1P0ZA

Sensor kinase cita binding domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
131
structure length
131
Chain Sequence
EERLHYQVGQRALIQAMQISAMPELVEAVQKRDLARIKALIDPMRSFSDATYITVGDASGQRLYHVNPDEIGKSMEGGDSDEALINAKSYVSVRKGSLGSSLRGKSPIQDATGKVIGIVSVGYTIEQLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sensor kinase citA
publication title The structure of the periplasmic ligand-binding domain of the sensor kinase CitA reveals the first extracellular PAS domain.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 38
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2003-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1p0zA00
4RQ9A 1D06A 3HJKA 1G28A 1OJ5A 1OTAA 1TS8A 2VEAA 3F1PA 1EW0A 4I39A 2Z6DA 5IU1A 1UWPX 4L9FA 3BY8A 2QWSA 3UB6A 1MZUA 4R38A 3F1PB 3IS2A 4PKYG 2GJ3A 1LL8A 5HWVA 1TS0A 3H7WA 3MFXA 4K08A 3OLOA 3D72A 4B9OA 4H6JB 2J80A 2V9AA 1TS7A 2A24A 5DJUA 3UMDA 4EEUA 3C8CA 4EQ1A 2OWJA 3K3CA 3RH8B 3F1NA 4LRYC 4HY8A 2Z6CA 3ZQ5A 5J4EA 5HWTA 1N9LA 4LRZE 4EW7A 2VV6A 3C2WA 4I3AA 1NWZA 3F1NB 2L4RA 2PD7A 1WA9A 3FG8A 3UE6A 3K3DA 3LIFA 2PR5A 5A8BA 1P97A 4KUOA 3HJIA 3NHQA 3IBRA 5G4YA 3PYPA 2OWHA 4HP4A 1OJGA 3B33A 4EEPA 1V9ZA 3BWLA 4F3LA 1KOUA 3H82A 2K7SA 3A0VA 1S1ZA 2I9VA 3UB9A 1XJ6A 4F3LB 3BY9A 1T1BA 3MXQA 3H82B 3A0RA 2KDKA 4HOIA 3GDIA 4NXEA 3LI8A 2W0NA 4HQAA 4L9GA 3NOUC 1DP6A 4GS9A 3LIAA 1T18A 1UGUA 2YKFA 2R78A 1S66L 1OTDA 3LIBA 5HD5A 2HV1A 2QJ5A 4EESA 4NXFA 2BASA 1OT6A 4H6JA 4GS9B 4KQDA 1XJ3A 3ULFA 4MN6A 4PKYA 1T19A 4M4XA 5J3WA 4HJ4A 2PD8A 4HI4A 1N9NA 2PHYA 1N9OA 1OTBA 4LRXC 4BBTA 2VLGA 1X0OA 4KUKA 5F69A 5F5YA 1TS6A 1D7EA 3NJAA 1XFQA 5J7EA 4DJ3A 4WL9A 3UMEA 2WKRA 4HP9A 3LIDA 1V9YA 2QJ7A 2INWA 3CLOA 4HH2A 4R6LA 3PHYA 4WF0A 5HDCA 1ODVA 4I5SA 5HDDA 5F68A 2V0UA 5AVEA 2ZOIA 3EEHA 2PDRA 2B02A 3E4OA 3E4PA 4I38A 2JHEA 4LLOB 2H28A 4WLAA 4HJ6A 4GCZA 1DP8A 2JN7A 3T50A 2V1AA 2PYPA 2ZOHA 1LSWA 1DRMA 4GHIA 4MN5A 5HSQA 5F6AA 4I3IA 4EXOA 5EFWA 3EWKA 3NOPC 2VV8A 5IS1A 5DKLA 2PR6A 1S67L 4GHIB 4HJ3A 2W27A 3MQOA 1LSVA 1XFNA 5I5LA 3RTYA 3NOTC 3FC7A 4L9EA 1S4RA 3UB8A 3VOLA 5DKKA 3F1OB 2D01A 4WUJA 2ZBBA 4YWZA 1GSVA 1LT0A 2VV7A 5TBMB 3LYXA 2V0WA 2L0WA 2PYRA 3LI9A 3ICYA 1UWNX 4BBUA 5HWWA 4R70A 3GECA 1S1YA 2QKPA 3A0SA 4XT2A 1T1AA 4HNBA 4JGRA 4EERA 4JGOA 1VB6A 1BYWA 3LICA 4XT2B 3UB7A 4HH3A 3IS2B 2V1BA 3P7NA 1GSXA 4JGPA 3H7WB 1Y28A 2EA9A 2YKHA 5DJTA 2CMNA 4I3JA 2A24B 2KX6A 2WKQA 5AVFA 2OOLA 3MQQA 4E04A 1GSWA 3SW1A 1OTEA 5G4ZA 5HZHA 3VE4A 3E4QA 4EETB 5KIZA 1JNUA 1XJ4A 1XJ2A 3MR0A 5HDSA 3LIEA 2M1CA 1F98A 3LUQA 1P0ZA 4HIAA 1OT9A 2P7JA 2L1MA 4LPZA 4DJ2A 2D02A 3MJQA 1DP9A 3CWFA 1T1CA 2WKPA 3F1OA 1OTIA 3CAXA 4WN5A 5HD3A 3G6OA 1S4SA 2QHKA 1LSXA 3KX0X 3VE3A 4GW9A 3H9WA 5TBMA 4NXGA 4BBVA 4HHDA 4NXBA 1F9IA 4R3AA 4JGQA
chains in the Genus database with same CATH superfamily
3HLCA 4R4RA 3KSIA 1RGYA 4E3IA 1H5XA 1L0FA 3WS1A 1YQSA 4OPYA 3F1PA 4Y3IA 2GDNA 4HEFA 3EGXC 1ESUA 1OPXA 2ZJ9A 2JBFA 3BY8A 2HDQA 4U3TA 3UB6A 3IBJA 3IS2A 3IH9A 5TFQA 2GJ3A 2JKRM 5HWVA 1TS0A 3P98A 3C30A 3CPTB 3FZCA 3OLOA 4B9OA 4UEYA 1MKMA 3BM6A 4HESA 4UAAA 3ZG7B 1Q2QA 3GR2A 2G2UA 2A24A 4C6YA 3TG9A 3K3CA 3RH8B 4LRYC 4ETXA 4KZ6A 5FL3A 3ZQ5A 4P6BA 2ZMAA 3PAGA 3A3DA 2XFSA 2VZWA 4G3WA 2JKTI 1NWZA 3G31A 3BJNA 3WWXA 4G3VA 1H8ZA 1XP4A 3LEZA 1TDLA 4QU3A 3BQAA 1P97A 3WS4A 4R23A 4YOFA 2Y59A 4ZBEA 4E3MA 1HTZA 3OPPA 3UY6A 1S0WA 3VFHA 5L10A 3B33A 3LY4A 4QB8A 4BQMA 3HREA 4DN0A 4F3LA 5KMWA 2X01A 4GZBA 2J7VA 1GHMA 4Z9QA 4AFIA 4WZ4A 1MY8A 3H82A 2XSSA 2W3GA 5GHYA 1NRJA 4GD8A 4HBUA 3R4KA 4MBFA 4OQHA 4UHUA 4JKTA 3LR5A 5FEGA 3OCNA 5L8MA 1BTLA 5FQ9A 5HX9A 3W4QA 1STZA 4L9GA 3MQ0A 4FH4A 4GDBA 3N8LA 3CG5A 3IWOA 3T4KA 1K0KA 4FSFA 1OTDA 4S2LA 5A92A 4K0WA 4Y0OA 4FD8A 2WKHA 3RJUA 1H3QA 2JCHA 3O3VA 5F1FA 1FR6A 3CI6A 3ULFA 1PI4A 1T19A 3P09A 3UE0A 3HLEA 4M4XA 3IQAA 5KZHA 1SZVA 2VA0A 4LCMA 2LB9A 2WYXA 2PHYA 3D3OA 3MKEA 2UWXA 3VV4A 3HUMA 4LRXC 3OBFA 1BLHA 1WYBA 5FDHA 3C4OA 1D7EA 2P04A 4PM8A 2VX8A 2XRNA 1G6AA 2Y2OA 2HJ9C 3LIDA 4F94A 2XA7S 2PBYA 4DDYA 1H8MA 2QPNA 1ZG6A 1GCEA 4NETA 2H5SA 3KSFA 3NECA 3OPLA 4I5SA 5HDDA 3QHYA 3HL9A 2V0UA 1YLPA 2ZOIA 5FQMA 3WRZA 2JKGA 2C6WB 4E6WA 2PU2A 3E4PA 4GB7A 1TDGA 3OOVA 4Z1WA 2JHEA 2XA7M 4LLOB 1MWRA 2H28A 2V2FF 3FPVA 1PW1A 3MZEA 4GCZA 2I72A 3T50A 4BJPA 3GMWA 2A3UA 3HCYA 2ZC5B 1KE4A 3UPPA 4GHIA 3VP3A 4JBFA 1D1JA 4MN5A 1JWPA 2JKFA 4DE2A 1N9BA 1GHPA 1TD5A 5AQ9A 1GA0A 3DTKA 4BWIA 4OLGA 1SHVA 1S67L 3NY4A 5DVAA 4P0MA 1L3LA 2WKEA 2CC1A 2Q9NA 2OLVA 3RTYA 5A90A 5DKKA 2Z2MB 3OC2A 1PZPA 5CERA 4XXRA 1CK3A 1E3UD 5FAPA 5E43A 2QMIA 3A3IA 1ES2A 1BULA 2EWVA 2O0YA 4X25A 1NLZA 2VV7A 4OP5A 4O8GA 2VGKA 2V0WA 3N8SA 1FR1A 4IUHA 5CGSA 1UWNX 1K56D 5HWWA 4FCFA 3GECA 4CLCB 1S1YA 3T1QB 2WZZA 5J8XA 2Y8HA 2EXAA 4HNBA 4KZ3A 1BSGA 1ONHA 2R9XA 5HW3A 3C7VA 1Y4OA 3ZVTA 3KYEA 3FPWA 1TVFA 1KGGA 2WGIA 2Y2HA 3DTEA 1Q2PA 3U4LP 3R7WB 2OAQ1 4NG2A 3QNBA 3IWIA 3LO7A 4MCWA 1DJBA 1MKIA 1K6SA 4Q0IA 2WKQA 4R1GA 4UA6A 1GSWA 2O9BA 5JYOA 3SW1A 5FAOA 3WRTA 4RX2A 2HDUA 4MBHA 2E8JA 1ACFA 1W7FA 4CQHA 4S2NA 1JNUA 3IX3A 3MR0A 2JE5A 5HDSA 4UA9A 1W8QA 3LIEA 5HARA 