4ESPA

Crystal structure of peanut allergen ara h 5
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
130
structure length
130
Chain Sequence
SWQTYVDDHLLCEIEGNHLSSAAILGQDGSVWAQSSNFPQFKPEEITAIMNDFAEPGSLAPTGLYLGGTKYMVIQGEPGTVIRGKKGPGGVTIKKTNQALIIGIYDEPMTPGQCNMIVEKLGDYLIDTGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Peanut ( Arachis hypogaea ) Allergen Ara h 5.
pubmed doi rcsb
source organism Arachis hypogaea
molecule tags Allergen
molecule keywords Profilin
total genus 39
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2012-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4espA00
1VEUB 1PRQA 3T1RA 5EM0A 2E8JA 3LGOA 3D9YA 5EVEA 1PNEA 1AWIA 3CPTA 2ACGA 1VETB 3CPTB 2B95A 3LEQA 3KYEA 4FTXA 4X1LA 5FEFA 2JKFA 3NULA 1CJFA 2HZ5A 2PRFA 4QWOA 3MS6A 4ESPA 1SZVA 1CQAA 1CF0A 1A0KA 2PBDP 5EM1A 3U4LP 3T1XA 3MSHA 3L9KA 1J3WA 1F2KA 3L7HA 1FIKA 1FILA 3DAVA 5FEGA 1Z09A 3CHWP 5EV0A 2JKGA 2PAVP 2ZL1A 2BTFP 3UB5P 3T1SA 2VK3A 2ZL1B 1YPRA 4FUWA 2V8FA 4X25A 4X1MA 1K0KA 1Y4OA 3T12B 2V8CA 1PFLA 5FDSA 3NECA 1SKOB 1ACFA 4D60A 1VETA 3T1QB 1SKOA 1VEUA 1D1JA 1HLUP 1G5UA
chains in the Genus database with same CATH superfamily
3IBJA 5GLCA 1GCEA 4N92A 2XSSA 3IF6C 2FFYA 2WKPA 2JCHA 2EWWA 3VP1A 5HAPA 1V9YA 2B5RA 2XD1A 1WYBA 3ZVWA 2M7VA 2PU4A 4F3LA 2ZOHA 1IYSA 3T1SA 1ZKJA 5CEBA 3B33A 5DKKA 3LI9A 3S4XA 3JVVA 4P87A 4RX2A 4R23A 2QMIA 3SOIA 4E3NA 2O9AA 1CJFA 3TOIA 1CQAA 3PAGA 1TDGA 4OQ0A 5GLBA 3EGDC 3SH7A 1L3LA 3A0SA 3K3DA 3BEBA 5J7EA 1XXMA 4GS9B 4OQHA 4XT2B 5EVEA 1IKIA 4BLMA 4JKTA 4GHIA 1E3UA 1XX2A 4PPRA 1M6KA 1W63M 2W1TB 3M2KA 2A24A 4Y0UA 4NG2A 4JXGA 1Y4OA 4I3IA 1RGZA 3ZG8B 3M6BA 4YFMA 5CTNA 3LY3A 5EM0A 3CUEC 4ZJ1A 1OTIA 3PBTA 4JBFA 1TS6A 5C5KA 3VE3A 1FSYA 3N8SA 1KE3A 3HLDA 4MCWA 4F94A 5DTSA 3D3OA 5HWVA 2VGLS 2V8CA 4GDBA 4EW7A 3CPTA 3LFVA 3QP6A 1I2WA 1IKGA 4WYYA 4XUXA 2HZ5A 1BLPA 4JF6A 1I2SA 3S1YA 2VGLM 4OQGA 3OOVA 3F1NA 4P85A 3TSGA 2EFUA 1BUEA 4QJGA 2WUQA 2QKPA 4U0XA 3W4QA 3T4JA 3LR4A 2EX8A 3P7NA 4FH4A 2W3FA 3IX4A 3EWKA 4CLCC 2BG1A 1YSQA 4B9OA 1NWZA 3LR0A 2I72A 3MFDA 2P9VB 2LB5A 2C6WB 3UDIA 3C7UA 3JYIA 2M7UA 3NBLA 1G6OA 3LIDA 2QHKA 4DDSA 4R1GA 2Z6DA 4CPKA 3H7WA 4HP9A 3O5YA 1S67L 4HJ6A 3ITAA 3E4QA 3TE8A 3FG8A 4X69A 5FAQA 3IF6B 1HLUP 3PXPA 3BWLA 1NZUA 2HGVA 3MQQA 3LIBA 3KX0X 4Y13A 3G31A 2INWA 1ZTUA 1QMEA 3ZYTA 3IHBA 3NDGA 3EQUA 4HQAA 4OVDA 3Q7VB 5GLAA 3ZG9B 4CLCB 1K55A 2WKRA 1YMSA 1MC0A 4UA7A 1T1CA 4WZ4A 5FQKA 1OTDA 5G4YA 4WEJA 3MKFA 3E2LA 3UE1A 3WRZA 4GHIB 1FCNA 3MS6A 4R3AA 2XFTA 3IF5A 1UWPX 1YLWA 1LSXA 1H8ZA 3G6OA 3NECA 3Q82A 5KSHA 3ITBA 4P6BA 4NKPA 5FSRA 4DE3A 4S2NA 1NRFA 1MWTA 3HREA 5HAIA 5AVFA 3HLCA 4IJGA 1IFQA 2Q9MA 1CI9A 3IHAA 5HWTA 3A3DA 2ZC4B 3UB6A 3DTIA 4DRTA 4Y17A 2PD8A 4HP4A 1KGGA 2WGVA 4MMNA 4WMCD 3IWIA 2GZAA 3OPRA 5DFXA 1L0DA 2OAQ1 2XA7S 3GSGA 2OWJA 3KYEA 3MZDA 3T1XA 5MC7A 3DW0A 3QP1A 1LLBA 3ICYA 3T4SA 2LB9A 2YKFA 4UAAA 2ZL1B 4I3JA 5J8XA 3GDIA 5G4ZA 4K0WA 1HZOA 3WS4A 3UMEA 5HARA 5EVLA 5DJTA 1MZUA 1PW8A 4Q0HA 1G28A 2XH9A 5E2GA 1F9IA 3NC8A 1JNUA 3E0YA 3KSHA 2OWHA 2WAFA 2HP5A 2UV0E 4Y0TA 2VLGA 4I3AA 1YLTA 5KIZA 1YT4A 1G5UA 3EOIA 4X1LA 5FA7A 3IXGA 5HPIA 3U4LP 2JKRI 3ZCZA 4S2KA 1K38A 3CHWP 2Y2OA 4KZBA 1N9OA 3IH8A 3MKEA 3C30A 3SS4A 5EOEA 2L4RA 3R7WA 4EBLA 3LEQA 5CGWA 1TDLA 2ZC3B 2HP9A 4HIAA 3VSLA 3WWXA 1DP9A 4HJ3A 1H3QA 4X68A 3PR6A 2OLUA 5CRFA 3Q7VA 3RXWA 5A90A 4BJPA 2ZMAA 3OPLA 1RCJA 4Y15A 2RL3A 2V2FF 4EQIA 2V9AA 5FQMA 4ARZB 3G35A 1LL8A 3LY4A 1XPBA 1XJ6A 4BL2A 1D06A 1G6AA 4Y3IA 3G32A 2JHEA 4WF0A 4S2MA 1FCOA 4HJ4A 4F3LB 4DN0A 3KYZA 