1JVJA

Crystal structure of n132a mutant of tem-1 beta-lactamase in complex with a n-formimidoyl-thienamycine
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDATAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE TEM
publication title Noncovalent interaction energies in covalent complexes: TEM-1 beta-lactamase and beta-lactams.
pubmed doi rcsb
source organism Escherichia coli
total genus 91
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1jvjA00
2OLUA 1ERMA 5HX9A 3ZDJA 1K55A 1KVMA 4IBXA 1CI8A 2VGKA 2Y2QA 4YFMA 3DWZA 2WKEA 4XUZA 4JXSA 5EPHA 2ZD8A 1EROA 1FCNA 1ZKJA 2BG1A 3PAGA 4ZJ3A 3IXBA 2WZXA 3ITAA 4QY5A 4OONA 5M1AA 4DKIA 4OKPA 4XUXA 2ZM8A 1FCMA 1K4FA 4RVAA 2HP5A 4JXVA 4WZ4A 2XD5A 1BLHA 1LL9A 1MY8A 4ZBEA 3UN7A 4PM6A 4S2JA 3NC8A 3N8LA 4GB7A 4KG5A 2WUQA 1M40A 3BRMA 4LV2A 4XXRA 4LV1A 3V5MA 2HDQA 1RGYA 2JCHA 4JF6A 1GHPA 4QU3A 3RXWA 1BLPA 3EQVA 4KG6A 1IKIA 4DF6A 5D3OA 5JYOA 1M6KA 2C6WB 3JYIA 1XPBA 4GKUA 5FATA 5CERA 3UPNA 4QB8A 1DJBA 1JTDA 4KZ7A 1K54C 3BYDA 2JC7A 3IF6B 4KQQA 3OC2A 3VSLA 2IWDA 2HDUA 3N6IA 4KZAA 4OVDA 3ITBA 1MKIA 3DW0A 3LY3A 4Y0UA 3OCNA 4WELA 5JYPA 2R9XA 4NETA 1YMXA 3BFEA 1IYSA 1GCEA 4HBUA 3SH9A 2RCXA 3NBLA 3A3IA 1CEGA 3E2KA 2A3UA 3M2KA 3OPPA 1ES4A 4EWFA 5CHUA 2HDSA 5FAOA 2XD1A 3Q82A 5KSHA 4WZ5A 4R1GA 3V3SA 4GOGA 3VMAA 1NYMA 4N9LA 5A92A 3MKEA 3UDXA 3B3XA 4GD6A 1BLCA 2Y4AA 2J9OA 5EOOA 5G18A 4U0XA 1ESIA 2C5WB 3A3JA 3OCLA 1JWPA 1NZUA 2UWXA 2WKHA 3M6BA 1CEFA 3MZDA 3VFFA 4OPZA 3HUMA 3CJMA 2WGWA 4PM7A 1PZPA 1S0WA 3IH9A 1SKFA 3G34A 3FYZA 1K56A 4X53A 2WK0A 3IXHA 4C3QA 5FSRA 4S2LA 4E6XA 1L0EA 3UDFA 3VOZA 4IVIA 4B4XA 5F1GA 4C6YA 4OP5A 2HP9A 3IWIA 5EVIC 1FSWA 1PW8A 1MWTA 1HVBA 4WMCD 5IHVA 1EI5A 3PBTA 3LO7A 5GHZA 1VM1A 1PWCA 1YLJA 1YM1A 2Y2OA 2OV5A 5CRFA 5CECA 4M3KA 3MFDA 3GMWA 5FQKA 1H8YA 1GA0A 1CK3A 2WADA 3Q7VA 1ZG6A 4JF4A 3FKWA 5FDHA 3UPPA 1JWVA 1ERQA 5M19A 5CGSA 4DXCA 2EFXA 4K0XA 4MBFA 5TGFA 2HDRA 2Y2NA 5TR7A 4WEKA 5FQMA 4EBNA 4RYEA 4EV4A 1ES2A 1GHIA 1VQQA 3WS1A 2R9WA 4EUZA 2JBFA 3NI9A 2Y55A 3MKFA 2V1ZA 3CG5A 3BLMA 4E3IA 4Q8IA 2J7VA 2ZQ9A 3BECA 3ZFZA 2WGIA 4QY6A 1IELA 3V3RA 1E25A 4O7DA 5AQAA 3ZG5A 1EWZA 3FV7A 3Q1FA 4ZTKA 5L2FA 1MWSA 2H5SA 1HZOA 5FI2A 4KQOA 4DE3A 4KENB 2P9VA 3LCEA 5CTMA 5DVAA 5E2EA 3TOIA 3GRJA 4IEDA 3N7WA 1PWDA 1E4DA 2ZM0A 2WAFA 1K38A 1I5QA 5HFOA 4JXWA 1XGJA 3MZEA 4JBFA 4X55A 1QMFA 5E2HA 4OP8A 3G35A 3IWQA 4JPMA 3FZCA 3G4PA 1K4EA 4BL3A 3QNBA 5DTSA 5CEBA 3IH8A 2XFTA 1LLBA 3LY4A 2ZC6B 3IHAA 3M6HA 1BSGA 3OPLA 4EBLA 5GHXA 3PBRA 1BUEA 4OPYA 2IWCA 4PMAA 5GL9A 2B5RA 3ZVWA 3C4OA 3A3EA 4KZ6A 4KZ8A 4FCFA 2P74A 4LV0A 4B88A 3HUNA 4LENA 3EQUA 5EOEA 1RGZA 2HPBA 3PAEA 5FQJA 1O07A 3SS3A 3NY4A 3V50A 1SCWA 4KZ3A 5AQ9A 2Y59A 3VOYA 2GDNA 4N92A 1PI5A 4OPRA 2EXBA 3G2YA 1Z6FA 1FR1A 3ZNTA 1KDWA 1K55C 4E3JA 1CI9A 4JXGA 4R3JA 3Q81A 3I7JA 3CMZA 1IYQA 1FCOA 1E3UD 1PI4A 1S6RA 2XGNA 4HESA 5F1FA 2Y2LA 1K54A 3VP3A 3CZDA 5FA7A 4GD8A 1FQGA 2V2FF 1YLTA 4DRTA 4WMCA 4BJPA 2PU4A 3MXSA 4S2IA 5HARA 3WS0A 3E2LA 3HLCA 4UA9A 3OZHA 4KG2A 1BZAA 4ZJ2A 3UDIA 1G6AA 5GHYA 3PBSA 4WYYA 4X6TA 2Y2JA 3ZNYA 1JWZA 4P87A 5F83A 1C3BA 1LHYA 3ZG8B 5DF7A 5TFQA 3PTEA 4DDYA 1PZOA 4MLLA 3DTMA 3IF6A 4E3KA 2QPNA 4E3OA 5KZHA 2XF3A 3HLDA 4QD4A 1KE4A 1W79A 2DRWA 4PM9A 4UA6A 4QJGA 3BFFA 3BEBA 3HLWA 5EVIB 2QZ6A 4MBHA 1XP4A 2H10A 3SOIA 4DE0A 4N1XA 1GA9A 3OPRA 1L0GA 3N8SA 2JE5A 4U3TA 1LI9A 2WKIA 1SHVA 4R23A 5DTKA 2PBYA 4E3MA 3G2ZA 2VGJA 2XK1A 2WGVA 3QNCA 1DJAA 1ALQA 1J9MA 3ZCZA 3O86A 4Y0OA 3GSGA 3OPHA 1HD8A 4DXBA 1BULA 4LCLA 3S4XA 1HTZA 3WRZA 1KE3A 4S2OA 4WZ5C 2Q9NA 1KGFA 1K6SA 2A49A 4UAAA 5GLCA 4ZAMA 3UNWA 4E6WA 2RL3A 4S2NA 2ZM2A 5CGWA 1N4OA 4WM9A 1TVFA 2V20A 4DE1A 3NDGA 1ZG4A 3HBRA 3G32A 4OOYA 3WRTA 4K91A 3VP4A 1FOFA 3O88A 4S2KA 1OMEA 3C5AA 1XA7A 3SH7A 5A93A 1YLYA 2EX6A 4DE2A 