1P0ZA

Sensor kinase cita binding domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
131
structure length
131
Chain Sequence
b'EERLHYQVGQRALIQAMQISAMPELVEAVQKRDLARIKALIDPMRSFSDATYITVGDASGQRLYHVNPDEIGKSMEGGDSDEALINAKSYVSVRKGSLGSSLRGKSPIQDATGKVIGIVSVGYTIEQLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor kinase citA
molecule tags Transferase
source organism Klebsiella pneumoniae
publication title The structure of the periplasmic ligand-binding domain of the sensor kinase CitA reveals the first extracellular PAS domain.
pubmed doi rcsb
total genus 38
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2003-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1p0zA00
2W0NA 1D06A 3F1PB 1X0OA 1OTBA 1JNUA 2W27A 3HJIA 3K3DA 5HDSA 1S4SA 3VOLA 3E4OA 5F68A 2VV6A 5IU1A 3LI8A 1OTIA 2WKPA 3LIDA 3SW1A 4LRZE 1S67L 1OJGA 1LSXA 4KUKA 4L9EA 3CAXA 4R70A 3G6OA 4JGRA 1D7EA 1N9NA 4GS9B 2PD8A 3VE3A 3E4PA 1T19A 1OTDA 2CMNA 3C8CA 3D72A 2YKFA 1UGUA 4GHIA 4HHDA 4I3JA 4JGOA 4LPZA 4R38A 5AVFA 5HWWA 1OT9A 4BBUA 1Y28A 2WKQA 1VB6A 4EETB 3UB6A 2VLGA 1S1YA 4E04A 5EFWA 2V1AA 1N9LA 5DKKA 1V9YA 3NHQA 2ZOHA 3H7WA 1OT6A 4NXBA 5TBMA 3UB7A 3A0VA 2ZOIA 1GSXA 5IS1A 2VV7A 2QWSA 3BY9A 4BBTA 2V9AA 3EEHA 3UE6A 1DP9A 3H9WA 3UMDA 1F98A 1TS8A 4MN6A 3MJQA 1DP6A 3H82A 3H7WB 3IS2B 3F1NB 3P7NA 4HH2A 5HDCA 3LIAA 4EXOA 5F5YA 2PYPA 4F3LA 2OWJA 3EWKA 2I9VA 3H82B 3PHYA 2QJ7A 4HJ3A 2V0WA 4HY8A 5J4EA 4XT2A 3UMEA 1LT0A 4WUJA 1UWPX 4EESA 1BYWA 1KOUA 5DKLA 5TBMB 2L4RA 4H6JA 5HWTA 4GCZA 3A0RA 1DRMA 1S1ZA 4HP9A 5J7EA 1XFQA 3UB9A 3VE4A 1F9IA 3MR0A 1T1CA 1NWZA 2PDRA 2M1CA 2J80A 4LRXC 3FG8A 5HDDA 3ZQ5A 3F1NA 5KIZA 1T1BA 2K7SA 3MQQA 4I3IA 3UB8A 2D01A 1LSWA 4HH3A 4HOIA 2QHKA 5HD5A 4NXGA 1ODVA 4EEPA 4XT2B 3IS2A 4KQDA 2L1MA 4RQ9A 2HV1A 3LIBA 4YWZA 1OJ5A 1T18A 2KDKA 3IBRA 3NJAA 1TS7A 4HJ4A 2PYRA 3CWFA 4HIAA 2D02A 2VV8A 1DP8A 3LIFA 2EA9A 4GHIB 5DJTA 4HI4A 4JGPA 1EW0A 4PKYG 4LLOB 3NOTC 2Z6DA 1LSVA 3BY8A 2A24A 2ZBBA 4WN5A 1TS6A 2BASA 2V0UA 4I38A 4EERA 2PR5A 4NXEA 5HSQA 1T1AA 3HJKA 4WL9A 4B9OA 4EQ1A 2A24B 4EEUA 4JGQA 1G28A 3C2WA 4I5SA 2INWA 3ICYA 3LUQA 3LICA 3LYXA 4MN5A 1OTEA 3E4QA 1GSWA 2OOLA 2JHEA 2V1BA 2Z6CA 3F1OB 4L9FA 5AVEA 4LRYC 4HJ6A 4GW9A 4R3AA 1XFNA 3RTYA 4HNBA 4WLAA 4DJ3A 1XJ6A 1GSVA 1V9ZA 2YKHA 1XJ2A 5A8BA 4BBVA 4EW7A 4NXFA 1P97A 1XJ3A 1P0ZA 2QJ5A 4PKYA 4I3AA 3LIEA 1S4RA 4WF0A 1OTAA 5G4ZA 5G4YA 4KUOA 4HQAA 3F1OA 3F1PA 3MQOA 4L9GA 3FC7A 2R78A 2VEAA 3ULFA 4GS9A 5HD3A 4DJ2A 2KX6A 4M4XA 2L0WA 2GJ3A 3KX0X 2WKRA 3PYPA 5I5LA 3BWLA 3OLOA 4I39A 5J3WA 2JN7A 2PR6A 1UWNX 1MZUA 3NOUC 5F69A 1LL8A 1TS0A 4HP4A 1WA9A 2OWHA 3NOPC 4F3LB 2B02A 5F6AA 3T50A 5HZHA 3A0SA 1XJ4A 3K3CA 5DJUA 2PD7A 4H6JB 2P7JA 2QKPA 3CLOA 4K08A 1N9OA 3GDIA 3RH8B 1S66L 3LI9A 2PHYA 3MFXA 3GECA 2H28A 3MXQA 5HWVA 3B33A 4R6LA
chains in the Genus database with same CATH superfamily
3HUNA 1OTBA 4UHUA 4EEUA 2CC1A 4QU3A 1YMXA 3BFCA 2WGWA 1E25A 1PW8A 4F3LA 1K6SA 1VETA 3G31A 2O0YA 5FSRA 2XDMA 3ZNYA 1P9RA 3V67A 1NLZA 3WS2A 4E04A 2V1AA 3NHQA 2WKEA 3A0VA 1GSXA 1XP4A 1TF1A 4KG5A 5CGWA 2ZC3B 2Y2MA 3MF0A 3HL9A 3PXPA 3O86A 4FH4A 4MCWA 5E2EA 2V0WA 1YT4A 2ZJ9A 3CITA 1UWPX 3WS4A 2W1TA 3HLGA 3G2YA 4GLQA 4E6WA 1YLPA 2DRWA 3MQ0A 4XXRA 4PM9A 4LCMA 4B4XA 1DJAA 4RQ9A 4DDSA 1FCOA 1TS7A 4ESPA 2WAFA 3SS5A 3GRJA 4R0QA 2GDNA 3MZEA 2V0UA 5JYPA 5HSQA 5MC7A 4EQ1A 4KG2A 4MLLA 4KZ3A 3VSLA 3ZNTA 3VOYA 4MBHA 4K0XA 4DJ3A 3Q81A 1PWCA 3C38A 3MXSA 5EVLA 3ZVWA 4BENA 3NC8A 4WZ5A 1PI4A 1YLJA 2EX6A 1KDWA 4WM9A 3SS4A 2EWVA 2Y79A 1UWNX 1MZUA 2VK3A 4UQIS 3K2NA 3L9KA 1K56D 3DTKA 4X1LA 3R4KA 4BD0A 2Y2PA 4CLCE 2P7JA 1STZA 3BRMA 2Y2LA 3RH8B 4WZ4A 3LI9A 2PHYA 3SOIA 3CI6A 4OKPA 3VSKA 5CX7A 5AQAA 2DMWA 5HPFA 3BYDA 5HDSA 2YKFA 4R38A 1IELA 5AVFA 4PM8A 1CEGA 1Y28A 2AVXA 3VP0A 4UEYA 1LI9A 1IKIA 4ZTKA 3T1RA 1L2SA 5HAIA 2WADA 4UA6A 4IVKA 4CLCA 1TEMA 3LEQA 5DKLA 5TBMB 5CECA 4KZ9A 3IXBA 3N8SA 4JXGA 2VJWA 5HL6A 2M7UA 4X68A 3KSGA 3RFBA 1NY0A 5KIZA 5L07A 4EEPA 3FKVA 5GLBA 1K55A 2W1RA 3IF5A 4HIAA 3UDFA 3BY8A 4WN5A 2BASA 4HBUA 4S2NA 2ZM8A 3HREA 4Q0IA 4WL9A 2XK1A 4JGQA 3QNCA 5AVEA 2Z6CA 3C5AA 1PZOA 4WLAA 2YKHA 5A8BA 4EW7A 3SZTA 4OONA 4HESA 3N8LA 3MZFA 1XGIA 5FAPA 4P85A 2JN7A 1MBLA 2ZLYA 1LL8A 4FTXA 5AQ9A 4BL3A 3M6HA 4GDNA 2G2WA 3PBTA 4OQHA 3F1PB 1JNUA 3IXDA 4JKTA 5DTTA 1M6KA 1CEFA 4NXGA 2QZ6A 1K0KA 1CF0A 4JF5A 3MMHA 2XA7S 1BSGA 4IJGA 4ZJ3A 2JKFA 1OT6A 2P9VB 5IS1A 2QWSA 2XD1A 5HX9A 5F1GA 5GHYA 4BQMA 1TS8A 1EI5A 4DMZA 2K31A 2HP9A 3GSGA 2V8CA 3KYZA 1BLPA 4S2MA 3DAVA 3DW0A 1YSPA 5HDDA 2XQZA 3JPUA 1LI0A 4I3IA 2D01A 4GNUA 5DVAA 3PR6A 1GA0A 3LR3A 4LFUA 2W3DA 5TR7A 4DE0A 3LFVA 1AXBA 3NOTC 1DJCA 1TDLA 4WZ5C 3T1XA 1K54A 3HLWA 3PAGA 1NRJA 1SKOB 3C2WA 4M3KA 2WK0A 1OTEA 1HTZA 3F1OB 1ESUA 2Y8HA 4P87A 4ME4A 4BBVA 4DE1A 4QY6A 2ZQDA 4QY5A 1L0EA 4DE2A 4CQHA 3MQOA 3FC7A 3ZFZA 5HD3A 5TFQA 3OLOA 3CUEA 1NXYA 3OCLA 2WUQA 4OQGA 3WS0A 2Y59A 1SZVA 1BTLA 1K25A 3GDIA 1FSYA 4OPZA 5DFYA 1X0OA 3BJNA 4LRZE 1S67L 5LBRA 4S2KA 4GHIA 4EBPA 1SKFA 2Z2LB 2HGVA 3C4OA 1N9LA 1GHPA 1SDEA 2JBFA 5DF8A 4X1MA 4E3MA 3A3JA 3IF6C 2BTFP 4S2OA 4YFMA 4C3QA 