5EV0A 5DJUA 4LV3A 4E6XA 4GDNA 1H0MA 4JXWA 5CECA 1ACFA 2WADA 2WGIA 4I38A 3AGFA 4JGRA 4O7DA 3B47A 1O07A 1GHMA 5DF9A 4B88A 1BLCA 5DF8A 4QWOA 3S7PA 3JVUA 4Y2FA 2WGWB 2OLVA 3DTEA 1S1YA 1ZC2A 2VV8A 2PBYA 5LBRA 1S0WA 3O87A 5AQ7A 3HJKA 4R6LA 4GN2A 1PI5A 1DJBA 4NETA 3T4OA 2J9PA 2ZQCA 3V3RA 3OC2A 2EX2A 4BL3A 4KG6A 5A92A 4R3JA 4BENA 1JWVA 1YAXA 4P6ZM 4E3JA 1PYYA 4EEUA 3TW8A 2BLSA 4LENA 1MWUA 2D01A 1L2SA 3S22A 2J3TD 3IXBA 4OOYA 1PZPA 4WN5A 3HL9A 3V67A 3Q7ZA 4HBUA 5E2HA 2E8JA 3S7QA 4PMAA 1YLYA 3EEAA 5HW3A 1PWGA 2ZMVA 3QP2A 4MDZA 4PM7A 4LRZE 2PBDP 1OPXA 4KZ8A 1IYOA 4JGPA 1OJGA 4ID4A 3A3EA 2PD7A 3IQAA 3OPHA 2Y2GA 2W0NA 2YKHA 4OPRA 3ZGAB 5IT5A 4BQMA 3W8KA 1ES4A 4GD6A 4OLDA 3NI9A 3Q07A 2QZ6A 2XA7M 2ZLYA 2FZ0A 1FSWA 4IBRA 4B93A 4C75A 3T1QB 4U3TA 3LYXA 5L07A 2HDQA 4KZ5A 3A3FA 4OPYA 2PHYA 2PU2A 3SS3A 3FYZA 1E4DA 3C2WA 2QPNA 3HUOA 3LIFA 1S6RA 3KSIA 4ZTKA 2V0UA 2WK0A 3IH9A 2W3HA 2P74A 4LLOB 2HDUA 4RA7A 3HBRA 5EVIA 2GX5A 3ZHHA 4EEPA 4L9FA 1S66L 2MJ6A 4EESA 2EWVA 2XRNA 5DVAA 5HDDA 3VV4A 5EPHA 3DTKA 3N8RA 1SDNA 1H8MA 3H9WA 3MJQA 4R4RA 2A24B 2WKEA 2KLIA 2JN7A 4YINA 4KZ4A 3OCLA 4NXEA 5E43A 5TFQA 3FV7A 1GSWA 4H8RA 3WS5A 4MEZA 2P08A 4U0TA 4E3OA 2ZC6B 5GL9A 4OH0A 1TS7A 1T1AA 1BYWA 2FFFB 1YSPA 4DJ3A 2JKTI 3RXXA 3OCNA 3UY6A 1VETA 2Y4AA 2ZQ7A 4JF5A 1Q2QA 3UPNA 2XFSA 3CPTB 3MR0A 3WRTA 3BFDA 4X55A 2G2WA 3LUQA 4KUOA 5TBMB 1MXOA 1TS0A 3PAEA 1NYMA 4ZJ2A 3LIEA 5F1GA 3MXRA 2NUPC 1I5QA 4WLAA 5E2FA 5AQ9A 2XQZA 3UO9A 1D7EA 1FILA 2IWDA 2DCFA 4MN7A 4IUHA 2O0YA 3IX3A 5U47A 3GVBA 2EA9A 3VP4A 3SZTA 1BT5A 2ZMFA 2VX8A 2J7VA 5A93A 3C4OA 3TG9A 1N9NA 5CX7A 2ZL1A 3TJZC 1WA9A 5E2EA 5L10A 3C38A 2B18A 3DWKA 3T4TA 5L2FA 1P9WA 1V9ZA 1ZG6A 4GZBA 1SHVA 1DRMA 1XGJA 1IELA 4FOFA 4X6TA 5EE8A 5DF7A 3QNCA 2H10A 4X25A 1P9RA 1YMXA 1SCWA 1XGIA 1P97A 1FQGA 1VEUA 3WS1A 2HDRA 4CLCE 1PRQA 1TS8A 3D9YA 1N9LA 4NXBA 5F69A 1MBLA 4BD1A 2QJ7A 3W2ZA 3E2KA 3EQVA 2Y91A 3MF0A 1JVJA 5F68A 4P0MA 2I9VA 4GLQA 2Y2JA 3PBRA 5EOOA 3K2NA 3AGEA 2EFXA 1GA0A 2HJ9C 4D2OA 3BY9A 4WELA 1GHPA 4WEKA 3V39A 4EBNA 3GECA 4P6ZS 1DY6A 5FI6A 4GKUA 4ZAMA 5HAQA 4R0QA 2BTFP 1BSGA 3LICA 5FDSA 1JTGA 4GW9A 4JF4A 4Z1WA 3IF6A 2XROA 4YWZA 1GSXA 4EUZA 3E98A 2VJWA 3IWQA 1ZHHB 2VEAA 4I39A 4IHQA 2W1TA 4ZDXA 4JXVA 1CEGA 1J3WA 5AVEA 4RYEA 2V1BA 4CLCA 2PAVP 4K08A 2O9CA 1F5MA 2VV7A 3V50A 3CWFA 1ES3A 4DDYA 2VGJA 5EVIB 4E3KA 3ZFZA 5CEDA 1PNEA 3UE3A 4Y0OA 3UE6A 3VFHA 2R9XA 2DMWA 4KQRA 4WBGA 4NK3A 2W3DA 2XR0A 3HLWA 1DP8A 1LSWA 4Z9QA 1Z09A 3PBOA 1S4RA 3UE0A 1OT9A 2V8FA 2W3GA 1OJ5A 4G3KA 2ZBBA 4FD8A 1EROA 4B4ZA 5HL1A 3MBZA 1NJ4A 2PRFA 4EUVA 3EGXC 1M40A 3SS5A 1KE4A 4CJNA 4FCFA 1KGEA 1U60A 2VA0A 3M2JA 4JPMA 3JPUA 3P98A 1KGFA 3BYDA 4PM5A 2QJ5A 3BQAA 3F1OB 3O86A 3FC7A 3MFXA 3LIAA 1CI8A 3ZG5A 3A0VA 1KE0A 1K4FA 1K6RA 2H0TA 1K6SA 1DP6A 2KOIA 1BLHA 1EWZA 1KDSA 1N9BA 4X56A 4NEED 1VB6A 3RTYA 5FAPA 1ESUA 3HLGA 5HPFA 2VV6A 3G2YA 3CLOA 3RJUA 1SKFA 1X0OA 4R3BA 4XUZA 4BWIA 2Y2PA 4S2NC 3VFFA 3N8LA 2ZOIA 5CERA 4LV1A 4QD4A 3ZNYA 1MWSA 3BFEA 3HLEA 1N4OA 5FASA 2OV5A 3ZVTA 3B3XA 5JYOA 3PYPA 3BFFA 2EX6A 4MBKA 4ZJ3A 4K0XA 5A8BA 3UB7A 5L8MA 2GDNA 1PZOA 5TBMA 4KQQA 3OZHA 3I7JA 4IBXA 2K7SA 1OTEA 1XP4A 4FUWA 1K0KA 1YLZA 1LL5A 5CHMA 5F1FA 4BBVA 4QPRA 1PIOA 1K55C 3T50A 3KO6A 2D02A 2M1CA 3NCKA 2V20A 1MWRA 4RX3A 4DJ2A 1XA7A 3KSGA 5G18A 3P01A 3SH9A 1KDWA 5AQBA 1F2KA 1FCMA 1UWNX 4JLFA 3ZDJA 2W1RA 5L09A 4UQIM 2JKTM 1STZA 1IYQA 1BLSA 3IT9A 1PFLA 4LPZA 2PR5A 5DTKA 1VEUB 4LFUA 4N1HA 4ETZA 3HJIA 4ETXA 3IS2B 1C3BA 4Q8IA 4PM6A 5F6AA 1UGUA 4OONA 4S2OA 5FQIA 2FH5A 4HESA 2W3EA 4L0LA 5FEGA 