1I2SA 4GNUA 1W8QA 3ZG0A 1K57C 5FAQA 2Y2KA 3IF5A 4PM8A 5KMWA 3W4QA 1PYYA 5FQ9A 1Q2QA 2Y2HA 3HLGA 4KZBA 4HEFA 1XXMA 4RA7A 3MBZA 5GLBA 2ZQCA 1TDLA 4IVKA 3VFHA 4GN2A 4BENA 3WS2A 2WYXA 5EUAA 4KZ5A 2I72A 1E3UA 3UPOA 2Z2MB 1ES5A 1YLZA 5FQIA 4EQIA 1PWGA 2Z2LB 3FKVA 5A91A 3O87A 4K0WA 1ESUA 1RCJA 4RX2A 1Y54A 1LI0A 1YT4A 5EVID 1W7FA 1K25A 1YLPA 5DTTA 5GLAA 5FI6A 5CXWA 2J8YA 2OLVA 4OQGA 5E2FA 3C4PA 4OLGA 1W8YA 2EX8A 5E2GA 4DDSA 2EFUA 5DF8A 5CTNA 4F94A 5AQBA 3RXXA 4BQMA 5FQQA 4KQRA 4P85A 4PPRA 3N4IA 3AGFA 3HLFA 1MWUA 1ZC2A 1MPLA 5A90A 3NCKA 3GVBA 1Q2PA 3HREA 1PW1A 4CPKA 4E3NA 2DNSA 4BLMA 4LV3A 3GR2A 4JLFA 1L2SA 4OLDA 3ZGAB 2ZQ7A 2E8IA 1N9BA 3ZHHA 3N8RA 1I2WA 3BFGA 4EBPA 3SS4A 4Y0TA 2G2UA 1WYCA 4UA7A 1KGGA 1NXYA 3WS4A 3IXGA 4X69A 3UE3A 1YLWA 5KSCA 1ES3A 2G2WA 3P98A 4BL2A 3SS5A 3UE0A 3LEZA 2XFSA 5J8XA 1L0FA 3G30A 1WE4A 1FR6A 2OSUA 2XDMA 5HW3A 4Z9QA 1XKZA 4OOLA 5DF9A 3G31A 3ZG7B 4FH2A 4MNRA 4N9KA 4S2MA 1GHMA 3BFCA 4UHUA 4MBKA 5FAPA 5CEDA 1SDEA 4N1HA 2HP6A 2Y2GA 4FSFA 2WAEA 2ZC5B 4GDBA 3S1YA 1QMEA 1JTGA 5EVLA 2FFFB 4A5RA 4OQHA 3D4FA 3PBQA 3IWOA 4OQIA 1K6RA 2FFYA 1FSYA 5EE8A 2XQZA 3ZG9B 5HAPA 5U47A 4L0LA 1DJCA 4X56A 2H0TA 4OQ0A 5AQ7A 5FASA 2Y2MA 1IYOA 4KZ4A 3VP0A 5CHJA 2ZQ8A 3C7VA 4ZDXA 3HVFA 2DCFA 2EXAA 3UE1A 5E43A 3UY6A 1DY6A 4ID4A 3V39A 3GV9A 4CJNA 1AXBA 4R3BA 4R4RA 3IT9A 3P09A 1MXOA 3MXRA 2ZC4B 1NYYA 5I94A 2ZMAA 4X68A 3RJUA 2IWBA 3HLBA 5EVIA 3WS5A 3IF6C 4E3LA 1XX2A 1TDGA 2WZZA 3NIAA 2WGWB 3UO9A 5F82A 1ONGA 2ZC7A 4R0QA 1NY0A 4B4ZA 4OH0A 4BD1A 1NZOA 2Q9MA 2ZQAA 1KE0A 1H5XA 3AGEA 3WWXA 3PBOA 3IHBA 4OOMA 4GZBA 4IBRA 3W4OA 3VP1A 2Y2PA 4RX3A 2QMIA 1BLSA 3BLSA 4R4SA 1BTLA 2EX2A 4Y7PA 2XLNA 4HBTA 1K57A 2X02A 2ZQDA 4OPQA 4YINA 3GTCA 3IQAA 4H8RA 3Q7VB 4PM5A 3O3VA 1O7EA 4BD0A 2J9PA 5FI7A 3IXDA 2EX9A 1XA1A 3VSKA 5HL1A 2BLSA 1YQSA 1MBLA 2Y2IA 1SDNA 3DWKA 1MWRA 3W4PA 3HLEA 2X01A 3TG9A 1JVJA 1LL5A 2XR0A 4C75A 1RP5A 4S2NC 3VP2A 1BT5A 3W8KA 1ONHA 3M2JA 2Y91A 2PU2A 4QHCA 3GQZA 3HUOA 3NDEA 4WEJA 3MZFA 3ISGA 1PIOA 3A3DA 1WYBA 3BM6A 5CHMA 1H8ZA 5HAQA 4D2OA 1KDSA 3FWLA 3QHYA 3SH8A 2ZC3B 3Q07A 5M18A 2ZJ9A 3A3FA 1G68A 2P9VB 2XH9A 1IEMA 1NRFA 4S2PA 1KVLA 4GDNA 4ZJ1A 2CC1A 3AGDA 4JF5A 4KZ9A 4MEZA 1NJ4A 5BOHA 1KGEA 3S22A 4WBGA 2X71A 4FH4A 4LCMA 3C7UA 4NK3A 5CGXA 2H0YA 1W5DA 1L0DA 4P6BA 2ZLYA 4FD8A 1U60A 5EECA 3ZVTA 1IYPA 1K56D 3BFDA 1YMSA 2XEPA 1IKGA 3TSGA 1TEMA 3HL9A 5GLDA 4JKTA 5HAIA 1XGIA 3Q7ZA 4P0MA 3PBNA 4U0TA
chains in the Genus database with same CATH superfamily
3BQAA 1KVMA 2J3TD 4IBXA 3RH8B 1CI8A 1S4SA 4JXSA 5EPHA 4IJGA 1FCNA 1ZKJA 2BG1A 4OONA 5M1AA 4XUXA 4GHIA 4WZ4A 1M40A 3H82A 2V1AA 4XXRA 3LIBA 4LV1A 3IX8A 2GNXA 1GHPA 4I3AA 5EV0A 1UWPX 4ESPA 3JYIA 1XPBA 5HWTA 4GKUA 5FATA 3UPNA 2HDUA 3VE3A 3MS6A 1MZUA 2A24B 5HD5A 2A2LA 4WELA 3KX0X 5J4EA 3SH9A 3A3IA 1CEGA 3OPPA 5CHUA 4DMZA 2XD1A 4WZ5A 4DJ3A 1NYMA 3MKEA 3E98A 4CLCC 1F5MA 2UV0E 2Y4AA 2J9OA 5EOOA 3E4PA 1NLZA 2C5WB 3OCLA 2UWXA 2O9BA 4LLOB 3P01A 4CLCE 4E6XA 1L0EA 3UDFA 2WKQA 4IVIA 3DTEA 4B4XA 3L9KA 1AWIA 3LO7A 1YM1A 5CECA 5CRFA 3ICYA 4M3KA 1GA0A 3Q7VA 3FKWA 3UPPA 1P9WA 1ERQA 5M19A 2PR5A 5CGSA 4DXCA 5TBMA 2M7VA 1W63Q 2HDRA 4WEKA 4X1LA 2KX6A 5FQMA 1ES2A 1VQQA 4EUZA 2Y55A 3BLMA 3BECA 2ZL1A 3TJZC 3ZFZA 2WGIA 4QY6A 4KUKA 1EWZA 4ZTKA 2H5SA 5E2EA 3GRJA 1PWDA 1I5QA 2W0NA 4JBFA 4X55A 5E2HA 4OP8A 3G35A 4HNBA 4JPMA 1DP8A 2W3GA 3OPLA 1N9OA 3MQOA 4PMAA 1SKOA 4KZ6A 1VHMA 3EQUA 5EOEA 3V50A 5AQ9A 2Y59A 3VOYA 3G2YA 3NOPC 1Z6FA 3ZNTA 1OT6A 4HP4A 2L0WA 2J3WA 3QP6A 2XGNA 1E3UD 1PI4A 1K54A 3CZDA 2D01A 2V2FF 3W2ZA 1N9LA 4HH2A 4WUJA 4DRTA 3R7WB 2PU4A 2PT7A 3WS0A 4KG2A 2VGLS 5HDCA 3F1OB 2OAQ1 3PBSA 4WYYA 4X6TA 2Y2JA 2EWVA 4P87A 2PHYA 4BBUA 1S4RA 1LHYA 3PYPA 4E3OA 5KZHA 4UA6A 2NUPC 3MFXA 2NUTC 3T4JA 3HLWA 1GA9A 2ZOHA 2JE5A 5HDDA 3DBAA 2P08A 