4ESPA

Crystal structure of peanut allergen ara h 5
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
130
structure length
130
Chain Sequence
SWQTYVDDHLLCEIEGNHLSSAAILGQDGSVWAQSSNFPQFKPEEITAIMNDFAEPGSLAPTGLYLGGTKYMVIQGEPGTVIRGKKGPGGVTIKKTNQALIIGIYDEPMTPGQCNMIVEKLGDYLIDTGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin
publication title Crystal Structure of Peanut ( Arachis hypogaea ) Allergen Ara h 5.
pubmed doi rcsb
source organism Arachis hypogaea
molecule tags Allergen
total genus 39
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2012-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4espA00
4D60A 1VETB 2BTFP 3DAVA 3CPTA 1PNEA 1Y4OA 1YPRA 3T12B 1VEUB 3NULA 4QWOA 1SKOA 2JKFA 3CPTB 2E8JA 5EM1A 2ACGA 5FEGA 1CJFA 2B95A 5EVEA 3L7HA 1PFLA 1SZVA 1J3WA 1F2KA 2PAVP 1A0KA 4X1LA 2PBDP 3L9KA 5FEFA 1SKOB 3LGOA 5EV0A 4X25A 1CQAA 1AWIA 1G5UA 4ESPA 4FTXA 1HLUP 3CHWP 3U4LP 3UB5P 3T1XA 3T1QB 3T1SA 3KYEA 1ACFA 2V8CA 2ZL1A 1D1JA 1PRQA 1FIKA 2V8FA 3LEQA 2PRFA 5EM0A 1CF0A 3MS6A 1FILA 3NECA 4FUWA 1VETA 1Z09A 3MSHA 2JKGA 3T1RA 2VK3A 5FDSA 2ZL1B 2HZ5A 1K0KA 1VEUA 4X1MA 3D9YA
chains in the Genus database with same CATH superfamily
2B5RA 3W4PA 4NEED 3DAVA 4DE1A 2H28A 3PHYA 2K7SA 3Q7VA 5FASA 4N92A 1T18A 1YPRA 3QP4A 4BBVA 2ZM0A 4OLDA 4R4RA 1WYBA 2Z2LB 1RGZA 2O9CA 5L09A 4P0MA 5FATA 4EWFA 4Q8IA 4QB8A 3BLSA 1EW0A 5EM1A 5EECA 4PM7A 3LIBA 4L0LA 2HDUA 1LI0A 5HL6A 3OPPA 4S2NA 4H8RA 1QMFA 3RJUA 3SOIA 4MEZA 5FEFA 2EWWA 1SKOB 5IT5A 2K31A 3HJKA 3GDIA 1GHMA 4QHCA 3SS4A 2X01A 5K5BA 3MJQA 4AFIA 1YLZA 4MN7A 4JBFA 5DJTA 5JYOA 3CAXA 5FA7A 4O7DA 1N9NA 3G2YA 5J4EA 3FPWA 4EW7A 3PBSA 4LFUA 4DMZA 2P9VB 3TW8A 3H82B 2J3WA 5L07A 2P74A 3BQ8A 3OOVA 3FYZA 3NDGA 4HY8A 4JGOA 4EETB 3IBJA 3WS1A 3OPRA 5GLBA 3VP2A 3HLGA 1MBLA 1P9WA 3B3XA 3T4JA 2KLIA 2G7UA 2Y2MA 1K6SA 5F1FA 5CGSA 1GSWA 3EOIA 2C6WB 2V9AA 4CLCA 2HZ5A 4IEDA 4BWIA 4L9EA 1OTBA 2WKHA 5DJUA 4ETZA 3UB6A 1K55A 4I3JA 1OTDA 1XJ3A 3LYXA 4JXVA 4JLFA 3GR2A 5TBMA 3E0YA 4E3KA 1XA1A 4MN6A 2E8IA 3VFFA 3I7JA 1GHIA 1IKGA 4R3JA 3O88A 4XUXA 5AQ7A 2WKQA 4DE2A 3E4PA 3T12B 3ULFA 4QWOA 3R7WB 1H8MA 5D3OA 2Y2GA 1TDLA 3CPTB 4BENA 3ZQ5A 2O0YA 2E8JA 5HAQA 2H0YA 4R6LA 2OOLA 4HHDA 1MC0A 2O9AA 1NJ4A 5AJGA 2XR0A 1LL9A 5HAPA 4N1HA 3HLDA 1MKMA 2ZMFA 1W79A 4HBUA 3IWOA 2BG1A 4FTXA 3WS0A 2EX6A 3IX3A 2JKRI 2Z6DA 1OTAA 2ZC7A 2W1TB 4DDYA 1XGJA 5EOEA 3T1SA 4ZJ3A 3DW0A 1ES2A 2HF6A 1RGYA 4OQGA 3SZTA 1O7EA 4O8GA 3UB8A 3ICYA 3NECA 3M6HA 1H3QA 2W3EA 4R0QA 5CXWA 4L9FA 4CPKA 2Y2QA 4P6ZS 4RQ9A 4GDBA 3LR5A 2WGWB 2A24A 3BY8A 4IJGA 2L4RA 1FSYA 5DVAA 3NI9A 2QHKA 4ID4A 2W3DA 4WF0A 4X69A 4I38A 1E4DA 4KZ8A 4K91A 3MKFA 5GHZA 1JNUA 2YKHA 3OPLA 5DTKA 2O99A 2VJWA 4HJ4A 2B95A 3IS2B 2IWBA 2JBFA 1BLSA 1OT9A 3BFDA 5KIZA 4BBTA 4ZAMA 3P98A 3EQVA 1GHPA 1A0KA 2JCHA 3N6IA 1ES3A 3L9KA 4JXSA 3UPPA 5EVIB 1BLPA 2Y2LA 2GNXA 3G4PA 2Q0OA 2WUQA 4KQOA 1W63Q 4S2IA 3AGFA 4Z9QA 3IHBA 3BFEA 3NOUC 3SW1A 2XA7M 4GN2A 2L1MA 1J9MA 3VOLA 3IX8A 3B42A 1DJCA 1IFQA 4XT2B 3T1XA 2W3FA 1LSWA 1SDNA 3C38A 5HD3A 3A0VA 5KSCA 1G28A 4GNUA 4Y13A 5HL1A 5HFOA 2QWSA 3EQUA 1CI8A 4M3KA 2PBYA 3BJNA 1DP9A 3NBLA 4I3AA 4NKPA 2HJEA 3IF6B 3H7WA 3WRTA 3FKVA 4D60A 5J7EA 1CI9A 2GZAA 1V9ZA 4QY6A 1FSWA 3SS5A 2JKTI 2HDRA 4LRZE 4II7A 4C75A 3VV4A 4N9KA 4MBFA 1FCOA 4K08A 1NRJA 4LV1A 4HH3A 3IH8A 2Y59A 4YWZA 1E25A 2JKFA 5F83A 3VFHA 1IKIA 1K56D 1EI5A 5EVEA 1YQSA 3LFVA 1J3WA 2PU4A 3QNCA 3VP1A 4E3OA 4KZBA 1KDWA 5KMWA 4FSFA 3MF0A 3K2NA 2VV8A 3BFGA 3S22A 3S7QA 3CHWP 1DY6A 1TS6A 3ITAA 3UB5P 3PBRA 4IBXA 1D06A 5F1GA 3E2LA 2ZL1A 