4ESPA

Crystal structure of peanut allergen ara h 5
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
130
structure length
130
Chain Sequence
b'SWQTYVDDHLLCEIEGNHLSSAAILGQDGSVWAQSSNFPQFKPEEITAIMNDFAEPGSLAPTGLYLGGTKYMVIQGEPGTVIRGKKGPGGVTIKKTNQALIIGIYDEPMTPGQCNMIVEKLGDYLIDTGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin
publication title Crystal Structure of Peanut ( Arachis hypogaea ) Allergen Ara h 5.
pubmed doi rcsb
source organism Arachis hypogaea
molecule tags Allergen
total genus 39
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2012-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4espA00
1G5UA 2B95A 3CPTA 1PFLA 5EV0A 4FUWA 1ACFA 4D60A 1K0KA 5EM1A 4X25A 1CJFA 1SKOB 3LGOA 2V8FA 1SKOA 5FDSA 3D9YA 1A0KA 1FILA 3LEQA 3L7HA 5FEFA 3T1SA 1VETA 2ACGA 4X1MA 2E8JA 2PBDP 1VEUB 3DAVA 5FEGA 3L9KA 1SZVA 1VEUA 1YPRA 1Z09A 2PRFA 3KYEA 4QWOA 2V8CA 3T12B 5EVEA 1CQAA 1AWIA 3MSHA 3T1QB 2PAVP 2BTFP 2JKGA 1CF0A 4FTXA 2JKFA 1J3WA 2ZL1B 3UB5P 1PRQA 3NECA 1D1JA 4X1LA 3NULA 3CPTB 3MS6A 1HLUP 2VK3A 5EM0A 2HZ5A 1PNEA 1Y4OA 3U4LP 3T1RA 3CHWP 4ESPA 1FIKA 1F2KA 1VETB 2ZL1A 3T1XA
chains in the Genus database with same CATH superfamily
4LV3A 1ES2A 3LIEA 5FATA 1OJGA 3Q7VA 5EV0A 3N4IA 3N8RA 4JGOA 1ACFA 3S7OA 3AGDA 2B02A 3UB9A 4EESA 1D7EA 2WKEA 2XQZA 1YMXA 3T4TA 4LPZA 3BY8A 1K57A 4F3LB 1Q2PA 3IXGA 4F94A 1PWGA 4OPQA 3LIAA 3R4KA 3DAVA 3LFVA 2M7VA 3LYXA 1Z09A 3M6HA 3EGXC 4UA6A 4QWOA 1YLTA 4KQOA 5A90A 4X55A 1AWIA 1K4EA 1MPLA 1YSQA 4KZ5A 3MXSA 2JN7A 3B47A 1U60A 3BECA 3PTEA 3VOYA 5CGSA 4R4RA 3HUNA 2P7JA 4S2NC 1CF0A 3DW0A 5IS1A 3F1OA 3UB5P 4JF5A 4E3MA 3NOPC 3Q82A 1ALQA 4KZ4A 1D1JA 1ES5A 5L2FA 1GHMA 3PAEA 2PHYA 5FI6A 3IBJA 2EA9A 3LR3A 1KGGA 2VZWA 5FAPA 2Y2OA 1YLJA 1TF1A 3TJZC 2VV8A 3LR4A 3S22A 3MQQA 1EW0A 1CI9A 3UDIA 3A3FA 4HI4A 1F2KA 3UB7A 4EWFA 1XFNA 1N4OA 2WAEA 5CX7A 2Y2JA 3V67A 1N9NA 1VM1A 5TGFA 2ZMVA 3MKEA 2WGVA 4H6JA 3TG9A 5IT5A 3HBRA 3GECA 3HUMA 1SKOB 4YINA 4HJ6A 1VQQA 3QP6A 3E98A 5FSRA 3PBNA 1K56A 5LBRA 4PHTA 4LRZE 1T1AA 3LCEA 5EE8A 2ACGA 1KOUA 3ITBA 2PBDP 4KZAA 5FQ9A 3L9KA 1L3LA 2EX6A 3LR5A 4X53A 3KYEA 5EOOA 2Z6DA 3OPPA 4IUKA 1XA1A 3IWOA 4U3TA 4UQIS 1IELA 5KSCA 5EUAA 3O88A 5J8XA 3LI8A 4ZJ2A 2QYBA 3K3CA 3BEBA 1H3QA 5M1AA 4WLAA 3RXXA 1Z6FA 2PR6A 1S1ZA 1K6SA 3IHBA 2W3EA 1LL5A 1PZPA 1RGYA 4I3AA 3BYDA 3EEHA 4CLCA 4ZJ3A 1MKIA 3G2ZA 3CZDA 4HJ4A 4IEDA 3T1RA 4R3JA 3KSIA 4EW7A 4NXGA 3W4OA 1DJCA 4OP8A 3FG8A 3S7PA 4ESPA 1G5UA 3PBOA 4K08A 3OCNA 1XX2A 4PAUA 4WF0A 3BFDA 1CI8A 3HL9A 4Q0IA 5FL3A 1FCOA 1YLPA 3M2KA 2VX8A 3ZGAB 1ZC2A 1XJ6A 2QJ5A 5GLDA 4GN2A 4DMZA 5DVAA 4Y13A 2V0WA 4LLOB 2JKTI 3JVVA 4EETB 1TDGA 1SZVA 3BM6A 2PRFA 2QWSA 2QZ6A 2ZC6B 1BLSA 3F1PB 3S1YA 1G6AA 4MLLA 1T19A 2KX6A 1WE4A 5E2FA 2W1RA 3G35A 1IOUA 4WN5A 2BTFP 1OJ5A 5CXWA 1VHMA 2EX9A 2XFTA 3K2NA 2WGWB 3FZCA 3F1NB 4IVIA 1PRQA 2WKPA 3PAGA 4HH3A 3CPTB 4OVDA 3UPOA 5L09A 4Z1WA 4UEYA 2KLIA 4HJ3A 1NYMA 4WELA 3LY4A 4KENB 3UY6A 3ZG8B 4QHCA 3CI6A 1XJ3A 1ESIA 1BLCA 2HPBA 4ZDXA 3RXWA 2Y2MA 2Y59A 1PFLA 1SCWA 2WKHA 4R6LA 1H5XA 1FCMA 2JCHA 3IXBA 2O9CA 4U0TA 1DY6A 1K38A 2ZJ9A 5DFYA 1SKOA 2X71A 4Y0TA 3C8CA 4QY5A 5AQAA 1GHIA 3R7WB 1YQSA 2ZOIA 4GLQA 1ZG6A 5HDDA 4NXBA 2Z2LB 4JXGA 5DJTA 4WZ5C 3MR0A 4I39A 3O5YA 1STZA 2ZQAA 2W27A 1XJ2A 5DF9A 4QJGA 5EVID 4Y0UA 1K4FA 1E3UD 3MSHA 3T1QB 3IQAA 5C5KA 3PYPA 2JKRM 2Y2GA 3ZFZA 3NBLA 3MMHA 1KE0A 2RL3A 5FAOA 3DWKA 4MBKA 2GX5A 1W7FA 3O3VA 4B9OA 3P7NA 2O99A 1HVBA 4MN6A 2ZBBA 3M6BA 4QD4A 1XXMA 3AGEA 4EV4A 1K55C 3HCYA 1MZUA 3LIDA 1LI9A 3LIBA 3H7WB 3G34A 1BULA 1ZTUA 