2PBYA 3QNCA 1ALQA 1XJ6A 3HCYA 1N9NA 4Y0OA 5AJGA 1HTZA 1P97A 1XJ3A 3WRZA 1KE3A 4S2OA 4WZ5C 2Q9NA 1K6SA 4UAAA 3UB7A 2IA2A 4WM9A 3BY9A 4DE2A 2EX6A 2W1TB 3W4QA 2Y2HA 4KZBA 1XXMA 4RA7A 5GLBA 3MSHA 1TDLA 2J3TC 4DJ2A 2WYXA 5EUAA 1CF0A 1E3UA 1ES5A 1YLZA 4EQIA 4K0WA 4PHTA 1RCJA 1Y54A 2G7UA 1YT4A 1W7FA 2JKTM 5DTTA 5GLAA 5FI6A 2J8YA 1W8YA 2EX8A 1ZHHB 4NKPA 4EXOA 4F94A 5CTNA 5FQQA 4P6ZM 3LFVA 5LBRA 4CPKA 2O9AA 2QHKA 4OLDA 3E4OA 4HJ6A 1N9BA 3N8RA 3KYEA 4EBPA 4Y0TA 2G2UA 5IT5A 1KGGA 3IXGA 1TF1A 4X69A 5A8BA 4BL2A 3UE0A 3E4QA 3LEZA 2XFSA 3LI8A 2H28A 4Z9QA 4DN0A 4OOLA 3T50A 5FAPA 1GHMA 3BFCA 4UHUA 1TD5A 3S7QA 2WKRA 4FSFA 1V9YA 4GDBA 3S1YA 1JTGA 5EVLA 4OQHA 1F9IA 3D4FA 1FSYA 5EE8A 5F5YA 2YKHA 4OQ0A 3C2WA 5CX7A 5MC7A 2FZ0A 3IT9A 4UQIS 4B9OA 2ZMAA 2ZOIA 3RJUA 5HZHA 4Y3IA 5HPIA 1TDGA 3NIAA 2WGWB 1T1BA 3C8CA 5F82A 4R0QA 3MJQA 4B4ZA 4OH0A 4BD1A 2W3HA 3AGEA 3V67A 4E04A 3T1SA 1DRMA 3VP1A 2QMIA 4IUKA 4YINA 4OPQA 3IQAA 2J9PA 5FI7A 2EX9A 5HL1A 1MBLA 3DWKA 1KOUA 3K2NA 2VA0A 4C75A 3VP2A 3OBFA 2PU2A 4QHCA 3KSIA 4WEJA 1L3LA 1PIOA 5CHMA 1WYBA 3BM6A 1H8ZA 4EW7A 3PR6A 4D2OA 3FWLA 3SH8A 2JHEA 1GSXA 1IEMA 4GDNA 3AGDA 4NXGA 2KLIA 4HQAA 2INWA 3S22A 2X71A 3CHWP 4NK3A 3ZVTA 1U60A 4Q0JA 5HPFA 2XEPA 1IKGA 5I5LA 3HL9A 2PBDP 3Q7ZA 1VB6A 1ERMA 2EWWA 3D9YA 4ETZA 3K3CA 3NULA 3T4TA 3CWFA 2WZXA 3ITAA 4QY5A 1BLHA 1LL9A 3UN7A 4PM6A 4S2JA 3NC8A 4KG5A 2WUQA 4L9FA 4F3LA 3BRMA 3V5MA 1G6OA 2OWJA 4NXEA 4PAUA 4HIAA 5D3OA 4II7A 2C6WB 5CERA 4Q0IA 1DJBA 2JC7A 3IF6B 4KQQA 4MN6A 2VV8A 3VSLA 2VV7A 3ITBA 4KUOA 4Y0UA 4RQ9A 4IUHA 4NETA 1YMXA 3BFEA 4HBUA 4H6JA 3E2KA 2HDSA 2QJ7A 2DMWA 3C38A 5KSHA 3V3SA 2L1MA 4N9LA 3CUEC 3F1NB 5G18A 1G28A 1ESIA 3A3JA 1JWPA 1NZUA 3MZDA 1CEFA 1ZTUA 1PZPA 1S0WA 1SKFA 4X53A 4C3QA 4S2LA 3VOZA 4KQDA 1W63M 3IWIA 1TS6A 1PW8A 4WMCD 1EI5A 5GHZA 1PWCA 1YLJA 2Y2OA 2OV5A 3MFDA 3B33A 1CK3A 3NOUC 4JF4A 4LRXC 4K0XA 5TGFA 2OOLA 4EU0A 2BTFP 2Q0OA 2R9WA 2JBFA 2V1ZA 3CG5A 1BYWA 5EVEA 1E25A 2Z6DA 3ZG5A 1HZOA 4KENB 3LCEA 5DVAA 4IEDA 2ZM0A 1XGJA 3G4PA 1K4EA 4BL3A 3QNBA 3O5YA 2W1RA 5L09A 3CITA 1LLBA 3IHAA 2HF6A 4XT2B 4LRZE 1UGUA 5GHXA 5GL9A 3B42A 4KZ8A 4LV0A 4GW9A 1RGZA 2HPBA 3SS3A 2PRFA 2BASA 2GDNA 1PI5A 4OPRA 4FTXA 4JXGA 3Q81A 4M4XA 1IYQA 1FCOA 5F1FA 4Y17A 2B95A 4GD8A 4WMCA 4BJPA 3MXSA 4MMNA 3UDIA 4CLCB 2XRNA 4X1MA 2VJWA 5GHYA 3A0VA 3ZNYA 3S7NA 5F69A 5DF7A 4CQHA 4MLLA 3DTMA 3R7WA 2QPNA 3MQ0A 2XF3A 3F1PA 2DRWA 1W79A 4QJGA 4PM9A 1V9ZA 4FUWA 3BFFA 5FEGA 4ARZB 2B18A 1XP4A 1MC0A 3N8SA 2PD8A 1P0ZA 5DTKA 2WGVA 5DFYA 3FPWA 1DJAA 1J9MA 3GSGA 1VETB 3OPHA 2AVXA 1HD8A 5EM0A 4LCLA 3S4XA 2JN7A 2A49A 4S2NA 2WKPA 1TVFA 2V20A 1ZG4A 4K91A 2E8JA 1FOFA 3O88A 3CI6A 5A93A 5FAQA 5KMWA 4MN5A 1PYYA 5FQ9A 1Q2QA 2VKSA 1NWZA 3VFHA 4GN2A 3WS2A 2P7JA 3KYQA 1PWGA 3FKVA 3O87A 1ESUA 5EVID 2I9VA 3NHQA 4D60A 3C4PA 4P85A 1OTIA 4GS9A 3LI9A 3HLFA 1MWUA 3NCKA 4BLMA 1L2SA 1CJFA 4GHIB 3MR0A 4UA7A 2G2WA 2V8CA 3SS5A 1D7EA 5AVFA 1S67L 1T18A 4GJ4A 3H82B 4O8GA 2XDMA 2VGLM 1XKZA 3ZG7B 5DF9A 4N9KA 4S2MA 4BBVA 1SDEA 2HP6A 2WAEA 2ZC5B 3L7HA 4A5RA 3H7WA 3LICA 1K6RA 3ZG9B 4O0PA 5U47A 4X56A 3U4LP 2Y2MA 2MJ6A 3NOTC 2ZQ8A 3TE8A 3TW8A 1CQAA 1YKDA 3D3OA 5E43A 1DY6A 4R4RA 1YSPA 1XFNA 1MXOA 3IX3A 3MXRA 4EERA 4X68A 4I5SA 2IWBA 5EVIA 3WS5A 1ODVA 1XX2A 2ZC7A 1OJGA 1VEUA 3VV4A 4R38A 2ZQAA 1KE0A 1H5XA 4OOMA 4R3AA 2Y2PA 3FG8A 4R4SA 1BTLA 2XLNA 1UWNX 1K57A 4Z1WA 2ZQDA 4LPZA 3GTCA 4H8RA 1S1ZA 3Q7VB 3ZQ5A 1O7EA 1XA1A 2JKRI 5TBMB 2Y2IA 1SDNA 1MWRA 3TG9A 1JVJA 1LL5A 4B93A 4S2NC 5HWWA 2GJ3A 2ZL1B 3NDEA 3MZFA 3ISGA 2HJ9C 1KDSA 3QP1A 3A3FA 2VV6A 3MXQA 1G68A 4HJ3A 1G5UA 1KVLA 4ZJ1A 2CC1A 4JF5A 2V8FA 2O99A 4LCMA 2QJ5A 4P6BA 1K56D 3BFDA 1YMSA 3TSGA 1TEMA 2K31A 4DE1A 4U0TA 2VX8A 1LSWA 1K55A 2VEAA 2Y2QA 3DWZA 2ZD8A 3PAGA 3IXBA 2ZM8A 2PD7A 3LEQA 1FCMA 1K4FA 2HP5A 4MN7A 