1JVJA

Crystal structure of n132a mutant of tem-1 beta-lactamase in complex with a n-formimidoyl-thienamycine
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDATAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE TEM
publication title Noncovalent interaction energies in covalent complexes: TEM-1 beta-lactamase and beta-lactams.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 91
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1jvjA00
1MWUA 3ZVWA 4KZ7A 3A3IA 4QJGA 2G2UA 3MKEA 4GOGA 4X6TA 5EE8A 3G35A 1ES2A 3IQAA 3IWOA 3IH9A 3GRJA 2XEPA 1NZOA 3HUNA 3PBSA 5EUAA 1FSWA 4RX2A 4ZTKA 2WKHA 3ZG5A 3Q82A 2WGWA 3FZCA 1LLBA 1DJAA 5EOEA 5GHZA 5F83A 1Q2PA 1ES3A 2X02A 4S2LA 1BLPA 1ZC2A 1ZG6A 3O87A 4NETA 5DTSA 4OQHA 3ZDJA 2EX9A 2X01A 5GLBA 2GDNA 4KZ9A 1EWZA 4N9LA 4PM7A 1RGYA 1VM1A 5FQQA 4LV2A 3A3JA 4UA9A 1WE4A 4EBPA 1XX2A 2IWCA 2ZM2A 1ALQA 1IKIA 3NY4A 3A3FA 2ZC5B 2WZXA 3LY3A 3PBTA 3MKFA 4PM9A 4BL3A 4EWFA 5HAQA 3HUOA 5AQ7A 3OPHA 5DTTA 2ZC7A 3MXSA 4OH0A 4X68A 3BLMA 2IWBA 5HAPA 4UA6A 3OPRA 5DF7A 4DDYA 4ZJ3A 1BLSA 2JCHA 1N4OA 3IHAA 4OPYA 4PPRA 4DXBA 5EVIA 4OQ0A 2Y2QA 5CGXA 3UO9A 1EROA 2WAFA 1BSGA 2JE5A 3I7JA 1IELA 5EVID 2WZZA 4DDSA 4XUXA 4GZBA 4GNUA 3G31A 1G68A 5A93A 2ZM8A 4JXSA 1K25A 5G18A 2WYXA 1K54A 2WKEA 4ZBEA 5EOOA 3IWQA 3N4IA 5E2FA 1FSYA 4R3BA 3UNWA 1BLHA 2WKIA 1DJBA 3UE3A 1L0DA 4NK3A 1K54C 3AGEA 5CXWA 1KDWA 1YLYA 4IEDA 3Q81A 4K0WA 4OOMA 5FQIA 1KE0A 2DRWA 5CRFA 2WGIA 3JYIA 1LL9A 3UPPA 3M6BA 1MWRA 4JXGA 2A3UA 3BFEA 4H8RA 4C6YA 4D2OA 4GKUA 3FKVA 4ZDXA 1TDGA 1O7EA 4BENA 1I2SA 4KQRA 2ZJ9A 5KSCA 1CI9A 2Y2PA 5J8XA 2QMIA 1Z6FA 4R4SA 4MBFA 1PI4A 3SS5A 2XQZA 3V50A 3ZNYA 4E6XA 4P85A 2Y55A 5TFQA 3W4OA 1MXOA 2HP9A 3IWIA 3O86A 2EFUA 4U3TA 4DF6A 3QNCA 3M2JA 4PM5A 1NYYA 4KG6A 4X53A 3SS4A 4S2IA 1IKGA 5JYOA 4KQQA 4RA7A 1DY6A 3WS0A 2FFFB 4KZBA 1YLZA 1K56A 3SH7A 1JVJA 2EX2A 2Y2JA 1SKFA 3WS4A 1PW8A 1O07A 5HARA 2DCFA 5CEDA 1TEMA 4XUZA 4LCMA 2OLUA 4YFMA 3PTEA 1XKZA 5KZHA 1K55C 2XDMA 2H0YA 2ZM0A 1K4EA 3WRZA 2XR0A 2B5RA 3IF6A 3BFDA 1QMFA 1GA9A 4E3MA 2FFYA 3NBLA 1YLJA 2EX8A 3O3VA 2Y2MA 5U47A 2Y4AA 4FCFA 4LCLA 1S6RA 4KENB 1XP4A 2ZQDA 4X69A 5TGFA 4DKIA 3W4PA 1ONHA 3MFDA 2J9OA 3NDGA 4MBKA 4EUZA 1XGJA 3GR2A 3N8LA 4WMCA 4E3KA 3SOIA 1E3UD 3OCNA 2WUQA 3SH9A 1ES4A 3TSGA 4JLFA 4OONA 2XLNA 2XK1A 4WMCD 5EVIB 1JWPA 4P0MA 5AQ9A 3IT9A 1KGGA 3G4PA 1BTLA 1ESUA 3D4FA 1K57C 3HLDA 1KE3A 3VP4A 1MPLA 4KZ3A 4Y0UA 2IWDA 3V3RA 3WS1A 3BRMA 1K6SA 3GMWA 1HVBA 4L0LA 4DXCA 4IVIA 1NYMA 1PYYA 4JF6A 4HBUA 5FAPA 1ES5A 4CPKA 4JF5A 3IH8A 4OQIA 1CI8A 1M40A 5FAQA 3MXRA 3PBNA 1L2SA 3EQUA 2ZC3B 4S2NC 4EBNA 3IXBA 3OCLA 3P09A 3FWLA 4N1HA 3M2KA 5FDHA 3S22A 2R9WA 2V20A 3QNBA 2XF3A 3M6HA 1PWGA 1DJCA 1QMEA 4N92A 3RXWA 3VP2A 1XA1A 4EV4A 1ZG4A 4WBGA 3AGFA 4E3JA 3HBRA 3MZEA 3SS3A 3OC2A 4GD6A 3MBZA 3IXHA 3FKWA 3DTMA 3EQVA 1L0FA 3DWZA 3VSLA 3ZNTA 4DE0A 4QY5A 3PAEA 5KMWA 4A5RA 5I94A 1YLPA 3RJUA 1YLTA 3A3EA 1FCOA 1PZOA 2XD5A 5EVLA 4QB8A 2Y2GA 2ZLYA 4B4ZA 1RCJA 4X56A 4FH2A 3WS2A 3B3XA 1NY0A 5FQMA 3A3DA 3IF5A 5HAIA 3E2LA 1JWVA 4WZ5C 3W8KA 4S2MA 1K4FA 2V2FF 2HDSA 3Q1FA 2PU2A 4P6BA 2E8IA 2EFXA 2WK0A 2P9VA 4UAAA 4RYEA 4PM8A 3WRTA 3G34A 5GL9A 1GHMA 4N9KA 3IF6B 5A91A 2P74A 4MBHA 3WS5A 3TG9A 4OP8A 1LI9A 4M3KA 4UHUA 4KG2A 1G6AA 4MNRA 4S2PA 4OLDA 3UE0A 1W8YA 4DRTA 4R4RA 5E2GA 5DF8A 1PIOA 5KSHA 5FQJA 1BULA 3PBQA 3S4XA 2OV5A 2ZMAA 5FI6A 4QY6A 1Q2QA 1C3BA 4JF4A 5FI2A 3SH8A 3LCEA 4MLLA 4QD4A 3VFHA 4E3OA 4HEFA 2HDRA 1WYCA 4Q8IA 3E2KA 3ITAA 3ZVTA 3BFGA 1U60A 1PW1A 2VGKA 3BEBA 5CTMA 1PZPA 3OPPA 1OMEA 1KGFA 4QU3A 2XH9A 3LY4A 4ID4A 1IEMA 5FQKA 2OSUA 4MEZA 4ZJ1A 2Z2LB 3FYZA 5F1FA 3ZG9B 3N7WA 1MBLA 5FASA 4WEKA 1ERMA 5HFOA 5CEBA 1K55A 5EECA 3NDEA 2WGWB 1W8QA 4HESA 4S2KA 2Q9NA 4WM9A 1JTDA 2UWXA 5FA7A 3GV9A 1VQQA 5DTKA 4LV1A 4R3JA 3IXDA 4P87A 4KZ4A 3OPLA 1HD8A 2J9PA 4JXVA 3IHBA 2WAEA 4O7DA 1KVMA 3P98A 4BD0A 5D3OA 2Y2IA 3N6IA 5M1AA 1W7FA 4GN2A 5CERA 4R23A 2G2WA 1E3UA 3VP3A 1YM1A 4OLGA 1BZAA 2V1ZA 2QPNA 1ERQA 2JC7A 3BYDA 3UDIA 4HBTA 5HL1A 3VSKA 2ZQCA 4E3IA 5FQ9A 1L0EA 5GLDA 3HLGA 1NJ4A 5GHXA 3UDFA 3C7UA 1LHYA 4OVDA 4OP5A 4OOYA 2ZD8A 4N1XA 4DE2A 1K57A 1W5DA 4XXRA 3VP0A 1AXBA 4K0XA 3V3SA 5HW3A 4X55A 3TOIA 3AGDA 3VOZA 2P9VB 3HVFA 2EXBA 1IYPA 3CG5A 3GSGA 3ITBA 5FAOA 2QZ6A 2ZQ8A 1MY8A 1I2WA 1RP5A 4BQMA 5CTNA 4OPRA 2J7VA 5FSRA 4Y7PA 3VMAA 1NXYA 3Q07A 4BL2A 5M19A 1GCEA 1I5QA 4KQOA 4KZ6A 4S2NA 4C3QA 1BT5A 1MKIA 4ZJ2A 1XGIA 2XGNA 4KZ8A 2EX6A 2Y2NA 2R9XA 3HLCA 4YINA 3UPNA 5F1GA 4Y0TA 4UA7A 4BJPA 2ZQ7A 2PBYA 2Q9MA 1TVFA 2BLSA 5E43A 5F82A 3NI9A 3HREA 1IYOA 1PWCA 1H5XA 4DE3A 1GHIA 4OOLA 3RXXA 1E25A 5GHYA 4IBRA 5BOHA 5TR7A 1BLCA 2Y2HA 2Y91A 5HX9A 1YLWA 3S1YA 4WZ5A 1SCWA 2VGJA 4E3LA 4E6WA 4QHCA 3Q7VA 2XD1A 1FQGA 2JBFA 4Z9QA 1YMSA 5E2EA 3UY6A 3G32A 2HP5A 3PBOA 1MWSA 5CHJA 5E2HA 1MWTA 3V5MA 5GLAA 2Y2KA 1YT4A 1BUEA 1L0GA 3CMZA 1KDSA 2XFTA 3C7VA 2WADA 5A90A 4S2OA 1XXMA 4OPZA 4PMAA 4OPQA 4WZ4A 1H8ZA 2CC1A 1YQSA 4OKPA 4RVAA 4BLMA 5FI7A 1JTGA 5CGWA 4R0QA 5A92A 4LENA 4RX3A 5EVIC 4BD1A 1ZKJA 3HUMA 1JWZA 1SDEA 1CK3A 2XFSA 3GQZA 4S2JA 1K6RA 3C4OA 1FR6A 4FD8A 1FOFA 2J8YA 1WYBA 3LEZA 4IBXA 1EI5A 2HDQA 1E4DA 5FATA 4KZ5A 3OZHA 2ZC6B 1S0WA 2DNSA 3ZG8B 1KGEA 4JXWA 5EPHA 3DWKA 2H10A 3G2YA 2WGVA 3GTCA 5GLCA 3ZG7B 3O88A 3Q7ZA 5IHVA 4Y0OA 4WEJA 3BECA 2C5WB 4IVKA 1CEGA 1GHPA 2C6WB 5CECA 1KVLA 3VP1A 3WWXA 4C75A 4KG5A 1XA7A 3NC8A 2H5SA 2ZQ9A 3PAGA 3V39A 3UN7A 4EQIA 1IYQA 4LV3A 4GD8A 3MZFA 4R1GA 4B4XA 1KE4A 1Y54A 1NZUA 1W79A 3CZDA 1TDLA 1FCNA 4WELA 4DE1A 3ZFZA 3DW0A 2PU4A 3HLFA 5DF9A 4JPMA 2ZC4B 2X71A 4K91A 2Y2LA 2OLVA 4OQGA 3HL9A 3QHYA 4CJNA 2BG1A 1HTZA 4LV0A 4F94A 5JYPA 3BFCA 2HPBA 3ZHHA 4U0XA 4EBLA 1LL5A 1K56D 5CHMA 1XPBA 4U0TA 4GDBA 5L2FA 4KZAA 4JKTA 3C4PA 3ZGAB 3G2ZA 2EXAA 2RL3A 3HLBA 4PM6A 2HP6A 3NIAA 1CEFA 3UDXA 5AQBA 3UE1A 1RGZA 1ONGA 1K38A 3BLSA 3IXGA 3NCKA 1YMXA 5M18A 2I72A 3HLEA 2ZQAA 3G30A 5CHUA 3CJMA 3ZCZA 1NRFA 3N8SA 1HZOA 1M6KA 4JBFA 3Q7VB 1H8YA 3VFFA 3IF6C 3W4QA 1GA0A 3GVBA 2Y2OA 5DVAA 3LO7A 3VOYA 1LI0A 1PWDA 3ISGA 3MZDA 2A49A 4GB7A 1SHVA 3N8RA 3BFFA 3PBRA 4FH4A 3ZG0A 3UPOA 2Y59A 1J9MA 1FR1A 4B88A 3FV7A 3C5AA 3HLWA 1N9BA 5CGSA 2Z2MB 1ESIA 3BM6A 1SDNA 4WYYA 2H0TA 1IYSA 4GDNA 2HDUA 4E3NA 1PI5A 4FSFA 4ZAMA 2RCXA 5AQAA 1FCMA
chains in the Genus database with same CATH superfamily
