4ESPA

Crystal structure of peanut allergen ara h 5
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
130
structure length
130
Chain Sequence
SWQTYVDDHLLCEIEGNHLSSAAILGQDGSVWAQSSNFPQFKPEEITAIMNDFAEPGSLAPTGLYLGGTKYMVIQGEPGTVIRGKKGPGGVTIKKTNQALIIGIYDEPMTPGQCNMIVEKLGDYLIDTGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Peanut ( Arachis hypogaea ) Allergen Ara h 5.
pubmed doi rcsb
source organism Arachis hypogaea
molecule tags Allergen
molecule keywords Profilin
total genus 39
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2012-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4espA00
1K0KA 2JKGA 2PRFA 2ACGA 2E8JA 3CPTA 3T1QB 1Y4OA 3NULA 2VK3A 2PAVP 1HLUP 2B95A 4D60A 1A0KA 5EV0A 1Z09A 1PRQA 2V8CA 3DAVA 1PNEA 4X1LA 3L7HA 2PBDP 3NECA 3U4LP 5EM0A 1F2KA 5EM1A 3MS6A 5FEFA 1CJFA 1FIKA 1VEUA 2ZL1A 2ZL1B 3L9KA 1D1JA 3D9YA 1ACFA 3MSHA 2BTFP 4FUWA 4ESPA 4X1MA 1SKOB 1VETB 3CHWP 1PFLA 2JKFA 5EVEA 5FDSA 3UB5P 1G5UA 3T1SA 1YPRA 2V8FA 1VEUB 3T1XA 3CPTB 3T12B 1FILA 1SZVA 1CQAA 1SKOA 1CF0A 1VETA 2HZ5A 4QWOA 3T1RA 3LGOA 1J3WA 3LEQA 5FEGA 4X25A 4FTXA 3KYEA 1AWIA
chains in the Genus database with same CATH superfamily
1ODVA 1XP4A 4RQ9A 2EA9A 2WKQA 2QHKA 1NLYA 4Z9QA 5DKKA 5F69A 5L07A 2VV6A 2H28A 4IUKA 3FKWA 4UAAA 4U0XA 1W8QA 4JXGA 3F1OA 2A24A 5J4EA 3KSIA 3NDGA 4DDSA 5EV0A 3KYZA 3UB6A 1AXBA 3HLBA 3LEZA 3HJKA 4X53A 4DE2A 4C75A 4L9EA 1D06A 3MXSA 2XROA 4MNRA 2PD7A 3WS2A 5CERA 3BJNA 5EVID 4U0TA 3MMHA 3T1RA 1LL5A 1QMFA 4BBUA 3N8SA 4DF6A 2IWBA 4AFIA 4LV2A 3C7VA 3SS4A 1ERQA 3VSKA 1MY8A 2ZM2A 2OWJA 4I38A 2WGWA 5FQ9A 3IXBA 4JF4A 2NUPC 3G31A 1L0EA 5L2FA 1JWVA 2XD1A 3S22A 3CZDA 3PR6A 4QWOA 5L10A 1L0GA 3IS2A 3V5MA 3SW1A 4EQIA 3V3RA 2OV5A 3SH9A 3NI9A 3Q7ZA 3OBFA 4LFUA 5CGXA 3HUMA 4LENA 5TBMA 5BOHA 3T4QA 4EBNA 2X02A 2HV1A 1NZOA 2A49A 1PWGA 1KE4A 3LYXA 3D72A 1NLZA 3MFDA 3H82B 1FCMA 3DW0A 1MC0A 5AVEA 3MR0A 5CXWA 3EOIA 4UA7A 1I2WA 4LV0A 2AVXA 3UE0A 3QP8A 3T4SA 3IF6C 4BWIA 3MSHA 3IWIA 3H7WB 1XFQA 3IXHA 3FG8A 4YWZA 2HDSA 2Y79A 4II7A 5HARA 3UY6A 2EXAA 4KQQA 3CMZA 1LI0A 3VSLA 2PAVP 4ARZA 4BENA 1ONGA 2XH9A 3MJQA 2J8YA 3MZFA 4N9LA 3VFHA 5FEFA 1CI8A 3M6BA 4L9FA 5CGSA 3V50A 1BLPA 3DTMA 4E3OA 3S7NA 1W8YA 3HUOA 2VGLM 1GSXA 1KGFA 4KZ5A 1YLJA 1BUEA 1YLWA 5FA7A 4ZJ2A 4KZ7A 4WN5A 1TS6A 4EXOA 5E43A 4DXBA 2L1MA 3FV7A 3ZHHA 5KZHA 1F98A 5FQMA 2IWDA 5E2EA 3VP3A 1QMEA 4NEED 1TF1A 2VKSA 4DE3A 3QP5A 1WYCA 1H5XA 2Y2JA 4R0QA 4R4RA 1P9WA 1XXMA 2DRWA 1PRQA 2QJ5A 1ZG6A 3FWLA 4OVDA 4OPZA 3IX4A 1D7EA 2FZ0A 3EQUA 1OMEA 1XJ6A 1CI9A 2JN7A 3BY9A 3LI8A 4WEKA 1S1ZA 3G35A 4FOFA 4JXWA 1JNUA 1G6OA 5FI2A 2ACGA 1VM1A 4O01A 3BYDA 2PYPA 2Y55A 3DTIA 2Y2GA 3ZDJA 4Y0UA 1KGEA 1YQSA 5HAPA 2O0YA 4OOMA 2VV8A 2M1CA 3A3DA 3UB7A 3VE3A 4S2NA 3HUNA 3OOVA 1L0FA 3RXWA 4EUZA 1NY0A 1YKDA 4QPRA 1TVFA 3KYEA 3A3EA 4IBXA 5HD3A 1K25A 4ZJ3A 5J7EA 3VOYA 3HL9A 2Y91A 3UDXA 2B5RA 5G4YA 5EUAA 2B18A 5EVIB 3AGFA 4QY6A 3HLEA 2W3FA 5FSRA 4IVIA 3PBSA 2VLGA 3BFEA 3IXDA 1DY6A 4OLGA 2PHYA 3LR4A 1VETB 1ZC2A 5A92A 2DCFA 1BULA 1MWUA 3OZHA 5EOEA 1J3WA 4FTXA 1AWIA 2JKGA 1I5QA 4EESA 5A90A 1W7FA 2Z6CA 4P87A 5G4ZA 1EROA 3MXRA 4NXFA 4JLFA 4S2OA 2H5SA 3HREA 2BG1A 3I7JA 2OOLA 4OONA 3HVFA 3NOPC 4KZ6A 5HWVA 4EETB 2LB5A 4HBUA 3VP1A 1WE4A 5M18A 3IF6B 4H8RA 3C5AA 3OC2A 2PYRA 2ZQ9A 4NXBA 4WLAA 1G28A 3GRJA 1SKOA 4FCFA 4GN2A 3BWLA 2I9VA 3Q1FA 4Q8IA 2V20A 1E4DA 3WRTA 2EFXA 4B4XA 1RGZA 4XT2B 3VP0A 3IBRA 3BLSA 1YMXA 4G3WA 1OT9A 5FDSA 4G3KA 2OWHA 4BQMA 3C8CA 4I3AA 4K08A 1J9MA 4I39A 3BY8A 4CLCD 3T1QB 3DBAA 2W0NA 4GOGA 4ARZB 3NY4A 1DRMA 3PBRA 