3DAVA 3N8LA 4GB7A 1LSVA 4LV2A 4EEUA 4HOIA 2JCHA 3RXWA 4QU3A 3LYXA 5J7EA 3EQVA 4DF6A 5JYOA 4Y13A 3KYZA 1K54C 3BYDA 3OC2A 2IWDA 5G4ZA 4KZAA 2V1BA 5G4YA 3DW0A 3LY3A 3OCNA 3LGOA 4EESA 3JPUA 4UQIM 3IX4A 1S66L 2A3UA 3M2KA 4EWFA 3Q82A 4L9EA 4L9GA 3R4KA 1XJ2A 3B3XA 1BLCA 3IS2A 4I39A 3M6BA 2WKHA 3BQ8A 3D72A 4OPZA 4PM7A 3CJMA 3SZTA 4Y7PA 1K56A 1FILA 2WK0A 3IXHA 1PNEA 3F1NA 4NG2A 1OPXA 5F1GA 4OP5A 5EVIC 1FSWA 1MWTA 4LFUA 5L07A 4AFIA 1EW0A 4X25A 3T4KA 5EFWA 5FQKA 3BWLA 3T4SA 2WADA 3KSFA 5FDHA 2M7UA 1JWVA 4ETXA 2XA7S 4MBFA 3UB8A 2Y2NA 5TR7A 3KO6A 3NECA 3NI9A 3MKFA 4E3IA 4Q8IA 2J7VA 2ZQ9A 3V3RA 5AQAA 3Q1FA 5L2FA 1MWSA 3CPTB 5FI2A 2P9VA 1SZVA 4MDZA 5CTMA 1J3WA 3N7WA 1E4DA 1K38A 2O0YA 5HFOA 3BJNA 3A0SA 3MZEA 2HZ5A 2LB5A 2PDRA 5CEBA 2P04A 1YPRA 1DP9A 1H3QA 1BSGA 4EBLA 3PBRA 1BUEA 2B5RA 3A3EA 1GSWA 2P74A 3HUNA 3GECA 3PAEA 5FQJA 1O07A 3NY4A 1SCWA 3T4OA 4NXFA 1FR1A 4E3JA 1K55C 1WA9A 4R3JA 4LGWA 4HESA 3VP3A 3LR5A 1YLTA 3MQQA 3E2LA 3HLCA 4UA9A 3OZHA 4ZJ2A 1BZAA 5DJUA 1G6AA 3GDIA 4O01A 5F83A 1C3BA 3ZG8B 5TFQA 4BBTA 4DDYA 1PZOA 4E3KA 3T1XA 3UMDA 1KE4A 2HV1A 1MKMA 2A24A 3RTYA 4DE0A 2H10A 3SOIA 3PXPA 3OPRA 4N1XA 1L0GA 4ME4A 4U3TA 1LI9A 2WKIA 1SHVA 3G2ZA 2VGJA 2XK1A 3ZCZA 3DTIA 4ARZA 1S1YA 4QPRA 4DXBA 1KGFA 5GLCA 5IU1A 2ZM2A 2JKTI 1N4OA 3B47A 3NDGA 1OTEA 3HBRA 3G32A 3MF0A 4S2KA 1OMEA 5HL6A 3C5AA 1ACFA 1XA7A 3UB5P 1YLYA 1I2SA 3ZG0A 2Y2KA 3IF5A 4WN5A 4K08A 4BWIA 3HLGA 4HEFA 2OWHA 3MBZA 2L4RA 3H9WA 4BENA 4KZ5A 4MCWA 2I72A 1T1CA 3EGDC 3UPOA 3QP4A 5A91A 4RX2A 3LR4A 5DKLA 1YLPA 2ZMFA 2OLVA 4OQGA 5E2FA 3S7OA 4OLGA 4YWZA 5E2GA 4EEPA 2EFUA 5DF8A 2B02A 5AQBA 4BQMA 4KQRA 1OJ5A 1MPLA 5A90A 3GVBA 1A0KA 1Q2PA 4FOFA 1PW1A 4HHDA 4E3NA 2DNSA 2JKRM 2PAVP 2E8IA 3UB6A 4HI4A 1I2WA 3PHYA 3SS4A 4NEED 2VK3A 1NXYA 3WS4A 1YLWA 3P98A 4G3KA 3CAXA 5FEFA 1L0FA 3G30A 4JGQA 1WE4A 4F3LB 3HJKA 5HW3A 3TRCA 4JGPA 2ACGA 5CEDA 4N1HA 3OOVA 1QMEA 5F6AA 2FFFB 2O9CA 3PBQA 1IOUA 1LSXA 3IWOA 2FFYA 4L0LA 1DJCA 5AQ7A 5FASA 4H6JB 1IYOA 3E0YA 3F1OA 3S7PA 5HDSA 1X0OA 4ZDXA 3G6OA 2DCFA 3UE1A 3V39A 1P9RA 3GV9A 4CJNA 4R3BA 3P09A 2FH5A 2ZC4B 1NYYA 5I94A 3C30A 2WZZA 3UO9A 1NY0A 3EEAA 3WWXA 3IHBA 4GZBA 3UE6A 3LR0A 2X02A 5FL3A 4EETB 3IXDA 3VSKA 4I3IA 1H0MA 2LB9A 3W4PA 3HLEA 2X01A 1Y28A 2XR0A 1DP6A 1TS7A 1RP5A 1BT5A 2J80A 1ONHA 3M2JA 2Y91A 2W1TA 4G3VA 3OLOA 3A3DA 3LIDA 3QHYA 3Q07A 5M18A 2ZJ9A 4S2PA 4KZ9A 3A0RA 1NJ4A 5DJTA 4WBGA 1HLUP 3C7UA 1LL8A 5HD3A 5CGXA 2H0YA 4HP9A 1IYPA 4PKYA 4HH3A 5GLDA 4JKTA 4WL9A 4P0MA 3PBNA 2OLUA 5HX9A 3KSHA 3ZDJA 2VGKA 4Q0HA 4YFMA 4XUZA 2WKEA 2PYRA 2QWSA 1EROA 4ZJ3A 3LUQA 1OTAA 4DKIA 4OKPA 3VE4A 4RVAA 4JXVA 2XD5A 1MY8A 4ZBEA 1H8MA 1YAXA 2HDQA 1RGYA 4JF6A 1BLPA 4KG6A 1IKIA 1OTBA 1M6KA 4EUVA 4QB8A 1JTDA 4KZ7A 2EA9A 3N6IA 3UB9A 3F1PB 4OVDA 1MKIA 1OTDA 3BW6A 5JYPA 2R9XA 3VOLA 1IYSA 1GCEA 4R70A 2RCXA 3NBLA 5FDSA 1ES4A 4YOFA 5FAOA 4R1GA 4GOGA 4BMWA 3VMAA 5A92A 3UDXA 5DKKA 4GD6A 3KSGA 3IBRA 2W27A 4IHQA 4U0XA 4WLAA 1K0KA 3VFFA 3HUMA 2WGWA 3IH9A 3G34A 3FYZA 5FSRA 2YKFA 5IS1A 4C6YA 2HP9A 2W3DA 2PR6A 4PKYG 1HVBA 2Z6CA 5IHVA 3PBTA 1VM1A 3GMWA 1Y4OA 1H8YA 4YNRA 2JKGA 1ZG6A 3LIFA 2R78A 2M1CA 2EFXA 4EBNA 4RYEA 4EV4A 1GHIA 3WS1A 2D02A 1IELA 4O7DA 5EM1A 3FV7A 1XJ4A 2OAP1 2W3EA 4KQOA 4DE3A 3T12B 4GS9B 3TOIA 5KIZA 5DFXA 2WAFA 4JXWA 1QMFA 1SKOB 3IWQA 3FZCA 1F2KA 5DTSA 1T19A 4JGRA 3CPTA 3IH8A 2XFTA 3LY4A 2ZC6B 3M6HA 4I38A 4OPYA 2IWCA 3ZVWA 4P6ZS 3C4OA 4FCFA 2PYPA 4JGOA 4B88A 4LENA 4LRYC 4QWOA 4KZ3A 2GZAA 4N92A 2EXBA 1KDWA 1CI9A 2VZWA 3BY8A 3I7JA 3CMZA 1NLYA 1S6RA 5J3WA 2ZBBA 2Y2LA 2HGVA 3H7WB 5FA7A 1FQGA 2V9AA 2Y8HA 4S2IA 5HARA 1PRQA 1JWZA 4GCZA 3PTEA 3IF6A 5L8MA 3SW1A 3HLDA 4QD4A 3CUEA 3U2AA 1Z09A 3BEBA 5EVIB 2QZ6A 4MBHA 1XFQA 3LIEA 1VEUB 4R23A 4E3MA 3EOIA 3O86A 1BULA 1F98A 2XROA 3UNWA 4ZAMA 3T4QA 4E6WA 2RL3A 