4NKPA 3ZVWA 3MKEA 4I5SA 3G35A 1ES2A 2GZAA 3IH9A 3K2NA 5EUAA 5IU1A 2WKHA 3D72A 1DJAA 5EOEA 5GHZA 1FIKA 1ES3A 2X02A 4S2LA 3O87A 1BYWA 3ZDJA 2EX9A 3BJNA 3S7NA 2X01A 3CPTA 4KZ9A 2EWVA 5J4EA 1WE4A 2QYBA 2ZM2A 1ALQA 3T4TA 3LY3A 1T1AA 4PM9A 4BL3A 1AWIA 5DTTA 3BLMA 5DKLA 4ZJ3A 2V9AA 4PPRA 1DP9A 4OPYA 5EVIA 2WAFA 2JE5A 3G31A 1G68A 3LGOA 4JXSA 1TS8A 1V9ZA 5G18A 1XFNA 4ZBEA 3IWQA 4R3BA 3GDIA 1DJBA 4P6ZM 3AGEA 1KDWA 2LB5A 2DRWA 2WGIA 3M6BA 1OTBA 4C6YA 4D2OA 2W1RA 2W3DA 1I2SA 4ZRRA 3E4PA 2QMIA 1Z6FA 4R4SA 3ZNYA 3W4OA 2HP9A 3SS4A 4KZBA 5K5BA 4JGPA 4NXEA 3R7WB 1JVJA 4QWOA 2IA2A 1YKDA 4GHIA 5HARA 1K55C 2ZM0A 1K4EA 3KYQA 3PXPA 3BFDA 3NOPC 4E3MA 3EWKA 1T1CA 2EX8A 5U47A 2PDRA 4X69A 3S7QA 4DKIA 3MFDA 2J9OA 4CLCB 3SOIA 3QP1A 3OCNA 2LB9A 2WUQA 1ES4A 3PYPA 4OONA 1S4SA 3IT9A 1VEUB 3G4PA 1K57C 3V3RA 2IWDA 1K6SA 2JN7A 1HVBA 4L0LA 2HF6A 1GSWA 1PYYA 5FDSA 5FAPA 1ES5A 2V8CA 3IH8A 1CI8A 1YSPA 2PHYA 3IXBA 3OCLA 3ZQ5A 2PAVP 3FWLA 5AVEA 5FDHA 1DJCA 2BASA 1QMEA 4WBGA 3DTIA 4UQIS 3IXHA 1L0FA 3HJKA 3CAXA 4QY5A 4A5RA 1YLPA 1YLTA 3A3EA 1FCOA 2Y2GA 1OJGA 4ARZA 4EW7A 4X56A 4FH2A 3B3XA 2E8JA 4WZ5C 3W8KA 3EEAA 4P6BA 2E8IA 3T4OA 2P9VA 3H82B 3NULA 5F5YA 3A0SA 4MBHA 3TG9A 4YOFA 4PKYG 4UHUA 4CLCC 5J7EA 1W8YA 5E2GA 2QJ5A 5FQJA 3KYEA 2OV5A 1C3BA 5FI2A 3NHQA 3LCEA 4QD4A 3BEBA 4DMZA 3UMEA 1KGFA 3S7PA 4BMWA 1W63Q 4ID4A 1IEMA 2OSUA 3FYZA 3ZG9B 3N7WA 4WEKA 1K55A 5EECA 3NDEA 2WGWB 5L8MA 1JTDA 4LV1A 4NXFA 3F1NB 2OOLA 3IHBA 1KVMA 3KYZA 5D3OA 4I3JA 3B33A 5TJJA 4OLGA 4X25A 2OAQ1 1ERQA 4HBTA 3MF0A 5FQ9A 4P6ZS 5GHXA 2PRFA 2B18A 2PR5A 1K57A 3BY9A 4GLQA 4XXRA 3V3SA 5HW3A 1OTEA 2ZQ8A 3MQ0A 4BQMA 4Y7PA 3Q07A 4C3QA 4ZJ2A 4Y5FA 3HLCA 4II7A 4HQAA 2Q9MA 1TF1A 5E43A 3F1PB 3HREA 4D60A 3RXXA 4IBRA 5BOHA 2NUPC 1BLCA 2Y91A 4WZ5A 4Q0HA 2B95A 4B93A 3MXQA 2J80A 4Z9QA 5DFXA 5CHJA 5E2HA 2WKRA 1BUEA 3EGDC 4CLCA 3C7VA 4Y2FA 4S2OA 4AFIA 4PMAA 4OPQA 3TRCA 1JTGA 4HP9A 3T1RA 4WUJA 3IBRA 3UB6A 1JWZA 1OTIA 1CK3A 4FD8A 1FR6A 2J8YA 4DN0A 4HP4A 2DNSA 2M7UA 4JXWA 3G2YA 2QJ7A 3ZG7B 3Q7ZA 4WEJA 2O99A 4FOFA 1CEGA 2J3WA 1TDLA 4WELA 4DE1A 4HI4A 1VETA 2OLVA 3V67A 2HZ5A 3H82A 3ULFA 5MC7A 3PHYA 1RGZA 3BLSA 3IXGA 3NCKA 4WL9A 4HJ3A 2I72A 4FTXA 5CHUA 1NRFA 3IF6C 2JHEA 1GA0A 3LIEA 5EVEA 1SKOA 2A49A 5EV0A 3T4KA 3UPOA 4WN5A 1N9BA 2Z2MB 1ESIA 1SDNA 4WYYA 5FEFA 4ZAMA 2RCXA 1QMFA 4BBUA 3IS2A 5HD5A 1MWUA 4KZ7A 3A3IA 1W63M 3IQAA 5IS1A 4EESA 3KSGA 3PBSA 3C8CA 1S66L 4ZTKA 3Q82A 2WGWA 1LLBA 2VV8A 5F83A 2Y8HA 1ZC2A 1RGYA 3TW8A 4EBPA 1OTDA 2ZC5B 3PBTA 2KDKA 3MKFA 1G6OA 4EEPA 5AQ7A 3OPHA 3ZYTA 3MFXA 2IWBA 4UA6A 5DJTA 4DXBA 1N4OA 3UO9A 1EROA 2EA9A 1IELA 5EVID 4XUXA 1PNEA 2ZM8A 4EETB 2WYXA 1K54A 3LFVA 3N4IA 5E2FA 4IEDA 2L4RA 3JYIA 2VJWA 3UPPA 5FL3A 2A3UA 4GKUA 1F2KA 4WF0A 5KSCA 3OBFA 4MBFA 1PI4A 3F1PA 4I3AA 5HDDA 5TFQA 1MXOA 2EFUA 3M2JA 1NYYA 3K3CA 1YLZA 5HWTA 5I5LA 3SH7A 1F5MA 2OWJA 1LSXA 5KZHA 3P7NA 2B5RA 3IF6A 2FFYA 3NBLA 1YLJA 2QWSA 3O3VA 5HPIA 2Y4AA 3OLOA 2ZQDA 3NDGA 4MBKA 4EUZA 3GR2A 1IOUA 4WMCA 2VV7A 1E3UD 4JLFA 3UB7A 1JWPA 4DJ3A 1D7EA 1KOUA 5AQ9A 1CJFA 1KGGA 1BTLA 3HLDA 1MPLA 4KZ3A 4Y0UA 3VE4A 4DXCA 4IVIA 1LL8A 3CITA 4JGRA 5L07A 4JF6A 2W1TB 1TS0A 4JF5A 4OQIA 4L9EA 4H6JB 4EU0A 3PBNA 1L2SA 3D3OA 4G3WA 1TS6A 4S2NC 1P9RA 3T4LA 1Y4OA 3M2KA 4MN6A 4EXOA 3FG8A 2XF3A 1Z09A 4HHDA 1XA1A 4EV4A 3G6OA 3MZEA 3SS3A 3OC2A 4GD6A 3MBZA 3DTMA 3EQVA 3DWZA 5KMWA 2XD5A 4QB8A 4B4ZA 4O8GA 1NY0A 5FQMA 3A3DA 3IF5A 5HAIA 1K4FA 2PU2A 2EFXA 4RYEA 4PM8A 3WRTA 4PHTA 4PAUA 5GL9A 5HPFA 5A91A 1G6AA 4S2PA 3UE0A 4DRTA 4R4RA 2PYPA 3UB5P 3T4JA 2K2NA 2KOIA 4JF4A 1EW0A 4R6LA 4MLLA 2FZ0A 3E2KA 1PW1A 3LR3A 5CTMA 4IJGA 1PZPA 3OPPA 4QU3A 3K3DA 2XH9A 3LY4A 5FQKA 4MEZA 5F1FA 1MBLA 5FASA 4LRYC 3LICA 1NRJA 1W8QA 2Q9NA 2FH5A 3HJIA 4WM9A 2UWXA 3IXDA 4KZ4A 3OPLA 4ME4A 4JXVA 2W3HA 3P98A 3RTYA 4XT2A 3CWFA 1E3UA 2A24B 3VP3A 3D9YA 1YM1A 1BZAA 2BTFP 2Z6CA 4E3IA 3CUEC 4FUWA 1L0EA 1YAXA 3UDFA 3C7UA 4N1XA 1W5DA 2L0WA 3VP0A 3TOIA 3AGDA 4CLCE 3ITBA 1MY8A 1I2WA 1RP5A 5CTNA 2J7VA 2B02A 2V0WA 5TBMA 5M19A 1GCEA 2VX8A 4S2NA 1BT5A 1MKIA 2XGNA 2EX6A 3UPNA 2VGLS 2ZQ7A 2BLSA 3EEHA 1VHMA 3NI9A 4DE3A 1TD5A 1GHIA 4OOLA 1E25A 5LBRA 5TR7A 4EQ1A 2Y2HA 3L9KA 3UB8A 4E6WA 4QHCA 3Q7VA 4WLAA 2JBFA 5C5KA 5E2EA 2H28A 2HP5A 1MWSA 3FPVA 5L10A 5GLAA 2Y2KA 1YT4A 1OTAA 3CMZA 2WADA 3DTKA 4OPZA 3KX0X 2A2LA 3VV4A 2P08A 2K31A 1N9NA 1YQSA 4CLCD 4Y15A 5A92A 2W3FA 4BD1A 1NWZA 2HV1A 1MC0A 3T12B 4LLOB 4GJ4A 4HJ6A 4HOIA 1EI5A 5FATA 2W1TA 1LSWA 1KGEA 4L9GA 2H10A 2WGVA 5GLCA 5IHVA 3BECA 4L9FA 4C75A 1P97A 4EQIA 2D01A 3CLOA 3UMDA 4B4XA 1Y54A 3MJQA 3LYXA 3DW0A 2PU4A 2ZC4B 3HL9A 2BG1A 3QP8A 1HTZA 5JYPA 2HPBA 3CUEA 3ZHHA 4NXGA 5CHMA 3MSHA 3E4QA 4JKTA 3C4PA 3G2ZA 3HLBA 2RL3A 4PM6A 4EERA 3UDXA 1YPRA 3T4QA 4CQHA 3HLEA 2ZQAA 3G30A 3IX8A 1D1JA 4JBFA 3W4QA 3DAVA 3E0YA 3LO7A 3VOYA 1LI0A 3LIDA 1LSVA 5CX7A 1SHVA 3N8RA 3BFFA 3PBRA 4FH4A 1FR1A 3C5AA 5CGSA 3HCYA 1IYSA 2HDUA 4E3NA 1PI5A 2V8FA 1GSXA 4QJGA 4MDZA 3H7WB 2VZWA 1PRQA 1XFQA 3IWOA 3GRJA 2XEPA 1NZOA 3R7WA 3MR0A 4NG2A 1FSWA 4RX2A 2JKTM 3FZCA 4LRXC 3NOTC 2JKGA 2XA7M 1ZG6A 4NETA 4HJ4A 5DTSA 4OQHA 3MMHA 5GLBA 2GDNA 3T1XA 1CQAA 5FQQA 1VM1A 2VK3A 4LFUA 4LV2A 4UA9A 4X1MA 1XX2A 2IWCA 2ZBBA 3C30A 3A3FA 2WZXA 3C2WA 1MKMA 4EWFA 3W2ZA 3HUOA 5HAQA 3SW1A 2ZC7A 4HH2A 4OH0A 2JKTI 5HAPA 5DF7A 1DRMA 5HSQA 1BLSA 2JCHA 3IHAA 4OQ0A 1OJ5A 1VEUA 4UEYA 1BSGA 1NLZA 4GNUA 2YKHA 2WKEA 5HDSA 5EOOA 1BLHA 2WKIA 4JGOA 3UE3A 1L0DA 1K54C 1YLYA 4K0WA 2O9AA 1KE0A 3QP4A 3OOVA 1MWRA 4JXGA 4H8RA 3BFEA 1TDGA 4BENA 4KQRA 5HD3A 1CI9A 2Y2PA 5J8XA 5L09A 3SS5A 2XQZA 4R70A 3V50A 2VA0A 4E6XA 2Y55A 3IWIA 3O86A 2INWA 5FEGA 3L7HA 4KG6A 4X53A 5JYOA 4S2IA 1IKGA 2FFFB 1XJ3A 2GX5A 4ETXA 3C38A 2Y2JA 3WS4A 2DCFA 5F69A 1A0KA 1TEMA 2OLUA 3PTEA 1XKZA 2H0YA 2XDMA 3LIAA 1ZTUA 3O5YA 3CPTB 1GA9A 4FCFA 4LCLA 1S6RA 4KENB 2HGVA 3SZTA 4YWZA 3TJZC 5TGFA 3W4PA 2CMNA 3N8LA 1N9LA 3JVVA 3SH9A 3GECA 2XLNA 4WMCD 4EEUA 2W27A 5EVIB 3BY8A 1KE3A 3VP4A 3WS1A 3BRMA 3LR0A 3GMWA 2HJEA 4HBUA 4Y3IA 4R3AA 1M40A 5FAQA 3F1NA 4EBNA 3P09A 2P7JA 2HJ9C 4I38A 3S22A 2R9WA 3M6HA 3U4LP 2V0UA 4N92A 3RXWA 3VP2A 1ZG4A 3HBRA 3RH8B 4DE0A 3KSIA 3PAEA 3VE3A 5I94A 3RJUA 2Y79A 4MN5A 4R38A 4S2MA 2V2FF 2HDSA 2W3EA 2WK0A 4GHIB 4UAAA 3FPWA 3G34A 4GW9A 1GHMA 2XSSA 2P74A 3WS5A 4OP8A 3VOLA 4KG2A 2D02A 4OLDA 1PIOA 5KSHA 2ZMAA 4QY6A 4HNBA 4KQDA 2VKSA 4E3OA 4E04A 2QKPA 2HDRA 4Q8IA 4K08A 3ITAA 2XA7S 3ZVTA 1U60A 2OWHA 4Q0IA 4ZJ1A 5AVFA 1OT6A 1UWNX 2W0NA 5HFOA 5IT5A 5F6AA 2VLGA 4HESA 4S2KA 2O9BA 4I39A 1VQQA 3T4SA 4R3JA 2JKRM 4P87A 4LRZE 1HD8A 2J9PA 2WAEA 2MJ6A 3N6IA 5M1AA 5CERA 4GN2A 4R23A 2G2WA 1H0MA 2V1ZA 4EUVA 3BYDA 3VSKA 3HLGA 2ZOIA 4LPZA 2V1BA 4OOYA 2ZD8A 1DP6A 4UQIM 3NOUC 5HL6A 4ARZB 4DE2A 2JKRI 4K0XA 2Z6DA 4X55A 3VOZA 2P9VB 1IYPA 3CG5A 5FAOA 2XROA 5FSRA 3VMAA 1NXYA 4KZ6A 1P9WA 1XGIA 3EGXC 2Q0OA 4YINA 5F1GA 4Y0TA 1FILA 4UA7A 2PBYA 1TVFA 5EFWA 2DMWA 4IUKA 1YSQA 5F82A 5A8BA 1IYOA 2P04A 4IHQA 1XJ4A 5HX9A 3S1YA 1JNUA 2VGJA 4E3LA 1F9IA 2XD1A 1FQGA 1ZHHB 3UY6A 3PBOA 1MWTA 3V5MA 1L0GA 5HWWA 4RQ9A 1KDSA 2XFTA 3NECA 5A90A 1XXMA 4DJ2A 2JKFA 1H8ZA 2CC1A 4OKPA 4BLMA 1LT0A 2PR6A 1VB6A 5FI7A 4R0QA 4LENA 4F3LB 4IUHA 5HWVA 1SDEA 4S2JA 1K6RA 3C4OA 1FOFA 2HDQA 5EM1A 3OZHA 2ZC6B 1S0WA 3ZG8B 3DWKA 3O88A 4Y0OA 2C5WB 4IVKA 2C6WB 5CECA 3VP1A 4KG5A 1XA7A 3NC8A 2H5SA 3V39A 3UN7A 4LV3A 3MZFA 3CZDA 2M1CA 1OT9A 2VEAA 3HLFA 5DF9A 4K91A 1H8MA 3QP6A 4OQGA 3T1QB 