1IYPA 4DXCA 1KGEA 4IEDA 1YMSA 3G30A 1PW1A 3WWXA 2XEPA 3NDGA 3C4PA 4G3WA 1K55C 2EFXA 4WUJA 2O99A 4H6JA 5FDSA 4ZJ1A 4EERA 4KZ4A 3BFFA 3MS6A 2H0TA 3ZDJA 2JHEA 1KVMA 1TVFA 2HDSA 1L0DA 3IF6B 4R3AA 3HUOA 4MBFA 2Y4AA 5CTMA 1TDGA 4E6XA 2JKTM 3ITBA 4IVIA 4B93A 4E3OA 3QP5A 3ZG9B 3BWLA 2O9BA 2P74A 3TSGA 2OWHA 4X6TA 1YLTA 5HZHA 3K3CA 5DF9A 2LB5A 2O9CA 4HBTA 5CGSA 2H28A 5L8MA 1K6RA 1WYCA 1I2SA 3BLMA 2W27A 4ZJ2A 3HJIA 2HZ5A 3S22A 1W8QA 2VGLS 4DKIA 3G6OA 3E4PA 1OTDA 1W5DA 3TOIA 2EX2A 1H5XA 4EUVA 2FH5A 1ES2A 2WAEA 2ZOHA 3AGDA 1VHMA 2PBYA 3NY4A 2VV7A 4WEKA 3DTIA 5CXWA 3UE6A 1DP9A 1GHMA 4OPQA 1XGJA 2VX8A 4FOFA 2OV5A 3UDXA 2PYPA 3VP2A 3T4OA 4D2OA 3C7VA 4NG2A 4EESA 5TJJA 2A2LA 5FEGA 1DRMA 1T1CA 3SH7A 2DNSA 5DF7A 4WELA 1H8ZA 4OOMA 5FQIA 4YOFA 3CWFA 4UA9A 3LIFA 2ZL1B 1LSVA 1TS6A 5GHZA 1IKGA 3P01A 1Y54A 3U4LP 1XJ3A 1RGZA 4KUOA 5HW3A 3UB5P 4L9GA 1KDSA 2KX6A 5I5LA 3KX0X 4A5RA 3VMAA 5J3WA 3IX4A 2PR6A 3G32A 1ES4A 1WA9A 3NOPC 4P6ZM 1W8YA 3T4TA 5FEFA 3GR2A 4B4ZA 3MXQA 2C5WB 3S7NA 5HL1A 3ZHHA 2JKRI 4NETA 3TG9A 5EVIA 2XROA 1YSQA 5D3OA 4R70A 1ERMA 5FI7A 3T12B 2WKIA 1T19A 3HBRA 4D60A 3E2LA 3IXGA 1S1YA 3WS5A 2EX9A 3VP3A 3EQVA 5L2FA 2W3EA 2ZMAA 2XSSA 3OC2A 3H9WA 4R1GA 1EROA 3IX3A 5F5YA 2A3UA 3WRTA 4ETZA 2GNXA 3H82B 5EVID 4DRTA 1IEMA 5E2GA 5FL3A 1K4FA 5EPHA 2JKRM 5BOHA 2LB9A 3W4PA 1DJBA 1MWRA 3SH8A 1ZG6A 3QP6A 2ZD8A 4GOGA 3HLCA 3CG5A 3UPPA 1LHYA 2W3GA 2JKTI 3HJKA 2VGJA 1QMEA 3ICYA 3E4QA 4GN2A 3RTYA 1GA9A 1F2KA 4KZ7A 5FDHA 2QJ5A 4ZDXA 5G4ZA 2ZMFA 2OLUA 3F1PA 2VEAA 4L0LA 2WKRA 1FIKA 2ZL1A 1ZC2A 3UPOA 1P9WA 1VEUA 3CLOA 1SHVA 5HWVA 4R6LA 1NYMA 3BFEA 1CJFA 1PI5A 4N9LA 5HD5A 4XT2B 1F5MA 3C8CA 4RA7A 1UGUA 2ZQCA 3FPWA 4BBUA 2VLGA 3QP2A 2V8FA 4YNRA 1BT5A 1ESIA 3UO9A 3BY9A 4BBTA 4Y0TA 3HVFA 4WMCD 3MJQA 5E2FA 3IS2B 4NKPA 4RX3A 5DTSA 5KSHA 4OOYA 3DWZA 1DY6A 3UE3A 3WRZA 4QB8A 3HLEA 1F9IA 5EVIC 5A93A 4OP5A 4CJNA 1YPRA 1T1BA 4MEZA 4HOIA 5IHVA 4Y13A 2QHKA 3IS2A 3JVVA 4PHTA 4E3LA 2ZQ8A 5DJTA 4OLDA 3W8KA 2HP6A 2VA0A 1LL5A 2ZBBA 3MKFA 3OZHA 1K57C 5M1AA 1T1AA 2A24B 5M18A 1A0KA 3HLBA 4GW9A 1GSVA 1V9ZA 1XA1A 1P97A 4KQRA 4ARZB 4FCFA 2XF3A 3UN7A 3A3EA 4PMAA 4C6YA 1KE0A 3O87A 4H8RA 1YAXA 4JXSA 3CPTA 4X55A 2PU2A 4OPYA 5EVIB 4MDZA 4JF6A 5F83A 1N9OA 3MBZA 3MFXA 4N92A 1D06A 2GZAA 5FASA 2A49A 3E4OA 1YLZA 3U2AA 5EM1A 1IOUA 3D9YA 3E0YA 3TE8A 4B88A 1W63Q 4II7A 1K56A 3GTCA 3CMZA 2J9OA 1YM1A 3G35A 3TJZC 1IYOA 1RCJA 5HPIA 4CLCD 3H7WA 5TBMA 3UB7A 4KQOA 2V1ZA 5HFOA 3FZCA 3IXHA 4EBLA 2BLSA 3IT9A 4LV2A 3PTEA 3IX8A 4HP9A 2WGWB 3FYZA 4HH3A 2J3TC 5A90A 2L1MA 2KDKA 3IBJA 4X25A 2PYRA 1Q2PA 4JLFA 1TD5A 1EW0A 3BLSA 2A24A 1KVLA 4I38A 2W3HA 3MXRA 4LV3A 1S0WA 4EU0A 3CHWP 4E3NA 1EWZA 2NUPC 3A3IA 2INWA 1OPXA 1GSWA 1XFNA 1PWGA 1XJ6A 3UY6A 4Y5FA 4PPRA 4WF0A 4Y15A 4OH0A 1ACFA 2PAVP 3T4SA 5DFXA 4M4XA 4MBKA 4LGWA 3CPTB 3Q7ZA 4RVAA 5CHJA 5F69A 1G6OA 2J3TD 4UA7A 4QHCA 3EEAA 3OCNA 2FFFB 4P0MA 3B33A 2W0NA 3K3DA 1FILA 3BQ8A 1CK3A 3CAXA 1D7EA 1JWZA 3ZG5A 4HHDA 2W3FA 2WKQA 3VOZA 1VB6A 3N7WA 4IBRA 2UWXA 3NDEA 3N6IA 3VFFA 5K5BA 3KYQA 4ETXA 2JC7A 3JYIA 2MJ6A 3V5MA 3EWKA 2HF6A 1LT0A 4KZAA 1BYWA 1KOUA 2L4RA 2X71A 1MWTA 5J7EA 2ZQ9A 3S1YA 2C6WB 3F1NA 4QWOA 1PNEA 1IYQA 2WGVA 4IUHA 5EVEA 1JTDA 3DBAA 3VP1A 2Y55A 4F94A 1ONHA 4GHIB 3AGFA 3AGEA 4PKYG 1NYYA 5AQ7A 3FV7A 4B9OA 5G18A 3IHBA 2HPBA 4LCLA 3G4PA 5FI2A 3LYXA 3BECA 4LENA 4Z9QA 4C75A 5KSCA 1JTGA 1XJ2A 1KE3A 2XGNA 4NXFA 4Q0HA 4IBXA 5G4YA 1FR6A 2IWBA 2IWCA 3ULFA 3N8RA 2L0WA 3BFGA 3IH8A 4JXVA 3EOIA 2UV0E 4IHQA 1ONGA 1NZUA 1PWDA 4K08A 1PRQA 5E2HA 5IU1A 3I7JA 4L9EA 3RJUA 4Y7PA 2CMNA 3D72A 4I3JA 4Y0OA 3Q1FA 4EETB 3LGOA 4CLCC 3E98A 4ZAMA 2XA7M 1BULA 4O8GA 4MN6A 5EOOA 3VV4A 3P7NA 2V20A 3GVBA 4IUKA 3LY3A 3PHYA 4K91A 4Q0JA 4BJPA 4MMNA 5AQBA 3A0RA 5KZHA 4FSFA 1KGGA 3NBLA 3FWLA 2M1CA 1FR1A 2I72A 1JWVA 4WYYA 3BM6A 3QP1A 1RGYA 4U0XA 5CEDA 3QNBA 3G2ZA 3OPLA 2KOIA 1ODVA 3IBRA 1FSWA 2PBDP 1HLUP 2PT7A 2Y2KA 1C3BA 2P08A 4NXEA 3E2KA 5FATA 4KZ5A 3NECA 4Y0UA 4RYEA 1G28A 2PRFA 4I5SA 4L9FA 4O01A 2HJ9C 1OTAA 4S2NC 1FCMA 3M2KA 3T4QA 3ITAA 3Q7VA 1PFLA 4S2PA 3DTEA 2JE5A 2H0YA 1K38A 3HCYA 2WKHA 1D1JA 5CEBA 2HJEA 2E8JA 1S66L 3GECA 2V9AA 4OPRA 5F82A 2XR0A 3D4FA 3BQAA 4R3BA 1S4SA 5FQQA 2WKPA 2XFSA 2ZC5B 4FUWA 3ZGAB 2BG1A 1ERQA 4KZ6A 2ZC4B 3B42A 1BUEA 3RXXA 2ZC6B 5DTKA 1H0MA 1XA7A 3W2ZA 3UMDA 3VP4A 4X56A 4KENB 3LIAA 3S7QA 4GD6A 1H8YA 1E4DA 2OWJA 3PBRA 2I9VA 4HJ3A 3CZDA 2Y2OA 4OQIA 4LV0A 1K54C 5AJGA 1K4EA 4S2IA 4EUZA 3PBSA 3BEBA 1NWZA 2K2NA 3UE1A 2Q0OA 3MQQA 3UB8A 3IWQA 3W4OA 2Q9MA 4OLGA 4YWZA 2R9WA 2VV8A 1CQAA 1MKMA 2ZQ7A 3RXWA 1I2WA 2R9XA 2Z2MB 1PIOA 1Z09A 2QMIA 3OBFA 3IHAA 3KSIA 3LUQA 1LL9A 3NULA 3T1SA 1XX2A 3HUMA 3FPVA 4GD8A 1H3QA 3NI9A 4PAUA 1RP5A 3LO7A 1S4RA 5GLCA 1MWUA 4HQAA 3F1OA 5CRFA 5CTNA 1NZOA 2E8IA 4I39A 5FQ9A 4YINA 2FZ0A 5FQKA 5GLDA 1FCNA 3O88A 5EECA 1VEUB 2G2UA 3A0SA 1SKOA 2X02A 2QKPA 1W7FA 1G5UA 1ZTUA 1L0GA 2OAQ1 4U3TA 4R3JA 3IQAA 5CERA 3VOLA 5A92A 3LIDA 2G7UA 4UQIM 4GS9B 2PD8A 1WE4A 4JXWA 3TRCA 5HWWA 1OT9A 1GHIA 2Y2JA 2J3WA 5A91A 4CLCB 4R23A 3S7PA 5EFWA 1K57A 2JKGA 3IWIA 1NRFA 2ZC7A 2J9PA 2ZOIA 1XXMA 4N9KA 3B47A 