2VLGA 3QP5A 4HJ4A 5CGWA 3P7NA 5L10A 4OOYA 3WRTA 3EWKA 2V0WA 2XA7M 3VP4A 3SH7A 1NRJA 4GNUA 1W8QA 1K57C 4CLCD 1STZA 4PM8A 1OT9A 4R6LA 4NXBA 1YSQA 2ZQCA 4IVKA 3JVVA 1D1JA 2Z2MB 5TJJA 3EEHA 5FQIA 5K5BA 2Z2LB 1LI0A 5HWVA 1K25A 5CXWA 2ZMVA 4DDSA 4UEYA 3RXXA 4PPRA 4ZRRA 3N4IA 3AGFA 1ZC2A 3HREA 4LV3A 3GR2A 4JLFA 3ZGAB 2ZQ7A 3ZHHA 3BFGA 1WYCA 4Y2FA 4XT2A 5KSCA 3UE3A 1ES3A 3T4LA 5J8XA 2Y79A 1FR6A 4WF0A 2OSUA 1TS0A 3HJIA 3G31A 2GX5A 4FH2A 4GLQA 4EQ1A 4MNRA 4HY8A 1JNUA 4MBKA 2Y2GA 2K7SA 3ZYTA 4OQIA 2XQZA 5HAPA 1IFQA 3JVUA 1GSVA 2H0TA 2QYBA 4CLCA 4KZ4A 3VP0A 5CHJA 4G3WA 1PFLA 3C7VA 3HVFA 5HSQA 2EXAA 2KDKA 3UY6A 4ID4A 1AXBA 3QP2A 3IS2B 3EGXC 3RFBA 3IBJA 1TS8A 3HLBA 3IF6C 4E3LA 3T1QB 1ONGA 2CMNA 3MMHA 1NZOA 2Q9MA 5AVEA 3PBOA 4IBRA 3W4OA 3K3DA 4RX3A 1VETA 1BLSA 3BLSA 4I3JA 2EX2A 2K2NA 3LR3A 4HBTA 4PM5A 3O3VA 4BD0A 2QKPA 2BLSA 1YQSA 5F68A 3CLOA 2V0UA 1T1AA 2W3FA 3W8KA 3UMEA 2XSSA 3T1RA 2JKFA 3GQZA 3HUOA 1D06A 3QP8A 3DTKA 2KOIA 5HAQA 2ZC3B 2P9VB 2XH9A 3FC7A 1NRFA 3LIAA 2HJEA 4MEZA 5C5KA 3NJAA 5BOHA 1KGEA 3FPVA 4Y15A 3ULFA 4FH4A 1LT0A 1FIKA 1W5DA 1L0DA 5EECA 2ZLYA 4FD8A 4Y5FA 5HAIA 1XGIA
chains in the Genus database with same CATH topology
2OLUA 1ERMA 5HX9A 3ZDJA 1K55A 1KVMA 4IBXA 1CI8A 2VGKA 2Y2QA 4YFMA 3DWZA 2WKEA 4XUZA 4JXSA 5EPHA 2ZD8A 1EROA 1FCNA 1ZKJA 2BG1A 3PAGA 4ZJ3A 3IXBA 2WZXA 3ITAA 4QY5A 4OONA 5M1AA 4DKIA 4OKPA 4XUXA 2ZM8A 1FCMA 1K4FA 4RVAA 2HP5A 4JXVA 4WZ4A 2XD5A 1BLHA 1LL9A 1MY8A 4ZBEA 3UN7A 4PM6A 4S2JA 3NC8A 3N8LA 4GB7A 4KG5A 2WUQA 1M40A 3BRMA 4LV2A 4XXRA 4LV1A 3V5MA 2HDQA 1RGYA 2JCHA 4JF6A 1GHPA 4QU3A 3RXWA 1BLPA 3EQVA 4KG6A 1IKIA 4DF6A 5D3OA 5JYOA 1M6KA 2C6WB 3JYIA 1XPBA 4GKUA 5FATA 5CERA 3UPNA 4QB8A 1DJBA 1JTDA 4KZ7A 1K54C 3BYDA 2JC7A 3IF6B 4KQQA 3OC2A 3VSLA 2IWDA 2HDUA 3N6IA 4KZAA 4OVDA 3ITBA 1MKIA 3DW0A 3LY3A 4Y0UA 3OCNA 4WELA 5JYPA 2R9XA 4NETA 1YMXA 3BFEA 1IYSA 1GCEA 4HBUA 3SH9A 2RCXA 3NBLA 3A3IA 1CEGA 3E2KA 2A3UA 3M2KA 3OPPA 1ES4A 4EWFA 5CHUA 2HDSA 5FAOA 2XD1A 3Q82A 5KSHA 4WZ5A 4R1GA 3V3SA 4GOGA 3VMAA 1NYMA 4N9LA 5A92A 3MKEA 3UDXA 3B3XA 4GD6A 1BLCA 2Y4AA 2J9OA 5EOOA 5G18A 4U0XA 1ESIA 2C5WB 3A3JA 3OCLA 1JWPA 1NZUA 2UWXA 2WKHA 3M6BA 1CEFA 3MZDA 3VFFA 4OPZA 3HUMA 3CJMA 2WGWA 4PM7A 1PZPA 1S0WA 3IH9A 1SKFA 3G34A 3FYZA 1K56A 4X53A 2WK0A 3IXHA 4C3QA 5FSRA 4S2LA 4E6XA 1L0EA 3UDFA 3VOZA 4IVIA 4B4XA 5F1GA 4C6YA 4OP5A 2HP9A 3IWIA 5EVIC 1FSWA 1PW8A 1MWTA 1HVBA 4WMCD 5IHVA 1EI5A 3PBTA 3LO7A 5GHZA 1VM1A 1PWCA 1YLJA 1YM1A 2Y2OA 2OV5A 5CRFA 5CECA 4M3KA 3MFDA 3GMWA 5FQKA 1H8YA 1GA0A 1CK3A 2WADA 3Q7VA 1ZG6A 4JF4A 3FKWA 5FDHA 3UPPA 1JWVA 1ERQA 5M19A 5CGSA 4DXCA 2EFXA 4K0XA 4MBFA 5TGFA 2HDRA 2Y2NA 5TR7A 4WEKA 5FQMA 4EBNA 4RYEA 4EV4A 1ES2A 1GHIA 1VQQA 3WS1A 2R9WA 4EUZA 2JBFA 3NI9A 2Y55A 3MKFA 2V1ZA 3CG5A 3BLMA 4E3IA 4Q8IA 2J7VA 2ZQ9A 3BECA 3ZFZA 2WGIA 4QY6A 1IELA 3V3RA 1E25A 4O7DA 5AQAA 3ZG5A 1EWZA 3FV7A 3Q1FA 4ZTKA 5L2FA 1MWSA 2H5SA 1HZOA 5FI2A 4KQOA 4DE3A 4KENB 2P9VA 3LCEA 5CTMA 5DVAA 5E2EA 3TOIA 3GRJA 4IEDA 3N7WA 1PWDA 1E4DA 2ZM0A 2WAFA 1K38A 1I5QA 5HFOA 4JXWA 1XGJA 3MZEA 4JBFA 4X55A 1QMFA 5E2HA 4OP8A 3G35A 3IWQA 4JPMA 3FZCA 3G4PA 1K4EA 4BL3A 3QNBA 5DTSA 5CEBA 3IH8A 2XFTA 1LLBA 3LY4A 2ZC6B 3IHAA 3M6HA 1BSGA 3OPLA 4EBLA 5GHXA 3PBRA 1BUEA 4OPYA 2IWCA 4PMAA 5GL9A 2B5RA 3ZVWA 3C4OA 3A3EA 4KZ6A 4KZ8A 4FCFA 2P74A 4LV0A 4B88A 3HUNA 4LENA 3EQUA 5EOEA 1RGZA 2HPBA 3PAEA 5FQJA 1O07A 3SS3A 3NY4A 3V50A 1SCWA 4KZ3A 5AQ9A 2Y59A 3VOYA 2GDNA 4N92A 1PI5A 4OPRA 2EXBA 3G2YA 1Z6FA 1FR1A 3ZNTA 1KDWA 1K55C 4E3JA 1CI9A 4JXGA 4R3JA 3Q81A 3I7JA 3CMZA 1IYQA 1FCOA 1E3UD 1PI4A 1S6RA 2XGNA 4HESA 5F1FA 2Y2LA 1K54A 3VP3A 3CZDA 5FA7A 4GD8A 1FQGA 2V2FF 1YLTA 4DRTA 4WMCA 4BJPA 2PU4A 3MXSA 4S2IA 5HARA 3WS0A 3E2LA 3HLCA 4UA9A 3OZHA 4KG2A 1BZAA 4ZJ2A 3UDIA 1G6AA 5GHYA 3PBSA 4WYYA 4X6TA 