4ESPA

Crystal structure of peanut allergen ara h 5
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
130
structure length
130
Chain Sequence
b'SWQTYVDDHLLCEIEGNHLSSAAILGQDGSVWAQSSNFPQFKPEEITAIMNDFAEPGSLAPTGLYLGGTKYMVIQGEPGTVIRGKKGPGGVTIKKTNQALIIGIYDEPMTPGQCNMIVEKLGDYLIDTGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin
molecule tags Allergen
source organism Arachis hypogaea
publication title Crystal Structure of Peanut ( Arachis hypogaea ) Allergen Ara h 5.
pubmed doi rcsb
total genus 39
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2012-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4espA00
4FTXA 1Y4OA 1ACFA 1J3WA 1VETA 1VEUA 2V8FA 5EM0A 3MS6A 1FILA 1PFLA 1Z09A 5FDSA 4X25A 1AWIA 3CHWP 3CPTA 2PRFA 4FUWA 1D1JA 2PAVP 3KYEA 2HZ5A 1A0KA 3L9KA 3T1RA 3LEQA 3T1XA 3MSHA 1FIKA 2B95A 3L7HA 3NULA 3LGOA 1SKOA 2ZL1A 4X1MA 5EV0A 3UB5P 4ESPA 3D9YA 2ACGA 1F2KA 1CQAA 3T1QB 1PNEA 2PBDP 2V8CA 1CJFA 4D60A 1SKOB 2ZL1B 1PRQA 1HLUP 2JKFA 2VK3A 5EM1A 1G5UA 1VEUB 1VETB 3U4LP 3NECA 4QWOA 3T1SA 4X1LA 1CF0A 1K0KA 1SZVA 2BTFP 2E8JA 3DAVA 1YPRA 5FEFA 5EVEA 5FEGA 3CPTB 2JKGA 3T12B
chains in the Genus database with same CATH superfamily
2MJ6A 1W63Q 3T4SA 5GL9A 4B4XA 3RXWA 1ES3A 1DJAA 1F98A 2G2UA 5HW3A 3IF6A 3BQ8A 3RXXA 3H82B 2WGIA 4L9EA 4XT2A 1YQSA 2X71A 1PW1A 1VETB 1CF0A 3TJZC 4IEDA 1TS0A 4NXEA 1Y28A 1H8ZA 3T1RA 3KYEA 3HLBA 3BJNA 5TBMB 1ALQA 2QJ7A 1DP8A 1XP4A 5TJJA 3NBLA 5HARA 4X6TA 2PBDP 5EM1A 4LRZE 2XA7S 2HF6A 3N8LA 3T50A 3PBTA 4II7A 3G6OA 4R0QA 1BLSA 4YFMA 2QJ5A 2Y2PA 2BASA 3LR0A 3T4QA 1DRMA 3LR5A 4R6LA 3BYDA 2HDSA 2VV8A 1NLZA 2ZM0A 3PBOA 2JKTI 4CJNA 4Y0OA 4IJGA 1FQGA 1O7EA 3MZEA 4UHUA 3N8SA 1GSXA 2Y79A 1M6KA 2XK1A 4PM7A 4JXSA 4R4RA 1XGIA 1K57C 3MXRA 4X69A 2E8JA 3C5AA 1IOUA 3O86A 3VFFA 1BT5A 4DXCA 5F6AA 2H0TA 1D06A 5CERA 5C5KA 3S7NA 5TFQA 1OTAA 5E2GA 2DRWA 1L2SA 3WRZA 4Y17A 1MBLA 2XFTA 3MZDA 3LCEA 3HCYA 4CLCC 4GD8A 2HDUA 2EX2A 1IYPA 2O9CA 4XXRA 1KVLA 5EE8A 3KO6A 4ZTKA 4OP5A 5HAPA 3MS6A 3VSLA 3MQOA 2ZMVA 2V1AA 3A0SA 1DP6A 3ZHHA 3V3SA 3P09A 4K0XA 2XDMA 2WGWA 1FCOA 3W4PA 3OLOA 4MN5A 2W27A 3SS4A 2PT7A 2A49A 5E2HA 2VKSA 3W2ZA 3ZDJA 2ZQ8A 4DXBA 4NG2A 4HBTA 4LCLA 2ZQCA 3ZFZA 3UPOA 3HUNA 3ZG7B 3G4PA 2FFYA 3DWKA 3T4OA 4MMNA 1YKDA 3G2ZA 2J3WA 4O0PA 2INWA 3W8KA 2WKIA 1OJ5A 1L0EA 1ZG4A 3EQUA 1P9RA 4JXWA 2W1TA 2WAFA 2QHKA 4JGRA 4NETA 1D7EA 3AGFA 3BY8A 3UPNA 1KVMA 4EQ1A 4L9FA 2L0WA 5DFYA 3IH8A 4BL2A 5HWVA 3LFVA 4CPKA 2ZQ9A 4OPZA 2V1ZA 2QZ6A 5HX9A 4BLMA 1DJCA 4S2MA 2FFFB 3GMWA 3GTCA 5FAPA 2Z2LB 3V50A 1AWIA 3PBSA 4OOMA 2RCXA 1YLPA 2DMWA 3T4JA 3EQVA 1K6RA 3P7NA 3NOTC 5EFWA 3MKEA 1MY8A 4K0WA 1TD5A 4Q0JA 2JKRM 3OOVA 2P04A 4FSFA 3ULFA 4LV2A 2M1CA 2XR0A 2HPBA 1DJBA 3VOZA 2ZJ9A 1SKFA 3IXBA 4DJ2A 1SDEA 4MDZA 5GHYA 2EFXA 1HTZA 5DKKA 3UMEA 2W3DA 5F68A 1PFLA 3OZHA 4GS9A 5EUAA 1PZOA 4WEKA 3CMZA 4WMCD 3BFEA 4GNUA 1IYQA 5AQ9A 1KGGA 2HV1A 3O3VA 3TG9A 4KZAA 5A91A 2H28A 5E43A 3NIAA 3G30A 2XRNA 2H0YA 4GHIA 3Q7VB 2PYPA 3IWOA 1XJ4A 3BLSA 4S2OA 1KOUA 3F1NA 4HOIA 2YKFA 4KQRA 2X01A 4OKPA 5GHZA 1VM1A 5CHJA 4KUOA 4IBRA 4ID4A 1E3UD 4BENA 3CG5A 3E4QA 5KZHA 2JKGA 4R70A 5HL6A 1XJ3A 3DW0A 4HHDA 5FI6A 1H3QA 3HLCA 5J4EA 4IUHA 1YSQA 2L4RA 1I2SA 3BFCA 2W1RA 3G35A 4S2IA 1XA1A 2OAQ1 3E2LA 4EBPA 5EOOA 5CX7A 2BTFP 1SZVA 4Z1WA 4LRXC 1PWDA 1WE4A 5L8MA 5DTSA 4UEYA 3LI8A 5EVIB 4ETXA 2EXBA 4U3TA 1VEUB 1ZC2A 3PBRA 1LT0A 4MLLA 4GKUA 2Y2NA 3ZG5A 4KUKA 3N8RA 4JBFA 2Z6CA 2PU2A 2ZOHA 4PKYG 4NEED 5A92A 3D72A 2B95A 2ZBBA 1TS7A 2A2LA 1XFQA 4F3LA 1KE0A 1K4EA 2PR5A 2W0NA 3QP2A 1VHMA 4OQHA 