1OPXA 3MBZA 4KUKA 5CTMA 1GA9A 3BEBA 4WEKA 4KG6A 1K38A 4OLGA 4X6TA 4WZ5A 1MWRA 4GHIB 1JWVA 3F1NB 4DRTA 3NOTC 2V0UA 2C5WB 1VHMA 1MZUA 2Z6CA 1FCMA 5AVFA 1N9OA 3DWKA 3HLBA 4WBGA 1S0WA 2XK1A 4R38A 3LR3A 5GLCA 2VEAA 1O07A 4Q0IA 1VM1A 2NUTC 5F6AA 4UA9A 2PYRA 4UA7A 4EUVA 2ZJ9A 3C30A 4H6JA 4WLAA 3OCLA 3T4SA 4WELA 2J8YA 4GS9A 3BWLA 4RA7A 1M6KA 2KOIA 3LIEA 4GB7A 1NYMA 3KYZA 2P08A 5TJJA 1YKDA 1Y54A 5HDCA 3ZCZA 1PFLA 1ESIA 1F2KA 3GTCA 1U60A 5CRFA 3N8SA 4HEFA 1ES5A 1YMSA 3NOPC 4GLQA 4ZJ1A 1CEGA 5CEBA 4KZ9A 3C5AA 1XJ4A 5CHMA 3B33A 4PPRA 3HUNA 3GRJA 5AQAA 5E2HA 5DTSA 3WS2A 1DP6A 2EXBA 5HAIA 5HWVA 3CG5A 3NJAA 2HP6A 1P9RA 1WYCA 4IUKA 4P6BA 4BMWA 4P85A 3IQAA 5FI7A 3GECA 2HDQA 2PT7A 4B9OA 4S2OA 1PWDA 3TJZC 3B47A 2O9BA 3NCKA 2UWXA 2RCXA 4Z1WA 1C3BA 2VGJA 1V9YA 1OMEA 5FL3A 4X1MA 4LGWA 3H9WA 4HESA 1NLYA 1X0OA 4JXWA 3C7UA 2J3TC 1F5MA 1OJGA 3N8RA 3G31A 2VX8A 3IBRA 3UPNA 4UQIS 4NXEA 5DFXA 2X02A 3O3VA 3E4QA 1JTDA 3FC7A 3MZDA 1YSQA 2A2LA 1SKOA 4S2MA 1UGUA 1FCNA 1GCEA 3T4LA 3VP0A 3UE3A 4BLMA 1LHYA 4KQQA 3ZHHA 4E3IA 3V50A 4QD4A 1OTEA 2FH5A 2ZM8A 3V39A 4NK3A 1L3LA 2FFYA 4Y17A 4MDZA 2P9VA 4G3VA 5DKLA 2ZQDA 1WE4A 1YM1A 3HLWA 4ZJ2A 2ZQ9A 4Q0HA 5DFYA 1BYWA 3PYPA 2EWVA 2NUPC 2ZQ7A 1LI9A 5EUAA 1K4EA 3HVFA 3BY9A 1IYOA 2VGLS 5EVID 3BW6A 1MWUA 4K0XA 2OLVA 4O01A 5A91A 3GMWA 2ZBBA 1QMEA 4HBTA 2V20A 5AVEA 3M2JA 3V5MA 1ALQA 4DE3A 1PW8A 4FUWA 2V2FF 4EV4A 2Y91A 3OZHA 2JKGA 1ERMA 3AGEA 3NHQA 5FQMA 1N9LA 2WK0A 3CMZA 5L8MA 3VSLA 2BASA 4P6ZM 5GLAA 3PTEA 1NXYA 4LENA 4PKYG 3RFBA 3R7WA 4O0PA 3MQ0A 1VETB 1DRMA 1IYSA 3CPTA 5CHJA 2HJ9C 2LB5A 2XRNA 3BRMA 3KSHA 1BZAA 4EBPA 5JYPA 1KGGA 1N9BA 3HLEA 2EXAA 4YFMA 1MWSA 5A93A 4IBRA 4KG2A 4HP9A 3S1YA 3VSKA 3G34A 4QY5A 1XFNA 2ZC3B 5E43A 3IXHA 2ZQ8A 2Y8HA 5A8BA 2OLUA 1YT4A 3ZNYA 2XD1A 4Y7PA 3VE4A 4X1LA 3T50A 3MFXA 4EQIA 2W1TA 3A3IA 4GZBA 4MN5A 4F3LB 1G5UA 1GSVA 2VKSA 5M18A 4OOYA 4S2LA 4JXGA 5F69A 3MXSA 4WEJA 4BBUA 3IF5A 3A0SA 4WYYA 3KYQA 3PBOA 2WKEA 2UV0E 3PBNA 5J8XA 3FPVA 5IHVA 5A90A 1IOUA 2WGWA 3CLOA 1BTLA 1E3UA 2Y2IA 2JC7A 1UWPX 3BQAA 4E3JA 5A92A 1G6OA 2H10A 2ZMAA 1KGFA 2PR5A 1K0KA 3LR4A 2L0WA 2JKRM 2PDRA 3F1OB 1GSXA 4ZTKA 2PHYA 3EEHA 4NETA 2FFFB 1I5QA 1NWZA 3T4TA 4QJGA 3DTMA 2OAQ1 3WS5A 5FDHA 2A3UA 1PZOA 3IS2A 1LSVA 2EFUA 1VEUB 1FR1A 1XXMA 4MBHA 2Y2HA 5FAOA 5EVIA 4U0TA 4EBNA 2J80A 1H8ZA 2KDKA 3V3SA 5FI2A 4ZBEA 5U47A 2VV6A 4X53A 1LSXA 2R9XA 2J3TD 4HIAA 1SZVA 3M6BA 2OWJA 3VP4A 4LV3A 4WN5A 4XT2A 2X71A 4L9GA 1CQAA 5F68A 1W5DA 3ZGAB 4ESPA 2W1RA 5DF7A 1NZOA 3DWZA 4ARZB 3UMDA 1H8YA 4ZDXA 1TEMA 5FSRA 3CWFA 3KYEA 4WL9A 2K2NA 3ZG8B 1D1JA 1PRQA 2Y2NA 3CUEA 3LY3A 3T4KA 2V8FA 3IF6A 3LEQA 3LI8A 2ZOIA 3HJIA 5HW3A 1PIOA 5KZHA 1MY8A 3LICA 4G3WA 4GOGA 3V67A 3HUOA 4DKIA 4OONA 4LV2A 1YLYA 4G3KA 1XX2A 1XJ6A 4I5SA 3VMAA 1LT0A 3C4OA 1PI4A 3WRZA 3S7PA 5EE8A 3IXGA 2OAP1 3PBQA 3CI6A 2HP9A 1T1AA 4M4XA 3UE6A 3QP6A 3K3CA 4OPYA 2XROA 1FQGA 2FZ0A 3Q82A 4WM9A 4Y3IA 2XFTA 4XUZA 1N4OA 2DMWA 3TRCA 1L0EA 4RX2A 3E2KA 4IVKA 4EESA 4C6YA 3O87A 1F9IA 1P0ZA 1LLBA 1H0MA 1L0GA 2OV5A 1I2WA 1OJ5A 3OCNA 1BUEA 2PD7A 3MQOA 2Q9MA 3SS3A 2JKTM 1KVMA 4LCMA 1TDGA 2W0NA 3LIAA 1K57C 4RX3A 1OT6A 5EVIC 3U2AA 2OSUA 3UY6A 1DJAA 4GHIA 1BLCA 1EWZA 2ZQAA 4RYEA 2KX6A 2DNSA 4E3LA 3LY4A 4PM5A 2WAEA 3TG9A 1D7EA 4IUHA 4Y15A 1PWCA 3O5YA 2HPBA 2ZC4B 2H5SA 1K4FA 4F94A 4PMAA 5DF8A 4OKPA 1ODVA 5CX7A 5TR7A 4YOFA 5HD5A 1KE3A 1L0FA 3UB9A 3E98A 2HGVA 2WGIA 5MC7A 3IT9A 4PAUA 1TS7A 4DN0A 2EX9A 3CUEC 3C4PA 2V0WA 3IF6C 3WS4A 4HJ6A 3IXDA 4P87A 3MQQA 4Y5FA 2A49A 3LR0A 2QKPA 3UB7A 2EX2A 3E4OA 1CJFA 5G4ZA 4N9LA 