4ESPA

Crystal structure of peanut allergen ara h 5
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
130
structure length
130
Chain Sequence
SWQTYVDDHLLCEIEGNHLSSAAILGQDGSVWAQSSNFPQFKPEEITAIMNDFAEPGSLAPTGLYLGGTKYMVIQGEPGTVIRGKKGPGGVTIKKTNQALIIGIYDEPMTPGQCNMIVEKLGDYLIDTGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords Profilin
publication title Crystal Structure of Peanut ( Arachis hypogaea ) Allergen Ara h 5.
pubmed doi rcsb
source organism Arachis hypogaea
total genus 39
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2012-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4espA00
2JKFA 3T1XA 3U4LP 3L9KA 1CQAA 2B95A 3MS6A 3KYEA 2PBDP 1VEUB 5EM0A 1G5UA 1Y4OA 4ESPA 2V8FA 1AWIA 3LEQA 1CJFA 3T1SA 3D9YA 1VETA 4X1LA 5EVEA 5EV0A 3T1QB 3T1RA 4D60A 3CPTA 2VK3A 5FEGA 2ZL1A 1PFLA 1FILA 2JKGA 2E8JA 3LGOA 2BTFP 5EM1A 1SKOA 3UB5P 1VETB 2PRFA 1PNEA 3CHWP 3DAVA 4X1MA 1PRQA 1FIKA 3NULA 3CPTB 1K0KA 2ZL1B 1CF0A 3L7HA 3T12B 1J3WA 2HZ5A 1A0KA 1HLUP 1SKOB 4FTXA 5FEFA 1SZVA 4FUWA 3NECA 1ACFA 1Z09A 4QWOA 2ACGA 3MSHA 1VEUA 2PAVP 4X25A 5FDSA 1YPRA 1D1JA 2V8CA 1F2KA
chains in the Genus database with same CATH superfamily
4KZ5A 5AQ7A 2XH9A 3P7NA 2ZOHA 3G35A 5GHXA 3L9KA 1L0FA 4R4RA 3RH8B 1KGGA 2FFYA 2ZC7A 4DN0A 3IF6A 5EM0A 2IWBA 4X53A 4ZJ1A 1U60A 3RXWA 4Y0UA 4WEKA 4M4XA 2WKIA 2R9XA 4PHTA 3CLOA 1W79A 5F83A 1VM1A 5EVIA 3HLBA 4WEJA 4YWZA 4JGQA 1SKOA 4FSFA 3IS2B 3IQAA 4ARZB 4DXBA 1ESUA 4LV1A 5HDCA 2C5WB 3CMZA 1UWNX 4C6YA 3VSKA 3DAVA 2VKSA 4CLCC 2Y59A 3RFBA 2VLGA 3Q7ZA 4JGRA 5E2GA 1EROA 5AQBA 2HJEA 3LFVA 4KZ6A 4JGOA 5M1AA 1LL8A 4AFIA 1K6RA 1JWZA 5IHVA 4HNBA 3EWKA 5EVID 4KQOA 1MC0A 1MKMA 2XF3A 1HD8A 4EUVA 1FSYA 1DP6A 4P0MA 3BFEA 4P6BA 5FA7A 2XEPA 5EE8A 1P9WA 1O7EA 2RL3A 5D3OA 2XGNA 2PDRA 4JF6A 1ES4A 3VOZA 2W3HA 5FSRA 1G68A 3A3JA 4ZRRA 3SOIA 3KYQA 1XFQA 4E3NA 3ZYTA 3ZQ5A 2EA9A 4OPYA 4UAAA 3IS2A 4HI4A 4C75A 1S1YA 4ARZA 3OZHA 3ZG5A 3OLOA 1L3LA 3M2JA 3N4IA 2PR5A 1WA9A 4UEYA 3IX4A 3E4PA 2L4RA 5HWTA 1HZOA 1EI5A 2QYBA 3D3OA 3UDIA 5F6AA 4FD8A 4KZBA 1SCWA 4ETXA 4JGPA 5HL6A 1XKZA 4E3OA 1YLTA 4S2IA 2A3UA 2WKRA 3JVUA 4O8GA 3ULFA 4LPZA 1H5XA 3V3SA 3DTKA 5TFQA 4S2OA 5HWVA 3QP2A 4WN5A 3IF5A 3G4PA 1S67L 1WYCA 4PMAA 5HX9A 1S66L 2JBFA 3BFCA 1L0DA 3HJKA 4BENA 4GCZA 2X71A 3IF6C 4RQ9A 1KE3A 4EEUA 2CMNA 2EWWA 1K25A 2KOIA 1NRJA 2ACGA 2OOLA 2YKHA 1PYYA 1TS8A 5KSHA 2DNSA 2ZMAA 4XXRA 4E3LA 2JN7A 1V9YA 2D02A 4ETZA 4GDNA 3VOYA 5EVIC 1STZA 3QP1A 4WYYA 3T1XA 4OPQA 2WKQA 3CWFA 5M18A 1VHMA 1DJBA 4HH2A 3CG5A 4R3AA 3OOVA 1PI4A 2V20A 2GX5A 2PBYA 1ZC2A 5CGXA 2V8FA 2J9PA 3H9WA 3IXBA 3R7WB 2ZQDA 1NZOA 3P98A 3QHYA 1MZUA 1PW8A 3GSGA 4QJGA 3NCKA 3TSGA 3RTYA 1W63M 3C4PA 4EBLA 3V50A 2WUQA 4X6TA 2Y2MA 3BWLA 1WYBA 5DTTA 2VGJA 3O86A 1W63Q 1QMEA 4HQAA 2ZC6B 2XFSA 1YLWA 2W27A 1PNEA 4Y7PA 4WUJA 2QZ6A 3N7WA 2L0WA 1GHMA 3NULA 5E43A 4LENA 1JWPA 4FOFA 4KZ3A 5U47A 1ES2A 1N9BA 3W2ZA 3VP4A 3TOIA 3HVFA 3T12B 1J3WA 4X55A 3SH8A 1RGZA 4ID4A 2HP6A 5CGSA 1LL9A 1IKGA 3B33A 2ZQ8A 4QWOA 3MQ0A 1BZAA 2CC1A 1LSWA 3HJIA 4EBNA 2XK1A 2HDUA 4N9LA 4I38A 4QU3A 3ZNTA 1W8YA 5AVEA 4X68A 3R7WA 2DCFA 5FQJA 3ITBA 2JKFA 1RGYA 1I2SA 3I7JA 1PZPA 1JTGA 1NYMA 1P0ZA 1LSVA 4Z1WA 1PI5A 4MNRA 4IBRA 2VK3A 2ZLYA 4NG2A 4B4XA 4EWFA 4I3JA 4YOFA 4S2JA 3VP1A 2Y2GA 3LCEA 4L0LA 3UDXA 2YKFA 2G7UA 2HF6A 1H8YA 3QP8A 5DF8A 2XSSA 4U0XA 3S22A 4CLCB 2Q9MA 4DE2A 5FQ9A 2UWXA 4OOMA 3GDIA 3S7PA 1L0GA 3H7WB 1NXYA 2Y2PA 3WRTA 4WL9A 3PR6A 4ZBEA 3ZGAB 2B5RA 3UDFA 4HBUA 4OKPA 3KSIA 5EFWA 3N6IA 5KZHA 5F69A 2EX9A 2C6WB 5HWWA 4FUWA 1PWDA 3FZCA 