4CJNA 3QHYA 3BFCA 4MN7A 4EBLA 1K56D 1XPBA 1CF0A 4GDBA 5L2FA 2EXAA 3TE8A 2HP6A 1CEFA 1K38A 3ZCZA 1HZOA 1WA9A 4B9OA 3GVBA 5DVAA 4X1LA 1PWDA 3ISGA 3MZDA 3DTEA 3CHWP 3ZG0A 1J9MA 2PYRA 4B88A 3HLWA 4BBTA 1ACFA 4JGQA 1Y28A 3BM6A 1J3WA 1XJ2A 2H0TA 4GDNA 2I9VA 2L1MA 3T1SA 2G2UA 4GOGA 4X6TA 5EE8A 3BQ8A 2KX6A 3FC7A 3HUNA 1MZUA 3ZG5A 1PFLA 3KSFA 3ICYA 1Q2PA 3EOIA 1BLPA 1EWZA 1G5UA 4N9LA 4PM7A 3A3JA 2O9CA 1IKIA 1S1YA 3NY4A 1D06A 3KSHA 3MXSA 4X68A 2QHKA 3OPRA 4DDYA 4Y17A 1VETB 4G3VA 2Y2QA 5CGXA 1N9OA 2KLIA 3I7JA 4DDSA 2WZZA 4GZBA 4LGWA 5A93A 1K25A 3UNWA 1FSYA 3LIFA 4NK3A 5CXWA 4OOMA 3Q81A 5FQIA 5CRFA 4H6JA 1LL9A 2NUTC 1SKOB 3FKVA 4ZDXA 1O7EA 2ZJ9A 5AJGA 1OPXA 3MQQA 3PR6A 1SZVA 4P85A 2GJ3A 2W3GA 4U3TA 3IX4A 4GCZA 3QNCA 4DF6A 4PM5A 3IS2B 1V9YA 4KQQA 4RA7A 1DY6A 3WS0A 2PT7A 1K56A 1F98A 2EX2A 4HIAA 1SKFA 1PW8A 1O07A 1K0KA 5CEDA 4XUZA 4LCMA 4O0PA 4YFMA 4NEED 3WRZA 2XR0A 3A0VA 2ZOHA 3BWLA 1T1BA 3F1OB 4HH3A 3H9WA 2Y2MA 1XP4A 1ONHA 4F3LA 4MMNA 4HY8A 1XGJA 4Y13A 4E3KA 4KUKA 3TSGA 2XK1A 4P0MA 1STZA 1ESUA 2ZL1B 3D4FA 1S4RA 3U2AA 1NYMA 1X0OA 2ACGA 4CPKA 3MXRA 1IFQA 2R78A 3EQUA 2ZC3B 2K7SA 4N1HA 3QNBA 2V20A 3LIBA 1PWGA 2A24A 3AGFA 4E3JA 3FKWA 3ZNTA 3VSLA 3VFFA 1PZOA 5EVLA 2M7VA 2ZLYA 1RCJA 1P0ZA 3CI6A 3WS2A 3LEQA 2G7UA 3E2LA 1JWVA 3Q1FA 5J3WA 2ZMVA 4KUOA 1S1ZA 3R4KA 3QP2A 5F68A 2XRNA 4YNRA 1ODVA 4N9KA 3IF6B 1LI9A 4M3KA 5DFYA 1T19A 4MNRA 5DF8A 1BULA 3PBQA 4GS9B 3LI9A 5HDCA 3S4XA 5FI6A 1Q2QA 4BBVA 3SH8A 3VFHA 4HEFA 1WYCA 2VV6A 3BFGA 2VGKA 3UE6A 4I3IA 1OMEA 2ZMFA 3S7OA 3LR5A 2Z2LB 1ERMA 3BQAA 5CEBA 4G3KA 4Z1WA 2V1AA 5FA7A 3GV9A 5DTKA 3E98A 4ESPA 1DP8A 4O7DA 4BD0A 3IX3A 2Y2IA 1W7FA 3UDIA 5HL1A 2QPNA 2JC7A 3NJAA 1XJ6A 2ZQCA 5GLDA 1NJ4A 3LR4A 1LHYA 4OVDA 4OP5A 4ETZA 2PBDP 1TS7A 1AXBA 3LI8A 3HVFA 2EXBA 3GSGA 3B47A 2QZ6A 3E4OA 4OPRA 3A0RA 3UB9A 1H3QA 4BL2A 2WKQA 1I5QA 4KQOA 5G4ZA 4KZ8A 4PKYA 2Y2NA 2R9XA 3LUQA 4BJPA 2GNXA 3MS6A 1PWCA 1H5XA 1G28A 3IBJA 5GHYA 2WKPA 1NLYA 4QPRA 4MCWA 1YLWA 1SCWA 3F1OA 5DKKA 1YMSA 4BWIA 2EWWA 2PD7A 3G32A 3QP5A 4Q0JA 4WZ4A 4RVAA 5CGWA 4XT2B 3H7WA 4RX3A 5EVIC 2ZL1A 3MQOA 1ZKJA 3HUMA 3KO6A 2XFSA 1UGUA 3GQZA 1WYBA 3LEZA 4IBXA 4M4XA 1E4DA 4KZ5A 2O0YA 5EM0A 5EPHA 1HLUP 2J3TC 2OAP1 2UV0E 3GTCA 2J3TD 2YKFA 3JPUA 1GHPA 1KVLA 2AVXA 3WWXA 5HZHA 2ZQ9A 3PAGA 5TBMB 1IYQA 4GD8A 4R1GA 1KE4A 1NZUA 1W79A 3P01A 1FCNA 3B42A 3ZFZA 4JPMA 5KIZA 2X71A 1GSVA 1S67L 4O01A 2Y2LA 5DJUA 4F94A 4LV0A 2VGLM 4U0XA 1LL5A 4U0TA 4KZAA 4NXBA 3ZGAB 3NIAA 5AQBA 3UE1A 1ONGA 2PD8A 1L3LA 3BW6A 1YMXA 5M18A 3RFBA 3CJMA 3N8SA 1M6KA 3Q7VB 1H8YA 1T18A 2Y2OA 3DBAA 5G4YA 4GB7A 4GS9A 2Y59A 3FV7A 3T50A 1UWPX 3JVUA 4FSFA 5AQAA 1FCMA
chains in the Genus database with same CATH topology
1MWUA 3ZVWA 4KZ7A 3A3IA 4QJGA 2G2UA 3MKEA 4GOGA 4X6TA 5EE8A 3G35A 1ES2A 3IQAA 3IWOA 3IH9A 3GRJA 2XEPA 1NZOA 3HUNA 3PBSA 5EUAA 1FSWA 4RX2A 4ZTKA 2WKHA 3ZG5A 3Q82A 2WGWA 3FZCA 1LLBA 1DJAA 5EOEA 5GHZA 5F83A 1Q2PA 1ES3A 2X02A 4S2LA 1BLPA 1ZC2A 1ZG6A 3O87A 4NETA 5DTSA 4OQHA 3ZDJA 2EX9A 2X01A 5GLBA 2GDNA 4KZ9A 1EWZA 4N9LA 4PM7A 1RGYA 1VM1A 5FQQA 4LV2A 3A3JA 4UA9A 1WE4A 4EBPA 1XX2A 2IWCA 2ZM2A 1ALQA 1IKIA 3NY4A 3A3FA 2ZC5B 2WZXA 3LY3A 3PBTA 3MKFA 4PM9A 4BL3A 4EWFA 5HAQA 3HUOA 5AQ7A 3OPHA 5DTTA 2ZC7A 3MXSA 4OH0A 4X68A 3BLMA 2IWBA 5HAPA 4UA6A 3OPRA 5DF7A 4DDYA 4ZJ3A 1BLSA 2JCHA 1N4OA 3IHAA 4OPYA 4PPRA 4DXBA 5EVIA 4OQ0A 2Y2QA 5CGXA 3UO9A 1EROA 2WAFA 1BSGA 2JE5A 3I7JA 1IELA 5EVID 2WZZA 4DDSA 4XUXA 4GZBA 4GNUA 3G31A 1G68A 5A93A 2ZM8A 4JXSA 1K25A 5G18A 2WYXA 1K54A 2WKEA 4ZBEA 5EOOA 3IWQA 3N4IA 5E2FA 1FSYA 4R3BA 3UNWA 1BLHA 2WKIA 1DJBA 3UE3A 1L0DA 4NK3A 1K54C 3AGEA 5CXWA 1KDWA 1YLYA 4IEDA 3Q81A 4K0WA 4OOMA 5FQIA 1KE0A 2DRWA 5CRFA 2WGIA 3JYIA 1LL9A 3UPPA 3M6BA 1MWRA 4JXGA 2A3UA 3BFEA 4H8RA 4C6YA 4D2OA 4GKUA 3FKVA 4ZDXA 1TDGA 1O7EA 4BENA 1I2SA 4KQRA 2ZJ9A 5KSCA 1CI9A 2Y2PA 5J8XA 2QMIA 1Z6FA 4R4SA 4MBFA 1PI4A 3SS5A 2XQZA 3V50A 3ZNYA 4E6XA 4P85A 2Y55A 5TFQA 3W4OA 1MXOA 2HP9A 3IWIA 3O86A 2EFUA 4U3TA 4DF6A 3QNCA 3M2JA 4PM5A 1NYYA 4KG6A 4X53A 3SS4A 4S2IA 1IKGA 5JYOA 4KQQA 4RA7A 1DY6A 3WS0A 2FFFB 4KZBA 1YLZA 1K56A 3SH7A 1JVJA 2EX2A 2Y2JA 1SKFA 3WS4A 1PW8A 1O07A 5HARA 2DCFA 5CEDA 1TEMA 4XUZA 4LCMA 2OLUA 4YFMA 3PTEA 1XKZA 5KZHA 1K55C 2XDMA 2H0YA 2ZM0A 1K4EA 3WRZA 2XR0A 2B5RA 3IF6A 3BFDA 1QMFA 1GA9A 4E3MA 2FFYA 3NBLA 1YLJA 2EX8A 3O3VA 2Y2MA 5U47A 2Y4AA 4FCFA 4LCLA 1S6RA 4KENB 1XP4A 2ZQDA 4X69A 5TGFA 4DKIA 3W4PA 1ONHA 3MFDA 2J9OA 3NDGA 4MBKA 4EUZA 1XGJA 3GR2A 3N8LA 4WMCA 4E3KA 3SOIA 1E3UD 3OCNA 2WUQA 3SH9A 1ES4A 3TSGA 4JLFA 4OONA 2XLNA 2XK1A 4WMCD 5EVIB 1JWPA 4P0MA 5AQ9A 3IT9A 1KGGA 3G4PA 1BTLA 1ESUA 3D4FA 1K57C 3HLDA 1KE3A 3VP4A 1MPLA 4KZ3A 4Y0UA 2IWDA 3V3RA 3WS1A 3BRMA 1K6SA 3GMWA 1HVBA 4L0LA 4DXCA 4IVIA 1NYMA 1PYYA 4JF6A 4HBUA 5FAPA 1ES5A 4CPKA 4JF5A 3IH8A 4OQIA 1CI8A 1M40A 5FAQA 3MXRA 3PBNA 1L2SA 3EQUA 2ZC3B 4S2NC 4EBNA 3IXBA 3OCLA 3P09A 3FWLA 4N1HA 3M2KA 5FDHA 3S22A 2R9WA 2V20A 3QNBA 2XF3A 3M6HA 1PWGA 1DJCA 1QMEA 4N92A 3RXWA 3VP2A 1XA1A 4EV4A 1ZG4A 4WBGA 3AGFA 4E3JA 3HBRA 3MZEA 3SS3A 3OC2A 4GD6A 3MBZA 3IXHA 3FKWA 3DTMA 3EQVA 1L0FA 3DWZA 3VSLA 3ZNTA 4DE0A 4QY5A 3PAEA 5KMWA 4A5RA 5I94A 1YLPA 3RJUA 1YLTA 3A3EA 1FCOA 1PZOA 2XD5A 5EVLA 4QB8A 2Y2GA 2ZLYA 4B4ZA 1RCJA 4X56A 4FH2A 3WS2A 3B3XA 1NY0A 5FQMA 3A3DA 3IF5A 5HAIA 3E2LA 1JWVA 4WZ5C 3W8KA 4S2MA 1K4FA 2V2FF 2HDSA 3Q1FA 2PU2A 4P6BA 2E8IA 2EFXA 2WK0A 2P9VA 4UAAA 4RYEA 4PM8A 3WRTA 3G34A 5GL9A 1GHMA 4N9KA 3IF6B 5A91A 2P74A 4MBHA 3WS5A 3TG9A 4OP8A 1LI9A 4M3KA 4UHUA 4KG2A 1G6AA 4MNRA 4S2PA 4OLDA 3UE0A 1W8YA 4DRTA 4R4RA 5E2GA 5DF8A 1PIOA 5KSHA 5FQJA 1BULA 3PBQA 3S4XA 2OV5A 2ZMAA 5FI6A 4QY6A 1Q2QA 1C3BA 4JF4A 5FI2A 3SH8A 3LCEA 4MLLA 4QD4A 3VFHA 4E3OA 4HEFA 2HDRA 1WYCA 4Q8IA 3E2KA 3ITAA 3ZVTA 3BFGA 1U60A 1PW1A 2VGKA 3BEBA 5CTMA 1PZPA 3OPPA 1OMEA 1KGFA 4QU3A 2XH9A 3LY4A 4ID4A 1IEMA 5FQKA 2OSUA 4MEZA 4ZJ1A 2Z2LB 3FYZA 5F1FA 3ZG9B 3N7WA 1MBLA 5FASA 4WEKA 1ERMA 5HFOA 5CEBA 1K55A 5EECA 3NDEA 2WGWB 1W8QA 4HESA 4S2KA 2Q9NA 4WM9A 1JTDA 2UWXA 5FA7A 3GV9A 1VQQA 5DTKA 4LV1A 4R3JA 3IXDA 4P87A 4KZ4A 3OPLA 1HD8A 2J9PA 4JXVA 3IHBA 2WAEA 4O7DA 1KVMA 3P98A 4BD0A 5D3OA 2Y2IA 3N6IA 5M1AA 1W7FA 4GN2A 5CERA 4R23A 2G2WA 1E3UA 3VP3A 1YM1A 4OLGA 1BZAA 2V1ZA 2QPNA 1ERQA 2JC7A 3BYDA 3UDIA 4HBTA 5HL1A 3VSKA 2ZQCA 4E3IA 5FQ9A 1L0EA 5GLDA 3HLGA 1NJ4A 5GHXA 3UDFA 3C7UA 1LHYA 4OVDA 4OP5A 4OOYA 2ZD8A 4N1XA 4DE2A 1K57A 1W5DA 4XXRA 3VP0A 1AXBA 4K0XA 3V3SA 5HW3A 4X55A 3TOIA 3AGDA 3VOZA 2P9VB 3HVFA 2EXBA 1IYPA 3CG5A 3GSGA 3ITBA 5FAOA 2QZ6A 2ZQ8A 1MY8A 1I2WA 1RP5A 4BQMA 5CTNA 4OPRA 2J7VA 5FSRA 4Y7PA 3VMAA 1NXYA 3Q07A 4BL2A 5M19A 1GCEA 1I5QA 4KQOA 4KZ6A 4S2NA 4C3QA 1BT5A 1MKIA 4ZJ2A 1XGIA 2XGNA 4KZ8A 2EX6A 2Y2NA 2R9XA 3HLCA 4YINA 3UPNA 5F1GA 4Y0TA 4UA7A 4BJPA 2ZQ7A 2PBYA 2Q9MA 1TVFA 2BLSA 5E43A 5F82A 3NI9A 3HREA 1IYOA 1PWCA 1H5XA 4DE3A 1GHIA 4OOLA 3RXXA 