2Y4AA 2GJ3A 1XPBA 3MFDA 5BOHA 1MKIA 4JGQA 3K3DA 3TOIA 3LGOA 1XKZA 3WWXA 5EFWA 3G2ZA 3UNWA 4GW9A 2ZD8A 4UAAA 1STZA 1L2SA 5IU1A 1P97A 2EX8A 3BM6A 5HPFA 4HNBA 4NXBA 3LCEA 2D01A 2XD5A 2P7JA 2VGLM 3JYIA 2W3GA 3OPHA 2QMIA 4DF6A 3S7OA 2PR6A 4DXCA 3D72A 1HD8A 2Y79A 3JPUA 5M1AA 5HDSA 1TVFA 5FQ9A 2V1ZA 4I39A 1RCJA 1CK3A 2RL3A 3RXWA 3UE1A 3IX4A 4EQ1A 3EEAA 1W7FA 3KSGA 2QJ7A 1ERQA 3OBFA 4DXBA 4B4XA 1IYPA 2J7VA 3BECA 1CEFA 4ZRRA 3VOZA 5FQJA 4ME4A 5EOOA 5I94A 3NY4A 3DTKA 1PWGA 4WMCD 4CLCD 4BD1A 2IA2A 4WUJA 1JWPA 1K56A 4YINA 4EUZA 4GD6A 2VGKA 3NULA 4B88A 3HUMA 4KZAA 1T1BA 2Q9NA 5CERA 5EVLA 3G35A 3GV9A 1S1ZA 3DTIA 2ZC5B 3LI9A 4EBLA 5TFQA 1W63M 2XGNA 3TE8A 1BULA 4DE0A 4LRYC 3T4OA 1IEMA 1AWIA 1Y28A 1NZUA 3G6OA 3BYDA 5HARA 2YKFA 4HI4A 4BL3A 3MXRA 3FV7A 1ZG6A 2VV7A 3MR0A 4JF4A 5HPIA 4OOLA 5DF9A 4C3QA 1XP4A 3C8CA 4Y2FA 4R3BA 5GLDA 1NRFA 4R70A 3H82A 3BFCA 3PAGA 5LBRA 1CF0A 2ZOHA 2J9OA 2ZM2A 1VETA 4WZ4A 5J3WA 3MSHA 2QZ6A 5FAPA 4CJNA 2IWDA 1ZTUA 4UHUA 3NDEA 3IHAA 3F1PB 3EGXC 4FD8A 5FQKA 3G30A 1UWNX 1H5XA 1ZKJA 4HJ3A 3GQZA 1PNEA 4OQIA 3ZNTA 3LIDA 4U0XA 3A3JA 2XSSA 2HDSA 1IELA 4BJPA 4EERA 1VB6A 4PM8A 1XGIA 4KG5A 1FR6A 4MBKA 5CGXA 3UO9A 4BL2A 2WKIA 2CC1A 2I9VA 3Q7VB 4F3LA 2ACGA 4KZ3A 5G4YA 3MXQA 4OPRA 3ZG9B 2M1CA 3VP3A 1K54A 2B18A 2Y55A 3QP8A 3LIFA 4GJ4A 4KUOA 3GVBA 4JGRA 5EV0A 4EEUA 5EPHA 3QP2A 2WADA 4RVAA 4E3MA 4LRXC 2J9PA 4HH2A 4EU0A 1ZC2A 3IWIA 2WGVA 3VE3A 3Q7ZA 4OPQA 1XA7A 3QHYA 3N8LA 3A3FA 3SH9A 4WMCA 3ITBA 3KSIA 2G2UA 1ZHHB 5CHUA 5G18A 3FZCA 5EM0A 3D4FA 3VOYA 1YLTA 3F1OA 1K6RA 1OTIA 3UDIA 5I5LA 2XQZA 4N1XA 3UPOA 5FDSA 3KO6A 4MCWA 4Y0UA 4DJ3A 1Q2PA 4OQ0A 2IWCA 1XJ2A 2ZLYA 1VEUA 2ZQCA 3EGDC 4OP5A 2VLGA 3HLCA 3D3OA 1YLJA 4JKTA 4LLOB 5CECA 3CZDA 2WKPA 4DJ2A 3UE0A 3UDFA 4PHTA 5E2EA 3LEZA 2EA9A 4OPZA 4KZ5A 4CLCB 3PR6A 1RP5A 3ZG7B 5TGFA 3NIAA 3G32A 2VA0A 3C7VA 2JN7A 4E04A 3P7NA 1GA0A 5TBMB 3RTYA 3ZFZA 3JVUA 3FG8A 4X68A 4ETXA 3QNBA 1G68A 5M19A 2PAVP 2QPNA 2PBDP 3MZFA 4ARZA 3PBTA 5HX9A 2Z2MB 4JPMA 3FWLA 4S2NC 2BLSA 1DP8A 5IS1A 3HCYA 1K57A 4R4SA 4E6XA 2XF3A 2P04A 2R78A 3GSGA 4NXFA 4R3AA 4HOIA 1HLUP 1W8YA 3MMHA 1NYYA 3R4KA 2B02A 1ES4A 3RXXA 4LCLA 3Q81A 1KVLA 1T19A 2I72A 4S2JA 3BFFA 4R23A 1TS0A 1K54C 4S2PA 3ZVTA 1G6AA 4PKYA 1FIKA 1PW1A 5C5KA 1ESUA 2JE5A 1FILA 2DRWA 1YLWA 2XFSA 4QU3A 4KENB 4XXRA 5L10A 5GHXA 3P01A 2XDMA 2Y2JA 4CLCC 1KE0A 5FQIA 1K55C 4IHQA 4E6WA 5HZHA 1SKFA 1T1CA 1M40A 5CTNA 1JTGA 5FQQA 2H0TA 3CITA 4I3IA 2OWHA 4FH4A 4OQHA 2A24B 4GD8A 2PYPA 1F98A 1BLHA 2V1AA 4KQRA 2W27A 1SHVA 3O86A 3UN7A 3OLOA 3QP1A 1K25A 3ZG0A 3SH7A 4X25A 4GKUA 2Y2KA 1PYYA 2LB9A 3S7NA 2WZXA 3DBAA 4KZ6A 3KX0X 4JGPA 3LUQA 3KSFA 3N7WA 4DDSA 2ZC6B 3PXPA 5F82A 2HV1A 3U4LP 1MWTA 3MKEA 4MMNA 1L0DA 5HDDA 2G2WA 1MXOA 4E3NA 1TF1A 4PM6A 2AVXA 2M7UA 4CQHA 2PD8A 3Q07A 2QYBA 2Y2PA 4KZ7A 1TS8A 4UEYA 4PM9A 1S67L 4JF5A 2WAFA 4KQDA 4Q0JA 1BT5A 3F1NA 3ZYTA 1KOUA 1HZOA 3IXBA 5HWWA 3HL9A 3D9YA 1NLZA 2BTFP 3HREA 3TSGA 4EXOA 5GHYA 5FI6A 1ONHA 1S1YA 5CGWA 1XFQA 2JHEA 3H7WB 3CJMA 4FCFA 1PZPA 3IH9A 1W8QA 4LV0A 4B4ZA 2INWA 3RH8B 4HQAA 4BD0A 4BQMA 1LL8A 1ZG4A 3W8KA 3A3DA 3W4OA 4CLCE 5AQ9A 1NY0A 5DTTA 5E2FA 3W4QA 3V3RA 1YLPA 4UQIM 3JVVA 2ZMVA 3AGDA 3C2WA 2D02A 1BSGA 5AQBA 4MNRA 4OP8A 2EFXA 2V1BA 4NG2A 2XA7S 3MZEA 4R1GA 4X56A 2QJ5A 2W3HA 1WA9A 3IWQA 3SH8A 1S66L 4QPRA 1LL5A 4GCZA 3T1QB 1KDSA 2PU2A 2HP5A 4D2OA 3HBRA 4Y0OA 1EROA 1SCWA 2WKRA 2VZWA 3ZVWA 1DJBA 3DTEA 1KE4A 4OVDA 1JVJA 2GX5A 2PRFA 3A0RA 2XLNA 3T1RA 2VK3A 3HLFA 2ZL1B 3A3EA 1KGEA 1YMXA 5GL9A 1AXBA 5F5YA 3P09A 4A5RA 4OH0A 4NXGA 4GDNA 3EWKA 1YAXA 