4X56A 4ZTKA 4HIAA 2L1MA 3JVVA 3CITA 4DJ2A 3MS6A 1T1CA 1OTIA 2Y2LA 4WN5A 5HD3A 2ZC4B 3VE3A 2DNSA 5A93A 5LBRA 4CLCE 1VETB 4RYEA 5IT5A 1EROA 4HHDA 4NXBA 3HUOA 1H8YA 1G28A 4JGQA 2ZM0A 1LI9A 3FKWA 2BLSA 2A2LA 2Y79A 5GLAA 4CLCA 3ZNYA 5HPFA 1D06A 1HVBA 4DMZA 2O9CA 5FI2A 1TF1A 1OTAA 2PBDP 5A91A 4DXCA 3E98A 1EW0A 3O86A 4CJNA 1YSPA 4IVKA 5IU1A 3DTMA 4L9FA 2ZM2A 1FSWA 4XUXA 3F1PB 2BTFP 4Q8IA 4IBXA 3LR0A 2ZC7A 3AGFA 3DAVA 3MFXA 3S7PA 2Y2IA 4KZBA 5FASA 2WGWB 3BYDA 3QP1A 3VOYA 3R7WA 2J80A 5E2HA 3G34A 3A3FA 2V9AA 4N9KA 3LR4A 1TS7A 5DJUA 2HZ5A 4PPRA 2ZQAA 4S2NC 4WYYA 2Z6CA 3PAEA 4GOGA 1NY0A 5J4EA 4ZAMA 4EBNA 3PBSA 1JVJA 3C2WA 2L4RA 2PD7A 4N9LA 2DCFA 3ZG0A 2Y2JA 3W8KA 4KZAA 3NDEA 3UE6A 3MXSA 4QD4A 3V50A 4X55A 4R0QA 4E3KA 4EUZA 5M1AA 5FATA 5DF7A 1G68A 3NHQA 2O9AA 4E3LA 3MXRA 2G7UA 1N4OA 3SH7A 1MWSA 1VQQA 4YNRA 4GDNA 4RA7A 3O87A 1YMSA 4CLCC 5HPIA 1VM1A 1S1ZA 4N1XA 4B4ZA 4WZ5A 3G4PA 3ZCZA 3UB9A 4ZJ2A 3CUEC 1S6RA 4F3LB 1CQAA 1T1BA 3E0YA 3MKFA 5CX7A 2GZAA 1Y54A 3QP4A 3H82B 3T4LA 3A0RA 4A5RA 3EGDC 1XGIA 2M7UA 1L0DA 5C5KA 3TRCA 1FCMA 2OLUA 2K2NA 3RFBA 2H0YA 1VHMA 1ERMA 3B47A 2Q9MA 3NOUC 1UGUA 2YKFA 1YLWA 4ID4A 1ZHHB 1S66L 2ZC6B 3SZTA 4FOFA 5HD5A 3HVFA 3V39A 4IBRA 4JLFA 2BASA 3IHBA 2WGWA 4S2JA 5TR7A 4KQDA 2J9PA 2P08A 4MN6A 3TJZC 4BLMA 3T4SA 2H0TA 4OQIA 3KO6A 2XF3A 4HJ4A 3B3XA 1NZUA 2J9OA 1N9OA 3Q7VB 1XA1A 2FH5A 2VLGA 4JF4A 4JF5A 1SKOA 1X0OA 4KUKA 2XDMA 2Y4AA 3QP8A 1K57A 2EX8A 3W4OA 4WBGA 1KDWA 5AJGA 3UMEA 2QJ7A 1IOUA 2INWA 4ARZB 4R6LA 4EUVA 4ZDXA 1F2KA 2WGVA 3K2NA 5GL9A 4B93A 1IYSA 5F68A 1YAXA 4S2MA 2FZ0A 2J3TD 3DWZA 5AVEA 1RGZA 3EEHA 3TOIA 4WZ5C 4EQIA 1FILA 2PDRA 5CTMA 4H8RA 3IXGA 4LFUA 3ZVWA 3T1XA 1XKZA 2JC7A 3M2JA 2V20A 2B95A 3EQUA 4QWOA 3PBOA 2HJEA 1LHYA 3VP4A 5CHJA 2V1AA 3PXPA 5HSQA 1Z09A 4E6XA 5EFWA 4BMWA 5IS1A 3E2LA 4GHIB 3V3RA 4HJ3A 3IX4A 1XFNA 3ZGAB 3S7OA 3NDGA 3NOTC 3FC7A 1DJCA 3UE3A 1S4RA 2PRFA 3VOLA 1IKIA 5HL1A 5FI6A 4EU0A 3F1OB 2EWWA 2UV0E 2D01A 2W3FA 1IYOA 4KG6A 3Q82A 3E2KA 1RP5A 1Z6FA 2EX9A 4KZ8A 1DY6A 2IWCA 5DTTA 1K57C 3P01A 3FWLA 2X02A 3PBQA 5TBMB 4OOLA 3Q7VA 1IEMA 2KLIA 1KVMA 4D2OA 3IXDA 2E8IA 1PRQA 3UNWA 4X6TA 2QKPA 2EX2A 4R3JA 4XT2A 4JGRA 2OSUA 4WELA 4EERA 2VGLS 4ARZA 4R3BA 1F5MA 3LICA 2ZLYA 4QY5A 2HP9A 3LR3A 4NKPA 4WM9A 4HH3A 1PNEA 2V1BA 3P7NA 2P74A 5CGWA 1GSXA 1NRFA 4S2KA 5DFXA 5JYPA 3DWKA 5FI7A 4Y15A 2WADA 1E25A 2VK3A 5DJTA 2VGLM 4DRTA 2ZQDA 5EVEA 1TEMA 2PU4A 4JXWA 2KX6A 5AVFA 3MQQA 4CPKA 1OTEA 3E4QA 1ZC2A 2W3HA 3V3SA 3UDIA 5L2FA 5EVID 2NUTC 1MC0A 3C4PA 1XJ2A 2V8FA 3B42A 1CF0A 3G2ZA 4KG2A 1G6OA 2M1CA 1F98A 3LUQA 1P0ZA 2B5RA 5M18A 2A49A 3ZDJA 1J9MA 3QNCA 1ERQA 3T1SA 1NXYA 2D02A 2Y2GA 2XD1A 1DP9A 3F1OA 3ZFZA 3CAXA 1BLSA 1W8YA 4OKPA 3S1YA 3G6OA 1S4SA 1XPBA 4Y13A 3NCKA 1LSXA 5FQQA 3KX0X 2GNXA 3JVUA 2VJWA 4LV1A 2JKTM 5TBMA 5CHMA 1YKDA 4QY6A 4Y7PA 3D4FA 1IYPA 1PWCA 3AGDA 1E3UA 3HJKA 5AQAA 1OJ5A 2HDRA 2VEAA 3GQZA 4I39A 4X69A 3LGOA 2Z6DA 5CHUA 5KSCA 5L09A 1W63Q 1KE3A 2ZC3B 3M2KA 4R38A 4E3NA 4PKYG 1K56A 1LL8A 4QPRA 4MDZA 3ITBA 4K08A 3T12B 1RCJA 4LV2A 2J8YA 2ZQ7A 1I2SA 3DBAA 4H6JB 2XFTA 2M7VA 1IYQA 1NYYA 1FCOA 3SS5A 4FUWA 1EI5A 2QYBA 4EEUA 2X71A 3S22A 3F1NA 2VGJA 1K4EA 4KZ9A 1MWUA 4BL2A 5EVIC 1ALQA 4LRZE 3N6IA 2VV6A 4I3AA 2XLNA 3W2ZA 5CEBA 1WA9A 4KENB 5E2EA 5G18A 2V1ZA 1K6RA 2Y2QA 3K3DA 3LIFA 2PR5A 5A8BA 5U47A 2O99A 3CHWP 2Z2LB 4KUOA 2Y2NA 2PT7A 5G4YA 5AQ7A 1CEFA 1K55A 3U2AA 2DMWA 4R4SA 3C38A 3BLSA 3Q07A 5E2GA 2GX5A 4YINA 4OOMA 4WMCD 4IUKA 3D9YA 1SCWA 1JTDA 1KOUA 2JKRI 4ZJ3A 4PM6A 2RCXA 3A0VA 1YM1A 4EV4A 3ISGA 3ITAA 5E2FA 2K31A 2KDKA 4KQRA 3GDIA 1NLYA 4FTXA 4L0LA 5CXWA 3LI8A 1NYMA 1EWZA 3IWQA 2W0NA 2ZM8A 5HAPA 1M6KA 5TJJA 3PBNA 4GS9A 4XUZA 4JXVA 3CUEA 1CJFA 4MEZA 4X53A 3I7JA 4S2PA 2WK0A 2HV1A 3HUNA 1YLTA 3PBRA 1JWVA 4NXFA 4GN2A 1OT6A 4H6JA 3BW6A 4Y5FA 5DF8A 5J3WA 4II7A 2PD8A 1N9NA 5GLBA 1DJAA 5F1GA 4KG5A 2OV5A 3BECA 5D3OA 3G35A 5J7EA 2B18A 4WL9A 1SKOB 2WKRA 3KYZA 1L0EA 3BFGA 4UQIM 1K55C 3BEBA 4OOYA 3CLOA 1L0GA 1BUEA 5I94A 3PHYA 1JTGA 2Y2KA 1ODVA 3TE8A 4BENA 3NBLA 3VOZA 1K38A 3BFCA 1LL9A 3E4OA 3LY3A 3BFEA 1LL5A 2WUQA 4Y0TA 2WKIA 3IH8A 5EM0A 1XXMA 1G5UA 4HJ6A 4OONA 2IA2A 3GVBA 2PYPA 2V8CA 1W63M 2ZOHA 3UN7A 1CEGA 1DRMA 1VEUB 3RXWA 4LV0A 3IXHA 1MPLA 4RX3A 3NOPC 3SOIA 5GLDA 4MMNA 4DE1A 2P9VB 2W27A 1PWGA 3MQOA 1NZOA 4DE0A 2HPBA 2Y2PA 5I5LA 4C3QA 3MBZA 1YT4A 3M6BA 4OQ0A 3G2YA 4N1HA 3UB5P 3UB8A 1I5QA 1KVLA 2W1TA 4WUJA 4G3KA 3IF6A 3ZG8B 4YWZA 1GSVA 3IF5A 1P9RA 1LT0A 5FQJA 4Y0UA 1ES4A 2PYRA 3LI9A 4DE3A 1SDNA 3HLGA 4DDSA 3KYQA 3VMAA 4KQOA 3OCLA 1M40A 1O7EA 3A0SA 2Y2MA 3CMZA 4S2OA 1QMEA 4DKIA 3NIAA 2IWBA 1VB6A 1BYWA 2Y91A 4XT2B 5BOHA 3Q81A 5GHXA 3Q1FA 5DTSA 2EFXA 4JGPA 4GNUA 3MZDA 4OP8A 3H7WB 2AVXA 1LI0A 5HAQA 4JF6A 2YKHA 3T4JA 1IELA 2Q0OA 4GJ4A 4MNRA 4I3JA 4BD0A 3UDXA 3PTEA 3A3EA 5G4ZA 3UE1A 4BL3A 3KSHA 4EETB 5GLCA 3EOIA 5KIZA 1C3BA 4OLDA 3MMHA 5EUAA 4HBTA 1VEUA 3OZHA 4PM9A 3QP5A 1XJ4A 1NJ4A 1KE0A 3HBRA 2XK1A 3S7NA 2P9VA 4OVDA 5CEDA 5HAIA 3IF6C 4LPZA 5DF9A 5EVLA 3UPNA 3BLMA 5FDSA 3MJQA 5EVIB 2J3WA 2RL3A 1YSQA 1AWIA 3C7UA 1BLPA 5IHVA 1FSYA 5K5BA 2WAEA 4NXGA 