4P6ZM 5DF9A 3LR4A 1DJCA 5HW3A 1GSXA 3D72A 4KG5A 1SKFA 4HESA 1G6AA 1TF1A 5FAPA 4BL3A 1E3UD 5J3WA 4B93A 3DBAA 1MWSA 3ZG0A 4BMWA 4QPRA 3EGDC 2Y2KA 2ZC5B 4ME4A 5TJJA 4KQQA 3KYEA 4EV4A 3LUQA 4N9KA 4FH2A 3KSFA 5EVLA 4CLCA 1YLYA 2E8IA 4IEDA 3FC7A 4LV3A 3G2YA 4X1LA 5DJTA 3H7WA 5TR7A 3A3EA 4BBUA 3NOTC 4D60A 3WRZA 1ZHHB 4EERA 1AXBA 5EM1A 2XROA 3RXXA 4KQDA 4MDZA 4YNRA 3PBSA 3BQAA 1Y54A 4N92A 4UHUA 1PWCA 2Y2HA 3CHWP 3MZFA 3KSGA 5KMWA 1TDGA 4K0XA 3A3FA 4F94A 1BT5A 3MKFA 1T1AA 4QY5A 2L1MA 3LIAA 3E98A 4Y13A 2VV8A 3MXQA 1SHVA 1S0WA 4O7DA 3VP0A 3HUMA 3NY4A 5FAOA 2J7VA 3S7NA 2GDNA 1BLPA 4M3KA 2R78A 3TJZC 5HDSA 5HPIA 3GRJA 5HDDA 1S4SA 3NOPC 2WKPA 2ZM2A 2OAP1 3UB9A 4HJ3A 3WS0A 3EQVA 3PHYA 4R3JA 2HGVA 4GZBA 3PAEA 5EOEA 4B4ZA 1GHIA 5E2FA 2H0YA 3M6BA 1K54A 4GS9B 1X0OA 3VFHA 3HCYA 3M2KA 4S2LA 5CERA 4Q0IA 3C4OA 1F5MA 1FCMA 3IWQA 5GL9A 3T1SA 3DTMA 5CHJA 4JXWA 4G3WA 1TEMA 4OLGA 3LR5A 1RP5A 1ONHA 5FQMA 3Q1FA 3CAXA 4E3IA 5F1GA 3ZVWA 3K3CA 4GKUA 3T4TA 2ZQ7A 3JVVA 1KE0A 1JVJA 3TRCA 3T4OA 2PD7A 2V1BA 5FI2A 1OJGA 3OCNA 1FCNA 4XUZA 3U2AA 3CPTB 3M6HA 2VEAA 1IYOA 4PM5A 3DWKA 4OQGA 2EXAA 3OCLA 3BY8A 4KQRA 1H0MA 4OQHA 2O9CA 5FEFA 4K91A 4BLMA 2VA0A 4HY8A 2K31A 2HV1A 1ACFA 2P74A 5J8XA 4JBFA 4EU0A 1QMFA 4GS9A 5DF7A 3LR3A 2PAVP 4X25A 4EBPA 3EOIA 2PT7A 3IT9A 1NY0A 4E3MA 3IXHA 4GB7A 3SS4A 1YKDA 3B47A 1CQAA 2MJ6A 4PM6A 2W3EA 3KSHA 4HEFA 1T19A 3ZG8B 1IYSA 2ZC4B 4Y0OA 1J9MA 4MMNA 5FI6A 5HZHA 4LRYC 3AGFA 3LIDA 4IVIA 3O5YA 2XD5A 3K3DA 3Q82A 1PWGA 3T4JA 5HFOA 4DRTA 3PAGA 3ZG7B 2ZD8A 3LR0A 3CPTA 4X56A 2QKPA 2QJ7A 3GR2A 5F82A 3VSLA 1PFLA 2GZAA 4EETB 2EXBA 2BTFP 3V5MA 3UN7A 5FATA 1XJ3A 4NETA 3BFFA 1ODVA 5HARA 2G2UA 5FASA 2XA7M 4PAUA 3CI6A 3KX0X 3OC2A 1P97A 4KUOA 4LRZE 2QPNA 4OVDA 1PRQA 4MN7A 3L7HA 4JF4A 4GN2A 2RCXA 4E3JA 4G3KA 4QY6A 1TVFA 1N9LA 4R1GA 5TBMB 1K54C 1KGEA 4C3QA 3VP2A 3UNWA 3UPPA 5CEBA 1XPBA 5GHYA 4F3LB 1IKIA 4IBXA 4R70A 3VV4A 3QP4A 3C2WA 3C8CA 3PBQA 5CECA 3ZCZA 4O0PA 2VJWA 1UGUA 1XFNA 2OLVA 2Z6CA 1ALQA 3C7VA 4L9GA 5GLDA 1YPRA 4KZ7A 1JNUA 2Y2OA 4PKYG 1GHPA 4YFMA 4MBHA 4OQ0A 2OSUA 4HH3A 3LI9A 5I94A 2WGIA 3BM6A 4DJ3A 4FH4A 3ZFZA 2QJ5A 2V2FF 3FYZA 1K4EA 4DE1A 4BL2A 2ZM8A 3V67A 4LCMA 2W1RA 5KIZA 3E4OA 2Y2QA 5FAQA 1IEMA 4DE3A 3FV7A 4E6WA 3G34A 3H82B 1GA9A 3T1QB 4FCFA 5AVFA 2A24B 4Y5FA 3SS5A 4NXFA 2WYXA 1DRMA 1RCJA 4EXOA 1MWUA 3NDEA 3VMAA 1OTIA 2XDMA 4I3AA 5F5YA 5HD5A 1S1ZA 2O99A 2ZQCA 4S2MA 2E8JA 2P08A 1ZKJA 3WWXA 3V39A 4P87A 5TBMA 2J3TD 4Y3IA 2Z2LB 3BYDA 4CLCE 1O07A 4F3LA 1KOUA 2Y55A 4NXGA 3LO7A 1A0KA 3MMHA 2I72A 2XQZA 1BYWA 1YLZA 4RVAA 2IA2A 3PBNA 3IX3A 3ISGA 3LIFA 1F9IA 4R3BA 4WBGA 3DWZA 2Y2NA 5G4YA 5FQQA 4JPMA 1FR6A 5IU1A 1OT6A 3UB8A 4U3TA 4OLDA 4B9OA 3FPWA 4R6LA 2M1CA 3Q7VB 4PM7A 3TE8A 4MBFA 5TGFA 2V1ZA 1K4FA 3T4LA 1YAXA 3H82A 2J80A 3WS2A 5CTNA 1LI9A 4GOGA 2A24A 3HBRA 2JHEA 1GSWA 3NBLA 4Q8IA 5E2EA 3MXSA 4BD1A 3MS6A 2O9BA 1Y4OA 4IUHA 4NEED 1XA7A 4GNUA 4Y15A 1LL5A 3AGEA 1FR1A 4CJNA 4JXSA 1MWRA 4OP8A 2HDSA 5DKKA 1MPLA 2M7VA 1PW1A 1MKIA 2KX6A 4I5SA 2HP9A 5HAPA 3SW1A 4MEZA 2G2WA 3TG9A 3WS1A 2OV5A 1N9OA 3MZDA 1OTAA 4K0WA 5CX7A 2V0WA 4II7A 3BFDA 1OMEA 4NKPA 5JYOA 4BJPA 1IOUA 1PIOA 4HP4A 2HPBA 3UE6A 3Q7VA 1OPXA 1ONGA 2J3TC 4NK3A 1LSXA 4GW9A 3GECA 1E3UA 5CGWA 3K2NA 1XX2A 2H28A 5A91A 1TD5A 1W7FA 1XJ2A 3QP6A 4EQIA 1PZOA 2BASA 4PM8A 2XD1A 3F1PB 1I5QA 3FKVA 1D1JA 3ZVTA 2PU2A 1YSPA 1ERMA 2D01A 2WAEA 3IXGA 4R23A 3A0RA 3MBZA 3MJQA 2WZZA 5FDHA 4L9EA 1XGIA 5L10A 1T18A 4EESA 5DVAA 1ZG4A 4LLOB 4OPRA 2X01A 2M7UA 5GLAA 3D9YA 3MZEA 3GQZA 4DDSA 1BULA 1TS6A 1L0EA 2JE5A 2ZQAA 2ZBBA 3NHQA 