4NK3A 3BW6A 1FOFA 3IXGA 4UA6A 5AVFA 2G2UA 3TSGA 3OCLA 1BLSA 3DTKA 1O07A 1PW8A 2V1BA 4DKIA 2W27A 1K57A 1UWPX 2HP9A 1IKIA 3W8KA 3DWZA 1PI5A 4NG2A 5HD5A 2W3GA 3TW8A 4ME4A 1H0MA 2GJ3A 1RGYA 2Y2NA 3ZCZA 2V1ZA 2W3EA 2GNXA 4E6WA 3A3IA 3TG9A 4HJ4A 2Y4AA 2KLIA 4LCLA 4HNBA 3V67A 4HI4A 4ZAMA 3MS6A 4WUJA 2ZD8A 4G3VA 2OSUA 4PHTA 3G2YA 1OTAA 2R9XA 1LL8A 4GD6A 5TFQA 3UB8A 4H6JB 1BLCA 2JKRM 2E8IA 1KE0A 3NCKA 5GLCA 5CX7A 3QP4A 4CPKA 1PFLA 4I3JA 5IU1A 3HCYA 3G6OA 4OKPA 4S2KA 2PDRA 3FPWA 3A3JA 4OPRA 3SH8A 3T4LA 2QWSA 2DNSA 5CHUA 1CEGA 3R4KA 4EU0A 4RA7A 2HJEA 4PM7A 1N9NA 3WWXA 4E3NA 1EI5A 4IUHA 1K54C 3ZYTA 3IHBA 5FQQA 2JHEA 3DWKA 1H8YA 2E8JA 3HLFA 1KVLA 3ITBA 4LPZA 2FFYA 1OTBA 5CRFA 2EWWA 3Q81A 2QPNA 4MMNA 4EV4A 3CAXA 3P7NA 1F9IA 1EWZA 4S2JA 1DP9A 3IX3A 3CG5A 1MWTA 2HJ9C 2OAQ1 3H9WA 2R9WA 1TS7A 2VX8A 4NKPA 4X55A 1FSYA 1LI9A 5F83A 1SCWA 5EPHA 2VEAA 1MWSA 3NOUC 5EVEA 4LLOB 2IA2A 2R78A 4CLCB 4JF5A 3GMWA 3BECA 1T1AA 4HP9A 4N1HA 2EWVA 2XEPA 4OPQA 3TRCA 1FIKA 2CC1A 2Y2QA 2WKPA 3IF6A 2Y2IA 3EGXC 4XXRA 1XA7A 1K55C 1LSVA 3EEHA 5DFYA 3UB9A 1KVMA 3MKFA 4E04A 4KUOA 3M2KA 2X01A 3UNWA 2WZZA 1K0KA 2OLVA 1SDNA 4QJGA 1DP6A 3FKVA 3IWOA 5JYOA 1Y54A 2GX5A 1ES3A 3N7WA 5EVLA 1STZA 3U4LP 2BASA 2HP6A 1F2KA 1BT5A 3C2WA 1NRFA 4CLCC 1DJCA 4KG6A 4P0MA 4RYEA 2P9VA 2M7UA 4JGPA 2V2FF 5IT5A 5CHMA 3IH9A 3E4QA 4OQIA 1T19A 1KE3A 4KZAA 4GLQA 1PNEA 4QY5A 3Q7VA 4LV3A 3NECA 4C3QA 2P9VB 2Q9NA 5F68A 2MJ6A 3GR2A 3LR3A 4MCWA 1CEFA 4R38A 3C38A 3CPTB 4IJGA 3LO7A 3OPHA 3P98A 1PW1A 4ESPA 4GJ4A 2PT7A 2VK3A 2XD5A 3QNBA 4MLLA 4R70A 5EVIC 3MXQA 4GS9A 4DJ2A 5EE8A 4JXSA 5FQKA 4S2LA 4MBFA 4FD8A 4WZ5A 4EW7A 1YPRA 3MBZA 2ZC6B 4JXVA 1XJ3A 3VMAA 1GSWA 2V0WA 2Z2MB 4JGQA 4BJPA 3IQAA 1S66L 1XKZA 4KQDA 4JKTA 4Y2FA 1GCEA 1W5DA 4OQHA 1VEUB 1CF0A 3ZNYA 4Y0TA 3ZFZA 2ZQ7A 1N4OA 3E2KA 4B93A 2B95A 2JCHA 2V8CA 1NJ4A 1Q2QA 4B9OA 1W79A 3HLGA 4DDYA 1BYWA 3PBQA 3MZDA 5L8MA 3Q82A 1E3UA 4IBRA 3PBOA 5CGWA 2PBYA 3D4FA 2KDKA 4JBFA 3IBJA 2O9BA 2J80A 4KENB 1OJGA 3T4TA 5GLAA 4X56A 1HZOA 4HOIA 4GCZA 4FUWA 2BTFP 3AGEA 4KZBA 4GZBA 1SZVA 3NBLA 4YINA 3WRZA 1YM1A 3QP6A 5M1AA 1PWCA 3CLOA 2W1TB 2G7UA 4OQ0A 2P08A 3NDEA 2P7JA 5J3WA 1C3BA 1H8ZA 4P6ZS 1E25A 2HF6A 4M3KA 3QP1A 3V3SA 1SKFA 4QB8A 3A0RA 4I5SA 3ZG5A 3SS5A 3ZNTA 1XFNA 1P9RA 1HVBA 1SHVA 2P04A 4GW9A 5J8XA 1MWRA 3SH7A 4JF6A 3E2LA 4BD0A 5AJGA 1IYOA 1NWZA 3VV4A 3RTYA 4S2PA 2ZOHA 2WAFA 3F1NB 2V8FA 4KZ8A 2HDRA 1XJ2A 4Y3IA 4Q0HA 3E4OA 5CEBA 3AGDA 2L4RA 4YFMA 1S4RA 4CLCA 5FASA 2Y2MA 4HQAA 2XRNA 2ZL1B 3VP4A 1MZUA 4BL3A 2ZBBA 4OOLA 2XGNA 4LCMA 3VP2A 5CTNA 4XUZA 4DMZA 5HDSA 2VGLS 2WK0A 3N4IA 3C30A 2ZMFA 1FR6A 4HH2A 1WA9A 2DMWA 4B88A 3CHWP 5HZHA 1S67L 4ETZA 4DE0A 1WYBA 4HIAA 1ZHHB 3UDFA 1FQGA 5E2FA 4NETA 3F1PB 2L0WA 3O87A 4EBPA 4HBTA 3LI9A 1NYMA 5DVAA 3VOZA 1PIOA 1ACFA 3E4PA 4JGOA 5A93A 3NIAA 2WGWB 1BTLA 2O9AA 5E2GA 4XUXA 1I2SA 4MDZA 1FSWA 1O7EA 3UMEA 3UPNA 4WF0A 3QNCA 5A8BA 1Z09A 5HAIA 4F3LA 1K57C 2XLNA 2ZL1A 4QHCA 2HDUA 3Q7VB 5I94A 4LRXC 4MBHA 3GVBA 2Z6DA 5HW3A 4H6JA 5CTMA 3CUEC 4Q0IA 5HAQA 4D60A 4EUVA 5HFOA 2K2NA 1F5MA 3Q07A 1GHMA 1SKOB 4GDBA 2ZLYA 4MN5A 2EX9A 2RCXA 5MC7A 2PU2A 4S2MA 2J3TC 1FCOA 4E6XA 4HY8A 5DKLA 1CK3A 5HL6A 3M2JA 2JC7A 5E2HA 3G30A 4E3JA 2INWA 2W3DA 3E0YA 4K0WA 5A91A 3T4OA 3TJZC 4JGRA 5EECA 2Y2HA 1ESIA 1YMSA 3T1SA 2D02A 2Y2KA 1MPLA 1XA1A 4OH0A 1IOUA 4KZ3A 2A2LA 1ONHA 3ZVTA 1TD5A 3O5YA 2H10A 1K56D 4BBVA 1TS8A 2VA0A 5JYPA 1M6KA 3BLMA 5DJTA 2W3HA 5HPFA 1VETA 3UE6A 4NXEA 2WYXA 3JPUA 4Y17A 1XPBA 4L0LA 1YT4A 3G34A 1VEUA 4KQRA 3ZG8B 4GHIA 4RX3A 3T12B 2ZM8A 4BL2A 4CLCE 