1P0ZA

Sensor kinase cita binding domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
131
structure length
131
Chain Sequence
EERLHYQVGQRALIQAMQISAMPELVEAVQKRDLARIKALIDPMRSFSDATYITVGDASGQRLYHVNPDEIGKSMEGGDSDEALINAKSYVSVRKGSLGSSLRGKSPIQDATGKVIGIVSVGYTIEQLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor kinase citA
publication title The structure of the periplasmic ligand-binding domain of the sensor kinase CitA reveals the first extracellular PAS domain.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transferase
total genus 38
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2003-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1p0zA00
1XJ6A 4M4XA 2D01A 1MZUA 2L0WA 5J3WA 1F98A 1OTDA 4HIAA 4LRXC 2KX6A 4I3IA 2Z6DA 5J4EA 3RH8B 2R78A 4XT2B 1T1CA 3B33A 3K3DA 3NOTC 3LICA 3MQOA 3H82A 4R70A 1LSVA 3LYXA 4I3AA 5DKLA 1V9ZA 1XFNA 2YKHA 3HJIA 3UE6A 2WKQA 4HP4A 3EWKA 5HDCA 2QHKA 3LI9A 1JNUA 2ZOIA 5KIZA 4WN5A 3LUQA 2KDKA 1BYWA 4HY8A 3A0VA 2OOLA 1T1AA 5I5LA 2BASA 5F6AA 3GECA 1DP8A 3A0SA 5HDSA 1OJGA 2PR5A 1V9YA 1XJ3A 4XT2A 3T50A 1LL8A 1T18A 2JN7A 3C8CA 4L9EA 4YWZA 3LIAA 1S66L 5AVFA 2WKRA 1OJ5A 3UB7A 3EEHA 4NXBA 5HSQA 3A0RA 5G4YA 4LLOB 2V1AA 1S1YA 4HP9A 2PD7A 1LSWA 4EETB 1EW0A 1OTAA 5J7EA 3F1PB 1DP6A 5TBMB 4BBTA 3MQQA 4K08A 4L9GA 2V1BA 3H7WB 1XJ4A 5HWTA 2VLGA 4EW7A 3PYPA 4NXGA 3LIDA 4GHIB 1OTIA 4NXEA 4JGRA 4KQDA 4EERA 3RTYA 3E4OA 4JGOA 4MN6A 1OTBA 1T1BA 2WKPA 1UGUA 4WF0A 4GS9B 2PHYA 4GCZA 2QWSA 1DRMA 4EEUA 2HV1A 5HWVA 1GSVA 3NOUC 5G4ZA 2VEAA 3FC7A 2PDRA 3F1PA 3IS2B 4HNBA 5TBMA 1ODVA 2W0NA 3H7WA 4WLAA 1TS0A 3H9WA 1OT9A 3MFXA 3FG8A 1TS8A 2K7SA 1N9NA 1GSWA 2L4RA 3LIEA 3ZQ5A 4B9OA 4I38A 2L1MA 4HH2A 1OT6A 1Y28A 5AVEA 2V9AA 4HJ6A 5EFWA 3CLOA 3E4QA 2A24B 1XFQA 4KUKA 4I5SA 5F69A 4GS9A 4HH3A 4HOIA 4R6LA 3NJAA 2EA9A 3VOLA 3P7NA 3MXQA 4WL9A 3ICYA 3VE4A 1WA9A 3LIBA 1F9IA 4JGQA 2CMNA 4HJ3A 3CAXA 5DJTA 2QJ7A 4HHDA 1TS6A 5F5YA 1KOUA 1D06A 4BBVA 4I3JA 2I9VA 2VV8A 3NHQA 1LT0A 1P97A 4R3AA 1X0OA 3H82B 1N9LA 3F1NB 4EXOA 1LSXA 5DJUA 3C2WA 4PKYA 4JGPA 3ULFA 2J80A 4H6JB 1NWZA 4EQ1A 3LIFA 4DJ3A 2YKFA 4BBUA 4F3LB 2INWA 1N9OA 2PYPA 1P0ZA 1D7EA 3UB9A 4I39A 3VE3A 2Z6CA 1S67L 2JHEA 1XJ2A 2QJ5A 3MR0A 4EESA 5HZHA 3UMEA 2H28A 2VV6A 3UMDA 2ZBBA 4DJ2A 1S4SA 2ZOHA 5IU1A 4LRYC 5HDDA 2QKPA 3UB8A 3CWFA 4EEPA 2B02A 1DP9A 4PKYG 4GHIA 1S4RA 3F1NA 2VV7A 2D02A 4RQ9A 3SW1A 5HWWA 3MJQA 3OLOA 3G6OA 5IS1A 4L9FA 4H6JA 1S1ZA 3K3CA 2M1CA 3HJKA 1OTEA 4F3LA 2P7JA 3F1OB 3GDIA 3BY9A 2OWJA 2W27A 1G28A 3IS2A 1TS7A 4GW9A 3LI8A 4HJ4A 4HQAA 2V0UA 4MN5A 4E04A 3NOPC 4LPZA 3D72A 4R38A 5HD3A 2PD8A 2V0WA 4WUJA 5DKKA 4HI4A 1UWNX 2GJ3A 4NXFA 5HD5A 4LRZE 3IBRA 2PYRA 2OWHA 2A24A 1UWPX 3PHYA 3KX0X 4KUOA 1GSXA 2PR6A 1T19A 1VB6A 3F1OA 3BY8A 3BWLA 5F68A 3E4PA 3UB6A 5A8BA
chains in the Genus database with same CATH superfamily
4ZDXA 5G18A 2HDUA 4M4XA 4OKPA 4EV4A 5GLCA 5J3WA 5FL3A 4R3BA 3N7WA 2GDNA 1OTDA 4LV1A 2VZWA 3LY4A 5JYPA 2FFFB 3W4QA 4MNRA 1W5DA 4EUVA 1U60A 5CHMA 5LBRA 4ZBEA 1T1CA 3EQVA 3B33A 2BLSA 3LICA 5TJJA 3H82A 4MBKA 4R70A 4EWFA 4K91A 1LSVA 2JCHA 2Y2MA 3LYXA 5AQAA 4KZAA 3OZHA 4Y15A 5DKLA 5AQ9A 3C7UA 1XFNA 2YKHA 5FDHA 1RP5A 5HAPA 3WS5A 4Q0HA 3DAVA 3SH8A 2WKQA 3MZFA 2XEPA 3EWKA 3DTEA 3LI9A 3S7NA 5FEGA 1DJAA 5F83A 5FAOA 2KDKA 3G2YA 1O7EA 1RGZA 1JWZA 4JXGA 1KDSA 4O8GA 5E43A 5A92A 1SZVA 3ZNTA 1XXMA 2JN7A 4E3OA 4Y0OA 1DJBA 3UN7A 1VHMA 3V3SA 1K55C 4NXBA 2JKRI 2XSSA 3NCKA 2LB9A 4LLOB 2ZMAA 3SS5A 2G2UA 1LSWA 1HVBA 4N9KA 3TSGA 4P6BA 3V50A 1ZTUA 1DP6A 1TVFA 3BEBA 1CF0A 1GA0A 3G34A 3MQQA 4L9GA 4JF6A 1XJ4A 3BQ8A 2H0TA 1VQQA 3V39A 4OQIA 3DTMA 2V8FA 4WZ5C 1S6RA 3Q7VA 1D1JA 2Y2LA 1K55A 1XKZA 5AQBA 4BENA 4LGWA 2PU2A 4X53A 4A5RA 3E4OA 2P9VB 1MWRA 2Y2OA 1W79A 5C5KA 4KZ5A 2XD1A 4WF0A 4PM6A 1FILA 2W3GA 4JBFA 1L0GA 4GCZA 2QWSA 1ES2A 4QU3A 1IOUA 2ZQAA 4WBGA 3W2ZA 4WMCA 2W1TB 3M2JA 3MXRA 5CTNA 5HWVA 3S7OA 3NOUC 2VEAA 3N6IA 4HESA 3WWXA 3SH9A 3IS2B 1JTGA 5FATA 4O7DA 3BECA 4IUKA 1YSQA 4PHTA 3SOIA 1OT9A 1TS8A 2EX6A 2A2LA 1M6KA 3MFDA 1GSWA 2WGIA 4R4SA 2Q0OA 3JPUA 1QMFA 2HJEA 2VA0A 4E3NA 1W7FA 4HH2A 2V9AA 2P9VA 4HJ6A 1ES5A 5U47A 1H8YA 4LCLA 2ZC3B 5DTKA 3HCYA 3OCLA 3T12B 4R6LA 3PBQA 4KZ4A 1SHVA 2W1TA 3CUEA 3QP1A 4Y2FA 1YT4A 4UAAA 1BUEA 3PTEA 3CJMA 1NYMA 1ZHHB 1VETB 3KSFA 3UPPA 4MEZA 1TF1A 4HJ3A 1GCEA 5HPIA 3T4LA 2P08A 4MN7A 1MC0A 1TS6A 3IHBA 5F5YA 4WZ4A 1C3BA 4BBVA 3R7WA 5M19A 2A3UA 3NHQA 3DWZA 1M40A 4RVAA 5CTMA 1X0OA 4KZ7A 3LR3A 5EOEA 5M1AA 3JVVA 4ETXA 1N9LA 4R4RA 4P6ZM 2QMIA 4K0XA 2Y2NA 2ACGA 3U2AA 2EX9A 5DJUA 4QY5A 3ULFA 4OP5A 2J80A 1NWZA 2WZXA 2R9WA 4NK3A 5EPHA 2INWA 1N9OA 1P0ZA 1YLPA 2O99A 4OLDA 5BOHA 3VE3A 2UV0E 5FASA 3FKWA 4DE3A 3LR5A 3LY3A 4EESA 3IX4A 3S1YA 3GSGA 3P09A 3TE8A 3PAGA 2W3HA 2G7UA 4DJ2A 4R23A 2ZOHA 3N4IA 4HBUA 3NULA 1OPXA 1F2KA 2Z2MB 3IBJA 4IBXA 3C38A 4GHIA 1ESUA 4KG5A 1K4EA 1NJ4A 2GX5A 4X1MA 3QNBA 1PZPA 3A3FA 3T1QB 2PAVP 2WAFA 4GB7A 3SS4A 5E2HA 5TGFA 1TEMA 2J3WA 3NDGA 5GHXA 1LHYA 3KSIA 3AGDA 4ZJ2A 5MC7A 2V0UA 2ZQDA 3NY4A 1NRJA 3DWKA 1BLHA 4JXSA 4QB8A 1PI4A 2OSUA 1KE4A 2RL3A 4DDSA 4N1XA 1CJFA 4P87A 4N9LA 