5HAPA 3H7WB 5HDCA 2EX8A 3T4KA 1H8MA 4PM6A 4GCZA 1CI9A 4GKUA 3B3XA 4ID4A 1WYBA 5EOEA 3UB9A 2PDRA 4LRXC 2EXAA 3A3DA 2HV1A 3LIBA 2J8YA 5EV0A 5L09A 2ZM2A 1ES3A 2D02A 3KYEA 4Y3IA 3NIAA 2KLIA 2Y2NA 4LRYC 1U60A 1MY8A 3SH9A 2HDRA 3ZCZA 3LR0A 3N4IA 3T4LA 3IF6A 3ZG8B 4GZBA 2RL3A 5HARA 1FQGA 1GCEA 3PYPA 3LCEA 1YQSA 2ACGA 3NOUC 3W4QA 3GV9A 4HP4A 4F3LB 4PM5A 4DE3A 3M6BA 3T50A 1Q2QA 3ZG7B 1MXOA 4G3VA 4LV1A 4KZBA 2M7VA 4BWIA 3UPNA 2HDUA 1OTIA 4KUKA 1N9NA 3VE3A 3PBQA 4WEJA 4PM7A 2QPNA 5CGXA 1V9YA 2HP5A 1XKZA 1YLYA 3R7WB 1G68A 3IWOA 3G34A 3LEZA 1F98A 4JF4A 1DP6A 3H82A 3V3RA 3LR5A 2XD5A 4EXOA 2J7VA 2B5RA 5JYOA 2JCHA 5J8XA 2PU4A 3OPRA 4N1XA 3R7WA 5HWTA 2P9VA 5FA7A 1XFQA 5HAQA 3C7UA 2ZQAA 5C5KA 1LSWA 5FAOA 5CHUA 4KQDA 3ZVTA 3S7OA 4DDYA 4JGPA 2IWDA 4KQQA 3GQZA 2HDQA 1BLHA 2EFUA 1VETB 2WYXA 5EUAA 1NLYA 1ZG4A 1SDNA 1AWIA 4HNBA 5E43A 3CJMA 1QMFA 4PKYA 4I3AA 4OOLA 5GLAA 5FI6A 2R78A 4DN0A 4GS9A 5FAQA 4R4RA 1BZAA 1LLBA 2EXBA 3C30A 1XJ4A 5GL9A 3SS3A 4JBFA 3JVUA 3A3FA 2B95A 3BFDA 4OVDA 4ZRRA 5TGFA 5GHXA 3LI8A 2VZWA 3EGDC 1S6RA 4GB7A 3P98A 3Q07A 1VQQA 3LR4A 5J4EA 3MSHA 1YLWA 3P09A 4Y2FA 4AFIA 4ZBEA 4P6ZS 4U0TA 1NJ4A 1IFQA 5EM0A 2VGKA 1J3WA 3QP8A 4E3JA 4NK3A 3KSFA 4E3KA 4HY8A 4XUXA 4EBNA 4OP8A 3OPHA 4MN7A 4O7DA 3CUEC 3VE4A 4S2LA 3FG8A 1W79A 3VFHA 3M2JA 3O3VA 2Y2QA 4Z1WA 3BW6A 1MKIA 2EA9A 5FQMA 1W63M 1E3UD 4GJ4A 1ES5A 1HZOA 3EGXC 2V1BA 4HJ6A 2XH9A 5EE8A 4ARZA 1ZHHB 3ISGA 1P0ZA 3T1QB 3TW8A 5M19A 2Y2HA 3ZYTA 4EQIA 3MKEA 4E3IA 2GJ3A 1O07A 2XLNA 3KO6A 1KE4A 4FD8A 5KMWA 3IH9A 4S2JA 3Q82A 2PD7A 2Y2GA 4H6JB 4WMCA 3V3SA 1O7EA 3T4JA 3PBOA 5F68A 3DTMA 1J9MA 1N4OA 2X01A 3D3OA 1OJGA 1LSXA 2WZZA 4JGRA 3MFDA 4JGOA 3UB6A 4QPRA 1HD8A 2OLVA 4KG6A 4QD4A 4P6BA 3EQUA 3EEHA 3WS1A 1PZPA 3F1NB 2RCXA 3QP4A 4RX2A 4EWFA 2V2FF 4XT2A 3UMEA 5L10A 2O9AA 1S1ZA 2OAP1 1BLCA 4O0PA 2Q9NA 3MR0A 4HEFA 1KGFA 1Z6FA 1XPBA 1HVBA 2ZMVA 1I5QA 1JWPA 2K7SA 1MWSA 2NUTC 5U47A 1T18A 3NJAA 1DP8A 3UDIA 4LLOB 1CI8A 2Z6DA 4BLMA 4X69A 2FFYA 2W1TB 4UAAA 3LICA 4G3KA 4WBGA 5CHMA 4QJGA 2XFTA 5FQJA 3LIEA 4DXBA 3KSHA 1M40A 3UNWA 4DJ2A 1TS0A 2B02A 2IA2A 5F6AA 3LY4A 2B18A 4BD1A 2Y91A 1L3LA 5IT5A 2WGIA 2QYBA 1VM1A 2VV6A 3SW1A 4DF6A 4NEED 4LPZA 4X53A 3GMWA 1L0FA 3NCKA 5DKKA 3ZG0A 3OOVA 1ALQA 1MPLA 4NXBA 4N1HA 2GX5A 3L7HA 3OPPA 1JVJA 1FOFA 4HH2A 2ZM0A 4Q8IA 3QHYA 2QJ7A 4BL2A 1MC0A 2P04A 3DWKA 3HLDA 2XRNA 2J80A 3HLFA 3ZQ5A 3FKWA 3UE0A 2H10A 3V50A 1OJ5A 4HJ4A 3PBNA 1N9BA 4HI4A 4FH2A 4CPKA 4K0WA 2PR5A 1ZKJA 4BMWA 3S4XA 2WZXA 4JPMA 4MN5A 4Y17A 2OOLA 4XUZA 3V39A 3Q7VB 3MZDA 2EWWA 5I94A 2DCFA 4R4SA 1E3UA 2VGLM 4GDBA 4MNRA 1OMEA 1PYYA 2OSUA 1IYSA 2Y2IA 3PAEA 4OQ0A 1SCWA 1BLSA 1G6AA 5DJUA 3O5YA 1YKDA 1Y4OA 2VKSA 2H5SA 5F1FA 4KZ8A 4EV4A
chains in the Genus database with same CATH topology
2W0NA 1OTBA 2W27A 3HJIA 4EEUA 3K3DA 3BQ8A 4BWIA 1OTIA 2VGLS 4KUKA 4F3LA 3CAXA 3G6OA 1D7EA 1N9NA 3VE3A 3E4PA 1OTDA 4HHDA 3PBQA 2O0YA 4WEJA 2W3FA 1P9RA 3V67A 1NLZA 2WKQA 1VB6A 4E04A 4EUVA 2FH5A 2V1AA 1V9YA 3NHQA 2ZOHA 3R7WB 1VHMA 3A0VA 1GSXA 4WEKA 2VV7A 1TF1A 5K5BA 3KYQA 3UE6A 1DP9A 4ETXA 1F98A 2VX8A 1DP6A 3H82A 4FOFA 3LR5A 3MF0A 4EXOA 2MJ6A 2PYPA 3PXPA 3EWKA 4MCWA 3T4OA 2V0WA 2HF6A 1LT0A 3CITA 4EESA 1UWPX 1BYWA 1KOUA 5TJJA 3R7WA 2L4RA 2W1TA 5HWTA 2A2LA 1DRMA 5J7EA 1XFQA 1T1CA 4GLQA 5C5KA 3F1NA 3MQ0A 1LSWA 4WELA 4IUHA 4KQDA 4OOMA 4RQ9A 3DBAA 4YOFA 1TS7A 3S7OA 3CWFA 3LIFA 4GHIB 4JGPA 4PKYG 1LSVA 1TS6A 2V0UA 5HSQA 5MC7A 4B9OA 4EQ1A 1NLYA 3P01A 3LYXA 4DJ3A 4HNBA 1XJ2A 4NXFA 4Q0HA 3C38A 1XJ3A 4PKYA 4I3AA 5G4YA 4KUOA 4OOLA 4L9GA 2R78A 3ULFA 4DN0A 4GS9A 2KX6A 2L0WA 3KX0X 5I5LA 5J3WA 2EWVA 2PR6A 2Y79A 1UWNX 1MZUA 4UQIS 1WA9A 3EOIA 3NOPC 3K2NA 3C30A 3R4KA 4P6ZM 1XJ4A 4IHQA 4CLCE 2P7JA 1STZA 3JVUA 4K08A 3RH8B 3T4TA 3LI9A 2PHYA 3CI6A 3MXQA 4ZRRA 3S7NA 2JKRI 5CX7A 5IU1A 2XROA 1YSQA 2VZWA 3EGDC 2DMWA 3LI8A 4L9EA 5HPFA 4R70A 3LR4A 5J4EA 1T19A 2CMNA 3D72A 4I3JA 2YKFA 5HDSA 4R38A 5AVFA 1Y28A 4EETB 1S1YA 4CLCC 4UEYA 3E98A 4Y2FA 4AFIA 2XA7M 3EQVA 4P6ZS 2W3EA 4O8GA 1IFQA 2XSSA 3OC2A 3H9WA 4MN6A 3VV4A 3P7NA 5F5YA 3KSFA 4IUKA 4ETZA 2GNXA 3H82B 3PHYA 4HY8A 4Q0JA 4CLCA 5DKLA 5FL3A 5TBMB 4BJPA 4MMNA 3A0RA 4MN7A 4FSFA 2VJWA 3CUEC 5HL6A 2M7UA 3VE4A 2JKRM 2M1CA 3FG8A 3KSGA 3RFBA 5KIZA 4Z1WA 2LB9A 2KOIA 1ODVA 3BW6A 4EEPA 3IBRA 2W1RA 2PT7A 4HIAA 2EA9A 1W63M 2P08A 3BY8A 4WN5A 2BASA 4NXEA 2W3GA 4Q0IA 2JKTI 3HJKA 4GJ4A 4WL9A 4JGQA 1G28A 4I5SA 3ICYA 3EGXC 3E4QA 2V1BA 4L9FA 5AVEA 2Z6CA 4HJ6A 3RTYA 4WLAA 2YKHA 5A8BA 4ARZA 1ZHHB 4EW7A 2QJ5A 1P0ZA 4O01A 2HJ9C 5G4ZA 1OTAA 3TW8A 2ZMFA 3F1PA 2VEAA 3ZYTA 4L0LA 2GJ3A 2WKRA 3T4QA 2JN7A 3KO6A 1LL8A 2PD7A 4H6JB 3HCYA 1P9WA 3CLOA 2HJEA 1S66L 3GECA 2V9AA 3PBTA 5HWVA 4R6LA 3T4JA 3F1PB 3PBOA 1JNUA 3BQAA 1S4SA 5F68A 2WKPA 3D3OA 1OJGA 1LSXA 4XT2B 5HD5A 4JGRA 4NXGA 1F5MA 3C8CA 4JGOA 1UGUA 3MMHA 3FPWA 4BBUA 2XA7S 3UB6A 2VLGA 4IJGA 3B42A 4QPRA 4YNRA 1OT6A 3EQUA 5IS1A 2QWSA 3BY9A 4BBTA 3EEHA 3W2ZA 3UMDA 1TS8A 3MJQA 3IS2B 3F1NB 4NKPA 4DMZA 3LIAA 2K31A 3S7QA 2OWJA 3PBRA 2I9VA 4HJ3A 5KSHA 4XT2A 3UMEA 3KYZA 3UE3A 2O9AA 1S1ZA 2OAP1 5AJGA 4O0PA 3PBSA 1F9IA 3MR0A 1YSPA 