4BBVA 1PYYA 2MJ6A 4RQ9A 3QP6A 3VP1A 4QJGA 3TSGA 2W1RA 5CRFA 1TS8A 5F83A 5L07A 2XEPA 1YLZA 3VFFA 3V67A 3CPTA 5CTNA 1UWPX 4Y2FA 2QWSA 1MBLA 1MZUA 3UDFA 2DRWA 1CI8A 3VP0A 2H10A 2W3DA 1ZG4A 3H7WA 3EQVA 1K25A 3D72A 4RVAA 3ZG9B 1YLYA 4DXBA 3N8RA 1O07A 2J3TC 3VP2A 1SKFA 3UMDA 1WYCA 3FKVA 3C8CA 3UO9A 4EQ1A 2ZL1B 2OWJA 2ZMVA 4JXGA 1I2WA 1ES3A 4HY8A 3T4TA 4Q0JA 5HWTA 1N9LA 4EW7A 3F1NB 2HGVA 5TGFA 4N92A 3FG8A 1KGFA 3MFDA 3GTCA 5EV0A 2G2WA 2XH9A 1IKGA 4K91A 1W5DA 2ACGA 3JPUA 3SS3A 4LCLA 1FOFA 3HJIA 1YPRA 5EOEA 3IBRA 4EBLA 1XX2A 5EVIA 4U0TA 5EOOA 3PYPA 2OWHA 4HP4A 1OJGA 4KZ4A 4EEPA 3OPRA 4QHCA 1V9ZA 4JPMA 3BWLA 2OAP1 2FFYA 4P6ZS 3CZDA 4B4XA 4KQQA 1KGEA 3WS2A 2K7SA 2XROA 3NI9A 1HLUP 2I9VA 4ZJ1A 1A0KA 3SH9A 1XJ6A 3BY9A 4OPRA 3GV9A 3MXQA 5MC7A 4MBKA 4HOIA 1HD8A 4WEJA 3PR6A 4M3KA 3RXXA 4NXEA 3M6HA 4P6ZM 3VSKA 4E3JA 4MLLA 1L2SA 2PAVP 4HQAA 1ONGA 4PMAA 4IJGA 4ME4A 3BRMA 3L7HA 1DP6A 4LV3A 5FQKA 3LIAA 1CI9A 1T18A 5CECA 2R78A 2NUPC 3ZG5A 2ZQCA 4NK3A 3LIBA 5AQBA 4GKUA 2C5WB 2QJ5A 4EESA 3PBTA 4GS9B 1XJ3A 3MZFA 3O88A 2WAFA 4PKYA 3S4XA 2ZL1A 1XGJA 3T1RA 1PZOA 1K4FA 4HI4A 1OTBA 3V5MA 4BBTA 5DTKA 2ZD8A 1WE4A 1GHIA 5FAQA 5F69A 5F5YA 3AGEA 3S7QA 1TS6A 3NJAA 1XFQA 2ZQ9A 4DJ3A 5EM1A 5M19A 3BFFA 2Y55A 4HP9A 4O01A 2IWDA 1V9YA 4LGWA 4HH2A 3SS4A 4ESPA 1ESIA 3Q7ZA 4LENA 1ZKJA 1K54A 5EE8A 4UA7A 2HDSA 2EXBA 1P9WA 1E4DA 4JXSA 4WF0A 5HDCA 3DW0A 1J3WA 4O7DA 1ZTUA 4PM5A 4PM7A 2W3EA 4E3OA 3SH8A 3GRJA 4IEDA 2B02A 4I38A 3HLBA 1MXOA 3MF0A 3CJMA 3QP2A 4EBPA 4WLAA 2XGNA 2BG1A 1PWDA 1U60A 3MSHA 5DFYA 1DP8A 2JN7A 2XR0A 3DTIA 4C75A 3L9KA 3O5YA 1JWZA 4OH0A 3LEQA 1LSWA 3OPHA 4WMCA 4Y17A 5F6AA 4I3IA 1FIKA 2XQZA 4EXOA 1OMEA 3EWKA 1HZOA 1QMFA 2VV8A 3NULA 4O0PA 5DKLA 2PR6A 1IFQA 3NC8A 4OPQA 1LSVA 3ZHHA 5HFOA 1LLBA 3LFVA 3C5AA 2KOIA 4L9EA 2WZXA 3G30A 1PW8A 4BD1A 1FQGA 4P87A 1ES5A 4CLCD 4ETZA 3HLFA 4PAUA 3IXBA 2FFFB 5EECA 1BLCA 5HL6A 4X1LA 2ZBBA 1YMXA 1FCNA 4OQGA 3HLDA 3IHAA 3IT9A 3G32A 4K0XA 2W1TB 3LYXA 2L0WA 4D60A 4GD6A 4B88A 3ICYA 3IF6B 4BBUA 4UQIS 5KSHA 2ZQ8A 4IVIA 4R70A 1H0MA 1W79A 1K54C 4S2IA 3N7WA 1T1AA 5FQIA 3A3JA 4IHQA 1BT5A 1SDEA 5EPHA 3ZYTA 4JGOA 2QZ6A 1KDSA 2EX6A 3FV7A 1YLJA 2EFUA 1PIOA 2VKSA 4MN7A 3UB7A 3BQ8A 4KZ7A 3IS2B 5FA7A 4Q0HA 3UPOA 1AXBA 2HP6A 1GA9A 1PI5A 3LCEA 3GSGA 4WEKA 1Y28A 2EA9A 3FYZA 3EEAA 3W4PA 2CMNA 2ZMFA 3JYIA 3IX8A 4PHTA 3ZNTA 2A24B 1BZAA 5GHZA 4EWFA 2OOLA 4E04A 2R9WA 4KZ5A 4X68A 5F82A 5HZHA 3VE4A 3T4OA 3WS5A 4NEED 3T4QA 5FSRA 4OPZA 3N4IA 3TW8A 3WS0A 3KSGA 4U0XA 1PFLA 5FEFA 4X1MA 4DF6A 4FH2A 1OT9A 2P7JA 4YFMA 2XD5A 4ZRRA 4GLQA 3BFDA 3CWFA 2WKPA 5CGXA 1VETA 2LB5A 1XA7A 2QHKA 1MWTA 4P85A 4GW9A 3H9WA 2HF6A 1F9IA 3VSLA 3HLWA 4R3AA 2HP5A
chains in the Genus database with same CATH topology
3KSIA 4RQ9A 2A2LA 2Y79A 4CLCA 5HPFA 1D06A 4DMZA 3HJKA 2O9CA 4JGQA 1TF1A 1OJ5A 1OTAA 2W1RA 1TS8A 2VEAA 3F1PA 3E98A 4Y3IA 1EW0A 4I39A 3EGXC 1YSPA 2Z6DA 1OPXA 5IU1A 3V67A 1UWPX 4L9FA 3BY8A 4Y2FA 2QWSA 1W63Q 3UB6A 1MZUA 4R38A 3IBJA 3F1PB 3IS2A 4PKYG 2GJ3A 1LL8A 2JKRM 5HWVA 1TS0A 3LR0A 2W3DA 3C30A 4QPRA 3H7WA 3EQVA 4MDZA 3MFXA 4K08A 3S7PA 3OLOA 3D72A 4B9OA 3DBAA 4H6JB 4UEYA 3R7WA 1MKMA 2M7VA 2J80A 2J3TC 2V9AA 3LR4A 1TS7A 2A24A 5DJUA 3UMDA 2QYBA 4EEUA 3C8CA 4EQ1A 2OWJA 2ZMVA 3K3CA 3F1NA 4LRYC 3RH8B 4HY8A 4ETXA 2Z6CA 5FL3A 3ZQ5A 3T4TA 4Q0JA 5J4EA 5HWTA 1N9LA 4LRZE 3PBSA 4EW7A 2VV6A 2VZWA 3C2WA 4I3AA 4G3WA 2JKTI 1NWZA 3F1NB 3W2ZA 2L4RA 2PD7A 2HGVA 1WA9A 3BJNA 3FG8A 4G3VA 3UE6A 3K3DA 3LIFA 2PR5A 5A8BA 2O99A 3BQAA 1P97A 4KUOA 4YOFA 3HJIA 2PT7A 3NHQA 3IBRA 5G4YA 2O9AA 3U2AA 2DMWA 3PYPA 2OWHA 4HP4A 1OJGA 3C38A 2G7UA 3B33A 4EEPA 2GX5A 1V9ZA 4YNRA 3BWLA 4OOMA 4IUKA 2OAP1 4DN0A 4F3LA 4P6ZS 4CLCC 1KOUA 2JKRI 4AFIA 5HPIA 3H82A 2K7SA 2XSSA 1S1ZA 3A0VA 2W3GA 2XROA 1NRJA 2I9VA 3UB9A 3CUEC 1XJ6A 4F3LB 3BY9A 1T1BA 3E0YA 5CX7A 3R4KA 2GZAA 3MXQA 2K31A 3H82B 3T4LA 3A0RA 3LR5A 2KDKA 4HOIA 5MC7A 3EGDC 1NLYA 3GDIA 2M7UA 4L0LA 4WEJA 5C5KA 3PR6A 3OCNA 5L8MA 3TRCA 4NXEA 2K2NA 4P6ZM 3RFBA 3LI8A 2W0NA 1VHMA 3B47A 4HQAA 1STZA 4L9GA 3MQ0A 4IJGA 4ME4A 5TJJA 3NOUC 1DP6A 3PBNA 4GS9A 3LIAA 1T18A 3T4KA 1UGUA 2YKFA 2R78A 3CUEA 2NUPC 1ZHHB 1S66L 4FSFA 1OTDA 3LIBA 4FOFA 5HD5A 2HV1A 1H3QA 2QJ5A 3PBRA 4EESA 3PBTA 4NXFA 1OT6A 2BASA 4H6JA 4GS9B 3BW6A 4KQDA 4Y5FA 1XJ3A 2P08A 3CI6A 3ULFA 4MN6A 4PKYA 1T19A 3TJZC 4M4XA 3T4SA 3KO6A 5J3WA 4HJ4A 2VA0A 4II7A 2LB9A 2PD8A 4HI4A 1N9NA 3D3OA 2PHYA 1N9OA 1OTBA 3VV4A 4LRXC 2FH5A 4BBTA 2VLGA 3OBFA 1X0OA 4KUKA 5F69A 5F5YA 3S7QA 1TS6A 1D7EA 3NJAA 1XFQA 2P04A 2B18A 5J7EA 2VX8A 5AJGA 4DJ3A 2XRNA 4WL9A 3UMEA 2HJ9C 2WKRA 3KYZA 4HP9A 4O01A 4UQIM 3LIDA 1V9YA 2QJ7A 1IOUA 2INWA 4ARZB 3CLOA 4HH2A 2XA7S 4R6LA 1H8MA 4EUVA 1P9WA 3PHYA 4WF0A 5HDCA 3KSFA 1ODVA 4I5SA 5HDDA 3K2NA 3TE8A 4B93A 1ZTUA 1YAXA 5F68A 2FZ0A 2J3TD 2V0UA 2W3EA 5AVEA 2ZOIA 3EEHA 2PDRA 2B02A 3E4OA 3E4PA 4I38A 3OOVA 4Z1WA 2JHEA 2XA7M 4LLOB 2H28A 3MF0A 4WLAA 3FPVA 4HJ6A 3EQUA 3PBOA 4GCZA 5DFYA 1DP8A 2IA2A 2JN7A 2HJEA 3T50A 4BJPA 3HCYA 2V1AA 2PYPA 3O5YA 1W63M 2ZOHA 3PXPA 1LSWA 1DRMA 4GHIA 4MN5A 5HSQA 1TD5A 5F6AA 4I3IA 4EXOA 5EFWA 4BWIA 4BMWA 