3M2KA 3FKWA 1Y4OA 4KZ4A 3Q1FA 4U3TA 2R9WA 2GDNA 1S6RA 5E2GA 5L2FA 3ZDJA 4OOMA 1YSPA 1MPLA 4UA6A 1I2SA 2XH9A 3S4XA 5FEGA 5HWTA 4YNRA 2CMNA 4IVIA 4FOFA 1HVBA 3L7HA 4H6JB 2WZZA 2M7VA 3QP5A 2DCFA 1JWZA 1ONGA 4GS9B 2MJ6A 5CEDA 1PI5A 1TD5A 1VQQA 4HP4A 4B93A 4Y0TA 2WYXA 3ZG5A 3T4QA 3UMEA 1Q2QA 5KSHA 1HTZA 5DKKA 5FAQA 4FH2A 3N4IA 4EEPA 3UDXA 4K0WA 3W2ZA 1ACFA 1IYQA 2V8CA 1SDEA 3F1PA 2Y2OA 4MLLA 1FOFA 3PAEA 1S4SA 3OC2A 3BLMA 3MS6A 4X55A 1Z09A 4S2KA 3NC8A 2XEPA 5HSQA 4LPZA 3ISGA 3LO7A 1Z6FA 4WZ5C 1S4RA 4JF6A 1E3UD
chains in the Genus database with same CATH topology
4D60A 1VETB 2BTFP 3DAVA 3CPTA 1PNEA 1Y4OA 1YPRA 3T12B 1VEUB 3NULA 4QWOA 1SKOA 2JKFA 3CPTB 2E8JA 5EM1A 2ACGA 5FEGA 1CJFA 2B95A 5EVEA 3L7HA 1PFLA 1SZVA 1J3WA 1F2KA 2PAVP 1A0KA 4X1LA 2PBDP 3L9KA 5FEFA 1SKOB 3LGOA 5EV0A 4X25A 1CQAA 1AWIA 1G5UA 4ESPA 4FTXA 1HLUP 3CHWP 3U4LP 3UB5P 3T1XA 3T1QB 3T1SA 3KYEA 1ACFA 2V8CA 2ZL1A 1D1JA 1PRQA 1FIKA 2V8FA 3LEQA 2PRFA 5EM0A 1CF0A 3MS6A 1FILA 3NECA 4FUWA 1VETA 1Z09A 3MSHA 2JKGA 3T1RA 2VK3A 5FDSA 2ZL1B 2HZ5A 1K0KA 1VEUA 4X1MA 3D9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D60 A;  1VET B;  2BTF P;  3DAV A;  3CPT A;  1PNE A;  1Y4O A;  1YPR A;  3T12 B;  1VEU B;  3NUL A;  4QWO A;  1SKO A;  2JKF A;  3CPT B;  2E8J A;  5EM1 A;  2ACG A;  5FEG A;  1CJF A;  2B95 A;  5EVE A;  3L7H A;  1PFL A;  1SZV A;  1J3W A;  1F2K A;  2PAV P;  1A0K A;  4X1L A;  2PBD P;  3L9K A;  5FEF A;  1SKO B;  3LGO A;  5EV0 A;  4X25 A;  1CQA A;  1AWI A;  1G5U A;  4ESP A;  4FTX A;  1HLU P;  3CHW P;  3U4L P;  3UB5 P;  3T1X A;  3T1Q B;  3T1S A;  3KYE A;  1ACF A;  2V8C A;  2ZL1 A;  1D1J A;  1PRQ A;  1FIK A;  2V8F A;  3LEQ A;  2PRF A;  5EM0 A;  1CF0 A;  3MS6 A;  1FIL A;  3NEC A;  4FUW A;  1VET A;  1Z09 A;  3MSH A;  2JKG A;  3T1R A;  2VK3 A;  5FDS A;  2ZL1 B;  2HZ5 A;  1K0K A;  1VEU A;  4X1M A;  3D9Y A; 
#chains in the Genus database with same CATH topology
 2B5R A;  3W4P A;  4NEE D;  3DAV A;  4DE1 A;  2H28 A;  3PHY A;  2K7S A;  3Q7V A;  5FAS A;  4N92 A;  1T18 A;  1YPR A;  3QP4 A;  4BBV A;  2ZM0 A;  4OLD A;  4R4R A;  1WYB A;  2Z2L B;  1RGZ A;  2O9C A;  5L09 A;  4P0M A;  5FAT A;  4EWF A;  4Q8I A;  4QB8 A;  3BLS A;  1EW0 A;  5EM1 A;  5EEC A;  4PM7 A;  3LIB A;  4L0L A;  2HDU A;  1LI0 A;  5HL6 A;  3OPP A;  4S2N A;  4H8R A;  1QMF A;  3RJU A;  3SOI A;  4MEZ A;  5FEF A;  2EWW A;  1SKO B;  5IT5 A;  2K31 A;  3HJK A;  3GDI A;  1GHM A;  4QHC A;  3SS4 A;  2X01 A;  5K5B A;  3MJQ A;  4AFI A;  1YLZ A;  4MN7 A;  4JBF A;  5DJT A;  5JYO A;  3CAX A;  5FA7 A;  4O7D A;  1N9N A;  3G2Y A;  5J4E A;  3FPW A;  4EW7 A;  3PBS A;  4LFU A;  4DMZ A;  2P9V B;  3TW8 A;  3H82 B;  2J3W A;  5L07 A;  2P74 A;  3BQ8 A;  3OOV A;  3FYZ A;  3NDG A;  4HY8 A;  4JGO A;  4EET B;  3IBJ A;  3WS1 A;  3OPR A;  5GLB A;  3VP2 A;  3HLG A;  1MBL A;  1P9W A;  3B3X A;  3T4J A;  2KLI A;  2G7U A;  2Y2M A;  1K6S A;  5F1F A;  5CGS A;  1GSW A;  3EOI A;  2C6W B;  2V9A A;  4CLC A;  2HZ5 A;  4IED A;  4BWI A;  4L9E A;  1OTB A;  2WKH A;  5DJU A;  4ETZ A;  3UB6 A;  1K55 A;  4I3J A;  1OTD A;  1XJ3 A;  3LYX A;  4JXV A;  4JLF A;  3GR2 A;  5TBM A;  3E0Y A;  4E3K A;  1XA1 A;  4MN6 A;  2E8I A;  3VFF A;  3I7J A;  1GHI A;  1IKG A;  4R3J A;  3O88 A;  4XUX A;  5AQ7 A;  2WKQ A;  4DE2 A;  3E4P A;  3T12 B;  3ULF A;  4QWO A;  3R7W B;  1H8M A;  5D3O A;  2Y2G A;  1TDL A;  3CPT B;  4BEN A;  3ZQ5 A;  2O0Y A;  2E8J A;  5HAQ A;  2H0Y A;  4R6L A;  2OOL A;  4HHD A;  1MC0 A;  2O9A A;  1NJ4 A;  5AJG A;  2XR0 A;  1LL9 A;  5HAP A;  4N1H A;  3HLD A;  1MKM A;  2ZMF