4HI4A 1XA1A 5EUAA 2XEPA 2WZXA 3LO7A 2IWBA 3R7WB 4NXFA 1T1BA 1IEMA 4LRYC 4QB8A 3C4PA 1ESIA 1K54C 2Y55A 4PAUA 2WYXA 3H82A 3BW6A 1H5XA 4OP8A 2HF6A 1RP5A 3OLOA 2VKSA 3FZCA 2Y2NA 5FI2A 1E3UD 5IHVA 3MZEA 3BECA 3ZNTA 3IXDA 3NOTC 3ULFA 3F1OA 2HV1A 2VZWA 4GCZA 5AQAA 2VGKA 2J3WA 5CGSA 4E3MA 4D60A 4OKPA 2H5SA 4KQDA 4JGQA 2ACGA 2ZM2A 4GB7A 4IUKA 5HSQA 3BM6A 3QP5A 3L9KA 4B4XA 1PI4A 4YNRA 3VOZA 2Y2LA 2ZQDA 3PBNA 2Y2IA 2Z6CA 4LRXC 4Q0JA 4II7A 2W27A 2ZD8A 4OOMA 4L9EA 3FPVA 5DFYA 1CEFA 3HCYA 2X01A 4KENB 4WMCA 5FQJA 4BBUA 1FR6A 5D3OA 2A2LA 1ALQA 3NOPC 1VHMA 1S1ZA 2Y8HA 1D1JA 3CJMA 4YOFA 2HPBA 5F82A 4GS9A 2J80A 2A49A 1MY8A 2JC7A 3NY4A 2J9OA 2G2UA 3G34A 5EFWA 1O7EA 1ES5A 1P0ZA 1TVFA 4LV2A 3K3CA 4MN5A 3PTEA 5EECA 1NXYA 1NLYA 2IWCA 3PBQA 1T18A 5BOHA 1HTZA 1A0KA 3V3SA 2JKRM 4UA9A 1K25A 2WKHA 5GLDA 4EBPA 1FR1A 1DJCA 3DBAA 5AJGA 5M1AA 1LT0A 1G68A 4Y5FA 4DE0A 3MXQA 3FKVA 2QWSA 3UN7A 2PR6A 5TGFA 4HNBA 4FSFA 4Q0IA 3BLSA 1ERQA 4OP5A 1VETB 3VP0A 2Q9NA 2C5WB 2KDKA 1J9MA 5EVIC 3GV9A 4MLLA 1PWDA 3QP8A 5EM1A 3GMWA 1XJ2A 3HUNA 2J8YA 2Y2KA 1ZG4A 3DWZA 3CG5A 4UHUA 4JXSA 1FOFA 4HBTA 3QNBA 4KUKA 4H6JB 1OTBA 1BZAA 1TF1A 4WM9A 2XGNA 3BFGA 4DE1A 2JKFA 2ZM8A 4GNUA 3LCEA 1L0EA 5M19A 4HOIA 4MBFA 4KZ9A 5HL6A 1PWCA 4I5SA 1XFNA 3UPPA 4S2PA 5F83A 1W7FA 1S4SA 4R70A 4N9KA 1H8YA 1NRJA 2R78A 1NYYA 4R4SA 3HLFA 2XF3A 3W4PA 1EI5A 4CQHA 3A0RA 1ERMA 3CITA 2K31A 4X1MA 4EV4A 1W79A 1GSVA 2K2NA 3O88A 2L1MA 1QMFA 1NLZA 2OAP1 2UWXA 4KZ7A 1BTLA 3NULA 4LCLA 3C8CA 1OT6A 1MKIA 1EW0A 1MPLA 3MSHA 1K54A 4KG2A 4LV0A 2A3UA 4GJ4A 3CUEA 3BQ8A 4KQOA 3IBRA 5TR7A 4UA6A 2V1ZA 1KVMA 1LHYA 4S2LA 2RCXA 2Q0OA 2OOLA 1XKZA 3CMZA 3VOYA 4LGWA 2XK1A 3MQOA 3EEHA 3D4FA 3T12B 5KSCA 3SH8A 4XT2A 4G3VA 1YKDA 3PBSA 3DTMA 3UDFA 1YM1A 1Q2PA 2BASA 3NJAA 3D72A 4QU3A 3CZDA 3N7WA 3CAXA 3L7HA 4WL9A 2X71A 1KOUA 2V1AA 2PYRA 1OMEA 4C6YA 1MKMA 4DKIA 5FQQA 2Y2MA 4QHCA 2L0WA 3CI6A 1K57C 5FAOA 5FEFA 4HH3A 3BRMA 2Y2QA 3VP3A 4QY6A 3T4LA 5J4EA 1XJ4A 3LI8A 3C5AA 3G30A 4EERA 4QY5A 1YPRA 1SDEA 1VM1A 2XLNA 1CK3A 3C7VA 4S2IA 1AWIA 2NUTC 4RVAA 3FWLA 2B02A 5IS1A 2PYPA 4UEYA 4ESPA 5FATA 2WAEA 1DJAA 3GR2A 5TJJA 4ME4A 2HJEA 4OLGA 5HD3A 2J3TC 3F1PA 2EX9A 3M6HA 4IVKA 5FQ9A 3P09A 5CHJA 3LR3A 3A3JA 1LL9A 3FKWA 4OPQA 1SZVA 3E4PA 5CXWA 1XFQA 3B42A 1Z6FA 2WKQA 4DE2A 4L9GA 4K91A 4LCMA 1HD8A 2DRWA 2XDMA 2HDSA 3NHQA 5GHYA 1T19A 1JWZA 2WZZA 1K56A 3N4IA 4IEDA 4A5RA 4CLCD 3T4QA 1LI0A 4WZ5A 1AXBA 4PKYG 2O9BA 4E3IA 4KZAA 1RGYA 5KZHA 5CTMA 1JTDA 1KVLA 4MNRA 2E8IA 2O99A 1Y54A 3RH8B 5FI7A 5HFOA 4MBHA 5CGXA 3IS2A 1K4EA 1ONGA 4GOGA 1W63Q 3UB8A 1YLPA 1ONHA 5IU1A 3BY8A 1XJ3A 1LI9A 2JBFA 2JE5A 4IVIA 3NDEA 4EQ1A 2Y59A 5FL3A 3UB9A 3Q81A 1F98A 2IA2A 1HVBA 3LR5A 4PM8A 5GHZA 4EWFA 4X53A 3LEZA 3UNWA 4XXRA 2Y2HA 3HUMA 3UDXA 3KSFA 1ODVA 3GTCA 3G2ZA 2GNXA 4H6JA 4BMWA 4M4XA 5HZHA 4ARZA 1IYPA 3UMDA 2B95A 3ZG7B 2XD5A 4O0PA 2DNSA 4JGOA 2ZJ9A 5HDCA 5J3WA 3IXHA 5F5YA 3TRCA 1Y28A 3RFBA 4N1XA 3UB5P 3VE4A 1YLJA 3WS2A 4GD8A 4HHDA 5HWWA 4MN6A 3VOLA 3S7NA 3HVFA 3Q1FA 3O3VA 1TD5A 4O8GA 3VMAA 2ZQAA 3MQ0A 2EXAA 5HDSA 1SKOB 1WYCA 4FH2A 2P04A 2HP6A 3F1PB 1W5DA 4PHTA 1VQQA 2Y79A 4N9LA 5I94A 3KYQA 3ISGA 1L0GA 2V0WA 5DKLA 2AVXA 2KX6A 1OTAA 3DAVA 3QHYA 4OQIA 5HX9A 1YQSA 3AGDA 2WKIA 3G4PA 4DXCA 1W8YA 2P7JA 3MZFA 2ZQ8A 2ZC7A 4OPZA 2H28A 2WGWA 4PM9A 3UPOA 3BLMA 4HH2A 3HLBA 2JKGA 1W8QA 4E3LA 3ZG0A 4S2JA 1L0FA 2P9VA 4AFIA 1WE4A 1NY0A 4E6WA 2ZQ9A 2Z2MB 4KZ6A 4FTXA 3OBFA 4HY8A 3BJNA 1JWPA 4HEFA 1CF0A 5HD5A 3A3IA 3NOUC 4EU0A 4KZ3A 1GA9A 1GHIA 5K5BA 5GHXA 1IOUA 3IWOA 2CC1A 2ZM0A 3R4KA 1ES2A 4DMZA 4M3KA 4BBTA 3SW1A 4PKYA 3N6IA 3ZQ5A 2Z2LB 5JYPA 1BULA 1NZOA 2PT7A 3V5MA 5EVID 2H0YA 4EETB 5CHUA 2OSUA 1TEMA 2R9WA 2EXBA 4R38A 1LSVA 4ZBEA 4Y7PA 3H7WB 2CMNA 3VSKA 3MXSA 3W4OA 4E04A 3U2AA 1FIKA 3E4OA 2PDRA 1PW1A 3OPPA 4ZRRA 3GQZA 3T1RA 3FPWA 4BD0A 3NIAA 3S7OA 3H82B 4KG5A 4DXBA 5M18A 4G3WA 4DF6A 5FDHA 4WZ5C 1K57A 3IX8A 4NXGA 5KMWA 2G7UA 3F1NB 5A91A 3WS0A 2QYBA 1SKOA 4RQ9A 3LGOA 3QP4A 4O01A 3T4KA 5DTTA 2ZC5B 1K56D 4EXOA 5I5LA 3MMHA 4C3QA 3PHYA 2GJ3A 3BFCA 3VP2A 2X02A 4UQIS 1E25A 2VK3A 4OOLA 3GRJA 4WUJA