3VP0A 4DE0A 4RX2A 4Y5FA 1Q2QA 1OPXA 4LV0A 2FZ0A 5FSRA 1W63M 2ZQ7A 4S2JA 3A3JA 4R23A 1ESIA 1T18A 4QU3A 4KG6A 4DE2A 5FEGA 4NK3A 2I72A 4FH2A 3ZYTA 5CGWA 1PW8A 4PPRA 1PWCA 3L7HA 4JXVA 4Y3IA 1SCWA 2JN7A 4OPQA 3HLWA 3NDGA 4G3KA 4E3KA 1N9NA 3BQAA 3PYPA 5F69A 1ACFA 5CHUA 5GLBA 5EVIA 3C38A 3TOIA 4Y0TA 3JYIA 3O5YA 2ZMAA 3JVUA 2GZAA 1LSVA 2V1BA 1GSVA 4E3OA 5AVEA 1P97A 3Q82A 3K2NA 2ZL1B 3R7WA 2KDKA 2Y2MA 4BBVA 3T12B 1STZA 2J9PA 1TDGA 1VEUA 2V8FA 3HJKA 4HH3A 1MPLA 1IKIA 4OLDA 1PZPA 5FDHA 1L0GA 3IXHA 3VMAA 4X55A 4JF4A 4JKTA 5HFOA 5E2FA 3TRCA 1GSWA 2C6WB 4ZDXA 3HVFA 5L2FA 2K7SA 3A0VA 4UA7A 3MJQA 5CGSA 2OSUA 1CK3A 5G18A 1ES2A 4YWZA 1L0DA 3IBRA 1Z6FA 1GCEA 4OOLA 2Q9MA 1GHIA 1K57A 3KSFA 2JKRI 4EEPA 4R3JA 3DTIA 4LLOB 4QWOA 3CJMA 1ES5A 1LSWA 4QJGA 3BECA 1KE4A 2HDQA 4DRTA 3IBJA 1NYYA 4DN0A 3B47A 1S6RA 1ODVA 2ACGA 1BLHA 3GR2A 2ZC6B 3VE4A 1W5DA 2WZZA 2NUTC 1GHPA 3H7WA 4ARZB 1H5XA 1OTBA 4R3AA 4B9OA 5DJUA 4HESA 3UB5P 5HAQA 3BRMA 3P01A 2JKFA 3A3FA 1AXBA 2ZM2A 3ZQ5A 1S67L 2Y91A 1VETA 1TS8A 5EM0A 2Q9NA 2R9WA 4WZ5A 3ZG0A 3IF6B 4Y15A 3F1PA 3WWXA 2EX9A 3GV9A 4OQGA 1K4FA 1XGJA 5TBMA 3ZVWA 4DMZA 3UB9A 5F1FA 3WS0A 4DKIA 3LIBA 1CI8A 1ONGA 5FI2A 3KSGA 4S2KA 4R4SA 1O07A 2WZXA 1IEMA 1PYYA 2G7UA 4S2PA 3ZVTA 5AQAA 1H0MA 4EBNA 2KOIA 4FH4A 4EUVA 3C7VA 3H82A 5FQIA 3MSHA 2VGLS 2WKHA 2B18A 3PR6A 3WS1A 2B5RA 4HI4A 4BBUA 1GA0A 3RTYA 1N9OA 2XGNA 4IHQA 3DWZA 4KZ7A 4JF6A 4I5SA 4KZ3A 5BOHA 3U2AA 2Q0OA 1RP5A 3LR4A 5F1GA 5CXWA 1EW0A 3D4FA 4OLGA 3TE8A 1LL8A 4WEJA 3OCNA 4R38A 1MC0A 3EEAA 4KZBA 4OPYA 5DF7A 5FDSA 4C75A 4MN6A 3BFGA 1K25A 2PRFA 1S66L 4CLCA 1J9MA 4QD4A 3KSIA 3OPPA 2IWCA 2D02A 1L0FA 1SKOA 5K5BA 4K08A 4K91A 1W79A 1K56D 4HP4A 3UB6A 4E04A 1XXMA 1G5UA 5E2EA 2D01A 1IYOA 4BQMA 4S2NC 3SS5A 3UE6A 1YLZA 2HDRA 3QP5A 1OTDA 1RCJA 3LYXA 4HJ4A 1DP9A 3IS2A 1E25A 1T19A 3EGXC 4EU0A 4I39A 5TR7A 3KYZA 5L07A 3H7WB 4E6XA 1PI4A 1YLJA 1LL9A 2PDRA 4GDNA 3T4TA 4GHIB 1I2WA 5IHVA 4GCZA 1P0ZA 4E3LA 4EWFA 4Y2FA 2VGJA 4HQAA 3LIDA 1CEFA 5A93A 3VP4A 1ESUA 2K31A 3DTKA 2JHEA 4JGOA 4B93A 3VE3A 4GD6A 2J80A 3UN7A 2W3HA 3Q07A 5F83A 3HLDA 4OQ0A 2Y4AA 2VV7A 2OV5A 4BMWA 5EPHA 2V8CA 2BLSA 1BLCA 3C8CA 3M6HA 4P0MA 1RGYA 3C4PA 3N4IA 2P74A 4ZRRA 3CPTB 3ZCZA 3B33A 4WZ5C 5IT5A 3BWLA 1BYWA 3HL9A 4I3AA 4YINA 5FQQA 4JLFA 3W4OA 1UGUA 3NDEA 3LO7A 2V2FF 2ZOIA 5HD3A 1MWSA 1JTGA 1W8YA 3E0YA 1YMXA 5CHMA 3UNWA 4OQIA 4B4ZA 2QYBA 2Y55A 4FCFA 1XFNA 2V9AA 4QHCA 1NZUA 2J9OA 3IWIA 1M40A 1BLPA 4ZBEA 5M19A 2I9VA 2IA2A 3D3OA 1XX2A 4NXFA 4WZ4A 4EW7A 3EOIA 1C3BA 3FPVA 1PRQA 1XJ6A 2C5WB 2WGVA 4BL3A 1PWGA 3UMDA 2H5SA 3NOUC 1Y4OA 1YM1A 4Z9QA 1BSGA 4Y0UA 5KIZA 3UE3A 1JWVA 1VQQA 3LI9A 3IX4A 4KZ6A 1P9WA 3FPWA 3UB8A 4WL9A 2O0YA 1FR6A 4KZ8A 5HDDA 1JWZA 3HUOA 1N9LA 1PI5A 4Q0IA 5HDCA 4LFUA 2O9AA 4WN5A 3T1SA 5FAOA 3CUEC 1NWZA 4L0LA 5KSCA 4FTXA 2W3FA 4JGPA 2E8IA 3NJAA 3GDIA 4JXGA 3E2KA 4Y7PA 2WAEA 2VEAA 3JPUA 4CLCB 2G2WA 3SS3A 5DF9A 5IS1A 4OPRA 3GRJA 1BTLA 3IHBA 4KZ5A 1TS6A 3G32A 5DVAA 5FAQA 2JCHA 1YMSA 2VA0A 4C3QA 2XLNA 4NXBA 2XFSA 1G6OA 3LEQA 2Y2IA 3UPPA 2IWDA 2J3TD 1FCNA 1LLBA 1YT4A 5FATA 4ZAMA 2A24B 4LGWA 1MWRA 3UO9A 3VV4A 4WF0A 2UV0E 5EVIC 3PBNA 1S1YA 3FZCA 5CTMA 3WS5A 1FIKA 4N1XA 4EXOA 4MCWA 5GHXA 3UY6A 2PHYA 3LICA 1FSWA 3BLMA 4LV3A 5DJTA 2Y2LA 2QWSA 3WS2A 2AVXA 2IWBA 1KE3A 3QHYA 5FASA 5CEDA 4MBHA 2XEPA 5J8XA 1YLWA 4UAAA 3CPTA 3S1YA 2PU4A 1A0KA 2LB9A 1EI5A 5AVFA 1ZKJA 3T4KA 4L9GA 2UWXA 4UQIS 3G34A 4C6YA 3F1OA 5HPIA 3UB7A 3C7UA 4LRYC 1XPBA 3GQZA 1J3WA 3F1OB 1G68A 1K38A 2ZM8A 5JYOA 2V0UA 3LR3A 5JYPA 2ZC3B 2J3TC 3VP1A 1NYMA 4EEUA 1VB6A 4RA7A 