A;  1W79 A;  4HBU A;  3IWO A;  2BG1 A;  4FTX A;  3WS0 A;  2EX6 A;  3IX3 A;  2JKR I;  2Z6D A;  1OTA A;  2ZC7 A;  2W1T B;  4DDY A;  1XGJ A;  5EOE A;  3T1S A;  4ZJ3 A;  3DW0 A;  1ES2 A;  2HF6 A;  1RGY A;  4OQG A;  3SZT A;  1O7E A;  4O8G A;  3UB8 A;  3ICY A;  3NEC A;  3M6H A;  1H3Q A;  2W3E A;  4R0Q A;  5CXW A;  4L9F A;  4CPK A;  2Y2Q A;  4P6Z S;  4RQ9 A;  4GDB A;  3LR5 A;  2WGW B;  2A24 A;  3BY8 A;  4IJG A;  2L4R A;  1FSY A;  5DVA A;  3NI9 A;  2QHK A;  4ID4 A;  2W3D A;  4WF0 A;  4X69 A;  4I38 A;  1E4D A;  4KZ8 A;  4K91 A;  3MKF A;  5GHZ A;  1JNU A;  2YKH A;  3OPL A;  5DTK A;  2O99 A;  2VJW A;  4HJ4 A;  2B95 A;  3IS2 B;  2IWB A;  2JBF A;  1BLS A;  1OT9 A;  3BFD A;  5KIZ A;  4BBT A;  4ZAM A;  3P98 A;  3EQV A;  1GHP A;  1A0K A;  2JCH A;  3N6I A;  1ES3 A;  3L9K A;  4JXS A;  3UPP A;  5EVI B;  1BLP A;  2Y2L A;  2GNX A;  3G4P A;  2Q0O A;  2WUQ A;  4KQO A;  1W63 Q;  4S2I A;  3AGF A;  4Z9Q A;  3IHB A;  3BFE A;  3NOU C;  3SW1 A;  2XA7 M;  4GN2 A;  2L1M A;  1J9M A;  3VOL A;  3IX8 A;  3B42 A;  1DJC A;  1IFQ A;  4XT2 B;  3T1X A;  2W3F A;  1LSW A;  1SDN A;  3C38 A;  5HD3 A;  3A0V A;  5KSC A;  1G28 A;  4GNU A;  4Y13 A;  5HL1 A;  5HFO A;  2QWS A;  3EQU A;  1CI8 A;  4M3K A;  2PBY A;  3BJN A;  1DP9 A;  3NBL A;  4I3A A;  4NKP A;  2HJE A;  3IF6 B;  3H7W A;  3WRT A;  3FKV A;  4D60 A;  5J7E A;  1CI9 A;  2GZA A;  1V9Z A;  4QY6 A;  1FSW A;  3SS5 A;  2JKT I;  2HDR A;  4LRZ E;  4II7 A;  4C75 A;  3VV4 A;  4N9K A;  4MBF A;  1FCO A;  4K08 A;  1NRJ A;  4LV1 A;  4HH3 A;  3IH8 A;  2Y59 A;  4YWZ A;  1E25 A;  2JKF A;  5F83 A;  3VFH A;  1IKI A;  1K56 D;  1EI5 A;  5EVE A;  1YQS A;  3LFV A;  1J3W A;  2PU4 A;  3QNC A;  3VP1 A;  4E3O A;  4KZB A;  1KDW A;  5KMW A;  4FSF A;  3MF0 A;  3K2N A;  2VV8 A;  3BFG A;  3S22 A;  3S7Q A;  3CHW P;  1DY6 A;  1TS6 A;  3ITA A;  3UB5 P;  3PBR A;  4IBX A;  1D06 A;  5F1G A;  3E2L A;  2ZL1 A;  1OPX A;  3MBZ A;  4KUK A;  5CTM A;  1GA9 A;  3BEB A;  4WEK A;  4KG6 A;  1K38 A;  4OLG A;  4X6T A;  4WZ5 A;  1MWR A;  4GHI B;  1JWV A;  3F1N B;  4DRT A;  3NOT C;  2V0U A;  2C5W B;  1VHM A;  1MZU A;  2Z6C A;  1FCM A;  5AVF A;  1N9O A;  3DWK A;  3HLB A;  4WBG A;  1S0W A;  2XK1 A;  4R38 A;  3LR3 A;  5GLC A;  2VEA A;  1O07 A;  4Q0I A;  1VM1 A;  2NUT C;  5F6A A;  4UA9 A;  2PYR A;  4UA7 A;  4EUV A;  2ZJ9 A;  3C30 A;  4H6J A;  4WLA A;  3OCL A;  3T4S A;  4WEL A;  2J8Y A;  4GS9 A;  3BWL A;  4RA7 A;  1M6K A;  2KOI A;  3LIE A;  4GB7 A;  1NYM A;  3KYZ A;  2P08 A;  5TJJ A;  1YKD A;  1Y54 A;  5HDC A;  3ZCZ A;  1PFL A;  1ESI A;  1F2K A;  3GTC A;  1U60 A;  5CRF A;  3N8S A;  4HEF A;  1ES5 A;  1YMS A;  3NOP C;  4GLQ A;  4ZJ1 A;  1CEG A;  5CEB A;  4KZ9 A;  3C5A A;  1XJ4 A;  5CHM A;  3B33 A;  4PPR A;  3HUN A;  3GRJ A;  5AQA A;  5E2H A;  5DTS A;  3WS2 A;  1DP6 A;  2EXB A;  5HAI A;  5HWV A;  3CG5 A;  3NJA A;  2HP6 A;  1P9R A;  1WYC A;  4IUK A;  4P6B A;  4BMW A;  4P85 A;  3IQA A;  5FI7 A;  3GEC A;  2HDQ A;  2PT7 A;  4B9O A;  4S2O A;  1PWD A;  3TJZ C;  3B47 A;  2O9B A;  3NCK A;  2UWX A;  2RCX A;  4Z1W A;  1C3B A;  2VGJ A;  1V9Y A;  1OME A;  5FL3 A;  4X1M A;  4LGW A;  3H9W A;  4HES A;  1NLY A;  1X0O A;  4JXW A;  3C7U A;  2J3T C;  1F5M A;  1OJG A;  3N8R A;  3G31 A;  2VX8 A;  3IBR A;  3UPN A;  4UQI S;  4NXE A;  5DFX A;  2X02 A;  3O3V A;  3E4Q A;  1JTD A;  3FC7 A;  3MZD A;  1YSQ A;  2A2L A;  1SKO A;  4S2M A;  1UGU A;  1FCN A;  1GCE A;  3T4L A;  3VP0 A;  3UE3 A;  4BLM A;  1LHY A;  4KQQ A;  3ZHH A;  4E3I A;  3V50 A;  4QD4 A;  1OTE A;  2FH5 A;  2ZM8 A;  3V39 A;  4NK3 A;  1L3L