chains in the Genus database with same CATH topology
1VEUB 1PRQA 3T1RA 5EM0A 2E8JA 3LGOA 3D9YA 5EVEA 1PNEA 1AWIA 3CPTA 2ACGA 1VETB 3CPTB 2B95A 3LEQA 3KYEA 4FTXA 4X1LA 5FEFA 2JKFA 3NULA 1CJFA 2HZ5A 2PRFA 4QWOA 3MS6A 4ESPA 1SZVA 1CQAA 1CF0A 1A0KA 2PBDP 5EM1A 3U4LP 3T1XA 3MSHA 3L9KA 1J3WA 1F2KA 3L7HA 1FIKA 1FILA 3DAVA 5FEGA 1Z09A 3CHWP 5EV0A 2JKGA 2PAVP 2ZL1A 2BTFP 3UB5P 3T1SA 2VK3A 2ZL1B 1YPRA 4FUWA 2V8FA 4X25A 4X1MA 1K0KA 1Y4OA 3T12B 2V8CA 1PFLA 5FDSA 3NECA 1SKOB 1ACFA 4D60A 1VETA 3T1QB 1SKOA 1VEUA 1D1JA 1HLUP 1G5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VEU B;  1PRQ A;  3T1R A;  5EM0 A;  2E8J A;  3LGO A;  3D9Y A;  5EVE A;  1PNE A;  1AWI A;  3CPT A;  2ACG A;  1VET B;  3CPT B;  2B95 A;  3LEQ A;  3KYE A;  4FTX A;  4X1L A;  5FEF A;  2JKF A;  3NUL A;  1CJF A;  2HZ5 A;  2PRF A;  4QWO A;  3MS6 A;  4ESP A;  1SZV A;  1CQA A;  1CF0 A;  1A0K A;  2PBD P;  5EM1 A;  3U4L P;  3T1X A;  3MSH A;  3L9K A;  1J3W A;  1F2K A;  3L7H A;  1FIK A;  1FIL A;  3DAV A;  5FEG A;  1Z09 A;  3CHW P;  5EV0 A;  2JKG A;  2PAV P;  2ZL1 A;  2BTF P;  3UB5 P;  3T1S A;  2VK3 A;  2ZL1 B;  1YPR A;  4FUW A;  2V8F A;  4X25 A;  4X1M A;  1K0K A;  1Y4O A;  3T12 B;  2V8C A;  1PFL A;  5FDS A;  3NEC A;  1SKO B;  1ACF A;  4D60 A;  1VET A;  3T1Q B;  1SKO A;  1VEU A;  1D1J A;  1HLU P;  1G5U A; 
#chains in the Genus database with same CATH topology
 3IBJ A;  5GLC A;  1GCE A;  4N92 A;  2XSS A;  3IF6 C;  2FFY A;  2WKP A;  2JCH A;  2EWW A;  3VP1 A;  5HAP A;  1V9Y A;  2B5R A;  2XD1 A;  1WYB A;  3ZVW A;  2M7V A;  2PU4 A;  4F3L A;  2ZOH A;  1IYS A;  3T1S A;  1ZKJ A;  5CEB A;  3B33 A;  5DKK A;  3LI9 A;  3S4X A;  3JVV A;  4P87 A;  4RX2 A;  4R23 A;  2QMI A;  3SOI A;  4E3N A;  2O9A A;  1CJF A;  3TOI A;  1CQA A;  3PAG A;  1TDG A;  4OQ0 A;  5GLB A;  3EGD C;  3SH7 A;  1L3L A;  3A0S A;  3K3D A;  3BEB A;  5J7E A;  1XXM A;  4GS9 B;  4OQH A;  4XT2 B;  5EVE A;  1IKI A;  4BLM A;  4JKT A;  4GHI A;  1E3U A;  1XX2 A;  4PPR A;  1M6K A;  1W63 M;  2W1T B;  3M2K A;  2A24 A;  4Y0U A;  4NG2 A;  4JXG A;  1Y4O A;  4I3I A;  1RGZ A;  3ZG8 B;  3M6B A;  4YFM A;  5CTN A;  3LY3 A;  5EM0 A;  3CUE C;  4ZJ1 A;  1OTI A;  3PBT A;  4JBF A;  1TS6 A;  5C5K A;  3VE3 A;  1FSY A;  3N8S A;  1KE3 A;  3HLD A;  4MCW A;  4F94 A;  5DTS A;  3D3O A;  5HWV A;  2VGL S;  2V8C A;  4GDB A;  4EW7 A;  3CPT A;  3LFV A;  3QP6 A;  1I2W A;  1IKG A;  4WYY A;  4XUX A;  2HZ5 A;  1BLP A;  4JF6 A;  1I2S A;  3S1Y A;  2VGL M;  4OQG A;  3OOV A;  3F1N A;  4P85 A;  3TSG A;  2EFU A;  1BUE A;  4QJG A;  2WUQ A;  2QKP A;  4U0X A;  3W4Q A;  3T4J A;  3LR4 A;  2EX8 A;  3P7N A;  4FH4 A;  2W3F A;  3IX4 A;  3EWK A;  4CLC C;  2BG1 A;  1YSQ A;  4B9O A;  1NWZ A;  3LR0 A;  2I72 A;  3MFD A;  2P9V B;  2LB5 A;  2C6W B;  3UDI A;  3C7U A;  3JYI A;  2M7U A;  3NBL A;  1G6O A;  3LID A;  2QHK A;  4DDS A;  4R1G A;  2Z6D A;  4CPK A;  3H7W A;  4HP9 A;  3O5Y A;  1S67 L;  4HJ6 A;  3ITA A;  3E4Q A;  3TE8 A;  3FG8 A;  4X69 A;  5FAQ A;  3IF6 B;  1HLU P;  3PXP A;  3BWL A;  1NZU