1KDWA 1LT0A 2ZJ9A 4DE1A 5FAQA 2JKTI 5DTTA 4EWFA 3JVUA 3HLDA 1YAXA 2VGJA 5FI6A 2W1RA 3S7QA 1YLTA 4WEJA 5EFWA 4GD8A 4EEUA 1BZAA 4PM8A 2CMNA 5D3OA 1XJ4A 3CITA 3C7UA 5HL1A 1OPXA 2ZC4B 4KUKA 5IHVA 5TBMB 4YOFA 3IF5A 1BLHA 1MXOA 4BD1A 3F1NA 1Y28A 4OP8A 1T18A 3SZTA 5GHZA 5EM0A 3NJAA 2V1AA 3C4PA 3MKEA 4EBLA 4N1XA 1OTDA 1PYYA 3HLCA 5F1FA 2C5WB 2XR0A 3LY3A 3VFFA 1HLUP 3EQVA 3BFFA 2B02A 1S4SA 3GTCA 4KZ4A 3KX0X 4A5RA 3GQZA 4PKYG 5M19A 1GA9A 2HP5A 1T1BA 1KDSA 2KX6A 1G6AA 4RX2A 1Y4OA 4U3TA 3LIBA 4WMCD 4MN7A 3DAVA 5FAOA 1S1YA 2WKEA 1PWDA 3IHAA 2ZOIA 3S7OA 1K6RA 3C4OA 3IWQA 1P0ZA 1JVJA 3RH8B 2QKPA 1T1CA 1DJAA 3QP2A 4ID4A 4OP5A 5FL3A 3GSGA 3T4JA 1OT6A 3WS5A 5DJUA 5L09A 2VGKA 2QJ7A 1OJ5A 4WYYA 5CECA 5EVIA 2Y2OA 5EM1A 3K3DA 1G5UA 3QHYA 2HZ5A 4KZ9A 1FR1A 3PBTA 5EOOA 2V0UA 3LGOA 5GLBA 3NULA 4QD4A 1SDEA 1K38A 3KSGA 3PTEA 3TE8A 3PAGA 4GKUA 1YLZA 3LFVA 3D3OA 3E98A 3L9KA 3LICA 4WZ4A 3A3FA 4WM9A 5K5BA 5KSCA 1KGGA 4MBKA 4ZBEA 2M7VA 3BFCA 4YNRA 5FEGA 2XA7M 4PM6A 4ZRRA 3S4XA 3ZVWA 3B47A 2EX6A 4ZDXA 4CQHA 1TEMA 5GL9A 3MZEA 3M6HA 1K4EA 2XK1A 4C6YA 1ALQA 1X0OA 2QYBA 3SS3A 1IELA 4DN0A 3ZG7B 3UPPA 1IYSA 5DF7A 2H0YA 1UWNX 3ISGA 2EXBA 4IVKA 4R3AA 4R6LA 2IWCA 3NC8A 3OPRA 3HBRA 2PR6A 2YKFA 5TR7A 2BLSA 3EGDC 1D1JA 4M4XA 2J9PA 3WS4A 3MQ0A 4UA9A 2ZQCA 4Q0JA 2Y59A 4WBGA 1ZTUA 3FPVA 1K54A 1LL9A 1MKIA 4WZ5C 1Q2PA 2O9CA 2P74A 3GV9A 4XT2A 1ES5A 1XGIA 2ZQDA 4X69A 4X1LA 3L7HA 5KMWA 2O99A 4ZTKA 1K6SA 3PBNA 4Z1WA 1VB6A 4Y13A 4R4SA 2H0TA 3ICYA 4N92A 2K7SA 4DRTA 3ZG0A 1ES4A 3RJUA 4Y0OA 2VV7A 3EEAA 3W4OA 3KYQA 3K3CA 3FZCA 5HX9A 5TGFA 5AQBA 4PMAA 5F6AA 2OAP1 4PM9A 3JYIA 3B3XA 3D9YA 2A3UA 3P09A 3S7PA 2ZQAA 2WADA 3CUEA 4EERA 1GHIA 4HJ6A 5AQ7A 4L9GA 4R23A 2QMIA 4PAUA 5IS1A 3LCEA 4LRZE 3BQAA 2G2WA 3LUQA 4I3IA 3UMDA 3A0SA 5GHXA 2UV0E 1JWZA 4E3LA 1L0DA 4Y7PA 4HJ3A 4S2NC 1TS0A 2W1TA 1IYPA 4HHDA 2ZC3B 3IH8A 4BBTA 1CJFA 5CEDA 4CJNA 1GSVA 4KG5A 4EEPA 3W2ZA 1YLYA 1YSQA 2WKHA 3MQOA 3LR5A 4O7DA 2WKRA 3KSHA 3LEQA 1EW0A 2JBFA 4HEFA 4PPRA 3G4PA 1JTDA 2FH5A 1L3LA 2FFFB 1S0WA 2XF3A 5FAPA 3UDIA 3W4QA 4BLMA 1S6RA 3RXXA 1YSPA 4GS9B 4Y5FA 4GNUA 2HDQA 5HDDA 2WAEA 4BMWA 1U60A 2RL3A 1PZOA 3CPTA 3U2AA 4F3LB 1LSXA 3G2ZA 1DJBA 3UO9A 2XFTA 5DTSA 2EX8A 4OOYA 1N9OA 2WGVA 3BQ8A 3LR0A 4QU3A 4F94A 4PM5A 4LRYC 2NUTC 3RFBA 2ZM0A 5TJJA 1DP8A 3S1YA 2C6WB 3F1OB 1JWPA 4B4ZA 1XX2A 4P6BA 5KIZA 4GB7A 1MBLA 4FSFA 4IHQA 3T50A 3IT9A 3GECA 3BRMA 5DF8A 3LIAA 5U47A 3O88A 2GDNA 4OPYA 4E3KA 1JTGA 5FATA 1M40A 2PU4A 1RP5A 2QZ6A 2OLUA 3DTEA 3R7WA 4X6TA 4NXGA 5HSQA 1HTZA 4K0XA 1FCNA 4KG2A 4GDNA 1ZG4A 1CQAA 3KSFA 2XSSA 3O86A 3R7WB 2PR5A 2JKTM 1PI4A 3FC7A 5F82A 1RCJA 5FDHA 1W63Q 3PXPA 4R1GA 3OPLA 1OTIA 5HDCA 2EX2A 1V9ZA 3CI6A 4S2IA 1VHMA 1IYQA 4P6ZM 4GHIB 3V39A 5FI7A 1NZUA 3UB5P 1LSWA 1NRJA 1PZPA 3TOIA 5AQ9A 1ES2A 2KOIA 5CHJA 2Y2PA 5HWWA 5FQJA 3CJMA 4JPMA 1IEMA 4HP4A 4N9KA 1KOUA 3LIFA 5F5YA 3UE1A 1HD8A 2XQZA 4X1MA 2HGVA 2XFSA 4HESA 5C5KA 4Y15A 2J3TD 4WELA 3ZG9B 3KO6A 3BEBA 2EFUA 1BSGA 3N8RA 5DTKA 3PYPA 3BFGA 1W63M 2J3WA 2UWXA 1Z6FA 4ZJ1A 3BFDA 2J9OA 1XGJA 3OCNA 1ESUA 1YLPA 2WKIA 3O3VA 4MN6A 1V9YA 3ZGAB 5KSHA 2PRFA 5DFXA 3SOIA 4P85A 4LV1A 2J7VA 1LHYA 4E3MA 2I72A 4WMCA 3N8LA 4E3IA 4MEZA 4X68A 1VQQA 3LIEA 3G32A 3VOLA 3VE4A 3T4KA 5I5LA 2ZC5B 3HJIA 3OLOA 4O8GA 1N9LA 3P01A 4UQIS 4DJ3A 2ZC7A 3K2NA 2Y2LA 5GLDA 4RVAA 1H8MA 4ETXA 1K55A 2JKRI 1H3QA 2GZAA 2WGIA 2X71A 5DF9A 4HH3A 2PD8A 2VZWA 5LBRA 2WZXA 4X25A 2YKHA 1E3UD 3PHYA 2V9AA 4IEDA 5F1GA 2JE5A 3UE3A 2Q9MA 2Z2LB 1UGUA 3FYZA 3NHQA 2A24B 1ERMA 3ULFA 3EWKA 1NYYA 1LLBA 3PAEA 3F1PA 2JKFA 4UEYA 3H7WA 3LY4A 5FQIA 3HLWA 3WS0A 2ZMVA 3ZQ5A 4FH2A 4UHUA 2K31A 3B42A 4OQGA 4KQOA 2Y8HA 3B33A 4EQ1A 3JVVA 3UPOA 4PKYA 4R3JA 3A0VA 4UQIM 4K91A 3MFXA 3OPPA 4D2OA 4R3BA 1P97A 2LB9A 1FILA 1NXYA 3W4PA 3BM6A 3T1XA 3LIDA 3MF0A 1A0KA 1L2SA 4O0PA 5HPIA 3CWFA 3GDIA 5GHYA 3ITAA 5G18A 1MKMA 3IS2B 1GHPA 3MQQA 1TDLA 2Q0OA 2VJWA 2WUQA 5AQAA 2XDMA 4FH4A 1K4FA 2ZQ8A 4WL9A 3WS1A 2XA7S 1OTEA 1K56A 3N6IA 1TDGA 4DXCA 2PBDP 3NOTC 4LGWA 3UN7A 1N9BA 1IFQA 3IX8A 3H82A 5HWTA 1ZKJA 1IKGA 2HPBA 1G68A 4OLDA 2ZMAA 1GA0A 2D01A
