1P0ZA

Sensor kinase cita binding domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
131
structure length
131
Chain Sequence
EERLHYQVGQRALIQAMQISAMPELVEAVQKRDLARIKALIDPMRSFSDATYITVGDASGQRLYHVNPDEIGKSMEGGDSDEALINAKSYVSVRKGSLGSSLRGKSPIQDATGKVIGIVSVGYTIEQLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the periplasmic ligand-binding domain of the sensor kinase CitA reveals the first extracellular PAS domain.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transferase
molecule keywords Sensor kinase citA
total genus 38
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2003-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1p0zA00
1UWNX 2PYRA 1LSXA 4PKYA 2J80A 3H7WA 3UB6A 3K3CA 1GSWA 3E4OA 1S67L 3UMEA 2HV1A 2A24B 2VEAA 1G28A 1T18A 1P97A 4HI4A 3NJAA 2PDRA 2PD7A 3F1OA 4H6JA 4LRXC 3VE4A 4HOIA 1GSXA 1T1CA 2PR6A 4HJ4A 4I39A 4WN5A 5HDSA 3UB9A 3IS2B 4F3LA 5DKKA 5HDDA 4EW7A 1D7EA 1DP6A 3CAXA 4JGRA 4KUKA 4I38A 4WLAA 1T1BA 5TBMB 5J7EA 4I3IA 3LI8A 2GJ3A 2WKRA 3EWKA 4B9OA 4L9FA 3B33A 3C8CA 1V9YA 4K08A 2B02A 2CMNA 2ZOHA 3LIEA 4EEUA 1S1ZA 2QKPA 1T19A 3CWFA 3ZQ5A 3H7WB 3MXQA 1V9ZA 5F6AA 2V1AA 2WKPA 3H82B 3LIDA 4EXOA 3F1NA 4GS9A 3E4PA 3SW1A 2V0WA 1EW0A 1N9LA 2ZBBA 3A0SA 4LPZA 2H28A 2R78A 3LIFA 1UWPX 4H6JB 4RQ9A 3KX0X 1XJ2A 1S1YA 4NXGA 1TS0A 3BWLA 2PHYA 3IS2A 1KOUA 2I9VA 4I3JA 4LRZE 5HSQA 1TS7A 3MQOA 3F1PA 2PD8A 2ZOIA 5F5YA 5DKLA 4WL9A 3A0VA 3UE6A 4WUJA 3VOLA 4GW9A 4E04A 1VB6A 3D72A 3F1OB 4BBUA 1XFNA 2L0WA 4F3LB 4BBVA 1ODVA 5HD5A 4GHIB 2VLGA 1WA9A 2QJ7A 1D06A 3CLOA 4R6LA 5IS1A 4WF0A 1S4SA 2BASA 3H82A 3OLOA 4HH3A 3F1NB 1LSVA 1XFQA 1LL8A 4GS9B 4I3AA 1S66L 3LUQA 3G6OA 5HWTA 1OT6A 2L4RA 3NOUC 1F98A 1DP9A 3LYXA 3PYPA 4KUOA 4XT2B 1N9OA 2PYPA 3P7NA 4HIAA 4L9EA 4M4XA 5DJUA 2OWJA 3NHQA 3VE3A 5J4EA 3F1PB 3LI9A 4JGPA 4MN5A 3UB7A 1DRMA 1OJ5A 5AVFA 1DP8A 2V1BA 2VV6A 2W27A 3MR0A 2QJ5A 4HJ6A 2JHEA 5EFWA 2W0NA 3E4QA 5F69A 5IU1A 3LIBA 4MN6A 4EESA 1Y28A 1S4RA 4BBTA 4JGQA 4HP9A 3MJQA 3GECA 1N9NA 4HHDA 2Z6DA 1OJGA 3UB8A 3UMDA 4NXEA 4HP4A 5J3WA 5F68A 3BY9A 1OT9A 3NOTC 3RH8B 4HJ3A 1LSWA 2YKHA 4R3AA 1BYWA 1LT0A 5HD3A 2L1MA 5G4YA 1OTDA 2V9AA 4GHIA 4LLOB 4EQ1A 4EEPA 4DJ2A 4NXFA 4HY8A 4GCZA 3EEHA 3ULFA 1TS6A 2D02A 2A24A 3C2WA 4L9GA 1GSVA 4EERA 1UGUA 4HNBA 4KQDA 1NWZA 4HQAA 2OWHA 4PKYG 1XJ3A 4R70A 2KX6A 1OTAA 3HJIA 3RTYA 2OOLA 3LICA 3A0RA 4XT2A 1X0OA 1XJ4A 4HH2A 5DJTA 1MZUA 5HWWA 3NOPC 1F9IA 2PR5A 3BY8A 3HJKA 4LRYC 3MFXA 1OTEA 1T1AA 2P7JA 2QHKA 2M1CA 2VV8A 2WKQA 3FC7A 3H9WA 2EA9A 3ICYA 4I5SA 4R38A 5AVEA 1OTBA 3FG8A 3K3DA 2INWA 2Z6CA 5I5LA 3GDIA 2V0UA 3PHYA 3T50A 5A8BA 5KIZA 5HZHA 1JNUA 1TS8A 4EETB 5HDCA 2K7SA 3IBRA 4JGOA 1OTIA 1P0ZA 2KDKA 5TBMA 4NXBA 2JN7A 2YKFA 4DJ3A 5HWVA 2QWSA 4YWZA 1XJ6A 2D01A 5G4ZA 2VV7A 3MQQA 3LIAA
chains in the Genus database with same CATH superfamily
4WELA 2HV1A 3BFDA 4KZAA 3F1OA 1S6RA 5CHUA 3NBLA 3IS2B 1JVJA 3CAXA 5TBMB 1L0FA 3EWKA 4UEYA 5G18A 4NETA 4OVDA 2WAEA 1MKIA 1K4EA 1EW0A 3ZG5A 5EVIB 1S1YA 4NXGA 2EFXA 1KOUA 2I9VA 4WUJA 2ZQCA 1MC0A 1N4OA 1M6KA 2BASA 3OLOA 4FTXA 1IYSA 1YLJA 4DRTA 1P9WA 1FR6A 1NLYA 5EFWA 3SS5A 3S7PA 4MN6A 3OPRA 4LENA 2BTFP 4N9KA 1JTGA 4P6BA 3RH8B 4JXSA 1LT0A 3IWQA 1FSYA 2ZC4B 2DNSA 4HEFA 2XH9A 5F83A 4CPKA 2OOLA 1F9IA 5D3OA 4LRYC 3JPUA 2WKQA 2X01A 4MLLA 3CI6A 4UA9A 2PU2A 2JN7A 1Y4OA 3IF6C 3LR0A 4KZ5A 2C5WB 1K57A 3DWZA 4GDBA 1BTLA 4BMWA 2DCFA 2WKRA 4L9FA 2EXAA 1J3WA 2EXBA 4UQIM 5IT5A 3MMHA 3A0SA 3R7WA 3IHAA 1EI5A 4N9LA 1DJCA 1HZOA 4Z9QA 4P0MA 5HX9A 4WYYA 1YMXA 3FV7A 2Z2LB 1IYPA 4LV3A 3O87A 1TDLA 4BBUA 2QJ7A 3IX8A 3FPVA 4S2NA 5CECA 3NOUC 3CUEA 1N9OA 2E8IA 3P01A 4MN5A 3GTCA 4JXVA 3UNWA 4X69A 1YLWA 3ZGAB 4S2LA 3MBZA 2Y2NA 3WS0A 1ALQA 3NOTC 4BLMA 4B93A 3MXRA 2ZC3B 5FASA 4ZJ1A 4PM9A 1GSVA 1XXMA 1BLPA 3T4SA 4R23A 2ACGA 4OLGA 1YPRA 3H9WA 5HAQA 1OTBA 1YM1A 2ZMFA 1DJAA 3MZDA 4U0TA 3M2KA 4JGOA 2XLNA 2B95A 4S2NC 5J8XA 2QWSA 4OLDA 2J8YA 3IBJA 1YLPA 2OV5A 2ZJ9A 1F5MA 1MWTA 2HDSA 4S2OA 4NEED 3QNBA 4KG2A 3VE4A 3GSGA 4EBNA 5EE8A 2JKFA 1CI8A 1WYBA 1TF1A 3MZEA 4KENB 3NC8A 4PPRA 4Y0OA 2CC1A 4LV2A 3ZQ5A 3A3JA 3KO6A 2V1AA 4EXOA 3H82B 5HL1A 2V0WA 3MZFA 4DE1A 3T4OA 3IS2A 3RJUA 3RFBA 3O86A 3ZG7B 3A0VA 2Y2OA 3F1OB 4S2IA 3Q1FA 3ZHHA 4ARZA 5A92A 1GHMA 3OOVA 1FCOA 2VGKA 1PIOA 2ZQ8A 4PM7A 5IS1A 2HP6A 2R9XA 5GLDA 4WMCA 4KUOA 4WBGA 4L9EA 2EX6A 5FATA 3VOYA 5I94A 4U3TA 3UE0A 1Y28A 3V67A 3M6BA 4QPRA 5CRFA 3CHWP 3IF6B 3VMAA 2VGJA 2XF3A 1IOUA 1OPXA 3C38A 4G3KA 4QHCA 1CI9A 4R38A 3JVVA 4ID4A 2Z6CA 1ZKJA 4EWFA 2VJWA 4EETB 3EQUA 1PRQA 2WGWB 4Q0HA 4MN7A 5G4ZA 4GJ4A 1G5UA 4PKYA 1GSWA 4JPMA 2A24B 2K2NA 2VEAA 4Q0JA 4HBTA 4R1GA 5FQKA 3CITA 5GLBA 1PZPA 4P6ZM 4WN5A 2PAVP 1S0WA 5J7EA 5FSRA 2WKEA 4OONA 2WKHA 2XD5A 1MWRA 4FOFA 2CMNA 3NULA 4OQ0A 4PAUA 2DRWA 3QP2A 1PFLA 4PHTA 4S2KA 1AWIA 1I5QA 2R78A 5DF8A 4LV1A 4OQIA 5HFOA 5F82A 4DE0A 5CHMA 2K31A 5FDHA 3D72A 4BL3A 1ES2A 2EX2A 4R6LA 1TVFA 1YLTA 3UE3A 2A49A 3QP8A 4OPRA 4GS9B 2Y2HA 3LEZA 3G6OA 3HLDA 3OPHA 5EVIC 1NLZA 1F98A 3QP5A 3DTIA 5FAOA 4B9OA 2V2FF 1LLBA 4P87A 2JKTI 1KDSA 5F69A 4JXGA 4X56A 3IHBA 4DF6A 3TW8A 5AJGA 1CQAA 