1NWZA 2K2NA 5HDDA 2ZMVA 1T1BA 2K7SA 3MQQA 4I3IA 3UB8A 2D01A 4HOIA 2QHKA 3PR6A 3IS2A 3JVVA 3LR3A 2NUTC 4PHTA 2W3DA 1T18A 4YWZA 3NJAA 5DJTA 2VV8A 1DP8A 1MKMA 3LFVA 2VA0A 3NOTC 4LLOB 2Z6DA 2ZBBA 1NRJA 3OBFA 1T1AA 2A24B 3C2WA 3KSIA 2W1TB 3LUQA 3LICA 4G3KA 1OTEA 3F1OB 4GW9A 2Y8HA 1GSVA 1V9ZA 4ME4A 3FPVA 1H3QA 4PAUA 4BBVA 1P97A 3LIEA 1S4RA 3KSHA 4HQAA 4ARZB 3F1OA 3MQOA 4CQHA 3FC7A 5HD3A 4DJ2A 3OLOA 3CUEA 4I39A 2FZ0A 1TS0A 1YAXA 3OCLA 2B02A 2IA2A 5F6AA 3A0SA 4MDZA 2B18A 2QKPA 1ZTUA 1N9OA 3GDIA 2OAQ1 3MFXA 5IT5A 5DFYA 2QYBA 1D06A 1X0OA 2GZAA 3VOLA 3E4OA 2VV6A 3U2AA 3LIDA 3BJNA 3SW1A 4LRZE 1S67L 5LBRA 2G7UA 3E0YA 3TE8A 1W63Q 1IOUA 4UQIM 4GS9B 2PD8A 4II7A 4NEED 4GHIA 4LPZA 3TRCA 5HWWA 1OT9A 3TJZC 2J3WA 2HGVA 4CLCB 3S7PA 5EFWA 5HPIA 1N9LA 5DKKA 3OOVA 4CLCD 3H7WA 4NXBA 5TBMA 3UB7A 4KQOA 2ZOIA 2GX5A 3B47A 3H7WB 4HH2A 5HDCA 4G3WA 3T4KA 1H8MA 2QJ7A 4WUJA 2O99A 4H6JA 1MC0A 4GCZA 2P04A 4HP9A 3UB9A 2XRNA 2PDRA 4LRXC 2J80A 3ZQ5A 4HH3A 2J3TC 2L1MA 2HV1A 3LIBA 1OJ5A 2KDKA 3IBJA 4HJ4A 2PYRA 2D02A 1TD5A 3PBNA 4HI4A 1EW0A 4Y3IA 2A24A 4I38A 2W3HA 4EERA 2PR5A 4EU0A 4BMWA 2NUPC 2INWA 4MN5A 2KLIA 1OPXA 1GSWA 2OOLA 2JHEA 4LRYC 4R3AA 1XFNA 1XJ6A 4Y5FA 2EWWA 4WF0A 3LR0A 2VGLM 2JKTM 3T4LA 4B93A 3T4SA 5DFXA 4M4XA 3PYPA 3BWLA 2O9BA 3NOUC 5F69A 1G6OA 2J3TD 4HP4A 4F3LB 2OWHA 5HZHA 3T50A 3K3CA 5DJUA 3O5YA 5DF9A 3EEAA 1YKDA 3OCNA 2LB5A 2O9CA 4G3VA 2VKSA 2H28A 5L8MA 3B33A 2M7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0N A;  1D06 A;  3F1P B;  1X0O A;  1OTB A;  1JNU A;  2W27 A;  3HJI A;  3K3D A;  5HDS A;  1S4S A;  3VOL A;  3E4O A;  5F68 A;  2VV6 A;  5IU1 A;  3LI8 A;  1OTI A;  2WKP A;  3LID A;  3SW1 A;  4LRZ E;  1S67 L;  1OJG A;  1LSX A;  4KUK A;  4L9E A;  3CAX A;  4R70 A;  3G6O A;  4JGR A;  1D7E A;  1N9N A;  4GS9 B;  2PD8 A;  3VE3 A;  3E4P A;  1T19 A;  1OTD A;  2CMN A;  3C8C A;  3D72 A;  2YKF A;  1UGU A;  4GHI A;  4HHD A;  4I3J A;  4JGO A;  4LPZ A;  4R38 A;  5AVF A;  5HWW A;  1OT9 A;  4BBU A;  1Y28 A;  2WKQ A;  1VB6 A;  4EET B;  3UB6 A;  2VLG A;  1S1Y A;  4E04 A;  5EFW A;  2V1A A;  1N9L A;  5DKK A;  1V9Y A;  3NHQ A;  2ZOH A;  3H7W A;  1OT6 A;  4NXB A;  5TBM A;  3UB7 A;  3A0V A;  2ZOI A;  1GSX A;  5IS1 A;  2VV7 A;  2QWS A;  3BY9 A;  4BBT A;  2V9A A;  3EEH A;  3UE6 A;  1DP9 A;  3H9W A;  3UMD A;  1F98 A;  1TS8 A;  4MN6 A;  3MJQ A;  1DP6 A;  3H82 A;  3H7W B;  3IS2 B;  3F1N B;  3P7N A;  4HH2 A;  5HDC A;  3LIA A;  4EXO A;  5F5Y A;  2PYP A;  4F3L A;  2OWJ A;  3EWK A;  2I9V A;  3H82 B;  3PHY A;  2QJ7 A;  4HJ3 A;  2V0W A;  4HY8 A;  5J4E A;  4XT2 A;  3UME A;  1LT0 A;  4WUJ A;  1UWP X;  4EES A;  1BYW A;  1KOU A;  5DKL A;  5TBM B;  2L4R A;  4H6J A;  5HWT A;  4GCZ A;  3A0R A;  1DRM A;  1S1Z A;  4HP9 A;  5J7E A;  1XFQ A;  3UB9 A;  3VE4 A;  1F9I A;  3MR0 A;  1T1C A;  1NWZ A;  2PDR A;  2M1C A;  2J80 A;  4LRX C;  3FG8 A;  5HDD A;  3ZQ5 A;  3F1N A;  5KIZ A;  1T1B A;  2K7S A;  3MQQ A;  4I3I A;  3UB8 A;  2D01 A;  1LSW A;  4HH3 A;  4HOI A;  2QHK A;  5HD5 A;  4NXG A;  1ODV A;  4EEP A;  4XT2 B;  3IS2 A;  4KQD A;  2L1M A;  4RQ9 A;  2HV1 A;  3LIB A;  4YWZ A;  1OJ5 A;  1T18 A;  2KDK A;  3IBR A;  3NJA A;  1TS7 A;  4HJ4 A;  2PYR A;  3CWF A;  4HIA A;  2D02 A;  2VV8 A;  1DP8 A;  3LIF A;  2EA9 A;  4GHI B;  5DJT A;  4HI4 A;  4JGP A;  1EW0 A;  4PKY G;  4LLO B;  3NOT C;  2Z6D A;  1LSV A;  3BY8 A;  2A24 A;  2ZBB A;  4WN5 A;  1TS6 A;  2BAS A;  2V0U A;  4I38 A;  4EER A;  2PR5 A;  4NXE A;  5HSQ A;  1T1A A;  3HJK A;  4WL9 A;  4B9O A;  4EQ1 A;  2A24 B;  4EEU A;  4JGQ A;  1G28 A;  3C2W A;  4I5S A;  2INW A;  3ICY A;  3LUQ A;  3LIC A;  3LYX A;  4MN5 A;  1OTE A;  3E4Q A;  1GSW A;  2OOL A;  2JHE A;  2V1B A;  2Z6C A;  3F1O B;  4L9F A;  5AVE A;  4LRY C;  4HJ6 A;  4GW9 A;  4R3A A;  1XFN A;  3RTY A;  4HNB A;  4WLA A;  4DJ3 A;  1XJ6 A;  1GSV A;  1V9Z A;  2YKH A;  1XJ2 A;  5A8B A;  4BBV A;  4EW7 A;  4NXF A;  1P97 A;  1XJ3 A;  1P0Z A;  2QJ5 A;  4PKY A;  4I3A A;  3LIE A;  1S4R A;  4WF0 A;  1OTA A;  5G4Z A;  5G4Y A;  4KUO A;  4HQA A;  3F1O A;  3F1P A;  3MQO A;  4L9G A;  3FC7 A;  2R78 A;  2VEA A;  3ULF A;  4GS9 A;  5HD3 A;  4DJ2 A;  2KX6 A;  4M4X A;  2L0W A;  2GJ3 A;  3KX0 X;  2WKR A;  3PYP A;  5I5L A;  3BWL A;  3OLO A;  4I39 A;  5J3W A;  2JN7 A;  2PR6 A;  1UWN X;  1MZU A;  3NOU C;  5F69 A;  1LL8 A;  1TS0 A;  4HP4 A;  1WA9 A;  2OWH A;  3NOP C;  4F3L B;  2B02 A;  5F6A A;  3T50 A;  5HZH A;  3A0S A;  1XJ4 A;  3K3C A;  5DJU A;  2PD7 A;  4H6J B;  2P7J A;  2QKP A;  3CLO A;  4K08 A;  1N9O A;  3GDI A;  3RH8 B;  1S66 L;  3LI9 A;  2PHY A;  3MFX A;  3GEC A;  2H28 A;  3MXQ A;  5HWV A;  3B33 A;  4R6L A; 
#chains in the Genus database with same CATH topology