2Y2JA 3ZNYA 1JWZA 4P87A 5F83A 1C3BA 1LHYA 3ZG8B 5DF7A 5TFQA 3PTEA 4DDYA 1PZOA 4MLLA 3DTMA 3IF6A 4E3KA 2QPNA 4E3OA 5KZHA 2XF3A 3HLDA 4QD4A 1KE4A 1W79A 2DRWA 4PM9A 4UA6A 4QJGA 3BFFA 3BEBA 3HLWA 5EVIB 2QZ6A 4MBHA 1XP4A 2H10A 3SOIA 4DE0A 4N1XA 1GA9A 3OPRA 1L0GA 3N8SA 2JE5A 4U3TA 1LI9A 2WKIA 1SHVA 4R23A 5DTKA 2PBYA 4E3MA 3G2ZA 2VGJA 2XK1A 2WGVA 3QNCA 1DJAA 1ALQA 1J9MA 3ZCZA 3O86A 4Y0OA 3GSGA 3OPHA 1HD8A 4DXBA 1BULA 4LCLA 3S4XA 1HTZA 3WRZA 1KE3A 4S2OA 4WZ5C 2Q9NA 1KGFA 1K6SA 2A49A 4UAAA 5GLCA 4ZAMA 3UNWA 4E6WA 2RL3A 4S2NA 2ZM2A 5CGWA 1N4OA 4WM9A 1TVFA 2V20A 4DE1A 3NDGA 1ZG4A 3HBRA 3G32A 4OOYA 3WRTA 4K91A 3VP4A 1FOFA 3O88A 4S2KA 1OMEA 3C5AA 1XA7A 3SH7A 5A93A 1YLYA 2EX6A 4DE2A 1I2SA 4GNUA 1W8QA 3ZG0A 1K57C 5FAQA 2Y2KA 3IF5A 4PM8A 5KMWA 3W4QA 1PYYA 5FQ9A 1Q2QA 2Y2HA 3HLGA 4KZBA 4HEFA 1XXMA 4RA7A 3MBZA 5GLBA 2ZQCA 1TDLA 4IVKA 3VFHA 4GN2A 4BENA 3WS2A 2WYXA 5EUAA 4KZ5A 2I72A 1E3UA 3UPOA 2Z2MB 1ES5A 1YLZA 5FQIA 4EQIA 1PWGA 2Z2LB 3FKVA 5A91A 3O87A 4K0WA 1ESUA 1RCJA 4RX2A 1Y54A 1LI0A 1YT4A 5EVID 1W7FA 1K25A 1YLPA 5DTTA 5GLAA 5FI6A 5CXWA 2J8YA 2OLVA 4OQGA 5E2FA 3C4PA 4OLGA 1W8YA 2EX8A 5E2GA 4DDSA 2EFUA 5DF8A 5CTNA 4F94A 5AQBA 3RXXA 4BQMA 5FQQA 4KQRA 4P85A 4PPRA 3N4IA 3AGFA 3HLFA 1MWUA 1ZC2A 1MPLA 5A90A 3NCKA 3GVBA 1Q2PA 3HREA 1PW1A 4CPKA 4E3NA 2DNSA 4BLMA 4LV3A 3GR2A 4JLFA 1L2SA 4OLDA 3ZGAB 2ZQ7A 2E8IA 1N9BA 3ZHHA 3N8RA 1I2WA 3BFGA 4EBPA 3SS4A 4Y0TA 2G2UA 1WYCA 4UA7A 1KGGA 1NXYA 3WS4A 3IXGA 4X69A 3UE3A 1YLWA 5KSCA 1ES3A 2G2WA 3P98A 4BL2A 3SS5A 3UE0A 3LEZA 2XFSA 5J8XA 1L0FA 3G30A 1WE4A 1FR6A 2OSUA 2XDMA 5HW3A 4Z9QA 1XKZA 4OOLA 5DF9A 3G31A 3ZG7B 4FH2A 4MNRA 4N9KA 4S2MA 1GHMA 3BFCA 4UHUA 4MBKA 5FAPA 5CEDA 1SDEA 4N1HA 2HP6A 2Y2GA 4FSFA 2WAEA 2ZC5B 4GDBA 3S1YA 1QMEA 1JTGA 5EVLA 2FFFB 4A5RA 4OQHA 3D4FA 3PBQA 3IWOA 4OQIA 1K6RA 2FFYA 1FSYA 5EE8A 2XQZA 3ZG9B 5HAPA 5U47A 4L0LA 1DJCA 4X56A 2H0TA 4OQ0A 5AQ7A 5FASA 2Y2MA 1IYOA 4KZ4A 3VP0A 5CHJA 2ZQ8A 3C7VA 4ZDXA 3HVFA 2DCFA 2EXAA 3UE1A 5E43A 3UY6A 1DY6A 4ID4A 3V39A 3GV9A 4CJNA 1AXBA 4R3BA 4R4RA 3IT9A 3P09A 1MXOA 3MXRA 2ZC4B 1NYYA 5I94A 2ZMAA 4X68A 3RJUA 2IWBA 3HLBA 5EVIA 3WS5A 3IF6C 4E3LA 1XX2A 1TDGA 2WZZA 3NIAA 2WGWB 3UO9A 5F82A 1ONGA 2ZC7A 4R0QA 1NY0A 4B4ZA 4OH0A 4BD1A 1NZOA 2Q9MA 2ZQAA 1KE0A 1H5XA 3AGEA 3WWXA 3PBOA 3IHBA 4OOMA 4GZBA 4IBRA 3W4OA 3VP1A 2Y2PA 4RX3A 2QMIA 1BLSA 3BLSA 4R4SA 1BTLA 2EX2A 4Y7PA 2XLNA 4HBTA 1K57A 2X02A 2ZQDA 4OPQA 4YINA 3GTCA 3IQAA 4H8RA 3Q7VB 4PM5A 3O3VA 1O7EA 4BD0A 2J9PA 5FI7A 3IXDA 2EX9A 1XA1A 3VSKA 5HL1A 2BLSA 1YQSA 1MBLA 2Y2IA 1SDNA 3DWKA 1MWRA 3W4PA 3HLEA 2X01A 3TG9A 1JVJA 1LL5A 2XR0A 4C75A 1RP5A 4S2NC 3VP2A 1BT5A 3W8KA 1ONHA 3M2JA 2Y91A 2PU2A 4QHCA 3GQZA 3HUOA 3NDEA 4WEJA 3MZFA 3ISGA 1PIOA 3A3DA 1WYBA 3BM6A 5CHMA 1H8ZA 5HAQA 4D2OA 1KDSA 3FWLA 3QHYA 3SH8A 2ZC3B 3Q07A 5M18A 2ZJ9A 3A3FA 1G68A 2P9VB 2XH9A 1IEMA 1NRFA 4S2PA 1KVLA 4GDNA 4ZJ1A 2CC1A 3AGDA 4JF5A 4KZ9A 4MEZA 1NJ4A 5BOHA 1KGEA 3S22A 4WBGA 2X71A 4FH4A 4LCMA 3C7UA 4NK3A 5CGXA 2H0YA 1W5DA 1L0DA 4P6BA 2ZLYA 4FD8A 1U60A 5EECA 3ZVTA 1IYPA 1K56D 3BFDA 1YMSA 2XEPA 1IKGA 3TSGA 1TEMA 3HL9A 5GLDA 4JKTA 5HAIA 1XGIA 3Q7ZA 4P0MA 3PBNA 4U0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OLU A;  1ERM A;  5HX9 A;  3ZDJ A;  1K55 A;  1KVM A;  4IBX A;  1CI8 A;  2VGK A;  2Y2Q A;  4YFM A;  3DWZ A;  2WKE A;  4XUZ A;  4JXS A;  5EPH A;  2ZD8 A;  1ERO A;  1FCN A;  1ZKJ A;  2BG1 A;  3PAG A;  4ZJ3 A;  3IXB A;  2WZX A;  3ITA A;  4QY5 A;  4OON A;  5M1A A;  4DKI A;  4OKP A;  4XUX A;  2ZM8 A;  1FCM A;  1K4F A;  4RVA A;  2HP5 A;  4JXV A;  4WZ4 A;  2XD5 A;  1BLH A;  1LL9 A;  1MY8 A;  4ZBE A;  3UN7 A;  4PM6 A;  4S2J A;  3NC8 A;  3N8L A;  4GB7 A;  4KG5 A;  2WUQ A;  1M40 A;  3BRM A;  4LV2 A;  4XXR A;  4LV1 A;  3V5M A;  2HDQ A;  1RGY A;  2JCH A;  4JF6 A;  