A;  2HGV A;  3MQQ A;  3LIB A;  3KX0 X;  4Y13 A;  3G31 A;  2INW A;  1ZTU A;  1QME A;  3ZYT A;  3IHB A;  3NDG A;  3EQU A;  4HQA A;  4OVD A;  3Q7V B;  5GLA A;  3ZG9 B;  4CLC B;  1K55 A;  2WKR A;  1YMS A;  1MC0 A;  4UA7 A;  1T1C A;  4WZ4 A;  5FQK A;  1OTD A;  5G4Y A;  4WEJ A;  3MKF A;  3E2L A;  3UE1 A;  3WRZ A;  4GHI B;  1FCN A;  3MS6 A;  4R3A A;  2XFT A;  3IF5 A;  1UWP X;  1YLW A;  1LSX A;  1H8Z A;  3G6O A;  3NEC A;  3Q82 A;  5KSH A;  3ITB A;  4P6B A;  4NKP A;  5FSR A;  4DE3 A;  4S2N A;  1NRF A;  1MWT A;  3HRE A;  5HAI A;  5AVF A;  3HLC A;  4IJG A;  1IFQ A;  2Q9M A;  1CI9 A;  3IHA A;  5HWT A;  3A3D A;  2ZC4 B;  3UB6 A;  3DTI A;  4DRT A;  4Y17 A;  2PD8 A;  4HP4 A;  1KGG A;  2WGV A;  4MMN A;  4WMC D;  3IWI A;  2GZA A;  3OPR A;  5DFX A;  1L0D A;  2OAQ 1;  2XA7 S;  3GSG A;  2OWJ A;  3KYE A;  3MZD A;  3T1X A;  5MC7 A;  3DW0 A;  3QP1 A;  1LLB A;  3ICY A;  3T4S A;  2LB9 A;  2YKF A;  4UAA A;  2ZL1 B;  4I3J A;  5J8X A;  3GDI A;  5G4Z A;  4K0W A;  1HZO A;  3WS4 A;  3UME A;  5HAR A;  5EVL A;  5DJT A;  1MZU A;  1PW8 A;  4Q0H A;  1G28 A;  2XH9 A;  5E2G A;  1F9I A;  3NC8 A;  1JNU A;  3E0Y A;  3KSH A;  2OWH A;  2WAF A;  2HP5 A;  2UV0 E;  4Y0T A;  2VLG A;  4I3A A;  1YLT A;  5KIZ A;  1YT4 A;  1G5U A;  3EOI A;  4X1L A;  5FA7 A;  3IXG A;  5HPI A;  3U4L P;  2JKR I;  3ZCZ A;  4S2K A;  1K38 A;  3CHW P;  2Y2O A;  4KZB A;  1N9O A;  3IH8 A;  3MKE A;  3C30 A;  3SS4 A;  5EOE A;  2L4R A;  3R7W A;  4EBL A;  3LEQ A;  5CGW A;  1TDL A;  2ZC3 B;  2HP9 A;  4HIA A;  3VSL A;  3WWX A;  1DP9 A;  4HJ3 A;  1H3Q A;  4X68 A;  3PR6 A;  2OLU A;  5CRF A;  3Q7V A;  3RXW A;  5A90 A;  4BJP A;  2ZMA A;  3OPL A;  1RCJ A;  4Y15 A;  2RL3 A;  2V2F F;  4EQI A;  2V9A A;  5FQM A;  4ARZ B;  3G35 A;  1LL8 A;  3LY4 A;  1XPB A;  1XJ6 A;  4BL2 A;  1D06 A;  1G6A A;  4Y3I A;  3G32 A;  2JHE A;  4WF0 A;  4S2M A;  1FCO A;  4HJ4 A;  4F3L B;  4DN0 A;  3KYZ A;  5EV0 A;  5DJU A;  4LV3 A;  4E6X A;  4GDN A;  1H0M A;  4JXW A;  5CEC A;  1ACF A;  2WAD A;  2WGI A;  4I38 A;  3AGF A;  4JGR A;  4O7D A;  3B47 A;  1O07 A;  1GHM A;  5DF9 A;  4B88 A;  1BLC A;  5DF8 A;  4QWO A;  3S7P A;  3JVU A;  4Y2F A;  2WGW B;  2OLV A;  3DTE A;  1S1Y A;  1ZC2 A;  2VV8 A;  2PBY A;  5LBR A;  1S0W A;  3O87 A;  5AQ7 A;  3HJK A;  4R6L A;  4GN2 A;  1PI5 A;  1DJB A;  4NET A;  3T4O A;  2J9P A;  2ZQC A;  3V3R A;  3OC2 A;  2EX2 A;  4BL3 A;  4KG6 A;  5A92 A;  4R3J A;  4BEN A;  1JWV A;  1YAX A;  4P6Z M;  4E3J A;  1PYY A;  4EEU A;  3TW8 A;  2BLS A;  4LEN A;  1MWU A;  2D01 A;  1L2S A;  3S22 A;  2J3T D;  3IXB A;  4OOY A;  1PZP A;  4WN5 A;  3HL9 A;  3V67 A;  3Q7Z A;  4HBU A;  5E2H A;  2E8J A;  3S7Q A;  4PMA A;  1YLY A;  3EEA A;  5HW3 A;  1PWG A;  2ZMV A;  3QP2 A;  4MDZ A;  4PM7 A;  4LRZ E;  2PBD P;  1OPX A;  4KZ8 A;  1IYO A;  4JGP A;  1OJG A;  4ID4 A;  3A3E A;  2PD7 A;  3IQA A;  3OPH A;  2Y2G A;  2W0N A;  2YKH A;  4OPR A;  3ZGA B;  5IT5 A;  4BQM A;  3W8K A;  1ES4 A;  4GD6 A;  4OLD A;  3NI9 A;  3Q07 A;  2QZ6 A;  2XA7 M;  2ZLY A;  2FZ0 A;  1FSW A;  4IBR A;  4B93 A;  4C75 A;  3T1Q B;  4U3T A;  3LYX A;  5L07 A;  2HDQ A;  4KZ5 A;  3A3F A;  4OPY A;  2PHY A;  2PU2 A;  3SS3 A;  3FYZ A;  1E4D A;  3C2W A;  2QPN A;  3HUO A;  3LIF A;  1S6R A;  3KSI A;  4ZTK A;  2V0U A;  2WK0 A;  3IH9 A;  2W3H A;  2P74 A;  4LLO B;  2HDU A;  4RA7 A;  3HBR A;  5EVI A;  2GX5 A;  3ZHH A;  4EEP A;  4L9F A;  1S66 L;  2MJ6 A;  4EES A;  2EWV A;  2XRN A;  5DVA A;  5HDD A;  3VV4 A;  5EPH A;  3DTK A;  3N8R A;  1SDN A;  1H8M A;  3H9W A;  3MJQ A;  4R4R A;  2A24 B;  2WKE A;  