1K54C 3T4JA 2HF6A 3T4QA 3VFHA 5AJGA 3HJIA 4R38A 3VMAA 2C5WB 5IHVA 3BQAA 1ZKJA 4B93A 1DJBA 3OCLA 1PWDA 1MWSA 2W1TA 3WS1A 1J9MA 3A0RA 4GD8A 4ARZA 3Q7ZA 3HJKA 2BLSA 3E4OA 1KDSA 2ZQCA 3MFDA 4O0PA 1LL8A 3BY9A 2H0YA 1FQGA 3KX0X 3TOIA 3WS4A 1FOFA 3CUEA 3MBZA 5TBMB 1BSGA 4UHUA 5DKLA 3H82A 3SW1A 4C75A 1JTGA 2XD5A 2HDUA 2I72A 4L9GA 1DRMA 1LT0A 2OLUA 5G4YA 1TS7A 5KZHA 2D01A 2V20A 2Y8HA 5EVLA 3A3EA 4BD1A 2P74A 1I5QA 4OQ0A 2G2WA 5KIZA 4X69A 3QP2A 1YT4A 4R3BA 3KYQA 1Y4OA 4LV1A 4NXEA 1GA9A 4R3AA 3KSGA 3M2JA 3TSGA 2HJEA 2QJ7A 2HDRA 2R78A 1XA7A 4KZ7A 1FIKA 3LI9A 3IXDA 1YKDA 2O0YA 4E3JA 3OBFA 3UMEA 4R0QA 1KGEA 5HAPA 2XH9A 1RGZA 3UO9A 3IF6A 3ZG0A 4WMCD 3SH7A 4P6ZM 2FZ0A 3GMWA 1FR1A 3K3DA 4L9FA 4BL3A 4JF4A 5U47A 2QHKA 2Q0OA 4GKUA 3T4KA 3TW8A 5DTTA 3FPVA 3IS2A 2EX2A 4X1MA 1S4RA 2H5SA 3NOTC 2LB5A 1PIOA 1BZAA 4BBUA 4DKIA 1XFQA 2W3DA 1OTBA 1S4SA 3OOVA 3T12B 2EWWA 4BWIA 4RQ9A 1LSXA 1MWTA 4HOIA 4P6ZS 3NDEA 4WZ4A 4GS9B 2ZMFA 5HL1A 3NDGA 4FH4A 4HNBA 5F6AA 5HL6A 1LHYA 3OPLA 5M18A 2Q9MA 2Z2MB 5KMWA 3NIAA 5FDHA 2ZLYA 1YM1A 3ZDJA 2M7UA 3ZVWA 3DTIA 4OPZA 4OLDA 3MQOA 3NULA 4N1XA 4JPMA 2ZC4B 1BT5A 3T4SA 2ZC7A 2ZQ9A 3Q81A 3ZNYA 4P6BA 1P0ZA 2K7SA 1PNEA 4O01A 3WRTA 5M19A 4DE1A 2J8YA 4MMNA 1S0WA 1I2WA 1NRFA 2O9AA 5HWVA 3QNCA 2ZL1A 3T1XA 4NXFA 3BRMA 2L4RA 1KDWA 5EVIA 1H0MA 4K0WA 2DMWA 4OOYA 1E3UA 4IJGA 3HUOA 5HDCA 4YNRA 3JPUA 4XXRA 2X01A 1TDLA 5GHYA 2OWJA 3E2KA 2IWCA 3CITA 3QP4A 3VP3A 1XJ4A 4G3VA 3C30A 5FAQA 1VETA 1P9WA 4MEZA 3O87A 1PZOA 3FC7A 4S2MA 1ZG4A 5HW3A 2ZC5B 1QMEA 1FR6A 2ZQDA 1MWUA 4U0XA 4D2OA 5I94A 5EVEA 3E0YA 4UQIM 3T4OA 1CQAA 3CWFA 4OQGA 3UPPA 4BBVA 4KG6A 1NLYA 3QP1A 1SHVA 2A24B 3S4XA 3C5AA 3PHYA 3UNWA 3TE8A 4WBGA 5E2EA 3C7UA 1KGFA 2JKFA 4Y15A 2UWXA 3IWQA 2HDSA 5FQMA 3NECA 3T50A 3IX3A 3MZFA 4G3KA 4X1LA 3JYIA 4YOFA 1XGIA 4WEJA 1TS6A 2VK3A 5AQ7A 4JGPA 4S2JA 3AGFA 1Y28A 3GRJA 3BFFA 5CERA 3NI9A 1E4DA 2ZMAA 5J4EA 2J3WA 5GLCA 2BG1A 3MF0A 5MC7A 1W8YA 3U2AA 4HP4A 2Y2QA 1K25A 1MWRA 1F5MA 3FV7A 5TJJA 4WYYA 1K6RA 1N9OA 3QP5A 1SKFA 1TVFA 1YLZA 3MXQA 5FI2A 3SS4A 3ULFA 3GV9A 2W0NA 2A3UA 1OTIA 4GHIB 2XK1A 2IA2A 1YLYA 2DNSA 4ZRRA 3D9YA 5G18A 4JXWA 3L7HA 4A5RA 4DE3A 3UDFA 3I7JA 4OPRA 3WWXA 2ZQ8A 2LB9A 4II7A 1RCJA 4KUKA 1VEUB 5A93A 4R23A 5J3WA 4S2NA 5A91A 4ETXA 4BMWA 4RYEA 4E6WA 4E6XA 4B88A 3ZG7B 4BJPA 5BOHA 4EUVA 4IHQA 1CEGA 4F3LA 4S2LA 3OZHA 3LR0A 3V5MA 3N7WA 4WMCA 5F1GA 4XUZA 4HBTA 1IFQA 5EOEA 3VV4A 2GDNA 2G7UA 3MKFA 2WZZA 4O8GA 4ETZA 4X56A 1W63Q 3KYZA 4WM9A 4E04A 1JWVA 5CGXA 4JF6A 4OLGA 5HZHA 2NUPC 5HSQA 3CHWP 4DJ2A 4LRXC 5CHMA 3CMZA 4PM7A 5IU1A 1BUEA 3MZEA 4BQMA 1S67L 2XR0A 3VOLA 1Q2QA 2PYRA 3D4FA 1ODVA 5AQBA 2V1BA 3ZHHA 2VJWA 3SH8A 5DF7A 4OP5A 1IYQA 1TS8A 4Y7PA 2CC1A 1KVMA 2W3HA 3ZVTA 2WGIA 3PXPA 1W79A 4N9LA 4HQAA 3ICYA 3GDIA 3HREA 5FEFA 1KVLA 1GA0A 3TRCA 4PM6A 3SS3A 2HJ9C 1DP8A 1GSWA 4C3QA 2WAFA 5FQKA 4MBHA 4QU3A 5HFOA 3CUEC 5CHJA 1AXBA 1X0OA 4PKYG 1EWZA 3FKVA 5GHZA 1LSVA 5TR7A 3EQUA 4S2OA 1PWCA 4GDNA 4OQIA 1BYWA 3C38A 5FQIA 5HARA 4FTXA 2I9VA 2XFSA 4EEUA 3FYZA 2V2FF 2H28A 2V9AA 3Q7VB 5HDSA 3VSLA 1T18A 4LV2A 2PU2A 2EWVA 3G31A 3C4OA 1GHPA 2IWDA 1QMFA 4Y0OA 2EFXA 4PM9A 2RCXA 3BLMA 3NCKA 1JWZA 3MXRA 2JKTM 1BLPA 3MFXA 1O7EA 4KZ9A 2OOLA 4X68A 2VGLS 3KSHA 1L0DA 1MXOA 1OT6A 2WYXA 2HGVA 5L07A 4P85A 3IF6C 3UB6A 1NJ4A 1NY0A 4QB8A 2BASA 1DP9A 3A3JA 4BENA 2J9OA 3NC8A 4HIAA 3CLOA 5CGWA 1ERMA 4KQDA 3WS5A 2WKQA 4EBLA 1OT9A 1LSWA 2VA0A 4GD6A 4DF6A 1BLHA 4RA7A 4ZTKA 4Y3IA 3OPHA 2Y2LA 1VEUA 1YPRA 4BD0A 3SH9A 1K57C 4DXCA 3E2LA 3HLEA 4M4XA 2CMNA 1XPBA 4MNRA 2XSSA 3P98A 2OWHA 4EBPA 