5G4ZA 1CEGA 2H0TA 4OQIA 3OPLA 3BJNA 3FWLA 2HP5A 2JKTI 4PM9A 2EX6A 2HDRA 4ZTKA 5HAIA 1VETB 2GNXA 3ICYA 3LEZA 3ZHHA 2PHYA 5L8MA 3C30A 3HUNA 3T4SA 2QHKA 2WAFA 3C7UA 2B18A 2XR0A 4KZ8A 3PBOA 3ITAA 3BECA 3F1PA 3RJUA 4B88A 3NJAA 1XXMA 5E2HA 3HUOA 3BFGA 4EW7A 3W8KA 2PYPA 3G2ZA 1H3QA 4LRXC 3WS5A 1MWTA 1NLZA 3NECA 4BBVA 1Z09A 4QHCA 4LV0A 5L07A 1N4OA 4OOLA 3O3VA 4N1XA 4UA9A 1KE4A 2W3DA 5J4EA 2K7SA 3MXRA 2IWDA 4GJ4A 2Q9NA 4OPZA 3UY6A 5JYPA 4KZ4A 3CUEA 3LIEA 1Q2PA 2EFXA 4QB8A 5CRFA 4MCWA 4WMCA 5CHUA 4H6JB 3IX8A 1MY8A 2A2LA 1VETA 5CHMA 3DW0A 1K55A 1M6KA 2UV0E 3BEBA 4BQMA 3LGOA 1Z6FA 1UWPX 4NXEA 1G28A 1BLSA 3QP5A 3IH9A 3HLFA 1YMSA 2JKTM 4HIAA 4X69A 1SDNA 4X1MA 4ZJ3A 4WMCD 3SH7A 1ES3A 3IBJA 3KYZA 3HLDA 1K56D 1FSWA 2HJ9C 3ZNYA 1BTLA 5GLCA 2W3GA 1CF0A 3S7OA 1CI9A 2AVXA 5EOOA 2PYRA 2HZ5A 4GDBA 3SS3A 2KLIA 1FOFA 1SZVA 3LY4A 1YLPA 3C5AA 4DMZA 4GHIB 1G6OA 4WZ5A 2I9VA 3DTEA 3D4FA 1Y28A 2OAQ1 1BUEA 5F68A 3IHAA 3MQOA 5I5LA 4ZAMA 2LB9A 3S7QA 2OLUA 3PXPA 3VP3A 4H6JA 2Z2MB 4CPKA 3TW8A 4RX2A 4DKIA 2VV6A 3U4LP 1S4RA 1CEFA 1TS0A 2ZMVA 3N8RA 3O87A 2PBDP 2W1TB 3CZDA 2OWJA 4ESPA 1T1BA 4KG2A 3G31A 4BBTA 3A3DA 3EQUA 4U0TA 3UB7A 3QNBA 1CJFA 1XJ4A 4DE0A 4DF6A 2A49A 1DP9A 2BLSA 3IH8A 1KDWA 1P9RA 3GVBA 2QMIA 5FEGA 4JLFA 1IELA 1YM1A 2ZM0A 3T50A 3GTCA 5HAQA 3C38A 3FKWA 2VV7A 1HTZA 2KDKA 2WGVA 4S2PA 2ZQ9A 1NZUA 4GHIA 2GJ3A 1JWVA 2WADA 4S2NA 3AGDA 3BW6A 4HJ4A 3BLMA 4WZ4A 3OPHA 5EUAA 1K0KA 2OWHA 4ZJ2A 4UQIS 1DY6A 2IWCA 3F1OB 3HLEA 3S1YA 3UMEA 3CUEC 4YINA 4WM9A 5L09A 1BLCA 2P04A 3V3RA 3VOLA 4GD8A 4OP5A 3SZTA 4H8RA 3OPRA 1C3BA 3MQQA 1BLHA 1N9NA 2W1TA 2Y2JA 4I39A 3W4OA 1EWZA 1K55C 4JXVA 2Y2LA 4WELA 1FQGA 3HLGA 5DTSA 1OTBA 4Y17A 3N8LA 2EX8A 1IFQA 4G3VA 4LCLA 2FH5A 4MN6A 4NXBA 1OJ5A 4KENB 5HPFA 5DFYA 4PKYA 5CXWA 3O88A 1VEUB 2Y91A 1HVBA 4IVKA 3UE1A 3A0SA 2WK0A 3FPVA 3KO6A 2PD8A 4BD0A 4KG6A 4RYEA 1XGJA 1CI8A 2J8YA 4R4SA 2Y2IA 1VB6A 3LI8A 3DTIA 4XT2B 3T1RA 5AQ9A 1YSQA 1EW0A 5GLBA 4LGWA 3UO9A 4WZ5C 3MKEA 2K2NA 3F1OA 2B02A 3EGXC 2EX2A 2PR6A 1MXOA 3N8SA 4K08A 4XUXA 2EWVA 4HHDA 3LYXA 4RA7A 1KVLA 3NIAA 2J3WA 2WKEA 3HLCA 4E3KA 2XFTA 3NC8A 3P09A 1T1CA 3PBRA 2ZC3B 4KZAA 4IHQA 5M19A 5BOHA 4FTXA 4MN5A 1BSGA 3S4XA 1XP4A 2W0NA 2Z6DA 4R38A 1WE4A 3FG8A 5J7EA 1KDSA 5G18A 1W5DA 2FFFB 1VEUA 1Q2QA 3T4QA 4IJGA 2JKRI 4JXGA 4P85A 3G32A 4E04A 3ZDJA 4UQIM 2PU4A 2EFUA 4GD6A 5AQAA 4XT2A 4EQ1A 2Y8HA 3BLSA 2B95A 1NJ4A 4S2NC 4P6ZS 1H8MA 3Q81A 2NUPC 2J9OA 3E0YA 1F98A 1JTDA 3PTEA 1XA1A 3LIBA 1OTEA 4R0QA 5FQKA 3UE3A 2ZMFA 4KZ9A 3VFFA 5EVEA 5L2FA 5EV0A 1TDLA 3CITA 3IWOA 1IYPA 2XRNA 5C5KA 1NLYA 2XLNA 1ES5A 1FILA 4OOYA 2INWA 1CK3A 2VZWA 1YT4A 3B42A 2VGKA 2ZL1B 3A0VA 4D2OA 1LLBA 3UE0A 5HL1A 3HREA 4ZDXA 4OH0A 2P9VB 4Y0TA 3BQ8A 1YQSA 4I3IA 4Y2FA 1M40A 3HL9A 3OBFA 1LHYA 2DMWA 3G6OA 2WGWB 5FDSA 3SH9A 2V8CA 2O9AA 4JKTA 1KVMA 4HJ6A 2JKRM 5A93A 3UPNA 1SDEA 4N1HA 1DP8A 2W3FA 1GCEA 4DXCA 2P7JA 1NWZA 1K57A 3UMDA 4Q0JA 2X02A 3MFDA 1K38A 1AWIA 5GHZA 2VGLS 2Q0OA 4UA7A 1ZTUA 3PBTA 5AJGA 2H5SA 2JCHA 3VE4A 4MBKA 3E2LA 5EPHA 5MC7A 3G30A 3JPUA 1TS7A 2ZL1A 3E2KA 3LY3A 1S6RA 1GA0A 1NYYA 4BWIA 1NRFA 3UB5P 3UPOA 5F1FA 2BG1A 3T4KA 3W4PA 2PRFA 1E25A 2O0YA 3WS4A 2P9VA 3IHBA 4LV2A 1I2WA 5K5BA 3A3IA 5HSQA 2V0UA 3EEHA 4O01A 3UB6A 3MF0A 1L2SA 2JC7A 1LI0A 1MBLA 2WGWA 4Z9QA 1HLUP 1V9ZA 3W4QA 5FL3A 2ZJ9A 5KSCA 1K6SA 5DTKA 1IYQA 1GSVA 5DJUA 5DKLA 3P01A 1DJAA 4A5RA 4LFUA 2FZ0A 3CJMA 1F2KA 1VQQA 3MFXA 5CEDA 3GMWA 4JF5A 5CTMA 3HLWA 2QWSA 2VX8A 2NUTC 3E4QA 5HD3A 1E4DA 4OONA 5IT5A 3F1NB 1YMXA 1G5UA 3LEQA 1YLJA 3BY9A 1XJ6A 4PPRA 5A92A 4IUKA 2WZXA 3ZG9B 1W8QA 4WLAA 3IWIA 3Q07A 4KUKA 4RX3A 3PYPA 2DRWA 2Y79A 4EUZA 3OPPA 4CLCD 2JKGA 3IF6B 1ZG6A 2H10A 2Y4AA 5FQIA 1K56A 3VE3A 1D7EA 4EEPA 3JYIA 4UA6A 3R4KA 2ZOIA 3B3XA 4L9FA 3BRMA 2VGLM 3NDGA 1OT9A 1H8ZA 5IS1A 1ESIA 4DDYA 1FIKA 2R9WA 4S2KA 2WKHA 4HBTA 5EVIB 4MLLA 3EEAA 3IBRA 3MR0A 3NOUC 2HDQA 4WF0A 4CQHA 1SKOB 4HOIA 1K57C 5FI7A 1OTDA 5EECA 5LBRA 1LT0A 4DJ2A 4QD4A 5A90A 2V1AA 1FCOA 5DFXA 4E6XA 4GLQA 3GV9A 2XA7S 3F1NA 3MSHA 4HP9A 2LB5A 3NI9A 5A8BA 3IXDA 1ERQA 4Q0HA 3QNCA 3LICA 1D06A 1KGFA 2V9AA