2J9PA 1HLUP 5FDSA 4B93A 1YAXA 4WUJA 5EM1A 2J3TD 2WKHA 5EOOA 5HD5A 2Q9NA 2ZQ7A 2A24A 3KX0X 1GSXA 1VB6A 2JE5A 2XA7S 2O0YA 4D60A 3BY8A 3BWLA 2P04A 5F68A 1XJ6A 3TG9A 1BLSA 2D01A 3N8RA 2Q9MA 1H8ZA 1F98A 3UO9A 3OOVA 4IBRA 1YPRA 2PT7A 2I72A 4LRXC 4I3IA 1NLYA 1ACFA 1K56D 4ID4A 4CLCC 3BFDA 2ZMVA 3Q7ZA 5HL6A 1KDWA 3NOTC 4Q0JA 3JVUA 3CPTB 4S2MA 2X71A 1BT5A 1FSWA 4BWIA 2ZL1A 2Y2JA 3UY6A 3T1RA 3HJIA 3UE6A 3HVFA 2GNXA 4Z1WA 2EX8A 5HDCA 3SS3A 2OAQ1 5A90A 5CECA 4CPKA 5FQMA 4EUZA 1L0DA 3ZG7B 3LUQA 4EBNA 2R9XA 4HY8A 4D2OA 2C6WB 2OOLA 1T1AA 1CQAA 5I5LA 3O3VA 2O9CA 4S2NC 3UNWA 2FH5A 5F82A 1DP8A 4QJGA 1J3WA 4ZAMA 1HZOA 4Y0UA 4KQRA 5FQQA 1PYYA 3P01A 1T18A 3C8CA 4YWZA 1K56A 3LIAA 3CPTA 3ZCZA 4GD6A 4MDZA 1L2SA 1OJ5A 2WGWB 5A91A 3VV4A 4E3IA 2P74A 5GLBA 4L0LA 2V1AA 1XGJA 2Y2HA 2PD7A 4O0PA 4JPMA 3JYIA 4MLLA 3BRMA 2VGLS 3CZDA 3QP5A 1MKIA 4UHUA 4BBTA 5HX9A 4OOLA 1FIKA 1IYQA 3DBAA 3V67A 1STZA 1L0FA 2V8CA 4EW7A 3OCNA 1XP4A 3Q82A 2ZM0A 4OPQA 4WYYA 1PI5A 2XA7M 1KVMA 4NXEA 3KYEA 4JGRA 1G68A 3T4SA 1H5XA 3HUMA 3KSHA 5KZHA 3FKVA 4C6YA 1LI0A 4N92A 3UB5P 3CITA 5DTSA 2EXAA 2WADA 2EFUA 2PHYA 1DRMA 4GJ4A 3GTCA 4S2PA 5CERA 1KGEA 5G4ZA 5JYOA 2JBFA 4OP8A 2ZMFA 3LO7A 1MWSA 3PBTA 2W0NA 1TS0A 3MFXA 2XK1A 4EQIA 4E6XA 2OLUA 3BYDA 3OBFA 3A3IA 2ZM8A 4B9OA 5HL1A 3VFHA 1OT6A 1Y28A 5AVEA 3CLOA 3D4FA 5FQ9A 5HAQA 1TDLA 1ONGA 4KUKA 4NKPA 4R1GA 2O9BA 4K0WA 4HOIA 5DF9A 1W63Q 2DNSA 2OLVA 1ZG6A 3GVBA 3B47A 3ICYA 3T4KA 5FQIA 4WMCD 1PZOA 1WA9A 3UPNA 3GV9A 3Q1FA 3NC8A 3WS0A 3EGXC 3HBRA 4OVDA 2XROA 1K6RA 1KGFA 3FV7A 3W4OA 2DRWA 4E3MA 1KOUA 4KZ3A 3LGOA 4XUXA 3C30A 4E3LA 1LT0A 4R3AA 5CEBA 1SKFA 1IYSA 1LL5A 2VGLM 1N4OA 2JKRM 2XFTA 3F1NB 1K38A 2ZC5B 4RA7A 2IA2A 3KO6A 3ZFZA 4LFUA 1GA9A 4JGPA 4KG6A 3KSGA 4H6JB 4LV2A 3FPVA 4DJ3A 4O01A 1ZG4A 2YKFA 4F3LB 2B18A 5DFYA 4DE2A 2PYPA 4DE1A 2HF6A 2A49A 4LCMA 4I39A 4X68A 3UB9A 1NRFA 3AGEA 3MMHA 5M18A 4WZ5A 4DRTA 1S67L 3FZCA 5D3OA 4FH4A 5HZHA 4PPRA 3UMDA 2ZBBA 4KZ9A 1JWVA 5HDDA 4PM8A 4B88A 1HTZA 3CWFA 1BLCA 4EEPA 1HD8A 4GD8A 4QD4A 1S4RA 3F1NA 1WE4A 1KE0A 4RQ9A 3SW1A 3I7JA 1PW8A 3MJQA 5EE8A 4DN0A 3DTKA 3PAEA 5L2FA 3P98A 3ZVTA 3LEZA 1YLTA 5HARA 3QP2A 4H6JA 1S1ZA 5CEDA 2WAEA 3FYZA 4OQ0A 4F3LA 1I2WA 2UWXA 3ZYTA 1K57C 3F1OB 3BY9A 2OWJA 3LR4A 2WKEA 1PFLA 4DE0A 1LI9A 3D9YA 3UE0A 2W27A 1XPBA 3DW0A 5FEFA 3IS2A 3IHAA 4XUZA 1TS7A 1MWUA 4HJ4A 3LI8A 4ESPA 4KG2A 4HQAA 4MN5A 3S4XA 1JVJA 3NOPC 5FAPA 3WRZA 1RGYA 3V3RA 2Y2GA 5EM0A 3GMWA 2W3DA 4ZRRA 4JXVA 4LV3A 2X01A 2RCXA 4OPYA 1K57A 3NDEA 4HI4A 3M6BA 1KE3A 4NXFA 1W8YA 5I94A 3G2ZA 4LRZE 3IBRA 2DMWA 3VFFA 4OOMA 2LB5A 3A3DA 2M7UA 1S0WA 1T19A 2OV5A 4MCWA 3OPLA 1DY6A 3F1OA 4GKUA 1RCJA 3UB6A 4G3KA 4UA9A 2L0WA 4X1LA 1VETA 1TD5A 3M2KA 2XR0A 2HDRA 4Y17A 3R4KA 2XFSA 4QWOA 4OLGA 1K4FA 4BQMA 5FQJA 1PWCA 5J4EA 4UEYA 1P9RA 1K54C 3ISGA 1NXYA 1H3QA 3TRCA 4DXBA 3IWIA 3C5AA 3HLBA 5HW3A 1H8MA 3ZG9B 3IXBA 5EVIB 2VK3A 4LV0A 2BTFP 3W4PA 2NUTC 1PNEA 4U0TA 3QP4A 2GZAA 3MBZA 4HP4A 3AGFA 3ZG8B 1JNUA 5EVIC 1K54A 3O87A 4WN5A 5KIZA 1L0EA 2Z2LB 2VGJA 2WZZA 4PAUA 3ZG0A 2HP6A 3IF5A 2BASA 4GOGA 5F6AA 3GECA 1SDEA 3VOZA 1OJGA 1XJ3A 1LL8A 2WYXA 4UA6A 1S66L 1E3UA 5AJGA 3G32A 1SKOB 2Y55A 3HLWA 3EEHA 2V20A 5G4YA 1YM1A 3A3EA 4EETB 5FQKA 3F1PB 3LEQA 4F94A 3QP6A 3E2KA 1I2SA 1K25A 4K08A 3ITAA 2V1BA 2EWWA 4CLCD 2ZC6B 5FI6A 1YKDA 5HWTA 2PU4A 4Y5FA 1YLZA 2C5WB 2VLGA 4OPRA 4NXGA 5FI7A 1TDGA 4CLCB 2JKTI 1IKGA 2VX8A 3QNCA 3BFEA 3LR0A 3WS4A 3C7VA 3RTYA 1MY8A 4HBTA 1OTBA 1T1BA 5FSRA 1SKOA 2WKPA 3UDXA 3PBSA 2J8YA 1FCNA 4EEUA 4H8RA 5F1GA 1GSVA 3HL9A 4FUWA 3IXHA 2HDSA 4Q0IA 2PDRA 4UA7A 3PBOA 3SZTA 1ERMA 4BL3A 3F1PA 3W8KA 2JC7A 4HNBA 5HAIA 2VKSA 1FCMA 1JTDA 4OPZA 2VJWA 2Y2KA 3MKFA 4WLAA 1Y4OA 3HREA 2WK0A 3IXGA 5DTTA 2K31A 2HP5A 3IXDA 4IHQA 2K7SA 2H10A 1N9NA 4QY6A 4CLCA 4PM5A 4JF4A 1IELA 4U3TA 2Y8HA 4RYEA 2ZLYA 1EWZA 4S2LA 4JF5A 3MSHA 1YQSA 2V2FF 2XD5A 3EQUA 4R0QA 3G4PA 4IVKA 4B4ZA 3E4QA 4IVIA 3UPOA 2VGKA 1CEGA 4AFIA 4I5SA 1MXOA 1EI5A 4DF6A 3EOIA 3NJAA 2EA9A 3VOLA 1W63M 3MXQA 3T4JA 4KZ6A 1VEUB 4WL9A 4OQHA 4CLCE 3RJUA 3UE1A 2DCFA 2CC1A 3NI9A 4S2NA 4ETZA 1ES4A 3O86A 5DJTA 4Y0TA 4HHDA 1D06A 1Y54A 4I3JA 2Y79A 1P97A 3U4LP 4OONA 3NBLA 2W3FA 3H82B 2JKFA 1CK3A 2HDQA 5L8MA 2ZM2A 2HZ5A 4CQHA 4E3KA 4NETA 1PWDA 3C2WA 3RXWA 4JXWA 4EBLA 1VEUA 1WYBA 3D3OA 2J9OA 2HGVA 5HFOA 4YINA 5GLAA 1ES3A 1Q2QA 2WGWA 1D7EA 1MWTA 3HUOA 2XLNA 2EFXA 2Z6CA 3G35A 3IWQA 4IEDA 3CMZA 2JHEA 3T1SA 4E3JA 2HPBA 1XJ2A 4UQIS 3IH9A 1VM1A 4GNUA 1NLZA 3MR0A 2EXBA 3MXSA 3V5MA 2VV6A 4Z9QA 1FQGA 4QHCA 1S4SA 3Q07A 5KMWA 5IU1A 2JKGA 1YSPA 3IF6B 4DDYA 3RXXA 1N9BA 1DP9A 4PKYG 3T4OA 5L09A 1Q2PA 3SH7A 1BTLA 4HEFA 2D02A 1XGIA 5HWWA 3EEAA 2ZQCA 3OLOA 3G6OA 1CEFA 1E25A 3WRTA 5IS1A 1W8QA 4L9FA 3OC2A 3K3CA 1YMXA 3IF6C 2M1CA 3HJKA 1SCWA 1OTEA 4GZBA 1MBLA 1CI8A 3VP0A 2P7JA 3GDIA 4S2IA 1P9WA 5FAQA 4DKIA 1PWGA 1FCOA 4G3WA 3Q7VB 4WEJA 1K6SA 1LLBA 1G28A 5GLDA 3VP3A 5J8XA 5DF7A 3VP2A 3PBRA 5CHJA 1WYCA 3N8SA 4FH2A 4X55A 1YMSA 1PW1A 1SDNA 4R38A 3IF6A 2XQZA 1JWPA 3VP1A 2ZC7A 4IJGA 2XDMA 4S2KA 2W3EA 5EVLA 3PXPA 4C75A 1UWNX 2WKIA 3G31A 4BD0A 2OWHA 4WEKA 5EV0A 5FI2A 