3EWKA 3NOPC 2VV8A 5IS1A 4O0PA 5DKLA 2PR6A 4MMNA 1S67L 1IFQA 4GHIB 4HJ3A 2W27A 3MQOA 1LSVA 1XFNA 3LFVA 5I5LA 3S7OA 3RTYA 3NOTC 3FC7A 2KOIA 4L9EA 3UE3A 1S4RA 3UB8A 3VOLA 5DKKA 4EU0A 3F1OB 2EWWA 3OC2A 4CLCD 4ETZA 2D01A 2W3FA 4PAUA 2W1TA 4WUJA 4G3KA 2EWVA 5HL6A 2ZBBA 4YWZA 1GSVA 1P9RA 2O0YA 1LT0A 1NLZA 3P01A 2VV7A 4O8GA 3PBQA 5TBMB 4OOLA 2W1TB 3LYXA 2V0WA 2L0WA 2PYRA 3LI9A 4IUHA 3ICYA 2KLIA 1UWNX 4BBUA 4UQIS 5KSHA 5HWWA 4R70A 3KYQA 3GECA 4CLCB 4KQOA 1S1YA 2QKPA 3OCLA 3A0SA 2Y8HA 4XT2A 1T1AA 4HNBA 4IHQA 4JGRA 4WELA 4EERA 2VGLS 3ZYTA 4ARZA 4JGOA 1VB6A 1BYWA 1F5MA 3LICA 2VKSA 4XT2B 3LR3A 4MN7A 4NKPA 3UB7A 3BQ8A 4HH3A 3IS2B 4Q0HA 2V1BA 3P7NA 1GSXA 4JGPA 5DFXA 3FPWA 3H7WB 4WEKA 1Y28A 2EA9A 3R7WB 2YKHA 5DJTA 3EEAA 2OAQ1 2CMNA 2ZMFA 3T4JA 2VGLM 4MCWA 4GJ4A 4PHTA 4I3JA 4Q0IA 2A24B 2KX6A 2WKQA 5AVFA 2OOLA 3MQQA 4E04A 1GSWA 2O9BA 3SW1A 1OTEA 5G4ZA 5HZHA 3VE4A 3E4QA 3KSHA 3T4OA 4NEED 2W3HA 4EETB 3EOIA 3T4QA 5KIZA 3MMHA 3TW8A 2NUTC 3KSGA 4CQHA 1MC0A 1JNUA 1XJ4A 1XJ2A 3B42A 3MR0A 5HDSA 1G6OA 3LIEA 2M1CA 1F98A 3LUQA 3S7NA 1P0ZA 4HIAA 1OT9A 2P7JA 2L1MA 4ZRRA 3JVVA 3CITA 4LPZA 5DF9A 4DJ2A 4GLQA 2D02A 3MJQA 1DP9A 3CWFA 1T1CA 2WKPA 3F1OA 1OTIA 2J3WA 3CAXA 1YSQA 4WN5A 2LB5A 5HD3A 3G6OA 1S4SA 2QHKA 1LSXA 3KX0X 3VE3A 2GNXA 3JVUA 4GW9A 3H9WA 2VJWA 5LBRA 4CLCE 2JKTM 5K5BA 5TBMA 5IT5A 2HF6A 1YKDA 4NXGA 4HHDA 4NXBA 4BBVA 1F9IA 4R3AA 1G28A 2MJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RQ9 A;  1D06 A;  3HJK A;  1G28 A;  1OJ5 A;  1OTA A;  1TS8 A;  2VEA A;  3F1P A;  1EW0 A;  4I39 A;  2Z6D A;  5IU1 A;  1UWP X;  4L9F A;  3BY8 A;  2QWS A;  3UB6 A;  1MZU A;  4R38 A;  3F1P B;  3IS2 A;  4PKY G;  2GJ3 A;  1LL8 A;  5HWV A;  1TS0 A;  3H7W A;  3MFX A;  4K08 A;  3OLO A;  3D72 A;  4B9O A;  4H6J B;  2J80 A;  2V9A A;  1TS7 A;  2A24 A;  5DJU A;  3UMD A;  4EEU A;  3C8C A;  4EQ1 A;  2OWJ A;  3K3C A;  3RH8 B;  3F1N A;  4LRY C;  4HY8 A;  2Z6C A;  3ZQ5 A;  5J4E A;  5HWT A;  1N9L A;  4LRZ E;  4EW7 A;  2VV6 A;  3C2W A;  4I3A A;  1NWZ A;  3F1N B;  2L4R A;  2PD7 A;  1WA9 A;  3FG8 A;  3UE6 A;  3K3D A;  3LIF A;  2PR5 A;  5A8B A;  1P97 A;  4KUO A;  3HJI A;  3NHQ A;  3IBR A;  5G4Y A;  3PYP A;  2OWH A;  4HP4 A;  1OJG A;  3B33 A;  4EEP A;  1V9Z A;  3BWL A;  4F3L A;  1KOU A;  3H82 A;  2K7S A;  3A0V A;  1S1Z A;  2I9V A;  3UB9 A;  1XJ6 A;  4F3L B;  3BY9 A;  1T1B A;  3MXQ A;  3H82 B;  3A0R A;  2KDK A;  4HOI A;  3GDI A;  4NXE A;  3LI8 A;  2W0N A;  4HQA A;  4L9G A;  3NOU C;  1DP6 A;  4GS9 A;  3LIA A;  1T18 A;  1UGU A;  2YKF A;  2R78 A;  1S66 L;  1OTD A;  3LIB A;  5HD5 A;  2HV1 A;  2QJ5 A;  4EES A;  4NXF A;  2BAS A;  1OT6 A;  4H6J A;  4GS9 B;  4KQD A;  1XJ3 A;  3ULF A;  4MN6 A;  4PKY A;  1T19 A;  4M4X A;  5J3W A;  4HJ4 A;  2PD8 A;  4HI4 A;  1N9N A;  2PHY A;  1N9O A;  1OTB A;  4LRX C;  4BBT A;  2VLG A;  1X0O A;  4KUK A;  5F69 A;  5F5Y A;  1TS6 A;  1D7E A;  3NJA A;  1XFQ A;  5J7E A;  4DJ3 A;  4WL9 A;  3UME A;  2WKR A;  4HP9 A;  3LID A;  1V9Y A;  2QJ7 A;  2INW A;  3CLO A;  4HH2 A;  4R6L A;  3PHY A;  4WF0 A;  5HDC A;  1ODV A;  4I5S A;  5HDD A;  5F68 A;  2V0U A;  5AVE A;  2ZOI A;  3EEH A;  2PDR A;  2B02 A;  3E4O A;  3E4P A;  4I38 A;  2JHE A;  4LLO B;  2H28 A;  4WLA A;  4HJ6 A;  4GCZ A;  1DP8 A;  2JN7 A;  3T50 A;  2V1A A;  2PYP A;  2ZOH A;  1LSW A;  1DRM A;  4GHI A;  4MN5 A;  5HSQ A;  5F6A A;  4I3I A;  4EXO A;  5EFW A;  3EWK A;  3NOP C;  2VV8 A;  5IS1 A;  5DKL A;  2PR6 A;  1S67 L;  4GHI B;  4HJ3 A;  2W27 A;  3MQO A;  1LSV A;  1XFN A;  5I5L A;  3RTY A;  3NOT C;  3FC7 A;  4L9E A;  1S4R A;  3UB8 A;  3VOL A;  5DKK A;  3F1O B;  2D01 A;  4WUJ A;  2ZBB A;  4YWZ A;  1GSV A;  1LT0 A;  2VV7 A;  5TBM B;  3LYX A;  2V0W A;  2L0W A;  2PYR A;  3LI9 A;  3ICY A;  1UWN X;  4BBU A;  5HWW A;  4R70 A;  3GEC A;  1S1Y A;  2QKP A;  3A0S A;  4XT2 A;  1T1A A;  4HNB A;  4JGR A;  4EER A;  4JGO A;  1VB6 A;  1BYW A;  3LIC A;  4XT2 B;  3UB7 A;  4HH3 A;  3IS2 B;  2V1B A;  3P7N A;  1GSX A;  4JGP A;  3H7W B;  1Y28 A;  2EA9 A;  2YKH A;  5DJT A;  2CMN A;  4I3J A;  2A24 B;  2KX6 A;  2WKQ A;  5AVF A;  2OOL A;  3MQQ A;  4E04 A;  1GSW A;  3SW1 A;  1OTE A;  5G4Z A;  5HZH A;  3VE4 A;  3E4Q A;  4EET B;  5KIZ A;  1JNU A;  1XJ4 A;  1XJ2 A;  3MR0 A;  5HDS A;  3LIE A;  2M1C A;  1F98 A;  3LUQ A;  1P0Z A;  4HIA A;  1OT9 A;  2P7J A;  2L1M A;  4LPZ A;  4DJ2 A;  2D02 A;  3MJQ A;  1DP9 A;  3CWF A;  1T1C A;  2WKP A;  3F1O A;  1OTI A;  3CAX A;  4WN5 A;  5HD3 A;  3G6O A;  1S4S A;  2QHK A;  1LSX A;  3KX0 X;  3VE3 A;  4GW9 A;  3H9W A;  5TBM A;  4NXG A;  4BBV A;  4HHD A;  4NXB A;  1F9I A;  4R3A A;  4JGQ A; 
#chains in the Genus database with same CATH topology