1GHP A;  4QU3 A;  3RXW A;  1BLP A;  3EQV A;  4KG6 A;  1IKI A;  4DF6 A;  5D3O A;  5JYO A;  1M6K A;  2C6W B;  3JYI A;  1XPB A;  4GKU A;  5FAT A;  5CER A;  3UPN A;  4QB8 A;  1DJB A;  1JTD A;  4KZ7 A;  1K54 C;  3BYD A;  2JC7 A;  3IF6 B;  4KQQ A;  3OC2 A;  3VSL A;  2IWD A;  2HDU A;  3N6I A;  4KZA A;  4OVD A;  3ITB A;  1MKI A;  3DW0 A;  3LY3 A;  4Y0U A;  3OCN A;  4WEL A;  5JYP A;  2R9X A;  4NET A;  1YMX A;  3BFE A;  1IYS A;  1GCE A;  4HBU A;  3SH9 A;  2RCX A;  3NBL A;  3A3I A;  1CEG A;  3E2K A;  2A3U A;  3M2K A;  3OPP A;  1ES4 A;  4EWF A;  5CHU A;  2HDS A;  5FAO A;  2XD1 A;  3Q82 A;  5KSH A;  4WZ5 A;  4R1G A;  3V3S A;  4GOG A;  3VMA A;  1NYM A;  4N9L A;  5A92 A;  3MKE A;  3UDX A;  3B3X A;  4GD6 A;  1BLC A;  2Y4A A;  2J9O A;  5EOO A;  5G18 A;  4U0X A;  1ESI A;  2C5W B;  3A3J A;  3OCL A;  1JWP A;  1NZU A;  2UWX A;  2WKH A;  3M6B A;  1CEF A;  3MZD A;  3VFF A;  4OPZ A;  3HUM A;  3CJM A;  2WGW A;  4PM7 A;  1PZP A;  1S0W A;  3IH9 A;  1SKF A;  3G34 A;  3FYZ A;  1K56 A;  4X53 A;  2WK0 A;  3IXH A;  4C3Q A;  5FSR A;  4S2L A;  4E6X A;  1L0E A;  3UDF A;  3VOZ A;  4IVI A;  4B4X A;  5F1G A;  4C6Y A;  4OP5 A;  2HP9 A;  3IWI A;  5EVI C;  1FSW A;  1PW8 A;  1MWT A;  1HVB A;  4WMC D;  5IHV A;  1EI5 A;  3PBT A;  3LO7 A;  5GHZ A;  1VM1 A;  1PWC A;  1YLJ A;  1YM1 A;  2Y2O A;  2OV5 A;  5CRF A;  5CEC A;  4M3K A;  3MFD A;  3GMW A;  5FQK A;  1H8Y A;  1GA0 A;  1CK3 A;  2WAD A;  3Q7V A;  1ZG6 A;  4JF4 A;  3FKW A;  5FDH A;  3UPP A;  1JWV A;  1ERQ A;  5M19 A;  5CGS A;  4DXC A;  2EFX A;  4K0X A;  4MBF A;  5TGF A;  2HDR A;  2Y2N A;  5TR7 A;  4WEK A;  5FQM A;  4EBN A;  4RYE A;  4EV4 A;  1ES2 A;  1GHI A;  1VQQ A;  3WS1 A;  2R9W A;  4EUZ A;  2JBF A;  3NI9 A;  2Y55 A;  3MKF A;  2V1Z A;  3CG5 A;  3BLM A;  4E3I A;  4Q8I A;  2J7V A;  2ZQ9 A;  3BEC A;  3ZFZ A;  2WGI A;  4QY6 A;  1IEL A;  3V3R A;  1E25 A;  4O7D A;  5AQA A;  3ZG5 A;  1EWZ A;  3FV7 A;  3Q1F A;  4ZTK A;  5L2F A;  1MWS A;  2H5S A;  1HZO A;  5FI2 A;  4KQO A;  4DE3 A;  4KEN B;  2P9V A;  3LCE A;  5CTM A;  5DVA A;  5E2E A;  3TOI A;  3GRJ A;  4IED A;  3N7W A;  1PWD A;  1E4D A;  2ZM0 A;  2WAF A;  1K38 A;  1I5Q A;  5HFO A;  4JXW A;  1XGJ A;  3MZE A;  4JBF A;  4X55 A;  1QMF A;  5E2H A;  4OP8 A;  3G35 A;  3IWQ A;  4JPM A;  3FZC A;  3G4P A;  1K4E A;  4BL3 A;  3QNB A;  5DTS A;  5CEB A;  3IH8 A;  2XFT A;  1LLB A;  3LY4 A;  2ZC6 B;  3IHA A;  3M6H A;  1BSG A;  3OPL A;  4EBL A;  5GHX A;  3PBR A;  1BUE A;  4OPY A;  2IWC A;  4PMA A;  5GL9 A;  2B5R A;  3ZVW A;  3C4O A;  3A3E A;  4KZ6 A;  4KZ8 A;  4FCF A;  2P74 A;  4LV0 A;  4B88 A;  3HUN A;  4LEN A;  3EQU A;  5EOE A;  1RGZ A;  2HPB A;  3PAE A;  5FQJ A;  1O07 A;  3SS3 A;  3NY4 A;  3V50 A;  1SCW A;  4KZ3 A;  5AQ9 A;  2Y59 A;  3VOY A;  2GDN A;  4N92 A;  1PI5 A;  4OPR A;  2EXB A;  3G2Y A;  1Z6F A;  1FR1 A;  3ZNT A;  1KDW A;  1K55 C;  4E3J A;  1CI9 A;  4JXG A;  4R3J A;  3Q81 A;  3I7J A;  3CMZ A;  1IYQ A;  1FCO A;  1E3U D;  1PI4 A;  1S6R A;  2XGN A;  4HES A;  5F1F A;  2Y2L A;  1K54 A;  3VP3 A;  3CZD A;  5FA7 A;  4GD8 A;  1FQG A;  2V2F F;  1YLT A;  4DRT A;  4WMC A;  4BJP A;  2PU4 A;  3MXS A;  4S2I A;  5HAR A;  3WS0 A;  3E2L A;  3HLC A;  4UA9 A;  3OZH A;  4KG2 A;  1BZA A;  4ZJ2 A;  3UDI A;  1G6A A;  5GHY A;  3PBS A;  4WYY A;  4X6T A;  2Y2J A;  3ZNY A;  1JWZ A;  4P87 A;  5F83 A;  1C3B A;  1LHY A;  3ZG8 B;  5DF7 A;  5TFQ A;  3PTE A;  4DDY A;  1PZO A;  4MLL A;  3DTM A;  3IF6 A;  4E3K A;  2QPN A;  4E3O A;  5KZH A;  2XF3 A;  3HLD A;  4QD4 A;  1KE4 A;  1W79 A;  2DRW A;  4PM9 A;  4UA6 A;  4QJG A;  3BFF A;  3BEB A;  3HLW A;  5EVI B;  2QZ6 A;  4MBH A;  1XP4 A;  2H10 A;  3SOI A;  4DE0 A;  4N1X A;  1GA9 A;  3OPR A;  1L0G A;  3N8S A;  2JE5 A;  4U3T A;  1LI9 A;  2WKI A;  1SHV A;  4R23 A;  5DTK A;  2PBY