chains in the Genus database with same CATH topology
2JKFA 3T1XA 3U4LP 3L9KA 1CQAA 2B95A 3MS6A 3KYEA 2PBDP 1VEUB 5EM0A 1G5UA 1Y4OA 4ESPA 2V8FA 1AWIA 3LEQA 1CJFA 3T1SA 3D9YA 1VETA 4X1LA 5EVEA 5EV0A 3T1QB 3T1RA 4D60A 3CPTA 2VK3A 5FEGA 2ZL1A 1PFLA 1FILA 2JKGA 2E8JA 3LGOA 2BTFP 5EM1A 1SKOA 3UB5P 1VETB 2PRFA 1PNEA 3CHWP 3DAVA 4X1MA 1PRQA 1FIKA 3NULA 3CPTB 1K0KA 2ZL1B 1CF0A 3L7HA 3T12B 1J3WA 2HZ5A 1A0KA 1HLUP 1SKOB 4FTXA 5FEFA 1SZVA 4FUWA 3NECA 1ACFA 1Z09A 4QWOA 2ACGA 3MSHA 1VEUA 2PAVP 4X25A 5FDSA 1YPRA 1D1JA 2V8CA 1F2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JKF A;  3T1X A;  3U4L P;  3L9K A;  1CQA A;  2B95 A;  3MS6 A;  3KYE A;  2PBD P;  1VEU B;  5EM0 A;  1G5U A;  1Y4O A;  4ESP A;  2V8F A;  1AWI A;  3LEQ A;  1CJF A;  3T1S A;  3D9Y A;  1VET A;  4X1L A;  5EVE A;  5EV0 A;  3T1Q B;  3T1R A;  4D60 A;  3CPT A;  2VK3 A;  5FEG A;  2ZL1 A;  1PFL A;  1FIL A;  2JKG A;  2E8J A;  3LGO A;  2BTF P;  5EM1 A;  1SKO A;  3UB5 P;  1VET B;  2PRF A;  1PNE A;  3CHW P;  3DAV A;  4X1M A;  1PRQ A;  1FIK A;  3NUL A;  3CPT B;  1K0K A;  2ZL1 B;  1CF0 A;  3L7H A;  3T12 B;  1J3W A;  2HZ5 A;  1A0K A;  1HLU P;  1SKO B;  4FTX A;  5FEF A;  1SZV A;  4FUW A;  3NEC A;  1ACF A;  1Z09 A;  4QWO A;  2ACG A;  3MSH A;  1VEU A;  2PAV P;  4X25 A;  5FDS A;  1YPR A;  1D1J A;  2V8C A;  1F2K A; 
#chains in the Genus database with same CATH topology
 4KZ5 A;  5AQ7 A;  2XH9 A;  3P7N A;  2ZOH A;  3G35 A;  5GHX A;  3L9K A;  1L0F A;  4R4R A;  3RH8 B;  1KGG A;  2FFY A;  2ZC7 A;  4DN0 A;  3IF6 A;  5EM0 A;  2IWB A;  4X53 A;  4ZJ1 A;  1U60 A;  3RXW A;  4Y0U A;  4WEK A;  4M4X A;  2WKI A;  2R9X A;  4PHT A;  3CLO A;  1W79 A;  5F83 A;  1VM1 A;  5EVI A;  3HLB A;  4WEJ A;  4YWZ A;  4JGQ A;  1SKO A;  4FSF A;  3IS2 B;  3IQA A;  4ARZ B;  4DXB A;  1ESU A;  4LV1 A;  5HDC A;  2C5W B;  3CMZ A;  1UWN X;  4C6Y A;  3VSK A;  3DAV A;  2VKS A;  4CLC C;  2Y59 A;  3RFB A;  2VLG A;  3Q7Z A;  4JGR A;  5E2G A;  1ERO A;  5AQB A;  2HJE A;  3LFV A;  4KZ6 A;  4JGO A;  5M1A A;  1LL8 A;  4AFI A;  1K6R A;  1JWZ A;  5IHV A;  4HNB A;  3EWK A;  5EVI D;  4KQO A;  1MC0 A;  1MKM A;  2XF3 A;  1HD8 A;  4EUV A;  1FSY A;  1DP6 A;  4P0M A;  3BFE A;  4P6B A;  5FA7 A;  2XEP A;  5EE8 A;  1P9W A;  1O7E A;  2RL3 A;  5D3O A;  2XGN A;  2PDR A;  4JF6 A;  1ES4 A;  3VOZ A;  2W3H A;  5FSR A;  1G68 A;  3A3J A;  4ZRR A;  3SOI A;  3KYQ A;  1XFQ A;  4E3N A;  3ZYT A;  3ZQ5 A;  2EA9 A;  4OPY A;  4UAA A;  3IS2 A;  4HI4 A;  4C75 A;  1S1Y A;  4ARZ A;  3OZH A;  3ZG5 A;  3OLO A;  1L3L A;  3M2J A;  3N4I A;  2PR5 A;  1WA9 A;  4UEY A;  3IX4 A;  3E4P A;  2L4R A;  5HWT A;  1HZO A;  1EI5 A;  2QYB A;  3D3O A;  3UDI A;  5F6A A;  4FD8 A;  4KZB A;  1SCW A;  4ETX A;  4JGP A;  5HL6 A;  1XKZ A;  4E3O A;  1YLT A;  4S2I A;  2A3U A;  2WKR A;  3JVU A;  4O8G A;  3ULF A;  4LPZ A;  1H5X A;  3V3S A;  3DTK A;  5TFQ A;  4S2O A;  5HWV A;  3QP2 A;  4WN5 A;  3IF5 A;  3G4P A;  1S67 L;  1WYC A;  4PMA A;  5HX9 A;  1S66 L;  2JBF A;  3BFC A;  1L0D A;  3HJK A;  4BEN A;  