2YKHA 4LLOB 3GQZA 1G6OA 1LI9A 5HL6A 4IBRA 4QD4A 4Q8IA 1MY8A 4HESA 1WYCA 4YNRA 4MBKA 2XQZA 2RL3A 4HBUA 3HLFA 2ZQAA 4MCWA 3EGXC 4Y13A 2HDUA 3N8LA 2JCHA 2VZWA 5I5LA 3T50A 2O9AA 2P9VB 4LCMA 1TD5A 4NXBA 4EQIA 3WS1A 2OSUA 1K55C 3QNCA 3UPOA 5EVIA 1I2WA 5K5BA 3G30A 1P97A 4LRXC 3ZCZA 1NXYA 2Q9NA 3VFFA 2EFUA 5FAPA 1L2SA 5A90A 4QB8A 4K08A 2V8FA 3KSHA 3HLCA 4KZ9A 2WGIA 1TS0A 2P08A 2FFFB 2Y2LA 2ZOIA 1I2SA 3UO9A 3TJZC 3MQ0A 2XA7S 3S7NA 1Q2PA 3SOIA 3CLOA 4X6TA 1GHPA 1SDNA 1K55A 5CTMA 2H10A 2PYPA 4L0LA 1U60A 2Y91A 4UQIS 5CEDA 3F1PB 4D60A 3ZNTA 3MR0A 2Y2IA 5IU1A 3WS2A 4ZJ2A 3AGDA 1ESUA 2ZM8A 4NXEA 1QMEA 3PBOA 1TEMA 4DE3A 1O7EA 3BY9A 3ITBA 5G4YA 2A3UA 1FILA 5HAPA 3C5AA 3NDGA 1H0MA 3R4KA 4II7A 1MWUA 1YAXA 2GDNA 4JBFA 1KDWA 1L0EA 5DJTA 4GW9A 1YLZA 2J3TC 2Y4AA 1HVBA 3GDIA 3SS4A 5HDCA 4A5RA 4DJ3A 1KGFA 5FQIA 1FQGA 1PW8A 2D01A 4UA7A 3T1SA 2ZMAA 3IH9A 3LIAA 2IWBA 5GL9A 1YT4A 3H7WA 1ONGA 3N8RA 4IUKA 1F2KA 5FL3A 5GHXA 3ITAA 3HLWA 1K0KA 3SS3A 4IEDA 5FAQA 4GD8A 4WLAA 2EWVA 4I3IA 4P6ZS 4FUWA 3ZVTA 1XPBA 3HREA 2XDMA 1O07A 1N9LA 4RQ9A 3LIFA 4LGWA 2UV0E 4C3QA 4E04A 4O7DA 4BD1A 1ERMA 3P98A 4X53A 2KOIA 3JYIA 2X02A 2L4RA 1DP9A 2WADA 4HIAA 5CERA 2H0YA 4IHQA 1GA0A 2HDRA 3BQAA 4DDYA 1DRMA 5KSCA 3W2ZA 3LIBA 5L2FA 4LV0A 2JC7A 1SCWA 4OPQA 1RCJA 4MNRA 3MKEA 5F1GA 3V3RA 4Y17A 4R3AA 4WM9A 2V9AA 5EECA 3FYZA 3Q7VA 1SKOA 4ME4A 1XGJA 2OWHA 2G7UA 3LGOA 3PBQA 4YINA 5JYOA 1FCMA 1GHIA 5FI7A 4OPYA 4WEJA 3IBRA 5TBMA 2OLVA 1MWSA 3VOZA 1CEFA 3SZTA 1J9MA 3IXBA 1AXBA 5DFYA 5KSHA 3UB5P 4HOIA 1BUEA 1VHMA 4P85A 1ZC2A 2BLSA 4F3LA 4KUKA 4Q0IA 3KYZA 4ZBEA 3SH7A 3FKVA 2WYXA 2P9VA 3O5YA 1KGEA 3H7WB 3PBNA 1W8QA 4KG6A 4YFMA 4DE2A 3S1YA 3HBRA 1E4DA 2FFYA 3BWLA 2J3TD 4FSFA 2B18A 3VOLA 3LY4A 3S7OA 2Y2KA 5HPFA 3DWKA 5DTKA 4E3LA 4KG5A 4ZAMA 3FPWA 3F1NB 2NUPC 1XGIA 3ZDJA 3IF6A 1PZOA 4KQQA 4GLQA 3NIAA 2JHEA 2P74A 1K57C 4JGQA 2JE5A 1N9NA 4K0WA 5F68A 2X71A 3G31A 1LSWA 1A0KA 4RA7A 4DJ2A 1NYYA 3EEHA 3ULFA 1TS6A 5HW3A 4GN2A 1NWZA 4GB7A 4PKYG 3RTYA 3HUNA 4XT2A 4HH2A 3IX3A 2VA0A 3BJNA 3HJKA 4D2OA 4X68A 1HTZA 1IKIA 3A3FA 2ZLYA 2ZQ9A 3FG8A 3LY3A 2OAQ1 2V0UA 5KMWA 4UAAA 4XUXA 1PI4A 2NUTC 1PW1A 5HAIA 2M7UA 4GKUA 4U0XA 2J80A 4OOLA 3K3CA 3RXWA 1G28A 1T18A 2PDRA 1L0DA 4WZ5A 3CPTA 5L10A 4S2MA 3UB9A 1CJFA 3NECA 1DP6A 4JGRA 2M7VA 2FH5A 3MF0A 4OP8A 4X25A 5E2GA 2QPNA 1K25A 2ZOHA 3EEAA 3S7QA 1KVLA 4KZ3A 2VGLS 1MXOA 3F1NA 4YOFA 2MJ6A 4Y5FA 1YLYA 5F5YA 4E3NA 5FA7A 2EWWA 1MPLA 1ODVA 5HD5A 4RYEA 2ZMVA 1LSVA 2QMIA 4MDZA 3HUOA 3PYPA 4FD8A 4XT2B 4KZ6A 2R9WA 3IQAA 4JGPA 4FH4A 4HHDA 4DXBA 3PBTA 2O9BA 4ARZB 3M2JA 4PM8A 2GZAA 3ZVWA 1ZG4A 1RGYA 1W8YA 4HY8A 3U4LP 2VKSA 2ZC7A 1PWGA 4BL2A 2KX6A 3KSIA 3VP2A 5M19A 2ZQDA 5EV0A 3NOPC 4BBVA 4O8GA 5E43A 3C7UA 3Q07A 3O3VA 3T1RA 3G32A 2C6WB 3CMZA 3PHYA 5A8BA 5KIZA 3B3XA 1G6AA 1EROA 3KSFA 1FIKA 3UY6A 3A3EA 3E4OA 2OAP1 1SKOB 1ES5A 3NJAA 3GRJA 3A3IA 3LFVA 5DKKA 1IELA 5HPIA 2XGNA 4OOYA 3C8CA 1S1ZA 1HD8A 2WKPA 4E3MA 3I7JA 3E4PA 4KZ8A 1K6RA 2PHYA 2WKIA 2B5RA 3E0YA 3O88A 1FCNA 1ES4A 1XFNA 1IEMA 2VLGA 1Z09A 3DBAA 3GVBA 1LL8A 4I3AA 4XXRA 5TGFA 2J3WA 2HF6A 3RXXA 3VP0A 3D3OA 1NRJA 2V1BA 5CHJA 2W0NA 4JF4A 1S4RA 3OBFA 3VP1A 4OKPA 1XX2A 1ZG6A 4IVIA 1STZA 3KYEA 1BYWA 2O9CA 4S2PA 3PR6A 4GCZA 5EVLA 3PBSA 5CX7A 3C7VA 1JWVA 3A0RA 4KQRA 1MZUA 5MC7A 2ZC6B 2VV8A 3ICYA 2E8JA 2INWA 3CG5A 4CLCA 3BYDA 3N8SA 1OTIA 3IF5A 4N1XA 3QP6A 5HARA 1XJ6A 2XEPA 4IUHA 2DMWA 2HP5A 1LSXA 1Z6FA 3W4QA 3BEBA 5L09A 4RX3A 1L0GA 4HI4A 4ZRRA 2PRFA 2PD7A 3BRMA 5AQ7A 3PTEA 2PR6A 1YMSA 2V20A 1E3UD 3D4FA 2W3EA 3LIDA 1FR1A 4GS9A 2PT7A 5EVID 4E6XA 1XJ2A 1VQQA 4LRZE 1TS7A 3LR3A 4WL9A 4CLCE 5FQMA 2WGVA 4GHIB 5L07A 4ZDXA 5E2HA 3BLSA 3EOIA 4WEKA 3BFFA 1NJ4A 4LCLA 2WUQA 5A91A 2O99A 3LEQA 4X1MA 1BLCA 4ETXA 1PWCA 1EWZA 4R4SA 3TSGA 3Q7VB 1BSGA 2UWXA 3BM6A 3GV9A 1NYMA 1ZTUA 3UPPA 1PWDA 1D1JA 1OJGA 4HP4A 3VSLA 3HLEA 4DDSA 3T1XA 1E3UA 4WZ4A 3LR4A 5CGXA 5HD3A 4CJNA 2ZM0A 4NXFA 2XSSA 3G34A 3N6IA 4L9GA 4PM5A 4HQAA 4MBFA 3IH8A 4JXWA 5HWWA 3BFEA 3BY8A 1T1AA 2QHKA 4AFIA 2EA9A 4I5SA 3ZG9B 1ES3A 4RX2A 4BJPA 3GMWA 2JKRM 1PYYA 4CLCD 3B42A 4O0PA 1UWNX 5C5KA 4GOGA 4KZBA 3PBRA 5CTNA 5E2EA 1VEUB 4ZJ3A 1NZUA 5TJJA 3VV4A 3K2NA 2KLIA 4ZTKA 2VGLM 4QWOA 1V9YA 1SDEA 1XP4A 1W7FA 4KZ4A 4DN0A 5EOOA 2Y2GA 4H6JB 3KX0X 2JKRI 5FQQA 2LB9A 4GZBA 4B88A 3F1PA 2XR0A 3OZHA 1VB6A 1ACFA 2Q9MA 4E3JA 1P9RA 4IBXA 1JWPA 4EUZA 2IWCA 4QY5A 4HH3A 3AGFA 1YSQA 1OT6A 2O0YA 4NK3A 2W1TA 3LYXA 4M4XA 4RVAA 2XK1A 3NCKA 3VE3A 5FQ9A 5AVFA 1DP8A 2QJ5A 2JKTM 3E4QA 3IXGA 3KSGA 1H5XA 1CEGA 3KYQA 4OOMA 2Z6DA 3UMDA 4BWIA 4EBLA 3QP4A 1K6SA 4EEPA 1W79A 1K38A 4EUVA 1DJBA 2EX9A 2XFTA 4WMCD 3CPTB 3HJIA 5EVEA 2XROA 1IYQA 1YKDA 2PR5A 2Z2MB 3PAEA 3T4LA 4C6YA 4BENA 4S2JA 2V1ZA 1NY0A 1TDGA 3WS5A 1KE0A 2K7SA 3C4OA 1L3LA 2KDKA 4YWZA 2J9PA 4ESPA 3IT9A 4GNUA 2QYBA 4JLFA 1S67L 5U47A 3OCLA 1SZVA 1KE4A 3WS4A 4H6JA 1SHVA 3WRTA 1GSXA 4I39A 2G2UA 1T1BA 5DF9A 1YSPA 4H8RA 4BQMA 2VX8A 2Y55A 1ONHA 1NZOA 3B33A 4DMZA 2ZL1B 2HP9A 3CWFA 4R0QA 3MXQA 3S4XA 3WRZA 3SW1A 4EEUA 3AGEA 1W5DA 5BOHA 3MSHA 4QJGA 5DKLA 3CZDA 2OLUA 3IWOA 3IXDA 4CLCC 1D06A 3NY4A 