4PKYA 3D9YA 4OOYA 1HD8A 1KDSA 5CTNA 3NECA 4WLAA 5FQMA 3G2YA 4G3VA 4GW9A 1T1AA 3NHQA 4KQDA 3LUQA 3MFXA 5I94A 2EXAA 2XH9A 4EV4A 5DF8A 4N1HA 1OMEA 1X0OA 1IKGA 3QP4A 4ESPA 4H6JB 3MKFA 4H8RA 3IX3A 5U47A 4O8GA 2HP6A 3DBAA 2PBYA 2ZLYA 3A3DA 2QKPA 5I5LA 4DE3A 3O88A 1K54A 3LIAA 3WS4A 2CMNA 5G4ZA 1EWZA 3CAXA 3EWKA 2Z2MB 3QNBA 3NI9A 3P98A 5EV0A 3NC8A 4MBFA 2EFUA 1NRJA 4I38A 4M3KA 1XA7A 4RX3A 2ZMFA 4P85A 1BUEA 1Y54A 1FSYA 1Q2PA 1FR1A 2PYRA 2XF3A 5HZHA 3UDXA 1WYBA 2OAP1 2EX6A 3CZDA 5HL1A 4OONA 1JWPA 2A24A 1S1ZA 3SH7A 4GLQA 3N7WA 2VV6A 1YSPA 3E4PA 1S4RA 2ZQAA 5DKLA 5MC7A 3OC2A 3UDIA 5FA7A 3Q81A 4GDBA 4MN7A 3U4LP 3VOLA 3MR0A 1YLTA 4Q8IA 1OTEA 3ISGA 3CLOA 4NKPA 3NY4A 2R78A 4WUJA 2GJ3A 4FOFA 3VP2A 1ES4A 1ZG6A 5CECA 2JBFA 3BFFA 1LI9A 3HJIA 4BD1A 3L9KA 4LV1A 5A90A 2JE5A 2VJWA 2J7VA 3HREA 3EGDC 1CJFA 1WYCA 1KDWA 3TSGA 4JF5A 4QY6A 2GNXA 2YKHA 2QMIA 5FL3A 4KQOA 4GZBA 4KZ4A 4EQIA 1RGZA 2L1MA 2XROA 3OBFA 4IUKA 2Y2OA 3BW6A 3PBQA 4HIAA 3LIEA 1E3UA 1CQAA 5HD5A 3S4XA 1TVFA 3BEBA 1OJGA 5EVLA 3IXGA 5L09A 3DAVA 2XSSA 3MQQA 1HZOA 2M7VA 2V0WA 2Y8HA 3HUMA 3IX8A 2PAVP 3OCLA 4XUXA 5CGXA 3KSHA 5HDSA 5GLAA 4ZJ1A 1K55C 5LBRA 1ERQA 3BFDA 4S2NA 2B02A 4I3JA 1XKZA 5KSHA 1SDNA 4E3JA 1Z09A 4N92A 3QP1A 5IU1A 3KYQA 2W3EA 2RL3A 3OPHA 1LSXA 2W3GA 1QMEA 4O01A 1K0KA 3WRTA 4EESA 3PHYA 2A3UA 4ZJ3A 4KQQA 5F5YA 2Z6DA 4KZ9A 5DFXA 3VSKA 1LHYA 1V9YA 3F1NB 3IF6C 3UDFA 3NULA 2QPNA 4OH0A 1UWPX 2WK0A 4A5RA 4ETZA 5HAIA 4EETB 1W7FA 1NZOA 1PIOA 3HBRA 4R1GA 2NUPC 4F94A 3ZG9B 3ITBA 3MXSA 4GS9B 5L10A 3LGOA 2P9VB 1CEGA 3PAGA 4DJ3A 2ZC7A 2OWHA 4NXGA 2GX5A 4KENB 1L3LA 1YAXA 3NOPC 3I7JA 3BM6A 4BJPA 4E3IA 1NY0A 1OTIA 3VOYA 4P6ZS 3W4QA 3SW1A 3N6IA 3FYZA 3NCKA 5A8BA 4Q0HA 1SHVA 4LPZA 5HPFA 3PXPA 3FKVA 2VLGA 2GDNA 2KLIA 1NJ4A 1YPRA 4BBTA 4WM9A 3VP3A 5AQ7A 3M2KA 1TDLA 3E4OA 3SZTA 3IXDA 4HJ6A 2Y2KA 3K3DA 4S2LA 5M1AA 3LY3A 3ICYA 2ZD8A 4HEFA 3QNCA 4EUZA 4QB8A 1ZHHB 5HWTA 4RVAA 4UA6A 2ZC4B 3PAEA 4E3MA 3FV7A 4AFIA 5FQKA 5HWWA 1NXYA 2OWJA 5TGFA 3CWFA 1N4OA 4HP9A 2HP5A 1N9BA 3ZG8B 3UE0A 3SOIA 4YNRA 3DTMA 1F5MA 3T1QB 1MWUA 5F82A 5J7EA 4DDSA 1LI0A 2R9XA 4OP8A 1NLYA 1H8MA 4JPMA 3VFHA 1JNUA 3V67A 3RH8B 1TEMA 3GSGA 4HJ3A 2PR6A 4B88A 5EVID 2HZ5A 3DTEA 5GLCA 1OT9A 1MKIA 3M6BA 2HJ9C 3V39A 4IVKA 3IF5A 4E6WA 4JGQA 2BG1A 2ZQDA 4HH2A 2P7JA 1SKOB 1MZUA 5GLDA 2XA7M 3A0RA 4OVDA 4DE1A 1K54C 3MXQA 3C4OA 1F9IA 2VGLM 1GHMA 1BULA 1NRFA 1QMFA 5FQ9A 4MBKA 4CQHA 3AGDA 3ZGAB 2V20A 1MKMA 4X68A 3EEHA 2VGKA 3HLEA 4P6BA 4MEZA 4PAUA 2WADA 5CRFA 3S7QA 4UQIM 4N9LA 2FH5A 1YLYA 4YOFA 3B3XA 1G28A 1FOFA 4HNBA 1IYSA 1S0WA 1LL5A 2DCFA 1V9ZA 3TW8A 4WYYA 2LB5A 4D2OA 1D1JA 4CLCE 5G4YA 3V5MA 2WUQA 4Y13A 1I5QA 4U0XA 3JVVA 3SH8A 2JKTM 4IBXA 4LENA 3M2JA 2VZWA 3HLFA 4PM9A 1UWNX 4P6ZM 2OLUA 4HBUA 4WMCA 3MFDA 4PM5A 2P08A 3QP6A 3AGEA 5AJGA 3A3IA 5D3OA 3S22A 5FI7A 4H6JA 1BZAA 3ZNYA 2PD7A 4M4XA 3CITA 2WKRA 4BWIA 1JVJA 1K6SA 1WA9A 5DTKA 3BY9A 3OPLA 3FC7A 4GN2A 4EERA 2JC7A 4UA9A 3T1XA 2O9BA 1EROA 1DY6A 2EA9A 3MZFA 3GVBA 4RYEA 4EBLA 4U0TA 2M7UA 4GJ4A 3IQAA 3IHAA 5CEBA 2CC1A 4DF6A 4X53A 4E3NA 1GA9A 3G31A 3KX0X 4LCMA 1E4DA 1T1CA 3PTEA 1KGEA 3GECA 3FKWA 2PD8A 5EOEA 5M18A 4IVIA 2Y2HA 4CLCD 3A3EA 3V3RA 1OT6A 4GOGA 5DTTA 3E98A 2OOLA 2K2NA 3Q1FA 1W8QA 3MF0A 1CI9A 4D60A 4RQ9A 3RJUA 2P9VA 2WYXA 3QP8A 5AQBA 3LY4A 4PMAA 3R4KA 2DNSA 2Y2JA 2WKPA 2J8YA 1ZTUA 2EWVA 3RFBA 1H8YA 4KG5A 4WELA 4I3IA 1ONHA 2O99A 4FD8A 1S4SA 3MQ0A 4X1LA 4QPRA 2H10A 4BD0A 3C30A 3Q7ZA 2VX8A 3B42A 1U60A 4GB7A 3CHWP 3MBZA 3IT9A 4PHTA 4FUWA 1FCMA 3HLGA 4N9KA 4XUZA 4X1MA 2ZL1A 2KX6A 3K3CA 1G6AA 3IH9A 