chains in the Genus database with same CATH topology
1K0KA 2JKGA 2PRFA 2ACGA 2E8JA 3CPTA 3T1QB 1Y4OA 3NULA 2VK3A 2PAVP 1HLUP 2B95A 4D60A 1A0KA 5EV0A 1Z09A 1PRQA 2V8CA 3DAVA 1PNEA 4X1LA 3L7HA 2PBDP 3NECA 3U4LP 5EM0A 1F2KA 5EM1A 3MS6A 5FEFA 1CJFA 1FIKA 1VEUA 2ZL1A 2ZL1B 3L9KA 1D1JA 3D9YA 1ACFA 3MSHA 2BTFP 4FUWA 4ESPA 4X1MA 1SKOB 1VETB 3CHWP 1PFLA 2JKFA 5EVEA 5FDSA 3UB5P 1G5UA 3T1SA 1YPRA 2V8FA 1VEUB 3T1XA 3CPTB 3T12B 1FILA 1SZVA 1CQAA 1SKOA 1CF0A 1VETA 2HZ5A 4QWOA 3T1RA 3LGOA 1J3WA 3LEQA 5FEGA 4X25A 4FTXA 3KYEA 1AWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0K A;  2JKG A;  2PRF A;  2ACG A;  2E8J A;  3CPT A;  3T1Q B;  1Y4O A;  3NUL A;  2VK3 A;  2PAV P;  1HLU P;  2B95 A;  4D60 A;  1A0K A;  5EV0 A;  1Z09 A;  1PRQ A;  2V8C A;  3DAV A;  1PNE A;  4X1L A;  3L7H A;  2PBD P;  3NEC A;  3U4L P;  5EM0 A;  1F2K A;  5EM1 A;  3MS6 A;  5FEF A;  1CJF A;  1FIK A;  1VEU A;  2ZL1 A;  2ZL1 B;  3L9K A;  1D1J A;  3D9Y A;  1ACF A;  3MSH A;  2BTF P;  4FUW A;  4ESP A;  4X1M A;  1SKO B;  1VET B;  3CHW P;  1PFL A;  2JKF A;  5EVE A;  5FDS A;  3UB5 P;  1G5U A;  3T1S A;  1YPR A;  2V8F A;  1VEU B;  3T1X A;  3CPT B;  3T12 B;  1FIL A;  1SZV A;  1CQA A;  1SKO A;  1CF0 A;  1VET A;  2HZ5 A;  4QWO A;  3T1R A;  3LGO A;  1J3W A;  3LEQ A;  5FEG A;  4X25 A;  4FTX A;  3KYE A;  1AWI A; 
#chains in the Genus database with same CATH topology
 1ODV A;  1XP4 A;  4RQ9 A;  2EA9 A;  2WKQ A;  2QHK A;  1NLY A;  4Z9Q A;  5DKK A;  5F69 A;  5L07 A;  2VV6 A;  2H28 A;  4IUK A;  3FKW A;  4UAA A;  4U0X A;  1W8Q A;  4JXG A;  3F1O A;  2A24 A;  5J4E A;  3KSI A;  3NDG A;  4DDS A;  5EV0 A;  3KYZ A;  3UB6 A;  1AXB A;  3HLB A;  3LEZ A;  3HJK A;  4X53 A;  4DE2 A;  4C75 A;  4L9E A;  1D06 A;  3MXS A;  2XRO A;  4MNR A;  2PD7 A;  3WS2 A;  5CER A;  3BJN A;  5EVI D;  4U0T A;  3MMH A;  3T1R A;  1LL5 A;  1QMF A;  4BBU A;  3N8S A;  4DF6 A;  2IWB A;  4AFI A;  4LV2 A;  3C7V A;  3SS4 A;  1ERQ A;  3VSK A;  1MY8 A;  2ZM2 A;  2OWJ A;  4I38 A;  2WGW A;  5FQ9 A;  3IXB A;  4JF4 A;  2NUP C;  3G31 A;  1L0E A;  5L2F A;  1JWV A;  2XD1 A;  3S22 A;  3CZD A;  3PR6 A;  4QWO A;  5L10 A;  1L0G A;  3IS2 A;  3V5M A;  3SW1 A;  4EQI A;  3V3R A;  2OV5 A;  3SH9 A;  3NI9 A;  3Q7Z A;  3OBF A;  4LFU A;  5CGX A;  3HUM A;  4LEN A;  5TBM A;  5BOH A;  3T4Q A;  4EBN A;  2X02 A;  2HV1 A;  1NZO A;  2A49 A;  1PWG A;  1KE4 A;  3LYX A;  3D72 A;  1NLZ A;  3MFD A;  3H82 B;  1FCM A;  3DW0 A;  1MC0 A;  5AVE A;  3MR0 A;  5CXW A;  3EOI A;  4UA7 A;  1I2W A;  4LV0 A;  2AVX A;  3UE0 A;  3QP8 A;  3T4S A;  3IF6 C;  4BWI A;  3MSH A;  3IWI A;  3H7W B;  1XFQ A;  3IXH A;  3FG8 A;  4YWZ A;  2HDS A;  2Y79 A;  4II7 A;  5HAR A;  3UY6 A;  2EXA A;  4KQQ A;  3CMZ A;  1LI0 A;  3VSL A;  2PAV P;  4ARZ A;  4BEN A;  1ONG A;  2XH9 A;  3MJQ A;  2J8Y A;  3MZF A;  4N9L A;  3VFH A;  5FEF A;  1CI8 A;  3M6B A;  4L9F A;  5CGS A;  3V50 A;  1BLP A;  3DTM A;  4E3O A;  3S7N A;  1W8Y A;  3HUO A;  2VGL M;  1GSX A;  1KGF A;  4KZ5 A;  1YLJ A;  1BUE A;  1YLW A;  5FA7 A;  4ZJ2 