1E25A 5GHYA 4IBRA 5BOHA 5TR7A 1BLCA 2Y2HA 2Y91A 5HX9A 1YLWA 3S1YA 4WZ5A 1SCWA 2VGJA 4E3LA 4E6WA 4QHCA 3Q7VA 2XD1A 1FQGA 2JBFA 4Z9QA 1YMSA 5E2EA 3UY6A 3G32A 2HP5A 3PBOA 1MWSA 5CHJA 5E2HA 1MWTA 3V5MA 5GLAA 2Y2KA 1YT4A 1BUEA 1L0GA 3CMZA 1KDSA 2XFTA 3C7VA 2WADA 5A90A 4S2OA 1XXMA 4OPZA 4PMAA 4OPQA 4WZ4A 1H8ZA 2CC1A 1YQSA 4OKPA 4RVAA 4BLMA 5FI7A 1JTGA 5CGWA 4R0QA 5A92A 4LENA 4RX3A 5EVIC 4BD1A 1ZKJA 3HUMA 1JWZA 1SDEA 1CK3A 2XFSA 3GQZA 4S2JA 1K6RA 3C4OA 1FR6A 4FD8A 1FOFA 2J8YA 1WYBA 3LEZA 4IBXA 1EI5A 2HDQA 1E4DA 5FATA 4KZ5A 3OZHA 2ZC6B 1S0WA 2DNSA 3ZG8B 1KGEA 4JXWA 5EPHA 3DWKA 2H10A 3G2YA 2WGVA 3GTCA 5GLCA 3ZG7B 3O88A 3Q7ZA 5IHVA 4Y0OA 4WEJA 3BECA 2C5WB 4IVKA 1CEGA 1GHPA 2C6WB 5CECA 1KVLA 3VP1A 3WWXA 4C75A 4KG5A 1XA7A 3NC8A 2H5SA 2ZQ9A 3PAGA 3V39A 3UN7A 4EQIA 1IYQA 4LV3A 4GD8A 3MZFA 4R1GA 4B4XA 1KE4A 1Y54A 1NZUA 1W79A 3CZDA 1TDLA 1FCNA 4WELA 4DE1A 3ZFZA 3DW0A 2PU4A 3HLFA 5DF9A 4JPMA 2ZC4B 2X71A 4K91A 2Y2LA 2OLVA 4OQGA 3HL9A 3QHYA 4CJNA 2BG1A 1HTZA 4LV0A 4F94A 5JYPA 3BFCA 2HPBA 3ZHHA 4U0XA 4EBLA 1LL5A 1K56D 5CHMA 1XPBA 4U0TA 4GDBA 5L2FA 4KZAA 4JKTA 3C4PA 3ZGAB 3G2ZA 2EXAA 2RL3A 3HLBA 4PM6A 2HP6A 3NIAA 1CEFA 3UDXA 5AQBA 3UE1A 1RGZA 1ONGA 1K38A 3BLSA 3IXGA 3NCKA 1YMXA 5M18A 2I72A 3HLEA 2ZQAA 3G30A 5CHUA 3CJMA 3ZCZA 1NRFA 3N8SA 1HZOA 1M6KA 4JBFA 3Q7VB 1H8YA 3VFFA 3IF6C 3W4QA 1GA0A 3GVBA 2Y2OA 5DVAA 3LO7A 3VOYA 1LI0A 1PWDA 3ISGA 3MZDA 2A49A 4GB7A 1SHVA 3N8RA 3BFFA 3PBRA 4FH4A 3ZG0A 3UPOA 2Y59A 1J9MA 1FR1A 4B88A 3FV7A 3C5AA 3HLWA 1N9BA 5CGSA 2Z2MB 1ESIA 3BM6A 1SDNA 4WYYA 2H0TA 1IYSA 4GDNA 2HDUA 4E3NA 1PI5A 4FSFA 4ZAMA 2RCXA 5AQAA 1FCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MWU A;  3ZVW A;  4KZ7 A;  3A3I A;  4QJG A;  2G2U A;  3MKE A;  4GOG A;  4X6T A;  5EE8 A;  3G35 A;  1ES2 A;  3IQA A;  3IWO A;  3IH9 A;  3GRJ A;  2XEP A;  1NZO A;  3HUN A;  3PBS A;  5EUA A;  1FSW A;  4RX2 A;  4ZTK A;  2WKH A;  3ZG5 A;  3Q82 A;  2WGW A;  3FZC A;  1LLB A;  1DJA A;  5EOE A;  5GHZ A;  5F83 A;  1Q2P A;  1ES3 A;  2X02 A;  4S2L A;  1BLP A;  1ZC2 A;  1ZG6 A;  3O87 A;  4NET A;  5DTS A;  4OQH A;  3ZDJ A;  2EX9 A;  2X01 A;  5GLB A;  2GDN A;  4KZ9 A;  1EWZ A;  4N9L A;  4PM7 A;  1RGY A;  1VM1 A;  5FQQ A;  4LV2 A;  3A3J A;  4UA9 A;  1WE4 A;  4EBP A;  1XX2 A;  2IWC A;  2ZM2 A;  1ALQ A;  1IKI A;  3NY4 A;  3A3F A;  2ZC5 B;  2WZX A;  3LY3 A;  3PBT A;  3MKF A;  4PM9 A;  4BL3 A;  4EWF A;  5HAQ A;  3HUO A;  5AQ7 A;  3OPH A;  5DTT A;  2ZC7 A;  3MXS A;  4OH0 A;  4X68 A;  3BLM A;  2IWB A;  5HAP A;  4UA6 A;  3OPR A;  5DF7 A;  4DDY A;  4ZJ3 A;  1BLS A;  2JCH A;  1N4O A;  3IHA A;  4OPY A;  4PPR A;  4DXB A;  5EVI A;  4OQ0 A;  2Y2Q A;  5CGX A;  3UO9 A;  1ERO A;  2WAF A;  1BSG A;  2JE5 A;  3I7J A;  1IEL A;  5EVI D;  2WZZ A;  4DDS A;  4XUX A;  4GZB A;  4GNU A;  3G31 A;  1G68 A;  5A93 A;  2ZM8 A;  4JXS A;  1K25 A;  5G18 A;  2WYX A;  1K54 A;  2WKE A;  4ZBE A;  5EOO A;  3IWQ A;  3N4I A;  5E2F A;  1FSY A;  4R3B A;  3UNW A;  1BLH A;  2WKI A;  1DJB A;  3UE3 A;  1L0D A;  4NK3 A;  1K54 C;  3AGE A;  5CXW A;  1KDW A;  1YLY A;  4IED A;  3Q81 A;  4K0W A;  4OOM A;  5FQI A;  1KE0 A;  2DRW A;  5CRF A;  2WGI A;  3JYI A;  1LL9 A;  3UPP A;  3M6B A;  1MWR A;  4JXG A;  2A3U A;  3BFE A;  4H8R A;  4C6Y A;  4D2O A;  4GKU A;  3FKV A;  4ZDX A;  1TDG A;  1O7E A;  4BEN A;  1I2S A;  4KQR A;  2ZJ9 A;  5KSC A;  1CI9 A;  2Y2P A;  5J8X A;  2QMI A;  1Z6F A;  4R4S A;  4MBF A;  1PI4 A;  3SS5 A;  2XQZ A;  3V50 A;  3ZNY A;  4E6X A;  4P85 A;  2Y55 A;  5TFQ A;  3W4O A;  1MXO A;  2HP9 A;  3IWI A;  3O86 A;  2EFU A;  4U3T A;  4DF6 A;  3QNC A;  3M2J A;  4PM5 A;  1NYY A;  4KG6 A;  4X53 A;  3SS4 A;  4S2I A;  1IKG A;  5JYO A;  4KQQ A;  4RA7 A;  1DY6 A;  3WS0 A;  2FFF B;  4KZB A;  1YLZ A;  1K56 A;  3SH7 A;  1JVJ A;  2EX2 A;  2Y2J A;  1SKF A;  3WS4 A;  1PW8 A;  1O07 A;  5HAR A;  2DCF A;  5CED A;  1TEM A;  4XUZ A;  4LCM A;  2OLU A;  4YFM A;  3PTE A;  1XKZ A;  5KZH A;  1K55 C;  2XDM A;  2H0Y A;  2ZM0 A;  1K4E A;  3WRZ A;  2XR0 A;  2B5R A;  3IF6 A;  3BFD A;  1QMF A;  1GA9 A;  4E3M A;  2FFY A;  3NBL A;  1YLJ A;  2EX8 A;  3O3V A;  2Y2M A;  5U47 A;  2Y4A A;  4FCF A;  4LCL A;  1S6R A;  4KEN B;  1XP4 A;  2ZQD A;  4X69 A;  5TGF A;  4DKI A;  3W4P A;  1ONH A;  3MFD A;  2J9O A;  3NDG A;  4MBK A;  4EUZ A;  1XGJ A;  3GR2 A;  3N8L A;  4WMC A;  4E3K A;  3SOI A;  1E3U D;  3OCN A;  2WUQ A;  3SH9 A;  1ES4 A;  3TSG A;  4JLF A;  4OON A;  2XLN A;  2XK1 A;  4WMC D;  5EVI B;  1JWP A;  4P0M A;  5AQ9 A;  3IT9 A;  1KGG A;  3G4P A;  1BTL A;  1ESU A;  3D4F A;  1K57 C;  3HLD A;  1KE3 A;  3VP4 A;  1MPL A;  4KZ3 A;  4Y0U A;  2IWD A;  3V3R A;  3WS1 A;  3BRM A;  1K6S A;  3GMW A;  1HVB A;  4L0L A;  4DXC A;  4IVI A;  1NYM A;  1PYY A;  4JF6 A;  4HBU A;  5FAP A;  1ES5 A;  4CPK A;  4JF5 A;  3IH8 A;  4OQI A;  1CI8 A;  1M40 A;  5FAQ A;  3MXR A;  3PBN A;  1L2S A;  3EQU A;  2ZC3 B;  4S2N C;  4EBN A;  3IXB A;  3OCL A;  3P09 A;  3FWL A;  4N1H A;  3M2K A;  5FDH A;  3S22 A;  2R9W A;  2V20 A;  3QNB A;  2XF3 A;  3M6H A;  1PWG A;  1DJC A;  1QME A;  4N92 A;  3RXW A;  3VP2 A;  1XA1 A;  4EV4 A;  1ZG4 A;  4WBG A;  3AGF A;  4E3J A;  3HBR A;  3MZE A;  3SS3 A;  3OC2 A;  4GD6 A;  3MBZ A;  3IXH A;  3FKW A;  3DTM A;  3EQV A;  1L0F A;  3DWZ A;  3VSL A;  3ZNT A;  4DE0 A;  4QY5 A;  3PAE A;  5KMW A;  4A5R A;  5I94 A;  1YLP A;  3RJU A;  1YLT A;  3A3E A;  1FCO A;  1PZO A;  2XD5 A;  5EVL A;  4QB8 A;  2Y2G A;  2ZLY A;  4B4Z A;  1RCJ A;  4X56 A;  4FH2 A;  3WS2 A;  3B3X A;  1NY0 A;  5FQM A;  3A3D A;  3IF5 A;  5HAI A;  3E2L A;  1JWV A;  4WZ5 C;  3W8K A;  4S2M A;  1K4F A;  2V2F F;  2HDS A;  3Q1F A;  2PU2 A;  4P6B A;  2E8I A;  2EFX A;  2WK0 A;  2P9V A;  4UAA A;  4RYE A;  4PM8 A;  3WRT A;  3G34 A;  5GL9 A;  1GHM A;  4N9K A;  3IF6 B;  5A91 A;  2P74 A;  4MBH A;  3WS5 A;  3TG9 A;  4OP8 A;  1LI9 A;  4M3K A;  4UHU A;  4KG2 A;  1G6A A;  4MNR A;  4S2P A;  4OLD A;  3UE0 A;  1W8Y A;  4DRT A;  4R4R A;  5E2G A;  5DF8 A;  1PIO A;  5KSH A;  5FQJ A;  1BUL A;  3PBQ A;  3S4X A;  2OV5 A;  2ZMA A;  5FI6 A;  4QY6 A;  1Q2Q A;  1C3B A;  4JF4 A;  5FI2 A;  3SH8 A;  3LCE A;  4MLL A;  4QD4 A;  3VFH A;  4E3O A;  4HEF A;  2HDR A;  1WYC A;  4Q8I A;  3E2K A;  3ITA A;  3ZVT A;  3BFG A;  1U60 A;  1PW1 A;  2VGK A;  3BEB A;  5CTM A;  1PZP A;  3OPP A;  1OME A;  1KGF A;  4QU3 A;  2XH9 A;  3LY4 A;  4ID4 A;  1IEM A;  5FQK A;  2OSU A;  4MEZ A;  4ZJ1 A;  2Z2L B;  3FYZ A;  5F1F A;  3ZG9 B;  3N7W A;  1MBL A;  5FAS A;  4WEK A;  1ERM A;  5HFO A;  5CEB A;  1K55 A;  5EEC A;  3NDE A;  2WGW B;  1W8Q A;  4HES A;  4S2K A;  2Q9N A;  4WM9 A;  1JTD A;  2UWX A;  5FA7 A;  3GV9 A;  1VQQ A;  5DTK A;  4LV1 A;  4R3J A;  3IXD A;  4P87 A;  4KZ4 A;  3OPL A;  1HD8 A;  2J9P A;  4JXV A;  3IHB A;  2WAE A;  4O7D A;  1KVM A;  3P98 A;  4BD0 A;  5D3O A;  2Y2I A;  3N6I A;  5M1A A;  1W7F A;  