2K2NA 1WYCA 2UV0E 3DTKA 2V1ZA 2JC7A 4ID4A 2WKRA 1G68A 2WADA 3F1PA 4FOFA 5CTNA 3BQ8A 3OLOA 4H6JB 2YKFA 1WYBA 4IUHA 5HX9A 1EROA 2HZ5A 1SDNA 5K5BA 5D3OA 3N8SA 3BFCA 1IEMA 1NZUA 1T1BA 1LLBA 3LEZA 3B33A 1IKGA 2WGWA 3GQZA 3F1NA 4K0XA 2JBFA 5DF8A 4C6YA 2K31A 3HLBA 3CPTA 4KZ8A 5DKKA 5J7EA 2OAP1 4B4ZA 4D60A 1ONHA 5KSHA 4GCZA 5DFXA 2VKSA 2JHEA 3LGOA 4WZ5A 2B5RA 1NRJA 4DDYA 5FDSA 4DN0A 4QY6A 1L2SA 1A0KA 5A92A 4DJ3A 1PYYA 2PR5A 1JWPA 3T1SA 3IH8A 3KSFA 5HD3A 3RFBA 4CPKA 1OTDA 4LFUA 1L0FA 4FH2A 4N1HA 4OONA 4PPRA 1WA9A 4KUOA 5CHUA 3N6IA 2V0UA 3ZNTA 1C3BA 4CLCB 1OTAA 4HEFA 3E4QA 3B3XA 2Y4AA 3N8LA 3R7WA 2DRWA 1IYSA 2PAVP 4ZAMA 2KDKA 4MN5A 2L0WA 1NLZA 3NHQA 1DJAA 2PBYA 4Q0JA 2GZAA 1VB6A 2Y2IA 4JKTA 5F68A 5F5YA 1K55A 4CLCE 3D3OA 3LUQA 5I5LA 2QKPA 4OH0A 2M1CA 2J3TC 2X02A 1G28A 4GB7A 4Q8IA 1JNUA 5A8BA 1P97A 5HPIA 4I5SA 5HWWA 2HP9A 1K54A 4GDBA 3HLGA 4L9EA 4L0LA 3UMDA 2XDMA 4DDSA 1ONGA 2ZD8A 5F83A 3SZTA 3P09A 5FA7A 3SS5A 5HPFA 3RTYA 3GSGA 2E8IA 1JVJA 4CLCC 2ZM0A 3FWLA 4Q0HA 4EQ1A 1T1CA 1H8MA 3FKWA 5G4ZA 2Z6CA 3DBAA 3HLFA 2OAQ1 1N9BA 3HVFA 1UWNX 2XROA 3V39A 3GVBA 2V8FA 4I38A 3G32A 3UE1A 5GHXA 1W63M 1NYYA 2EX8A 5FQJA 3IBRA 2ZM8A 3BFGA 2PU4A 3E4PA 3G2YA 3H7WA 2E8JA 5FEGA 4NG2A 4BLMA 5CRFA 4JGQA 2V8CA 1P9RA 4Z9QA 2ZOHA 5L10A 4DE2A 3NY4A 2Y2NA 3RH8B 4MCWA 5F82A 4GZBA 5E43A 1YSPA 4GOGA 1S66L 2J9PA 4I3JA 3CJMA 2JKGA 3CG5A 2GJ3A 4IBXA 1XP4A 4OPYA 4HP9A 3QHYA 2ZM2A 3C7VA 3VE3A 2H10A 4LENA 1CEFA 5CEDA 1M40A 3B42A 4OQHA 1Y54A 3ISGA 4E3IA 5EECA 1KE3A 4ZBEA 1V9YA 3MS6A 4N92A 5TBMA 5CEBA 2PT7A 3EOIA 1M6KA 3DWZA 3VFFA 2C6WB 1IYPA 4KG5A 4B4XA 3V50A 1S1YA 1H8YA 2D02A 3IXHA 1HD8A 2XD1A 4HHDA 5HAIA 2KOIA 2WK0A 4R4SA 1O07A 1G6OA 2PDRA 1RP5A 2HP6A 3D72A 1YLWA 4FUWA 3OPRA 5CTMA 1K0KA 2FFFB 1CJFA 1YMSA 4LCMA 4FD8A 2JE5A 3MZDA 4S2KA 4M3KA 4WUJA 5TFQA 5GLBA 3BJNA 4NEED 1DP6A 2Y91A 1TEMA 3ZCZA 4LCLA 1ZHHB 1OMEA 4XUXA 4DRTA 5EPHA 3SOIA 1ES4A 1H8ZA 4H8RA 5FASA 3IH9A 5HAQA 1PW8A 2Y79A 1V9ZA 4LRYC 1UGUA 4EUZA 4RX3A 1PW1A 2Y2PA 4YWZA 4EQIA 1EI5A 1OPXA 4EERA 2ZQ7A 1CK3A 5FQQA 4KZ3A 3VP0A 2R9WA 2P9VB 3G30A 3O86A 3NJAA 3LICA 1SDEA 4DXBA 2Y2KA 3DTEA 4UAAA 3WS0A 2EXBA 3EWKA 1I2SA 1BTLA 1ES3A 3UN7A 4GS9A 4XT2B 2A49A 1NWZA 3ZG9B 4OKPA 2JKRI 4JBFA 4I3IA 4WL9A 1PI5A 3S7NA 2OSUA 2W1TB 4PMAA 3RJUA 4S2PA 4ARZB 3HLWA 3IX4A 2XLNA 1KE4A 3UDXA 3IX8A 3W8KA 4P0MA 4CQHA 3PBQA 4DE0A 2YKHA 1MBLA 5E2HA 3LY3A 4EBNA 3H82B 1JTDA 1D06A 4OOMA 4WEKA 4G3WA 3V3RA 1ERQA 2EFUA 4NK3A 4AFIA 5JYOA 5GL9A 4MN7A 3ZYTA 3H9WA 3BFEA 3HLCA 4KZBA 5GLAA 3PBRA 1MKMA 3UPNA 3VSKA 2GNXA 3UE3A 4GW9A 4FSFA 5F1FA 4IBRA 1TD5A 4UA9A 4NKPA 3PBTA 3KO6A 4EEPA 1W8QA 5DTKA 2PD8A 2Y2HA 1L0GA 1J3WA 4GNUA 1FCNA 2Q9NA 3UB8A 4E3LA 2V1AA 3IF6B 4JLFA 4ZJ1A 3G6OA 3IHAA 2A24A 3EQVA 3U4LP 4QPRA 2VGLM 3BWLA 4Y2FA 4O7DA 2IWBA 4R1GA 3MJQA 3IS2B 1S6RA 3WRZA 3MQ0A 5E2GA 5EM1A 3EEAA 3GTCA 3LIFA 2DCFA 4S2IA 3C4PA 1E25A 5AVFA 4PM5A 1F98A 1N9LA 2B18A 1XKZA 4Y17A 4HH2A 2AVXA 4JGRA 4RVAA 4E3KA 4UA7A 4KG2A 1W5DA 2L1MA 5HWTA 3C2WA 3DTMA 1IYOA 5HD5A 3S7QA 4GHIA 2P08A 5FI7A 2J80A 2QMIA 2A2LA 4IVKA 3CAXA 5L8MA 4HESA 4EU0A 2QPNA 3HLDA 5JYPA 2OV5A 3OC2A 3W2ZA 3PR6A 2HDQA 3F1OB 2H0TA 4ME4A 5DJUA 3UE6A 2ZL1B 1K56D 2OLVA 1TS0A 2P9VA 2VLGA 1PI4A 4MBFA 4JXSA 4NETA 5EVIB 4KQRA 5CECA 4HBUA 2XGNA 1HLUP 5AQ9A 3IT9A 2NUTC 5EM0A 4N9KA 4OOLA 2VV6A 3BLSA 3QP8A 4E3NA 1LI0A 3NOUC 4XT2A 4YFMA 2VGKA 2XA7M 3A3IA 1GSVA 2VGJA 2VV7A 5EFWA 2FH5A 1OTEA 1VETB 1L0EA 4BBTA 3IWIA 4JXVA 2J3TD 2B95A 3BW6A 3G4PA 1LL9A 3EGDC 4EXOA 4X25A 2XRNA 1FSYA 3VOZA 2W3GA 3Q07A 1MC0A 1HTZA 2W3FA 5DTSA 