2KLI A;  2JN7 A;  4YIN A;  4KZ4 A;  3OCL A;  4NXE A;  5E43 A;  5TFQ A;  3FV7 A;  1GSW A;  4H8R A;  3WS5 A;  4MEZ A;  2P08 A;  4U0T A;  4E3O A;  2ZC6 B;  5GL9 A;  4OH0 A;  1TS7 A;  1T1A A;  1BYW A;  2FFF B;  1YSP A;  4DJ3 A;  2JKT I;  3RXX A;  3OCN A;  3UY6 A;  1VET A;  2Y4A A;  2ZQ7 A;  4JF5 A;  1Q2Q A;  3UPN A;  2XFS A;  3CPT B;  3MR0 A;  3WRT A;  3BFD A;  4X55 A;  2G2W A;  3LUQ A;  4KUO A;  5TBM B;  1MXO A;  1TS0 A;  3PAE A;  1NYM A;  4ZJ2 A;  3LIE A;  5F1G A;  3MXR A;  2NUP C;  1I5Q A;  4WLA A;  5E2F A;  5AQ9 A;  2XQZ A;  3UO9 A;  1D7E A;  1FIL A;  2IWD A;  2DCF A;  4MN7 A;  4IUH A;  2O0Y A;  3IX3 A;  5U47 A;  3GVB A;  2EA9 A;  3VP4 A;  3SZT A;  1BT5 A;  2ZMF A;  2VX8 A;  2J7V A;  5A93 A;  3C4O A;  3TG9 A;  1N9N A;  5CX7 A;  2ZL1 A;  3TJZ C;  1WA9 A;  5E2E A;  5L10 A;  3C38 A;  2B18 A;  3DWK A;  3T4T A;  5L2F A;  1P9W A;  1V9Z A;  1ZG6 A;  4GZB A;  1SHV A;  1DRM A;  1XGJ A;  1IEL A;  4FOF A;  4X6T A;  5EE8 A;  5DF7 A;  3QNC A;  2H10 A;  4X25 A;  1P9R A;  1YMX A;  1SCW A;  1XGI A;  1P97 A;  1FQG A;  1VEU A;  3WS1 A;  2HDR A;  4CLC E;  1PRQ A;  1TS8 A;  3D9Y A;  1N9L A;  4NXB A;  5F69 A;  1MBL A;  4BD1 A;  2QJ7 A;  3W2Z A;  3E2K A;  3EQV A;  2Y91 A;  3MF0 A;  1JVJ A;  5F68 A;  4P0M A;  2I9V A;  4GLQ A;  2Y2J A;  3PBR A;  5EOO A;  3K2N A;  3AGE A;  2EFX A;  1GA0 A;  2HJ9 C;  4D2O A;  3BY9 A;  4WEL A;  1GHP A;  4WEK A;  3V39 A;  4EBN A;  3GEC A;  4P6Z S;  1DY6 A;  5FI6 A;  4GKU A;  4ZAM A;  5HAQ A;  4R0Q A;  2BTF P;  1BSG A;  3LIC A;  5FDS A;  1JTG A;  4GW9 A;  4JF4 A;  4Z1W A;  3IF6 A;  2XRO A;  4YWZ A;  1GSX A;  4EUZ A;  3E98 A;  2VJW A;  3IWQ A;  1ZHH B;  2VEA A;  4I39 A;  4IHQ A;  2W1T A;  4ZDX A;  4JXV A;  1CEG A;  1J3W A;  5AVE A;  4RYE A;  2V1B A;  4CLC A;  2PAV P;  4K08 A;  2O9C A;  1F5M A;  2VV7 A;  3V50 A;  3CWF A;  1ES3 A;  4DDY A;  2VGJ A;  5EVI B;  4E3K A;  3ZFZ A;  5CED A;  1PNE A;  3UE3 A;  4Y0O A;  3UE6 A;  3VFH A;  2R9X A;  2DMW A;  4KQR A;  4WBG A;  4NK3 A;  2W3D A;  2XR0 A;  3HLW A;  1DP8 A;  1LSW A;  4Z9Q A;  1Z09 A;  3PBO A;  1S4R A;  3UE0 A;  1OT9 A;  2V8F A;  2W3G A;  1OJ5 A;  4G3K A;  2ZBB A;  4FD8 A;  1ERO A;  4B4Z A;  5HL1 A;  3MBZ A;  1NJ4 A;  2PRF A;  4EUV A;  3EGX C;  1M40 A;  3SS5 A;  1KE4 A;  4CJN A;  4FCF A;  1KGE A;  1U60 A;  2VA0 A;  3M2J A;  4JPM A;  3JPU A;  3P98 A;  1KGF A;  3BYD A;  4PM5 A;  2QJ5 A;  3BQA A;  3F1O B;  3O86 A;  3FC7 A;  3MFX A;  3LIA A;  1CI8 A;  3ZG5 A;  3A0V A;  1KE0 A;  1K4F A;  1K6R A;  2H0T A;  1K6S A;  1DP6 A;  2KOI A;  1BLH A;  1EWZ A;  1KDS A;  1N9B A;  4X56 A;  4NEE D;  1VB6 A;  3RTY A;  5FAP A;  1ESU A;  3HLG A;  5HPF A;  2VV6 A;  3G2Y A;  3CLO A;  3RJU A;  1SKF A;  1X0O A;  4R3B A;  4XUZ A;  4BWI A;  2Y2P A;  4S2N C;  3VFF A;  3N8L A;  2ZOI A;  5CER A;  4LV1 A;  4QD4 A;  3ZNY A;  1MWS A;  3BFE A;  3HLE A;  1N4O A;  5FAS A;  2OV5 A;  3ZVT A;  3B3X A;  5JYO A;  3PYP A;  3BFF A;  2EX6 A;  4MBK A;  4ZJ3 A;  4K0X A;  5A8B A;  3UB7 A;  5L8M A;  2GDN A;  1PZO A;  5TBM A;  4KQQ A;  3OZH A;  3I7J A;  4IBX A;  2K7S A;  1OTE A;  1XP4 A;  4FUW A;  1K0K A;  1YLZ A;  1LL5 A;  5CHM A;  5F1F A;  4BBV A;  4QPR A;  1PIO A;  1K55 C;  3T50 A;  3KO6 A;  2D02 A;  2M1C A;  3NCK A;  2V20 A;  1MWR A;  4RX3 A;  4DJ2 A;  1XA7 A;  3KSG A;  5G18 A;  3P01 A;  3SH9 A;  1KDW A;  5AQB A;  1F2K A;  1FCM A;  1UWN X;  4JLF A;  3ZDJ A;  2W1R A;  5L09 A;  4UQI M;  2JKT M;  1STZ A;  1IYQ A;  1BLS A;  3IT9 A;  1PFL A;  4LPZ A;  2PR5 A;  5DTK A;  1VEU B;  4LFU A;  4N1H A;  4ETZ A;  3HJI A;  4ETX