4GN2 A;  5CER A;  4R23 A;  2G2W A;  1E3U A;  3VP3 A;  1YM1 A;  4OLG A;  1BZA A;  2V1Z A;  2QPN A;  1ERQ A;  2JC7 A;  3BYD A;  3UDI A;  4HBT A;  5HL1 A;  3VSK A;  2ZQC A;  4E3I A;  5FQ9 A;  1L0E A;  5GLD A;  3HLG A;  1NJ4 A;  5GHX A;  3UDF A;  3C7U A;  1LHY A;  4OVD A;  4OP5 A;  4OOY A;  2ZD8 A;  4N1X A;  4DE2 A;  1K57 A;  1W5D A;  4XXR A;  3VP0 A;  1AXB A;  4K0X A;  3V3S A;  5HW3 A;  4X55 A;  3TOI A;  3AGD A;  3VOZ A;  2P9V B;  3HVF A;  2EXB A;  1IYP A;  3CG5 A;  3GSG A;  3ITB A;  5FAO A;  2QZ6 A;  2ZQ8 A;  1MY8 A;  1I2W A;  1RP5 A;  4BQM A;  5CTN A;  4OPR A;  2J7V A;  5FSR A;  4Y7P A;  3VMA A;  1NXY A;  3Q07 A;  4BL2 A;  5M19 A;  1GCE A;  1I5Q A;  4KQO A;  4KZ6 A;  4S2N A;  4C3Q A;  1BT5 A;  1MKI A;  4ZJ2 A;  1XGI A;  2XGN A;  4KZ8 A;  2EX6 A;  2Y2N A;  2R9X A;  3HLC A;  4YIN A;  3UPN A;  5F1G A;  4Y0T A;  4UA7 A;  4BJP A;  2ZQ7 A;  2PBY A;  2Q9M A;  1TVF A;  2BLS A;  5E43 A;  5F82 A;  3NI9 A;  3HRE A;  1IYO A;  1PWC A;  1H5X A;  4DE3 A;  1GHI A;  4OOL A;  3RXX A;  1E25 A;  5GHY A;  4IBR A;  5BOH A;  5TR7 A;  1BLC A;  2Y2H A;  2Y91 A;  5HX9 A;  1YLW A;  3S1Y A;  4WZ5 A;  1SCW A;  2VGJ A;  4E3L A;  4E6W A;  4QHC A;  3Q7V A;  2XD1 A;  1FQG A;  2JBF A;  4Z9Q A;  1YMS A;  5E2E A;  3UY6 A;  3G32 A;  2HP5 A;  3PBO A;  1MWS A;  5CHJ A;  5E2H A;  1MWT A;  3V5M A;  5GLA A;  2Y2K A;  1YT4 A;  1BUE A;  1L0G A;  3CMZ A;  1KDS A;  2XFT A;  3C7V A;  2WAD A;  5A90 A;  4S2O A;  1XXM A;  4OPZ A;  4PMA A;  4OPQ A;  4WZ4 A;  1H8Z A;  2CC1 A;  1YQS A;  4OKP A;  4RVA A;  4BLM A;  5FI7 A;  1JTG A;  5CGW A;  4R0Q A;  5A92 A;  4LEN A;  4RX3 A;  5EVI C;  4BD1 A;  1ZKJ A;  3HUM A;  1JWZ A;  1SDE A;  1CK3 A;  2XFS A;  3GQZ A;  4S2J A;  1K6R A;  3C4O A;  1FR6 A;  4FD8 A;  1FOF A;  2J8Y A;  1WYB A;  3LEZ A;  4IBX A;  1EI5 A;  2HDQ A;  1E4D A;  5FAT A;  4KZ5 A;  3OZH A;  2ZC6 B;  1S0W A;  2DNS A;  3ZG8 B;  1KGE A;  4JXW A;  5EPH A;  3DWK A;  2H10 A;  3G2Y A;  2WGV A;  3GTC A;  5GLC A;  3ZG7 B;  3O88 A;  3Q7Z A;  5IHV A;  4Y0O A;  4WEJ A;  3BEC A;  2C5W B;  4IVK A;  1CEG A;  1GHP A;  2C6W B;  5CEC A;  1KVL A;  3VP1 A;  3WWX A;  4C75 A;  4KG5 A;  1XA7 A;  3NC8 A;  2H5S A;  2ZQ9 A;  3PAG A;  3V39 A;  3UN7 A;  4EQI A;  1IYQ A;  4LV3 A;  4GD8 A;  3MZF A;  4R1G A;  4B4X A;  1KE4 A;  1Y54 A;  1NZU A;  1W79 A;  3CZD A;  1TDL A;  1FCN A;  4WEL A;  4DE1 A;  3ZFZ A;  3DW0 A;  2PU4 A;  3HLF A;  5DF9 A;  4JPM A;  2ZC4 B;  2X71 A;  4K91 A;  2Y2L A;  2OLV A;  4OQG A;  3HL9 A;  3QHY A;  4CJN A;  2BG1 A;  1HTZ A;  4LV0 A;  4F94 A;  5JYP A;  3BFC A;  2HPB A;  3ZHH A;  4U0X A;  4EBL A;  1LL5 A;  1K56 D;  5CHM A;  1XPB A;  4U0T A;  4GDB A;  5L2F A;  4KZA A;  4JKT A;  3C4P A;  3ZGA B;  3G2Z A;  2EXA A;  2RL3 A;  3HLB A;  4PM6 A;  2HP6 A;  3NIA A;  1CEF A;  3UDX A;  5AQB A;  3UE1 A;  1RGZ A;  1ONG A;  1K38 A;  3BLS A;  3IXG A;  3NCK A;  1YMX A;  5M18 A;  2I72 A;  3HLE A;  2ZQA A;  3G30 A;  5CHU A;  3CJM A;  3ZCZ A;  1NRF A;  3N8S A;  1HZO A;  1M6K A;  4JBF A;  3Q7V B;  1H8Y A;  3VFF A;  3IF6 C;  3W4Q A;  1GA0 A;  3GVB A;  2Y2O A;  5DVA A;  3LO7 A;  3VOY A;  1LI0 A;  1PWD A;  3ISG A;  3MZD A;  2A49 A;  4GB7 A;  1SHV A;  3N8R A;  3BFF A;  3PBR A;  4FH4 A;  3ZG0 A;  3UPO A;  2Y59 A;  1J9M A;  1FR1 A;  4B88 A;  3FV7 A;  3C5A A;  3HLW A;  1N9B A;  5CGS A;  2Z2M B;  1ESI A;  3BM6 A;  1SDN A;  4WYY A;  2H0T A;  1IYS A;  4GDN A;  2HDU A;  4E3N A;  1PI5 A;  4FSF A;  4ZAM A;  2RCX A;  5AQA A;  1FCM A; 
#chains in the Genus database with same CATH topology
 4NKP A;  3ZVW A;  3MKE A;  4I5S A;  3G35 A;  1ES2 A;  2GZA A;  3IH9 A;  3K2N A;  5EUA A;  5IU1 A;  2WKH A;  3D72 A;  1DJA A;  5EOE A;  5GHZ A;  1FIK A;  1ES3 A;  2X02 A;  4S2L A;  3O87 A;  1BYW A;  3ZDJ A;  2EX9 A;  3BJN A;  3S7N A;  2X01 A;  3CPT A;  4KZ9 A;  2EWV A;  5J4E A;  1WE4 A;  2QYB A;  2ZM2 A;  1ALQ A;  3T4T A;  3LY3 A;  1T1A A;  4PM9 A;  4BL3 A;  1AWI A;  5DTT A;  3BLM A;  5DKL A;  4ZJ3 A;  2V9A A;  4PPR A;  1DP9 A;  4OPY A;  5EVI A;  2WAF A;  2JE5 A;  3G31 A;  1G68 A;  3LGO A;  4JXS A;  1TS8 A;  1V9Z A;  5G18 A;  1XFN A;  4ZBE A;  3IWQ A;  4R3B A;  3GDI A;  1DJB A;  4P6Z M;  3AGE A;  1KDW A;  2LB5 A;  2DRW A;  2WGI A;  3M6B A;  1OTB A;  4C6Y A;  4D2O A;  2W1R A;  2W3D A;  1I2S A;  4ZRR A;  3E4P A;  2QMI A;  1Z6F A;  4R4S A;  3ZNY A;  3W4O A;  2HP9 A;  3SS4 A;  4KZB A;  5K5B A;  4JGP A;  4NXE A;  3R7W B;  1JVJ A;  4QWO A;  2IA2 A;  1YKD A;  4GHI A;  5HAR A;  1K55 C;  2ZM0 A;  1K4E A;  3KYQ A;  3PXP A;  3BFD A;  3NOP C;  4E3M A;  3EWK A;  1T1C A;  2EX8 A;  5U47 A;  2PDR A;  4X69 A;  3S7Q A;  4DKI A;  3MFD A;  2J9O A;  4CLC B;  3SOI A;  3QP1 A;  3OCN A;  2LB9 A;  2WUQ A;  1ES4 A;  3PYP A;  4OON A;  1S4S A;  3IT9 A;  1VEU B;  3G4P A;  1K57 C;  3V3R A;  2IWD A;  1K6S A;  2JN7 A;  1HVB A;  4L0L A;  2HF6 A;  1GSW A;  1PYY A;  5FDS A;  5FAP A;  1ES5 A;  2V8C A;  3IH8 A;  1CI8 A;  1YSP A;  2PHY A;  3IXB A;  3OCL A;  3ZQ5 A;  2PAV P;  3FWL A;  5AVE A;  5FDH A;  1DJC A;  2BAS A;  1QME A;  4WBG A;  3DTI A;  4UQI S;  3IXH A;  1L0F A;  3HJK A;  3CAX A;  4QY5 A;  4A5R A;  1YLP A;  1YLT A;  3A3E A;  1FCO A;  2Y2G A;  1OJG A;  4ARZ A;  4EW7 A;  4X56 A;  4FH2 A;  3B3X A;  2E8J A;  4WZ5 C;  3W8K A;  3EEA A;  4P6B A;  2E8I A;  3T4O A;  2P9V A;  3H82 B;  3NUL A;  5F5Y A;  3A0S A;  4MBH A;  3TG9 A;  4YOF A;  4PKY G;  4UHU A;  4CLC C;  5J7E A;  1W8Y A;  5E2G A;  2QJ5 A;  5FQJ A;  3KYE A;  2OV5 A;  1C3B A;  5FI2 A;  3NHQ A;  3LCE A;  4QD4 A;  3BEB A;  4DMZ A;  3UME A;  1KGF A;  3S7P A;  4BMW A;  1W63 Q;  4ID4 A;  1IEM A;  2OSU A;  3FYZ A;  3ZG9 B;  3N7W A;  4WEK A;  1K55 A;  5EEC A;  3NDE A;  2WGW B;  5L8M A;  1JTD A;  4LV1 A;  4NXF A;  3F1N B;  2OOL A;  3IHB A;  1KVM A;  3KYZ A;  5D3O A;  4I3J A;  3B33 A;  5TJJ A;  4OLG A;  4X25 A;  2OAQ 1;  1ERQ A;  4HBT A;  3MF0 A;  5FQ9 A;  4P6Z S;  5GHX A;  2PRF A;  2B18 A;  2PR5 A;  1K57 A;  3BY9 A;  4GLQ A;  4XXR A;  3V3S A;  5HW3 A;  1OTE A;  2ZQ8 A;  3MQ0 A;  4BQM A;  4Y7P A;  3Q07 A;  4C3Q A;  4ZJ2 A;  4Y5F A;  3HLC A;  4II7 A;  4HQA A;  2Q9M A;  1TF1 A;  5E43 A;  3F1P B;  3HRE A;  4D60 A;  3RXX A;  4IBR A;  5BOH A;  2NUP C;  1BLC A;  2Y91 A;  4WZ5 A;  4Q0H A;  2B95 A;  4B93 A;  3MXQ A;  2J80 A;  4Z9Q A;  5DFX A;  5CHJ A;  5E2H A;  2WKR A;  1BUE A;  3EGD C;  4CLC A;  3C7V A;  4Y2F A;  4S2O A;  4AFI A;  4PMA A;  4OPQ A;  3TRC A;  1JTG A;  4HP9 A;  3T1R A;  4WUJ A;  3IBR A;  3UB6 A;  1JWZ A;  1OTI A;  1CK3 A;  4FD8 A;  1FR6 A;  2J8Y A;  4DN0 A;  4HP4 A;  2DNS A;  2M7U A;  4JXW A;  3G2Y A;  2QJ7 A;  3ZG7 B;  3Q7Z A;  4WEJ A;  2O99 A;  4FOF A;  1CEG A;  2J3W A;  1TDL A;  4WEL A;  4DE1 A;  4HI4 A;  1VET A;  2OLV A;  3V67 A;  2HZ5 A;  3H82 A;  3ULF A;  5MC7 A;  3PHY A;  1RGZ A;  3BLS A;  3IXG A;  3NCK A;  4WL9 A;  4HJ3 A;  2I72 A;  4FTX