2FFYA 1FILA 4CLCD 4E3OA 3LEQA 4CJNA 5EVIC 3ITAA 3A0VA 2XA7S 2MJ6A 4RX2A 3WS2A 3VP2A 3Q1FA 4K91A 2XF3A 2P04A 1GCEA 4HY8A 2INWA 1FSWA 3V3SA 2ZC3B 2WKIA 4BL2A 2R9XA 3FPWA 3ZG5A 1NZOA 2G2UA 2XEPA 4LV0A 3W4QA 2WZXA 4P87A 3JVUA 3GR2A 3UE0A 3LO7A 3QNBA 5F69A 3VE4A 2O9BA 1GSXA 1NXYA 4PKYA 3VP1A 3VP4A 4PM8A 3P01A 4LGWA 2PYPA 1IKIA 4R70A 3T4LA 2HP5A 2EXAA 3ZQ5A 3IF5A 3A0SA 4KZ6A 5AVEA 1F9IA 1XGJA 1HZOA 4X6TA 2J7VA 4MDZA 1ESUA 3PBSA 2VEAA 2Y55A 4KQQA 1YAXA 3A3DA 3W4PA 4Y5FA 2HV1A 4FCFA 4GJ4A 2WUQA 1UWPX 1MY8A 2PD7A
chains in the Genus database with same CATH topology
1G5UA 2B95A 3CPTA 1PFLA 5EV0A 4FUWA 1ACFA 4D60A 1K0KA 5EM1A 4X25A 1CJFA 1SKOB 3LGOA 2V8FA 1SKOA 5FDSA 3D9YA 1A0KA 1FILA 3LEQA 3L7HA 5FEFA 3T1SA 1VETA 2ACGA 4X1MA 2E8JA 2PBDP 1VEUB 3DAVA 5FEGA 3L9KA 1SZVA 1VEUA 1YPRA 1Z09A 2PRFA 3KYEA 4QWOA 2V8CA 3T12B 5EVEA 1CQAA 1AWIA 3MSHA 3T1QB 2PAVP 2BTFP 2JKGA 1CF0A 4FTXA 2JKFA 1J3WA 2ZL1B 3UB5P 1PRQA 3NECA 1D1JA 4X1LA 3NULA 3CPTB 3MS6A 1HLUP 2VK3A 5EM0A 2HZ5A 1PNEA 1Y4OA 3U4LP 3T1RA 3CHWP 4ESPA 1FIKA 1F2KA 1VETB 2ZL1A 3T1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G5U A;  2B95 A;  3CPT A;  1PFL A;  5EV0 A;  4FUW A;  1ACF A;  4D60 A;  1K0K A;  5EM1 A;  4X25 A;  1CJF A;  1SKO B;  3LGO A;  2V8F A;  1SKO A;  5FDS A;  3D9Y A;  1A0K A;  1FIL A;  3LEQ A;  3L7H A;  5FEF A;  3T1S A;  1VET A;  2ACG A;  4X1M A;  2E8J A;  2PBD P;  1VEU B;  3DAV A;  5FEG A;  3L9K A;  1SZV A;  1VEU A;  1YPR A;  1Z09 A;  2PRF A;  3KYE A;  4QWO A;  2V8C A;  3T12 B;  5EVE A;  1CQA A;  1AWI A;  3MSH A;  3T1Q B;  2PAV P;  2BTF P;  2JKG A;  1CF0 A;  4FTX A;  2JKF A;  1J3W A;  2ZL1 B;  3UB5 P;  1PRQ A;  3NEC A;  1D1J A;  4X1L A;  3NUL A;  3CPT B;  3MS6 A;  1HLU P;  2VK3 A;  5EM0 A;  2HZ5 A;  1PNE A;  1Y4O A;  3U4L P;  3T1R A;  3CHW P;  4ESP A;  1FIK A;  1F2K A;  1VET B;  2ZL1 A;  3T1X A; 
#chains in the Genus database with same CATH topology
 4LV3 A;  1ES2 A;  3LIE A;  5FAT A;  1OJG A;  3Q7V A;  5EV0 A;  3N4I A;  3N8R A;  4JGO A;  1ACF A;  3S7O A;  3AGD A;  2B02 A;  3UB9 A;  4EES A;  1D7E A;  2WKE A;  2XQZ A;  1YMX A;  3T4T A;  4LPZ A;  3BY8 A;  1K57 A;  4F3L B;  1Q2P A;  3IXG A;  4F94 A;  1PWG A;  4OPQ A;  3LIA A;  3R4K A;  3DAV A;  3LFV A;  2M7V A;  3LYX A;  1Z09 A;  3M6H A;  3EGX C;  4UA6 A;  4QWO A;  1YLT A;  4KQO A;  5A90 A;  4X55 A;  1AWI A;  1K4E A;  1MPL A;  1YSQ A;  4KZ5 A;  3MXS A;  2JN7 A;  3B47 A;  1U60 A;  3BEC A;  3PTE A;  3VOY A;  5CGS A;  4R4R A;  3HUN A;  2P7J A;  4S2N C;  1CF0 A;  3DW0 A;  5IS1 A;  3F1O A;  3UB5 P;  4JF5 A;  4E3M A;  3NOP C;  3Q82 A;  1ALQ A;  4KZ4 A;  1D1J A;  1ES5 A;  5L2F A;  1GHM A;  3PAE A;  2PHY A;  5FI6 A;  3IBJ A;  2EA9 A;  3LR3 A;  1KGG A;  2VZW A;  5FAP A;  2Y2O A;  1YLJ A;  1TF1 A;  3TJZ C;  2VV8 A;  3LR4 A;  3S22 A;  3MQQ A;  1EW0 A;  1CI9 A;  3UDI A;  3A3F A;  4HI4 A;  1F2K A;  3UB7 A;  4EWF A;  1XFN A;  1N4O A;  2WAE A;  5CX7 A;  2Y2J A;  3V67 A;  1N9N A;  1VM1 A;  5TGF A;  2ZMV A;  3MKE A;  2WGV A;  4H6J A;  3TG9 A;  5IT5 A;  3HBR A;  3GEC A;  3HUM A;  1SKO B;  4YIN A;  4HJ6 A;  1VQQ A;  3QP6 A;  3E98 A;  5FSR A;  3PBN A;  1K56 A;  5LBR A;  4PHT A;  4LRZ E;  1T1A A;  3LCE A;  5EE8 A;  2ACG A;  1KOU A;  3ITB A;  2PBD P;  4KZA A;  5FQ9 A;  3L9K A;  1L3L A;  2EX6 A;  3LR5 A;  4X53 A;  3KYE A;  5EOO A;  2Z6D A;  3OPP A;  4IUK A;  1XA1 A;  3IWO A;  4U3T A;  4UQI S;  1IEL A;  5KSC A;  5EUA A;  3O88 A;  5J8X A;  3LI8 A;  4ZJ2 A;  2QYB A;  3K3C A;  3BEB A;  1H3Q A;  5M1A A;  4WLA A;  3RXX A;  1Z6F A;  2PR6 A;  1S1Z