A;  4KZ7 A;  4WN5 A;  1TS6 A;  4EXO A;  5E43 A;  4DXB A;  2L1M A;  3FV7 A;  3ZHH A;  5KZH A;  1F98 A;  5FQM A;  2IWD A;  5E2E A;  3VP3 A;  1QME A;  4NEE D;  1TF1 A;  2VKS A;  4DE3 A;  3QP5 A;  1WYC A;  1H5X A;  2Y2J A;  4R0Q A;  4R4R A;  1P9W A;  1XXM A;  2DRW A;  1PRQ A;  2QJ5 A;  1ZG6 A;  3FWL A;  4OVD A;  4OPZ A;  3IX4 A;  1D7E A;  2FZ0 A;  3EQU A;  1OME A;  1XJ6 A;  1CI9 A;  2JN7 A;  3BY9 A;  3LI8 A;  4WEK A;  1S1Z A;  3G35 A;  4FOF A;  4JXW A;  1JNU A;  1G6O A;  5FI2 A;  2ACG A;  1VM1 A;  4O01 A;  3BYD A;  2PYP A;  2Y55 A;  3DTI A;  2Y2G A;  3ZDJ A;  4Y0U A;  1KGE A;  1YQS A;  5HAP A;  2O0Y A;  4OOM A;  2VV8 A;  2M1C A;  3A3D A;  3UB7 A;  3VE3 A;  4S2N A;  3HUN A;  3OOV A;  1L0F A;  3RXW A;  4EUZ A;  1NY0 A;  1YKD A;  4QPR A;  1TVF A;  3KYE A;  3A3E A;  4IBX A;  5HD3 A;  1K25 A;  4ZJ3 A;  5J7E A;  3VOY A;  3HL9 A;  2Y91 A;  3UDX A;  2B5R A;  5G4Y A;  5EUA A;  2B18 A;  5EVI B;  3AGF A;  4QY6 A;  3HLE A;  2W3F A;  5FSR A;  4IVI A;  3PBS A;  2VLG A;  3BFE A;  3IXD A;  1DY6 A;  4OLG A;  2PHY A;  3LR4 A;  1VET B;  1ZC2 A;  5A92 A;  2DCF A;  1BUL A;  1MWU A;  3OZH A;  5EOE A;  1J3W A;  4FTX A;  1AWI A;  2JKG A;  1I5Q A;  4EES A;  5A90 A;  1W7F A;  2Z6C A;  4P87 A;  5G4Z A;  1ERO A;  3MXR A;  4NXF A;  4JLF A;  4S2O A;  2H5S A;  3HRE A;  2BG1 A;  3I7J A;  2OOL A;  4OON A;  3HVF A;  3NOP C;  4KZ6 A;  5HWV A;  4EET B;  2LB5 A;  4HBU A;  3VP1 A;  1WE4 A;  5M18 A;  3IF6 B;  4H8R A;  3C5A A;  3OC2 A;  2PYR A;  2ZQ9 A;  4NXB A;  4WLA A;  1G28 A;  3GRJ A;  1SKO A;  4FCF A;  4GN2 A;  3BWL A;  2I9V A;  3Q1F A;  4Q8I A;  2V20 A;  1E4D A;  3WRT A;  2EFX A;  4B4X A;  1RGZ A;  4XT2 B;  3VP0 A;  3IBR A;  3BLS A;  1YMX A;  4G3W A;  1OT9 A;  5FDS A;  4G3K A;  2OWH A;  4BQM A;  3C8C A;  4I3A A;  4K08 A;  1J9M A;  4I39 A;  3BY8 A;  4CLC D;  3T1Q B;  3DBA A;  2W0N A;  4GOG A;  4ARZ B;  3NY4 A;  1DRM A;  3PBR A;  4NK3 A;  3BW6 A;  1FOF A;  3IXG A;  4UA6 A;  5AVF A;  2G2U A;  3TSG A;  3OCL A;  1BLS A;  3DTK A;  1O07 A;  1PW8 A;  2V1B A;  4DKI A;  2W27 A;  1K57 A;  1UWP X;  2HP9 A;  1IKI A;  3W8K A;  3DWZ A;  1PI5 A;  4NG2 A;  5HD5 A;  2W3G A;  3TW8 A;  4ME4 A;  1H0M A;  2GJ3 A;  1RGY A;  2Y2N A;  3ZCZ A;  2V1Z A;  2W3E A;  2GNX A;  4E6W A;  3A3I A;  3TG9 A;  4HJ4 A;  2Y4A A;  2KLI A;  4LCL A;  4HNB A;  3V67 A;  4HI4 A;  4ZAM A;  3MS6 A;  4WUJ A;  2ZD8 A;  4G3V A;  2OSU A;  4PHT A;  3G2Y A;  1OTA A;  2R9X A;  1LL8 A;  4GD6 A;  5TFQ A;  3UB8 A;  4H6J B;  1BLC A;  2JKR M;  2E8I A;  1KE0 A;  3NCK A;  5GLC A;  5CX7 A;  3QP4 A;  4CPK A;  1PFL A;  4I3J A;  5IU1 A;  3HCY A;  3G6O A;  4OKP A;  4S2K A;  2PDR A;  3FPW A;  3A3J A;  4OPR A;  3SH8 A;  3T4L A;  2QWS A;  2DNS A;  5CHU A;  1CEG A;  3R4K A;  4EU0 A;  4RA7 A;  2HJE A;  4PM7 A;  1N9N A;  3WWX A;  4E3N A;  1EI5 A;  4IUH A;  1K54 C;  3ZYT A;  3IHB A;  5FQQ A;  2JHE A;  3DWK A;  1H8Y A;  2E8J A;  3HLF A;  1KVL A;  3ITB A;  4LPZ A;  2FFY A;  1OTB A;  5CRF A;  2EWW A;  3Q81 A;  2QPN A;  4MMN A;  4EV4 A;  3CAX A;  3P7N A;  1F9I A;  1EWZ A;  4S2J A;  1DP9 A;  3IX3 A;  3CG5 A;  1MWT A;  2HJ9 C;  2OAQ 1;  3H9W A;  2R9W A;  1TS7 A;  2VX8 A;  4NKP A;  4X55 A;  1FSY A;  1LI9 A;  5F83 A;  1SCW A;  5EPH A;  2VEA A;  1MWS A;  3NOU C;  5EVE A;  4LLO B;  2IA2 A;  2R78 A;  4CLC B;  4JF5 A;  3GMW A;  3BEC A;  1T1A A;  4HP9 A;  4N1H A;  2EWV A;  2XEP A;  4OPQ A;  3TRC A;  1FIK A;  2CC1 A;  2Y2Q A;  2WKP A;  3IF6 A;  2Y2I A;  3EGX C;  4XXR A;  1XA7 A;  1K55 C;  1LSV A;  3EEH A;  5DFY A;  3UB9 A;  1KVM A;  3MKF A;  