1K56A 2VK3A 1HVBA 4P87A 2Y59A 4PM6A 2EWWA 2WKEA 5FEFA 3FWLA 4XT2B 4R3BA 4MNRA 1FILA 2X02A 1T1BA 5KMWA 3H9WA 4PM8A 4G3WA 3LEZA 1JTDA 1TF1A 3ITAA 3R7WB 1ERMA 1F2KA 5EECA 3IS2B 2WGWB 4QY5A 2Y2GA 3O87A 2Y2QA 2HP9A 4ME4A 3F1PB 4ZJ2A 4X25A 2XD1A 2HGVA 3LIFA 2XD5A 3S7OA 4F3LB 2WKQA 2EX8A 2ZC5B 1PNEA 2XQZA 4X56A 1HLUP 3OPRA 3C2WA 4O7DA 3ZNTA 3CUEA 3S7PA 5J3WA 2OLVA 3UE1A 1IFQA 4KG2A 4WBGA 1MXOA 1XJ2A 4ARZA 1MWTA 1K55A 4HY8A 3SH9A 3FG8A 3MMHA 3Q7VA 5FQJA 3CI6A 1KGFA 4DDYA 3T4LA 2HJEA 1IELA 3IWQA 5EVEA 5HSQA 2W1TB
chains in the Genus database with same CATH topology
4FTXA 1Y4OA 1ACFA 1J3WA 1VETA 1VEUA 2V8FA 5EM0A 3MS6A 1FILA 1PFLA 1Z09A 5FDSA 4X25A 1AWIA 3CHWP 3CPTA 2PRFA 4FUWA 1D1JA 2PAVP 3KYEA 2HZ5A 1A0KA 3L9KA 3T1RA 3LEQA 3T1XA 3MSHA 1FIKA 2B95A 3L7HA 3NULA 3LGOA 1SKOA 2ZL1A 4X1MA 5EV0A 3UB5P 4ESPA 3D9YA 2ACGA 1F2KA 1CQAA 3T1QB 1PNEA 2PBDP 2V8CA 1CJFA 4D60A 1SKOB 2ZL1B 1PRQA 1HLUP 2JKFA 2VK3A 5EM1A 1G5UA 1VEUB 1VETB 3U4LP 3NECA 4QWOA 3T1SA 4X1LA 1CF0A 1K0KA 1SZVA 2BTFP 2E8JA 3DAVA 1YPRA 5FEFA 5EVEA 5FEGA 3CPTB 2JKGA 3T12B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FTX A;  1Y4O A;  1ACF A;  1J3W A;  1VET A;  1VEU A;  2V8F A;  5EM0 A;  3MS6 A;  1FIL A;  1PFL A;  1Z09 A;  5FDS A;  4X25 A;  1AWI A;  3CHW P;  3CPT A;  2PRF A;  4FUW A;  1D1J A;  2PAV P;  3KYE A;  2HZ5 A;  1A0K A;  3L9K A;  3T1R A;  3LEQ A;  3T1X A;  3MSH A;  1FIK A;  2B95 A;  3L7H A;  3NUL A;  3LGO A;  1SKO A;  2ZL1 A;  4X1M A;  5EV0 A;  3UB5 P;  4ESP A;  3D9Y A;  2ACG A;  1F2K A;  1CQA A;  3T1Q B;  1PNE A;  2PBD P;  2V8C A;  1CJF A;  4D60 A;  1SKO B;  2ZL1 B;  1PRQ A;  1HLU P;  2JKF A;  2VK3 A;  5EM1 A;  1G5U A;  1VEU B;  1VET B;  3U4L P;  3NEC A;  4QWO A;  3T1S A;  4X1L A;  1CF0 A;  1K0K A;  1SZV A;  2BTF P;  2E8J A;  3DAV A;  1YPR A;  5FEF A;  5EVE A;  5FEG A;  3CPT B;  2JKG A;  3T12 B; 
#chains in the Genus database with same CATH topology
 2MJ6 A;  1W63 Q;  3T4S A;  5GL9 A;  4B4X A;  3RXW A;  1ES3 A;  1DJA A;  1F98 A;  2G2U A;  5HW3 A;  3IF6 A;  3BQ8 A;  3RXX A;  3H82 B;  2WGI A;  4L9E A;  4XT2 A;  1YQS A;  2X71 A;  1PW1 A;  1VET B;  1CF0 A;  3TJZ C;  4IED A;  1TS0 A;  4NXE A;  1Y28 A;  1H8Z A;  3T1R A;  3KYE A;  3HLB A;  3BJN A;  5TBM B;  1ALQ A;  2QJ7 A;  1DP8 A;  1XP4 A;  5TJJ A;  3NBL A;  5HAR A;  4X6T A;  2PBD P;  5EM1 A;  4LRZ E;  2XA7 S;  2HF6 A;  3N8L A;  3T50 A;  3PBT A;  4II7 A;  3G6O A;  4R0Q A;  1BLS A;  4YFM A;  2QJ5 A;  2Y2P A;  2BAS A;  3LR0 A;  3T4Q A;  1DRM A;  3LR5 A;  4R6L A;  3BYD A;  2HDS A;  2VV8 A;  1NLZ A;  2ZM0 A;  3PBO A;  2JKT I;  4CJN A;  4Y0O A;  4IJG A;  1FQG A;  1O7E A;  3MZE A;  4UHU A;  3N8S A;  1GSX A;  2Y79 A;  1M6K A;  2XK1 A;  4PM7 A;  4JXS A;  4R4R A;  1XGI A;  1K57 C;  3MXR A;  4X69 A;  2E8J A;  3C5A A;  1IOU A;  3O86 A;  3VFF A;  1BT5 A;  4DXC A;  5F6A A;  2H0T A;  1D06 A;  5CER A;  5C5K A;  3S7N A;  5TFQ A;  1OTA A;  5E2G A;  2DRW A;  1L2S A;  3WRZ A;  4Y17 A;  1MBL A;  2XFT A;  3MZD A;  3LCE A;  3HCY A;  4CLC C;  4GD8 A;  2HDU A;  2EX2 A;  1IYP A;  2O9C A;  4XXR A;  1KVL A;  5EE8 A;  3KO6 A;  4ZTK A;  4OP5 A;  5HAP A;  3MS6 A;  3VSL A;  3MQO A;  2ZMV A;  2V1A A;  3A0S A;  1DP6 A;  3ZHH A;  3V3S A;  3P09 A;  4K0X A;  2XDM A;  2WGW A;  1FCO A;  3W4P A;  3OLO A;  4MN5 A;  2W27 A;  3SS4 A;  2PT7 A;  2A49 A;  5E2H A;  2VKS A;  3W2Z A;  3ZDJ A;  2ZQ8 A;  4DXB A;  4NG2 A;  4HBT A;  4LCL A;  2ZQC A;  3ZFZ A;  3UPO A;  3HUN A;  3ZG7 B;  3G4P A;  2FFY A;  3DWK A;  3T4O A;  4MMN A;  1YKD A;  3G2Z A;  2J3W A;  4O0P A;  2INW