A;  1K6S A;  3IHB A;  2W3E A;  1LL5 A;  1PZP A;  1RGY A;  4I3A A;  3BYD A;  3EEH A;  4CLC A;  4ZJ3 A;  1MKI A;  3G2Z A;  3CZD A;  4HJ4 A;  4IED A;  3T1R A;  4R3J A;  3KSI A;  4EW7 A;  4NXG A;  3W4O A;  1DJC A;  4OP8 A;  3FG8 A;  3S7P A;  4ESP A;  1G5U A;  3PBO A;  4K08 A;  3OCN A;  1XX2 A;  4PAU A;  4WF0 A;  3BFD A;  1CI8 A;  3HL9 A;  4Q0I A;  5FL3 A;  1FCO A;  1YLP A;  3M2K A;  2VX8 A;  3ZGA B;  1ZC2 A;  1XJ6 A;  2QJ5 A;  5GLD A;  4GN2 A;  4DMZ A;  5DVA A;  4Y13 A;  2V0W A;  4LLO B;  2JKT I;  3JVV A;  4EET B;  1TDG A;  1SZV A;  3BM6 A;  2PRF A;  2QWS A;  2QZ6 A;  2ZC6 B;  1BLS A;  3F1P B;  3S1Y A;  1G6A A;  4MLL A;  1T19 A;  2KX6 A;  1WE4 A;  5E2F A;  2W1R A;  3G35 A;  1IOU A;  4WN5 A;  2BTF P;  1OJ5 A;  5CXW A;  1VHM A;  2EX9 A;  2XFT A;  3K2N A;  2WGW B;  3FZC A;  3F1N B;  4IVI A;  1PRQ A;  2WKP A;  3PAG A;  4HH3 A;  3CPT B;  4OVD A;  3UPO A;  5L09 A;  4Z1W A;  4UEY A;  2KLI A;  4HJ3 A;  1NYM A;  4WEL A;  3LY4 A;  4KEN B;  3UY6 A;  3ZG8 B;  4QHC A;  3CI6 A;  1XJ3 A;  1ESI A;  1BLC A;  2HPB A;  4ZDX A;  3RXW A;  2Y2M A;  2Y59 A;  1PFL A;  1SCW A;  2WKH A;  4R6L A;  1H5X A;  1FCM A;  2JCH A;  3IXB A;  2O9C A;  4U0T A;  1DY6 A;  1K38 A;  2ZJ9 A;  5DFY A;  1SKO A;  2X71 A;  4Y0T A;  3C8C A;  4QY5 A;  5AQA A;  1GHI A;  3R7W B;  1YQS A;  2ZOI A;  4GLQ A;  1ZG6 A;  5HDD A;  4NXB A;  2Z2L B;  4JXG A;  5DJT A;  4WZ5 C;  3MR0 A;  4I39 A;  3O5Y A;  1STZ A;  2ZQA A;  2W27 A;  1XJ2 A;  5DF9 A;  4QJG A;  5EVI D;  4Y0U A;  1K4F A;  1E3U D;  3MSH A;  3T1Q B;  3IQA A;  5C5K A;  3PYP A;  2JKR M;  2Y2G A;  3ZFZ A;  3NBL A;  3MMH A;  1KE0 A;  2RL3 A;  5FAO A;  3DWK A;  4MBK A;  2GX5 A;  1W7F A;  3O3V A;  4B9O A;  3P7N A;  2O99 A;  1HVB A;  4MN6 A;  2ZBB A;  3M6B A;  4QD4 A;  1XXM A;  3AGE A;  4EV4 A;  1K55 C;  3HCY A;  1MZU A;  3LID A;  1LI9 A;  3LIB A;  3H7W B;  3G34 A;  1BUL A;  1ZTU A;  1K54 C;  3T4J A;  2HF6 A;  3T4Q A;  3VFH A;  5AJG A;  3HJI A;  4R38 A;  3VMA A;  2C5W B;  5IHV A;  3BQA A;  1ZKJ A;  4B93 A;  1DJB A;  3OCL A;  1PWD A;  1MWS A;  2W1T A;  3WS1 A;  1J9M A;  3A0R A;  4GD8 A;  4ARZ A;  3Q7Z A;  3HJK A;  2BLS A;  3E4O A;  1KDS A;  2ZQC A;  3MFD A;  4O0P A;  1LL8 A;  3BY9 A;  2H0Y A;  1FQG A;  3KX0 X;  3TOI A;  3WS4 A;  1FOF A;  3CUE A;  3MBZ A;  5TBM B;  1BSG A;  4UHU A;  5DKL A;  3H82 A;  3SW1 A;  4C75 A;  1JTG A;  2XD5 A;  2HDU A;  2I72 A;  4L9G A;  1DRM A;  1LT0 A;  2OLU A;  5G4Y A;  1TS7 A;  5KZH A;  2D01 A;  2V20 A;  2Y8H A;  5EVL A;  3A3E A;  4BD1 A;  2P74 A;  1I5Q A;  4OQ0 A;  2G2W A;  5KIZ A;  4X69 A;  3QP2 A;  1YT4 A;  4R3B A;  3KYQ A;  1Y4O A;  4LV1 A;  4NXE A;  1GA9 A;  4R3A A;  3KSG A;  3M2J A;  3TSG A;  2HJE A;  2QJ7 A;  2HDR A;  2R78 A;  1XA7 A;  4KZ7 A;  1FIK A;  3LI9 A;  3IXD A;  1YKD A;  2O0Y A;  4E3J A;  3OBF A;  3UME A;  4R0Q A;  1KGE A;  5HAP A;  2XH9 A;  1RGZ A;  3UO9 A;  3IF6 A;  3ZG0 A;  4WMC D;  3SH7 A;  4P6Z M;  2FZ0 A;  3GMW A;  1FR1 A;  3K3D A;  4L9F A;  4BL3 A;  4JF4 A;  5U47 A;  2QHK A;  2Q0O A;  4GKU A;  3T4K A;  3TW8 A;  5DTT A;  3FPV A;  3IS2 A;  2EX2 A;  4X1M A;  1S4R A;  2H5S A;  3NOT C;  2LB5 A;  1PIO A;  1BZA A;  4BBU A;  4DKI A;  1XFQ A;  2W3D A;  1OTB A;  1S4S A;  3OOV A;  3T12 B;  2EWW A;  4BWI A;  4RQ9 A;  1LSX A;  1MWT A;  4HOI A;  4P6Z S;  3NDE A;  4WZ4 A;  4GS9 B;  2ZMF A;  5HL1 A;  3NDG A;  4FH4 A;  4HNB A;  5F6A A;  5HL6 A;  1LHY A;  3OPL A;  5M18 A;  2Q9M A;  2Z2M B;  5KMW A;  3NIA A;  5FDH A;  2ZLY A;  1YM1 A;  3ZDJ A;  2M7U A;  3ZVW A;  3DTI A;  4OPZ A;  4OLD A;  3MQO A;  3NUL