4E04 A;  4KUO A;  3M2K A;  2X01 A;  3UNW A;  2WZZ A;  1K0K A;  2OLV A;  1SDN A;  4QJG A;  1DP6 A;  3FKV A;  3IWO A;  5JYO A;  1Y54 A;  2GX5 A;  1ES3 A;  3N7W A;  5EVL A;  1STZ A;  3U4L P;  2BAS A;  2HP6 A;  1F2K A;  1BT5 A;  3C2W A;  1NRF A;  4CLC C;  1DJC A;  4KG6 A;  4P0M A;  4RYE A;  2P9V A;  2M7U A;  4JGP A;  2V2F F;  5IT5 A;  5CHM A;  3IH9 A;  3E4Q A;  4OQI A;  1T19 A;  1KE3 A;  4KZA A;  4GLQ A;  1PNE A;  4QY5 A;  3Q7V A;  4LV3 A;  3NEC A;  4C3Q A;  2P9V B;  2Q9N A;  5F68 A;  2MJ6 A;  3GR2 A;  3LR3 A;  4MCW A;  1CEF A;  4R38 A;  3C38 A;  3CPT B;  4IJG A;  3LO7 A;  3OPH A;  3P98 A;  1PW1 A;  4ESP A;  4GJ4 A;  2PT7 A;  2VK3 A;  2XD5 A;  3QNB A;  4MLL A;  4R70 A;  5EVI C;  3MXQ A;  4GS9 A;  4DJ2 A;  5EE8 A;  4JXS A;  5FQK A;  4S2L A;  4MBF A;  4FD8 A;  4WZ5 A;  4EW7 A;  1YPR A;  3MBZ A;  2ZC6 B;  4JXV A;  1XJ3 A;  3VMA A;  1GSW A;  2V0W A;  2Z2M B;  4JGQ A;  4BJP A;  3IQA A;  1S66 L;  1XKZ A;  4KQD A;  4JKT A;  4Y2F A;  1GCE A;  1W5D A;  4OQH A;  1VEU B;  1CF0 A;  3ZNY A;  4Y0T A;  3ZFZ A;  2ZQ7 A;  1N4O A;  3E2K A;  4B93 A;  2B95 A;  2JCH A;  2V8C A;  1NJ4 A;  1Q2Q A;  4B9O A;  1W79 A;  3HLG A;  4DDY A;  1BYW A;  3PBQ A;  3MZD A;  5L8M A;  3Q82 A;  1E3U A;  4IBR A;  3PBO A;  5CGW A;  2PBY A;  3D4F A;  2KDK A;  4JBF A;  3IBJ A;  2O9B A;  2J80 A;  4KEN B;  1OJG A;  3T4T A;  5GLA A;  4X56 A;  1HZO A;  4HOI A;  4GCZ A;  4FUW A;  2BTF P;  3AGE A;  4KZB A;  4GZB A;  1SZV A;  3NBL A;  4YIN A;  3WRZ A;  1YM1 A;  3QP6 A;  5M1A A;  1PWC A;  3CLO A;  2W1T B;  2G7U A;  4OQ0 A;  2P08 A;  3NDE A;  2P7J A;  5J3W A;  1C3B A;  1H8Z A;  4P6Z S;  1E25 A;  2HF6 A;  4M3K A;  3QP1 A;  3V3S A;  1SKF A;  4QB8 A;  3A0R A;  4I5S A;  3ZG5 A;  3SS5 A;  3ZNT A;  1XFN A;  1P9R A;  1HVB A;  1SHV A;  2P04 A;  4GW9 A;  5J8X A;  1MWR A;  3SH7 A;  4JF6 A;  3E2L A;  4BD0 A;  5AJG A;  1IYO A;  1NWZ A;  3VV4 A;  3RTY A;  4S2P A;  2ZOH A;  2WAF A;  3F1N B;  2V8F A;  4KZ8 A;  2HDR A;  1XJ2 A;  4Y3I A;  4Q0H A;  3E4O A;  5CEB A;  3AGD A;  2L4R A;  4YFM A;  1S4R A;  4CLC A;  5FAS A;  2Y2M A;  4HQA A;  2XRN A;  2ZL1 B;  3VP4 A;  1MZU A;  4BL3 A;  2ZBB A;  4OOL A;  2XGN A;  4LCM A;  3VP2 A;  5CTN A;  4XUZ A;  4DMZ A;  5HDS A;  2VGL S;  2WK0 A;  3N4I A;  3C30 A;  2ZMF A;  1FR6 A;  4HH2 A;  1WA9 A;  2DMW A;  4B88 A;  3CHW P;  5HZH A;  1S67 L;  4ETZ A;  4DE0 A;  1WYB A;  4HIA A;  1ZHH B;  3UDF A;  1FQG A;  5E2F A;  4NET A;  3F1P B;  2L0W A;  3O87 A;  4EBP A;  4HBT A;  3LI9 A;  1NYM A;  5DVA A;  3VOZ A;  1PIO A;  1ACF A;  3E4P A;  4JGO A;  5A93 A;  3NIA A;  2WGW B;  1BTL A;  2O9A A;  5E2G A;  4XUX A;  1I2S A;  4MDZ A;  1FSW A;  1O7E A;  3UME A;  3UPN A;  4WF0 A;  3QNC A;  5A8B A;  1Z09 A;  5HAI A;  4F3L A;  1K57 C;  2XLN A;  2ZL1 A;  4QHC A;  2HDU A;  3Q7V B;  5I94 A;  4LRX C;  4MBH A;  3GVB A;  2Z6D A;  5HW3 A;  4H6J A;  5CTM A;  3CUE C;  4Q0I A;  5HAQ A;  4D60 A;  4EUV A;  5HFO A;  2K2N A;  1F5M A;  3Q07 A;  1GHM A;  1SKO B;  4GDB A;  2ZLY A;  4MN5 A;  2EX9 A;  2RCX A;  5MC7 A;  2PU2 A;  4S2M A;  2J3T C;  1FCO A;  4E6X A;  4HY8 A;  5DKL A;  1CK3 A;  5HL6 A;  3M2J A;  2JC7 A;  5E2H A;  3G30 A;  4E3J A;  2INW A;  2W3D A;  3E0Y A;  4K0W A;  5A91 A;  3T4O A;  3TJZ C;  4JGR A;  5EEC A;  2Y2H A;  1ESI A;  1YMS A;  3T1S A;  2D02 A;  2Y2K A;  1MPL A;  1XA1 A;  4OH0 A;  1IOU A;  4KZ3 A;  2A2L A;  1ONH A;  3ZVT A;  1TD5 A;  3O5Y A;  2H10 A;  1K56 D;  4BBV A;  1TS8 A;  2VA0 A;  5JYP A;  1M6K A;  3BLM A;  5DJT A;  2W3H A;  5HPF A;  1VET A;  3UE6 A;  4NXE A;  2WYX A;  3JPU