A;  2FFY A;  4Y17 A;  4MDZ A;  2P9V A;  4G3V A;  5DKL A;  2ZQD A;  1WE4 A;  1YM1 A;  3HLW A;  4ZJ2 A;  2ZQ9 A;  4Q0H A;  5DFY A;  1BYW A;  3PYP A;  2EWV A;  2NUP C;  2ZQ7 A;  1LI9 A;  5EUA A;  1K4E A;  3HVF A;  3BY9 A;  1IYO A;  2VGL S;  5EVI D;  3BW6 A;  1MWU A;  4K0X A;  2OLV A;  4O01 A;  5A91 A;  3GMW A;  2ZBB A;  1QME A;  4HBT A;  2V20 A;  5AVE A;  3M2J A;  3V5M A;  1ALQ A;  4DE3 A;  1PW8 A;  4FUW A;  2V2F F;  4EV4 A;  2Y91 A;  3OZH A;  2JKG A;  1ERM A;  3AGE A;  3NHQ A;  5FQM A;  1N9L A;  2WK0 A;  3CMZ A;  5L8M A;  3VSL A;  2BAS A;  4P6Z M;  5GLA A;  3PTE A;  1NXY A;  4LEN A;  4PKY G;  3RFB A;  3R7W A;  4O0P A;  3MQ0 A;  1VET B;  1DRM A;  1IYS A;  3CPT A;  5CHJ A;  2HJ9 C;  2LB5 A;  2XRN A;  3BRM A;  3KSH A;  1BZA A;  4EBP A;  5JYP A;  1KGG A;  1N9B A;  3HLE A;  2EXA A;  4YFM A;  1MWS A;  5A93 A;  4IBR A;  4KG2 A;  4HP9 A;  3S1Y A;  3VSK A;  3G34 A;  4QY5 A;  1XFN A;  2ZC3 B;  5E43 A;  3IXH A;  2ZQ8 A;  2Y8H A;  5A8B A;  2OLU A;  1YT4 A;  3ZNY A;  2XD1 A;  4Y7P A;  3VE4 A;  4X1L A;  3T50 A;  3MFX A;  4EQI A;  2W1T A;  3A3I A;  4GZB A;  4MN5 A;  4F3L B;  1G5U A;  1GSV A;  2VKS A;  5M18 A;  4OOY A;  4S2L A;  4JXG A;  5F69 A;  3MXS A;  4WEJ A;  4BBU A;  3IF5 A;  3A0S A;  4WYY A;  3KYQ A;  3PBO A;  2WKE A;  2UV0 E;  3PBN A;  5J8X A;  3FPV A;  5IHV A;  5A90 A;  1IOU A;  2WGW A;  3CLO A;  1BTL A;  1E3U A;  2Y2I A;  2JC7 A;  1UWP X;  3BQA A;  4E3J A;  5A92 A;  1G6O A;  2H10 A;  2ZMA A;  1KGF A;  2PR5 A;  1K0K A;  3LR4 A;  2L0W A;  2JKR M;  2PDR A;  3F1O B;  1GSX A;  4ZTK A;  2PHY A;  3EEH A;  4NET A;  2FFF B;  1I5Q A;  1NWZ A;  3T4T A;  4QJG A;  3DTM A;  2OAQ 1;  3WS5 A;  5FDH A;  2A3U A;  1PZO A;  3IS2 A;  1LSV A;  2EFU A;  1VEU B;  1FR1 A;  1XXM A;  4MBH A;  2Y2H A;  5FAO A;  5EVI A;  4U0T A;  4EBN A;  2J80 A;  1H8Z A;  2KDK A;  3V3S A;  5FI2 A;  4ZBE A;  5U47 A;  2VV6 A;  4X53 A;  1LSX A;  2R9X A;  2J3T D;  4HIA A;  1SZV A;  3M6B A;  2OWJ A;  3VP4 A;  4LV3 A;  4WN5 A;  4XT2 A;  2X71 A;  4L9G A;  1CQA A;  5F68 A;  1W5D A;  3ZGA B;  4ESP A;  2W1R A;  5DF7 A;  1NZO A;  3DWZ A;  4ARZ B;  3UMD A;  1H8Y A;  4ZDX A;  1TEM A;  5FSR A;  3CWF A;  3KYE A;  4WL9 A;  2K2N A;  3ZG8 B;  1D1J A;  1PRQ A;  2Y2N A;  3CUE A;  3LY3 A;  3T4K A;  2V8F A;  3IF6 A;  3LEQ A;  3LI8 A;  2ZOI A;  3HJI A;  5HW3 A;  1PIO A;  5KZH A;  1MY8 A;  3LIC A;  4G3W A;  4GOG A;  3V67 A;  3HUO A;  4DKI A;  4OON A;  4LV2 A;  1YLY A;  4G3K A;  1XX2 A;  1XJ6 A;  4I5S A;  3VMA A;  1LT0 A;  3C4O A;  1PI4 A;  3WRZ A;  3S7P A;  5EE8 A;  3IXG A;  2OAP 1;  3PBQ A;  3CI6 A;  2HP9 A;  1T1A A;  4M4X A;  3UE6 A;  3QP6 A;  3K3C A;  4OPY A;  2XRO A;  1FQG A;  2FZ0 A;  3Q82 A;  4WM9 A;  4Y3I A;  2XFT A;  4XUZ A;  1N4O A;  2DMW A;  3TRC A;  1L0E A;  4RX2 A;  3E2K A;  4IVK A;  4EES A;  4C6Y A;  3O87 A;  1F9I A;  1P0Z A;  1LLB A;  1H0M A;  1L0G A;  2OV5 A;  1I2W A;  1OJ5 A;  3OCN A;  1BUE A;  2PD7 A;  3MQO A;  2Q9M A;  3SS3 A;  2JKT M;  1KVM A;  4LCM A;  1TDG A;  2W0N A;  3LIA A;  1K57 C;  4RX3 A;  1OT6 A;  5EVI C;  3U2A A;  2OSU A;  3UY6 A;  1DJA A;  4GHI A;  1BLC A;  1EWZ A;  2ZQA A;  4RYE A;  2KX6 A;  2DNS A;  4E3L A;  3LY4 A;  4PM5 A;  2WAE A;  3TG9 A;  1D7E A;  4IUH A;  4Y15 A;  1PWC A;  3O5Y A;  2HPB A;  2ZC4 B;  2H5S A;  1K4F A;  4F94 A;  4PMA A;  5DF8 A;  4OKP A;  1ODV A;  5CX7 A;  5TR7 A;  4YOF A;  5HD5 A;  1KE3 A;  1L0F A;  3UB9 A;  3E98 A;  2HGV A;  2WGI A;  5MC7 A;  3IT9 A;  4PAU A;  1TS7 A;  4DN0 A;  2EX9 A;  3CUE C;  3C4P A;  2V0W A;  3IF6 C;  3WS4 A;  4HJ6 A;  