 3HUN A;  1OTB A;  4UHU A;  4EEU A;  2CC1 A;  4QU3 A;  1YMX A;  3BFC A;  2WGW A;  1E25 A;  1PW8 A;  4F3L A;  1K6S A;  1VET A;  3G31 A;  2O0Y A;  5FSR A;  2XDM A;  3ZNY A;  1P9R A;  3V67 A;  1NLZ A;  3WS2 A;  4E04 A;  2V1A A;  3NHQ A;  2WKE A;  3A0V A;  1GSX A;  1XP4 A;  1TF1 A;  4KG5 A;  5CGW A;  2ZC3 B;  2Y2M A;  3MF0 A;  3HL9 A;  3PXP A;  3O86 A;  4FH4 A;  4MCW A;  5E2E A;  2V0W A;  1YT4 A;  2ZJ9 A;  3CIT A;  1UWP X;  3WS4 A;  2W1T A;  3HLG A;  3G2Y A;  4GLQ A;  4E6W A;  1YLP A;  2DRW A;  3MQ0 A;  4XXR A;  4PM9 A;  4LCM A;  4B4X A;  1DJA A;  4RQ9 A;  4DDS A;  1FCO A;  1TS7 A;  4ESP A;  2WAF A;  3SS5 A;  3GRJ A;  4R0Q A;  2GDN A;  3MZE A;  2V0U A;  5JYP A;  5HSQ A;  5MC7 A;  4EQ1 A;  4KG2 A;  4MLL A;  4KZ3 A;  3VSL A;  3ZNT A;  3VOY A;  4MBH A;  4K0X A;  4DJ3 A;  3Q81 A;  1PWC A;  3C38 A;  3MXS A;  5EVL A;  3ZVW A;  4BEN A;  3NC8 A;  4WZ5 A;  1PI4 A;  1YLJ A;  2EX6 A;  1KDW A;  4WM9 A;  3SS4 A;  2EWV A;  2Y79 A;  1UWN X;  1MZU A;  2VK3 A;  4UQI S;  3K2N A;  3L9K A;  1K56 D;  3DTK A;  4X1L A;  3R4K A;  4BD0 A;  2Y2P A;  4CLC E;  2P7J A;  1STZ A;  3BRM A;  2Y2L A;  3RH8 B;  4WZ4 A;  3LI9 A;  2PHY A;  3SOI A;  3CI6 A;  4OKP A;  3VSK A;  5CX7 A;  5AQA A;  2DMW A;  5HPF A;  3BYD A;  5HDS A;  2YKF A;  4R38 A;  1IEL A;  5AVF A;  4PM8 A;  1CEG A;  1Y28 A;  2AVX A;  3VP0 A;  4UEY A;  1LI9 A;  1IKI A;  4ZTK A;  3T1R A;  1L2S A;  5HAI A;  2WAD A;  4UA6 A;  4IVK A;  4CLC A;  1TEM A;  3LEQ A;  5DKL A;  5TBM B;  5CEC A;  4KZ9 A;  3IXB A;  3N8S A;  4JXG A;  2VJW A;  5HL6 A;  2M7U A;  4X68 A;  3KSG A;  3RFB A;  1NY0 A;  5KIZ A;  5L07 A;  4EEP A;  3FKV A;  5GLB A;  1K55 A;  2W1R A;  3IF5 A;  4HIA A;  3UDF A;  3BY8 A;  4WN5 A;  2BAS A;  4HBU A;  4S2N A;  2ZM8 A;  3HRE A;  4Q0I A;  4WL9 A;  2XK1 A;  4JGQ A;  3QNC A;  5AVE A;  2Z6C A;  3C5A A;  1PZO A;  4WLA A;  2YKH A;  5A8B A;  4EW7 A;  3SZT A;  4OON A;  4HES A;  3N8L A;  3MZF A;  1XGI A;  5FAP A;  4P85 A;  2JN7 A;  1MBL A;  2ZLY A;  1LL8 A;  4FTX A;  5AQ9 A;  4BL3 A;  3M6H A;  4GDN A;  2G2W A;  3PBT A;  4OQH A;  3F1P B;  1JNU A;  3IXD A;  4JKT A;  5DTT A;  1M6K A;  1CEF A;  4NXG A;  2QZ6 A;  1K0K A;  1CF0 A;  4JF5 A;  3MMH A;  2XA7 S;  1BSG A;  4IJG A;  4ZJ3 A;  2JKF A;  1OT6 A;  2P9V B;  5IS1 A;  2QWS A;  2XD1 A;  5HX9 A;  5F1G A;  5GHY A;  4BQM A;  1TS8 A;  1EI5 A;  4DMZ A;  2K31 A;  2HP9 A;  3GSG A;  2V8C A;  3KYZ A;  1BLP A;  4S2M A;  3DAV A;  3DW0 A;  1YSP A;  5HDD A;  2XQZ A;  3JPU A;  1LI0 A;  4I3I A;  2D01 A;  4GNU A;  5DVA A;  3PR6 A;  1GA0 A;  3LR3 A;  4LFU A;  2W3D A;  5TR7 A;  4DE0 A;  3LFV A;  1AXB A;  3NOT C;  1DJC A;  1TDL A;  4WZ5 C;  3T1X A;  1K54 A;  3HLW A;  3PAG A;  1NRJ A;  1SKO B;  3C2W A;  4M3K A;  2WK0 A;  1OTE A;  1HTZ A;  3F1O B;  1ESU A;  2Y8H A;  4P87 A;  4ME4 A;  4BBV A;  4DE1 A;  4QY6 A;  2ZQD A;  4QY5 A;  1L0E A;  4DE2 A;  4CQH A;  3MQO A;  3FC7 A;  3ZFZ A;  5HD3 A;  5TFQ A;  3OLO A;  3CUE A;  1NXY A;  3OCL A;  2WUQ A;  4OQG A;  3WS0 A;  2Y59 A;  1SZV A;  1BTL A;  1K25 A;  3GDI A;  1FSY A;  4OPZ A;  5DFY A;  1X0O A;  3BJN A;  4LRZ E;  1S67 L;  5LBR A;  4S2K A;  4GHI A;  4EBP A;  1SKF A;  2Z2L B;  2HGV A;  3C4O A;  1N9L A;  1GHP A;  1SDE A;  2JBF A;  5DF8 A;  4X1M A;  4E3M A;  3A3J A;  3IF6 C;  2BTF P;  4S2O A;  4YFM A;  4C3Q A;  1IYP A;  4DXC A;  1KGE A;  4IED A;  1YMS A;  3G30 A;  1PW1 A;  3WWX A;  2XEP A;  3NDG A;  3C4P A;  4G3W A;  1K55 C;  2EFX A;  4WUJ A;  2O99 A;  4H6J A;  5FDS A;  4ZJ1 A;  4EER A;  4KZ4 A;  3BFF A;  3MS6 A;  2H0T A;  3ZDJ A;  2JHE A;  1KVM A;  1TVF A;  2HDS A;  1L0D A;  3IF6 B;  4R3A A;  3HUO A;  4MBF A;  2Y4A A;  5CTM A;  1TDG A;  4E6X A;  2JKT M;  3ITB A;  4IVI A;  4B93 A;  4E3O A;  3QP5 A;  3ZG9 B;  3BWL A;  2O9B A;  2P74 A;  3TSG A;  2OWH A;  4X6T A;  1YLT A;  5HZH A;  3K3C A;  5DF9 A;  2LB5 A;  2O9C A;  4HBT A;  5CGS A;  2H28 A;  5L8M A;  1K6R A;  1WYC A;  1I2S A;  3BLM A;  2W27 A;  4ZJ2 A;  3HJI A;  2HZ5 A;  3S22 A;  1W8Q A;  2VGL S;  4DKI A;  3G6O A;  3E4P A;  1OTD A;  1W5D A;  3TOI A;  2EX2 A;  1H5X A;  4EUV A;  2FH5 A;  1ES2 A;  2WAE A;  2ZOH A;  3AGD A;  1VHM A;  2PBY A;  3NY4 A;  2VV7 A;  4WEK A;  3DTI A;  5CXW A;  3UE6 A;  1DP9 A;  1GHM A;  4OPQ A;  1XGJ A;  2VX8 A;  4FOF A;  2OV5 A;  3UDX A;  2PYP A;  3VP2 A;  3T4O A;  4D2O A;  3C7V A;  4NG2 A;  4EES A;  5TJJ A;  2A2L A;  5FEG A;  1DRM A;  1T1C A;  3SH7 A;  2DNS A;  5DF7 A;  4WEL A;  1H8Z A;  4OOM A;  5FQI A;  4YOF A;  3CWF A;  4UA9 A;  3LIF A;  2ZL1 B;  1LSV A;  1TS6 A;  5GHZ A;  1IKG A;  3P01 A;  1Y54 A;  3U4L P;  1XJ3 A;  1RGZ A;  4KUO A;  5HW3 A;  3UB5 P;  4L9G A;  1KDS A;  2KX6 A;  5I5L A;  3KX0 X;  4A5R A;  3VMA A;  5J3W A;  3IX4 A;  2PR6 A;  3G32 A;  1ES4 A;  1WA9 A;  3NOP C;  4P6Z M;  1W8Y A;  3T4T A;  5FEF A;  3GR2 A;  4B4Z A;  3MXQ A;  2C5W B;  3S7N A;  5HL1 A;  3ZHH A;  2JKR I;  4NET A;  3TG9 A;  5EVI A;  2XRO A;  1YSQ A;  5D3O A;  4R70 A;  1ERM A;  5FI7 A;  3T12 B;  2WKI A;  1T19 A;  3HBR A;  4D60 A;  3E2L A;  3IXG A;  1S1Y A;  3WS5 A;  2EX9 A;  3VP3 A;  3EQV A;  5L2F A;  2W3E A;  2ZMA A;  2XSS A;  3OC2 A;  3H9W A;  4R1G A;  1ERO A;  3IX3 A;  5F5Y A;  2A3U A;  3WRT A;  4ETZ A;  2GNX A;  3H82 B;  5EVI D;  4DRT A;  1IEM A;  5E2G A;  5FL3 A;  1K4F A;  5EPH A;  2JKR M;  5BOH A;  2LB9 A;  3W4P A;  1DJB A;  1MWR A;  3SH8 A;  1ZG6 A;  3QP6 A;  2ZD8 A;  4GOG A;  3HLC A;  3CG5 A;  3UPP A;  1LHY A;  2W3G A;  2JKT I;  3HJK A;  2VGJ A;  1QME A;  3ICY A;  3E4Q A;  4GN2 