 3HLC A;  4R4R A;  3KSI A;  1RGY A;  4E3I A;  1H5X A;  1L0F A;  3WS1 A;  1YQS A;  4OPY A;  3F1P A;  4Y3I A;  2GDN A;  4HEF A;  3EGX C;  1ESU A;  1OPX A;  2ZJ9 A;  2JBF A;  3BY8 A;  2HDQ A;  4U3T A;  3UB6 A;  3IBJ A;  3IS2 A;  3IH9 A;  5TFQ A;  2GJ3 A;  2JKR M;  5HWV A;  1TS0 A;  3P98 A;  3C30 A;  3CPT B;  3FZC A;  3OLO A;  4B9O A;  4UEY A;  1MKM A;  3BM6 A;  4HES A;  4UAA A;  3ZG7 B;  1Q2Q A;  3GR2 A;  2G2U A;  2A24 A;  4C6Y A;  3TG9 A;  3K3C A;  3RH8 B;  4LRY C;  4ETX A;  4KZ6 A;  5FL3 A;  3ZQ5 A;  4P6B A;  2ZMA A;  3PAG A;  3A3D A;  2XFS A;  2VZW A;  4G3W A;  2JKT I;  1NWZ A;  3G31 A;  3BJN A;  3WWX A;  4G3V A;  1H8Z A;  1XP4 A;  3LEZ A;  1TDL A;  4QU3 A;  3BQA A;  1P97 A;  3WS4 A;  4R23 A;  4YOF A;  2Y59 A;  4ZBE A;  4E3M A;  1HTZ A;  3OPP A;  3UY6 A;  1S0W A;  3VFH A;  5L10 A;  3B33 A;  3LY4 A;  4QB8 A;  4BQM A;  3HRE A;  4DN0 A;  4F3L A;  5KMW A;  2X01 A;  4GZB A;  2J7V A;  1GHM A;  4Z9Q A;  4AFI A;  4WZ4 A;  1MY8 A;  3H82 A;  2XSS A;  2W3G A;  5GHY A;  1NRJ A;  4GD8 A;  4HBU A;  3R4K A;  4MBF A;  4OQH A;  4UHU A;  4JKT A;  3LR5 A;  5FEG A;  3OCN A;  5L8M A;  1BTL A;  5FQ9 A;  5HX9 A;  3W4Q A;  1STZ A;  4L9G A;  3MQ0 A;  4FH4 A;  4GDB A;  3N8L A;  3CG5 A;  3IWO A;  3T4K A;  1K0K A;  4FSF A;  1OTD A;  4S2L A;  5A92 A;  4K0W A;  4Y0O A;  4FD8 A;  2WKH A;  3RJU A;  1H3Q A;  2JCH A;  3O3V A;  5F1F A;  1FR6 A;  3CI6 A;  3ULF A;  1PI4 A;  1T19 A;  3P09 A;  3UE0 A;  3HLE A;  4M4X A;  3IQA A;  5KZH A;  1SZV A;  2VA0 A;  4LCM A;  2LB9 A;  2WYX A;  2PHY A;  3D3O A;  3MKE A;  2UWX A;  3VV4 A;  3HUM A;  4LRX C;  3OBF A;  1BLH A;  1WYB A;  5FDH A;  3C4O A;  1D7E A;  2P04 A;  4PM8 A;  2VX8 A;  2XRN A;  1G6A A;  2Y2O A;  2HJ9 C;  3LID A;  4F94 A;  2XA7 S;  2PBY A;  4DDY A;  1H8M A;  2QPN A;  1ZG6 A;  1GCE A;  4NET A;  2H5S A;  3KSF A;  3NEC A;  3OPL A;  4I5S A;  5HDD A;  3QHY A;  3HL9 A;  2V0U A;  1YLP A;  2ZOI A;  5FQM A;  3WRZ A;  2JKG A;  2C6W B;  4E6W A;  2PU2 A;  3E4P A;  4GB7 A;  1TDG A;  3OOV A;  4Z1W A;  2JHE A;  2XA7 M;  4LLO B;  1MWR A;  2H28 A;  2V2F F;  3FPV A;  1PW1 A;  3MZE A;  4GCZ A;  2I72 A;  3T50 A;  4BJP A;  3GMW A;  2A3U A;  3HCY A;  2ZC5 B;  1KE4 A;  3UPP A;  4GHI A;  3VP3 A;  4JBF A;  1D1J A;  4MN5 A;  1JWP A;  2JKF A;  4DE2 A;  1N9B A;  1GHP A;  1TD5 A;  5AQ9 A;  1GA0 A;  3DTK A;  4BWI A;  4OLG A;  1SHV A;  1S67 L;  3NY4 A;  5DVA A;  4P0M A;  1L3L A;  2WKE A;  2CC1 A;  2Q9N A;  2OLV A;  3RTY A;  5A90 A;  5DKK A;  2Z2M B;  3OC2 A;  1PZP A;  5CER A;  4XXR A;  1CK3 A;  1E3U D;  5FAP A;  5E43 A;  2QMI A;  3A3I A;  1ES2 A;  1BUL A;  2EWV A;  2O0Y A;  4X25 A;  1NLZ A;  2VV7 A;  4OP5 A;  4O8G A;  2VGK A;  2V0W A;  3N8S A;  1FR1 A;  4IUH A;  5CGS A;  1UWN X;  1K56 D;  5HWW A;  4FCF A;  3GEC A;  4CLC B;  1S1Y A;  3T1Q B;  2WZZ A;  5J8X A;  2Y8H A;  2EXA A;  4HNB A;  4KZ3 A;  1BSG A;  1ONH A;  2R9X A;  5HW3 A;  3C7V A;  1Y4O A;  3ZVT A;  3KYE A;  3FPW A;  1TVF A;  1KGG A;  2WGI A;  2Y2H A;  3DTE A;  1Q2P A;  3U4L P;  3R7W B;  2OAQ 1;  4NG2 A;  3QNB A;  3IWI A;  3LO7 A;  4MCW A;  1DJB A;  1MKI A;  1K6S A;  4Q0I A;  2WKQ A;  4R1G A;  4UA6 A;  1GSW A;  2O9B A;  5JYO A;  3SW1 A;  5FAO A;  3WRT A;  4RX2 A;  2HDU A;  4MBH A;  2E8J A;  1ACF A;  1W7F A;  4CQH A;  4S2N A;  1JNU A;  3IX3 A;  3MR0 A;  2JE5 A;  5HDS A;  4UA9 A;  1W8Q A;  3LIE A;  5HAR A;  4X56 A;  4ZTK A;  4HIA A;  2L1M A;  3JVV A;  3CIT A;  4DJ2 A;  3MS6 A;  1T1C A;  1OTI A;  2Y2L A;  4WN5 A;  5HD3 A;  2ZC4 B;  3VE3 A;  2DNS A;  5A93 A;  5LBR A;  4CLC E;  1VET B;  4RYE A;  5IT5 A;  1ERO A;  4HHD A;  4NXB A;  3HUO A;  1H8Y A;  1G28 A;  4JGQ A;  2ZM0 A;  1LI9 A;  3FKW A;  2BLS A;  2A2L A;  2Y79 A;  5GLA A;  4CLC A;  3ZNY A;  5HPF A;  1D06 A;  1HVB A;  4DMZ A;  2O9C A;  5FI2 A;  1TF1 A;  1OTA A;  2PBD P;  5A91 A;  4DXC A;  3E98 A;  1EW0 A;  3O86 A;  4CJN A;  1YSP A;  4IVK A;  5IU1 A;  3DTM A;  4L9F A;  2ZM2 A;  1FSW A;  4XUX A;  3F1P B;  2BTF P;  4Q8I A;  4IBX A;  3LR0 A;  2ZC7 A;  3AGF A;  3DAV A;  3MFX A;  3S7P A;  2Y2I A;  4KZB A;  5FAS A;  2WGW B;  3BYD A;  3QP1 A;  3VOY A;  3R7W A;  2J80 A;  5E2H A;  3G34 A;  3A3F A;  2V9A A;  4N9K A;  3LR4 A;  1TS7 A;  5DJU A;  2HZ5 A;  4PPR A;  2ZQA A;  4S2N C;  4WYY A;  2Z6C A;  3PAE A;  4GOG A;  1NY0 A;  5J4E A;  4ZAM A;  4EBN A;  3PBS A;  1JVJ A;  3C2W A;  2L4R A;  2PD7 A;  4N9L A;  2DCF A;  3ZG0 A;  2Y2J A;  3W8K A;  4KZA A;  3NDE A;  3UE6 A;  3MXS A;  4QD4 A;  3V50 A;  4X55 A;  4R0Q A;  4E3K A;  4EUZ A;  5M1A A;  5FAT A;  5DF7 A;  1G68 A;  3NHQ A;  2O9A A;  4E3L A;  3MXR A;  2G7U A;  1N4O A;  3SH7 A;  1MWS A;  1VQQ A;  4YNR A;  4GDN A;  4RA7 A;  3O87 A;  1YMS A;  4CLC C;  5HPI A;  1VM1 A;  1S1Z A;  4N1X A;  4B4Z A;  4WZ5 A;  3G4P A;  3ZCZ A;  3UB9 A;  4ZJ2 A;  3CUE C;  1S6R A;  4F3L B;  1CQA A;  1T1B A;  3E0Y A;  3MKF A;  5CX7 A;  2GZA A;  1Y54 A;  3QP4 A;  3H82 B;  3T4L A;  3A0R A;  4A5R A;  3EGD C;  1XGI A;  2M7U A;  1L0D A;  5C5K A;  3TRC A;  1FCM A;  2OLU A;  2K2N A;  3RFB A;  2H0Y A;  1VHM A;  1ERM A;  3B47 A;  2Q9M A;  3NOU C;  1UGU A;  2YKF A;  1YLW A;  4ID4 A;  1ZHH B;  1S66 L;  2ZC6 B;  3SZT A;  4FOF A;  5HD5 A;  3HVF A;  3V39 A;  4IBR A;  4JLF A;  2BAS A;  3IHB A;  2WGW A;  4S2J A;  5TR7 A;  4KQD A;  2J9P A;  2P08 A;  4MN6 A;  3TJZ C;  4BLM A;  3T4S A;  2H0T A;  4OQI A;  3KO6 A;  2XF3 A;  4HJ4 A;  3B3X A;  1NZU A;  2J9O A;  1N9O A;  3Q7V B;  1XA1 A;  2FH5 A;  2VLG A;  4JF4 A;  4JF5 A;  1SKO A;  1X0O A;  4KUK A;  2XDM A;  