3PHYA 2PR6A 3MF0A 2IWBA 5E2FA 2XGNA 4FSFA 3BJNA 4FD8A 4JKTA 3T1XA 4P6ZS 3E4PA 4R3JA 5A8BA 1A0KA 2G2WA 1GHMA 1MZUA 5L10A 2NUPC 4HIAA 5GHYA 4YNRA 2KX6A 3VSKA 2Z6DA 1G6AA 2HP9A 4OQGA 1K0KA 3RH8B 4BMWA 2R78A 4BD1A 4XT2B 4WELA 5GHZA 1J9MA 3ZG5A 4UQIM 3CG5A 4OH0A 3K3DA 3MQOA 4ZTKA 3MZEA 1GHPA 3BW6A 2X02A 4QPRA 3LCEA 2OAP1 2B95A 1NZUA 4GDBA 4I3AA 1V9ZA 5FA7A 1BSGA 3N8LA 4KZ8A 2H0YA 3QHYA 5KSCA 2QYBA 3CUEC 1Z6FA 1NYYA 5L07A 1Z09A 4X6TA 4FTXA 2BG1A 2QHKA 3R7WB 2ZOIA 4JLFA 4GDNA 3KYZA 1BYWA 3A0VA 1AWIA 4ZJ1A 2Y59A 1KGGA 4KQOA 4Q8IA 5HPFA 3A0SA 4ME4A 2Y2IA 4NG2A 5HDSA 3Q81A 4Y3IA 2PBDP 2PR5A 3O5YA 3C4PA 1V9YA 4XT2A 5CGWA 3T50A 3HLGA 4L9EA 1E4DA 1G6OA 3BLMA 5DF8A 5AVFA 2WKRA 4PM7A 3IQAA 3UB7A 2K2NA 3E98A 5HSQA 2AVXA 5K5BA 3A0RA 1BZAA 4FOFA 1S1YA 4HP9A 3UDFA 1EROA 1EW0A 1OTAA 4GN2A 2XRNA 5J7EA 2QZ6A 2FZ0A 2ZC4B 3ZHHA 5TBMB 1FSYA 2ZD8A 4E6WA 3H7WB 4G3VA 3ZNYA 2KLIA 3PR6A 3PYPA 4M3KA 3VSLA 3WS1A 1YLJA 3O88A 3LIDA 4KZBA 3ZGAB 4GHIB 5DVAA 1OTIA 3ZDJA 1ONHA 4KQDA 4EERA 5KSHA 1MKMA 4U0XA 4XXRA 2M7VA 4PM9A 1LL9A 1XX2A 4JGOA 4MN6A 3BFCA 1UGUA 2Y2PA 3QP8A 1E3UD 4GS9B 4BL2A 2HJ9C 5EVID 4GLQA 2HV1A 3UE3A 1QMEA 1XA7A 4BLMA 2IWDA 1F5MA 3OPPA 5E2GA 3FC7A 5CGSA 3GRJA 1ODVA 5TBMA 4X25A 3H7WA 3L9KA 3H9WA 4N1HA 1H0MA 3FG8A 1XA1A 3HLCA 4EBPA 4EU0A 2L4RA 3HLDA 3DTIA 3TOIA 3LIEA 4KQQA 4CJNA 3IT9A 3BLSA 3ZQ5A 3TJZC 4ARZB 3OPRA 4I38A 2L1MA 4Y13A 1GHIA 3BFFA 5EFWA 1FR1A 5IHVA 5EECA 3IX8A 2A24B 3S22A 3OPHA 1XFQA 2V1ZA 3HLFA 3EGDC 5CX7A 3BQAA 5F69A 4IUHA 4GS9A 4S2OA 4HH3A 2EWVA 2O9AA 1MPLA 5CGXA 3P7NA 5F1FA 3CHWP 4C3QA 1AXBA 4OOYA 5EVIA 3VE4A 3L7HA 3M6HA 4X56A 3LIBA 3NIAA 3A3JA 1F9IA 4JGQA 2CMNA 3CAXA 2QJ7A 2ZQ9A 1FOFA 1KVLA 4BJPA 5AQ7A 2I9VA 2VV8A 2FFYA 1CI9A 2PBYA 3IWOA 4YFMA 3T4QA 4DXCA 4ARZA 4DMZA 1IYPA 1IFQA 3C4OA 3MKEA 4MBHA 2ZL1B 4EXOA 3S7QA 1LSXA 4RX3A 1ERQA 2J7VA 1ALQA 1L3LA 1PIOA 4PKYA 5DFXA 3PBNA 4NEED 5CXWA 1YLYA 2Y91A 4Y7PA 4EQ1A 1G5UA 3K2NA 3LIFA 2XH9A 4BBUA 4X69A 4YOFA 3BM6A 2J3TC 1IYOA 4PMAA 3MZDA 3E2LA 5EVEA 4P85A 3CI6A 2JKTM 2QJ5A 2Y2QA 4MBFA 2ZJ9A 3IX3A 3KYQA 3UMEA 2H28A 2IWCA 5A93A 5TFQA 1IEMA 1YLWA 1NZOA 4KENB 2EX2A 2KOIA 4LRYC 1ESIA 3ITBA 2QKPA 3B3XA 3UB8A 2PRFA 2B02A 2ZQ8A 3LFVA 2VV7A 1O07A 3HUNA 4II7A 3WS2A 1ZKJA 3IH8A 3B42A 3VP4A 3GQZA 2H5SA 2XF3A 2W1RA 2B5RA 4RX2A 3VOYA 1ZC2A 3S7PA 3FWLA 3UDIA 5CRFA 2Y4AA 5CHUA 2QPNA 2MJ6A 2E8JA 4GW9A 5GL9A 5TR7A 4E04A 3RFBA 4FCFA 4LPZA 3D72A 3TW8A 5EUAA 3VMAA 5HD3A 3MS6A 4WM9A 1NY0A 1IKIA 4P0MA 2PD8A 3MQ0A 2WGVA 4S2JA 4B4XA 2V0WA 1DJCA 5DKKA 3E0YA 3T4TA 1OMEA 2GJ3A 1BULA 1I5QA 3BFGA 2E8IA 4ZJ3A 4MMNA 2PYRA 3ZVWA 3HLEA 2WUQA 1UWPX 4KUOA 3FPWA 3GR2A 1FR6A 1BLPA 3NECA 5IT5A 4LENA 5E2EA 1PRQA 3G30A
chains in the Genus database with same CATH topology
1XJ6A 4M4XA 2D01A 1MZUA 2L0WA 1TD5A 5FL3A 5J3WA 1F98A 2NUPC 1OTDA 4HIAA 3R4KA 3OOVA 2VZWA 2PT7A 4LRXC 4YNRA 2KX6A 4I3IA 1NLYA 2Z6DA 4EUVA 5J4EA 3RH8B 5LBRA 4UEYA 4BMWA 4CLCC 2R78A 2ZMVA 1P9RA 5HL6A 4XT2B 4WELA 1H3QA 1T1CA 3EQVA 3TRCA 3B33A 4UQIM 3K3DA 3NOTC 4Q0JA 3LICA 3JVUA 3MQOA 5TJJA 3H82A 1H8MA 3BW6A 4R70A 4QPRA 1LSVA 4BWIA 2OAP1 3LYXA 4I3AA 5DKLA 1V9ZA 2NUTC 1XFNA 2YKHA 3HJIA 3UE6A 2QYBA 4Q0HA 2GZAA 3CUEC 2WKQA 4HP4A 2GNXA 4Z1WA 3EWKA 5HDCA 2OAQ1 2QHKA 3LI9A 3S7NA 3R7WB 1JNUA 2ZOIA 5KIZA 4WN5A 3LUQA 3KYZA 2KDKA 1BYWA 4HY8A 3A0VA 2OOLA 1T1AA 5I5LA 4PAUA 2O9CA 2BASA 4KQOA 2FH5A 5F6AA 5HPFA 3GECA 1DP8A 3A0SA 4ME4A 4O8GA 5HDSA 4Y3IA 1OJGA 2PR5A 3O5YA 1V9YA 1XJ3A 4XT2A 3T50A 1LL8A 3P01A 1T18A 2JN7A 3C8CA 4L9EA 4YWZA 3LIAA 1G6OA 1S66L 5AVFA 2WKRA 5AJGA 1VHMA 4MDZA 1OJ5A 3UB7A 3EEHA 2K2NA 3E98A 4NXBA 3VV4A 2JKRI 5HSQA 5K5BA 2XSSA 3A0RA 5G4YA 4FOFA 4L0LA 2LB9A 2V1AA 4LLOB 1S1YA 4HP9A 2PD7A 1LSWA 4EETB 1EW0A 1OTAA 4O0PA 2XRNA 5J7EA 1ZTUA 3F1PB 1DP6A 2FZ0A 2VGLS 5TBMB 4BBTA 3MQQA 4K08A 4OOLA 4L9GA 2V1BA 3DBAA 3H7WB 3V67A 1XJ4A 1STZA 2EWWA 4G3VA 4CLCD 3BQ8A 1YKDA 5HWTA 2KLIA 4Y5FA 2VLGA 3PR6A 4EW7A 3PYPA 3OCNA 4NXGA 4CLCB 2JKTI 3LIDA 2VX8A 2XA7M 4GHIB 1OTIA 4NXEA 3LR0A 4JGRA 4KQDA 4EERA 5KSHA 3T4SA 1MKMA 2M7VA 3RTYA 3E4OA 4JGOA 3KSHA 4MN6A 1OTBA 1T1BA 5C5KA 3CITA 2WKPA 1UGUA 4WF0A 2W3GA 3PBSA 4GS9B 2PHYA 4GCZA 2QWSA 2HJ9C 1DRMA 4GJ4A 4GLQA 1IOUA 4EEUA 2HV1A 3UE3A 3W2ZA 2W1TB 5HWVA 3S7OA 1GSVA 3NOUC 1F5MA 5G4ZA 2VEAA 3FC7A 4Q0IA 2PDRA 3PBOA 3F1PA 3IS2B 4HNBA 2VKSA 2ZMFA 4IUKA 1ODVA 5TBMA 1YSQA 3PBTA 2VJWA 2W0NA 4PHTA 3H7WA 4WLAA 1TS0A 3H9WA 1OT9A 3MFXA 3FG8A 2K31A 1TS8A 2A2LA 4IHQA 2K7SA 1N9NA 4CLCA 3OBFA 4EU0A 1GSWA 2L4RA 2Y8HA 3LIEA 3ZQ5A 2HJEA 3TJZC 4ARZB 2VA0A 4B9OA 4I38A 2L1MA 4HH2A 1OT6A 1Y28A 3EQUA 2V9AA 4HJ6A 5AVEA 5EFWA 3CLOA 3E4QA 2A24B 1XFQA 4KUKA 4NKPA 3EGDC 3BQAA 4I5SA 2O9BA 3HCYA 5CX7A 5F69A 4IUHA 4GS9A 3OCLA 4AFIA 4HH3A 4HOIA 4R6LA 3PBQA 3EOIA 5DF9A 3NJAA 2EA9A 2W1TA 1W63Q 2EWVA 2O9AA 3CUEA 3VOLA 1W63M 3P7NA 3MXQA 4Y2FA 3T4JA 4WL9A 4CLCE 3B47A 3ICYA 3T4KA 3VE4A 1ZHHB 1WA9A 3KSFA 3LIBA 3EGXC 1F9IA 4JGQA 1TF1A 2CMNA 4HJ3A 3CAXA 2XROA 4ETZA 5DJTA 2QJ7A 5HPIA 3T4LA 2P08A 4HHDA 1MC0A 1TS6A 4MN7A 5F5YA 4BJPA 1KOUA 1D06A 4BBVA 4I3JA 2I9VA 3R7WA 2VV8A 2Y79A 3C30A 3NHQA 