4GCZ A;  2X71 A;  3IF6 C;  4RQ9 A;  1KE3 A;  4EEU A;  2CMN A;  2EWW A;  1K25 A;  2KOI A;  1NRJ A;  2ACG A;  2OOL A;  2YKH A;  1PYY A;  1TS8 A;  5KSH A;  2DNS A;  2ZMA A;  4XXR A;  4E3L A;  2JN7 A;  1V9Y A;  2D02 A;  4ETZ A;  4GDN A;  3VOY A;  5EVI C;  1STZ A;  3QP1 A;  4WYY A;  3T1X A;  4OPQ A;  2WKQ A;  3CWF A;  5M18 A;  1VHM A;  1DJB A;  4HH2 A;  3CG5 A;  4R3A A;  3OOV A;  1PI4 A;  2V20 A;  2GX5 A;  2PBY A;  1ZC2 A;  5CGX A;  2V8F A;  2J9P A;  3H9W A;  3IXB A;  3R7W B;  2ZQD A;  1NZO A;  3P98 A;  3QHY A;  1MZU A;  1PW8 A;  3GSG A;  4QJG A;  3NCK A;  3TSG A;  3RTY A;  1W63 M;  3C4P A;  4EBL A;  3V50 A;  2WUQ A;  4X6T A;  2Y2M A;  3BWL A;  1WYB A;  5DTT A;  2VGJ A;  3O86 A;  1W63 Q;  1QME A;  4HQA A;  2ZC6 B;  2XFS A;  1YLW A;  2W27 A;  1PNE A;  4Y7P A;  4WUJ A;  2QZ6 A;  3N7W A;  2L0W A;  1GHM A;  3NUL A;  5E43 A;  4LEN A;  1JWP A;  4FOF A;  4KZ3 A;  5U47 A;  1ES2 A;  1N9B A;  3W2Z A;  3VP4 A;  3TOI A;  3HVF A;  3T12 B;  1J3W A;  4X55 A;  3SH8 A;  1RGZ A;  4ID4 A;  2HP6 A;  5CGS A;  1LL9 A;  1IKG A;  3B33 A;  2ZQ8 A;  4QWO A;  3MQ0 A;  1BZA A;  2CC1 A;  1LSW A;  3HJI A;  4EBN A;  2XK1 A;  2HDU A;  4N9L A;  4I38 A;  4QU3 A;  3ZNT A;  1W8Y A;  5AVE A;  4X68 A;  3R7W A;  2DCF A;  5FQJ A;  3ITB A;  2JKF A;  1RGY A;  1I2S A;  3I7J A;  1PZP A;  1JTG A;  1NYM A;  1P0Z A;  1LSV A;  4Z1W A;  1PI5 A;  4MNR A;  4IBR A;  2VK3 A;  2ZLY A;  4NG2 A;  4B4X A;  4EWF A;  4I3J A;  4YOF A;  4S2J A;  3VP1 A;  2Y2G A;  3LCE A;  4L0L A;  3UDX A;  2YKF A;  2G7U A;  2HF6 A;  1H8Y A;  3QP8 A;  5DF8 A;  2XSS A;  4U0X A;  3S22 A;  4CLC B;  2Q9M A;  4DE2 A;  5FQ9 A;  2UWX A;  4OOM A;  3GDI A;  3S7P A;  1L0G A;  3H7W B;  1NXY A;  2Y2P A;  3WRT A;  4WL9 A;  3PR6 A;  4ZBE A;  3ZGA B;  2B5R A;  3UDF A;  4HBU A;  4OKP A;  3KSI A;  5EFW A;  3N6I A;  5KZH A;  5F69 A;  2EX9 A;  2C6W B;  5HWW A;  4FUW A;  1PWD A;  3FZC A;  4P6Z M;  5DF9 A;  3LR4 A;  1DJC A;  5HW3 A;  1GSX A;  3D72 A;  4KG5 A;  1SKF A;  4HES A;  1G6A A;  1TF1 A;  5FAP A;  4BL3 A;  1E3U D;  5J3W A;  4B93 A;  3DBA A;  1MWS A;  3ZG0 A;  4BMW A;  4QPR A;  3EGD C;  2Y2K A;  2ZC5 B;  4ME4 A;  5TJJ A;  4KQQ A;  3KYE A;  4EV4 A;  3LUQ A;  4N9K A;  4FH2 A;  3KSF A;  5EVL A;  4CLC A;  1YLY A;  2E8I A;  4IED A;  3FC7 A;  4LV3 A;  3G2Y A;  4X1L A;  5DJT A;  3H7W A;  5TR7 A;  3A3E A;  4BBU A;  3NOT C;  4D60 A;  3WRZ A;  1ZHH B;  4EER A;  1AXB A;  5EM1 A;  2XRO A;  3RXX A;  4KQD A;  4MDZ A;  4YNR A;  3PBS A;  3BQA A;  1Y54 A;  4N92 A;  4UHU A;  1PWC A;  2Y2H A;  3CHW P;  3MZF A;  3KSG A;  5KMW A;  1TDG A;  4K0X A;  3A3F A;  4F94 A;  1BT5 A;  3MKF A;  1T1A A;  4QY5 A;  2L1M A;  3LIA A;  3E98 A;  4Y13 A;  2VV8 A;  3MXQ A;  1SHV A;  1S0W A;  4O7D A;  3VP0 A;  3HUM A;  3NY4 A;  5FAO A;  2J7V A;  3S7N A;  2GDN A;  1BLP A;  4M3K A;  2R78 A;  3TJZ C;  5HDS A;  5HPI A;  3GRJ A;  5HDD A;  1S4S A;  3NOP C;  2WKP A;  2ZM2 A;  2OAP 1;  3UB9 A;  4HJ3 A;  3WS0 A;  3EQV A;  3PHY A;  4R3J A;  2HGV A;  4GZB A;  3PAE A;  5EOE A;  4B4Z A;  1GHI A;  5E2F A;  2H0Y A;  3M6B A;  1K54 A;  4GS9 B;  1X0O A;  3VFH A;  3HCY A;  3M2K A;  4S2L A;  5CER A;  4Q0I A;  3C4O A;  1F5M A;  1FCM A;  3IWQ A;  5GL9 A;  3T1S A;  3DTM A;  5CHJ A;  4JXW A;  4G3W A;  1TEM A;  4OLG A;  3LR5 A;  1RP5 A;  1ONH A;  5FQM A;  3Q1F A;  3CAX A;  4E3I A;  5F1G A;  3ZVW A;  3K3C A;  4GKU A;  3T4T A;  2ZQ7 A;  3JVV A;  1KE0 A;  1JVJ A;  3TRC A;  3T4O A;  2PD7 A;  2V1B A;  5FI2 A;  1OJG A;  3OCN A;  1FCN A;  4XUZ A;  3U2A A;  3CPT B;  3M6H A;  2VEA A;  1IYO A;  