A;  4Y17 A;  1XPB A;  4L0L A;  1YT4 A;  3G34 A;  1VEU A;  4KQR A;  3ZG8 B;  4GHI A;  4RX3 A;  3T12 B;  2ZM8 A;  4BL2 A;  4CLC E;  1KDW A;  1LT0 A;  2ZJ9 A;  4DE1 A;  5FAQ A;  2JKT I;  5DTT A;  4EWF A;  3JVU A;  3HLD A;  1YAX A;  2VGJ A;  5FI6 A;  2W1R A;  3S7Q A;  1YLT A;  4WEJ A;  5EFW A;  4GD8 A;  4EEU A;  1BZA A;  4PM8 A;  2CMN A;  5D3O A;  1XJ4 A;  3CIT A;  3C7U A;  5HL1 A;  1OPX A;  2ZC4 B;  4KUK A;  5IHV A;  5TBM B;  4YOF A;  3IF5 A;  1BLH A;  1MXO A;  4BD1 A;  3F1N A;  1Y28 A;  4OP8 A;  1T18 A;  3SZT A;  5GHZ A;  5EM0 A;  3NJA A;  2V1A A;  3C4P A;  3MKE A;  4EBL A;  4N1X A;  1OTD A;  1PYY A;  3HLC A;  5F1F A;  2C5W B;  2XR0 A;  3LY3 A;  3VFF A;  1HLU P;  3EQV A;  3BFF A;  2B02 A;  1S4S A;  3GTC A;  4KZ4 A;  3KX0 X;  4A5R A;  3GQZ A;  4PKY G;  5M19 A;  1GA9 A;  2HP5 A;  1T1B A;  1KDS A;  2KX6 A;  1G6A A;  4RX2 A;  1Y4O A;  4U3T A;  3LIB A;  4WMC D;  4MN7 A;  3DAV A;  5FAO A;  1S1Y A;  2WKE A;  1PWD A;  3IHA A;  2ZOI A;  3S7O A;  1K6R A;  3C4O A;  3IWQ A;  1P0Z A;  1JVJ A;  3RH8 B;  2QKP A;  1T1C A;  1DJA A;  3QP2 A;  4ID4 A;  4OP5 A;  5FL3 A;  3GSG A;  3T4J A;  1OT6 A;  3WS5 A;  5DJU A;  5L09 A;  2VGK A;  2QJ7 A;  1OJ5 A;  4WYY A;  5CEC A;  5EVI A;  2Y2O A;  5EM1 A;  3K3D A;  1G5U A;  3QHY A;  2HZ5 A;  4KZ9 A;  1FR1 A;  3PBT A;  5EOO A;  2V0U A;  3LGO A;  5GLB A;  3NUL A;  4QD4 A;  1SDE A;  1K38 A;  3KSG A;  3PTE A;  3TE8 A;  3PAG A;  4GKU A;  1YLZ A;  3LFV A;  3D3O A;  3E98 A;  3L9K A;  3LIC A;  4WZ4 A;  3A3F A;  4WM9 A;  5K5B A;  5KSC A;  1KGG A;  4MBK A;  4ZBE A;  2M7V A;  3BFC A;  4YNR A;  5FEG A;  2XA7 M;  4PM6 A;  4ZRR A;  3S4X A;  3ZVW A;  3B47 A;  2EX6 A;  4ZDX A;  4CQH A;  1TEM A;  5GL9 A;  3MZE A;  3M6H A;  1K4E A;  2XK1 A;  4C6Y A;  1ALQ A;  1X0O A;  2QYB A;  3SS3 A;  1IEL A;  4DN0 A;  3ZG7 B;  3UPP A;  1IYS A;  5DF7 A;  2H0Y A;  1UWN X;  3ISG A;  2EXB A;  4IVK A;  4R3A A;  4R6L A;  2IWC A;  3NC8 A;  3OPR A;  3HBR A;  2PR6 A;  2YKF A;  5TR7 A;  2BLS A;  3EGD C;  1D1J A;  4M4X A;  2J9P A;  3WS4 A;  3MQ0 A;  4UA9 A;  2ZQC A;  4Q0J A;  2Y59 A;  4WBG A;  1ZTU A;  3FPV A;  1K54 A;  1LL9 A;  1MKI A;  4WZ5 C;  1Q2P A;  2O9C A;  2P74 A;  3GV9 A;  4XT2 A;  1ES5 A;  1XGI A;  2ZQD A;  4X69 A;  4X1L A;  3L7H A;  5KMW A;  2O99 A;  4ZTK A;  1K6S A;  3PBN A;  4Z1W A;  1VB6 A;  4Y13 A;  4R4S A;  2H0T A;  3ICY A;  4N92 A;  2K7S A;  4DRT A;  3ZG0 A;  1ES4 A;  3RJU A;  4Y0O A;  2VV7 A;  3EEA A;  3W4O A;  3KYQ A;  3K3C A;  3FZC A;  5HX9 A;  5TGF A;  5AQB A;  4PMA A;  5F6A A;  2OAP 1;  4PM9 A;  3JYI A;  3B3X A;  3D9Y A;  2A3U A;  3P09 A;  3S7P A;  2ZQA A;  2WAD A;  3CUE A;  4EER A;  1GHI A;  4HJ6 A;  5AQ7 A;  4L9G A;  4R23 A;  2QMI A;  4PAU A;  5IS1 A;  3LCE A;  4LRZ E;  3BQA A;  2G2W A;  3LUQ A;  4I3I A;  3UMD A;  3A0S A;  5GHX A;  2UV0 E;  1JWZ A;  4E3L A;  1L0D A;  4Y7P A;  4HJ3 A;  4S2N C;  1TS0 A;  2W1T A;  1IYP A;  4HHD A;  2ZC3 B;  3IH8 A;  4BBT A;  1CJF A;  5CED A;  4CJN A;  1GSV A;  4KG5 A;  4EEP A;  3W2Z A;  1YLY A;  1YSQ A;  2WKH A;  3MQO A;  3LR5 A;  4O7D A;  2WKR A;  3KSH A;  3LEQ A;  1EW0 A;  2JBF A;  4HEF A;  4PPR A;  3G4P A;  1JTD A;  2FH5 A;  1L3L A;  2FFF B;  1S0W A;  2XF3 A;  5FAP A;  3UDI A;  3W4Q A;  4BLM A;  1S6R A;  3RXX A;  1YSP A;  4GS9 B;  4Y5F A;  4GNU A;  2HDQ A;  5HDD A;  2WAE A;  4BMW A;  1U60 A;  2RL3 A;  1PZO A;  3CPT A;  3U2A A;  4F3L B;  1LSX A;  3G2Z A;  1DJB A;  3UO9 A;  2XFT A;  5DTS A;  2EX8 A;  4OOY A;  1N9O A;  2WGV A;  3BQ8 A;  3LR0 A;  4QU3 A;  4F94 A;  4PM5 A;  4LRY C;  2NUT C;  