1LT0A 1P97A 4R3AA 3T4QA 1X0OA 4ARZA 4DMZA 1IFQA 2W3FA 3H82B 3LR3A 2VGLM 3JVVA 4ETXA 2JKRM 5L8MA 1N9LA 3F1NB 4P6ZM 4CQHA 2IA2A 3KO6A 1LSXA 3S7QA 3U2AA 4EXOA 5DJUA 3C2WA 4PKYA 5DFXA 4JGPA 3PBNA 4NEED 3ULFA 3KSGA 2J80A 4H6JB 1NWZA 4EQ1A 3FPVA 3K2NA 3LIFA 3D3OA 4DJ3A 2HGVA 4O01A 2YKFA 4BBUA 4F3LB 2B18A 2INWA 4YOFA 5DFYA 2J3TC 2PYPA 1N9OA 2HF6A 1P0ZA 2O99A 1D7EA 3UB9A 4I39A 3VE3A 3MMHA 2Z6CA 1S67L 2JHEA 1XJ2A 3CI6A 4UQIS 2JKTM 3LR5A 1NLZA 2QJ5A 3MR0A 4EESA 5HZHA 3KYQA 3UMEA 2H28A 2VV6A 3UMDA 3TE8A 2ZBBA 2W3HA 2G7UA 4DJ2A 1S4SA 2ZOHA 5IU1A 2KOIA 4LRYC 5HDDA 1YSPA 1OPXA 2QKPA 3UB8A 3CWFA 4EEPA 2B02A 3IBJA 1DP9A 3LFVA 4PKYG 3C38A 3T4OA 4GHIA 1S4RA 3F1NA 2VV7A 2D02A 4RQ9A 3SW1A 5HWWA 3EEAA 2GX5A 3MJQA 4DN0A 3OLOA 3G6OA 4II7A 5IS1A 4L9FA 4H6JA 1S1ZA 3K3CA 3OC2A 3B42A 2M1CA 3HJKA 1OTEA 4F3LA 3ZYTA 2P7JA 2W1RA 3F1OB 3GDIA 3BY9A 2OWJA 3LR4A 1P9WA 3S7PA 4G3WA 2W27A 4WEJA 2J3WA 1G28A 3IS2A 3KSIA 2MJ6A 1TS7A 4GW9A 3LI8A 3PBRA 4HJ4A 5MC7A 4HQAA 2V0UA 4MN5A 4E04A 3NOPC 1NRJA 3RFBA 4LPZA 3D72A 3TW8A 4R38A 5HD3A 2PD8A 4IJGA 3MQ0A 2W3DA 4ZRRA 2W3EA 2V0WA 1YAXA 3PXPA 4B93A 4WUJA 5DKKA 3E0YA 4HI4A 1UWNX 3T4TA 2J3TD 2GJ3A 4NXFA 5HD5A 4LRZE 4MMNA 3IBRA 2PYRA 2DMWA 2OWHA 4WEKA 4OOMA 2LB5A 2A24A 1UWPX 3PHYA 3KX0X 4KUOA 1GSXA 2M7UA 2PR6A 3FPWA 3MF0A 1T19A 1VB6A 4MCWA 4FSFA 2XA7S 3F1OA 2O0YA 3BJNA 5IT5A 3BY8A 4P6ZS 3BWLA 2P04A 5F68A 3E4PA 3UB6A 5A8BA 4G3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XJ6 A;  4M4X A;  2D01 A;  1MZU A;  2L0W A;  5J3W A;  1F98 A;  1OTD A;  4HIA A;  4LRX C;  2KX6 A;  4I3I A;  2Z6D A;  5J4E A;  3RH8 B;  2R78 A;  4XT2 B;  1T1C A;  3B33 A;  3K3D A;  3NOT C;  3LIC A;  3MQO A;  3H82 A;  4R70 A;  1LSV A;  3LYX A;  4I3A A;  5DKL A;  1V9Z A;  1XFN A;  2YKH A;  3HJI A;  3UE6 A;  2WKQ A;  4HP4 A;  3EWK A;  5HDC A;  2QHK A;  3LI9 A;  1JNU A;  2ZOI A;  5KIZ A;  4WN5 A;  3LUQ A;  2KDK A;  1BYW A;  4HY8 A;  3A0V A;  2OOL A;  1T1A A;  5I5L A;  2BAS A;  5F6A A;  3GEC A;  1DP8 A;  3A0S A;  5HDS A;  1OJG A;  2PR5 A;  1V9Y A;  1XJ3 A;  4XT2 A;  3T50 A;  1LL8 A;  1T18 A;  2JN7 A;  3C8C A;  4L9E A;  4YWZ A;  3LIA A;  1S66 L;  5AVF A;  2WKR A;  1OJ5 A;  3UB7 A;  3EEH A;  4NXB A;  5HSQ A;  3A0R A;  5G4Y A;  4LLO B;  2V1A A;  1S1Y A;  4HP9 A;  2PD7 A;  1LSW A;  4EET B;  1EW0 A;  1OTA A;  5J7E A;  3F1P B;  1DP6 A;  5TBM B;  4BBT A;  3MQQ A;  4K08 A;  4L9G A;  2V1B A;  3H7W B;  1XJ4 A;  5HWT A;  2VLG A;  4EW7 A;  3PYP A;  4NXG A;  3LID A;  4GHI B;  1OTI A;  4NXE A;  4JGR A;  4KQD A;  4EER A;  3RTY A;  3E4O A;  4JGO A;  4MN6 A;  1OTB A;  1T1B A;  2WKP A;  1UGU A;  4WF0 A;  4GS9 B;  2PHY A;  4GCZ A;  2QWS A;  1DRM A;  4EEU A;  2HV1 A;  5HWV A;  1GSV A;  3NOU C;  5G4Z A;  2VEA A;  3FC7 A;  2PDR A;  3F1P A;  3IS2 B;  4HNB A;  5TBM A;  1ODV A;  2W0N A;  3H7W A;  4WLA A;  1TS0 A;  3H9W A;  1OT9 A;  3MFX A;  3FG8 A;  1TS8 A;  2K7S A;  1N9N A;  1GSW A;  2L4R A;  3LIE A;  3ZQ5 A;  4B9O A;  4I38 A;  2L1M A;  4HH2 A;  1OT6 A;  1Y28 A;  5AVE A;  2V9A A;  4HJ6 A;  5EFW A;  3CLO A;  3E4Q A;  2A24 B;  1XFQ A;  4KUK A;  4I5S A;  5F69 A;  4GS9 A;  4HH3 A;  4HOI A;  4R6L A;  3NJA A;  2EA9 A;  3VOL A;  3P7N A;  3MXQ A;  4WL9 A;  3ICY A;  3VE4 A;  1WA9 A;  3LIB A;  1F9I A;  4JGQ A;  2CMN A;  4HJ3 A;  3CAX A;  5DJT A;  2QJ7 A;  4HHD A;  1TS6 A;  5F5Y A;  1KOU A;  1D06 A;  4BBV A;  4I3J A;  2I9V A;  2VV8 A;  3NHQ A;  1LT0 A;  1P97 A;  4R3A A;  1X0O A;  3H82 B;  1N9L A;  3F1N B;  4EXO A;  1LSX A;  5DJU A;  3C2W A;  4PKY A;  4JGP A;  3ULF A;  2J80 A;  4H6J B;  1NWZ A;  4EQ1 A;  3LIF A;  4DJ3 A;  2YKF A;  4BBU A;  4F3L B;  2INW A;  1N9O A;  2PYP A;  1P0Z A;  1D7E A;  3UB9 A;  4I39 A;  3VE3 A;  2Z6C A;  1S67 L;  2JHE A;  1XJ2 A;  2QJ5 A;  3MR0 A;  4EES A;  5HZH A;  3UME A;  2H28 A;  2VV6 A;  3UMD A;  2ZBB A;  4DJ2 A;  1S4S A;  2ZOH A;  5IU1 A;  4LRY C;  5HDD A;  2QKP A;  3UB8 A;  3CWF A;  4EEP A;  2B02 A;  1DP9 A;  4PKY G;  4GHI A;  1S4R A;  3F1N A;  2VV7 A;  2D02 A;  4RQ9 A;  3SW1 A;  5HWW A;  3MJQ A;  3OLO A;  3G6O A;  5IS1 A;  4L9F A;  4H6J A;  1S1Z A;  3K3C A;  2M1C A;  3HJK A;  1OTE A;  4F3L A;  2P7J A;  3F1O B;  3GDI A;  3BY9 A;  2OWJ A;  2W27 A;  1G28 A;  3IS2 A;  1TS7 A;  4GW9 A;  3LI8 A;  4HJ4 A;  4HQA A;  2V0U A;  4MN5 A;  4E04 A;  3NOP C;  4LPZ A;  3D72 A;  4R38 A;  5HD3 A;  2PD8 A;  2V0W A;  4WUJ A;  5DKK A;  4HI4 A;  1UWN X;  2GJ3 A;  4NXF A;  5HD5 A;  4LRZ E;  3IBR A;  2PYR A;  2OWH A;  2A24 A;  1UWP X;  3PHY A;  3KX0 X;  4KUO A;  1GSX A;  2PR6 A;  1T19 A;  1VB6 A;  3F1O A;  3BY8 A;  3BWL A;  5F68 A;  3E4P A;  3UB6 A;  5A8B A; 
#chains in the Genus database with same CATH topology