A;  3W8K A;  2WKI A;  1OJ5 A;  1L0E A;  1ZG4 A;  3EQU A;  1P9R A;  4JXW A;  2W1T A;  2WAF A;  2QHK A;  4JGR A;  4NET A;  1D7E A;  3AGF A;  3BY8 A;  3UPN A;  1KVM A;  4EQ1 A;  4L9F A;  2L0W A;  5DFY A;  3IH8 A;  4BL2 A;  5HWV A;  3LFV A;  4CPK A;  2ZQ9 A;  4OPZ A;  2V1Z A;  2QZ6 A;  5HX9 A;  4BLM A;  1DJC A;  4S2M A;  2FFF B;  3GMW A;  3GTC A;  5FAP A;  2Z2L B;  3V50 A;  1AWI A;  3PBS A;  4OOM A;  2RCX A;  1YLP A;  2DMW A;  3T4J A;  3EQV A;  1K6R A;  3P7N A;  3NOT C;  5EFW A;  3MKE A;  1MY8 A;  4K0W A;  1TD5 A;  4Q0J A;  2JKR M;  3OOV A;  2P04 A;  4FSF A;  3ULF A;  4LV2 A;  2M1C A;  2XR0 A;  2HPB A;  1DJB A;  3VOZ A;  2ZJ9 A;  1SKF A;  3IXB A;  4DJ2 A;  1SDE A;  4MDZ A;  5GHY A;  2EFX A;  1HTZ A;  5DKK A;  3UME A;  2W3D A;  5F68 A;  1PFL A;  3OZH A;  4GS9 A;  5EUA A;  1PZO A;  4WEK A;  3CMZ A;  4WMC D;  3BFE A;  4GNU A;  1IYQ A;  5AQ9 A;  1KGG A;  2HV1 A;  3O3V A;  3TG9 A;  4KZA A;  5A91 A;  2H28 A;  5E43 A;  3NIA A;  3G30 A;  2XRN A;  2H0Y A;  4GHI A;  3Q7V B;  2PYP A;  3IWO A;  1XJ4 A;  3BLS A;  4S2O A;  1KOU A;  3F1N A;  4HOI A;  2YKF A;  4KQR A;  2X01 A;  4OKP A;  5GHZ A;  1VM1 A;  5CHJ A;  4KUO A;  4IBR A;  4ID4 A;  1E3U D;  4BEN A;  3CG5 A;  3E4Q A;  5KZH A;  2JKG A;  4R70 A;  5HL6 A;  1XJ3 A;  3DW0 A;  4HHD A;  5FI6 A;  1H3Q A;  3HLC A;  5J4E A;  4IUH A;  1YSQ A;  2L4R A;  1I2S A;  3BFC A;  2W1R A;  3G35 A;  4S2I A;  1XA1 A;  2OAQ 1;  3E2L A;  4EBP A;  5EOO A;  5CX7 A;  2BTF P;  1SZV A;  4Z1W A;  4LRX C;  1PWD A;  1WE4 A;  5L8M A;  5DTS A;  4UEY A;  3LI8 A;  5EVI B;  4ETX A;  2EXB A;  4U3T A;  1VEU B;  1ZC2 A;  3PBR A;  1LT0 A;  4MLL A;  4GKU A;  2Y2N A;  3ZG5 A;  4KUK A;  3N8R A;  4JBF A;  2Z6C A;  2PU2 A;  2ZOH A;  4PKY G;  4NEE D;  5A92 A;  3D72 A;  2B95 A;  2ZBB A;  1TS7 A;  2A2L A;  1XFQ A;  4F3L A;  1KE0 A;  1K4E A;  2PR5 A;  2W0N A;  3QP2 A;  1VHM A;  4OQH A;  3VP0 A;  4DE0 A;  4RX2 A;  4Y5F A;  1Q2Q A;  1OPX A;  4LV0 A;  2FZ0 A;  5FSR A;  1W63 M;  2ZQ7 A;  4S2J A;  3A3J A;  4R23 A;  1ESI A;  1T18 A;  4QU3 A;  4KG6 A;  4DE2 A;  5FEG A;  4NK3 A;  2I72 A;  4FH2 A;  3ZYT A;  5CGW A;  1PW8 A;  4PPR A;  1PWC A;  3L7H A;  4JXV A;  4Y3I A;  1SCW A;  2JN7 A;  4OPQ A;  3HLW A;  3NDG A;  4G3K A;  4E3K A;  1N9N A;  3BQA A;  3PYP A;  5F69 A;  1ACF A;  5CHU A;  5GLB A;  5EVI A;  3C38 A;  3TOI A;  4Y0T A;  3JYI A;  3O5Y A;  2ZMA A;  3JVU A;  2GZA A;  1LSV A;  2V1B A;  1GSV A;  4E3O A;  5AVE A;  1P97 A;  3Q82 A;  3K2N A;  2ZL1 B;  3R7W A;  2KDK A;  2Y2M A;  4BBV A;  3T12 B;  1STZ A;  2J9P A;  1TDG A;  1VEU A;  2V8F A;  3HJK A;  4HH3 A;  1MPL A;  1IKI A;  4OLD A;  1PZP A;  5FDH A;  1L0G A;  3IXH A;  3VMA A;  4X55 A;  4JF4 A;  4JKT A;  5HFO A;  5E2F A;  3TRC A;  1GSW A;  2C6W B;  4ZDX A;  3HVF A;  5L2F A;  2K7S A;  3A0V A;  4UA7 A;  3MJQ A;  5CGS A;  2OSU A;  1CK3 A;  5G18 A;  1ES2 A;  4YWZ A;  1L0D A;  3IBR A;  1Z6F A;  1GCE A;  4OOL A;  2Q9M A;  1GHI A;  1K57 A;  3KSF A;  2JKR I;  4EEP A;  4R3J A;  3DTI A;  4LLO B;  4QWO A;  3CJM A;  1ES5 A;  1LSW A;  4QJG A;  3BEC A;  1KE4 A;  2HDQ A;  4DRT A;  3IBJ A;  1NYY A;  4DN0 A;  3B47 A;  1S6R A;  1ODV A;  2ACG A;  1BLH A;  3GR2 A;  2ZC6 B;  3VE4 A;  1W5D A;  2WZZ A;  2NUT C;  1GHP A;  3H7W A;  4ARZ B;  1H5X A;  1OTB A;  4R3A A;  4B9O A;  5DJU A;  4HES A;  3UB5 P;  5HAQ A;  3BRM A;  3P01 A;  2JKF A;  3A3F A;  1AXB A;  2ZM2 A;  3ZQ5 A;  1S67 L;  2Y91 A;  1VET A;  1TS8 A;  5EM0 A;  2Q9N A;  2R9W A;  4WZ5 A;  3ZG0 A;  3IF6 B;  4Y15 A;  3F1P A;  3WWX A;  2EX9 A;  3GV9 A;  4OQG A;  1K4F