A;  5CHU A;  1NRF A;  3IF6 C;  2JHE A;  1GA0 A;  3LIE A;  5EVE A;  1SKO A;  2A49 A;  5EV0 A;  3T4K A;  3UPO A;  4WN5 A;  1N9B A;  2Z2M B;  1ESI A;  1SDN A;  4WYY A;  5FEF A;  4ZAM A;  2RCX A;  1QMF A;  4BBU A;  3IS2 A;  5HD5 A;  1MWU A;  4KZ7 A;  3A3I A;  1W63 M;  3IQA A;  5IS1 A;  4EES A;  3KSG A;  3PBS A;  3C8C A;  1S66 L;  4ZTK A;  3Q82 A;  2WGW A;  1LLB A;  2VV8 A;  5F83 A;  2Y8H A;  1ZC2 A;  1RGY A;  3TW8 A;  4EBP A;  1OTD A;  2ZC5 B;  3PBT A;  2KDK A;  3MKF A;  1G6O A;  4EEP A;  5AQ7 A;  3OPH A;  3ZYT A;  3MFX A;  2IWB A;  4UA6 A;  5DJT A;  4DXB A;  1N4O A;  3UO9 A;  1ERO A;  2EA9 A;  1IEL A;  5EVI D;  4XUX A;  1PNE A;  2ZM8 A;  4EET B;  2WYX A;  1K54 A;  3LFV A;  3N4I A;  5E2F A;  4IED A;  2L4R A;  3JYI A;  2VJW A;  3UPP A;  5FL3 A;  2A3U A;  4GKU A;  1F2K A;  4WF0 A;  5KSC A;  3OBF A;  4MBF A;  1PI4 A;  3F1P A;  4I3A A;  5HDD A;  5TFQ A;  1MXO A;  2EFU A;  3M2J A;  1NYY A;  3K3C A;  1YLZ A;  5HWT A;  5I5L A;  3SH7 A;  1F5M A;  2OWJ A;  1LSX A;  5KZH A;  3P7N A;  2B5R A;  3IF6 A;  2FFY A;  3NBL A;  1YLJ A;  2QWS A;  3O3V A;  5HPI A;  2Y4A A;  3OLO A;  2ZQD A;  3NDG A;  4MBK A;  4EUZ A;  3GR2 A;  1IOU A;  4WMC A;  2VV7 A;  1E3U D;  4JLF A;  3UB7 A;  1JWP A;  4DJ3 A;  1D7E A;  1KOU A;  5AQ9 A;  1CJF A;  1KGG A;  1BTL A;  3HLD A;  1MPL A;  4KZ3 A;  4Y0U A;  3VE4 A;  4DXC A;  4IVI A;  1LL8 A;  3CIT A;  4JGR A;  5L07 A;  4JF6 A;  2W1T B;  1TS0 A;  4JF5 A;  4OQI A;  4L9E A;  4H6J B;  4EU0 A;  3PBN A;  1L2S A;  3D3O A;  4G3W A;  1TS6 A;  4S2N C;  1P9R A;  3T4L A;  1Y4O A;  3M2K A;  4MN6 A;  4EXO A;  3FG8 A;  2XF3 A;  1Z09 A;  4HHD A;  1XA1 A;  4EV4 A;  3G6O A;  3MZE A;  3SS3 A;  3OC2 A;  4GD6 A;  3MBZ A;  3DTM A;  3EQV A;  3DWZ A;  5KMW A;  2XD5 A;  4QB8 A;  4B4Z A;  4O8G A;  1NY0 A;  5FQM A;  3A3D A;  3IF5 A;  5HAI A;  1K4F A;  2PU2 A;  2EFX A;  4RYE A;  4PM8 A;  3WRT A;  4PHT A;  4PAU A;  5GL9 A;  5HPF A;  5A91 A;  1G6A A;  4S2P A;  3UE0 A;  4DRT A;  4R4R A;  2PYP A;  3UB5 P;  3T4J A;  2K2N A;  2KOI A;  4JF4 A;  1EW0 A;  4R6L A;  4MLL A;  2FZ0 A;  3E2K A;  1PW1 A;  3LR3 A;  5CTM A;  4IJG A;  1PZP A;  3OPP A;  4QU3 A;  3K3D A;  2XH9 A;  3LY4 A;  5FQK A;  4MEZ A;  5F1F A;  1MBL A;  5FAS A;  4LRY C;  3LIC A;  1NRJ A;  1W8Q A;  2Q9N A;  2FH5 A;  3HJI A;  4WM9 A;  2UWX A;  3IXD A;  4KZ4 A;  3OPL A;  4ME4 A;  4JXV A;  2W3H A;  3P98 A;  3RTY A;  4XT2 A;  3CWF A;  1E3U A;  2A24 B;  3VP3 A;  3D9Y A;  1YM1 A;  1BZA A;  2BTF P;  2Z6C A;  4E3I A;  3CUE C;  4FUW A;  1L0E A;  1YAX A;  3UDF A;  3C7U A;  4N1X A;  1W5D A;  2L0W A;  3VP0 A;  3TOI A;  3AGD A;  4CLC E;  3ITB A;  1MY8 A;  1I2W A;  1RP5 A;  5CTN A;  2J7V A;  2B02 A;  2V0W A;  5TBM A;  5M19 A;  1GCE A;  2VX8 A;  4S2N A;  1BT5 A;  1MKI A;  2XGN A;  2EX6 A;  3UPN A;  2VGL S;  2ZQ7 A;  2BLS A;  3EEH A;  1VHM A;  3NI9 A;  4DE3 A;  1TD5 A;  1GHI A;  4OOL A;  1E25 A;  5LBR A;  5TR7 A;  4EQ1 A;  2Y2H A;  3L9K A;  3UB8 A;  4E6W A;  4QHC A;  3Q7V A;  4WLA A;  2JBF A;  5C5K A;  5E2E A;  2H28 A;  2HP5 A;  1MWS A;  3FPV A;  5L10 A;  5GLA A;  2Y2K A;  1YT4 A;  1OTA A;  3CMZ A;  2WAD A;  3DTK A;  4OPZ A;  3KX0 X;  2A2L A;  3VV4 A;  2P08 A;  2K31 A;  1N9N A;  1YQS A;  4CLC D;  4Y15 A;  5A92 A;  2W3F A;  4BD1 A;  1NWZ A;  2HV1 A;  1MC0 A;  3T12 B;  4LLO B;  4GJ4 A;  4HJ6 A;  4HOI A;  1EI5 A;  5FAT A;  2W1T A;  1LSW A;  1KGE A;  4L9G A;  2H10 A;  2WGV A;  5GLC A;  5IHV A;  3BEC A;  4L9F A;  4C75 A;  1P97 A;  4EQI A;  2D01 A;  3CLO A;  3UMD A;  4B4X A;  1Y54 A;  3MJQ A;  3LYX A;  3DW0 A;  2PU4 A;  2ZC4 B;  3HL9 A;  2BG1 A;  3QP8 A;  1HTZ A;  5JYP A;  2HPB A;  3CUE A;  3ZHH A;  4NXG A;  5CHM A;  3MSH A;  3E4Q A;  4JKT A;  3C4P A;  3G2Z A;  3HLB A;  2RL3 A;  4PM6 A;  4EER A;  3UDX A;  1YPR A;  3T4Q A;  4CQH A;  3HLE A;  2ZQA A;  3G30 A;  3IX8 A;  1D1J A;  4JBF A;  3W4Q A;  3DAV A;  3E0Y A;  3LO7 A;  3VOY A;  1LI0 A;  3LID A;  1LSV A;  5CX7 A;  1SHV A;  3N8R A;  3BFF A;  3PBR A;  4FH4 A;  1FR1 A;  3C5A A;  5CGS A;  3HCY A;  1IYS A;  2HDU A;  4E3N A;  1PI5 A;  2V8F A;  1GSX A;  4QJG A;  4MDZ A;  3H7W B;  2VZW A;  1PRQ A;  1XFQ A;  3IWO A;  3GRJ A;  2XEP A;  1NZO A;  3R7W A;  3MR0 A;  4NG2 A;  1FSW A;  4RX2 A;  2JKT M;  3FZC A;  4LRX C;  3NOT C;  2JKG A;  2XA7 M;  1ZG6 A;  4NET A;  4HJ4 A;  5DTS A;  4OQH A;  3MMH A;  5GLB A;  2GDN A;  3T1X A;  1CQA A;  5FQQ A;  1VM1 A;  2VK3 A;  4LFU A;  4LV2 A;  4UA9 A;  4X1M A;  1XX2 A;  2IWC A;  2ZBB A;  3C30 A;  3A3F A;  2WZX A;  3C2W A;  1MKM A;  4EWF A;  3W2Z A;  3HUO A;  5HAQ A;  3SW1 A;  2ZC7 A;  4HH2 A;  4OH0 A;  2JKT I;  5HAP A;  5DF7 A;  1DRM A;  5HSQ A;  1BLS A;  2JCH A;  3IHA A;  4OQ0 A;  1OJ5 A;  1VEU A;  4UEY A;  1BSG A;  1NLZ A;  4GNU A;  2YKH A;  2WKE A;  5HDS A;  5EOO A;  1BLH A;  2WKI A;  4JGO A;  3UE3 A;  1L0D A;  1K54 C;  1YLY A;  4K0W A;  2O9A A;  1KE0 A;  3QP4 A;  3OOV A;  1MWR A;  4JXG A;  4H8R A;  3BFE A;  1TDG A;  4BEN A;  4KQR A;  5HD3 A;  1CI9 A;  2Y2P A;  5J8X A;  5L09 A;  3SS5 A;  2XQZ A;  4R70 A;  3V50 A;  2VA0 A;  4E6X A;  2Y55 A;  3IWI A;  3O86 A;  2INW A;  5FEG A;  3L7H A;  4KG6 A;  4X53 A;  5JYO A;  4S2I A;  1IKG A;  2FFF B;  1XJ3 A;  2GX5 A;  4ETX A;  3C38 A;  2Y2J A;  3WS4 A;  2DCF A;  5F69 A;  1A0K A;  1TEM A;  2OLU A;  3PTE A;  1XKZ A;  2H0Y A;  2XDM A;  3LIA A;  1ZTU A;  3O5Y A;  3CPT B;  1GA9 A;  4FCF A;  4LCL A;  1S6R A;  4KEN B;  2HGV A;  3SZT A;  4YWZ A;  3TJZ C;  5TGF A;  3W4P A;  2CMN A;  3N8L A;  1N9L A;  3JVV A;  3SH9 A;  3GEC A;  2XLN A;  4WMC D;  4EEU A;  2W27 A;  5EVI B;  3BY8 A;  1KE3 A;  3VP4 A;  3WS1 A;  3BRM A;  3LR0 A;  3GMW A;  2HJE A;  4HBU A;  4Y3I A;  4R3A A;  1M40 A;  5FAQ A;  3F1N A;  4EBN A;  3P09 A;  2P7J A;  2HJ9 C;  4I38 A;  3S22 A;  2R9W A;  3M6H A;  3U4L P;  2V0U A;  4N92 A;  3RXW A;  3VP2 A;  1ZG4 A;  3HBR A;  3RH8 B;  4DE0 A;  3KSI A;  3PAE A;  3VE3 A;  5I94 A;  3RJU A;  2Y79 A;  4MN5 A;  4R38 A;  4S2M A;  2V2F F;  2HDS A;  2W3E A;  2WK0 A;  4GHI B;  4UAA A;  3FPW A;  3G34 A;  4GW9 A;  1GHM A;  2XSS A;  2P74 A;  3WS5 A;  4OP8 A;  3VOL A;  4KG2 A;  2D02 A;  4OLD A;  1PIO A;  5KSH A;  2ZMA A;  4QY6 A;  4HNB A;  4KQD A;  2VKS A;  4E3O A;  4E04 A;  2QKP A;  2HDR A;  4Q8I A;  4K08 A;  3ITA A;  2XA7 S;  3ZVT A;  1U60 A;  2OWH A;  4Q0I A;  4ZJ1 A;  5AVF A;  1OT6 A;  1UWN X;  2W0N A;  5HFO A;  5IT5 A;  5F6A A;  2VLG A;  4HES A;  4S2K A;  2O9B A;  4I39 A;  1VQQ A;  3T4S A;  4R3J A;  2JKR M;  4P87 A;  4LRZ E;  1HD8 A;  2J9P A;  2WAE A;  2MJ6 A;  3N6I A;  5M1A A;  5CER A;  4GN2 A;  4R23 A;  2G2W A;  1H0M A;  2V1Z A;  4EUV A;  3BYD A;  3VSK A;  3HLG A;  2ZOI A;  4LPZ A;  2V1B A;  4OOY A;  2ZD8 A;  1DP6 A;  4UQI M;  3NOU C;  5HL6 A;  4ARZ B;  4DE2 A;  2JKR I;  4K0X A;  2Z6D A;  4X55 A;  3VOZ A;  2P9V B;  1IYP A;  3CG5 A;  5FAO A;  2XRO A;  