4PM5 A;  3DWK A;  4OQG A;  2EXA A;  3OCL A;  3BY8 A;  4KQR A;  1H0M A;  4OQH A;  2O9C A;  5FEF A;  4K91 A;  4BLM A;  2VA0 A;  4HY8 A;  2K31 A;  2HV1 A;  1ACF A;  2P74 A;  5J8X A;  4JBF A;  4EU0 A;  1QMF A;  4GS9 A;  5DF7 A;  3LR3 A;  2PAV P;  4X25 A;  4EBP A;  3EOI A;  2PT7 A;  3IT9 A;  1NY0 A;  4E3M A;  3IXH A;  4GB7 A;  3SS4 A;  1YKD A;  3B47 A;  1CQA A;  2MJ6 A;  4PM6 A;  2W3E A;  3KSH A;  4HEF A;  1T19 A;  3ZG8 B;  1IYS A;  2ZC4 B;  4Y0O A;  1J9M A;  4MMN A;  5FI6 A;  5HZH A;  4LRY C;  3AGF A;  3LID A;  4IVI A;  3O5Y A;  2XD5 A;  3K3D A;  3Q82 A;  1PWG A;  3T4J A;  5HFO A;  4DRT A;  3PAG A;  3ZG7 B;  2ZD8 A;  3LR0 A;  3CPT A;  4X56 A;  2QKP A;  2QJ7 A;  3GR2 A;  5F82 A;  3VSL A;  1PFL A;  2GZA A;  4EET B;  2EXB A;  2BTF P;  3V5M A;  3UN7 A;  5FAT A;  1XJ3 A;  4NET A;  3BFF A;  1ODV A;  5HAR A;  2G2U A;  5FAS A;  2XA7 M;  4PAU A;  3CI6 A;  3KX0 X;  3OC2 A;  1P97 A;  4KUO A;  4LRZ E;  2QPN A;  4OVD A;  1PRQ A;  4MN7 A;  3L7H A;  4JF4 A;  4GN2 A;  2RCX A;  4E3J A;  4G3K A;  4QY6 A;  1TVF A;  1N9L A;  4R1G A;  5TBM B;  1K54 C;  1KGE A;  4C3Q A;  3VP2 A;  3UNW A;  3UPP A;  5CEB A;  1XPB A;  5GHY A;  4F3L B;  1IKI A;  4IBX A;  4R70 A;  3VV4 A;  3QP4 A;  3C2W A;  3C8C A;  3PBQ A;  5CEC A;  3ZCZ A;  4O0P A;  2VJW A;  1UGU A;  1XFN A;  2OLV A;  2Z6C A;  1ALQ A;  3C7V A;  4L9G A;  5GLD A;  1YPR A;  4KZ7 A;  1JNU A;  2Y2O A;  4PKY G;  1GHP A;  4YFM A;  4MBH A;  4OQ0 A;  2OSU A;  4HH3 A;  3LI9 A;  5I94 A;  2WGI A;  3BM6 A;  4DJ3 A;  4FH4 A;  3ZFZ A;  2QJ5 A;  2V2F F;  3FYZ A;  1K4E A;  4DE1 A;  4BL2 A;  2ZM8 A;  3V67 A;  4LCM A;  2W1R A;  5KIZ A;  3E4O A;  2Y2Q A;  5FAQ A;  1IEM A;  4DE3 A;  3FV7 A;  4E6W A;  3G34 A;  3H82 B;  1GA9 A;  3T1Q B;  4FCF A;  5AVF A;  2A24 B;  4Y5F A;  3SS5 A;  4NXF A;  2WYX A;  1DRM A;  1RCJ A;  4EXO A;  1MWU A;  3NDE A;  3VMA A;  1OTI A;  2XDM A;  4I3A A;  5F5Y A;  5HD5 A;  1S1Z A;  2O99 A;  2ZQC A;  4S2M A;  2E8J A;  2P08 A;  1ZKJ A;  3WWX A;  3V39 A;  4P87 A;  5TBM A;  2J3T D;  4Y3I A;  2Z2L B;  3BYD A;  4CLC E;  1O07 A;  4F3L A;  1KOU A;  2Y55 A;  4NXG A;  3LO7 A;  1A0K A;  3MMH A;  2I72 A;  2XQZ A;  1BYW A;  1YLZ A;  4RVA A;  2IA2 A;  3PBN A;  3IX3 A;  3ISG A;  3LIF A;  1F9I A;  4R3B A;  4WBG A;  3DWZ A;  2Y2N A;  5G4Y A;  5FQQ A;  4JPM A;  1FR6 A;  5IU1 A;  1OT6 A;  3UB8 A;  4U3T A;  4OLD A;  4B9O A;  3FPW A;  4R6L A;  2M1C A;  3Q7V B;  4PM7 A;  3TE8 A;  4MBF A;  5TGF A;  2V1Z A;  1K4F A;  3T4L A;  1YAX A;  3H82 A;  2J80 A;  3WS2 A;  5CTN A;  1LI9 A;  4GOG A;  2A24 A;  3HBR A;  2JHE A;  1GSW A;  3NBL A;  4Q8I A;  5E2E A;  3MXS A;  4BD1 A;  3MS6 A;  2O9B A;  1Y4O A;  4IUH A;  4NEE D;  1XA7 A;  4GNU A;  4Y15 A;  1LL5 A;  3AGE A;  1FR1 A;  4CJN A;  4JXS A;  1MWR A;  4OP8 A;  2HDS A;  5DKK A;  1MPL A;  2M7V A;  1PW1 A;  1MKI A;  2KX6 A;  4I5S A;  2HP9 A;  5HAP A;  3SW1 A;  4MEZ A;  2G2W A;  3TG9 A;  3WS1 A;  2OV5 A;  1N9O A;  3MZD A;  1OTA A;  4K0W A;  5CX7 A;  2V0W A;  4II7 A;  3BFD A;  1OME A;  4NKP A;  5JYO A;  4BJP A;  1IOU A;  1PIO A;  4HP4 A;  2HPB A;  3UE6 A;  3Q7V A;  1OPX A;  1ONG A;  2J3T C;  4NK3 A;  1LSX A;  4GW9 A;  3GEC A;  1E3U A;  5CGW A;  3K2N A;  1XX2 A;  2H28 A;  5A91 A;  1TD5 A;  1W7F A;  1XJ2 A;  3QP6 A;  4EQI A;  1PZO A;  2BAS A;  4PM8 A;  2XD1 A;  3F1P B;  1I5Q A;  3FKV A;  1D1J A;  3ZVT A;  2PU2 A;  1YSP A;  1ERM A;  2D01 A;  2WAE A;  3IXG A;  4R23 A;  3A0R A;  3MBZ A;  3MJQ A;  2WZZ A;  5FDH A;  4L9E A;  1XGI A;  5L10 A;  1T18 A;  4EES A;  5DVA A;  1ZG4 A;  4LLO B;  4OPR