A;  3RTY A;  1GA9 A;  1F2K A;  4KZ7 A;  5FDH A;  2QJ5 A;  4ZDX A;  5G4Z A;  2ZMF A;  2OLU A;  3F1P A;  2VEA A;  4L0L A;  2WKR A;  1FIK A;  2ZL1 A;  1ZC2 A;  3UPO A;  1P9W A;  1VEU A;  3CLO A;  1SHV A;  5HWV A;  4R6L A;  1NYM A;  3BFE A;  1CJF A;  1PI5 A;  4N9L A;  5HD5 A;  4XT2 B;  1F5M A;  3C8C A;  4RA7 A;  1UGU A;  2ZQC A;  3FPW A;  4BBU A;  2VLG A;  3QP2 A;  2V8F A;  4YNR A;  1BT5 A;  1ESI A;  3UO9 A;  3BY9 A;  4BBT A;  4Y0T A;  3HVF A;  4WMC D;  3MJQ A;  5E2F A;  3IS2 B;  4NKP A;  4RX3 A;  5DTS A;  5KSH A;  4OOY A;  3DWZ A;  1DY6 A;  3UE3 A;  3WRZ A;  4QB8 A;  3HLE A;  1F9I A;  5EVI C;  5A93 A;  4OP5 A;  4CJN A;  1YPR A;  1T1B A;  4MEZ A;  4HOI A;  5IHV A;  4Y13 A;  2QHK A;  3IS2 A;  3JVV A;  4PHT A;  4E3L A;  2ZQ8 A;  5DJT A;  4OLD A;  3W8K A;  2HP6 A;  2VA0 A;  1LL5 A;  2ZBB A;  3MKF A;  3OZH A;  1K57 C;  5M1A A;  1T1A A;  2A24 B;  5M18 A;  1A0K A;  3HLB A;  4GW9 A;  1GSV A;  1V9Z A;  1XA1 A;  1P97 A;  4KQR A;  4ARZ B;  4FCF A;  2XF3 A;  3UN7 A;  3A3E A;  4PMA A;  4C6Y A;  1KE0 A;  3O87 A;  4H8R A;  1YAX A;  4JXS A;  3CPT A;  4X55 A;  2PU2 A;  4OPY A;  5EVI B;  4MDZ A;  4JF6 A;  5F83 A;  1N9O A;  3MBZ A;  3MFX A;  4N92 A;  1D06 A;  2GZA A;  5FAS A;  2A49 A;  3E4O A;  1YLZ A;  3U2A A;  5EM1 A;  1IOU A;  3D9Y A;  3E0Y A;  3TE8 A;  4B88 A;  1W63 Q;  4II7 A;  1K56 A;  3GTC A;  3CMZ A;  2J9O A;  1YM1 A;  3G35 A;  3TJZ C;  1IYO A;  1RCJ A;  5HPI A;  4CLC D;  3H7W A;  5TBM A;  3UB7 A;  4KQO A;  2V1Z A;  5HFO A;  3FZC A;  3IXH A;  4EBL A;  2BLS A;  3IT9 A;  4LV2 A;  3PTE A;  3IX8 A;  4HP9 A;  2WGW B;  3FYZ A;  4HH3 A;  2J3T C;  5A90 A;  2L1M A;  2KDK A;  3IBJ A;  4X25 A;  2PYR A;  1Q2P A;  4JLF A;  1TD5 A;  1EW0 A;  3BLS A;  2A24 A;  1KVL A;  4I38 A;  2W3H A;  3MXR A;  4LV3 A;  1S0W A;  4EU0 A;  3CHW P;  4E3N A;  1EWZ A;  2NUP C;  3A3I A;  2INW A;  1OPX A;  1GSW A;  1XFN A;  1PWG A;  1XJ6 A;  3UY6 A;  4Y5F A;  4PPR A;  4WF0 A;  4Y15 A;  4OH0 A;  1ACF A;  2PAV P;  3T4S A;  5DFX A;  4M4X A;  4MBK A;  4LGW A;  3CPT B;  3Q7Z A;  4RVA A;  5CHJ A;  5F69 A;  1G6O A;  2J3T D;  4UA7 A;  4QHC A;  3EEA A;  3OCN A;  2FFF B;  4P0M A;  3B33 A;  2W0N A;  3K3D A;  1FIL A;  3BQ8 A;  1CK3 A;  3CAX A;  1D7E A;  1JWZ A;  3ZG5 A;  4HHD A;  2W3F A;  2WKQ A;  3VOZ A;  1VB6 A;  3N7W A;  4IBR A;  2UWX A;  3NDE A;  3N6I A;  3VFF A;  5K5B A;  3KYQ A;  4ETX A;  2JC7 A;  3JYI A;  2MJ6 A;  3V5M A;  3EWK A;  2HF6 A;  1LT0 A;  4KZA A;  1BYW A;  1KOU A;  2L4R A;  2X71 A;  1MWT A;  5J7E A;  2ZQ9 A;  3S1Y A;  2C6W B;  3F1N A;  4QWO A;  1PNE A;  1IYQ A;  2WGV A;  4IUH A;  5EVE A;  1JTD A;  3DBA A;  3VP1 A;  2Y55 A;  4F94 A;  1ONH A;  4GHI B;  3AGF A;  3AGE A;  4PKY G;  1NYY A;  5AQ7 A;  3FV7 A;  4B9O A;  5G18 A;  3IHB A;  2HPB A;  4LCL A;  3G4P A;  5FI2 A;  3LYX A;  3BEC A;  4LEN A;  4Z9Q A;  4C75 A;  5KSC A;  1JTG A;  1XJ2 A;  1KE3 A;  2XGN A;  4NXF A;  4Q0H A;  4IBX A;  5G4Y A;  1FR6 A;  2IWB A;  2IWC A;  3ULF A;  3N8R A;  2L0W A;  3BFG A;  3IH8 A;  4JXV A;  3EOI A;  2UV0 E;  4IHQ A;  1ONG A;  1NZU A;  1PWD A;  4K08 A;  1PRQ A;  5E2H A;  5IU1 A;  3I7J A;  4L9E A;  3RJU A;  4Y7P A;  2CMN A;  3D72 A;  4I3J A;  4Y0O A;  3Q1F A;  4EET B;  3LGO A;  4CLC C;  3E98 A;  4ZAM A;  2XA7 M;  1BUL A;  4O8G A;  4MN6 A;  5EOO A;  3VV4 A;  3P7N A;  2V20 A;  3GVB A;  4IUK A;  3LY3 A;  3PHY A;  4K91 A;  4Q0J A;  4BJP A;  4MMN A;  5AQB A;  3A0R A;  5KZH A;  4FSF A;  1KGG A;  3NBL A;  3FWL A;  2M1C A;  1FR1 A;  2I72 A;  1JWV A;  4WYY A;  3BM6 A;  3QP1 A;  1RGY A;  4U0X A;  5CED A;  3QNB A;  3G2Z A;  3OPL A;  2KOI A;  1ODV A;  3IBR A;  1FSW A;  2PBD P;  1HLU P;  2PT7 A;  2Y2K A;  1C3B A;  2P08 A;  4NXE A;  3E2K A;  5FAT A;  4KZ5 A;  3NEC A;  4Y0U A;  4RYE A;  1G28 A;  2PRF A;  4I5S A;  4L9F A;  4O01 A;  2HJ9 C;  1OTA A;  4S2N C;  1FCM A;  3M2K A;  3T4Q A;  3ITA A;  3Q7V A;  1PFL A;  4S2P A;  3DTE A;  2JE5 A;  2H0Y A;  1K38 A;  3HCY A;  2WKH A;  1D1J A;  5CEB A;  2HJE A;  2E8J A;  1S66 L;  3GEC A;  2V9A A;  4OPR A;  5F82 A;  2XR0 A;  3D4F A;  3BQA A;  4R3B A;  1S4S A;  5FQQ A;  2WKP A;  2XFS A;  2ZC5 B;  4FUW A;  3ZGA B;  2BG1 A;  1ERQ A;  4KZ6 A;  2ZC4 B;  3B42 A;  1BUE A;  3RXX A;  2ZC6 B;  5DTK A;  1H0M A;  1XA7 A;  3W2Z A;  3UMD A;  3VP4 A;  4X56 A;  4KEN B;  3LIA A;  3S7Q A;  4GD6 A;  1H8Y A;  1E4D A;  2OWJ A;  3PBR A;  2I9V A;  4HJ3 A;  3CZD A;  2Y2O A;  4OQI A;  4LV0 A;  1K54 C;  5AJG A;  1K4E A;  4S2I A;  4EUZ A;  3PBS A;  3BEB A;  1NWZ A;  2K2N A;  3UE1 A;  2Q0O A;  3MQQ A;  3UB8 A;  3IWQ A;  3W4O A;  2Q9M A;  4OLG A;  4YWZ A;  2R9W A;  2VV8 A;  1CQA A;  1MKM A;  2ZQ7 A;  3RXW A;  1I2W A;  2R9X A;  2Z2M B;  1PIO A;  1Z09 A;  2QMI A;  3OBF A;  3IHA A;  3KSI A;  3LUQ A;  1LL9 A;  3NUL A;  3T1S A;  1XX2 A;  3HUM A;  3FPV A;  4GD8 A;  1H3Q A;  3NI9 A;  4PAU A;  1RP5 A;  3LO7 A;  1S4R A;  5GLC A;  1MWU A;  4HQA A;  3F1O A;  5CRF A;  5CTN A;  1NZO A;  2E8I A;  4I39 A;  5FQ9 A;  4YIN A;  2FZ0 A;  5FQK A;  5GLD A;  1FCN A;  3O88 A;  5EEC A;  1VEU B;  2G2U A;  3A0S A;  1SKO A;  2X02 A;  2QKP A;  1W7F