 4ZDX A;  5G18 A;  2HDU A;  4M4X A;  4OKP A;  4EV4 A;  5GLC A;  5J3W A;  5FL3 A;  4R3B A;  3N7W A;  2GDN A;  1OTD A;  4LV1 A;  2VZW A;  3LY4 A;  5JYP A;  2FFF B;  3W4Q A;  4MNR A;  1W5D A;  4EUV A;  1U60 A;  5CHM A;  5LBR A;  4ZBE A;  1T1C A;  3EQV A;  3B33 A;  2BLS A;  3LIC A;  5TJJ A;  3H82 A;  4MBK A;  4R70 A;  4EWF A;  4K91 A;  1LSV A;  2JCH A;  2Y2M A;  3LYX A;  5AQA A;  4KZA A;  3OZH A;  4Y15 A;  5DKL A;  5AQ9 A;  3C7U A;  1XFN A;  2YKH A;  5FDH A;  1RP5 A;  5HAP A;  3WS5 A;  4Q0H A;  3DAV A;  3SH8 A;  2WKQ A;  3MZF A;  2XEP A;  3EWK A;  3DTE A;  3LI9 A;  3S7N A;  5FEG A;  1DJA A;  5F83 A;  5FAO A;  2KDK A;  3G2Y A;  1O7E A;  1RGZ A;  1JWZ A;  4JXG A;  1KDS A;  4O8G A;  5E43 A;  5A92 A;  1SZV A;  3ZNT A;  1XXM A;  2JN7 A;  4E3O A;  4Y0O A;  1DJB A;  3UN7 A;  1VHM A;  3V3S A;  1K55 C;  4NXB A;  2JKR I;  2XSS A;  3NCK A;  2LB9 A;  4LLO B;  2ZMA A;  3SS5 A;  2G2U A;  1LSW A;  1HVB A;  4N9K A;  3TSG A;  4P6B A;  3V50 A;  1ZTU A;  1DP6 A;  1TVF A;  3BEB A;  1CF0 A;  1GA0 A;  3G34 A;  3MQQ A;  4L9G A;  4JF6 A;  1XJ4 A;  3BQ8 A;  2H0T A;  1VQQ A;  3V39 A;  4OQI A;  3DTM A;  2V8F A;  4WZ5 C;  1S6R A;  3Q7V A;  1D1J A;  2Y2L A;  1K55 A;  1XKZ A;  5AQB A;  4BEN A;  4LGW A;  2PU2 A;  4X53 A;  4A5R A;  3E4O A;  2P9V B;  1MWR A;  2Y2O A;  1W79 A;  5C5K A;  4KZ5 A;  2XD1 A;  4WF0 A;  4PM6 A;  1FIL A;  2W3G A;  4JBF A;  1L0G A;  4GCZ A;  2QWS A;  1ES2 A;  4QU3 A;  1IOU A;  2ZQA A;  4WBG A;  3W2Z A;  4WMC A;  2W1T B;  3M2J A;  3MXR A;  5CTN A;  5HWV A;  3S7O A;  3NOU C;  2VEA A;  3N6I A;  4HES A;  3WWX A;  3SH9 A;  3IS2 B;  1JTG A;  5FAT A;  4O7D A;  3BEC A;  4IUK A;  1YSQ A;  4PHT A;  3SOI A;  1OT9 A;  1TS8 A;  2EX6 A;  2A2L A;  1M6K A;  3MFD A;  1GSW A;  2WGI A;  4R4S A;  2Q0O A;  3JPU A;  1QMF A;  2HJE A;  2VA0 A;  4E3N A;  1W7F A;  4HH2 A;  2V9A A;  2P9V A;  4HJ6 A;  1ES5 A;  5U47 A;  1H8Y A;  4LCL A;  2ZC3 B;  5DTK A;  3HCY A;  3OCL A;  3T12 B;  4R6L A;  3PBQ A;  4KZ4 A;  1SHV A;  2W1T A;  3CUE A;  3QP1 A;  4Y2F A;  1YT4 A;  4UAA A;  1BUE A;  3PTE A;  3CJM A;  1NYM A;  1ZHH B;  1VET B;  3KSF A;  3UPP A;  4MEZ A;  1TF1 A;  4HJ3 A;  1GCE A;  5HPI A;  3T4L A;  2P08 A;  4MN7 A;  1MC0 A;  1TS6 A;  3IHB A;  5F5Y A;  4WZ4 A;  1C3B A;  4BBV A;  3R7W A;  5M19 A;  2A3U A;  3NHQ A;  3DWZ A;  1M40 A;  4RVA A;  5CTM A;  1X0O A;  4KZ7 A;  3LR3 A;  5EOE A;  5M1A A;  3JVV A;  4ETX A;  1N9L A;  4R4R A;  4P6Z M;  2QMI A;  4K0X A;  2Y2N A;  2ACG A;  3U2A A;  2EX9 A;  5DJU A;  4QY5 A;  3ULF A;  4OP5 A;  2J80 A;  1NWZ A;  2WZX A;  2R9W A;  4NK3 A;  5EPH A;  2INW A;  1N9O A;  1P0Z A;  1YLP A;  2O99 A;  4OLD A;  5BOH A;  3VE3 A;  2UV0 E;  5FAS A;  3FKW A;  4DE3 A;  3LR5 A;  3LY3 A;  4EES A;  3IX4 A;  3S1Y A;  3GSG A;  3P09 A;  3TE8 A;  3PAG A;  2W3H A;  2G7U A;  4DJ2 A;  4R23 A;  2ZOH A;  3N4I A;  4HBU A;  3NUL A;  1OPX A;  1F2K A;  2Z2M B;  3IBJ A;  4IBX A;  3C38 A;  4GHI A;  1ESU A;  4KG5 A;  1K4E A;  1NJ4 A;  2GX5 A;  4X1M A;  3QNB A;  1PZP A;  3A3F A;  3T1Q B;  2PAV P;  2WAF A;  4GB7 A;  3SS4 A;  5E2H A;  5TGF A;  1TEM A;  2J3W A;  3NDG A;  5GHX A;  1LHY A;  3KSI A;  3AGD A;  4ZJ2 A;  5MC7 A;  2V0U A;  2ZQD A;  3NY4 A;  1NRJ A;  3DWK A;  1BLH A;  4JXS A;  4QB8 A;  1PI4 A;  2OSU A;  1KE4 A;  2RL3 A;  4DDS A;  4N1X A;  1CJF A;  4P87 A;  4N9L A;  2J9P A;  1HLU P;  5FDS A;  4B93 A;  1YAX A;  4WUJ A;  5EM1 A;  2J3T D;  2WKH A;  5EOO A;  5HD5 A;  2Q9N A;  2ZQ7 A;  2A24 A;  3KX0 X;  1GSX A;  1VB6 A;  2JE5 A;  2XA7 S;  2O0Y A;  4D60 A;  3BY8 A;  3BWL A;  2P04 A;  5F68 A;  1XJ6 A;  3TG9 A;  1BLS A;  2D01 A;  3N8R A;  2Q9M A;  1H8Z A;  1F98 A;  3UO9 A;  3OOV A;  4IBR A;  1YPR A;  2PT7 A;  2I72 A;  4LRX C;  4I3I A;  1NLY A;  1ACF A;  1K56 D;  4ID4 A;  4CLC C;  3BFD A;  2ZMV A;  3Q7Z A;  5HL6 A;  1KDW A;  3NOT C;  4Q0J A;  3JVU A;  3CPT B;  4S2M A;  2X71 A;  1BT5 A;  1FSW A;  4BWI A;  2ZL1 A;  2Y2J A;  3UY6 A;  3T1R A;  3HJI A;  3UE6 A;  3HVF A;  2GNX A;  4Z1W A;  2EX8 A;  5HDC A;  3SS3 A;  2OAQ 1;  5A90 A;  5CEC A;  4CPK A;  5FQM A;  4EUZ A;  1L0D A;  3ZG7 B;  3LUQ A;  4EBN A;  2R9X A;  4HY8 A;  4D2O A;  2C6W B;  2OOL A;  1T1A A;  1CQA A;  5I5L A;  3O3V A;  2O9C A;  4S2N C;  3UNW A;  2FH5 A;  5F82 A;  1DP8 A;  4QJG A;  1J3W A;  4ZAM A;  1HZO A;  4Y0U A;  4KQR A;  5FQQ A;  1PYY A;  3P01 A;  1T18 A;  3C8C A;  4YWZ A;  1K56 A;  3LIA A;  3CPT A;  3ZCZ A;  4GD6 A;  4MDZ A;  1L2S A;  1OJ5 A;  2WGW B;  5A91 A;  3VV4 A;  4E3I A;  2P74 A;  5GLB A;  4L0L A;  2V1A A;  1XGJ A;  2Y2H A;  2PD7 A;  4O0P A;  4JPM A;  3JYI A;  4MLL A;  3BRM A;  2VGL S;  3CZD A;  3QP5 A;  1MKI A;  4UHU A;  4BBT A;  5HX9 A;  4OOL A;  1FIK A;  1IYQ A;  3DBA A;  3V67 A;  1STZ A;  1L0F A;  2V8C A;  4EW7 A;  3OCN A;  1XP4 A;  3Q82 A;  2ZM0 A;  4OPQ A;  4WYY A;  1PI5 A;  2XA7 M;  1KVM A;  4NXE A;  3KYE A;  4JGR A;  1G68 A;  3T4S A;  1H5X A;  3HUM A;  3KSH A;  5KZH A;  3FKV A;  4C6Y A;  1LI0 A;  4N92 A;  3UB5 P;  3CIT A;  5DTS A;  2EXA A;  2WAD A;  2EFU A;  2PHY A;  1DRM A;  4GJ4 A;  3GTC A;  4S2P A;  5CER A;  1KGE A;  5G4Z A;  5JYO A;  2JBF A;  4OP8 A;  2ZMF A;  3LO7 A;  1MWS A;  3PBT A;  2W0N A;  1TS0 A;  3MFX A;  2XK1 A;  4EQI A;  4E6X A;  2OLU A;  3BYD A;  3OBF A;  3A3I A;  2ZM8 A;  4B9O A;  5HL1 A;  3VFH A;  1OT6 A;  1Y28 A;  5AVE A;  3CLO A;  3D4F A;  5FQ9 A;  5HAQ A;  1TDL A;  1ONG A;  4KUK A;  4NKP A;  4R1G A;  2O9B A;  4K0W A;  4HOI A;  5DF9 A;  1W63 Q;  2DNS A;  2OLV A;  1ZG6 A;  3GVB A;  3B47 