2Y4A A;  3QP8 A;  1K57 A;  2EX8 A;  3W4O A;  4WBG A;  1KDW A;  5AJG A;  3UME A;  2QJ7 A;  1IOU A;  2INW A;  4ARZ B;  4R6L A;  4EUV A;  4ZDX A;  1F2K A;  2WGV A;  3K2N A;  5GL9 A;  4B93 A;  1IYS A;  5F68 A;  1YAX A;  4S2M A;  2FZ0 A;  2J3T D;  3DWZ A;  5AVE A;  1RGZ A;  3EEH A;  3TOI A;  4WZ5 C;  4EQI A;  1FIL A;  2PDR A;  5CTM A;  4H8R A;  3IXG A;  4LFU A;  3ZVW A;  3T1X A;  1XKZ A;  2JC7 A;  3M2J A;  2V20 A;  2B95 A;  3EQU A;  4QWO A;  3PBO A;  2HJE A;  1LHY A;  3VP4 A;  5CHJ A;  2V1A A;  3PXP A;  5HSQ A;  1Z09 A;  4E6X A;  5EFW A;  4BMW A;  5IS1 A;  3E2L A;  4GHI B;  3V3R A;  4HJ3 A;  3IX4 A;  1XFN A;  3ZGA B;  3S7O A;  3NDG A;  3NOT C;  3FC7 A;  1DJC A;  3UE3 A;  1S4R A;  2PRF A;  3VOL A;  1IKI A;  5HL1 A;  5FI6 A;  4EU0 A;  3F1O B;  2EWW A;  2UV0 E;  2D01 A;  2W3F A;  1IYO A;  4KG6 A;  3Q82 A;  3E2K A;  1RP5 A;  1Z6F A;  2EX9 A;  4KZ8 A;  1DY6 A;  2IWC A;  5DTT A;  1K57 C;  3P01 A;  3FWL A;  2X02 A;  3PBQ A;  5TBM B;  4OOL A;  3Q7V A;  1IEM A;  2KLI A;  1KVM A;  4D2O A;  3IXD A;  2E8I A;  1PRQ A;  3UNW A;  4X6T A;  2QKP A;  2EX2 A;  4R3J A;  4XT2 A;  4JGR A;  2OSU A;  4WEL A;  4EER A;  2VGL S;  4ARZ A;  4R3B A;  1F5M A;  3LIC A;  2ZLY A;  4QY5 A;  2HP9 A;  3LR3 A;  4NKP A;  4WM9 A;  4HH3 A;  1PNE A;  2V1B A;  3P7N A;  2P74 A;  5CGW A;  1GSX A;  1NRF A;  4S2K A;  5DFX A;  5JYP A;  3DWK A;  5FI7 A;  4Y15 A;  2WAD A;  1E25 A;  2VK3 A;  5DJT A;  2VGL M;  4DRT A;  2ZQD A;  5EVE A;  1TEM A;  2PU4 A;  4JXW A;  2KX6 A;  5AVF A;  3MQQ A;  4CPK A;  1OTE A;  3E4Q A;  1ZC2 A;  2W3H A;  3V3S A;  3UDI A;  5L2F A;  5EVI D;  2NUT C;  1MC0 A;  3C4P A;  1XJ2 A;  2V8F A;  3B42 A;  1CF0 A;  3G2Z A;  4KG2 A;  1G6O A;  2M1C A;  1F98 A;  3LUQ A;  1P0Z A;  2B5R A;  5M18 A;  2A49 A;  3ZDJ A;  1J9M A;  3QNC A;  1ERQ A;  3T1S A;  1NXY A;  2D02 A;  2Y2G A;  2XD1 A;  1DP9 A;  3F1O A;  3ZFZ A;  3CAX A;  1BLS A;  1W8Y A;  4OKP A;  3S1Y A;  3G6O A;  1S4S A;  1XPB A;  4Y13 A;  3NCK A;  1LSX A;  5FQQ A;  3KX0 X;  2GNX A;  3JVU A;  2VJW A;  4LV1 A;  2JKT M;  5TBM A;  5CHM A;  1YKD A;  4QY6 A;  4Y7P A;  3D4F A;  1IYP A;  1PWC A;  3AGD A;  1E3U A;  3HJK A;  5AQA A;  1OJ5 A;  2HDR A;  2VEA A;  3GQZ A;  4I39 A;  4X69 A;  3LGO A;  2Z6D A;  5CHU A;  5KSC A;  5L09 A;  1W63 Q;  1KE3 A;  2ZC3 B;  3M2K A;  4R38 A;  4E3N A;  4PKY G;  1K56 A;  1LL8 A;  4QPR A;  4MDZ A;  3ITB A;  4K08 A;  3T12 B;  1RCJ A;  4LV2 A;  2J8Y A;  2ZQ7 A;  1I2S A;  3DBA A;  4H6J B;  2XFT A;  2M7V A;  1IYQ A;  1NYY A;  1FCO A;  3SS5 A;  4FUW A;  1EI5 A;  2QYB A;  4EEU A;  2X71 A;  3S22 A;  3F1N A;  2VGJ A;  1K4E A;  4KZ9 A;  1MWU A;  4BL2 A;  5EVI C;  1ALQ A;  4LRZ E;  3N6I A;  2VV6 A;  4I3A A;  2XLN A;  3W2Z A;  5CEB A;  1WA9 A;  4KEN B;  5E2E A;  5G18 A;  2V1Z A;  1K6R A;  2Y2Q A;  3K3D A;  3LIF A;  2PR5 A;  5A8B A;  5U47 A;  2O99 A;  3CHW P;  2Z2L B;  4KUO A;  2Y2N A;  2PT7 A;  5G4Y A;  5AQ7 A;  1CEF A;  1K55 A;  3U2A A;  2DMW A;  4R4S A;  3C38 A;  3BLS A;  3Q07 A;  5E2G A;  2GX5 A;  4YIN A;  4OOM A;  4WMC D;  4IUK A;  3D9Y A;  1SCW A;  1JTD A;  1KOU A;  2JKR I;  4ZJ3 A;  4PM6 A;  2RCX A;  3A0V A;  1YM1 A;  4EV4 A;  3ISG A;  3ITA A;  5E2F A;  2K31 A;  2KDK A;  4KQR A;  3GDI A;  1NLY A;  4FTX A;  4L0L A;  5CXW A;  3LI8 A;  1NYM A;  1EWZ A;  3IWQ A;  2W0N A;  2ZM8 A;  5HAP A;  1M6K A;  5TJJ A;  3PBN A;  4GS9 A;  4XUZ A;  4JXV A;  3CUE A;  1CJF A;  4MEZ A;  4X53 A;  3I7J A;  4S2P A;  2WK0 A;  2HV1 A;  3HUN A;  1YLT A;  3PBR A;  1JWV A;  4NXF A;  4GN2 A;  1OT6 A;  4H6J A;  3BW6 A;  4Y5F A;  5DF8 A;  5J3W A;  4II7 A;  2PD8 A;  1N9N A;  5GLB A;  1DJA A;  5F1G A;  4KG5 A;  2OV5 A;  3BEC A;  5D3O A;  3G35 A;  5J7E A;  2B18 A;  4WL9 A;  1SKO B;  2WKR A;  3KYZ A;  1L0E A;  3BFG A;  4UQI M;  1K55 C;  3BEB A;  4OOY A;  3CLO A;  1L0G A;  1BUE A;  5I94 A;  3PHY A;  1JTG A;  2Y2K A;  1ODV A;  3TE8 A;  4BEN A;  3NBL A;  3VOZ A;  1K38 A;  3BFC A;  1LL9 A;  3E4O A;  3LY3 A;  3BFE A;  1LL5 A;  2WUQ A;  4Y0T A;  2WKI A;  3IH8 A;  5EM0 A;  1XXM A;  1G5U A;  4HJ6 A;  4OON A;  2IA2 A;  3GVB A;  2PYP A;  2V8C A;  1W63 M;  2ZOH A;  3UN7 A;  1CEG A;  1DRM A;  1VEU B;  3RXW A;  4LV0 A;  3IXH A;  1MPL A;  4RX3 A;  3NOP C;  3SOI A;  5GLD A;  4MMN A;  4DE1 A;  2P9V B;  2W27 A;  1PWG A;  3MQO A;  1NZO A;  4DE0 A;  2HPB A;  2Y2P A;  5I5L A;  4C3Q A;  3MBZ A;  1YT4 A;  3M6B A;  4OQ0 A;  3G2Y A;  4N1H A;  3UB5 P;  3UB8 A;  1I5Q A;  1KVL A;  2W1T A;  4WUJ A;  4G3K A;  3IF6 A;  3ZG8 B;  4YWZ A;  1GSV A;  3IF5 A;  1P9R A;  1LT0 A;  5FQJ A;  4Y0U A;  1ES4 A;  2PYR A;  3LI9 A;  4DE3 A;  1SDN A;  3HLG A;  4DDS A;  3KYQ A;  3VMA A;  4KQO A;  3OCL A;  1M40 A;  1O7E A;  3A0S A;  2Y2M A;  3CMZ A;  4S2O A;  1QME A;  4DKI A;  3NIA A;  2IWB A;  1VB6 A;  1BYW A;  2Y91 A;  4XT2 B;  5BOH A;  3Q81 A;  5GHX A;  3Q1F A;  5DTS A;  2EFX A;  4JGP A;  4GNU A;  3MZD A;  4OP8 A;  3H7W B;  2AVX A;  1LI0 A;  5HAQ A;  4JF6 A;  2YKH A;  3T4J A;  1IEL A;  2Q0O A;  4GJ4 A;  4MNR A;  4I3J A;  4BD0 A;  3UDX A;  3PTE A;  3A3E A;  5G4Z A;  3UE1 A;  4BL3 A;  3KSH A;  4EET