A;  1G5U A;  1ZTU A;  1L0G A;  2OAQ 1;  4U3T A;  4R3J A;  3IQA A;  5CER A;  3VOL A;  5A92 A;  3LID A;  2G7U A;  4UQI M;  4GS9 B;  2PD8 A;  1WE4 A;  4JXW A;  3TRC A;  5HWW A;  1OT9 A;  1GHI A;  2Y2J A;  2J3W A;  5A91 A;  4CLC B;  4R23 A;  3S7P A;  5EFW A;  1K57 A;  2JKG A;  3IWI A;  1NRF A;  2ZC7 A;  2J9P A;  2ZOI A;  1XXM A;  4N9K A;  3B47 A;  5HAP A;  3H7W B;  5HDC A;  2EX8 A;  3T4K A;  1H8M A;  4PM6 A;  4GCZ A;  1CI9 A;  4GKU A;  3B3X A;  4ID4 A;  1WYB A;  5EOE A;  3UB9 A;  2PDR A;  4LRX C;  2EXA A;  3A3D A;  2HV1 A;  3LIB A;  2J8Y A;  5EV0 A;  5L09 A;  2ZM2 A;  1ES3 A;  2D02 A;  3KYE A;  4Y3I A;  3NIA A;  2KLI A;  2Y2N A;  4LRY C;  1U60 A;  1MY8 A;  3SH9 A;  2HDR A;  3ZCZ A;  3LR0 A;  3N4I A;  3T4L A;  3IF6 A;  3ZG8 B;  4GZB A;  2RL3 A;  5HAR A;  1FQG A;  1GCE A;  3PYP A;  3LCE A;  1YQS A;  2ACG A;  3NOU C;  3W4Q A;  3GV9 A;  4HP4 A;  4F3L B;  4PM5 A;  4DE3 A;  3M6B A;  3T50 A;  1Q2Q A;  3ZG7 B;  1MXO A;  4G3V A;  4LV1 A;  4KZB A;  2M7V A;  4BWI A;  3UPN A;  2HDU A;  1OTI A;  4KUK A;  1N9N A;  3VE3 A;  3PBQ A;  4WEJ A;  4PM7 A;  2QPN A;  5CGX A;  1V9Y A;  2HP5 A;  1XKZ A;  1YLY A;  3R7W B;  1G68 A;  3IWO A;  3G34 A;  3LEZ A;  1F98 A;  4JF4 A;  1DP6 A;  3H82 A;  3V3R A;  3LR5 A;  2XD5 A;  4EXO A;  2J7V A;  2B5R A;  5JYO A;  2JCH A;  5J8X A;  2PU4 A;  3OPR A;  4N1X A;  3R7W A;  5HWT A;  2P9V A;  5FA7 A;  1XFQ A;  5HAQ A;  3C7U A;  2ZQA A;  5C5K A;  1LSW A;  5FAO A;  5CHU A;  4KQD A;  3ZVT A;  3S7O A;  4DDY A;  4JGP A;  2IWD A;  4KQQ A;  3GQZ A;  2HDQ A;  1BLH A;  2EFU A;  1VET B;  2WYX A;  5EUA A;  1NLY A;  1ZG4 A;  1SDN A;  1AWI A;  4HNB A;  5E43 A;  3CJM A;  1QMF A;  4PKY A;  4I3A A;  4OOL A;  5GLA A;  5FI6 A;  2R78 A;  4DN0 A;  4GS9 A;  5FAQ A;  4R4R A;  1BZA A;  1LLB A;  2EXB A;  3C30 A;  1XJ4 A;  5GL9 A;  3SS3 A;  4JBF A;  3JVU A;  3A3F A;  2B95 A;  3BFD A;  4OVD A;  4ZRR A;  5TGF A;  5GHX A;  3LI8 A;  2VZW A;  3EGD C;  1S6R A;  4GB7 A;  3P98 A;  3Q07 A;  1VQQ A;  3LR4 A;  5J4E A;  3MSH A;  1YLW A;  3P09 A;  4Y2F A;  4AFI A;  4ZBE A;  4P6Z S;  4U0T A;  1NJ4 A;  1IFQ A;  5EM0 A;  2VGK A;  1J3W A;  3QP8 A;  4E3J A;  4NK3 A;  3KSF A;  4E3K A;  4HY8 A;  4XUX A;  4EBN A;  4OP8 A;  3OPH A;  4MN7 A;  4O7D A;  3CUE C;  3VE4 A;  4S2L A;  3FG8 A;  1W79 A;  3VFH A;  3M2J A;  3O3V A;  2Y2Q A;  4Z1W A;  3BW6 A;  1MKI A;  2EA9 A;  5FQM A;  1W63 M;  1E3U D;  4GJ4 A;  1ES5 A;  1HZO A;  3EGX C;  2V1B A;  4HJ6 A;  2XH9 A;  5EE8 A;  4ARZ A;  1ZHH B;  3ISG A;  1P0Z A;  3T1Q B;  3TW8 A;  5M19 A;  2Y2H A;  3ZYT A;  4EQI A;  3MKE A;  4E3I A;  2GJ3 A;  1O07 A;  2XLN A;  3KO6 A;  1KE4 A;  4FD8 A;  5KMW A;  3IH9 A;  4S2J A;  3Q82 A;  2PD7 A;  2Y2G A;  4H6J B;  4WMC A;  3V3S A;  1O7E A;  3T4J A;  3PBO A;  5F68 A;  3DTM A;  1J9M A;  1N4O A;  2X01 A;  3D3O A;  1OJG A;  1LSX A;  2WZZ A;  4JGR A;  3MFD A;  4JGO A;  3UB6 A;  4QPR A;  1HD8 A;  2OLV A;  4KG6 A;  4QD4 A;  4P6B A;  3EQU A;  3EEH A;  3WS1 A;  1PZP A;  3F1N B;  2RCX A;  3QP4 A;  4RX2 A;  4EWF A;  2V2F F;  4XT2 A;  3UME A;  5L10 A;  2O9A A;  1S1Z A;  2OAP 1;  1BLC A;  4O0P A;  2Q9N A;  3MR0 A;  4HEF A;  1KGF A;  1Z6F A;  1XPB A;  1HVB A;  2ZMV A;  1I5Q A;  1JWP A;  2K7S A;  1MWS A;  2NUT C;  5U47 A;  1T18 A;  3NJA A;  1DP8 A;  3UDI A;  4LLO B;  1CI8 A;  2Z6D A;  4BLM A;  4X69 A;  2FFY A;  2W1T B;  4UAA A;  3LIC A;  4G3K A;  4WBG A;  5CHM A;  4QJG A;  2XFT A;  5FQJ A;  3LIE A;  4DXB A;  3KSH A;  1M40 A;  3UNW A;  4DJ2 A;  1TS0 A;  2B02 A;  2IA2 A;  5F6A A;  3LY4 A;  2B18 A;  4BD1 A;  2Y91 A;  1L3L A;  5IT5 A;  2WGI A;  2QYB A;  1VM1 A;  2VV6 A;  3SW1 A;  4DF6 A;  4NEE D;  4LPZ A;  4X53 A;  3GMW A;  1L0F A;  3NCK A;  5DKK A;  3ZG0 A;  3OOV A;  1ALQ A;  1MPL A;  4NXB A;  4N1H A;  2GX5 A;  3L7H A;  3OPP A;  1JVJ A;  1FOF A;  4HH2 A;  2ZM0 A;  4Q8I A;  3QHY A;  2QJ7 A;  4BL2 A;  1MC0 A;  2P04 A;  3DWK A;  3HLD A;  2XRN A;  2J80 A;  3HLF A;  3ZQ5 A;  3FKW A;  3UE0 A;  2H10 A;  3V50 A;  1OJ5 A;  4HJ4 A;  3PBN A;  1N9B A;  4HI4 A;  4FH2 A;  4CPK A;  4K0W A;  2PR5 A;  1ZKJ A;  4BMW A;  3S4X A;  2WZX A;  4JPM A;  4MN5 A;  4Y17 A;  2OOL A;  4XUZ A;  3V39 A;  3Q7V B;  3MZD A;  2EWW A;  5I94 A;  2DCF A;  4R4S A;  1E3U A;  2VGL M;  4GDB A;  4MNR A;  1OME A;  1PYY A;  2OSU A;  1IYS A;  2Y2I A;  3PAE A;  4OQ0 A;  1SCW A;  1BLS A;  1G6A A;  5DJU A;  3O5Y A;  1YKD A;  1Y4O A;  2VKS A;  2H5S A;  5F1F A;  4KZ8 A;  4EV4 A; 
#chains in the Genus database with same CATH homology