A;  3ICY A;  3T4K A;  5FQI A;  4WMC D;  1PZO A;  1WA9 A;  3UPN A;  3GV9 A;  3Q1F A;  3NC8 A;  3WS0 A;  3EGX C;  3HBR A;  4OVD A;  2XRO A;  1K6R A;  1KGF A;  3FV7 A;  3W4O A;  2DRW A;  4E3M A;  1KOU A;  4KZ3 A;  3LGO A;  4XUX A;  3C30 A;  4E3L A;  1LT0 A;  4R3A A;  5CEB A;  1SKF A;  1IYS A;  1LL5 A;  2VGL M;  1N4O A;  2JKR M;  2XFT A;  3F1N B;  1K38 A;  2ZC5 B;  4RA7 A;  2IA2 A;  3KO6 A;  3ZFZ A;  4LFU A;  1GA9 A;  4JGP A;  4KG6 A;  3KSG A;  4H6J B;  4LV2 A;  3FPV A;  4DJ3 A;  4O01 A;  1ZG4 A;  2YKF A;  4F3L B;  2B18 A;  5DFY A;  4DE2 A;  2PYP A;  4DE1 A;  2HF6 A;  2A49 A;  4LCM A;  4I39 A;  4X68 A;  3UB9 A;  1NRF A;  3AGE A;  3MMH A;  5M18 A;  4WZ5 A;  4DRT A;  1S67 L;  3FZC A;  5D3O A;  4FH4 A;  5HZH A;  4PPR A;  3UMD A;  2ZBB A;  4KZ9 A;  1JWV A;  5HDD A;  4PM8 A;  4B88 A;  1HTZ A;  3CWF A;  1BLC A;  4EEP A;  1HD8 A;  4GD8 A;  4QD4 A;  1S4R A;  3F1N A;  1WE4 A;  1KE0 A;  4RQ9 A;  3SW1 A;  3I7J A;  1PW8 A;  3MJQ A;  5EE8 A;  4DN0 A;  3DTK A;  3PAE A;  5L2F A;  3P98 A;  3ZVT A;  3LEZ A;  1YLT A;  5HAR A;  3QP2 A;  4H6J A;  1S1Z A;  5CED A;  2WAE A;  3FYZ A;  4OQ0 A;  4F3L A;  1I2W A;  2UWX A;  3ZYT A;  1K57 C;  3F1O B;  3BY9 A;  2OWJ A;  3LR4 A;  2WKE A;  1PFL A;  4DE0 A;  1LI9 A;  3D9Y A;  3UE0 A;  2W27 A;  1XPB A;  3DW0 A;  5FEF A;  3IS2 A;  3IHA A;  4XUZ A;  1TS7 A;  1MWU A;  4HJ4 A;  3LI8 A;  4ESP A;  4KG2 A;  4HQA A;  4MN5 A;  3S4X A;  1JVJ A;  3NOP C;  5FAP A;  3WRZ A;  1RGY A;  3V3R A;  2Y2G A;  5EM0 A;  3GMW A;  2W3D A;  4ZRR A;  4JXV A;  4LV3 A;  2X01 A;  2RCX A;  4OPY A;  1K57 A;  3NDE A;  4HI4 A;  3M6B A;  1KE3 A;  4NXF A;  1W8Y A;  5I94 A;  3G2Z A;  4LRZ E;  3IBR A;  2DMW A;  3VFF A;  4OOM A;  2LB5 A;  3A3D A;  2M7U A;  1S0W A;  1T19 A;  2OV5 A;  4MCW A;  3OPL A;  1DY6 A;  3F1O A;  4GKU A;  1RCJ A;  3UB6 A;  4G3K A;  4UA9 A;  2L0W A;  4X1L A;  1VET A;  1TD5 A;  3M2K A;  2XR0 A;  2HDR A;  4Y17 A;  3R4K A;  2XFS A;  4QWO A;  4OLG A;  1K4F A;  4BQM A;  5FQJ A;  1PWC A;  5J4E A;  4UEY A;  1P9R A;  1K54 C;  3ISG A;  1NXY A;  1H3Q A;  3TRC A;  4DXB A;  3IWI A;  3C5A A;  3HLB A;  5HW3 A;  1H8M A;  3ZG9 B;  3IXB A;  5EVI B;  2VK3 A;  4LV0 A;  2BTF P;  3W4P A;  2NUT C;  1PNE A;  4U0T A;  3QP4 A;  2GZA A;  3MBZ A;  4HP4 A;  3AGF A;  3ZG8 B;  1JNU A;  5EVI C;  1K54 A;  3O87 A;  4WN5 A;  5KIZ A;  1L0E A;  2Z2L B;  2VGJ A;  2WZZ A;  4PAU A;  3ZG0 A;  2HP6 A;  3IF5 A;  2BAS A;  4GOG A;  5F6A A;  3GEC A;  1SDE A;  3VOZ A;  1OJG A;  1XJ3 A;  1LL8 A;  2WYX A;  4UA6 A;  1S66 L;  1E3U A;  5AJG A;  3G32 A;  1SKO B;  2Y55 A;  3HLW A;  3EEH A;  2V20 A;  5G4Y A;  1YM1 A;  3A3E A;  4EET B;  5FQK A;  3F1P B;  3LEQ A;  4F94 A;  3QP6 A;  3E2K A;  1I2S A;  1K25 A;  4K08 A;  3ITA A;  2V1B A;  2EWW A;  4CLC D;  2ZC6 B;  5FI6 A;  1YKD A;  5HWT A;  2PU4 A;  4Y5F A;  1YLZ A;  2C5W B;  2VLG A;  4OPR A;  4NXG A;  5FI7 A;  1TDG A;  4CLC B;  2JKT I;  1IKG A;  2VX8 A;  3QNC A;  3BFE A;  3LR0 A;  3WS4 A;  3C7V A;  3RTY A;  1MY8 A;  4HBT A;  1OTB A;  1T1B A;  5FSR A;  1SKO A;  2WKP A;  3UDX A;  3PBS A;  2J8Y A;  1FCN A;  4EEU A;  4H8R A;  5F1G A;  1GSV A;  3HL9 A;  4FUW A;  3IXH A;  2HDS A;  4Q0I A;  2PDR A;  4UA7 A;  3PBO A;  3SZT A;  1ERM A;  4BL3 A;  3F1P A;  3W8K A;  2JC7 A;  4HNB A;  5HAI A;  2VKS A;  1FCM A;  1JTD A;  4OPZ A;  2VJW A;  2Y2K A;  3MKF A;  4WLA A;  1Y4O A;  3HRE A;  2WK0 A;  3IXG A;  5DTT A;  2K31 A;  2HP5 A;  3IXD A;  4IHQ A;  2K7S A;  2H10 A;  1N9N A;  4QY6 A;  4CLC A;  4PM5 A;  4JF4 A;  1IEL A;  4U3T A;  2Y8H A;  4RYE A;  2ZLY A;  1EWZ A;  4S2L A;  4JF5 A;  3MSH A;  1YQS A;  2V2F F;  2XD5 A;  3EQU A;  4R0Q A;  3G4P A;  4IVK A;  4B4Z A;  3E4Q A;  4IVI A;  3UPO A;  2VGK A;  1CEG A;  4AFI A;  4I5S A;  1MXO A;  1EI5 A;  4DF6 A;  3EOI A;  3NJA A;  2EA9 A;  3VOL A;  1W63 M;  3MXQ A;  3T4J A;  4KZ6 A;  1VEU B;  4WL9 A;  4OQH A;  4CLC E;  3RJU A;  3UE1 A;  2DCF A;  2CC1 A;  3NI9 A;  4S2N A;  4ETZ A;  1ES4 A;  3O86 A;  5DJT A;  4Y0T A;  4HHD A;  1D06 A;  1Y54 A;  4I3J A;  2Y79 A;  1P97 A;  3U4L P;  4OON A;  3NBL A;  2W3F A;  3H82 B;  2JKF A;  1CK3 A;  2HDQ A;  5L8M A;  2ZM2 A;  2HZ5 A;  4CQH A;  4E3K A;  4NET A;  1PWD A;  3C2W A;  3RXW A;  4JXW A;  4EBL A;  1VEU A;  1WYB A;  3D3O A;  2J9O A;  2HGV A;  5HFO A;  4YIN A;  5GLA A;  1ES3 A;  1Q2Q A;  2WGW A;  1D7E A;  1MWT A;  3HUO A;  2XLN A;  2EFX A;  2Z6C A;  3G35 A;  3IWQ A;  4IED A;  3CMZ A;  2JHE A;  3T1S A;  4E3J A;  2HPB A;  1XJ2 A;  4UQI S;  3IH9 A;  1VM1 A;  4GNU A;  1NLZ A;  3MR0 A;  2EXB A;  3MXS A;  3V5M A;  2VV6 A;  4Z9Q A;  1FQG A;  4QHC A;  1S4S A;  3Q07 A;  5KMW A;  5IU1 A;  2JKG A;  1YSP A;  3IF6 B;  4DDY A;  3RXX A;  1N9B A;  1DP9 A;  4PKY G;  3T4O A;  5L09 A;  1Q2P A;  3SH7 A;  1BTL A;  4HEF A;  2D02 A;  1XGI A;  5HWW A;  3EEA A;  2ZQC A;  3OLO A;  3G6O A;  1CEF A;  1E25 A;  3WRT A;  5IS1 A;  1W8Q A;  4L9F A;  3OC2 A;  3K3C A;  1YMX A;  3IF6 C;  2M1C A;  3HJK A;  1SCW A;  1OTE A;  4GZB A;  1MBL A;  1CI8 A;  3VP0 A;  2P7J A;  3GDI A;  4S2I A;  1P9W A;  5FAQ A;  4DKI A;  1PWG A;  1FCO A;  