A;  2X01 A;  2M7U A;  5GLA A;  3D9Y A;  3MZE A;  3GQZ A;  4DDS A;  1BUL A;  1TS6 A;  1L0E A;  2JE5 A;  2ZQA A;  2ZBB A;  3NHQ A;  5G4Z A;  1CEG A;  2H0T A;  4OQI A;  3OPL A;  3BJN A;  3FWL A;  2HP5 A;  2JKT I;  4PM9 A;  2EX6 A;  2HDR A;  4ZTK A;  5HAI A;  1VET B;  2GNX A;  3ICY A;  3LEZ A;  3ZHH A;  2PHY A;  5L8M A;  3C30 A;  3HUN A;  3T4S A;  2QHK A;  2WAF A;  3C7U A;  2B18 A;  2XR0 A;  4KZ8 A;  3PBO A;  3ITA A;  3BEC A;  3F1P A;  3RJU A;  4B88 A;  3NJA A;  1XXM A;  5E2H A;  3HUO A;  3BFG A;  4EW7 A;  3W8K A;  2PYP A;  3G2Z A;  1H3Q A;  4LRX C;  3WS5 A;  1MWT A;  1NLZ A;  3NEC A;  4BBV A;  1Z09 A;  4QHC A;  4LV0 A;  5L07 A;  1N4O A;  4OOL A;  3O3V A;  4N1X A;  4UA9 A;  1KE4 A;  2W3D A;  5J4E A;  2K7S A;  3MXR A;  2IWD A;  4GJ4 A;  2Q9N A;  4OPZ A;  3UY6 A;  5JYP A;  4KZ4 A;  3CUE A;  3LIE A;  1Q2P A;  2EFX A;  4QB8 A;  5CRF A;  4MCW A;  4WMC A;  5CHU A;  4H6J B;  3IX8 A;  1MY8 A;  2A2L A;  1VET A;  5CHM A;  3DW0 A;  1K55 A;  1M6K A;  2UV0 E;  3BEB A;  4BQM A;  3LGO A;  1Z6F A;  1UWP X;  4NXE A;  1G28 A;  1BLS A;  3QP5 A;  3IH9 A;  3HLF A;  1YMS A;  2JKT M;  4HIA A;  4X69 A;  1SDN A;  4X1M A;  4ZJ3 A;  4WMC D;  3SH7 A;  1ES3 A;  3IBJ A;  3KYZ A;  3HLD A;  1K56 D;  1FSW A;  2HJ9 C;  3ZNY A;  1BTL A;  5GLC A;  2W3G A;  1CF0 A;  3S7O A;  1CI9 A;  2AVX A;  5EOO A;  2PYR A;  2HZ5 A;  4GDB A;  3SS3 A;  2KLI A;  1FOF A;  1SZV A;  3LY4 A;  1YLP A;  3C5A A;  4DMZ A;  4GHI B;  1G6O A;  4WZ5 A;  2I9V A;  3DTE A;  3D4F A;  1Y28 A;  2OAQ 1;  1BUE A;  5F68 A;  3IHA A;  3MQO A;  5I5L A;  4ZAM A;  2LB9 A;  3S7Q A;  2OLU A;  3PXP A;  3VP3 A;  4H6J A;  2Z2M B;  4CPK A;  3TW8 A;  4RX2 A;  4DKI A;  2VV6 A;  3U4L P;  1S4R A;  1CEF A;  1TS0 A;  2ZMV A;  3N8R A;  3O87 A;  2PBD P;  2W1T B;  3CZD A;  2OWJ A;  4ESP A;  1T1B A;  4KG2 A;  3G31 A;  4BBT A;  3A3D A;  3EQU A;  4U0T A;  3UB7 A;  3QNB A;  1CJF A;  1XJ4 A;  4DE0 A;  4DF6 A;  2A49 A;  1DP9 A;  2BLS A;  3IH8 A;  1KDW A;  1P9R A;  3GVB A;  2QMI A;  5FEG A;  4JLF A;  1IEL A;  1YM1 A;  2ZM0 A;  3T50 A;  3GTC A;  5HAQ A;  3C38 A;  3FKW A;  2VV7 A;  1HTZ A;  2KDK A;  2WGV A;  4S2P A;  2ZQ9 A;  1NZU A;  4GHI A;  2GJ3 A;  1JWV A;  2WAD A;  4S2N A;  3AGD A;  3BW6 A;  4HJ4 A;  3BLM A;  4WZ4 A;  3OPH A;  5EUA A;  1K0K A;  2OWH A;  4ZJ2 A;  4UQI S;  1DY6 A;  2IWC A;  3F1O B;  3HLE A;  3S1Y A;  3UME A;  3CUE C;  4YIN A;  4WM9 A;  5L09 A;  1BLC A;  2P04 A;  3V3R A;  3VOL A;  4GD8 A;  4OP5 A;  3SZT A;  4H8R A;  3OPR A;  1C3B A;  3MQQ A;  1BLH A;  1N9N A;  2W1T A;  2Y2J A;  4I39 A;  3W4O A;  1EWZ A;  1K55 C;  4JXV A;  2Y2L A;  4WEL A;  1FQG A;  3HLG A;  5DTS A;  1OTB A;  4Y17 A;  3N8L A;  2EX8 A;  1IFQ A;  4G3V A;  4LCL A;  2FH5 A;  4MN6 A;  4NXB A;  1OJ5 A;  4KEN B;  5HPF A;  5DFY A;  4PKY A;  5CXW A;  3O88 A;  1VEU B;  2Y91 A;  1HVB A;  4IVK A;  3UE1 A;  3A0S A;  2WK0 A;  3FPV A;  3KO6 A;  2PD8 A;  4BD0 A;  4KG6 A;  4RYE A;  1XGJ A;  1CI8 A;  2J8Y A;  4R4S A;  2Y2I A;  1VB6 A;  3LI8 A;  3DTI A;  4XT2 B;  3T1R A;  5AQ9 A;  1YSQ A;  1EW0 A;  5GLB A;  4LGW A;  3UO9 A;  4WZ5 C;  3MKE A;  2K2N A;  3F1O A;  2B02 A;  3EGX C;  2EX2 A;  2PR6 A;  1MXO A;  3N8S A;  4K08 A;  4XUX A;  2EWV A;  4HHD A;  3LYX A;  4RA7 A;  1KVL A;  3NIA A;  2J3W A;  2WKE A;  3HLC A;  4E3K A;  2XFT A;  3NC8 A;  3P09 A;  1T1C A;  3PBR A;  2ZC3 B;  4KZA A;  4IHQ A;  5M19 A;  5BOH A;  4FTX A;  4MN5 A;  1BSG A;  3S4X A;  1XP4 A;  2W0N A;  2Z6D A;  4R38 A;  1WE4 A;  3FG8 A;  5J7E A;  1KDS A;  5G18 A;  1W5D A;  2FFF B;  1VEU A;  1Q2Q A;  