A;  4N1X A;  4JPM A;  2ZC4 B;  1BT5 A;  3T4S A;  2ZC7 A;  2ZQ9 A;  3Q81 A;  3ZNY A;  4P6B A;  1P0Z A;  2K7S A;  1PNE A;  4O01 A;  3WRT A;  5M19 A;  4DE1 A;  2J8Y A;  4MMN A;  1S0W A;  1I2W A;  1NRF A;  2O9A A;  5HWV A;  3QNC A;  2ZL1 A;  3T1X A;  4NXF A;  3BRM A;  2L4R A;  1KDW A;  5EVI A;  1H0M A;  4K0W A;  2DMW A;  4OOY A;  1E3U A;  4IJG A;  3HUO A;  5HDC A;  4YNR A;  3JPU A;  4XXR A;  2X01 A;  1TDL A;  5GHY A;  2OWJ A;  3E2K A;  2IWC A;  3CIT A;  3QP4 A;  3VP3 A;  1XJ4 A;  4G3V A;  3C30 A;  5FAQ A;  1VET A;  1P9W A;  4MEZ A;  3O87 A;  1PZO A;  3FC7 A;  4S2M A;  1ZG4 A;  5HW3 A;  2ZC5 B;  1QME A;  1FR6 A;  2ZQD A;  1MWU A;  4U0X A;  4D2O A;  5I94 A;  5EVE A;  3E0Y A;  4UQI M;  3T4O A;  1CQA A;  3CWF A;  4OQG A;  3UPP A;  4BBV A;  4KG6 A;  1NLY A;  3QP1 A;  1SHV A;  2A24 B;  3S4X A;  3C5A A;  3PHY A;  3UNW A;  3TE8 A;  4WBG A;  5E2E A;  3C7U A;  1KGF A;  2JKF A;  4Y15 A;  2UWX A;  3IWQ A;  2HDS A;  5FQM A;  3NEC A;  3T50 A;  3IX3 A;  3MZF A;  4G3K A;  4X1L A;  3JYI A;  4YOF A;  1XGI A;  4WEJ A;  1TS6 A;  2VK3 A;  5AQ7 A;  4JGP A;  4S2J A;  3AGF A;  1Y28 A;  3GRJ A;  3BFF A;  5CER A;  3NI9 A;  1E4D A;  2ZMA A;  5J4E A;  2J3W A;  5GLC A;  2BG1 A;  3MF0 A;  5MC7 A;  1W8Y A;  3U2A A;  4HP4 A;  2Y2Q A;  1K25 A;  1MWR A;  1F5M A;  3FV7 A;  5TJJ A;  4WYY A;  1K6R A;  1N9O A;  3QP5 A;  1SKF A;  1TVF A;  1YLZ A;  3MXQ A;  5FI2 A;  3SS4 A;  3ULF A;  3GV9 A;  2W0N A;  2A3U A;  1OTI A;  4GHI B;  2XK1 A;  2IA2 A;  1YLY A;  2DNS A;  4ZRR A;  3D9Y A;  5G18 A;  4JXW A;  3L7H A;  4A5R A;  4DE3 A;  3UDF A;  3I7J A;  4OPR A;  3WWX A;  2ZQ8 A;  2LB9 A;  4II7 A;  1RCJ A;  4KUK A;  1VEU B;  5A93 A;  4R23 A;  5J3W A;  4S2N A;  5A91 A;  4ETX A;  4BMW A;  4RYE A;  4E6W A;  4E6X A;  4B88 A;  3ZG7 B;  4BJP A;  5BOH A;  4EUV A;  4IHQ A;  1CEG A;  4F3L A;  4S2L A;  3OZH A;  3LR0 A;  3V5M A;  3N7W A;  4WMC A;  5F1G A;  4XUZ A;  4HBT A;  1IFQ A;  5EOE A;  3VV4 A;  2GDN A;  2G7U A;  3MKF A;  2WZZ A;  4O8G A;  4ETZ A;  4X56 A;  1W63 Q;  3KYZ A;  4WM9 A;  4E04 A;  1JWV A;  5CGX A;  4JF6 A;  4OLG A;  5HZH A;  2NUP C;  5HSQ A;  3CHW P;  4DJ2 A;  4LRX C;  5CHM A;  3CMZ A;  4PM7 A;  5IU1 A;  1BUE A;  3MZE A;  4BQM A;  1S67 L;  2XR0 A;  3VOL A;  1Q2Q A;  2PYR A;  3D4F A;  1ODV A;  5AQB A;  2V1B A;  3ZHH A;  2VJW A;  3SH8 A;  5DF7 A;  4OP5 A;  1IYQ A;  1TS8 A;  4Y7P A;  2CC1 A;  1KVM A;  2W3H A;  3ZVT A;  2WGI A;  3PXP A;  1W79 A;  4N9L A;  4HQA A;  3ICY A;  3GDI A;  3HRE A;  5FEF A;  1KVL A;  1GA0 A;  3TRC A;  4PM6 A;  3SS3 A;  2HJ9 C;  1DP8 A;  1GSW A;  4C3Q A;  2WAF A;  5FQK A;  4MBH A;  4QU3 A;  5HFO A;  3CUE C;  5CHJ A;  1AXB A;  1X0O A;  4PKY G;  1EWZ A;  3FKV A;  5GHZ A;  1LSV A;  5TR7 A;  3EQU A;  4S2O A;  1PWC A;  4GDN A;  4OQI A;  1BYW A;  3C38 A;  5FQI A;  5HAR A;  4FTX A;  2I9V A;  2XFS A;  4EEU A;  3FYZ A;  2V2F F;  2H28 A;  2V9A A;  3Q7V B;  5HDS A;  3VSL A;  1T18 A;  4LV2 A;  2PU2 A;  2EWV A;  3G31 A;  3C4O A;  1GHP A;  2IWD A;  1QMF A;  4Y0O A;  2EFX A;  4PM9 A;  2RCX A;  3BLM A;  3NCK A;  1JWZ A;  3MXR A;  2JKT M;  1BLP A;  3MFX A;  1O7E A;  4KZ9 A;  2OOL A;  4X68 A;  2VGL S;  3KSH A;  1L0D A;  1MXO A;  1OT6 A;  2WYX A;  2HGV A;  5L07 A;  4P85 A;  3IF6 C;  3UB6 A;  1NJ4 A;  1NY0 A;  4QB8 A;  2BAS A;  1DP9 A;  3A3J A;  4BEN A;  2J9O A;  3NC8 A;  4HIA A;  3CLO A;  5CGW A;  1ERM A;  4KQD A;  3WS5 A;  2WKQ A;  4EBL A;  1OT9 A;  1LSW A;  2VA0 A;  4GD6 A;  4DF6 A;  1BLH A;  4RA7 A;  4ZTK A;  4Y3I A;  3OPH A;  2Y2L A;  1VEU A;  1YPR A;  4BD0 A;  