2WZXA 3LUQA 3MFDA 2H0TA 4MMNA 5DJUA 2OWJA 3UB7A 3UDFA 3UB8A 2WK0A 2W3DA 5DTSA 4EESA 3EQVA 2ZQ7A 5GLAA 4HP9A 4Y0TA 2Y8HA 5GHYA 5TFQA 4HJ3A 1FOFA 3BW6A 4EU0A 2H5SA 2WGWA 2A24A 4HNBA 3Q82A 1XJ3A 2Y2PA 3MFXA 3P09A 2IA2A 4XUZA 1LL9A 3G35A 3ZFZA 5CEBA 4M3KA 4GD6A 1P0ZA 3L9KA 2YKFA 5FEFA 3R7WB 3N4IA 1Y54A 5FEGA 1VETB 3OCNA 2RCXA 2V8CA 4ETZA 4NKPA 3N7WA 5EOEA 4EW7A 4OH0A 5GHZA 2QKPA 2VK3A 3DAVA 2AVXA 2G2WA 2P04A 1K54A 3TE8A 1FSWA 2ZBBA 1UWPX 3C30A 3WWXA 3IWIA 3MQOA 3UE6A 1W63Q 2J7VA 3V50A 3TRCA 4FCFA 3OPPA 4Y7PA 1WA9A 5GLCA 4QU3A 1H8ZA 2XA7M 1HLUP 3H82A 3JVUA 1XFQA 3FZCA 1M40A 3UPNA 2GNXA 3NHQA 5EM1A 3UDIA 2VV6A 2W27A 4WZ5C 5CXWA 1H8YA 1DY6A 3Q7ZA 3ISGA 1KVMA 1LHYA 4JF6A 2PBYA 1OT9A 1CF0A 3IXHA 2L1MA 4E3OA 3BFCA 3E98A 3SH9A 5JYPA 1LI0A 2JBFA 4UA6A 1PNEA 1SKFA 1OTAA 3LICA 1X0OA 5HDSA 3T4JA 1OTEA 2Q0OA 3QHYA 2FZ0A 3ZYTA 1TS8A 1W63M 3LCEA 3DTKA 5M1AA 5FI6A 5HWVA 3L7HA 2ZD8A 4R3JA 4JF5A 2Y2QA 3UB6A 4UHUA 3UMEA 5EM0A 1Q2QA 3NI9A 1C3BA 3V3SA 4HJ4A 5HDDA 4X55A 5IHVA 3TOIA 3MXSA 1XKZA 3HUMA 2GJ3A 3UE1A 2B02A 3LIEA 1VETA 1T19A 2HDQA 3T1QB 3G2YA 5DF7A 4B4XA 4Z1WA 2H28A 3FKWA 5FI2A 3HLGA 2HJ9C 5HSQA 1MBLA 1QMFA 3CJMA 3E2LA 4E3IA 3E2KA 2A2LA 4F3LB 4Y2FA 3QP1A 3G4PA 1N9BA 1S66L 5HWTA 4K0XA 1BLSA 1VM1A 3P7NA 3LI9A 1OJ5A 4HJ6A 3W4PA 4BBTA 3BQ8A 4CQHA 2HJEA 4LFUA 4OPZA 2Y2JA 4EQ1A 1OTDA 5M18A 3LR5A 4OQHA 5LBRA 4EERA 1UGUA 5KZHA 1MKMA 1VEUA 5EUAA 3TG9A 4BD0A 2M1CA 5A93A 5E2FA 3B47A 3HVFA 4G3VA 2ZL1A 1XA1A 1JNUA 4IVKA 3T4KA 4PM6A 1LL5A 5FDSA 5DTTA 4C75A 3PXPA 1ZHHB 1T1CA 1BLHA 5AQBA 1H3QA 1CK3A 4I38A 2HPBA 3LI8A 2ZC5B 3ZG8B 3DTMA 2W1TB 3HL9A 3MKFA 1V9ZA 4R4RA 4JKTA 3DTEA 1G68A 1RGZA 1IFQA 4PMAA 4N1HA 5DFXA 4MBHA 1ESIA 4K91A 3C4PA 3V39A 3S22A 1BULA 4KQOA 3MS6A 4E3KA 4WF0A 1NRFA 2PU4A 4GDNA 3V5MA 4R3BA 2W3GA 1YQSA 4NG2A 3UDXA 4O01A 3MJQA 4CLCB 5J3WA 2Y79A 3DW0A 4Y0UA 1JWZA 3EGDC 3UN7A 4Y15A 4GHIA 3T4TA 2Y59A 2BG1A 2D02A 1K54C 3IX4A 4R70A 4DXCA 1H8MA 2ZM2A 2GX5A 3BECA 4E6WA 3PAGA 5DVAA 3OC2A 1IYOA 3VSKA 3BLMA 1IKGA 3G2ZA 4OP5A 3HLBA 3NDEA 2VV7A 4X1LA 3CUEC 2PYRA 2XD1A 1K4FA 1JTDA 1K56D 2IWDA 2XRNA 4QY6A 1KE3A 4B4ZA 1XA7A 4G3WA 1D7EA 4DKIA 1OMEA 3VFHA 4Y3IA 3LO7A 5F6AA 4MEZA 2QZ6A 4LPZA 3T4QA 3OPLA 2Y2MA 4I3JA 3HCYA 3FWLA 2PD8A 4F94A 4N92A 3M6HA 3SH8A 2L0WA 3Q81A 2LB5A 4FH2A 2HZ5A 1KGGA 1E25A 3A3DA 1S4SA 5CGWA 2EX8A 3VP4A 3VP3A 3BFGA 2XFSA 2WZZA 1ERQA 5J4EA 4EBPA 2JKGA 5EPHA 5AQ9A 4IJGA 4OQGA 4KZ7A 2J9OA 3GECA 1PI5A 3T12B 5F1FA 2I72A 5FQJA 3ZG0A 1BZAA 3W4OA 2W3HA 3C2WA 1WE4A 3ZNYA 4KQDA 2PBDP 4EV4A 1GA9A 1K56A 1XJ4A 5TR7A 3D9YA 2P7JA 1BT5A 3FC7A 5AVEA 1RP5A 5AQAA 1GCEA 3K3DA 5L8MA 2W3FA 2HGVA 3GR2A 5HZHA 2W1RA 3U2AA 3W8KA 3MQQA 2WAFA 5CGSA
chains in the Genus database with same CATH topology
3KSFA 4WELA 3OCNA 3E4OA 2HV1A 5K5BA 2OAP1 1P97A 4ETZA 4NKPA 3NJAA 3F1OA 4LRXC 3LFVA 3IS2B 5DKKA 4EW7A 3CAXA 5TBMB 5HPIA 3EWKA 4UEYA 3C8CA 4K08A 1S1ZA 2QKPA 2P04A 2WKPA 3KSHA 3TE8A 3E4PA 2ZBBA 1EW0A 1UWPX 3C30A 1S1YA 4NXGA 1TS0A 2PHYA 1KOUA 2I9VA 2P08A 3E0YA 3MQOA 3UE6A 1W63Q 2ZOIA 3TJZC 4WUJA 3MQ0A 2XA7S 3S7NA 1MC0A 1XFNA 3TRCA 2VLGA 1WA9A 3CLOA 3DBAA 3OLOA 2BASA 2XA7M 3H82A 3JVUA 1XFQA 1LL8A 4I3AA 2J3WA 2HF6A 2GNXA 3D3OA 2PYPA 4L0LA 4UQIS 3NHQA 1P9WA 3F1PB 1NLYA 1NRJA 2V1BA 3MR0A 2VV6A 2W27A 5EFWA 2W0NA 5IU1A 3S7PA 4MN6A 1S4RA 3OBFA 4NXEA 3PBOA 1STZA 3BY9A 1OT9A 3RH8B 1BYWA 1LT0A 2L1MA 2O9CA 5G4YA 3E98A 3PR6A 4GCZA 3R4KA 3PBSA 5CX7A 4II7A 1YAXA 1OTAA 2OOLA 3LICA 3A0RA 1X0OA 1MZUA 5MC7A 1F9IA 5DJTA 4LRYC 5HDSA 1OTEA 2WKQA 4GW9A 3T4JA 2VV8A 3ICYA 2J3TC 2FZ0A 2INWA 3CI6A 3ZYTA 3GDIA 1TS8A 1W63M 5HDCA 4CLCA 1OTIA 2JN7A 4DJ3A 5HWVA 1XJ6A 2D01A 3LIAA 4IUHA 2DMWA 1LSXA 3H7WA 3UB6A 3LR0A 3UMEA 4IUKA 4HI4A 4ZRRA 5FL3A 2PD7A 2PR6A 4HJ4A 5HDDA 4WLAA 4BMWA 2EWVA 4I3IA 2GJ3A 4P6ZS 2WKRA 4L9FA 2B02A 3LIEA 4UQIM 5IT5A 1T19A 2W3EA 3LIDA 3MMHA 4GS9A 2PT7A 3A0SA 1N9LA 4RQ9A 4Z1WA 2H28A 3R7WA 3LIFA 1XJ2A 2HJ9C 4LRZE 5HSQA 1TS7A 3LR3A 4WL9A 4CLCE 4E04A 4BBUA 2A2LA 4F3LB 4GHIB 2QJ7A 4Y2FA 3EOIA 4WEKA 3FPVA 2KOIA 1S66L 2O99A 5HWTA 2L4RA 3NOUC 3CUEA 1DP9A 4ETXA 1N9OA 4HIAA 3P7NA 4IHQA 3P01A 3LI9A 3BQAA 4MN5A 1DRMA 1OJ5A 4HJ6A 3W2ZA 3LIBA 1ZTUA 4BBTA 3BQ8A 4CQHA 2HJEA 1OJGA 4HP4A 3NOTC 3LR4A 4R3AA 5HD3A 4EQ1A 1OTDA 2V9AA 4B93A 3LR5A 4NXFA 5LBRA 4EERA 2XSSA 4L9GA 1GSVA 1UGUA 4ME4A 4HQAA 2OWHA 2G7UA 1MKMA 3PBQA 3T4SA 5HWWA 3BY8A 1T1AA 2QHKA 2M1CA 4AFIA 3H9WA 2EA9A 4I5SA 3B47A 1OTBA 4WEJA 4G3VA 1JNUA 2ZMFA 4BJPA 3T4KA 3IBRA 2JKRM 4JGOA 5TBMA 4CLCD 3B42A 2QWSA 4O0PA 3IBJA 1UWNX 5C5KA 1F5MA 5DFYA 5KSHA 4NEED 3PXPA 1ZHHB 3PBRA 3VE4A 4HOIA 1T1CA 1VHMA 4F3LA 1H3QA 4KUKA 4I38A 4Q0IA 5TJJA 3K2NA 3VV4A 3KYZA 2KLIA 3LI8A 1TF1A 2VGLM 1V9YA 2W1TB 3O5YA 3ZQ5A 3H7WB 3PBNA 3KO6A 1V9ZA 2V1AA 4EXOA 3H82B 4DN0A 2V0WA 4H6JB 1IFQA 3KX0X 5DFXA 3T4OA 2JKRI 2LB9A 3BWLA 3IS2A 2J3TD 4FSFA 3F1PA 3RFBA 2B18A 3A0VA 3VOLA 1VB6A 3S7OA 3F1OB 4KQOA 4ARZA 5HPFA 1P9RA 3OOVA 5IS1A 4WF0A 3FPWA 4HH3A 3F1NB 2NUPC 1YSQA 1OT6A 2O0YA 2W3GA 2W1TA 3LYXA 4KUOA 4M4XA 4L9EA 3VE3A 4GLQA 5AVFA 1DP8A 2QJ5A 2JKTM 2JHEA 3E4QA 1Y28A 3V67A 4O01A 4JGQA 3KSGA 