A;  1XGJ A;  5TBM A;  3ZVW A;  4DMZ A;  3UB9 A;  5F1F A;  3WS0 A;  4DKI A;  3LIB A;  1CI8 A;  1ONG A;  5FI2 A;  3KSG A;  4S2K A;  4R4S A;  1O07 A;  2WZX A;  1IEM A;  1PYY A;  2G7U A;  4S2P A;  3ZVT A;  5AQA A;  1H0M A;  4EBN A;  2KOI A;  4FH4 A;  4EUV A;  3C7V A;  3H82 A;  5FQI A;  3MSH A;  2VGL S;  2WKH A;  2B18 A;  3PR6 A;  3WS1 A;  2B5R A;  4HI4 A;  4BBU A;  1GA0 A;  3RTY A;  1N9O A;  2XGN A;  4IHQ A;  3DWZ A;  4KZ7 A;  4JF6 A;  4I5S A;  4KZ3 A;  5BOH A;  3U2A A;  2Q0O A;  1RP5 A;  3LR4 A;  5F1G A;  5CXW A;  1EW0 A;  3D4F A;  4OLG A;  3TE8 A;  1LL8 A;  4WEJ A;  3OCN A;  4R38 A;  1MC0 A;  3EEA A;  4KZB A;  4OPY A;  5DF7 A;  5FDS A;  4C75 A;  4MN6 A;  3BFG A;  1K25 A;  2PRF A;  1S66 L;  4CLC A;  1J9M A;  4QD4 A;  3KSI A;  3OPP A;  2IWC A;  2D02 A;  1L0F A;  1SKO A;  5K5B A;  4K08 A;  4K91 A;  1W79 A;  1K56 D;  4HP4 A;  3UB6 A;  4E04 A;  1XXM A;  1G5U A;  5E2E A;  2D01 A;  1IYO A;  4BQM A;  4S2N C;  3SS5 A;  3UE6 A;  1YLZ A;  2HDR A;  3QP5 A;  1OTD A;  1RCJ A;  3LYX A;  4HJ4 A;  1DP9 A;  3IS2 A;  1E25 A;  1T19 A;  3EGX C;  4EU0 A;  4I39 A;  5TR7 A;  3KYZ A;  5L07 A;  3H7W B;  4E6X A;  1PI4 A;  1YLJ A;  1LL9 A;  2PDR A;  4GDN A;  3T4T A;  4GHI B;  1I2W A;  5IHV A;  4GCZ A;  1P0Z A;  4E3L A;  4EWF A;  4Y2F A;  2VGJ A;  4HQA A;  3LID A;  1CEF A;  5A93 A;  3VP4 A;  1ESU A;  2K31 A;  3DTK A;  2JHE A;  4JGO A;  4B93 A;  3VE3 A;  4GD6 A;  2J80 A;  3UN7 A;  2W3H A;  3Q07 A;  5F83 A;  3HLD A;  4OQ0 A;  2Y4A A;  2VV7 A;  2OV5 A;  4BMW A;  5EPH A;  2V8C A;  2BLS A;  1BLC A;  3C8C A;  3M6H A;  4P0M A;  1RGY A;  3C4P A;  3N4I A;  2P74 A;  4ZRR A;  3CPT B;  3ZCZ A;  3B33 A;  4WZ5 C;  5IT5 A;  3BWL A;  1BYW A;  3HL9 A;  4I3A A;  4YIN A;  5FQQ A;  4JLF A;  3W4O A;  1UGU A;  3NDE A;  3LO7 A;  2V2F F;  2ZOI A;  5HD3 A;  1MWS A;  1JTG A;  1W8Y A;  3E0Y A;  1YMX A;  5CHM A;  3UNW A;  4OQI A;  4B4Z A;  2QYB A;  2Y55 A;  4FCF A;  1XFN A;  2V9A A;  4QHC A;  1NZU A;  2J9O A;  3IWI A;  1M40 A;  1BLP A;  4ZBE A;  5M19 A;  2I9V A;  2IA2 A;  3D3O A;  1XX2 A;  4NXF A;  4WZ4 A;  4EW7 A;  3EOI A;  1C3B A;  3FPV A;  1PRQ A;  1XJ6 A;  2C5W B;  2WGV A;  4BL3 A;  1PWG A;  3UMD A;  2H5S A;  3NOU C;  1Y4O A;  1YM1 A;  4Z9Q A;  1BSG A;  4Y0U A;  5KIZ A;  3UE3 A;  1JWV A;  1VQQ A;  3LI9 A;  3IX4 A;  4KZ6 A;  1P9W A;  3FPW A;  3UB8 A;  4WL9 A;  2O0Y A;  1FR6 A;  4KZ8 A;  5HDD A;  1JWZ A;  3HUO A;  1N9L A;  1PI5 A;  4Q0I A;  5HDC A;  4LFU A;  2O9A A;  4WN5 A;  3T1S A;  5FAO A;  3CUE C;  1NWZ A;  4L0L A;  5KSC A;  4FTX A;  2W3F A;  4JGP A;  2E8I A;  3NJA A;  3GDI A;  4JXG A;  3E2K A;  4Y7P A;  2WAE A;  2VEA A;  3JPU A;  4CLC B;  2G2W A;  3SS3 A;  5DF9 A;  5IS1 A;  4OPR A;  3GRJ A;  1BTL A;  3IHB A;  4KZ5 A;  1TS6 A;  3G32 A;  5DVA A;  5FAQ A;  2JCH A;  1YMS A;  2VA0 A;  4C3Q A;  2XLN A;  4NXB A;  2XFS A;  1G6O A;  3LEQ A;  2Y2I A;  3UPP A;  2IWD A;  2J3T D;  1FCN A;  1LLB A;  1YT4 A;  5FAT A;  4ZAM A;  2A24 B;  4LGW A;  1MWR A;  3UO9 A;  3VV4 A;  4WF0 A;  2UV0 E;  5EVI C;  3PBN A;  1S1Y A;  3FZC A;  5CTM A;  3WS5 A;  1FIK A;  4N1X A;  4EXO A;  4MCW A;  5GHX A;  3UY6 A;  2PHY A;  3LIC A;  1FSW A;  3BLM A;  4LV3 A;  5DJT A;  2Y2L A;  2QWS A;  3WS2 A;  2AVX A;  2IWB A;  1KE3 A;  3QHY A;  5FAS A;  5CED A;  4MBH A;  2XEP A;  5J8X A;  1YLW A;  4UAA A;  3CPT A;  3S1Y A;  2PU4 A;  1A0K A;  2LB9 A;  1EI5 A;  5AVF A;  1ZKJ A;  3T4K A;  4L9G A;  2UWX A;  4UQI S;  3G34 A;  4C6Y A;  3F1O A;  5HPI A;  3UB7 A;  3C7U A;  4LRY C;  1XPB A;  3GQZ A;  1J3W A;  3F1O B;  1G68 A;  