3SH9 A;  1K57 C;  4DXC A;  3E2L A;  3HLE A;  4M4X A;  2CMN A;  1XPB A;  4MNR A;  2XSS A;  3P98 A;  2OWH A;  4EBP A;  2K2N A;  1WYC A;  2UV0 E;  3DTK A;  2V1Z A;  2JC7 A;  4ID4 A;  2WKR A;  1G68 A;  2WAD A;  3F1P A;  4FOF A;  5CTN A;  3BQ8 A;  3OLO A;  4H6J B;  2YKF A;  1WYB A;  4IUH A;  5HX9 A;  1ERO A;  2HZ5 A;  1SDN A;  5K5B A;  5D3O A;  3N8S A;  3BFC A;  1IEM A;  1NZU A;  1T1B A;  1LLB A;  3LEZ A;  3B33 A;  1IKG A;  2WGW A;  3GQZ A;  3F1N A;  4K0X A;  2JBF A;  5DF8 A;  4C6Y A;  2K31 A;  3HLB A;  3CPT A;  4KZ8 A;  5DKK A;  5J7E A;  2OAP 1;  4B4Z A;  4D60 A;  1ONH A;  5KSH A;  4GCZ A;  5DFX A;  2VKS A;  2JHE A;  3LGO A;  4WZ5 A;  2B5R A;  1NRJ A;  4DDY A;  5FDS A;  4DN0 A;  4QY6 A;  1L2S A;  1A0K A;  5A92 A;  4DJ3 A;  1PYY A;  2PR5 A;  1JWP A;  3T1S A;  3IH8 A;  3KSF A;  5HD3 A;  3RFB A;  4CPK A;  1OTD A;  4LFU A;  1L0F A;  4FH2 A;  4N1H A;  4OON A;  4PPR A;  1WA9 A;  4KUO A;  5CHU A;  3N6I A;  2V0U A;  3ZNT A;  1C3B A;  4CLC B;  1OTA A;  4HEF A;  3E4Q A;  3B3X A;  2Y4A A;  3N8L A;  3R7W A;  2DRW A;  1IYS A;  2PAV P;  4ZAM A;  2KDK A;  4MN5 A;  2L0W A;  1NLZ A;  3NHQ A;  1DJA A;  2PBY A;  4Q0J A;  2GZA A;  1VB6 A;  2Y2I A;  4JKT A;  5F68 A;  5F5Y A;  1K55 A;  4CLC E;  3D3O A;  3LUQ A;  5I5L A;  2QKP A;  4OH0 A;  2M1C A;  2J3T C;  2X02 A;  1G28 A;  4GB7 A;  4Q8I A;  1JNU A;  5A8B A;  1P97 A;  5HPI A;  4I5S A;  5HWW A;  2HP9 A;  1K54 A;  4GDB A;  3HLG A;  4L9E A;  4L0L A;  3UMD A;  2XDM A;  4DDS A;  1ONG A;  2ZD8 A;  5F83 A;  3SZT A;  3P09 A;  5FA7 A;  3SS5 A;  5HPF A;  3RTY A;  3GSG A;  2E8I A;  1JVJ A;  4CLC C;  2ZM0 A;  3FWL A;  4Q0H A;  4EQ1 A;  1T1C A;  1H8M A;  3FKW A;  5G4Z A;  2Z6C A;  3DBA A;  3HLF A;  2OAQ 1;  1N9B A;  3HVF A;  1UWN X;  2XRO A;  3V39 A;  3GVB A;  2V8F A;  4I38 A;  3G32 A;  3UE1 A;  5GHX A;  1W63 M;  1NYY A;  2EX8 A;  5FQJ A;  3IBR A;  2ZM8 A;  3BFG A;  2PU4 A;  3E4P A;  3G2Y A;  3H7W A;  2E8J A;  5FEG A;  4NG2 A;  4BLM A;  5CRF A;  4JGQ A;  2V8C A;  1P9R A;  4Z9Q A;  2ZOH A;  5L10 A;  4DE2 A;  3NY4 A;  2Y2N A;  3RH8 B;  4MCW A;  5F82 A;  4GZB A;  5E43 A;  1YSP A;  4GOG A;  1S66 L;  2J9P A;  4I3J A;  3CJM A;  2JKG A;  3CG5 A;  2GJ3 A;  4IBX A;  1XP4 A;  4OPY A;  4HP9 A;  3QHY A;  2ZM2 A;  3C7V A;  3VE3 A;  2H10 A;  4LEN A;  1CEF A;  5CED A;  1M40 A;  3B42 A;  4OQH A;  1Y54 A;  3ISG A;  4E3I A;  5EEC A;  1KE3 A;  4ZBE A;  1V9Y A;  3MS6 A;  4N92 A;  5TBM A;  5CEB A;  2PT7 A;  3EOI A;  1M6K A;  3DWZ A;  3VFF A;  2C6W B;  1IYP A;  4KG5 A;  4B4X A;  3V50 A;  1S1Y A;  1H8Y A;  2D02 A;  3IXH A;  1HD8 A;  2XD1 A;  4HHD A;  5HAI A;  2KOI A;  2WK0 A;  4R4S A;  1O07 A;  1G6O A;  2PDR A;  1RP5 A;  2HP6 A;  3D72 A;  1YLW A;  4FUW A;  3OPR A;  5CTM A;  1K0K A;  2FFF B;  1CJF A;  1YMS A;  4LCM A;  4FD8 A;  2JE5 A;  3MZD A;  4S2K A;  4M3K A;  4WUJ A;  5TFQ A;  5GLB A;  3BJN A;  4NEE D;  1DP6 A;  2Y91 A;  1TEM A;  3ZCZ A;  4LCL A;  1ZHH B;  1OME A;  4XUX A;  4DRT A;  5EPH A;  3SOI A;  1ES4 A;  1H8Z A;  4H8R A;  5FAS A;  3IH9 A;  5HAQ A;  1PW8 A;  2Y79 A;  1V9Z A;  4LRY C;  1UGU A;  4EUZ A;  4RX3 A;  1PW1 A;  2Y2P A;  4YWZ A;  4EQI A;  1EI5 A;  1OPX A;  4EER A;  2ZQ7 A;  1CK3 A;  5FQQ A;  4KZ3 A;  3VP0 A;  2R9W A;  2P9V B;  3G30 A;  3O86 A;  3NJA A;  3LIC A;  1SDE A;  4DXB A;  2Y2K A;  3DTE A;  4UAA A;  3WS0 A;  2EXB A;  3EWK A;  1I2S A;  1BTL A;  1ES3 A;  3UN7 A;  4GS9 A;  4XT2 B;  2A49 A;  1NWZ A;  3ZG9 B;  4OKP A;  2JKR I;  4JBF A;  4I3I A;  4WL9 A;  1PI5 A;  3S7N A;  2OSU A;  2W1T B;  4PMA A;  3RJU A;  4S2P A;  