4QPRA 3MJQA 3KYQA 4CLCB 4OOMA 1N9NA 2Z6DA 3UMDA 4BWIA 5J3WA 2Y79A 5F68A 3EGDC 1LSWA 4GHIA 4EEPA 4DJ2A 3T4TA 4EUVA 3EEHA 3ULFA 1TS6A 2D02A 1NWZA 4R70A 4PKYG 3RTYA 1IOUA 1H8MA 3HJIA 1OPXA 4XT2A 3C38A 4HH2A 2XROA 4G3KA 1YKDA 2VA0A 2PR5A 3BJNA 3HJKA 2GX5A 4R38A 3JVVA 3T4LA 3FG8A 2Z6CA 2OAQ1 2V0UA 3OC2A 2VJWA 4EETB 3EQUA 2K7SA 2KDKA 4Q0HA 2NUTC 4MN7A 2M7UA 4YWZA 5G4ZA 2VV7A 4GJ4A 3CUEC 2PYRA 4PKYA 2J80A 2QYBA 4OOLA 3K3CA 1GSWA 1S67L 2A24B 2K2NA 2VEAA 1G28A 1T18A 3OCLA 2XRNA 4Q0JA 2PDRA 4H6JA 3CITA 1GSXA 4I39A 4P6ZM 4WN5A 3UB9A 4G3WA 1D7EA 1DP6A 4JGRA 1T1BA 5DF9A 1YSPA 2FH5A 3MF0A 4Y3IA 2M7VA 5J7EA 2VX8A 3B33A 4DMZA 4FOFA 2CMNA 2ZOHA 3EEAA 4PAUA 3S7QA 3CWFA 3MXQA 5F6AA 2VGLS 3F1NA 4PHTA 4YOFA 3SW1A 4EEUA 4LPZA 2R78A 3T4QA 2MJ6A 4Y5FA 4I3JA 3HCYA 5F5YA 2PD8A 5DKLA 2K31A 3D72A 2EWWA 2L0WA 2LB5A 1ODVA 5HD5A 4CLCC 4R6LA 1D06A 3UE3A 1S4SA 2ZMVA 1LSVA 4GS9B 3LUQA 3G6OA 4MDZA 1NLZA 1F98A 3PYPA 4XT2B 4B9OA 5J4EA 4MMNA 5DJUA 2OWJA 2JKTI 3UB7A 4JGPA 3UB8A 5F69A 2W3DA 4EESA 4IJGA 3EQVA 4HP9A 3GECA 2Y8HA 4HHDA 3TW8A 3PBTA 5AJGA 4HJ3A 2O9BA 4ARZB 2YKHA 3BW6A 4LLOB 4EU0A 2W3HA 2GZAA 1G6OA 4HY8A 5HL6A 2A24A 3C2WA 4HNBA 4KQDA 2VKSA 4YNRA 1XJ3A 2KX6A 3KSIA 1XJ4A 4MCWA 3NOPC 3EGXC 4BBVA 4O8GA 3MFXA 2P7JA 3FC7A 5AVEA 2IA2A 2VZWA 3K3DA 5I5LA 5L8MA 3PHYA 5A8BA 5KIZA 2W3FA 3T50A 2HGVA 2O9AA 5HZHA 2W1RA 3U2AA 1P0ZA 1TD5A 4NXBA 2YKFA 3R7WB 3MQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWN X;  2PYR A;  1LSX A;  4PKY A;  2J80 A;  3H7W A;  3UB6 A;  3K3C A;  1GSW A;  3E4O A;  1S67 L;  3UME A;  2HV1 A;  2A24 B;  2VEA A;  1G28 A;  1T18 A;  1P97 A;  4HI4 A;  3NJA A;  2PDR A;  2PD7 A;  3F1O A;  4H6J A;  4LRX C;  3VE4 A;  4HOI A;  1GSX A;  1T1C A;  2PR6 A;  4HJ4 A;  4I39 A;  4WN5 A;  5HDS A;  3UB9 A;  3IS2 B;  4F3L A;  5DKK A;  5HDD A;  4EW7 A;  1D7E A;  1DP6 A;  3CAX A;  4JGR A;  4KUK A;  4I38 A;  4WLA A;  1T1B A;  5TBM B;  5J7E A;  4I3I A;  3LI8 A;  2GJ3 A;  2WKR A;  3EWK A;  4B9O A;  4L9F A;  3B33 A;  3C8C A;  1V9Y A;  4K08 A;  2B02 A;  2CMN A;  2ZOH A;  3LIE A;  4EEU A;  1S1Z A;  2QKP A;  1T19 A;  3CWF A;  3ZQ5 A;  3H7W B;  3MXQ A;  1V9Z A;  5F6A A;  2V1A A;  2WKP A;  3H82 B;  3LID A;  4EXO A;  3F1N A;  4GS9 A;  3E4P A;  3SW1 A;  2V0W A;  1EW0 A;  1N9L A;  2ZBB A;  3A0S A;  4LPZ A;  2H28 A;  2R78 A;  3LIF A;  1UWP X;  4H6J B;  4RQ9 A;  3KX0 X;  1XJ2 A;  1S1Y A;  4NXG A;  1TS0 A;  3BWL A;  2PHY A;  3IS2 A;  1KOU A;  2I9V A;  4I3J A;  4LRZ E;  5HSQ A;  1TS7 A;  3MQO A;  3F1P A;  2PD8 A;  2ZOI A;  5F5Y A;  5DKL A;  4WL9 A;  3A0V A;  3UE6 A;  4WUJ A;  3VOL A;  4GW9 A;  4E04 A;  1VB6 A;  3D72 A;  3F1O B;  4BBU A;  1XFN A;  2L0W A;  4F3L B;  4BBV A;  1ODV A;  5HD5 A;  4GHI B;  2VLG A;  1WA9 A;  2QJ7 A;  1D06 A;  3CLO A;  4R6L A;  5IS1 A;  4WF0 A;  1S4S A;  2BAS A;  3H82 A;  3OLO A;  4HH3 A;  3F1N B;  1LSV A;  1XFQ A;  1LL8 A;  4GS9 B;  4I3A A;  1S66 L;  3LUQ A;  3G6O A;  5HWT A;  1OT6 A;  2L4R A;  3NOU C;  1F98 A;  1DP9 A;  3LYX A;  3PYP A;  4KUO A;  4XT2 B;  1N9O A;  2PYP A;  3P7N A;  4HIA A;  4L9E A;  4M4X A;  5DJU A;  2OWJ A;  3NHQ A;  3VE3 A;  5J4E A;  3F1P B;  3LI9 A;  4JGP A;  4MN5 A;  3UB7 A;  1DRM A;  1OJ5 A;  5AVF A;  1DP8 A;  2V1B A;  2VV6 A;  2W27 A;  3MR0 A;  2QJ5 A;  4HJ6 A;  2JHE A;  5EFW A;  2W0N A;  3E4Q A;  5F69 A;  5IU1 A;  3LIB A;  4MN6 A;  4EES A;  1Y28 A;  1S4R A;  4BBT A;  4JGQ A;  4HP9 A;  3MJQ A;  3GEC A;  1N9N A;  4HHD A;  2Z6D A;  1OJG A;  3UB8 A;  3UMD A;  4NXE A;  4HP4 A;  5J3W A;  5F68 A;  3BY9 A;  1OT9 A;  3NOT C;  3RH8 B;  4HJ3 A;  1LSW A;  2YKH A;  4R3A A;  1BYW A;  1LT0 A;  5HD3 A;  2L1M A;  5G4Y A;  1OTD A;  2V9A A;  4GHI A;  4LLO B;  4EQ1 A;  4EEP A;  4DJ2 A;  4NXF A;  4HY8 A;  4GCZ A;  3EEH A;  3ULF A;  1TS6 A;  2D02 A;  2A24 A;  3C2W A;  4L9G A;  1GSV A;  4EER A;  1UGU A;  4HNB A;  4KQD A;  1NWZ A;  4HQA A;  2OWH A;  4PKY G;  1XJ3 A;  4R70 A;  2KX6 A;  1OTA A;  3HJI A;  3RTY A;  2OOL A;  3LIC A;  3A0R A;  4XT2 A;  1X0O A;  1XJ4 A;  4HH2 A;  5DJT A;  1MZU A;  5HWW A;  3NOP C;  1F9I A;  2PR5 A;  3BY8 A;  3HJK A;  4LRY C;  3MFX A;  1OTE A;  1T1A A;  2P7J A;  2QHK A;  2M1C A;  2VV8 A;  2WKQ A;  3FC7 A;  3H9W A;  2EA9 A;  3ICY A;  4I5S A;  4R38 A;  5AVE A;  1OTB A;  3FG8 A;  3K3D A;  2INW A;  2Z6C A;  5I5L A;  3GDI A;  2V0U A;  3PHY A;  3T50 A;  5A8B A;  5KIZ A;  5HZH A;  1JNU A;  1TS8 A;  4EET B;  5HDC A;  2K7S A;  3IBR A;  4JGO A;  1OTI A;  1P0Z A;  2KDK A;  5TBM A;  4NXB A;  2JN7 A;  2YKF A;  4DJ3 A;  5HWV A;  2QWS A;  4YWZ A;  1XJ6 A;  2D01 A;  5G4Z A;  2VV7 A;  3MQQ A;  3LIA A; 
#chains in the Genus database with same CATH topology