3RFB A;  2ZM0 A;  5TJJ A;  1DP8 A;  3S1Y A;  2C6W B;  3F1O B;  1JWP A;  4B4Z A;  1XX2 A;  4P6B A;  5KIZ A;  4GB7 A;  1MBL A;  4FSF A;  4IHQ A;  3T50 A;  3IT9 A;  3GEC A;  3BRM A;  5DF8 A;  3LIA A;  5U47 A;  3O88 A;  2GDN A;  4OPY A;  4E3K A;  1JTG A;  5FAT A;  1M40 A;  2PU4 A;  1RP5 A;  2QZ6 A;  2OLU A;  3DTE A;  3R7W A;  4X6T A;  4NXG A;  5HSQ A;  1HTZ A;  4K0X A;  1FCN A;  4KG2 A;  4GDN A;  1ZG4 A;  1CQA A;  3KSF A;  2XSS A;  3O86 A;  3R7W B;  2PR5 A;  2JKT M;  1PI4 A;  3FC7 A;  5F82 A;  1RCJ A;  5FDH A;  1W63 Q;  3PXP A;  4R1G A;  3OPL A;  1OTI A;  5HDC A;  2EX2 A;  1V9Z A;  3CI6 A;  4S2I A;  1VHM A;  1IYQ A;  4P6Z M;  4GHI B;  3V39 A;  5FI7 A;  1NZU A;  3UB5 P;  1LSW A;  1NRJ A;  1PZP A;  3TOI A;  5AQ9 A;  1ES2 A;  2KOI A;  5CHJ A;  2Y2P A;  5HWW A;  5FQJ A;  3CJM A;  4JPM A;  1IEM A;  4HP4 A;  4N9K A;  1KOU A;  3LIF A;  5F5Y A;  3UE1 A;  1HD8 A;  2XQZ A;  4X1M A;  2HGV A;  2XFS A;  4HES A;  5C5K A;  4Y15 A;  2J3T D;  4WEL A;  3ZG9 B;  3KO6 A;  3BEB A;  2EFU A;  1BSG A;  3N8R A;  5DTK A;  3PYP A;  3BFG A;  1W63 M;  2J3W A;  2UWX A;  1Z6F A;  4ZJ1 A;  3BFD A;  2J9O A;  1XGJ A;  3OCN A;  1ESU A;  1YLP A;  2WKI A;  3O3V A;  4MN6 A;  1V9Y A;  3ZGA B;  5KSH A;  2PRF A;  5DFX A;  3SOI A;  4P85 A;  4LV1 A;  2J7V A;  1LHY A;  4E3M A;  2I72 A;  4WMC A;  3N8L A;  4E3I A;  4MEZ A;  4X68 A;  1VQQ A;  3LIE A;  3G32 A;  3VOL A;  3VE4 A;  3T4K A;  5I5L A;  2ZC5 B;  3HJI A;  3OLO A;  4O8G A;  1N9L A;  3P01 A;  4UQI S;  4DJ3 A;  2ZC7 A;  3K2N A;  2Y2L A;  5GLD A;  4RVA A;  1H8M A;  4ETX A;  1K55 A;  2JKR I;  1H3Q A;  2GZA A;  2WGI A;  2X71 A;  5DF9 A;  4HH3 A;  2PD8 A;  2VZW A;  5LBR A;  2WZX A;  4X25 A;  2YKH A;  1E3U D;  3PHY A;  2V9A A;  4IED A;  5F1G A;  2JE5 A;  3UE3 A;  2Q9M A;  2Z2L B;  1UGU A;  3FYZ A;  3NHQ A;  2A24 B;  1ERM A;  3ULF A;  3EWK A;  1NYY A;  1LLB A;  3PAE A;  3F1P A;  2JKF A;  4UEY A;  3H7W A;  3LY4 A;  5FQI A;  3HLW A;  3WS0 A;  2ZMV A;  3ZQ5 A;  4FH2 A;  4UHU A;  2K31 A;  3B42 A;  4OQG A;  4KQO A;  2Y8H A;  3B33 A;  4EQ1 A;  3JVV A;  3UPO A;  4PKY A;  4R3J A;  3A0V A;  4UQI M;  4K91 A;  3MFX A;  3OPP A;  4D2O A;  4R3B A;  1P97 A;  2LB9 A;  1FIL A;  1NXY A;  3W4P A;  3BM6 A;  3T1X A;  3LID A;  3MF0 A;  1A0K A;  1L2S A;  4O0P A;  5HPI A;  3CWF A;  3GDI A;  5GHY A;  3ITA A;  5G18 A;  1MKM A;  3IS2 B;  1GHP A;  3MQQ A;  1TDL A;  2Q0O A;  2VJW A;  2WUQ A;  5AQA A;  2XDM A;  4FH4 A;  1K4F A;  2ZQ8 A;  4WL9 A;  3WS1 A;  2XA7 S;  1OTE A;  1K56 A;  3N6I A;  1TDG A;  4DXC A;  2PBD P;  3NOT C;  4LGW A;  3UN7 A;  1N9B A;  1IFQ A;  3IX8 A;  3H82 A;  5HWT A;  1ZKJ A;  1IKG A;  2HPB A;  1G68 A;  4OLD A;  2ZMA A;  1GA0 A;  2D01 A; 
#chains in the Genus database with same CATH homology
 1K0K A;  2JKG A;  2PRF A;  2ACG A;  2E8J A;  3CPT A;  3T1Q B;  1Y4O A;  3NUL A;  2VK3 A;  2PAV P;  1HLU P;  2B95 A;  4D60 A;  1A0K A;  5EV0 A;  1Z09 A;  1PRQ A;  2V8C A;  3DAV A;  1PNE A;  4X1L A;  3L7H A;  2PBD P;  3NEC A;  3U4L P;  5EM0 A;  1F2K A;  5EM1 A;  3MS6 A;  5FEF A;  1CJF A;  1FIK A;  1VEU A;  2ZL1 A;  2ZL1 B;  3L9K A;  1D1J A;  3D9Y A;  1ACF A;  3MSH A;  2BTF P;  4FUW A;  4ESP A;  4X1M A;  1SKO B;  1VET B;  3CHW P;  1PFL A;  2JKF A;  5EVE A;  5FDS A;  3UB5 P;  1G5U A;  3T1S A;  1YPR A;  2V8F A;  1VEU B;  3T1X A;  3CPT B;  3T12 B;  1FIL A;  1SZV A;  1CQA A;  1SKO A;  1CF0 A;  1VET A;  2HZ5 A;  4QWO A;  3T1R A;  3LGO A;  1J3W A;  3LEQ A;  5FEG A;  4X25 A;  4FTX A;  3KYE A;  1AWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...