B;  5GLC A;  3EOI A;  5KIZ A;  1C3B A;  4OLD A;  3MMH A;  5EUA A;  4HBT A;  1VEU A;  3OZH A;  4PM9 A;  3QP5 A;  1XJ4 A;  1NJ4 A;  1KE0 A;  3HBR A;  2XK1 A;  3S7N A;  2P9V A;  4OVD A;  5CED A;  5HAI A;  3IF6 C;  4LPZ A;  5DF9 A;  5EVL A;  3UPN A;  3BLM A;  5FDS A;  3MJQ A;  5EVI B;  2J3W A;  2RL3 A;  1YSQ A;  1AWI A;  3C7U A;  1BLP A;  5IHV A;  1FSY A;  5K5B A;  2WAE A;  4NXG A;  4BBV A;  1PYY A;  2MJ6 A;  4RQ9 A;  3QP6 A;  3VP1 A;  4QJG A;  3TSG A;  2W1R A;  5CRF A;  1TS8 A;  5F83 A;  5L07 A;  2XEP A;  1YLZ A;  3VFF A;  3V67 A;  3CPT A;  5CTN A;  1UWP X;  4Y2F A;  2QWS A;  1MBL A;  1MZU A;  3UDF A;  2DRW A;  1CI8 A;  3VP0 A;  2H10 A;  2W3D A;  1ZG4 A;  3H7W A;  3EQV A;  1K25 A;  3D72 A;  4RVA A;  3ZG9 B;  1YLY A;  4DXB A;  3N8R A;  1O07 A;  2J3T C;  3VP2 A;  1SKF A;  3UMD A;  1WYC A;  3FKV A;  3C8C A;  3UO9 A;  4EQ1 A;  2ZL1 B;  2OWJ A;  2ZMV A;  4JXG A;  1I2W A;  1ES3 A;  4HY8 A;  3T4T A;  4Q0J A;  5HWT A;  1N9L A;  4EW7 A;  3F1N B;  2HGV A;  5TGF A;  4N92 A;  3FG8 A;  1KGF A;  3MFD A;  3GTC A;  5EV0 A;  2G2W A;  2XH9 A;  1IKG A;  4K91 A;  1W5D A;  2ACG A;  3JPU A;  3SS3 A;  4LCL A;  1FOF A;  3HJI A;  1YPR A;  5EOE A;  3IBR A;  4EBL A;  1XX2 A;  5EVI A;  4U0T A;  5EOO A;  3PYP A;  2OWH A;  4HP4 A;  1OJG A;  4KZ4 A;  4EEP A;  3OPR A;  4QHC A;  1V9Z A;  4JPM A;  3BWL A;  2OAP 1;  2FFY A;  4P6Z S;  3CZD A;  4B4X A;  4KQQ A;  1KGE A;  3WS2 A;  2K7S A;  2XRO A;  3NI9 A;  1HLU P;  2I9V A;  4ZJ1 A;  1A0K A;  3SH9 A;  1XJ6 A;  3BY9 A;  4OPR A;  3GV9 A;  3MXQ A;  5MC7 A;  4MBK A;  4HOI A;  1HD8 A;  4WEJ A;  3PR6 A;  4M3K A;  3RXX A;  4NXE A;  3M6H A;  4P6Z M;  3VSK A;  4E3J A;  4MLL A;  1L2S A;  2PAV P;  4HQA A;  1ONG A;  4PMA A;  4IJG A;  4ME4 A;  3BRM A;  3L7H A;  1DP6 A;  4LV3 A;  5FQK A;  3LIA A;  1CI9 A;  1T18 A;  5CEC A;  2R78 A;  2NUP C;  3ZG5 A;  2ZQC A;  4NK3 A;  3LIB A;  5AQB A;  4GKU A;  2C5W B;  2QJ5 A;  4EES A;  3PBT A;  4GS9 B;  1XJ3 A;  3MZF A;  3O88 A;  2WAF A;  4PKY A;  3S4X A;  2ZL1 A;  1XGJ A;  3T1R A;  1PZO A;  1K4F A;  4HI4 A;  1OTB A;  3V5M A;  4BBT A;  5DTK A;  2ZD8 A;  1WE4 A;  1GHI A;  5FAQ A;  5F69 A;  5F5Y A;  3AGE A;  3S7Q A;  1TS6 A;  3NJA A;  1XFQ A;  2ZQ9 A;  4DJ3 A;  5EM1 A;  5M19 A;  3BFF A;  2Y55 A;  4HP9 A;  4O01 A;  2IWD A;  1V9Y A;  4LGW A;  4HH2 A;  3SS4 A;  4ESP A;  1ESI A;  3Q7Z A;  4LEN A;  1ZKJ A;  1K54 A;  5EE8 A;  4UA7 A;  2HDS A;  2EXB A;  1P9W A;  1E4D A;  4JXS A;  4WF0 A;  5HDC A;  3DW0 A;  1J3W A;  4O7D A;  1ZTU A;  4PM5 A;  4PM7 A;  2W3E A;  4E3O A;  3SH8 A;  3GRJ A;  4IED A;  2B02 A;  4I38 A;  3HLB A;  1MXO A;  3MF0 A;  3CJM A;  3QP2 A;  4EBP A;  4WLA A;  2XGN A;  2BG1 A;  1PWD A;  1U60 A;  3MSH A;  5DFY A;  1DP8 A;  2JN7 A;  2XR0 A;  3DTI A;  4C75 A;  3L9K A;  3O5Y A;  1JWZ A;  4OH0 A;  3LEQ A;  1LSW A;  3OPH A;  4WMC A;  4Y17 A;  5F6A A;  4I3I A;  1FIK A;  2XQZ A;  4EXO A;  1OME A;  3EWK A;  1HZO A;  1QMF A;  2VV8 A;  3NUL A;  4O0P A;  5DKL A;  2PR6 A;  1IFQ A;  3NC8 A;  4OPQ A;  1LSV A;  3ZHH A;  5HFO A;  1LLB A;  3LFV A;  3C5A A;  2KOI A;  4L9E A;  2WZX A;  3G30 A;  1PW8 A;  4BD1 A;  1FQG A;  4P87 A;  1ES5 A;  4CLC D;  4ETZ A;  3HLF A;  4PAU A;  3IXB A;  2FFF B;  5EEC A;  1BLC A;  5HL6 A;  4X1L A;  2ZBB A;  1YMX A;  1FCN A;  4OQG A;  3HLD A;  3IHA A;  3IT9 A;  3G32 A;  4K0X A;  2W1T B;  3LYX A;  2L0W A;  4D60 A;  4GD6 A;  4B88 A;  3ICY A;  3IF6 B;  4BBU A;  4UQI S;  5KSH A;  2ZQ8 A;  4IVI A;  4R70 A;  1H0M A;  1W79 A;  1K54 C;  4S2I A;  3N7W A;  1T1A A;  5FQI A;  3A3J A;  4IHQ A;  1BT5 A;  1SDE A;  5EPH A;  3ZYT A;  4JGO A;  2QZ6 A;  1KDS A;  2EX6 A;  3FV7 A;  1YLJ A;  2EFU A;  1PIO A;  2VKS A;  4MN7 A;  3UB7 A;  3BQ8 A;  4KZ7 A;  3IS2 B;  5FA7 A;  4Q0H A;  3UPO A;  1AXB A;  2HP6 A;  1GA9 A;  1PI5 A;  3LCE A;  3GSG A;  4WEK A;  1Y28 A;  2EA9 A;  3FYZ A;  3EEA A;  3W4P A;  2CMN A;  2ZMF A;  3JYI A;  3IX8 A;  4PHT A;  3ZNT A;  2A24 B;  1BZA A;  5GHZ A;  4EWF A;  2OOL A;  4E04 A;  2R9W A;  4KZ5 A;  4X68 A;  5F82 A;  5HZH A;  3VE4 A;  3T4O A;  3WS5 A;  4NEE D;  3T4Q A;  5FSR A;  4OPZ A;  3N4I A;  3TW8 A;  3WS0 A;  3KSG A;  4U0X A;  1PFL A;  5FEF A;  4X1M A;  4DF6 A;  4FH2 A;  1OT9 A;  2P7J A;  4YFM A;  2XD5 A;  4ZRR A;  4GLQ A;  3BFD A;  3CWF A;  2WKP A;  5CGX A;  1VET A;  2LB5 A;  1XA7 A;  2QHK A;  1MWT A;  4P85 A;  4GW9 A;  3H9W A;  2HF6 A;  1F9I A;  3VSL A;  3HLW A;  4R3A A;  2HP5 A; 
#chains in the Genus database with same CATH homology