3T4Q A;  4IJG A;  2JKR I;  4JXG A;  4P85 A;  3G32 A;  4E04 A;  3ZDJ A;  4UQI M;  2PU4 A;  2EFU A;  4GD6 A;  5AQA A;  4XT2 A;  4EQ1 A;  2Y8H A;  3BLS A;  2B95 A;  1NJ4 A;  4S2N C;  4P6Z S;  1H8M A;  3Q81 A;  2NUP C;  2J9O A;  3E0Y A;  1F98 A;  1JTD A;  3PTE A;  1XA1 A;  3LIB A;  1OTE A;  4R0Q A;  5FQK A;  3UE3 A;  2ZMF A;  4KZ9 A;  3VFF A;  5EVE A;  5L2F A;  5EV0 A;  1TDL A;  3CIT A;  3IWO A;  1IYP A;  2XRN A;  5C5K A;  1NLY A;  2XLN A;  1ES5 A;  1FIL A;  4OOY A;  2INW A;  1CK3 A;  2VZW A;  1YT4 A;  3B42 A;  2VGK A;  2ZL1 B;  3A0V A;  4D2O A;  1LLB A;  3UE0 A;  5HL1 A;  3HRE A;  4ZDX A;  4OH0 A;  2P9V B;  4Y0T A;  3BQ8 A;  1YQS A;  4I3I A;  4Y2F A;  1M40 A;  3HL9 A;  3OBF A;  1LHY A;  2DMW A;  3G6O A;  2WGW B;  5FDS A;  3SH9 A;  2V8C A;  2O9A A;  4JKT A;  1KVM A;  4HJ6 A;  2JKR M;  5A93 A;  3UPN A;  1SDE A;  4N1H A;  1DP8 A;  2W3F A;  1GCE A;  4DXC A;  2P7J A;  1NWZ A;  1K57 A;  3UMD A;  4Q0J A;  2X02 A;  3MFD A;  1K38 A;  1AWI A;  5GHZ A;  2VGL S;  2Q0O A;  4UA7 A;  1ZTU A;  3PBT A;  5AJG A;  2H5S A;  2JCH A;  3VE4 A;  4MBK A;  3E2L A;  5EPH A;  5MC7 A;  3G30 A;  3JPU A;  1TS7 A;  2ZL1 A;  3E2K A;  3LY3 A;  1S6R A;  1GA0 A;  1NYY A;  4BWI A;  1NRF A;  3UB5 P;  3UPO A;  5F1F A;  2BG1 A;  3T4K A;  3W4P A;  2PRF A;  1E25 A;  2O0Y A;  3WS4 A;  2P9V A;  3IHB A;  4LV2 A;  1I2W A;  5K5B A;  3A3I A;  5HSQ A;  2V0U A;  3EEH A;  4O01 A;  3UB6 A;  3MF0 A;  1L2S A;  2JC7 A;  1LI0 A;  1MBL A;  2WGW A;  4Z9Q A;  1HLU P;  1V9Z A;  3W4Q A;  5FL3 A;  2ZJ9 A;  5KSC A;  1K6S A;  5DTK A;  1IYQ A;  1GSV A;  5DJU A;  5DKL A;  3P01 A;  1DJA A;  4A5R A;  4LFU A;  2FZ0 A;  3CJM A;  1F2K A;  1VQQ A;  3MFX A;  5CED A;  3GMW A;  4JF5 A;  5CTM A;  3HLW A;  2QWS A;  2VX8 A;  2NUT C;  3E4Q A;  5HD3 A;  1E4D A;  4OON A;  5IT5 A;  3F1N B;  1YMX A;  1G5U A;  3LEQ A;  1YLJ A;  3BY9 A;  1XJ6 A;  4PPR A;  5A92 A;  4IUK A;  2WZX A;  3ZG9 B;  1W8Q A;  4WLA A;  3IWI A;  3Q07 A;  4KUK A;  4RX3 A;  3PYP A;  2DRW A;  2Y79 A;  4EUZ A;  3OPP A;  4CLC D;  2JKG A;  3IF6 B;  1ZG6 A;  2H10 A;  2Y4A A;  5FQI A;  1K56 A;  3VE3 A;  1D7E A;  4EEP A;  3JYI A;  4UA6 A;  3R4K A;  2ZOI A;  3B3X A;  4L9F A;  3BRM A;  2VGL M;  3NDG A;  1OT9 A;  1H8Z A;  5IS1 A;  1ESI A;  4DDY A;  1FIK A;  2R9W A;  4S2K A;  2WKH A;  4HBT A;  5EVI B;  4MLL A;  3EEA A;  3IBR A;  3MR0 A;  3NOU C;  2HDQ A;  4WF0 A;  4CQH A;  1SKO B;  4HOI A;  1K57 C;  5FI7 A;  1OTD A;  5EEC A;  5LBR A;  1LT0 A;  4DJ2 A;  4QD4 A;  5A90 A;  2V1A A;  1FCO A;  5DFX A;  4E6X A;  4GLQ A;  3GV9 A;  2XA7 S;  3F1N A;  3MSH A;  4HP9 A;  2LB5 A;  3NI9 A;  5A8B A;  3IXD A;  1ERQ A;  4Q0H A;  3QNC A;  3LIC A;  1D06 A;  1KGF A;  2V9A A; 
#chains in the Genus database with same CATH homology
 2JKF A;  3T1X A;  3U4L P;  3L9K A;  1CQA A;  2B95 A;  3MS6 A;  3KYE A;  2PBD P;  1VEU B;  5EM0 A;  1G5U A;  1Y4O A;  4ESP A;  2V8F A;  1AWI A;  3LEQ A;  1CJF A;  3T1S A;  3D9Y A;  1VET A;  4X1L A;  5EVE A;  5EV0 A;  3T1Q B;  3T1R A;  4D60 A;  3CPT A;  2VK3 A;  5FEG A;  2ZL1 A;  1PFL A;  1FIL A;  2JKG A;  2E8J A;  3LGO A;  2BTF P;  5EM1 A;  1SKO A;  3UB5 P;  1VET B;  2PRF A;  1PNE A;  3CHW P;  3DAV A;  4X1M A;  1PRQ A;  1FIK A;  3NUL A;  3CPT B;  1K0K A;  2ZL1 B;  1CF0 A;  3L7H A;  3T12 B;  1J3W A;  2HZ5 A;  1A0K A;  1HLU P;  1SKO B;  4FTX A;  5FEF A;  1SZV A;  4FUW A;  3NEC A;  1ACF A;  1Z09 A;  4QWO A;  2ACG A;  3MSH A;  1VEU A;  2PAV P;  4X25 A;  5FDS A;  1YPR A;  1D1J A;  2V8C A;  1F2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...