1K38 A;  2ZM8 A;  5JYO A;  2V0U A;  3LR3 A;  5JYP A;  2ZC3 B;  2J3T C;  3VP1 A;  1NYM A;  4EEU A;  1VB6 A;  4RA7 A;  4PKY A;  3D9Y A;  4OOY A;  1HD8 A;  1KDS A;  5CTN A;  3NEC A;  4WLA A;  5FQM A;  3G2Y A;  4G3V A;  4GW9 A;  1T1A A;  3NHQ A;  4KQD A;  3LUQ A;  3MFX A;  5I94 A;  2EXA A;  2XH9 A;  4EV4 A;  5DF8 A;  4N1H A;  1OME A;  1X0O A;  1IKG A;  3QP4 A;  4ESP A;  4H6J B;  3MKF A;  4H8R A;  3IX3 A;  5U47 A;  4O8G A;  2HP6 A;  3DBA A;  2PBY A;  2ZLY A;  3A3D A;  2QKP A;  5I5L A;  4DE3 A;  3O88 A;  1K54 A;  3LIA A;  3WS4 A;  2CMN A;  5G4Z A;  1EWZ A;  3CAX A;  3EWK A;  2Z2M B;  3QNB A;  3NI9 A;  3P98 A;  5EV0 A;  3NC8 A;  4MBF A;  2EFU A;  1NRJ A;  4I38 A;  4M3K A;  1XA7 A;  4RX3 A;  2ZMF A;  4P85 A;  1BUE A;  1Y54 A;  1FSY A;  1Q2P A;  1FR1 A;  2PYR A;  2XF3 A;  5HZH A;  3UDX A;  1WYB A;  2OAP 1;  2EX6 A;  3CZD A;  5HL1 A;  4OON A;  1JWP A;  2A24 A;  1S1Z A;  3SH7 A;  4GLQ A;  3N7W A;  2VV6 A;  1YSP A;  3E4P A;  1S4R A;  2ZQA A;  5DKL A;  5MC7 A;  3OC2 A;  3UDI A;  5FA7 A;  3Q81 A;  4GDB A;  4MN7 A;  3U4L P;  3VOL A;  3MR0 A;  1YLT A;  4Q8I A;  1OTE A;  3ISG A;  3CLO A;  4NKP A;  3NY4 A;  2R78 A;  4WUJ A;  2GJ3 A;  4FOF A;  3VP2 A;  1ES4 A;  1ZG6 A;  5CEC A;  2JBF A;  3BFF A;  1LI9 A;  3HJI A;  4BD1 A;  3L9K A;  4LV1 A;  5A90 A;  2JE5 A;  2VJW A;  2J7V A;  3HRE A;  3EGD C;  1CJF A;  1WYC A;  1KDW A;  3TSG A;  4JF5 A;  4QY6 A;  2GNX A;  2YKH A;  2QMI A;  5FL3 A;  4KQO A;  4GZB A;  4KZ4 A;  4EQI A;  1RGZ A;  2L1M A;  2XRO A;  3OBF A;  4IUK A;  2Y2O A;  3BW6 A;  3PBQ A;  4HIA A;  3LIE A;  1E3U A;  1CQA A;  5HD5 A;  3S4X A;  1TVF A;  3BEB A;  1OJG A;  5EVL A;  3IXG A;  5L09 A;  3DAV A;  2XSS A;  3MQQ A;  1HZO A;  2M7V A;  2V0W A;  2Y8H A;  3HUM A;  3IX8 A;  2PAV P;  3OCL A;  4XUX A;  5CGX A;  3KSH A;  5HDS A;  5GLA A;  4ZJ1 A;  1K55 C;  5LBR A;  1ERQ A;  3BFD A;  4S2N A;  2B02 A;  4I3J A;  1XKZ A;  5KSH A;  1SDN A;  4E3J A;  1Z09 A;  4N92 A;  3QP1 A;  5IU1 A;  3KYQ A;  2W3E A;  2RL3 A;  3OPH A;  1LSX A;  2W3G A;  1QME A;  4O01 A;  1K0K A;  3WRT A;  4EES A;  3PHY A;  2A3U A;  4ZJ3 A;  4KQQ A;  5F5Y A;  2Z6D A;  4KZ9 A;  5DFX A;  3VSK A;  1LHY A;  1V9Y A;  3F1N B;  3IF6 C;  3UDF A;  3NUL A;  2QPN A;  4OH0 A;  1UWP X;  2WK0 A;  4A5R A;  4ETZ A;  5HAI A;  4EET B;  1W7F A;  1NZO A;  1PIO A;  3HBR A;  4R1G A;  2NUP C;  4F94 A;  3ZG9 B;  3ITB A;  3MXS A;  4GS9 B;  5L10 A;  3LGO A;  2P9V B;  1CEG A;  3PAG A;  4DJ3 A;  2ZC7 A;  2OWH A;  4NXG A;  2GX5 A;  4KEN B;  1L3L A;  1YAX A;  3NOP C;  3I7J A;  3BM6 A;  4BJP A;  4E3I A;  1NY0 A;  1OTI A;  3VOY A;  4P6Z S;  3W4Q A;  3SW1 A;  3N6I A;  3FYZ A;  3NCK A;  5A8B A;  4Q0H A;  1SHV A;  4LPZ A;  5HPF A;  3PXP A;  3FKV A;  2VLG A;  2GDN A;  2KLI A;  1NJ4 A;  1YPR A;  4BBT A;  4WM9 A;  3VP3 A;  5AQ7 A;  3M2K A;  1TDL A;  3E4O A;  3SZT A;  3IXD A;  4HJ6 A;  2Y2K A;  3K3D A;  4S2L A;  5M1A A;  3LY3 A;  3ICY A;  2ZD8 A;  4HEF A;  3QNC A;  4EUZ A;  4QB8 A;  1ZHH B;  5HWT A;  4RVA A;  4UA6 A;  2ZC4 B;  3PAE A;  4E3M A;  3FV7 A;  4AFI A;  5FQK A;  5HWW A;  1NXY A;  2OWJ A;  5TGF A;  3CWF A;  1N4O A;  4HP9 A;  2HP5 A;  1N9B A;  3ZG8 B;  3UE0 A;  3SOI A;  4YNR A;  3DTM A;  1F5M A;  3T1Q B;  1MWU A;  5F82 A;  5J7E A;  4DDS A;  1LI0 A;  2R9X A;  4OP8 A;  1NLY A;  1H8M A;  4JPM A;  3VFH A;  1JNU A;  3V67 A;  3RH8 B;  1TEM A;  3GSG A;  4HJ3 A;  2PR6 A;  4B88 A;  5EVI D;  2HZ5 A;  3DTE A;  5GLC A;  1OT9 A;  1MKI A;  3M6B A;  2HJ9 C;  3V39 A;  4IVK A;  3IF5 A;  4E6W A;  4JGQ A;  2BG1 A;  2ZQD A;  4HH2 A;  