5FSR A;  3VMA A;  1NXY A;  4KZ6 A;  1P9W A;  1XGI A;  3EGX C;  2Q0O A;  4YIN A;  5F1G A;  4Y0T A;  1FIL A;  4UA7 A;  2PBY A;  1TVF A;  5EFW A;  2DMW A;  4IUK A;  1YSQ A;  5F82 A;  5A8B A;  1IYO A;  2P04 A;  4IHQ A;  1XJ4 A;  5HX9 A;  3S1Y A;  1JNU A;  2VGJ A;  4E3L A;  1F9I A;  2XD1 A;  1FQG A;  1ZHH B;  3UY6 A;  3PBO A;  1MWT A;  3V5M A;  1L0G A;  5HWW A;  4RQ9 A;  1KDS A;  2XFT A;  3NEC A;  5A90 A;  1XXM A;  4DJ2 A;  2JKF A;  1H8Z A;  2CC1 A;  4OKP A;  4BLM A;  1LT0 A;  2PR6 A;  1VB6 A;  5FI7 A;  4R0Q A;  4LEN A;  4F3L B;  4IUH A;  5HWV A;  1SDE A;  4S2J A;  1K6R A;  3C4O A;  1FOF A;  2HDQ A;  5EM1 A;  3OZH A;  2ZC6 B;  1S0W A;  3ZG8 B;  3DWK A;  3O88 A;  4Y0O A;  2C5W B;  4IVK A;  2C6W B;  5CEC A;  3VP1 A;  4KG5 A;  1XA7 A;  3NC8 A;  2H5S A;  3V39 A;  3UN7 A;  4LV3 A;  3MZF A;  3CZD A;  2M1C A;  1OT9 A;  2VEA A;  3HLF A;  5DF9 A;  4K91 A;  1H8M A;  3QP6 A;  4OQG A;  3T1Q B;  4CJN A;  3QHY A;  3BFC A;  4MN7 A;  4EBL A;  1K56 D;  1XPB A;  1CF0 A;  4GDB A;  5L2F A;  2EXA A;  3TE8 A;  2HP6 A;  1CEF A;  1K38 A;  3ZCZ A;  1HZO A;  1WA9 A;  4B9O A;  3GVB A;  5DVA A;  4X1L A;  1PWD A;  3ISG A;  3MZD A;  3DTE A;  3CHW P;  3ZG0 A;  1J9M A;  2PYR A;  4B88 A;  3HLW A;  4BBT A;  1ACF A;  4JGQ A;  1Y28 A;  3BM6 A;  1J3W A;  1XJ2 A;  2H0T A;  4GDN A;  2I9V A;  2L1M A;  3T1S A;  2G2U A;  4GOG A;  4X6T A;  5EE8 A;  3BQ8 A;  2KX6 A;  3FC7 A;  3HUN A;  1MZU A;  3ZG5 A;  1PFL A;  3KSF A;  3ICY A;  1Q2P A;  3EOI A;  1BLP A;  1EWZ A;  1G5U A;  4N9L A;  4PM7 A;  3A3J A;  2O9C A;  1IKI A;  1S1Y A;  3NY4 A;  1D06 A;  3KSH A;  3MXS A;  4X68 A;  2QHK A;  3OPR A;  4DDY A;  4Y17 A;  1VET B;  4G3V A;  2Y2Q A;  5CGX A;  1N9O A;  2KLI A;  3I7J A;  4DDS A;  2WZZ A;  4GZB A;  4LGW A;  5A93 A;  1K25 A;  3UNW A;  1FSY A;  3LIF A;  4NK3 A;  5CXW A;  4OOM A;  3Q81 A;  5FQI A;  5CRF A;  4H6J A;  1LL9 A;  2NUT C;  1SKO B;  3FKV A;  4ZDX A;  1O7E A;  2ZJ9 A;  5AJG A;  1OPX A;  3MQQ A;  3PR6 A;  1SZV A;  4P85 A;  2GJ3 A;  2W3G A;  4U3T A;  3IX4 A;  4GCZ A;  3QNC A;  4DF6 A;  4PM5 A;  3IS2 B;  1V9Y A;  4KQQ A;  4RA7 A;  1DY6 A;  3WS0 A;  2PT7 A;  1K56 A;  1F98 A;  2EX2 A;  4HIA A;  1SKF A;  1PW8 A;  1O07 A;  1K0K A;  5CED A;  4XUZ A;  4LCM A;  4O0P A;  4YFM A;  4NEE D;  3WRZ A;  2XR0 A;  3A0V A;  2ZOH A;  3BWL A;  1T1B A;  3F1O B;  4HH3 A;  3H9W A;  2Y2M A;  1XP4 A;  1ONH A;  4F3L A;  4MMN A;  4HY8 A;  1XGJ A;  4Y13 A;  4E3K A;  4KUK A;  3TSG A;  2XK1 A;  4P0M A;  1STZ A;  1ESU A;  2ZL1 B;  3D4F A;  1S4R A;  3U2A A;  1NYM A;  1X0O A;  2ACG A;  4CPK A;  3MXR A;  1IFQ A;  2R78 A;  3EQU A;  2ZC3 B;  2K7S A;  4N1H A;  3QNB A;  2V20 A;  3LIB A;  1PWG A;  2A24 A;  3AGF A;  4E3J A;  3FKW A;  3ZNT A;  3VSL A;  3VFF A;  1PZO A;  5EVL A;  2M7V A;  2ZLY A;  1RCJ A;  1P0Z A;  3CI6 A;  3WS2 A;  3LEQ A;  2G7U A;  3E2L A;  1JWV A;  3Q1F A;  5J3W A;  2ZMV A;  4KUO A;  1S1Z A;  3R4K A;  3QP2 A;  5F68 A;  2XRN A;  4YNR A;  1ODV A;  4N9K A;  3IF6 B;  1LI9 A;  4M3K A;  5DFY A;  1T19 A;  4MNR A;  5DF8 A;  1BUL A;  3PBQ A;  4GS9 B;  3LI9 A;  5HDC A;  3S4X A;  5FI6 A;  1Q2Q A;  4BBV A;  3SH8 A;  3VFH A;  4HEF A;  1WYC A;  2VV6 A;  3BFG A;  2VGK A;  3UE6 A;  4I3I A;  1OME A;  2ZMF A;  3S7O A;  3LR5 A;  2Z2L B;  1ERM A;  3BQA A;  5CEB A;  4G3K A;  4Z1W A;  2V1A A;  5FA7 A;  3GV9 A;  5DTK A;  3E98 A;  4ESP A;  1DP8 A;  4O7D A;  4BD0 A;  3IX3 A;  2Y2I A;  1W7F A;  3UDI A;  5HL1 A;  2QPN A;  2JC7 A;  3NJA A;  1XJ6 A;  2ZQC A;  5GLD A;  1NJ4 A;  3LR4 A;  1LHY A;  4OVD A;  4OP5 A;  4ETZ A;  2PBD P;  1TS7 A;  1AXB A;  3LI8 A;  3HVF A;  2EXB A;  3GSG A;  3B47 A;  2QZ6 A;  3E4O A;  4OPR A;  3A0R A;  3UB9 A;  1H3Q A;  4BL2 A;  2WKQ A;  1I5Q A;  4KQO A;  5G4Z A;  4KZ8 A;  4PKY A;  2Y2N A;  2R9X A;  3LUQ A;  4BJP A;  2GNX A;  3MS6 A;  1PWC A;  1H5X A;  1G28 A;  3IBJ A;  5GHY A;  2WKP A;  1NLY A;  4QPR A;  4MCW A;  1YLW A;  1SCW A;  3F1O A;  5DKK A;  1YMS A;  4BWI A;  2EWW A;  2PD7 A;  3G32 A;  3QP5 A;  4Q0J A;  4WZ4 A;  4RVA A;  5CGW A;  4XT2 B;  3H7W A;  4RX3 A;  5EVI C;  2ZL1 A;  3MQO A;  1ZKJ A;  3HUM A;  3KO6 A;  2XFS A;  1UGU A;  3GQZ A;  1WYB A;  3LEZ A;  4IBX A;  4M4X A;  1E4D A;  4KZ5 A;  2O0Y A;  5EM0 A;  5EPH A;  1HLU P;  2J3T C;  2OAP 1;  2UV0 E;  3GTC A;  2J3T D;  2YKF A;  3JPU A;  1GHP A;  1KVL A;  2AVX A;  3WWX A;  5HZH A;  2ZQ9 A;  3PAG A;  5TBM B;  1IYQ A;  4GD8 A;  4R1G A;  1KE4 A;  1NZU A;  1W79 A;  3P01 A;  1FCN A;  3B42 A;  3ZFZ A;  4JPM A;  5KIZ A;  2X71 A;  1GSV A;  1S67 L;  4O01 A;  2Y2L A;  5DJU A;  4F94 A;  4LV0 A;  2VGL M;  4U0X A;  1LL5 A;  4U0T A;  4KZA A;  4NXB A;  3ZGA B;  3NIA A;  5AQB A;  3UE1 A;  1ONG A;  2PD8 A;  1L3L A;  3BW6 A;  1YMX A;  5M18 A;  3RFB A;  3CJM A;  3N8S A;  1M6K A;  3Q7V B;  1H8Y A;  1T18 A;  2Y2O A;  3DBA A;  5G4Y A;  4GB7 A;  4GS9 A;  2Y59 A;  3FV7 A;  3T50 A;  1UWP X;  3JVU A;  4FSF A;  5AQA A;  1FCM A; 
#chains in the Genus database with same CATH homology
 1MWU A;  3ZVW A;  4KZ7 A;  3A3I A;  4QJG A;  2G2U A;  3MKE A;  4GOG A;  4X6T A;  5EE8 A;  3G35 A;  1ES2 A;  3IQA A;  3IWO A;  3IH9 A;  3GRJ A;  2XEP A;  1NZO A;  3HUN A;  3PBS A;  5EUA A;  1FSW A;  4RX2 A;  4ZTK A;  2WKH A;  3ZG5 A;  3Q82 A;  2WGW A;  3FZC A;  1LLB A;  1DJA A;  5EOE A;  5GHZ A;  5F83 A;  1Q2P A;  1ES3 A;  2X02 A;  4S2L A;  1BLP A;  1ZC2 A;  1ZG6 A;  3O87 A;  4NET A;  5DTS A;  4OQH A;  3ZDJ A;  2EX9 A;  2X01 A;  5GLB A;  2GDN A;  4KZ9 A;  1EWZ A;  4N9L A;  4PM7 A;  1RGY A;  1VM1 A;  5FQQ A;  4LV2 A;  3A3J A;  4UA9 A;  1WE4 A;  4EBP A;  1XX2 A;  2IWC A;  2ZM2 A;  1ALQ A;  1IKI A;  3NY4 A;  3A3F A;  2ZC5 B;  2WZX A;  3LY3 A;  3PBT A;  3MKF A;  4PM9 A;  4BL3 A;  4EWF A;  5HAQ A;  3HUO A;  5AQ7 A;  3OPH A;  5DTT A;  2ZC7 A;  3MXS A;  4OH0 A;  4X68 A;  3BLM A;  2IWB A;  5HAP A;  4UA6 A;  3OPR A;  5DF7 A;  4DDY A;  4ZJ3 A;  1BLS A;  2JCH A;  1N4O A;  3IHA A;  4OPY A;  4PPR A;  4DXB A;  5EVI A;  4OQ0 A;  2Y2Q A;  5CGX A;  3UO9 A;  1ERO A;  2WAF A;  1BSG A;  2JE5 A;  3I7J A;  1IEL A;  5EVI D;  2WZZ A;  4DDS A;  4XUX A;  4GZB A;  4GNU A;  3G31 A;  1G68 A;  5A93 A;  2ZM8 A;  4JXS A;  1K25 A;  5G18 A;  2WYX A;  1K54 A;  2WKE A;  4ZBE A;  5EOO A;  3IWQ A;  3N4I A;  5E2F A;  1FSY A;  4R3B A;  3UNW A;  1BLH A;  2WKI A;  1DJB A;  3UE3 A;  1L0D A;  4NK3 A;  1K54 C;  3AGE A;  5CXW A;  1KDW A;  1YLY A;  4IED A;  3Q81 A;  4K0W A;  4OOM A;  5FQI A;  1KE0 A;  2DRW A;  5CRF A;  2WGI A;  3JYI A;  1LL9 A;  3UPP A;  3M6B A;  1MWR A;  4JXG A;  2A3U A;  3BFE A;  4H8R A;  4C6Y A;  4D2O A;  4GKU A;  3FKV A;  4ZDX A;  1TDG A;  1O7E A;  4BEN A;  1I2S A;  4KQR A;  2ZJ9 A;  5KSC A;  1CI9 A;  2Y2P A;  5J8X A;  2QMI A;  1Z6F A;  4R4S A;  4MBF A;  1PI4 A;  3SS5 A;  2XQZ A;  3V50 A;  3ZNY A;  4E6X A;  4P85 A;  2Y55 A;  5TFQ A;  3W4O A;  1MXO A;  