 4WEL A;  2HV1 A;  3BFD A;  4KZA A;  3F1O A;  1S6R A;  5CHU A;  3NBL A;  3IS2 B;  1JVJ A;  3CAX A;  5TBM B;  1L0F A;  3EWK A;  4UEY A;  5G18 A;  4NET A;  4OVD A;  2WAE A;  1MKI A;  1K4E A;  1EW0 A;  3ZG5 A;  5EVI B;  1S1Y A;  4NXG A;  2EFX A;  1KOU A;  2I9V A;  4WUJ A;  2ZQC A;  1MC0 A;  1N4O A;  1M6K A;  2BAS A;  3OLO A;  4FTX A;  1IYS A;  1YLJ A;  4DRT A;  1P9W A;  1FR6 A;  1NLY A;  5EFW A;  3SS5 A;  3S7P A;  4MN6 A;  3OPR A;  4LEN A;  2BTF P;  4N9K A;  1JTG A;  4P6B A;  3RH8 B;  4JXS A;  1LT0 A;  3IWQ A;  1FSY A;  2ZC4 B;  2DNS A;  4HEF A;  2XH9 A;  5F83 A;  4CPK A;  2OOL A;  1F9I A;  5D3O A;  4LRY C;  3JPU A;  2WKQ A;  2X01 A;  4MLL A;  3CI6 A;  4UA9 A;  2PU2 A;  2JN7 A;  1Y4O A;  3IF6 C;  3LR0 A;  4KZ5 A;  2C5W B;  1K57 A;  3DWZ A;  4GDB A;  1BTL A;  4BMW A;  2DCF A;  2WKR A;  4L9F A;  2EXA A;  1J3W A;  2EXB A;  4UQI M;  5IT5 A;  3MMH A;  3A0S A;  3R7W A;  3IHA A;  1EI5 A;  4N9L A;  1DJC A;  1HZO A;  4Z9Q A;  4P0M A;  5HX9 A;  4WYY A;  1YMX A;  3FV7 A;  2Z2L B;  1IYP A;  4LV3 A;  3O87 A;  1TDL A;  4BBU A;  2QJ7 A;  3IX8 A;  3FPV A;  4S2N A;  5CEC A;  3NOU C;  3CUE A;  1N9O A;  2E8I A;  3P01 A;  4MN5 A;  3GTC A;  4JXV A;  3UNW A;  4X69 A;  1YLW A;  3ZGA B;  4S2L A;  3MBZ A;  2Y2N A;  3WS0 A;  1ALQ A;  3NOT C;  4BLM A;  4B93 A;  3MXR A;  2ZC3 B;  5FAS A;  4ZJ1 A;  4PM9 A;  1GSV A;  1XXM A;  1BLP A;  3T4S A;  4R23 A;  2ACG A;  4OLG A;  1YPR A;  3H9W A;  5HAQ A;  1OTB A;  1YM1 A;  2ZMF A;  1DJA A;  3MZD A;  4U0T A;  3M2K A;  4JGO A;  2XLN A;  2B95 A;  4S2N C;  5J8X A;  2QWS A;  4OLD A;  2J8Y A;  3IBJ A;  1YLP A;  2OV5 A;  2ZJ9 A;  1F5M A;  1MWT A;  2HDS A;  4S2O A;  4NEE D;  3QNB A;  4KG2 A;  3VE4 A;  3GSG A;  4EBN A;  5EE8 A;  2JKF A;  1CI8 A;  1WYB A;  1TF1 A;  3MZE A;  4KEN B;  3NC8 A;  4PPR A;  4Y0O A;  2CC1 A;  4LV2 A;  3ZQ5 A;  3A3J A;  3KO6 A;  2V1A A;  4EXO A;  3H82 B;  5HL1 A;  2V0W A;  3MZF A;  4DE1 A;  3T4O A;  3IS2 A;  3RJU A;  3RFB A;  3O86 A;  3ZG7 B;  3A0V A;  2Y2O A;  3F1O B;  4S2I A;  3Q1F A;  3ZHH A;  4ARZ A;  5A92 A;  1GHM A;  3OOV A;  1FCO A;  2VGK A;  1PIO A;  2ZQ8 A;  4PM7 A;  5IS1 A;  2HP6 A;  2R9X A;  5GLD A;  4WMC A;  4KUO A;  4WBG A;  4L9E A;  2EX6 A;  5FAT A;  3VOY A;  5I94 A;  4U3T A;  3UE0 A;  1Y28 A;  3V67 A;  3M6B A;  4QPR A;  5CRF A;  3CHW P;  3IF6 B;  3VMA A;  2VGJ A;  2XF3 A;  1IOU A;  1OPX A;  3C38 A;  4G3K A;  4QHC A;  1CI9 A;  4R38 A;  3JVV A;  4ID4 A;  2Z6C A;  1ZKJ A;  4EWF A;  2VJW A;  4EET B;  3EQU A;  1PRQ A;  2WGW B;  4Q0H A;  4MN7 A;  5G4Z A;  4GJ4 A;  1G5U A;  4PKY A;  1GSW A;  4JPM A;  2A24 B;  2K2N A;  2VEA A;  4Q0J A;  4HBT A;  4R1G A;  5FQK A;  3CIT A;  5GLB A;  1PZP A;  4P6Z M;  4WN5 A;  2PAV P;  1S0W A;  5J7E A;  5FSR A;  2WKE A;  4OON A;  2WKH A;  2XD5 A;  1MWR A;  4FOF A;  2CMN A;  3NUL A;  4OQ0 A;  4PAU A;  2DRW A;  3QP2 A;  1PFL A;  4PHT A;  4S2K A;  1AWI A;  1I5Q A;  2R78 A;  5DF8 A;  4LV1 A;  4OQI A;  5HFO A;  5F82 A;  4DE0 A;  5CHM A;  2K31 A;  5FDH A;  3D72 A;  4BL3 A;  1ES2 A;  2EX2 A;  4R6L A;  1TVF A;  1YLT A;  3UE3 A;  2A49 A;  3QP8 A;  4OPR A;  4GS9 B;  2Y2H A;  3LEZ A;  3G6O A;  3HLD A;  3OPH A;  5EVI C;  1NLZ A;  1F98 A;  3QP5 A;  3DTI A;  5FAO A;  4B9O A;  2V2F F;  1LLB A;  4P87 A;  2JKT I;  1KDS A;  5F69 A;  4JXG A;  4X56 A;  3IHB A;  4DF6 A;  3TW8 A;  5AJG A;  1CQA A;  2YKH A;  4LLO B;  3GQZ A;  1G6O A;  1LI9 A;  5HL6 A;  4IBR A;  4QD4 A;  4Q8I A;  1MY8 A;  4HES A;  1WYC A;  4YNR A;  4MBK A;  2XQZ A;  2RL3 A;  4HBU A;  3HLF A;  2ZQA A;  4MCW A;  3EGX C;  4Y13 A;  2HDU A;  3N8L A;  2JCH A;  2VZW A;  5I5L A;  3T50 A;  2O9A A;  2P9V B;  4LCM A;  1TD5 A;  4NXB A;  4EQI A;  3WS1 A;  2OSU A;  1K55 C;  3QNC A;  3UPO A;  5EVI A;  1I2W A;  5K5B A;  3G30 A;  1P97 A;  4LRX C;  3ZCZ A;  1NXY A;  2Q9N A;  3VFF A;  2EFU A;  5FAP A;  1L2S A;  5A90 A;  4QB8 A;  4K08 A;  2V8F A;  3KSH A;  3HLC A;  4KZ9 A;  2WGI A;  1TS0 A;  2P08 A;  2FFF B;  2Y2L A;  2ZOI A;  1I2S A;  3UO9 A;  3TJZ C;  3MQ0 A;  2XA7 S;  3S7N A;  1Q2P A;  3SOI A;  3CLO A;  4X6T A;  1GHP A;  1SDN A;  1K55 A;  5CTM A;  2H10 A;  2PYP A;  4L0L A;  1U60 A;  2Y91 A;  4UQI S;  5CED A;  3F1P B;  4D60 A;  3ZNT A;  3MR0 A;  2Y2I A;  5IU1 A;  3WS2 A;  4ZJ2 A;  3AGD A;  1ESU A;  2ZM8 A;  4NXE A;  1QME A;  3PBO A;  1TEM A;  4DE3 A;  1O7E A;  3BY9 A;  3ITB A;  5G4Y A;  2A3U A;  1FIL A;  5HAP A;  3C5A A;  3NDG A;  1H0M A;  3R4K A;  4II7 A;  1MWU A;  1YAX A;  2GDN A;  4JBF A;  1KDW A;  1L0E A;  5DJT A;  4GW9 A;  1YLZ A;  2J3T C;  2Y4A A;  1HVB A;  3GDI A;  3SS4 A;  5HDC A;  4A5R A;  4DJ3 A;  1KGF A;  5FQI A;  1FQG A;  1PW8 A;  2D01 A;  4UA7 A;  3T1S A;  2ZMA A;  3IH9 A;  3LIA A;  2IWB A;  5GL9 A;  1YT4 A;  3H7W A;  1ONG A;  3N8R A;  4IUK A;  1F2K A;  5FL3 A;  5GHX A;  3ITA A;  3HLW A;  1K0K A;  3SS3 A;  4IED A;  5FAQ A;  4GD8 A;  4WLA A;  2EWV A;  4I3I A;  4P6Z S;  4FUW A;  3ZVT A;  1XPB A;  3HRE A;  2XDM A;  1O07 A;  1N9L A;  4RQ9 A;  3LIF A;  4LGW A;  2UV0 E;  4C3Q A;  4E04 A;  4O7D A;  4BD1 A;  1ERM A;  3P98 A;  4X53 A;  2KOI A;  3JYI A;  2X02 A;  2L4R A;  1DP9 A;  2WAD A;  4HIA A;  5CER A;  2H0Y A;  4IHQ A;  1GA0 A;  2HDR A;  3BQA A;  4DDY A;  1DRM A;  5KSC A;  3W2Z A;  3LIB A;  5L2F A;  4LV0 A;  2JC7 A;  1SCW A;  4OPQ A;  1RCJ A;  4MNR A;  3MKE A;  5F1G A;  3V3R A;  4Y17 A;  4R3A A;  4WM9 A;  2V9A A;  5EEC A;  3FYZ A;  3Q7V A;  1SKO A;  4ME4 A;  1XGJ A;  2OWH A;  2G7U A;  3LGO A;  3PBQ A;  4YIN A;  5JYO A;  1FCM A;  1GHI A;  