4G3W A;  3Q7V B;  4WEJ A;  1K6S A;  1LLB A;  1G28 A;  5GLD A;  3VP3 A;  5J8X A;  5DF7 A;  3VP2 A;  3PBR A;  5CHJ A;  1WYC A;  3N8S A;  4FH2 A;  4X55 A;  1YMS A;  1PW1 A;  1SDN A;  4R38 A;  3IF6 A;  2XQZ A;  1JWP A;  3VP1 A;  2ZC7 A;  4IJG A;  2XDM A;  4S2K A;  2W3E A;  5EVL A;  3PXP A;  4C75 A;  1UWN X;  2WKI A;  3G31 A;  4BD0 A;  2OWH A;  4WEK A;  5EV0 A;  5FI2 A;  3PHY A;  2PR6 A;  3MF0 A;  2IWB A;  5E2F A;  2XGN A;  4FSF A;  3BJN A;  4FD8 A;  4JKT A;  3T1X A;  4P6Z S;  3E4P A;  4R3J A;  5A8B A;  1A0K A;  2G2W A;  1GHM A;  1MZU A;  5L10 A;  2NUP C;  4HIA A;  5GHY A;  4YNR A;  2KX6 A;  3VSK A;  2Z6D A;  1G6A A;  2HP9 A;  4OQG A;  1K0K A;  3RH8 B;  4BMW A;  2R78 A;  4BD1 A;  4XT2 B;  4WEL A;  5GHZ A;  1J9M A;  3ZG5 A;  4UQI M;  3CG5 A;  4OH0 A;  3K3D A;  3MQO A;  4ZTK A;  3MZE A;  1GHP A;  3BW6 A;  2X02 A;  4QPR A;  3LCE A;  2OAP 1;  2B95 A;  1NZU A;  4GDB A;  4I3A A;  1V9Z A;  5FA7 A;  1BSG A;  3N8L A;  4KZ8 A;  2H0Y A;  3QHY A;  5KSC A;  2QYB A;  3CUE C;  1Z6F A;  1NYY A;  5L07 A;  1Z09 A;  4X6T A;  4FTX A;  2BG1 A;  2QHK A;  3R7W B;  2ZOI A;  4JLF A;  4GDN A;  3KYZ A;  1BYW A;  3A0V A;  1AWI A;  4ZJ1 A;  2Y59 A;  1KGG A;  4KQO A;  4Q8I A;  5HPF A;  3A0S A;  4ME4 A;  2Y2I A;  4NG2 A;  5HDS A;  3Q81 A;  4Y3I A;  2PBD P;  2PR5 A;  3O5Y A;  3C4P A;  1V9Y A;  4XT2 A;  5CGW A;  3T50 A;  3HLG A;  4L9E A;  1E4D A;  1G6O A;  3BLM A;  5DF8 A;  5AVF A;  2WKR A;  4PM7 A;  3IQA A;  3UB7 A;  2K2N A;  3E98 A;  5HSQ A;  2AVX A;  5K5B A;  3A0R A;  1BZA A;  4FOF A;  1S1Y A;  4HP9 A;  3UDF A;  1ERO A;  1EW0 A;  1OTA A;  4GN2 A;  2XRN A;  5J7E A;  2QZ6 A;  2FZ0 A;  2ZC4 B;  3ZHH A;  5TBM B;  1FSY A;  2ZD8 A;  4E6W A;  3H7W B;  4G3V A;  3ZNY A;  2KLI A;  3PR6 A;  3PYP A;  4M3K A;  3VSL A;  3WS1 A;  1YLJ A;  3O88 A;  3LID A;  4KZB A;  3ZGA B;  4GHI B;  5DVA A;  1OTI A;  3ZDJ A;  1ONH A;  4KQD A;  4EER A;  5KSH A;  1MKM A;  4U0X A;  4XXR A;  2M7V A;  4PM9 A;  1LL9 A;  1XX2 A;  4JGO A;  4MN6 A;  3BFC A;  1UGU A;  2Y2P A;  3QP8 A;  1E3U D;  4GS9 B;  4BL2 A;  2HJ9 C;  5EVI D;  4GLQ A;  2HV1 A;  3UE3 A;  1QME A;  1XA7 A;  4BLM A;  2IWD A;  1F5M A;  3OPP A;  5E2G A;  3FC7 A;  5CGS A;  3GRJ A;  1ODV A;  5TBM A;  4X25 A;  3H7W A;  3L9K A;  3H9W A;  4N1H A;  1H0M A;  3FG8 A;  1XA1 A;  3HLC A;  4EBP A;  4EU0 A;  2L4R A;  3HLD A;  3DTI A;  3TOI A;  3LIE A;  4KQQ A;  4CJN A;  3IT9 A;  3BLS A;  3ZQ5 A;  3TJZ C;  4ARZ B;  3OPR A;  4I38 A;  2L1M A;  4Y13 A;  1GHI A;  3BFF A;  5EFW A;  1FR1 A;  5IHV A;  5EEC A;  3IX8 A;  2A24 B;  3S22 A;  3OPH A;  1XFQ A;  2V1Z A;  3HLF A;  3EGD C;  5CX7 A;  3BQA A;  5F69 A;  4IUH A;  4GS9 A;  4S2O A;  4HH3 A;  2EWV A;  2O9A A;  1MPL A;  5CGX A;  3P7N A;  5F1F A;  3CHW P;  4C3Q A;  1AXB A;  4OOY A;  5EVI A;  3VE4 A;  3L7H A;  3M6H A;  4X56 A;  3LIB A;  3NIA A;  3A3J A;  1F9I A;  4JGQ A;  2CMN A;  3CAX A;  2QJ7 A;  2ZQ9 A;  1FOF A;  1KVL A;  4BJP A;  5AQ7 A;  2I9V A;  2VV8 A;  2FFY A;  1CI9 A;  2PBY A;  3IWO A;  4YFM A;  3T4Q A;  4DXC A;  4ARZ A;  4DMZ A;  1IYP A;  1IFQ A;  3C4O A;  3MKE A;  4MBH A;  2ZL1 B;  4EXO A;  3S7Q A;  1LSX A;  4RX3 A;  1ERQ A;  2J7V A;  1ALQ A;  1L3L A;  1PIO A;  4PKY A;  5DFX A;  3PBN A;  4NEE D;  5CXW A;  1YLY A;  2Y91 A;  4Y7P A;  4EQ1 A;  1G5U A;  3K2N A;  3LIF A;  2XH9 A;  4BBU A;  4X69 A;  4YOF A;  3BM6 A;  2J3T C;  1IYO A;  4PMA A;  3MZD A;  3E2L A;  5EVE A;  4P85 A;  3CI6 A;  2JKT M;  2QJ5 A;  2Y2Q A;  4MBF A;  2ZJ9 A;  3IX3 A;  3KYQ A;  3UME A;  2H28 A;  2IWC A;  5A93 A;  5TFQ A;  1IEM A;  1YLW A;  1NZO A;  4KEN B;  2EX2 A;  2KOI A;  4LRY C;  1ESI A;  3ITB A;  2QKP A;  3B3X A;  3UB8 A;  2PRF A;  2B02 A;  2ZQ8 A;  3LFV A;  2VV7 A;  1O07 A;  3HUN A;  4II7 A;  3WS2 A;  1ZKJ A;  3IH8 A;  3B42 A;  3VP4 A;  3GQZ A;  2H5S A;  2XF3 A;  2W1R A;  2B5R A;  4RX2 A;  3VOY A;  1ZC2 A;  3S7P A;  3FWL A;  3UDI A;  5CRF A;  2Y4A A;  5CHU A;  2QPN A;  2MJ6 A;  2E8J A;  4GW9 A;  5GL9 A;  5TR7 A;  4E04 A;  3RFB A;  4FCF A;  4LPZ A;  3D72 A;  3TW8 A;  5EUA A;  3VMA A;  5HD3 A;  3MS6 A;  4WM9 A;  1NY0 A;  1IKI A;  4P0M A;  2PD8 A;  3MQ0 A;  2WGV A;  4S2J A;  4B4X A;  2V0W A;  1DJC A;  5DKK A;  3E0Y A;  3T4T A;  1OME A;  2GJ3 A;  1BUL A;  1I5Q A;  3BFG A;  2E8I A;  4ZJ3 A;  4MMN A;  2PYR A;  3ZVW A;  3HLE A;  2WUQ A;  1UWP X;  4KUO A;  3FPW A;  3GR2 A;  1FR6 A;  1BLP A;  3NEC A;  5IT5 A;  4LEN A;  5E2E A;  1PRQ A;  3G30 A; 
#chains in the Genus database with same CATH homology