2HP9 A;  3IWI A;  3O86 A;  2EFU A;  4U3T A;  4DF6 A;  3QNC A;  3M2J A;  4PM5 A;  1NYY A;  4KG6 A;  4X53 A;  3SS4 A;  4S2I A;  1IKG A;  5JYO A;  4KQQ A;  4RA7 A;  1DY6 A;  3WS0 A;  2FFF B;  4KZB A;  1YLZ A;  1K56 A;  3SH7 A;  1JVJ A;  2EX2 A;  2Y2J A;  1SKF A;  3WS4 A;  1PW8 A;  1O07 A;  5HAR A;  2DCF A;  5CED A;  1TEM A;  4XUZ A;  4LCM A;  2OLU A;  4YFM A;  3PTE A;  1XKZ A;  5KZH A;  1K55 C;  2XDM A;  2H0Y A;  2ZM0 A;  1K4E A;  3WRZ A;  2XR0 A;  2B5R A;  3IF6 A;  3BFD A;  1QMF A;  1GA9 A;  4E3M A;  2FFY A;  3NBL A;  1YLJ A;  2EX8 A;  3O3V A;  2Y2M A;  5U47 A;  2Y4A A;  4FCF A;  4LCL A;  1S6R A;  4KEN B;  1XP4 A;  2ZQD A;  4X69 A;  5TGF A;  4DKI A;  3W4P A;  1ONH A;  3MFD A;  2J9O A;  3NDG A;  4MBK A;  4EUZ A;  1XGJ A;  3GR2 A;  3N8L A;  4WMC A;  4E3K A;  3SOI A;  1E3U D;  3OCN A;  2WUQ A;  3SH9 A;  1ES4 A;  3TSG A;  4JLF A;  4OON A;  2XLN A;  2XK1 A;  4WMC D;  5EVI B;  1JWP A;  4P0M A;  5AQ9 A;  3IT9 A;  1KGG A;  3G4P A;  1BTL A;  1ESU A;  3D4F A;  1K57 C;  3HLD A;  1KE3 A;  3VP4 A;  1MPL A;  4KZ3 A;  4Y0U A;  2IWD A;  3V3R A;  3WS1 A;  3BRM A;  1K6S A;  3GMW A;  1HVB A;  4L0L A;  4DXC A;  4IVI A;  1NYM A;  1PYY A;  4JF6 A;  4HBU A;  5FAP A;  1ES5 A;  4CPK A;  4JF5 A;  3IH8 A;  4OQI A;  1CI8 A;  1M40 A;  5FAQ A;  3MXR A;  3PBN A;  1L2S A;  3EQU A;  2ZC3 B;  4S2N C;  4EBN A;  3IXB A;  3OCL A;  3P09 A;  3FWL A;  4N1H A;  3M2K A;  5FDH A;  3S22 A;  2R9W A;  2V20 A;  3QNB A;  2XF3 A;  3M6H A;  1PWG A;  1DJC A;  1QME A;  4N92 A;  3RXW A;  3VP2 A;  1XA1 A;  4EV4 A;  1ZG4 A;  4WBG A;  3AGF A;  4E3J A;  3HBR A;  3MZE A;  3SS3 A;  3OC2 A;  4GD6 A;  3MBZ A;  3IXH A;  3FKW A;  3DTM A;  3EQV A;  1L0F A;  3DWZ A;  3VSL A;  3ZNT A;  4DE0 A;  4QY5 A;  3PAE A;  5KMW A;  4A5R A;  5I94 A;  1YLP A;  3RJU A;  1YLT A;  3A3E A;  1FCO A;  1PZO A;  2XD5 A;  5EVL A;  4QB8 A;  2Y2G A;  2ZLY A;  4B4Z A;  1RCJ A;  4X56 A;  4FH2 A;  3WS2 A;  3B3X A;  1NY0 A;  5FQM A;  3A3D A;  3IF5 A;  5HAI A;  3E2L A;  1JWV A;  4WZ5 C;  3W8K A;  4S2M A;  1K4F A;  2V2F F;  2HDS A;  3Q1F A;  2PU2 A;  4P6B A;  2E8I A;  2EFX A;  2WK0 A;  2P9V A;  4UAA A;  4RYE A;  4PM8 A;  3WRT A;  3G34 A;  5GL9 A;  1GHM A;  4N9K A;  3IF6 B;  5A91 A;  2P74 A;  4MBH A;  3WS5 A;  3TG9 A;  4OP8 A;  1LI9 A;  4M3K A;  4UHU A;  4KG2 A;  1G6A A;  4MNR A;  4S2P A;  4OLD A;  3UE0 A;  1W8Y A;  4DRT A;  4R4R A;  5E2G A;  5DF8 A;  1PIO A;  5KSH A;  5FQJ A;  1BUL A;  3PBQ A;  3S4X A;  2OV5 A;  2ZMA A;  5FI6 A;  4QY6 A;  1Q2Q A;  1C3B A;  4JF4 A;  5FI2 A;  3SH8 A;  3LCE A;  4MLL A;  4QD4 A;  3VFH A;  4E3O A;  4HEF A;  2HDR A;  1WYC A;  4Q8I A;  3E2K A;  3ITA A;  3ZVT A;  3BFG A;  1U60 A;  1PW1 A;  2VGK A;  3BEB A;  5CTM A;  1PZP A;  3OPP A;  1OME A;  1KGF A;  4QU3 A;  2XH9 A;  3LY4 A;  4ID4 A;  1IEM A;  5FQK A;  2OSU A;  4MEZ A;  4ZJ1 A;  2Z2L B;  3FYZ A;  5F1F A;  3ZG9 B;  3N7W A;  1MBL A;  5FAS A;  4WEK A;  1ERM A;  5HFO A;  5CEB A;  1K55 A;  5EEC A;  3NDE A;  2WGW B;  1W8Q A;  4HES A;  4S2K A;  2Q9N A;  4WM9 A;  1JTD A;  2UWX A;  5FA7 A;  3GV9 A;  1VQQ A;  5DTK A;  4LV1 A;  4R3J A;  3IXD A;  4P87 A;  4KZ4 A;  3OPL A;  1HD8 A;  2J9P A;  4JXV A;  3IHB A;  2WAE A;  4O7D A;  1KVM A;  3P98 A;  4BD0 A;  5D3O A;  2Y2I A;  3N6I A;  5M1A A;  1W7F A;  4GN2 A;  5CER A;  4R23 A;  2G2W A;  1E3U A;  3VP3 A;  1YM1 A;  4OLG A;  1BZA A;  2V1Z A;  2QPN A;  1ERQ A;  2JC7 A;  3BYD A;  3UDI A;  4HBT A;  5HL1 A;  3VSK A;  2ZQC A;  4E3I A;  5FQ9 A;  1L0E A;  5GLD A;  3HLG A;  1NJ4 A;  5GHX A;  3UDF A;  3C7U A;  1LHY A;  4OVD A;  4OP5 A;  4OOY A;  2ZD8 A;  4N1X A;  4DE2 A;  1K57 A;  1W5D A;  4XXR A;  3VP0 A;  1AXB A;  4K0X A;  3V3S A;  5HW3 A;  4X55 A;  3TOI A;  3AGD A;  3VOZ A;  2P9V B;  3HVF A;  2EXB A;  1IYP A;  3CG5 A;  3GSG A;  3ITB A;  5FAO A;  2QZ6 A;  2ZQ8 A;  1MY8 A;  1I2W A;  1RP5 A;  4BQM A;  5CTN A;  4OPR A;  2J7V A;  5FSR A;  4Y7P A;  3VMA A;  1NXY A;  3Q07 A;  4BL2 A;  5M19 A;  1GCE A;  1I5Q A;  4KQO A;  4KZ6 A;  4S2N A;  4C3Q A;  1BT5 A;  1MKI A;  4ZJ2 A;  1XGI A;  2XGN A;  4KZ8 A;  2EX6 A;  2Y2N A;  2R9X A;  3HLC A;  4YIN A;  3UPN A;  5F1G A;  4Y0T A;  4UA7 A;  4BJP A;  2ZQ7 A;  2PBY A;  2Q9M A;  1TVF A;  2BLS A;  5E43 A;  5F82 A;  3NI9 A;  3HRE A;  1IYO A;  1PWC A;  1H5X A;  4DE3 A;  1GHI A;  4OOL A;  3RXX A;  1E25 A;  5GHY A;  4IBR A;  5BOH A;  5TR7 A;  1BLC A;  2Y2H A;  2Y91 A;  5HX9 A;  1YLW A;  3S1Y A;  4WZ5 A;  1SCW A;  2VGJ A;  4E3L A;  4E6W A;  4QHC A;  3Q7V A;  2XD1 A;  1FQG A;  2JBF A;  4Z9Q A;  1YMS A;  5E2E A;  3UY6 A;  3G32 A;  2HP5 A;  3PBO A;  1MWS A;  5CHJ A;  5E2H A;  1MWT A;  3V5M A;  5GLA A;  2Y2K A;  1YT4 A;  1BUE A;  1L0G A;  3CMZ A;  1KDS A;  2XFT A;  3C7V A;  2WAD A;  5A90 A;  4S2O A;  1XXM A;  4OPZ A;  4PMA A;  4OPQ A;  4WZ4 A;  1H8Z A;  2CC1 A;  1YQS A;  4OKP A;  4RVA A;  4BLM A;  5FI7 A;  1JTG A;  5CGW A;  4R0Q A;  5A92 A;  4LEN A;  4RX3 A;  5EVI C;  4BD1 A;  1ZKJ A;  3HUM A;  1JWZ A;  1SDE A;  1CK3 A;  2XFS A;  3GQZ A;  4S2J A;  1K6R A;  3C4O A;  1FR6 A;  4FD8 A;  1FOF A;  2J8Y A;  1WYB A;  3LEZ A;  4IBX A;  1EI5 A;  2HDQ A;  1E4D A;  5FAT A;  4KZ5 A;  3OZH A;  2ZC6 B;  1S0W A;  2DNS A;  3ZG8 B;  1KGE A;  4JXW A;  5EPH A;  3DWK A;  2H10 A;  3G2Y A;  2WGV A;  3GTC A;  5GLC A;  3ZG7 B;  3O88 A;  3Q7Z A;  5IHV A;  4Y0O A;  4WEJ A;  3BEC A;  2C5W B;  4IVK A;  1CEG A;  1GHP A;  2C6W B;  5CEC A;  1KVL A;  3VP1 A;  3WWX A;  4C75 A;  4KG5 A;  1XA7 A;  3NC8 A;  2H5S A;  2ZQ9 A;  3PAG A;  3V39 A;  3UN7 A;  4EQI A;  1IYQ A;  4LV3 A;  4GD8 A;  3MZF A;  4R1G A;  4B4X A;  1KE4 A;  1Y54 A;  1NZU A;  1W79 A;  3CZD A;  1TDL A;  1FCN A;  4WEL A;  4DE1 A;  3ZFZ A;  3DW0 A;  2PU4 A;  3HLF A;  5DF9 A;  4JPM A;  2ZC4 B;  2X71 A;  4K91 A;  2Y2L A;  2OLV A;  4OQG A;  3HL9 A;  3QHY A;  4CJN A;  2BG1 A;  1HTZ A;  4LV0 A;  4F94 A;  5JYP A;  3BFC A;  2HPB A;  3ZHH A;  4U0X A;  4EBL A;  1LL5 A;  1K56 D;  5CHM A;  1XPB A;  4U0T A;  4GDB A;  5L2F A;  4KZA A;  4JKT A;  3C4P A;  3ZGA B;  3G2Z A;  2EXA A;  2RL3 A;  3HLB A;  4PM6 A;  2HP6 A;  3NIA A;  1CEF A;  3UDX A;  5AQB A;  3UE1 A;  1RGZ A;  1ONG A;  1K38 A;  3BLS A;  3IXG A;  3NCK A;  1YMX A;  5M18 A;  2I72 A;  3HLE A;  2ZQA A;  3G30 A;  5CHU A;  3CJM A;  3ZCZ A;  1NRF A;  3N8S A;  1HZO A;  1M6K A;  4JBF A;  3Q7V B;  1H8Y A;  3VFF A;  3IF6 C;  3W4Q A;  1GA0 A;  3GVB A;  2Y2O A;  5DVA A;  3LO7 A;  3VOY A;  1LI0 A;  1PWD A;  3ISG A;  3MZD A;  2A49 A;  4GB7 A;  1SHV A;  3N8R A;  3BFF A;  3PBR A;  4FH4 A;  3ZG0 A;  3UPO A;  2Y59 A;  1J9M A;  1FR1 A;  4B88 A;  3FV7 A;  3C5A A;  3HLW A;  1N9B A;  5CGS A;  2Z2M B;  1ESI A;  3BM6 A;  1SDN A;  4WYY A;  2H0T A;  1IYS A;  4GDN A;  2HDU A;  4E3N A;  1PI5 A;  4FSF A;  4ZAM A;  2RCX A;  5AQA A;  1FCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...