5FI7 A;  4OPY A;  4WEJ A;  3IBR A;  5TBM A;  2OLV A;  1MWS A;  3VOZ A;  1CEF A;  3SZT A;  1J9M A;  3IXB A;  1AXB A;  5DFY A;  5KSH A;  3UB5 P;  4HOI A;  1BUE A;  1VHM A;  4P85 A;  1ZC2 A;  2BLS A;  4F3L A;  4KUK A;  4Q0I A;  3KYZ A;  4ZBE A;  3SH7 A;  3FKV A;  2WYX A;  2P9V A;  3O5Y A;  1KGE A;  3H7W B;  3PBN A;  1W8Q A;  4KG6 A;  4YFM A;  4DE2 A;  3S1Y A;  3HBR A;  1E4D A;  2FFY A;  3BWL A;  2J3T D;  4FSF A;  2B18 A;  3VOL A;  3LY4 A;  3S7O A;  2Y2K A;  5HPF A;  3DWK A;  5DTK A;  4E3L A;  4KG5 A;  4ZAM A;  3FPW A;  3F1N B;  2NUP C;  1XGI A;  3ZDJ A;  3IF6 A;  1PZO A;  4KQQ A;  4GLQ A;  3NIA A;  2JHE A;  2P74 A;  1K57 C;  4JGQ A;  2JE5 A;  1N9N A;  4K0W A;  5F68 A;  2X71 A;  3G31 A;  1LSW A;  1A0K A;  4RA7 A;  4DJ2 A;  1NYY A;  3EEH A;  3ULF A;  1TS6 A;  5HW3 A;  4GN2 A;  1NWZ A;  4GB7 A;  4PKY G;  3RTY A;  3HUN A;  4XT2 A;  4HH2 A;  3IX3 A;  2VA0 A;  3BJN A;  3HJK A;  4D2O A;  4X68 A;  1HTZ A;  1IKI A;  3A3F A;  2ZLY A;  2ZQ9 A;  3FG8 A;  3LY3 A;  2OAQ 1;  2V0U A;  5KMW A;  4UAA A;  4XUX A;  1PI4 A;  2NUT C;  1PW1 A;  5HAI A;  2M7U A;  4GKU A;  4U0X A;  2J80 A;  4OOL A;  3K3C A;  3RXW A;  1G28 A;  1T18 A;  2PDR A;  1L0D A;  4WZ5 A;  3CPT A;  5L10 A;  4S2M A;  3UB9 A;  1CJF A;  3NEC A;  1DP6 A;  4JGR A;  2M7V A;  2FH5 A;  3MF0 A;  4OP8 A;  4X25 A;  5E2G A;  2QPN A;  1K25 A;  2ZOH A;  3EEA A;  3S7Q A;  1KVL A;  4KZ3 A;  2VGL S;  1MXO A;  3F1N A;  4YOF A;  2MJ6 A;  4Y5F A;  1YLY A;  5F5Y A;  4E3N A;  5FA7 A;  2EWW A;  1MPL A;  1ODV A;  5HD5 A;  4RYE A;  2ZMV A;  1LSV A;  2QMI A;  4MDZ A;  3HUO A;  3PYP A;  4FD8 A;  4XT2 B;  4KZ6 A;  2R9W A;  3IQA A;  4JGP A;  4FH4 A;  4HHD A;  4DXB A;  3PBT A;  2O9B A;  4ARZ B;  3M2J A;  4PM8 A;  2GZA A;  3ZVW A;  1ZG4 A;  1RGY A;  1W8Y A;  4HY8 A;  3U4L P;  2VKS A;  2ZC7 A;  1PWG A;  4BL2 A;  2KX6 A;  3KSI A;  3VP2 A;  5M19 A;  2ZQD A;  5EV0 A;  3NOP C;  4BBV A;  4O8G A;  5E43 A;  3C7U A;  3Q07 A;  3O3V A;  3T1R A;  3G32 A;  2C6W B;  3CMZ A;  3PHY A;  5A8B A;  5KIZ A;  3B3X A;  1G6A A;  1ERO A;  3KSF A;  1FIK A;  3UY6 A;  3A3E A;  3E4O A;  2OAP 1;  1SKO B;  1ES5 A;  3NJA A;  3GRJ A;  3A3I A;  3LFV A;  5DKK A;  1IEL A;  5HPI A;  2XGN A;  4OOY A;  3C8C A;  1S1Z A;  1HD8 A;  2WKP A;  4E3M A;  3I7J A;  3E4P A;  4KZ8 A;  1K6R A;  2PHY A;  2WKI A;  2B5R A;  3E0Y A;  3O88 A;  1FCN A;  1ES4 A;  1XFN A;  1IEM A;  2VLG A;  1Z09 A;  3DBA A;  3GVB A;  1LL8 A;  4I3A A;  4XXR A;  5TGF A;  2J3W A;  2HF6 A;  3RXX A;  3VP0 A;  3D3O A;  1NRJ A;  2V1B A;  5CHJ A;  2W0N A;  4JF4 A;  1S4R A;  3OBF A;  3VP1 A;  4OKP A;  1XX2 A;  1ZG6 A;  4IVI A;  1STZ A;  3KYE A;  1BYW A;  2O9C A;  4S2P A;  3PR6 A;  4GCZ A;  5EVL A;  3PBS A;  5CX7 A;  3C7V A;  1JWV A;  3A0R A;  4KQR A;  1MZU A;  5MC7 A;  2ZC6 B;  2VV8 A;  3ICY A;  2E8J A;  2INW A;  3CG5 A;  4CLC A;  3BYD A;  3N8S A;  1OTI A;  3IF5 A;  4N1X A;  3QP6 A;  5HAR A;  1XJ6 A;  2XEP A;  4IUH A;  2DMW A;  2HP5 A;  1LSX A;  1Z6F A;  3W4Q A;  3BEB A;  5L09 A;  4RX3 A;  1L0G A;  4HI4 A;  4ZRR A;  2PRF A;  2PD7 A;  3BRM A;  5AQ7 A;  3PTE A;  2PR6 A;  1YMS A;  2V20 A;  1E3U D;  3D4F A;  2W3E A;  3LID A;  1FR1 A;  4GS9 A;  2PT7 A;  5EVI D;  4E6X A;  1XJ2 A;  1VQQ A;  4LRZ E;  1TS7 A;  3LR3 A;  4WL9 A;  4CLC E;  5FQM A;  2WGV A;  4GHI B;  5L07 A;  4ZDX A;  5E2H A;  3BLS A;  3EOI A;  4WEK A;  3BFF A;  1NJ4 A;  4LCL A;  2WUQ A;  5A91 A;  2O99 A;  3LEQ A;  4X1M A;  1BLC A;  4ETX A;  1PWC A;  1EWZ A;  4R4S A;  3TSG A;  3Q7V B;  1BSG A;  2UWX A;  3BM6 A;  3GV9 A;  1NYM A;  1ZTU A;  3UPP A;  1PWD A;  1D1J A;  1OJG A;  4HP4 A;  3VSL A;  3HLE A;  4DDS A;  3T1X A;  1E3U A;  4WZ4 A;  3LR4 A;  5CGX A;  5HD3 A;  4CJN A;  2ZM0 A;  4NXF A;  2XSS A;  3G34 A;  3N6I A;  4L9G A;  4PM5 A;  4HQA A;  4MBF A;  3IH8 A;  4JXW A;  5HWW A;  3BFE A;  3BY8 A;  1T1A A;  2QHK A;  4AFI A;  2EA9 A;  4I5S A;  3ZG9 B;  1ES3 A;  4RX2 A;  4BJP A;  3GMW A;  2JKR M;  1PYY A;  4CLC D;  3B42 A;  4O0P A;  1UWN X;  5C5K A;  4GOG A;  4KZB A;  3PBR A;  5CTN A;  5E2E A;  1VEU B;  4ZJ3 A;  1NZU A;  5TJJ A;  3VV4 A;  3K2N A;  2KLI A;  4ZTK A;  2VGL M;  4QWO A;  1V9Y A;  1SDE A;  1XP4 A;  1W7F A;  4KZ4 A;  4DN0 A;  5EOO A;  2Y2G A;  4H6J B;  3KX0 X;  2JKR I;  5FQQ A;  2LB9 A;  4GZB A;  4B88 A;  3F1P A;  2XR0 A;  3OZH A;  1VB6 A;  1ACF A;  2Q9M A;  4E3J A;  1P9R A;  4IBX A;  1JWP A;  4EUZ A;  2IWC A;  4QY5 A;  4HH3 A;  3AGF A;  1YSQ A;  1OT6 A;  2O0Y A;  4NK3 A;  2W1T A;  3LYX A;  4M4X A;  4RVA A;  2XK1 A;  3NCK A;  3VE3 A;  5FQ9 A;  5AVF A;  1DP8 A;  2QJ5 A;  2JKT M;  3E4Q A;  3IXG A;  3KSG A;  1H5X A;  1CEG A;  3KYQ A;  4OOM A;  2Z6D A;  3UMD A;  4BWI A;  4EBL A;  3QP4 A;  1K6S A;  4EEP A;  1W79 A;  1K38 A;  4EUV A;  1DJB A;  2EX9 A;  2XFT A;  4WMC D;  3CPT B;  3HJI A;  5EVE A;  2XRO A;  1IYQ A;  1YKD A;  2PR5 A;  2Z2M B;  3PAE A;  3T4L A;  4C6Y A;  4BEN A;  4S2J A;  2V1Z A;  1NY0 A;  1TDG A;  3WS5 A;  1KE0 A;  2K7S A;  3C4O A;  1L3L A;  2KDK A;  4YWZ A;  2J9P A;  4ESP A;  3IT9 A;  4GNU A;  2QYB A;  4JLF A;  1S67 L;  5U47 A;  3OCL A;  