A;  3IS2 B;  1C3B A;  4Q8I A;  4PM6 A;  5F6A A;  1UGU A;  4OON A;  4S2O A;  5FQI A;  2FH5 A;  4HES A;  2W3E A;  4L0L A;  5FEG A;  4HI4 A;  1XA1 A;  5EUA A;  2XEP A;  2WZX A;  3LO7 A;  2IWB A;  3R7W B;  4NXF A;  1T1B A;  1IEM A;  4LRY C;  4QB8 A;  3C4P A;  1ESI A;  1K54 C;  2Y55 A;  4PAU A;  2WYX A;  3H82 A;  3BW6 A;  1H5X A;  4OP8 A;  2HF6 A;  1RP5 A;  3OLO A;  2VKS A;  3FZC A;  2Y2N A;  5FI2 A;  1E3U D;  5IHV A;  3MZE A;  3BEC A;  3ZNT A;  3IXD A;  3NOT C;  3ULF A;  3F1O A;  2HV1 A;  2VZW A;  4GCZ A;  5AQA A;  2VGK A;  2J3W A;  5CGS A;  4E3M A;  4D60 A;  4OKP A;  2H5S A;  4KQD A;  4JGQ A;  2ACG A;  2ZM2 A;  4GB7 A;  4IUK A;  5HSQ A;  3BM6 A;  3QP5 A;  3L9K A;  4B4X A;  1PI4 A;  4YNR A;  3VOZ A;  2Y2L A;  2ZQD A;  3PBN A;  2Y2I A;  2Z6C A;  4LRX C;  4Q0J A;  4II7 A;  2W27 A;  2ZD8 A;  4OOM A;  4L9E A;  3FPV A;  5DFY A;  1CEF A;  3HCY A;  2X01 A;  4KEN B;  4WMC A;  5FQJ A;  4BBU A;  1FR6 A;  5D3O A;  2A2L A;  1ALQ A;  3NOP C;  1VHM A;  1S1Z A;  2Y8H A;  1D1J A;  3CJM A;  4YOF A;  2HPB A;  5F82 A;  4GS9 A;  2J80 A;  2A49 A;  1MY8 A;  2JC7 A;  3NY4 A;  2J9O A;  2G2U A;  3G34 A;  5EFW A;  1O7E A;  1ES5 A;  1P0Z A;  1TVF A;  4LV2 A;  3K3C A;  4MN5 A;  3PTE A;  5EEC A;  1NXY A;  1NLY A;  2IWC A;  3PBQ A;  1T18 A;  5BOH A;  1HTZ A;  1A0K A;  3V3S A;  2JKR M;  4UA9 A;  1K25 A;  2WKH A;  5GLD A;  4EBP A;  1FR1 A;  1DJC A;  3DBA A;  5AJG A;  5M1A A;  1LT0 A;  1G68 A;  4Y5F A;  4DE0 A;  3MXQ A;  3FKV A;  2QWS A;  3UN7 A;  2PR6 A;  5TGF A;  4HNB A;  4FSF A;  4Q0I A;  3BLS A;  1ERQ A;  4OP5 A;  1VET B;  3VP0 A;  2Q9N A;  2C5W B;  2KDK A;  1J9M A;  5EVI C;  3GV9 A;  4MLL A;  1PWD A;  3QP8 A;  5EM1 A;  3GMW A;  1XJ2 A;  3HUN A;  2J8Y A;  2Y2K A;  1ZG4 A;  3DWZ A;  3CG5 A;  4UHU A;  4JXS A;  1FOF A;  4HBT A;  3QNB A;  4KUK A;  4H6J B;  1OTB A;  1BZA A;  1TF1 A;  4WM9 A;  2XGN A;  3BFG A;  4DE1 A;  2JKF A;  2ZM8 A;  4GNU A;  3LCE A;  1L0E A;  5M19 A;  4HOI A;  4MBF A;  4KZ9 A;  5HL6 A;  1PWC A;  4I5S A;  1XFN A;  3UPP A;  4S2P A;  5F83 A;  1W7F A;  1S4S A;  4R70 A;  4N9K A;  1H8Y A;  1NRJ A;  2R78 A;  1NYY A;  4R4S A;  3HLF A;  2XF3 A;  3W4P A;  1EI5 A;  4CQH A;  3A0R A;  1ERM A;  3CIT A;  2K31 A;  4X1M A;  4EV4 A;  1W79 A;  1GSV A;  2K2N A;  3O88 A;  2L1M A;  1QMF A;  1NLZ A;  2OAP 1;  2UWX A;  4KZ7 A;  1BTL A;  3NUL A;  4LCL A;  3C8C A;  1OT6 A;  1MKI A;  1EW0 A;  1MPL A;  3MSH A;  1K54 A;  4KG2 A;  4LV0 A;  2A3U A;  4GJ4 A;  3CUE A;  3BQ8 A;  4KQO A;  3IBR A;  5TR7 A;  4UA6 A;  2V1Z A;  1KVM A;  1LHY A;  4S2L A;  2RCX A;  2Q0O A;  2OOL A;  1XKZ A;  3CMZ A;  3VOY A;  4LGW A;  2XK1 A;  3MQO A;  3EEH A;  3D4F A;  3T12 B;  5KSC A;  3SH8 A;  4XT2 A;  4G3V A;  1YKD A;  3PBS A;  3DTM A;  3UDF A;  1YM1 A;  1Q2P A;  2BAS A;  3NJA A;  3D72 A;  4QU3 A;  3CZD A;  3N7W A;  3CAX A;  3L7H A;  4WL9 A;  2X71 A;  1KOU A;  2V1A A;  2PYR A;  1OME A;  4C6Y A;  1MKM A;  4DKI A;  5FQQ A;  2Y2M A;  4QHC A;  2L0W A;  3CI6 A;  1K57 C;  5FAO A;  5FEF A;  4HH3 A;  3BRM A;  2Y2Q A;  3VP3 A;  4QY6 A;  3T4L A;  5J4E A;  1XJ4 A;  3LI8 A;  3C5A A;  3G30 A;  4EER A;  4QY5 A;  1YPR A;  1SDE A;  1VM1 A;  2XLN A;  1CK3 A;  3C7V A;  4S2I A;  1AWI A;  2NUT C;  4RVA A;  3FWL A;  2B02 A;  5IS1 A;  2PYP A;  4UEY A;  4ESP A;  5FAT A;  2WAE A;  1DJA A;  3GR2 A;  5TJJ A;  4ME4 A;  2HJE A;  4OLG A;  5HD3 A;  2J3T C;  3F1P A;  2EX9 A;  3M6H A;  4IVK A;  5FQ9 A;  3P09 A;  5CHJ A;  3LR3 A;  3A3J A;  1LL9 A;  3FKW A;  4OPQ A;  1SZV A;  3E4P A;  5CXW A;  1XFQ A;  3B42 A;  1Z6F A;  