 2W0N A;  1OTB A;  2W27 A;  3HJI A;  4EEU A;  3K3D A;  3BQ8 A;  4BWI A;  1OTI A;  2VGL S;  4KUK A;  4F3L A;  3CAX A;  3G6O A;  1D7E A;  1N9N A;  3VE3 A;  3E4P A;  1OTD A;  4HHD A;  3PBQ A;  2O0Y A;  4WEJ A;  2W3F A;  1P9R A;  3V67 A;  1NLZ A;  2WKQ A;  1VB6 A;  4E04 A;  4EUV A;  2FH5 A;  2V1A A;  1V9Y A;  3NHQ A;  2ZOH A;  3R7W B;  1VHM A;  3A0V A;  1GSX A;  4WEK A;  2VV7 A;  1TF1 A;  5K5B A;  3KYQ A;  3UE6 A;  1DP9 A;  4ETX A;  1F98 A;  2VX8 A;  1DP6 A;  3H82 A;  4FOF A;  3LR5 A;  3MF0 A;  4EXO A;  2MJ6 A;  2PYP A;  3PXP A;  3EWK A;  4MCW A;  3T4O A;  2V0W A;  2HF6 A;  1LT0 A;  3CIT A;  4EES A;  1UWP X;  1BYW A;  1KOU A;  5TJJ A;  3R7W A;  2L4R A;  2W1T A;  5HWT A;  2A2L A;  1DRM A;  5J7E A;  1XFQ A;  1T1C A;  4GLQ A;  5C5K A;  3F1N A;  3MQ0 A;  1LSW A;  4WEL A;  4IUH A;  4KQD A;  4OOM A;  4RQ9 A;  3DBA A;  4YOF A;  1TS7 A;  3S7O A;  3CWF A;  3LIF A;  4GHI B;  4JGP A;  4PKY G;  1LSV A;  1TS6 A;  2V0U A;  5HSQ A;  5MC7 A;  4B9O A;  4EQ1 A;  1NLY A;  3P01 A;  3LYX A;  4DJ3 A;  4HNB A;  1XJ2 A;  4NXF A;  4Q0H A;  3C38 A;  1XJ3 A;  4PKY A;  4I3A A;  5G4Y A;  4KUO A;  4OOL A;  4L9G A;  2R78 A;  3ULF A;  4DN0 A;  4GS9 A;  2KX6 A;  2L0W A;  3KX0 X;  5I5L A;  5J3W A;  2EWV A;  2PR6 A;  2Y79 A;  1UWN X;  1MZU A;  4UQI S;  1WA9 A;  3EOI A;  3NOP C;  3K2N A;  3C30 A;  3R4K A;  4P6Z M;  1XJ4 A;  4IHQ A;  4CLC E;  2P7J A;  1STZ A;  3JVU A;  4K08 A;  3RH8 B;  3T4T A;  3LI9 A;  2PHY A;  3CI6 A;  3MXQ A;  4ZRR A;  3S7N A;  2JKR I;  5CX7 A;  5IU1 A;  2XRO A;  1YSQ A;  2VZW A;  3EGD C;  2DMW A;  3LI8 A;  4L9E A;  5HPF A;  4R70 A;  3LR4 A;  5J4E A;  1T19 A;  2CMN A;  3D72 A;  4I3J A;  2YKF A;  5HDS A;  4R38 A;  5AVF A;  1Y28 A;  4EET B;  1S1Y A;  4CLC C;  4UEY A;  3E98 A;  4Y2F A;  4AFI A;  2XA7 M;  3EQV A;  4P6Z S;  2W3E A;  4O8G A;  1IFQ A;  2XSS A;  3OC2 A;  3H9W A;  4MN6 A;  3VV4 A;  3P7N A;  5F5Y A;  3KSF A;  4IUK A;  4ETZ A;  2GNX A;  3H82 B;  3PHY A;  4HY8 A;  4Q0J A;  4CLC A;  5DKL A;  5FL3 A;  5TBM B;  4BJP A;  4MMN A;  3A0R A;  4MN7 A;  4FSF A;  2VJW A;  3CUE C;  5HL6 A;  2M7U A;  3VE4 A;  2JKR M;  2M1C A;  3FG8 A;  3KSG A;  3RFB A;  5KIZ A;  4Z1W A;  2LB9 A;  2KOI A;  1ODV A;  3BW6 A;  4EEP A;  3IBR A;  2W1R A;  2PT7 A;  4HIA A;  2EA9 A;  1W63 M;  2P08 A;  3BY8 A;  4WN5 A;  2BAS A;  4NXE A;  2W3G A;  4Q0I A;  2JKT I;  3HJK A;  4GJ4 A;  4WL9 A;  4JGQ A;  1G28 A;  4I5S A;  3ICY A;  3EGX C;  3E4Q A;  2V1B A;  4L9F A;  5AVE A;  2Z6C A;  4HJ6 A;  3RTY A;  4WLA A;  2YKH A;  5A8B A;  4ARZ A;  1ZHH B;  4EW7 A;  2QJ5 A;  1P0Z A;  4O01 A;  2HJ9 C;  5G4Z A;  1OTA A;  3TW8 A;  2ZMF A;  3F1P A;  2VEA A;  3ZYT A;  4L0L A;  2GJ3 A;  2WKR A;  3T4Q A;  2JN7 A;  3KO6 A;  1LL8 A;  2PD7 A;  4H6J B;  3HCY A;  1P9W A;  3CLO A;  2HJE A;  1S66 L;  3GEC A;  2V9A A;  3PBT A;  5HWV A;  4R6L A;  3T4J A;  3F1P B;  3PBO A;  1JNU A;  3BQA A;  1S4S A;  5F68 A;  2WKP A;  3D3O A;  1OJG A;  1LSX A;  4XT2 B;  5HD5 A;  4JGR A;  4NXG A;  1F5M A;  3C8C A;  4JGO A;  1UGU A;  3MMH A;  3FPW A;  4BBU A;  2XA7 S;  3UB6 A;  2VLG A;  4IJG A;  3B42 A;  4QPR A;  4YNR A;  1OT6 A;  3EQU A;  5IS1 A;  2QWS A;  3BY9 A;  4BBT A;  3EEH A;  3W2Z A;  3UMD A;  1TS8 A;  3MJQ A;  3IS2 B;  3F1N B;  4NKP A;  4DMZ A;  3LIA A;  2K31 A;  3S7Q A;  2OWJ A;  3PBR A;  2I9V A;  4HJ3 A;  5KSH A;  4XT2 A;  3UME A;  3KYZ A;  3UE3 A;  2O9A A;  1S1Z A;  2OAP 1;  5AJG A;  4O0P A;  3PBS A;  1F9I A;  3MR0 A;  1YSP A;  1NWZ A;  2K2N A;  5HDD A;  2ZMV A;  1T1B A;  2K7S A;  3MQQ A;  4I3I A;  3UB8 A;  2D01 A;  4HOI A;  2QHK A;  3PR6 A;  3IS2 A;  3JVV A;  3LR3 A;  2NUT C;  4PHT A;  2W3D A;  1T18 A;  4YWZ A;  3NJA A;  5DJT A;  2VV8 A;  1DP8 A;  1MKM A;  3LFV A;  2VA0 A;  3NOT C;  4LLO B;  2Z6D A;  2ZBB A;  1NRJ A;  3OBF A;  1T1A A;  2A24 B;  3C2W A;  3KSI A;  2W1T B;  3LUQ A;  3LIC A;  4G3K A;  1OTE A;  3F1O B;  4GW9 A;  2Y8H A;  1GSV A;  1V9Z A;  4ME4 A;  3FPV A;  1H3Q A;  4PAU A;  4BBV A;  1P97 A;  3LIE A;  1S4R A;  3KSH A;  4HQA A;  4ARZ B;  3F1O A;  3MQO A;  4CQH A;  3FC7 A;  5HD3 A;  4DJ2 A;  3OLO A;  3CUE A;  4I39 A;  2FZ0 A;  1TS0 A;  1YAX A;  3OCL A;  2B02 A;  2IA2 A;  5F6A A;  3A0S A;  4MDZ A;  2B18 A;  2QKP A;  1ZTU A;  1N9O A;  3GDI A;  2OAQ 1;  3MFX A;  5IT5 A;  5DFY A;  2QYB A;  1D06 A;  1X0O A;  2GZA A;  3VOL A;  3E4O A;  2VV6 A;  3U2A A;  3LID A;  3BJN A;  3SW1 A;  4LRZ E;  1S67 L;  5LBR A;  2G7U A;  3E0Y A;  3TE8 A;  1W63 Q;  1IOU A;  4UQI M;  4GS9 B;  2PD8 A;  4II7 A;  4NEE D;  4GHI A;  4LPZ A;  3TRC A;  5HWW A;  1OT9 A;  3TJZ C;  2J3W A;  2HGV A;  4CLC B;  3S7P A;  5EFW A;  5HPI A;  1N9L A;  5DKK A;  3OOV A;  4CLC D;  3H7W A;  4NXB A;  5TBM A;  3UB7 A;  4KQO A;  2ZOI A;  2GX5 A;  3B47 A;  3H7W B;  4HH2 A;  5HDC A;  4G3W A;  3T4K A;  1H8M A;  2QJ7 A;  4WUJ A;  2O99 A;  4H6J A;  1MC0 A;  4GCZ A;  2P04 A;  4HP9 A;  3UB9 A;  2XRN A;  2PDR A;  4LRX C;  2J80 A;  3ZQ5 A;  4HH3 A;  2J3T C;  2L1M A;  2HV1 A;  3LIB A;  1OJ5 A;  2KDK A;  3IBJ A;  4HJ4 A;  2PYR A;  2D02 A;  1TD5 A;  3PBN A;  4HI4 A;  1EW0 A;  4Y3I A;  2A24 A;  4I38 A;  2W3H A;  4EER A;  2PR5 A;  4EU0 A;  4BMW A;  2NUP C;  2INW A;  4MN5 A;  2KLI A;  1OPX A;  1GSW A;  2OOL A;  2JHE A;  4LRY C;  4R3A A;  1XFN A;  1XJ6 A;  4Y5F A;  2EWW A;  4WF0 A;  3LR0 A;  2VGL M;  2JKT M;  3T4L A;  4B93 A;  3T4S A;  5DFX A;  4M4X A;  3PYP A;  3BWL A;  2O9B A;  3NOU C;  5F69 A;  1G6O A;  2J3T D;  4HP4 A;  4F3L B;  2OWH A;  5HZH A;  3T50 A;  3K3C A;  5DJU A;  3O5Y A;  5DF9 A;  3EEA A;  1YKD A;  3OCN A;  2LB5 A;  2O9C A;  4G3V A;  2VKS A;  2H28 A;  5L8M A;  3B33 A;  2M7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...