1SZV A;  1KE4 A;  3WS4 A;  4H6J A;  1SHV A;  3WRT A;  1GSX A;  4I39 A;  2G2U A;  1T1B A;  5DF9 A;  1YSP A;  4H8R A;  4BQM A;  2VX8 A;  2Y55 A;  1ONH A;  1NZO A;  3B33 A;  4DMZ A;  2ZL1 B;  2HP9 A;  3CWF A;  4R0Q A;  3MXQ A;  3S4X A;  3WRZ A;  3SW1 A;  4EEU A;  3AGE A;  1W5D A;  5BOH A;  3MSH A;  4QJG A;  5DKL A;  3CZD A;  2OLU A;  3IWO A;  3IXD A;  4CLC C;  1D06 A;  3NY4 A;  2WZX A;  3LUQ A;  3MFD A;  2H0T A;  4MMN A;  5DJU A;  2OWJ A;  3UB7 A;  3UDF A;  3UB8 A;  2WK0 A;  2W3D A;  5DTS A;  4EES A;  3EQV A;  2ZQ7 A;  5GLA A;  4HP9 A;  4Y0T A;  2Y8H A;  5GHY A;  5TFQ A;  4HJ3 A;  1FOF A;  3BW6 A;  4EU0 A;  2H5S A;  2WGW A;  2A24 A;  4HNB A;  3Q82 A;  1XJ3 A;  2Y2P A;  3MFX A;  3P09 A;  2IA2 A;  4XUZ A;  1LL9 A;  3G35 A;  3ZFZ A;  5CEB A;  4M3K A;  4GD6 A;  1P0Z A;  3L9K A;  2YKF A;  5FEF A;  3R7W B;  3N4I A;  1Y54 A;  5FEG A;  1VET B;  3OCN A;  2RCX A;  2V8C A;  4ETZ A;  4NKP A;  3N7W A;  5EOE A;  4EW7 A;  4OH0 A;  5GHZ A;  2QKP A;  2VK3 A;  3DAV A;  2AVX A;  2G2W A;  2P04 A;  1K54 A;  3TE8 A;  1FSW A;  2ZBB A;  1UWP X;  3C30 A;  3WWX A;  3IWI A;  3MQO A;  3UE6 A;  1W63 Q;  2J7V A;  3V50 A;  3TRC A;  4FCF A;  3OPP A;  4Y7P A;  1WA9 A;  5GLC A;  4QU3 A;  1H8Z A;  2XA7 M;  1HLU P;  3H82 A;  3JVU A;  1XFQ A;  3FZC A;  1M40 A;  3UPN A;  2GNX A;  3NHQ A;  5EM1 A;  3UDI A;  2VV6 A;  2W27 A;  4WZ5 C;  5CXW A;  1H8Y A;  1DY6 A;  3Q7Z A;  3ISG A;  1KVM A;  1LHY A;  4JF6 A;  2PBY A;  1OT9 A;  1CF0 A;  3IXH A;  2L1M A;  4E3O A;  3BFC A;  3E98 A;  3SH9 A;  5JYP A;  1LI0 A;  2JBF A;  4UA6 A;  1PNE A;  1SKF A;  1OTA A;  3LIC A;  1X0O A;  5HDS A;  3T4J A;  1OTE A;  2Q0O A;  3QHY A;  2FZ0 A;  3ZYT A;  1TS8 A;  1W63 M;  3LCE A;  3DTK A;  5M1A A;  5FI6 A;  5HWV A;  3L7H A;  2ZD8 A;  4R3J A;  4JF5 A;  2Y2Q A;  3UB6 A;  4UHU A;  3UME A;  5EM0 A;  1Q2Q A;  3NI9 A;  1C3B A;  3V3S A;  4HJ4 A;  5HDD A;  4X55 A;  5IHV A;  3TOI A;  3MXS A;  1XKZ A;  3HUM A;  2GJ3 A;  3UE1 A;  2B02 A;  3LIE A;  1VET A;  1T19 A;  2HDQ A;  3T1Q B;  3G2Y A;  5DF7 A;  4B4X A;  4Z1W A;  2H28 A;  3FKW A;  5FI2 A;  3HLG A;  2HJ9 C;  5HSQ A;  1MBL A;  1QMF A;  3CJM A;  3E2L A;  4E3I A;  3E2K A;  2A2L A;  4F3L B;  4Y2F A;  3QP1 A;  3G4P A;  1N9B A;  1S66 L;  5HWT A;  4K0X A;  1BLS A;  1VM1 A;  3P7N A;  3LI9 A;  1OJ5 A;  4HJ6 A;  3W4P A;  4BBT A;  3BQ8 A;  4CQH A;  2HJE A;  4LFU A;  4OPZ A;  2Y2J A;  4EQ1 A;  1OTD A;  5M18 A;  3LR5 A;  4OQH A;  5LBR A;  4EER A;  1UGU A;  5KZH A;  1MKM A;  1VEU A;  5EUA A;  3TG9 A;  4BD0 A;  2M1C A;  5A93 A;  5E2F A;  3B47 A;  3HVF A;  4G3V A;  2ZL1 A;  1XA1 A;  1JNU A;  4IVK A;  3T4K A;  4PM6 A;  1LL5 A;  5FDS A;  5DTT A;  4C75 A;  3PXP A;  1ZHH B;  1T1C A;  1BLH A;  5AQB A;  1H3Q A;  1CK3 A;  4I38 A;  2HPB A;  3LI8 A;  2ZC5 B;  3ZG8 B;  3DTM A;  2W1T B;  3HL9 A;  3MKF A;  1V9Z A;  4R4R A;  4JKT A;  3DTE A;  1G68 A;  1RGZ A;  1IFQ A;  4PMA A;  4N1H A;  5DFX A;  4MBH A;  1ESI A;  4K91 A;  3C4P A;  3V39 A;  3S22 A;  1BUL A;  4KQO A;  3MS6 A;  4E3K A;  4WF0 A;  1NRF A;  2PU4 A;  4GDN A;  3V5M A;  4R3B A;  2W3G A;  1YQS A;  4NG2 A;  3UDX A;  4O01 A;  3MJQ A;  4CLC B;  5J3W A;  2Y79 A;  3DW0 A;  4Y0U A;  1JWZ A;  3EGD C;  3UN7 A;  4Y15 A;  4GHI A;  3T4T A;  2Y59 A;  2BG1 A;  2D02 A;  1K54 C;  3IX4 A;  4R70 A;  4DXC A;  1H8M A;  2ZM2 A;  2GX5 A;  3BEC A;  4E6W A;  3PAG A;  5DVA A;  3OC2 A;  1IYO A;  3VSK A;  3BLM A;  1IKG A;  3G2Z A;  4OP5 A;  3HLB A;  3NDE A;  2VV7 A;  4X1L A;  3CUE C;  2PYR A;  2XD1 A;  1K4F A;  1JTD A;  1K56 D;  2IWD A;  2XRN A;  4QY6 A;  1KE3 A;  4B4Z A;  1XA7 A;  4G3W A;  1D7E A;  4DKI A;  1OME A;  3VFH A;  4Y3I A;  3LO7 A;  5F6A A;  4MEZ A;  2QZ6 A;  4LPZ A;  3T4Q A;  3OPL A;  2Y2M A;  4I3J A;  3HCY A;  3FWL A;  2PD8 A;  4F94 A;  4N92 A;  3M6H A;  3SH8 A;  2L0W A;  3Q81 A;  2LB5 A;  4FH2 A;  2HZ5 A;  1KGG A;  1E25 A;  3A3D A;  1S4S A;  5CGW A;  2EX8 A;  3VP4 A;  3VP3 A;  3BFG A;  2XFS A;  2WZZ A;  1ERQ A;  5J4E A;  4EBP A;  2JKG A;  5EPH A;  5AQ9 A;  4IJG A;  4OQG A;  4KZ7 A;  2J9O A;  3GEC A;  1PI5 A;  3T12 B;  5F1F A;  2I72 A;  5FQJ A;  3ZG0 A;  1BZA A;  3W4O A;  2W3H A;  3C2W A;  1WE4 A;  3ZNY A;  4KQD A;  2PBD P;  4EV4 A;  1GA9 A;  1K56 A;  1XJ4 A;  5TR7 A;  3D9Y A;  2P7J A;  1BT5 A;  3FC7 A;  5AVE A;  1RP5 A;  5AQA A;  1GCE A;  3K3D A;  5L8M A;  2W3F A;  2HGV A;  3GR2 A;  5HZH A;  2W1R A;  3U2A A;  3W8K A;  3MQQ A;  2WAF A;  5CGS A; 
#chains in the Genus database with same CATH homology