 1XJ6 A;  4M4X A;  2D01 A;  1MZU A;  2L0W A;  1TD5 A;  5FL3 A;  5J3W A;  1F98 A;  2NUP C;  1OTD A;  4HIA A;  3R4K A;  3OOV A;  2VZW A;  2PT7 A;  4LRX C;  4YNR A;  2KX6 A;  4I3I A;  1NLY A;  2Z6D A;  4EUV A;  5J4E A;  3RH8 B;  5LBR A;  4UEY A;  4BMW A;  4CLC C;  2R78 A;  2ZMV A;  1P9R A;  5HL6 A;  4XT2 B;  4WEL A;  1H3Q A;  1T1C A;  3EQV A;  3TRC A;  3B33 A;  4UQI M;  3K3D A;  3NOT C;  4Q0J A;  3LIC A;  3JVU A;  3MQO A;  5TJJ A;  3H82 A;  1H8M A;  3BW6 A;  4R70 A;  4QPR A;  1LSV A;  4BWI A;  2OAP 1;  3LYX A;  4I3A A;  5DKL A;  1V9Z A;  2NUT C;  1XFN A;  2YKH A;  3HJI A;  3UE6 A;  2QYB A;  4Q0H A;  2GZA A;  3CUE C;  2WKQ A;  4HP4 A;  2GNX A;  4Z1W A;  3EWK A;  5HDC A;  2OAQ 1;  2QHK A;  3LI9 A;  3S7N A;  3R7W B;  1JNU A;  2ZOI A;  5KIZ A;  4WN5 A;  3LUQ A;  3KYZ A;  2KDK A;  1BYW A;  4HY8 A;  3A0V A;  2OOL A;  1T1A A;  5I5L A;  4PAU A;  2O9C A;  2BAS A;  4KQO A;  2FH5 A;  5F6A A;  5HPF A;  3GEC A;  1DP8 A;  3A0S A;  4ME4 A;  4O8G A;  5HDS A;  4Y3I A;  1OJG A;  2PR5 A;  3O5Y A;  1V9Y A;  1XJ3 A;  4XT2 A;  3T50 A;  1LL8 A;  3P01 A;  1T18 A;  2JN7 A;  3C8C A;  4L9E A;  4YWZ A;  3LIA A;  1G6O A;  1S66 L;  5AVF A;  2WKR A;  5AJG A;  1VHM A;  4MDZ A;  1OJ5 A;  3UB7 A;  3EEH A;  2K2N A;  3E98 A;  4NXB A;  3VV4 A;  2JKR I;  5HSQ A;  5K5B A;  2XSS A;  3A0R A;  5G4Y A;  4FOF A;  4L0L A;  2LB9 A;  2V1A A;  4LLO B;  1S1Y A;  4HP9 A;  2PD7 A;  1LSW A;  4EET B;  1EW0 A;  1OTA A;  4O0P A;  2XRN A;  5J7E A;  1ZTU A;  3F1P B;  1DP6 A;  2FZ0 A;  2VGL S;  5TBM B;  4BBT A;  3MQQ A;  4K08 A;  4OOL A;  4L9G A;  2V1B A;  3DBA A;  3H7W B;  3V67 A;  1XJ4 A;  1STZ A;  2EWW A;  4G3V A;  4CLC D;  3BQ8 A;  1YKD A;  5HWT A;  2KLI A;  4Y5F A;  2VLG A;  3PR6 A;  4EW7 A;  3PYP A;  3OCN A;  4NXG A;  4CLC B;  2JKT I;  3LID A;  2VX8 A;  2XA7 M;  4GHI B;  1OTI A;  4NXE A;  3LR0 A;  4JGR A;  4KQD A;  4EER A;  5KSH A;  3T4S A;  1MKM A;  2M7V A;  3RTY A;  3E4O A;  4JGO A;  3KSH A;  4MN6 A;  1OTB A;  1T1B A;  5C5K A;  3CIT A;  2WKP A;  1UGU A;  4WF0 A;  2W3G A;  3PBS A;  4GS9 B;  2PHY A;  4GCZ A;  2QWS A;  2HJ9 C;  1DRM A;  4GJ4 A;  4GLQ A;  1IOU A;  4EEU A;  2HV1 A;  3UE3 A;  3W2Z A;  2W1T B;  5HWV A;  3S7O A;  1GSV A;  3NOU C;  1F5M A;  5G4Z A;  2VEA A;  3FC7 A;  4Q0I A;  2PDR A;  3PBO A;  3F1P A;  3IS2 B;  4HNB A;  2VKS A;  2ZMF A;  4IUK A;  1ODV A;  5TBM A;  1YSQ A;  3PBT A;  2VJW A;  2W0N A;  4PHT A;  3H7W A;  4WLA A;  1TS0 A;  3H9W A;  1OT9 A;  3MFX A;  3FG8 A;  2K31 A;  1TS8 A;  2A2L A;  4IHQ A;  2K7S A;  1N9N A;  4CLC A;  3OBF A;  4EU0 A;  1GSW A;  2L4R A;  2Y8H A;  3LIE A;  3ZQ5 A;  2HJE A;  3TJZ C;  4ARZ B;  2VA0 A;  4B9O A;  4I38 A;  2L1M A;  4HH2 A;  1OT6 A;  1Y28 A;  3EQU A;  2V9A A;  4HJ6 A;  5AVE A;  5EFW A;  3CLO A;  3E4Q A;  2A24 B;  1XFQ A;  4KUK A;  4NKP A;  3EGD C;  3BQA A;  4I5S A;  2O9B A;  3HCY A;  5CX7 A;  5F69 A;  4IUH A;  4GS9 A;  3OCL A;  4AFI A;  4HH3 A;  4HOI A;  4R6L A;  3PBQ A;  3EOI A;  5DF9 A;  3NJA A;  2EA9 A;  2W1T A;  1W63 Q;  2EWV A;  2O9A A;  3CUE A;  3VOL A;  1W63 M;  3P7N A;  3MXQ A;  4Y2F A;  3T4J A;  4WL9 A;  4CLC E;  3B47 A;  3ICY A;  3T4K A;  3VE4 A;  1ZHH B;  1WA9 A;  3KSF A;  3LIB A;  3EGX C;  1F9I A;  4JGQ A;  1TF1 A;  2CMN A;  4HJ3 A;  3CAX A;  2XRO A;  4ETZ A;  5DJT A;  2QJ7 A;  5HPI A;  3T4L A;  2P08 A;  4HHD A;  1MC0 A;  1TS6 A;  4MN7 A;  5F5Y A;  4BJP A;  1KOU A;  1D06 A;  4BBV A;  4I3J A;  2I9V A;  3R7W A;  2VV8 A;  2Y79 A;  3C30 A;  3NHQ A;  1LT0 A;  1P97 A;  4R3A A;  3T4Q A;  1X0O A;  4ARZ A;  4DMZ A;  1IFQ A;  2W3F A;  3H82 B;  3LR3 A;  2VGL M;  3JVV A;  4ETX A;  2JKR M;  5L8M A;  1N9L A;  3F1N B;  4P6Z M;  4CQH A;  2IA2 A;  3KO6 A;  1LSX A;  3S7Q A;  3U2A A;  4EXO A;  5DJU A;  3C2W A;  4PKY A;  5DFX A;  4JGP A;  3PBN A;  4NEE D;  3ULF A;  3KSG A;  2J80 A;  4H6J B;  1NWZ A;  4EQ1 A;  3FPV A;  3K2N A;  3LIF A;  3D3O A;  4DJ3 A;  2HGV A;  4O01 A;  2YKF A;  4BBU A;  4F3L B;  2B18 A;  2INW A;  4YOF A;  5DFY A;  2J3T C;  2PYP A;  1N9O A;  2HF6 A;  1P0Z A;  2O99 A;  1D7E A;  3UB9 A;  4I39 A;  3VE3 A;  3MMH A;  2Z6C A;  1S67 L;  2JHE A;  1XJ2 A;  3CI6 A;  4UQI S;  2JKT M;  3LR5 A;  1NLZ A;  2QJ5 A;  3MR0 A;  4EES A;  5HZH A;  3KYQ A;  3UME A;  2H28 A;  2VV6 A;  3UMD A;  3TE8 A;  2ZBB A;  2W3H A;  2G7U A;  4DJ2 A;  1S4S A;  2ZOH A;  5IU1 A;  2KOI A;  4LRY C;  5HDD A;  1YSP A;  1OPX A;  2QKP A;  3UB8 A;  3CWF A;  4EEP A;  2B02 A;  3IBJ A;  1DP9 A;  3LFV A;  4PKY G;  3C38 A;  3T4O A;  4GHI A;  1S4R A;  3F1N A;  2VV7 A;  2D02 A;  4RQ9 A;  3SW1 A;  5HWW A;  3EEA A;  2GX5 A;  3MJQ A;  4DN0 A;  3OLO A;  3G6O A;  4II7 A;  5IS1 A;  4L9F A;  4H6J A;  1S1Z A;  3K3C A;  3OC2 A;  3B42 A;  2M1C A;  3HJK A;  1OTE A;  4F3L A;  3ZYT A;  2P7J A;  2W1R A;  3F1O B;  3GDI A;  3BY9 A;  2OWJ A;  3LR4 A;  1P9W A;  3S7P A;  4G3W A;  2W27 A;  4WEJ A;  2J3W A;  1G28 A;  3IS2 A;  3KSI A;  2MJ6 A;  1TS7 A;  4GW9 A;  3LI8 A;  3PBR A;  4HJ4 A;  5MC7 A;  4HQA A;  2V0U A;  4MN5 A;  4E04 A;  3NOP C;  1NRJ A;  3RFB A;  4LPZ A;  3D72 A;  3TW8 A;  4R38 A;  5HD3 A;  2PD8 A;  4IJG A;  3MQ0 A;  2W3D A;  4ZRR A;  2W3E A;  2V0W A;  1YAX A;  3PXP A;  4B93 A;  4WUJ A;  5DKK A;  3E0Y A;  4HI4 A;  1UWN X;  3T4T A;  2J3T D;  2GJ3 A;  4NXF A;  5HD5 A;  4LRZ E;  4MMN A;  3IBR A;  2PYR A;  2DMW A;  2OWH A;  4WEK A;  4OOM A;  2LB5 A;  2A24 A;  1UWP X;  3PHY A;  3KX0 X;  4KUO A;  1GSX A;  2M7U A;  2PR6 A;  3FPW A;  3MF0 A;  1T19 A;  1VB6 A;  4MCW A;  4FSF A;  2XA7 S;  3F1O A;  2O0Y A;  3BJN A;  5IT5 A;  3BY8 A;  4P6Z S;  3BWL A;  2P04 A;  5F68 A;  3E4P A;  3UB6 A;  5A8B A;  4G3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...