2P7J A;  1SKO B;  1MZU A;  5GLD A;  2XA7 M;  3A0R A;  4OVD A;  4DE1 A;  1K54 C;  3MXQ A;  3C4O A;  1F9I A;  2VGL M;  1GHM A;  1BUL A;  1NRF A;  1QMF A;  5FQ9 A;  4MBK A;  4CQH A;  3AGD A;  3ZGA B;  2V20 A;  1MKM A;  4X68 A;  3EEH A;  2VGK A;  3HLE A;  4P6B A;  4MEZ A;  4PAU A;  2WAD A;  5CRF A;  3S7Q A;  4UQI M;  4N9L A;  2FH5 A;  1YLY A;  4YOF A;  3B3X A;  1G28 A;  1FOF A;  4HNB A;  1IYS A;  1S0W A;  1LL5 A;  2DCF A;  1V9Z A;  3TW8 A;  4WYY A;  2LB5 A;  4D2O A;  1D1J A;  4CLC E;  5G4Y A;  3V5M A;  2WUQ A;  4Y13 A;  1I5Q A;  4U0X A;  3JVV A;  3SH8 A;  2JKT M;  4IBX A;  4LEN A;  3M2J A;  2VZW A;  3HLF A;  4PM9 A;  1UWN X;  4P6Z M;  2OLU A;  4HBU A;  4WMC A;  3MFD A;  4PM5 A;  2P08 A;  3QP6 A;  3AGE A;  5AJG A;  3A3I A;  5D3O A;  3S22 A;  5FI7 A;  4H6J A;  1BZA A;  3ZNY A;  2PD7 A;  4M4X A;  3CIT A;  2WKR A;  4BWI A;  1JVJ A;  1K6S A;  1WA9 A;  5DTK A;  3BY9 A;  3OPL A;  3FC7 A;  4GN2 A;  4EER A;  2JC7 A;  4UA9 A;  3T1X A;  2O9B A;  1ERO A;  1DY6 A;  2EA9 A;  3MZF A;  3GVB A;  4RYE A;  4EBL A;  4U0T A;  2M7U A;  4GJ4 A;  3IQA A;  3IHA A;  5CEB A;  2CC1 A;  4DF6 A;  4X53 A;  4E3N A;  1GA9 A;  3G31 A;  3KX0 X;  4LCM A;  1E4D A;  1T1C A;  3PTE A;  1KGE A;  3GEC A;  3FKW A;  2PD8 A;  5EOE A;  5M18 A;  4IVI A;  2Y2H A;  4CLC D;  3A3E A;  3V3R A;  1OT6 A;  4GOG A;  5DTT A;  3E98 A;  2OOL A;  2K2N A;  3Q1F A;  1W8Q A;  3MF0 A;  1CI9 A;  4D60 A;  4RQ9 A;  3RJU A;  2P9V A;  2WYX A;  3QP8 A;  5AQB A;  3LY4 A;  4PMA A;  3R4K A;  2DNS A;  2Y2J A;  2WKP A;  2J8Y A;  1ZTU A;  2EWV A;  3RFB A;  1H8Y A;  4KG5 A;  4WEL A;  4I3I A;  1ONH A;  2O99 A;  4FD8 A;  1S4S A;  3MQ0 A;  4X1L A;  4QPR A;  2H10 A;  4BD0 A;  3C30 A;  3Q7Z A;  2VX8 A;  3B42 A;  1U60 A;  4GB7 A;  3CHW P;  3MBZ A;  3IT9 A;  4PHT A;  4FUW A;  1FCM A;  3HLG A;  4N9K A;  4XUZ A;  4X1M A;  2ZL1 A;  2KX6 A;  3K3C A;  1G6A A;  3IH9 A;  1K56 A;  2VK3 A;  1HVB A;  4P87 A;  2Y59 A;  4PM6 A;  2EWW A;  2WKE A;  5FEF A;  3FWL A;  4XT2 B;  4R3B A;  4MNR A;  1FIL A;  2X02 A;  1T1B A;  5KMW A;  3H9W A;  4PM8 A;  4G3W A;  3LEZ A;  1JTD A;  1TF1 A;  3ITA A;  3R7W B;  1ERM A;  1F2K A;  5EEC A;  3IS2 B;  2WGW B;  4QY5 A;  2Y2G A;  3O87 A;  2Y2Q A;  2HP9 A;  4ME4 A;  3F1P B;  4ZJ2 A;  4X25 A;  2XD1 A;  2HGV A;  3LIF A;  2XD5 A;  3S7O A;  4F3L B;  2WKQ A;  2EX8 A;  2ZC5 B;  1PNE A;  2XQZ A;  4X56 A;  1HLU P;  3OPR A;  3C2W A;  4O7D A;  3ZNT A;  3CUE A;  3S7P A;  5J3W A;  2OLV A;  3UE1 A;  1IFQ A;  4KG2 A;  4WBG A;  1MXO A;  1XJ2 A;  4ARZ A;  1MWT A;  1K55 A;  4HY8 A;  3SH9 A;  3FG8 A;  3MMH A;  3Q7V A;  5FQJ A;  3CI6 A;  1KGF A;  4DDY A;  3T4L A;  2HJE A;  1IEL A;  3IWQ A;  5EVE A;  5HSQ A;  2W1T B; 
#chains in the Genus database with same CATH homology
 4FTX A;  1Y4O A;  1ACF A;  1J3W A;  1VET A;  1VEU A;  2V8F A;  5EM0 A;  3MS6 A;  1FIL A;  1PFL A;  1Z09 A;  5FDS A;  4X25 A;  1AWI A;  3CHW P;  3CPT A;  2PRF A;  4FUW A;  1D1J A;  2PAV P;  3KYE A;  2HZ5 A;  1A0K A;  3L9K A;  3T1R A;  3LEQ A;  3T1X A;  3MSH A;  1FIK A;  2B95 A;  3L7H A;  3NUL A;  3LGO A;  1SKO A;  2ZL1 A;  4X1M A;  5EV0 A;  3UB5 P;  4ESP A;  3D9Y A;  2ACG A;  1F2K A;  1CQA A;  3T1Q B;  1PNE A;  2PBD P;  2V8C A;  1CJF A;  4D60 A;  1SKO B;  2ZL1 B;  1PRQ A;  1HLU P;  2JKF A;  2VK3 A;  5EM1 A;  1G5U A;  1VEU B;  1VET B;  3U4L P;  3NEC A;  4QWO A;  3T1S A;  4X1L A;  1CF0 A;  1K0K A;  1SZV A;  2BTF P;  2E8J A;  3DAV A;  1YPR A;  5FEF A;  5EVE A;  5FEG A;  3CPT B;  2JKG A;  3T12 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...