3IXD A;  4P87 A;  3MQQ A;  4Y5F A;  2A49 A;  3LR0 A;  2QKP A;  3UB7 A;  2EX2 A;  3E4O A;  1CJF A;  5G4Z A;  4N9L A;  2Y4A A;  2GJ3 A;  1XPB A;  3MFD A;  5BOH A;  1MKI A;  4JGQ A;  3K3D A;  3TOI A;  3LGO A;  1XKZ A;  3WWX A;  5EFW A;  3G2Z A;  3UNW A;  4GW9 A;  2ZD8 A;  4UAA A;  1STZ A;  1L2S A;  5IU1 A;  1P97 A;  2EX8 A;  3BM6 A;  5HPF A;  4HNB A;  4NXB A;  3LCE A;  2D01 A;  2XD5 A;  2P7J A;  2VGL M;  3JYI A;  2W3G A;  3OPH A;  2QMI A;  4DF6 A;  3S7O A;  2PR6 A;  4DXC A;  3D72 A;  1HD8 A;  2Y79 A;  3JPU A;  5M1A A;  5HDS A;  1TVF A;  5FQ9 A;  2V1Z A;  4I39 A;  1RCJ A;  1CK3 A;  2RL3 A;  3RXW A;  3UE1 A;  3IX4 A;  4EQ1 A;  3EEA A;  1W7F A;  3KSG A;  2QJ7 A;  1ERQ A;  3OBF A;  4DXB A;  4B4X A;  1IYP A;  2J7V A;  3BEC A;  1CEF A;  4ZRR A;  3VOZ A;  5FQJ A;  4ME4 A;  5EOO A;  5I94 A;  3NY4 A;  3DTK A;  1PWG A;  4WMC D;  4CLC D;  4BD1 A;  2IA2 A;  4WUJ A;  1JWP A;  1K56 A;  4YIN A;  4EUZ A;  4GD6 A;  2VGK A;  3NUL A;  4B88 A;  3HUM A;  4KZA A;  1T1B A;  2Q9N A;  5CER A;  5EVL A;  3G35 A;  3GV9 A;  1S1Z A;  3DTI A;  2ZC5 B;  3LI9 A;  4EBL A;  5TFQ A;  1W63 M;  2XGN A;  3TE8 A;  1BUL A;  4DE0 A;  4LRY C;  3T4O A;  1IEM A;  1AWI A;  1Y28 A;  1NZU A;  3G6O A;  3BYD A;  5HAR A;  2YKF A;  4HI4 A;  4BL3 A;  3MXR A;  3FV7 A;  1ZG6 A;  2VV7 A;  3MR0 A;  4JF4 A;  5HPI A;  4OOL A;  5DF9 A;  4C3Q A;  1XP4 A;  3C8C A;  4Y2F A;  4R3B A;  5GLD A;  1NRF A;  4R70 A;  3H82 A;  3BFC A;  3PAG A;  5LBR A;  1CF0 A;  2ZOH A;  2J9O A;  2ZM2 A;  1VET A;  4WZ4 A;  5J3W A;  3MSH A;  2QZ6 A;  5FAP A;  4CJN A;  2IWD A;  1ZTU A;  4UHU A;  3NDE A;  3IHA A;  3F1P B;  3EGX C;  4FD8 A;  5FQK A;  3G30 A;  1UWN X;  1H5X A;  1ZKJ A;  4HJ3 A;  3GQZ A;  1PNE A;  4OQI A;  3ZNT A;  3LID A;  4U0X A;  3A3J A;  2XSS A;  2HDS A;  1IEL A;  4BJP A;  4EER A;  1VB6 A;  4PM8 A;  1XGI A;  4KG5 A;  1FR6 A;  4MBK A;  5CGX A;  3UO9 A;  4BL2 A;  2WKI A;  2CC1 A;  2I9V A;  3Q7V B;  4F3L A;  2ACG A;  4KZ3 A;  5G4Y A;  3MXQ A;  4OPR A;  3ZG9 B;  2M1C A;  3VP3 A;  1K54 A;  2B18 A;  2Y55 A;  3QP8 A;  3LIF A;  4GJ4 A;  4KUO A;  3GVB A;  4JGR A;  5EV0 A;  4EEU A;  5EPH A;  3QP2 A;  2WAD A;  4RVA A;  4E3M A;  4LRX C;  2J9P A;  4HH2 A;  4EU0 A;  1ZC2 A;  3IWI A;  2WGV A;  3VE3 A;  3Q7Z A;  4OPQ A;  1XA7 A;  3QHY A;  3N8L A;  3A3F A;  3SH9 A;  4WMC A;  3ITB A;  3KSI A;  2G2U A;  1ZHH B;  5CHU A;  5G18 A;  3FZC A;  5EM0 A;  3D4F A;  3VOY A;  1YLT A;  3F1O A;  1K6R A;  1OTI A;  3UDI A;  5I5L A;  2XQZ A;  4N1X A;  3UPO A;  5FDS A;  3KO6 A;  4MCW A;  4Y0U A;  4DJ3 A;  1Q2P A;  4OQ0 A;  2IWC A;  1XJ2 A;  2ZLY A;  1VEU A;  2ZQC A;  3EGD C;  4OP5 A;  2VLG A;  3HLC A;  3D3O A;  1YLJ A;  4JKT A;  4LLO B;  5CEC A;  3CZD A;  2WKP A;  4DJ2 A;  3UE0 A;  3UDF A;  4PHT A;  5E2E A;  3LEZ A;  2EA9 A;  4OPZ A;  4KZ5 A;  4CLC B;  3PR6 A;  1RP5 A;  3ZG7 B;  5TGF A;  3NIA A;  3G32 A;  2VA0 A;  3C7V A;  2JN7 A;  4E04 A;  3P7N A;  1GA0 A;  5TBM B;  3RTY A;  3ZFZ A;  3JVU A;  3FG8 A;  4X68 A;  4ETX A;  3QNB A;  1G68 A;  5M19 A;  2PAV P;  2QPN A;  2PBD P;  3MZF A;  4ARZ A;  3PBT A;  5HX9 A;  2Z2M B;  4JPM A;  3FWL A;  4S2N C;  2BLS A;  1DP8 A;  5IS1 A;  3HCY A;  1K57 A;  4R4S A;  4E6X A;  2XF3 A;  2P04 A;  2R78 A;  3GSG A;  4NXF A;  4R3A A;  4HOI A;  1HLU P;  1W8Y A;  3MMH A;  1NYY A;  3R4K A;  2B02 A;  1ES4 A;  3RXX A;  4LCL A;  3Q81 A;  1KVL A;  1T19 A;  2I72 A;  4S2J A;  3BFF A;  4R23 A;  1TS0 A;  1K54 C;  4S2P A;  3ZVT A;  1G6A A;  4PKY A;  1FIK A;  1PW1 A;  5C5K A;  1ESU A;  2JE5 A;  1FIL A;  2DRW A;  1YLW A;  