 3KSF A;  4WEL A;  3OCN A;  3E4O A;  2HV1 A;  5K5B A;  2OAP 1;  1P97 A;  4ETZ A;  4NKP A;  3NJA A;  3F1O A;  4LRX C;  3LFV A;  3IS2 B;  5DKK A;  4EW7 A;  3CAX A;  5TBM B;  5HPI A;  3EWK A;  4UEY A;  3C8C A;  4K08 A;  1S1Z A;  2QKP A;  2P04 A;  2WKP A;  3KSH A;  3TE8 A;  3E4P A;  2ZBB A;  1EW0 A;  1UWP X;  3C30 A;  1S1Y A;  4NXG A;  1TS0 A;  2PHY A;  1KOU A;  2I9V A;  2P08 A;  3E0Y A;  3MQO A;  3UE6 A;  1W63 Q;  2ZOI A;  3TJZ C;  4WUJ A;  3MQ0 A;  2XA7 S;  3S7N A;  1MC0 A;  1XFN A;  3TRC A;  2VLG A;  1WA9 A;  3CLO A;  3DBA A;  3OLO A;  2BAS A;  2XA7 M;  3H82 A;  3JVU A;  1XFQ A;  1LL8 A;  4I3A A;  2J3W A;  2HF6 A;  2GNX A;  3D3O A;  2PYP A;  4L0L A;  4UQI S;  3NHQ A;  1P9W A;  3F1P B;  1NLY A;  1NRJ A;  2V1B A;  3MR0 A;  2VV6 A;  2W27 A;  5EFW A;  2W0N A;  5IU1 A;  3S7P A;  4MN6 A;  1S4R A;  3OBF A;  4NXE A;  3PBO A;  1STZ A;  3BY9 A;  1OT9 A;  3RH8 B;  1BYW A;  1LT0 A;  2L1M A;  2O9C A;  5G4Y A;  3E98 A;  3PR6 A;  4GCZ A;  3R4K A;  3PBS A;  5CX7 A;  4II7 A;  1YAX A;  1OTA A;  2OOL A;  3LIC A;  3A0R A;  1X0O A;  1MZU A;  5MC7 A;  1F9I A;  5DJT A;  4LRY C;  5HDS A;  1OTE A;  2WKQ A;  4GW9 A;  3T4J A;  2VV8 A;  3ICY A;  2J3T C;  2FZ0 A;  2INW A;  3CI6 A;  3ZYT A;  3GDI A;  1TS8 A;  1W63 M;  5HDC A;  4CLC A;  1OTI A;  2JN7 A;  4DJ3 A;  5HWV A;  1XJ6 A;  2D01 A;  3LIA A;  4IUH A;  2DMW A;  1LSX A;  3H7W A;  3UB6 A;  3LR0 A;  3UME A;  4IUK A;  4HI4 A;  4ZRR A;  5FL3 A;  2PD7 A;  2PR6 A;  4HJ4 A;  5HDD A;  4WLA A;  4BMW A;  2EWV A;  4I3I A;  2GJ3 A;  4P6Z S;  2WKR A;  4L9F A;  2B02 A;  3LIE A;  4UQI M;  5IT5 A;  1T19 A;  2W3E A;  3LID A;  3MMH A;  4GS9 A;  2PT7 A;  3A0S A;  1N9L A;  4RQ9 A;  4Z1W A;  2H28 A;  3R7W A;  3LIF A;  1XJ2 A;  2HJ9 C;  4LRZ E;  5HSQ A;  1TS7 A;  3LR3 A;  4WL9 A;  4CLC E;  4E04 A;  4BBU A;  2A2L A;  4F3L B;  4GHI B;  2QJ7 A;  4Y2F A;  3EOI A;  4WEK A;  3FPV A;  2KOI A;  1S66 L;  2O99 A;  5HWT A;  2L4R A;  3NOU C;  3CUE A;  1DP9 A;  4ETX A;  1N9O A;  4HIA A;  3P7N A;  4IHQ A;  3P01 A;  3LI9 A;  3BQA A;  4MN5 A;  1DRM A;  1OJ5 A;  4HJ6 A;  3W2Z A;  3LIB A;  1ZTU A;  4BBT A;  3BQ8 A;  4CQH A;  2HJE A;  1OJG A;  4HP4 A;  3NOT C;  3LR4 A;  4R3A A;  5HD3 A;  4EQ1 A;  1OTD A;  2V9A A;  4B93 A;  3LR5 A;  4NXF A;  5LBR A;  4EER A;  2XSS A;  4L9G A;  1GSV A;  1UGU A;  4ME4 A;  4HQA A;  2OWH A;  2G7U A;  1MKM A;  3PBQ A;  3T4S A;  5HWW A;  3BY8 A;  1T1A A;  2QHK A;  2M1C A;  4AFI A;  3H9W A;  2EA9 A;  4I5S A;  3B47 A;  1OTB A;  4WEJ A;  4G3V A;  1JNU A;  2ZMF A;  4BJP A;  3T4K A;  3IBR A;  2JKR M;  4JGO A;  5TBM A;  4CLC D;  3B42 A;  2QWS A;  4O0P A;  3IBJ A;  1UWN X;  5C5K A;  1F5M A;  5DFY A;  5KSH A;  4NEE D;  3PXP A;  1ZHH B;  3PBR A;  3VE4 A;  4HOI A;  1T1C A;  1VHM A;  4F3L A;  1H3Q A;  4KUK A;  4I38 A;  4Q0I A;  5TJJ A;  3K2N A;  3VV4 A;  3KYZ A;  2KLI A;  3LI8 A;  1TF1 A;  2VGL M;  1V9Y A;  2W1T B;  3O5Y A;  3ZQ5 A;  3H7W B;  3PBN A;  3KO6 A;  1V9Z A;  2V1A A;  4EXO A;  3H82 B;  4DN0 A;  2V0W A;  4H6J B;  1IFQ A;  3KX0 X;  5DFX A;  3T4O A;  2JKR I;  2LB9 A;  3BWL A;  3IS2 A;  2J3T D;  4FSF A;  3F1P A;  3RFB A;  2B18 A;  3A0V A;  3VOL A;  1VB6 A;  3S7O A;  3F1O B;  4KQO A;  4ARZ A;  5HPF A;  1P9R A;  3OOV A;  5IS1 A;  4WF0 A;  3FPW A;  4HH3 A;  3F1N B;  2NUP C;  1YSQ A;  1OT6 A;  2O0Y A;  2W3G A;  2W1T A;  3LYX A;  4KUO A;  4M4X A;  4L9E A;  3VE3 A;  4GLQ A;  5AVF A;  1DP8 A;  2QJ5 A;  2JKT M;  2JHE A;  3E4Q A;  1Y28 A;  3V67 A;  4O01 A;  4JGQ A;  3KSG A;  4QPR A;  3MJQ A;  3KYQ A;  4CLC B;  4OOM A;  1N9N A;  2Z6D A;  3UMD A;  4BWI A;  5J3W A;  2Y79 A;  5F68 A;  3EGD C;  1LSW A;  4GHI A;  4EEP A;  4DJ2 A;  3T4T A;  4EUV A;  3EEH A;  3ULF A;  1TS6 A;  2D02 A;  1NWZ A;  4R70 A;  4PKY G;  3RTY A;  1IOU A;  1H8M A;  3HJI A;  1OPX A;  4XT2 A;  3C38 A;  4HH2 A;  2XRO A;  4G3K A;  1YKD A;  2VA0 A;  2PR5 A;  3BJN A;  3HJK A;  2GX5 A;  4R38 A;  3JVV A;  3T4L A;  3FG8 A;  2Z6C A;  2OAQ 1;  2V0U A;  3OC2 A;  2VJW A;  4EET B;  3EQU A;  2K7S A;  2KDK A;  4Q0H A;  2NUT C;  4MN7 A;  2M7U A;  4YWZ A;  5G4Z A;  2VV7 A;  4GJ4 A;  3CUE C;  2PYR A;  4PKY A;  2J80 A;  2QYB A;  4OOL A;  3K3C A;  1GSW A;  1S67 L;  2A24 B;  2K2N A;  2VEA A;  1G28 A;  1T18 A;  3OCL A;  2XRN A;  4Q0J A;  2PDR A;  4H6J A;  3CIT A;  1GSX A;  4I39 A;  4P6Z M;  4WN5 A;  3UB9 A;  4G3W A;  1D7E A;  1DP6 A;  4JGR A;  1T1B A;  5DF9 A;  1YSP A;  2FH5 A;  3MF0 A;  4Y3I A;  2M7V A;  5J7E A;  2VX8 A;  3B33 A;  4DMZ A;  4FOF A;  2CMN A;  2ZOH A;  3EEA A;  4PAU A;  3S7Q A;  3CWF A;  3MXQ A;  5F6A A;  2VGL S;  3F1N A;  4PHT A;  4YOF A;  3SW1 A;  4EEU A;  4LPZ A;  2R78 A;  3T4Q A;  2MJ6 A;  4Y5F A;  4I3J A;  3HCY A;  5F5Y A;  2PD8 A;  5DKL A;  2K31 A;  3D72 A;  2EWW A;  2L0W A;  2LB5 A;  1ODV A;  5HD5 A;  4CLC C;  4R6L A;  1D06 A;  3UE3 A;  1S4S A;  2ZMV A;  1LSV A;  4GS9 B;  3LUQ A;  3G6O A;  4MDZ A;  1NLZ A;  1F98 A;  3PYP A;  4XT2 B;  4B9O A;  5J4E A;  4MMN A;  5DJU A;  2OWJ A;  2JKT I;  3UB7 A;  4JGP A;  3UB8 A;  5F69 A;  2W3D A;  4EES A;  4IJG A;  3EQV A;  4HP9 A;  3GEC A;  2Y8H A;  4HHD A;  3TW8 A;  3PBT A;  5AJG A;  4HJ3 A;  2O9B A;  4ARZ B;  2YKH A;  3BW6 A;  4LLO B;  4EU0 A;  2W3H A;  2GZA A;  1G6O A;  4HY8 A;  5HL6 A;  2A24 A;  3C2W A;  4HNB A;  4KQD A;  2VKS A;  4YNR A;  1XJ3 A;  2KX6 A;  3KSI A;  1XJ4 A;  4MCW A;  3NOP C;  3EGX C;  4BBV A;  4O8G A;  3MFX A;  2P7J A;  3FC7 A;  5AVE A;  2IA2 A;  2VZW A;  3K3D A;  5I5L A;  5L8M A;  3PHY A;  5A8B A;  5KIZ A;  2W3F A;  3T50 A;  2HGV A;  2O9A A;  5HZH A;  2W1R A;  3U2A A;  1P0Z A;  1TD5 A;  4NXB A;  2YKF A;  3R7W B;  3MQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...