2WKQ A;  4DE2 A;  4L9G A;  4K91 A;  4LCM A;  1HD8 A;  2DRW A;  2XDM A;  2HDS A;  3NHQ A;  5GHY A;  1T19 A;  1JWZ A;  2WZZ A;  1K56 A;  3N4I A;  4IED A;  4A5R A;  4CLC D;  3T4Q A;  1LI0 A;  4WZ5 A;  1AXB A;  4PKY G;  2O9B A;  4E3I A;  4KZA A;  1RGY A;  5KZH A;  5CTM A;  1JTD A;  1KVL A;  4MNR A;  2E8I A;  2O99 A;  1Y54 A;  3RH8 B;  5FI7 A;  5HFO A;  4MBH A;  5CGX A;  3IS2 A;  1K4E A;  1ONG A;  4GOG A;  1W63 Q;  3UB8 A;  1YLP A;  1ONH A;  5IU1 A;  3BY8 A;  1XJ3 A;  1LI9 A;  2JBF A;  2JE5 A;  4IVI A;  3NDE A;  4EQ1 A;  2Y59 A;  5FL3 A;  3UB9 A;  3Q81 A;  1F98 A;  2IA2 A;  1HVB A;  3LR5 A;  4PM8 A;  5GHZ A;  4EWF A;  4X53 A;  3LEZ A;  3UNW A;  4XXR A;  2Y2H A;  3HUM A;  3UDX A;  3KSF A;  1ODV A;  3GTC A;  3G2Z A;  2GNX A;  4H6J A;  4BMW A;  4M4X A;  5HZH A;  4ARZ A;  1IYP A;  3UMD A;  2B95 A;  3ZG7 B;  2XD5 A;  4O0P A;  2DNS A;  4JGO A;  2ZJ9 A;  5HDC A;  5J3W A;  3IXH A;  5F5Y A;  3TRC A;  1Y28 A;  3RFB A;  4N1X A;  3UB5 P;  3VE4 A;  1YLJ A;  3WS2 A;  4GD8 A;  4HHD A;  5HWW A;  4MN6 A;  3VOL A;  3S7N A;  3HVF A;  3Q1F A;  3O3V A;  1TD5 A;  4O8G A;  3VMA A;  2ZQA A;  3MQ0 A;  2EXA A;  5HDS A;  1SKO B;  1WYC A;  4FH2 A;  2P04 A;  2HP6 A;  3F1P B;  1W5D A;  4PHT A;  1VQQ A;  2Y79 A;  4N9L A;  5I94 A;  3KYQ A;  3ISG A;  1L0G A;  2V0W A;  5DKL A;  2AVX A;  2KX6 A;  1OTA A;  3DAV A;  3QHY A;  4OQI A;  5HX9 A;  1YQS A;  3AGD A;  2WKI A;  3G4P A;  4DXC A;  1W8Y A;  2P7J A;  3MZF A;  2ZQ8 A;  2ZC7 A;  4OPZ A;  2H28 A;  2WGW A;  4PM9 A;  3UPO A;  3BLM A;  4HH2 A;  3HLB A;  2JKG A;  1W8Q A;  4E3L A;  3ZG0 A;  4S2J A;  1L0F A;  2P9V A;  4AFI A;  1WE4 A;  1NY0 A;  4E6W A;  2ZQ9 A;  2Z2M B;  4KZ6 A;  4FTX A;  3OBF A;  4HY8 A;  3BJN A;  1JWP A;  4HEF A;  1CF0 A;  5HD5 A;  3A3I A;  3NOU C;  4EU0 A;  4KZ3 A;  1GA9 A;  1GHI A;  5K5B A;  5GHX A;  1IOU A;  3IWO A;  2CC1 A;  2ZM0 A;  3R4K A;  1ES2 A;  4DMZ A;  4M3K A;  4BBT A;  3SW1 A;  4PKY A;  3N6I A;  3ZQ5 A;  2Z2L B;  5JYP A;  1BUL A;  1NZO A;  2PT7 A;  3V5M A;  5EVI D;  2H0Y A;  4EET B;  5CHU A;  2OSU A;  1TEM A;  2R9W A;  2EXB A;  4R38 A;  1LSV A;  4ZBE A;  4Y7P A;  3H7W B;  2CMN A;  3VSK A;  3MXS A;  3W4O A;  4E04 A;  3U2A A;  1FIK A;  3E4O A;  2PDR A;  1PW1 A;  3OPP A;  4ZRR A;  3GQZ A;  3T1R A;  3FPW A;  4BD0 A;  3NIA A;  3S7O A;  3H82 B;  4KG5 A;  4DXB A;  5M18 A;  4G3W A;  4DF6 A;  5FDH A;  4WZ5 C;  1K57 A;  3IX8 A;  4NXG A;  5KMW A;  2G7U A;  3F1N B;  5A91 A;  3WS0 A;  2QYB A;  1SKO A;  4RQ9 A;  3LGO A;  3QP4 A;  4O01 A;  3T4K A;  5DTT A;  2ZC5 B;  1K56 D;  4EXO A;  5I5L A;  3MMH A;  4C3Q A;  3PHY A;  2GJ3 A;  3BFC A;  3VP2 A;  2X02 A;  4UQI S;  1E25 A;  2VK3 A;  4OOL A;  3GRJ A;  4WUJ A; 
#chains in the Genus database with same CATH homology
 1VEU B;  1PRQ A;  3T1R A;  5EM0 A;  2E8J A;  3LGO A;  3D9Y A;  5EVE A;  1PNE A;  1AWI A;  3CPT A;  2ACG A;  1VET B;  3CPT B;  2B95 A;  3LEQ A;  3KYE A;  4FTX A;  4X1L A;  5FEF A;  2JKF A;  3NUL A;  1CJF A;  2HZ5 A;  2PRF A;  4QWO A;  3MS6 A;  4ESP A;  1SZV A;  1CQA A;  1CF0 A;  1A0K A;  2PBD P;  5EM1 A;  3U4L P;  3T1X A;  3MSH A;  3L9K A;  1J3W A;  1F2K A;  3L7H A;  1FIK A;  1FIL A;  3DAV A;  5FEG A;  1Z09 A;  3CHW P;  5EV0 A;  2JKG A;  2PAV P;  2ZL1 A;  2BTF P;  3UB5 P;  3T1S A;  2VK3 A;  2ZL1 B;  1YPR A;  4FUW A;  2V8F A;  4X25 A;  4X1M A;  1K0K A;  1Y4O A;  3T12 B;  2V8C A;  1PFL A;  5FDS A;  3NEC A;  1SKO B;  1ACF A;  4D60 A;  1VET A;  3T1Q B;  1SKO A;  1VEU A;  1D1J A;  1HLU P;  1G5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...