2XFS A;  4QU3 A;  4KEN B;  4XXR A;  5L10 A;  5GHX A;  3P01 A;  2XDM A;  2Y2J A;  4CLC C;  1KE0 A;  5FQI A;  1K55 C;  4IHQ A;  4E6W A;  5HZH A;  1SKF A;  1T1C A;  1M40 A;  5CTN A;  1JTG A;  5FQQ A;  2H0T A;  3CIT A;  4I3I A;  2OWH A;  4FH4 A;  4OQH A;  2A24 B;  4GD8 A;  2PYP A;  1F98 A;  1BLH A;  2V1A A;  4KQR A;  2W27 A;  1SHV A;  3O86 A;  3UN7 A;  3OLO A;  3QP1 A;  1K25 A;  3ZG0 A;  3SH7 A;  4X25 A;  4GKU A;  2Y2K A;  1PYY A;  2LB9 A;  3S7N A;  2WZX A;  3DBA A;  4KZ6 A;  3KX0 X;  4JGP A;  3LUQ A;  3KSF A;  3N7W A;  4DDS A;  2ZC6 B;  3PXP A;  5F82 A;  2HV1 A;  3U4L P;  1MWT A;  3MKE A;  4MMN A;  1L0D A;  5HDD A;  2G2W A;  1MXO A;  4E3N A;  1TF1 A;  4PM6 A;  2AVX A;  2M7U A;  4CQH A;  2PD8 A;  3Q07 A;  2QYB A;  2Y2P A;  4KZ7 A;  1TS8 A;  4UEY A;  4PM9 A;  1S67 L;  4JF5 A;  2WAF A;  4KQD A;  4Q0J A;  1BT5 A;  3F1N A;  3ZYT A;  1KOU A;  1HZO A;  3IXB A;  5HWW A;  3HL9 A;  3D9Y A;  1NLZ A;  2BTF P;  3HRE A;  3TSG A;  4EXO A;  5GHY A;  5FI6 A;  1ONH A;  1S1Y A;  5CGW A;  1XFQ A;  2JHE A;  3H7W B;  3CJM A;  4FCF A;  1PZP A;  3IH9 A;  1W8Q A;  4LV0 A;  4B4Z A;  2INW A;  3RH8 B;  4HQA A;  4BD0 A;  4BQM A;  1LL8 A;  1ZG4 A;  3W8K A;  3A3D A;  3W4O A;  4CLC E;  5AQ9 A;  1NY0 A;  5DTT A;  5E2F A;  3W4Q A;  3V3R A;  1YLP A;  4UQI M;  3JVV A;  2ZMV A;  3AGD A;  3C2W A;  2D02 A;  1BSG A;  5AQB A;  4MNR A;  4OP8 A;  2EFX A;  2V1B A;  4NG2 A;  2XA7 S;  3MZE A;  4R1G A;  4X56 A;  2QJ5 A;  2W3H A;  1WA9 A;  3IWQ A;  3SH8 A;  1S66 L;  4QPR A;  1LL5 A;  4GCZ A;  3T1Q B;  1KDS A;  2PU2 A;  2HP5 A;  4D2O A;  3HBR A;  4Y0O A;  1ERO A;  1SCW A;  2WKR A;  2VZW A;  3ZVW A;  1DJB A;  3DTE A;  1KE4 A;  4OVD A;  1JVJ A;  2GX5 A;  2PRF A;  3A0R A;  2XLN A;  3T1R A;  2VK3 A;  3HLF A;  2ZL1 B;  3A3E A;  1KGE A;  1YMX A;  5GL9 A;  1AXB A;  5F5Y A;  3P09 A;  4A5R A;  4OH0 A;  4NXG A;  4GDN A;  3EWK A;  1YAX A;  3M2K A;  3FKW A;  1Y4O A;  4KZ4 A;  3Q1F A;  4U3T A;  2R9W A;  2GDN A;  1S6R A;  5E2G A;  5L2F A;  3ZDJ A;  4OOM A;  1YSP A;  1MPL A;  4UA6 A;  1I2S A;  2XH9 A;  3S4X A;  5FEG A;  5HWT A;  4YNR A;  2CMN A;  4IVI A;  4FOF A;  1HVB A;  3L7H A;  4H6J B;  2WZZ A;  2M7V A;  3QP5 A;  2DCF A;  1JWZ A;  1ONG A;  4GS9 B;  2MJ6 A;  5CED A;  1PI5 A;  1TD5 A;  1VQQ A;  4HP4 A;  4B93 A;  4Y0T A;  2WYX A;  3ZG5 A;  3T4Q A;  3UME A;  1Q2Q A;  5KSH A;  1HTZ A;  5DKK A;  5FAQ A;  4FH2 A;  3N4I A;  4EEP A;  3UDX A;  4K0W A;  3W2Z A;  1ACF A;  1IYQ A;  2V8C A;  1SDE A;  3F1P A;  2Y2O A;  4MLL A;  1FOF A;  3PAE A;  1S4S A;  3OC2 A;  3BLM A;  3MS6 A;  4X55 A;  1Z09 A;  4S2K A;  3NC8 A;  2XEP A;  5HSQ A;  4LPZ A;  3ISG A;  3LO7 A;  1Z6F A;  4WZ5 C;  1S4R A;  4JF6 A;  1E3U D; 
#chains in the Genus database with same CATH homology
 4D60 A;  1VET B;  2BTF P;  3DAV A;  3CPT A;  1PNE A;  1Y4O A;  1YPR A;  3T12 B;  1VEU B;  3NUL A;  4QWO A;  1SKO A;  2JKF A;  3CPT B;  2E8J A;  5EM1 A;  2ACG A;  5FEG A;  1CJF A;  2B95 A;  5EVE A;  3L7H A;  1PFL A;  1SZV A;  1J3W A;  1F2K A;  2PAV P;  1A0K A;  4X1L A;  2PBD P;  3L9K A;  5FEF A;  1SKO B;  3LGO A;  5EV0 A;  4X25 A;  1CQA A;  1AWI A;  1G5U A;  4ESP A;  4FTX A;  1HLU P;  3CHW P;  3U4L P;  3UB5 P;  3T1X A;  3T1Q B;  3T1S A;  3KYE A;  1ACF A;  2V8C A;  2ZL1 A;  1D1J A;  1PRQ A;  1FIK A;  2V8F A;  3LEQ A;  2PRF A;  5EM0 A;  1CF0 A;  3MS6 A;  1FIL A;  3NEC A;  4FUW A;  1VET A;  1Z09 A;  3MSH A;  2JKG A;  3T1R A;  2VK3 A;  5FDS A;  2ZL1 B;  2HZ5 A;  1K0K A;  1VEU A;  4X1M A;  3D9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...