 3KSI A;  4RQ9 A;  2A2L A;  2Y79 A;  4CLC A;  5HPF A;  1D06 A;  4DMZ A;  3HJK A;  2O9C A;  4JGQ A;  1TF1 A;  1OJ5 A;  1OTA A;  2W1R A;  1TS8 A;  2VEA A;  3F1P A;  3E98 A;  4Y3I A;  1EW0 A;  4I39 A;  3EGX C;  1YSP A;  2Z6D A;  1OPX A;  5IU1 A;  3V67 A;  1UWP X;  4L9F A;  3BY8 A;  4Y2F A;  2QWS A;  1W63 Q;  3UB6 A;  1MZU A;  4R38 A;  3IBJ A;  3F1P B;  3IS2 A;  4PKY G;  2GJ3 A;  1LL8 A;  2JKR M;  5HWV A;  1TS0 A;  3LR0 A;  2W3D A;  3C30 A;  4QPR A;  3H7W A;  3EQV A;  4MDZ A;  3MFX A;  4K08 A;  3S7P A;  3OLO A;  3D72 A;  4B9O A;  3DBA A;  4H6J B;  4UEY A;  3R7W A;  1MKM A;  2M7V A;  2J80 A;  2J3T C;  2V9A A;  3LR4 A;  1TS7 A;  2A24 A;  5DJU A;  3UMD A;  2QYB A;  4EEU A;  3C8C A;  4EQ1 A;  2OWJ A;  2ZMV A;  3K3C A;  3F1N A;  4LRY C;  3RH8 B;  4HY8 A;  4ETX A;  2Z6C A;  5FL3 A;  3ZQ5 A;  3T4T A;  4Q0J A;  5J4E A;  5HWT A;  1N9L A;  4LRZ E;  3PBS A;  4EW7 A;  2VV6 A;  2VZW A;  3C2W A;  4I3A A;  4G3W A;  2JKT I;  1NWZ A;  3F1N B;  3W2Z A;  2L4R A;  2PD7 A;  2HGV A;  1WA9 A;  3BJN A;  3FG8 A;  4G3V A;  3UE6 A;  3K3D A;  3LIF A;  2PR5 A;  5A8B A;  2O99 A;  3BQA A;  1P97 A;  4KUO A;  4YOF A;  3HJI A;  2PT7 A;  3NHQ A;  3IBR A;  5G4Y A;  2O9A A;  3U2A A;  2DMW A;  3PYP A;  2OWH A;  4HP4 A;  1OJG A;  3C38 A;  2G7U A;  3B33 A;  4EEP A;  2GX5 A;  1V9Z A;  4YNR A;  3BWL A;  4OOM A;  4IUK A;  2OAP 1;  4DN0 A;  4F3L A;  4P6Z S;  4CLC C;  1KOU A;  2JKR I;  4AFI A;  5HPI A;  3H82 A;  2K7S A;  2XSS A;  1S1Z A;  3A0V A;  2W3G A;  2XRO A;  1NRJ A;  2I9V A;  3UB9 A;  3CUE C;  1XJ6 A;  4F3L B;  3BY9 A;  1T1B A;  3E0Y A;  5CX7 A;  3R4K A;  2GZA A;  3MXQ A;  2K31 A;  3H82 B;  3T4L A;  3A0R A;  3LR5 A;  2KDK A;  4HOI A;  5MC7 A;  3EGD C;  1NLY A;  3GDI A;  2M7U A;  4L0L A;  4WEJ A;  5C5K A;  3PR6 A;  3OCN A;  5L8M A;  3TRC A;  4NXE A;  2K2N A;  4P6Z M;  3RFB A;  3LI8 A;  2W0N A;  1VHM A;  3B47 A;  4HQA A;  1STZ A;  4L9G A;  3MQ0 A;  4IJG A;  4ME4 A;  5TJJ A;  3NOU C;  1DP6 A;  3PBN A;  4GS9 A;  3LIA A;  1T18 A;  3T4K A;  1UGU A;  2YKF A;  2R78 A;  3CUE A;  2NUP C;  1ZHH B;  1S66 L;  4FSF A;  1OTD A;  3LIB A;  4FOF A;  5HD5 A;  2HV1 A;  1H3Q A;  2QJ5 A;  3PBR A;  4EES A;  3PBT A;  4NXF A;  1OT6 A;  2BAS A;  4H6J A;  4GS9 B;  3BW6 A;  4KQD A;  4Y5F A;  1XJ3 A;  2P08 A;  3CI6 A;  3ULF A;  4MN6 A;  4PKY A;  1T19 A;  3TJZ C;  4M4X A;  3T4S A;  3KO6 A;  5J3W A;  4HJ4 A;  2VA0 A;  4II7 A;  2LB9 A;  2PD8 A;  4HI4 A;  1N9N A;  3D3O A;  2PHY A;  1N9O A;  1OTB A;  3VV4 A;  4LRX C;  2FH5 A;  4BBT A;  2VLG A;  3OBF A;  1X0O A;  4KUK A;  5F69 A;  5F5Y A;  3S7Q A;  1TS6 A;  1D7E A;  3NJA A;  1XFQ A;  2P04 A;  2B18 A;  5J7E A;  2VX8 A;  5AJG A;  4DJ3 A;  2XRN A;  4WL9 A;  3UME A;  2HJ9 C;  2WKR A;  3KYZ A;  4HP9 A;  4O01 A;  4UQI M;  3LID A;  1V9Y A;  2QJ7 A;  1IOU A;  2INW A;  4ARZ B;  3CLO A;  4HH2 A;  2XA7 S;  4R6L A;  1H8M A;  4EUV A;  1P9W A;  3PHY A;  4WF0 A;  5HDC A;  3KSF A;  1ODV A;  4I5S A;  5HDD A;  3K2N A;  3TE8 A;  4B93 A;  1ZTU A;  1YAX A;  5F68 A;  2FZ0 A;  2J3T D;  2V0U A;  2W3E A;  5AVE A;  2ZOI A;  3EEH A;  2PDR A;  2B02 A;  3E4O A;  3E4P A;  4I38 A;  3OOV A;  4Z1W A;  2JHE A;  2XA7 M;  4LLO B;  2H28 A;  3MF0 A;  4WLA A;  3FPV A;  4HJ6 A;  3EQU A;  3PBO A;  4GCZ A;  5DFY A;  1DP8 A;  2IA2 A;  2JN7 A;  2HJE A;  3T50 A;  4BJP A;  3HCY A;  2V1A A;  2PYP A;  3O5Y A;  1W63 M;  2ZOH A;  3PXP A;  1LSW A;  1DRM A;  4GHI A;  4MN5 A;  5HSQ A;  1TD5 A;  5F6A A;  4I3I A;  4EXO A;  5EFW A;  4BWI A;  4BMW A;  3EWK A;  3NOP C;  2VV8 A;  5IS1 A;  4O0P A;  5DKL A;  2PR6 A;  4MMN A;  1S67 L;  1IFQ A;  4GHI B;  4HJ3 A;  2W27 A;  3MQO A;  1LSV A;  1XFN A;  3LFV A;  5I5L A;  3S7O A;  3RTY A;  3NOT C;  3FC7 A;  2KOI A;  4L9E A;  3UE3 A;  1S4R A;  3UB8 A;  3VOL A;  5DKK A;  4EU0 A;  3F1O B;  2EWW A;  3OC2 A;  4CLC D;  4ETZ A;  2D01 A;  2W3F A;  4PAU A;  2W1T A;  4WUJ A;  4G3K A;  2EWV A;  5HL6 A;  2ZBB A;  4YWZ A;  1GSV A;  1P9R A;  2O0Y A;  1LT0 A;  1NLZ A;  3P01 A;  2VV7 A;  4O8G A;  3PBQ A;  5TBM B;  4OOL A;  2W1T B;  3LYX A;  2V0W A;  2L0W A;  2PYR A;  3LI9 A;  4IUH A;  3ICY A;  2KLI A;  1UWN X;  4BBU A;  4UQI S;  5KSH A;  5HWW A;  4R70 A;  3KYQ A;  3GEC A;  4CLC B;  4KQO A;  1S1Y A;  2QKP A;  3OCL A;  3A0S A;  2Y8H A;  4XT2 A;  1T1A A;  4HNB A;  4IHQ A;  4JGR A;  4WEL A;  4EER A;  2VGL S;  3ZYT A;  4ARZ A;  4JGO A;  1VB6 A;  1BYW A;  1F5M A;  3LIC A;  2VKS A;  4XT2 B;  3LR3 A;  4MN7 A;  4NKP A;  3UB7 A;  3BQ8 A;  4HH3 A;  3IS2 B;  4Q0H A;  2V1B A;  3P7N A;  1GSX A;  4JGP A;  5DFX A;  3FPW A;  3H7W B;  4WEK A;  1Y28 A;  2EA9 A;  3R7W B;  2YKH A;  5DJT A;  3EEA A;  2OAQ 1;  2CMN A;  2ZMF A;  3T4J A;  2VGL M;  4MCW A;  4GJ4 A;  4PHT A;  4I3J A;  4Q0I A;  2A24 B;  2KX6 A;  2WKQ A;  5AVF A;  2OOL A;  3MQQ A;  4E04 A;  1GSW A;  2O9B A;  3SW1 A;  1OTE A;  5G4Z A;  5HZH A;  3VE4 A;  3E4Q A;  3KSH A;  3T4O A;  4NEE D;  2W3H A;  4EET B;  3EOI A;  3T4Q A;  5KIZ A;  3MMH A;  3TW8 A;  2NUT C;  3KSG A;  4CQH A;  1MC0 A;  1JNU A;  1XJ4 A;  1XJ2 A;  3B42 A;  3MR0 A;  5HDS A;  1G6O A;  3LIE A;  2M1C A;  1F98 A;  3LUQ A;  3S7N A;  1P0Z A;  4HIA A;  1OT9 A;  2P7J A;  2L1M A;  4ZRR A;  3JVV A;  3CIT A;  4LPZ A;  5DF9 A;  4DJ2 A;  4GLQ A;  2D02 A;  3MJQ A;  1DP9 A;  3CWF A;  1T1C A;  2WKP A;  3F1O A;  1OTI A;  2J3W A;  3CAX A;  1YSQ A;  4WN5 A;  2LB5 A;  5HD3 A;  3G6O A;  1S4S A;  2QHK A;  1LSX A;  3KX0 X;  3VE3 A;  2GNX A;  3JVU A;  4GW9 A;  3H9W A;  2VJW A;  5LBR A;  4CLC E;  2JKT M;  5K5B A;  5TBM A;  5IT5 A;  2HF6 A;  1YKD A;  4NXG A;  4HHD A;  4NXB A;  4BBV A;  1F9I A;  4R3A A;  1G28 A;  2MJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...