4ARZ B;  3HLW A;  3IX4 A;  2XLN A;  1KE4 A;  3UDX A;  3IX8 A;  3W8K A;  4P0M A;  4CQH A;  3PBQ A;  4DE0 A;  2YKH A;  1MBL A;  5E2H A;  3LY3 A;  4EBN A;  3H82 B;  1JTD A;  1D06 A;  4OOM A;  4WEK A;  4G3W A;  3V3R A;  1ERQ A;  2EFU A;  4NK3 A;  4AFI A;  5JYO A;  5GL9 A;  4MN7 A;  3ZYT A;  3H9W A;  3BFE A;  3HLC A;  4KZB A;  5GLA A;  3PBR A;  1MKM A;  3UPN A;  3VSK A;  2GNX A;  3UE3 A;  4GW9 A;  4FSF A;  5F1F A;  4IBR A;  1TD5 A;  4UA9 A;  4NKP A;  3PBT A;  3KO6 A;  4EEP A;  1W8Q A;  5DTK A;  2PD8 A;  2Y2H A;  1L0G A;  1J3W A;  4GNU A;  1FCN A;  2Q9N A;  3UB8 A;  4E3L A;  2V1A A;  3IF6 B;  4JLF A;  4ZJ1 A;  3G6O A;  3IHA A;  2A24 A;  3EQV A;  3U4L P;  4QPR A;  2VGL M;  3BWL A;  4Y2F A;  4O7D A;  2IWB A;  4R1G A;  3MJQ A;  3IS2 B;  1S6R A;  3WRZ A;  3MQ0 A;  5E2G A;  5EM1 A;  3EEA A;  3GTC A;  3LIF A;  2DCF A;  4S2I A;  3C4P A;  1E25 A;  5AVF A;  4PM5 A;  1F98 A;  1N9L A;  2B18 A;  1XKZ A;  4Y17 A;  4HH2 A;  2AVX A;  4JGR A;  4RVA A;  4E3K A;  4UA7 A;  4KG2 A;  1W5D A;  2L1M A;  5HWT A;  3C2W A;  3DTM A;  1IYO A;  5HD5 A;  3S7Q A;  4GHI A;  2P08 A;  5FI7 A;  2J80 A;  2QMI A;  2A2L A;  4IVK A;  3CAX A;  5L8M A;  4HES A;  4EU0 A;  2QPN A;  3HLD A;  5JYP A;  2OV5 A;  3OC2 A;  3W2Z A;  3PR6 A;  2HDQ A;  3F1O B;  2H0T A;  4ME4 A;  5DJU A;  3UE6 A;  2ZL1 B;  1K56 D;  2OLV A;  1TS0 A;  2P9V A;  2VLG A;  1PI4 A;  4MBF A;  4JXS A;  4NET A;  5EVI B;  4KQR A;  5CEC A;  4HBU A;  2XGN A;  1HLU P;  5AQ9 A;  3IT9 A;  2NUT C;  5EM0 A;  4N9K A;  4OOL A;  2VV6 A;  3BLS A;  3QP8 A;  4E3N A;  1LI0 A;  3NOU C;  4XT2 A;  4YFM A;  2VGK A;  2XA7 M;  3A3I A;  1GSV A;  2VGJ A;  2VV7 A;  5EFW A;  2FH5 A;  1OTE A;  1VET B;  1L0E A;  4BBT A;  3IWI A;  4JXV A;  2J3T D;  2B95 A;  3BW6 A;  3G4P A;  1LL9 A;  3EGD C;  4EXO A;  4X25 A;  2XRN A;  1FSY A;  3VOZ A;  2W3G A;  3Q07 A;  1MC0 A;  1HTZ A;  2W3F A;  5DTS A;  2FFY A;  1FIL A;  4CLC D;  4E3O A;  3LEQ A;  4CJN A;  5EVI C;  3ITA A;  3A0V A;  2XA7 S;  2MJ6 A;  4RX2 A;  3WS2 A;  3VP2 A;  3Q1F A;  4K91 A;  2XF3 A;  2P04 A;  1GCE A;  4HY8 A;  2INW A;  1FSW A;  3V3S A;  2ZC3 B;  2WKI A;  4BL2 A;  2R9X A;  3FPW A;  3ZG5 A;  1NZO A;  2G2U A;  2XEP A;  4LV0 A;  3W4Q A;  2WZX A;  4P87 A;  3JVU A;  3GR2 A;  3UE0 A;  3LO7 A;  3QNB A;  5F69 A;  3VE4 A;  2O9B A;  1GSX A;  1NXY A;  4PKY A;  3VP1 A;  3VP4 A;  4PM8 A;  3P01 A;  4LGW A;  2PYP A;  1IKI A;  4R70 A;  3T4L A;  2HP5 A;  2EXA A;  3ZQ5 A;  3IF5 A;  3A0S A;  4KZ6 A;  5AVE A;  1F9I A;  1XGJ A;  1HZO A;  4X6T A;  2J7V A;  4MDZ A;  1ESU A;  3PBS A;  2VEA A;  2Y55 A;  4KQQ A;  1YAX A;  3A3D A;  3W4P A;  4Y5F A;  2HV1 A;  4FCF A;  4GJ4 A;  2WUQ A;  1UWP X;  1MY8 A;  2PD7 A; 
#chains in the Genus database with same CATH homology
 1G5U A;  2B95 A;  3CPT A;  1PFL A;  5EV0 A;  4FUW A;  1ACF A;  4D60 A;  1K0K A;  5EM1 A;  4X25 A;  1CJF A;  1SKO B;  3LGO A;  2V8F A;  1SKO A;  5FDS A;  3D9Y A;  1A0K A;  1FIL A;  3LEQ A;  3L7H A;  5FEF A;  3T1S A;  1VET A;  2ACG A;  4X1M A;  2E8J A;  2PBD P;  1VEU B;  3DAV A;  5FEG A;  3L9K A;  1SZV A;  1VEU A;  1YPR A;  1Z09 A;  2PRF A;  3KYE A;  4QWO A;  2V8C A;  3T12 B;  5EVE A;  1CQA A;  1AWI A;  3MSH A;  3T1Q B;  2PAV P;  2BTF P;  2JKG A;  1CF0 A;  4FTX A;  2JKF A;  1J3W A;  2ZL1 B;  3UB5 P;  1PRQ A;  3NEC A;  1D1J A;  4X1L A;  3NUL A;  3CPT B;  3MS6 A;  1HLU P;  2VK3 A;  5EM0 A;  2HZ5 A;  1PNE A;  1Y4O A;  3U4L P;  3T1R A;  3CHW P;  4ESP A;  1FIK A;  1F2K A;  1VET B;  2ZL1 A;  3T1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...