A;  4E3M A;  3G2Z A;  2VGJ A;  2XK1 A;  2WGV A;  3QNC A;  1DJA A;  1ALQ A;  1J9M A;  3ZCZ A;  3O86 A;  4Y0O A;  3GSG A;  3OPH A;  1HD8 A;  4DXB A;  1BUL A;  4LCL A;  3S4X A;  1HTZ A;  3WRZ A;  1KE3 A;  4S2O A;  4WZ5 C;  2Q9N A;  1KGF A;  1K6S A;  2A49 A;  4UAA A;  5GLC A;  4ZAM A;  3UNW A;  4E6W A;  2RL3 A;  4S2N A;  2ZM2 A;  5CGW A;  1N4O A;  4WM9 A;  1TVF A;  2V20 A;  4DE1 A;  3NDG A;  1ZG4 A;  3HBR A;  3G32 A;  4OOY A;  3WRT A;  4K91 A;  3VP4 A;  1FOF A;  3O88 A;  4S2K A;  1OME A;  3C5A A;  1XA7 A;  3SH7 A;  5A93 A;  1YLY A;  2EX6 A;  4DE2 A;  1I2S A;  4GNU A;  1W8Q A;  3ZG0 A;  1K57 C;  5FAQ A;  2Y2K A;  3IF5 A;  4PM8 A;  5KMW A;  3W4Q A;  1PYY A;  5FQ9 A;  1Q2Q A;  2Y2H A;  3HLG A;  4KZB A;  4HEF A;  1XXM A;  4RA7 A;  3MBZ A;  5GLB A;  2ZQC A;  1TDL A;  4IVK A;  3VFH A;  4GN2 A;  4BEN A;  3WS2 A;  2WYX A;  5EUA A;  4KZ5 A;  2I72 A;  1E3U A;  3UPO A;  2Z2M B;  1ES5 A;  1YLZ A;  5FQI A;  4EQI A;  1PWG A;  2Z2L B;  3FKV A;  5A91 A;  3O87 A;  4K0W A;  1ESU A;  1RCJ A;  4RX2 A;  1Y54 A;  1LI0 A;  1YT4 A;  5EVI D;  1W7F A;  1K25 A;  1YLP A;  5DTT A;  5GLA A;  5FI6 A;  5CXW A;  2J8Y A;  2OLV A;  4OQG A;  5E2F A;  3C4P A;  4OLG A;  1W8Y A;  2EX8 A;  5E2G A;  4DDS A;  2EFU A;  5DF8 A;  5CTN A;  4F94 A;  5AQB A;  3RXX A;  4BQM A;  5FQQ A;  4KQR A;  4P85 A;  4PPR A;  3N4I A;  3AGF A;  3HLF A;  1MWU A;  1ZC2 A;  1MPL A;  5A90 A;  3NCK A;  3GVB A;  1Q2P A;  3HRE A;  1PW1 A;  4CPK A;  4E3N A;  2DNS A;  4BLM A;  4LV3 A;  3GR2 A;  4JLF A;  1L2S A;  4OLD A;  3ZGA B;  2ZQ7 A;  2E8I A;  1N9B A;  3ZHH A;  3N8R A;  1I2W A;  3BFG A;  4EBP A;  3SS4 A;  4Y0T A;  2G2U A;  1WYC A;  4UA7 A;  1KGG A;  1NXY A;  3WS4 A;  3IXG A;  4X69 A;  3UE3 A;  1YLW A;  5KSC A;  1ES3 A;  2G2W A;  3P98 A;  4BL2 A;  3SS5 A;  3UE0 A;  3LEZ A;  2XFS A;  5J8X A;  1L0F A;  3G30 A;  1WE4 A;  1FR6 A;  2OSU A;  2XDM A;  5HW3 A;  4Z9Q A;  1XKZ A;  4OOL A;  5DF9 A;  3G31 A;  3ZG7 B;  4FH2 A;  4MNR A;  4N9K A;  4S2M A;  1GHM A;  3BFC A;  4UHU A;  4MBK A;  5FAP A;  5CED A;  1SDE A;  4N1H A;  2HP6 A;  2Y2G A;  4FSF A;  2WAE A;  2ZC5 B;  4GDB A;  3S1Y A;  1QME A;  1JTG A;  5EVL A;  2FFF B;  4A5R A;  4OQH A;  3D4F A;  3PBQ A;  3IWO A;  4OQI A;  1K6R A;  2FFY A;  1FSY A;  5EE8 A;  2XQZ A;  3ZG9 B;  5HAP A;  5U47 A;  4L0L A;  1DJC A;  4X56 A;  2H0T A;  4OQ0 A;  5AQ7 A;  5FAS A;  2Y2M A;  1IYO A;  4KZ4 A;  3VP0 A;  5CHJ A;  2ZQ8 A;  3C7V A;  4ZDX A;  3HVF A;  2DCF A;  2EXA A;  3UE1 A;  5E43 A;  3UY6 A;  1DY6 A;  4ID4 A;  3V39 A;  3GV9 A;  4CJN A;  1AXB A;  4R3B A;  4R4R A;  3IT9 A;  3P09 A;  1MXO A;  3MXR A;  2ZC4 B;  1NYY A;  5I94 A;  2ZMA A;  4X68 A;  3RJU A;  2IWB A;  3HLB A;  5EVI A;  3WS5 A;  3IF6 C;  4E3L A;  1XX2 A;  1TDG A;  2WZZ A;  3NIA A;  2WGW B;  3UO9 A;  5F82 A;  1ONG A;  2ZC7 A;  4R0Q A;  1NY0 A;  4B4Z A;  4OH0 A;  4BD1 A;  1NZO A;  2Q9M A;  2ZQA A;  1KE0 A;  1H5X A;  3AGE A;  3WWX A;  3PBO A;  3IHB A;  4OOM A;  4GZB A;  4IBR A;  3W4O A;  3VP1 A;  2Y2P A;  4RX3 A;  2QMI A;  1BLS A;  3BLS A;  4R4S A;  1BTL A;  2EX2 A;  4Y7P A;  2XLN A;  4HBT A;  1K57 A;  2X02 A;  2ZQD A;  4OPQ A;  4YIN A;  3GTC A;  3IQA A;  4H8R A;  3Q7V B;  4PM5 A;  3O3V A;  1O7E A;  4BD0 A;  2J9P A;  5FI7 A;  3IXD A;  2EX9 A;  1XA1 A;  3VSK A;  5HL1 A;  2BLS A;  1YQS A;  1MBL A;  2Y2I A;  1SDN A;  3DWK A;  1MWR A;  3W4P A;  3HLE A;  2X01 A;  3TG9 A;  1JVJ A;  1LL5 A;  2XR0 A;  4C75 A;  1RP5 A;  4S2N C;  3VP2 A;  1BT5 A;  3W8K A;  1ONH A;  3M2J A;  2Y91 A;  2PU2 A;  4QHC A;  3GQZ A;  3HUO A;  3NDE A;  4WEJ A;  3MZF A;  3ISG A;  1PIO A;  3A3D A;  1WYB A;  3BM6 A;  5CHM A;  1H8Z A;  5HAQ A;  4D2O A;  1KDS A;  3FWL A;  3QHY A;  3SH8 A;  2ZC3 B;  3Q07 A;  5M18 A;  2ZJ9 A;  3A3F A;  1G68 A;  2P9V B;  2XH9 A;  1IEM A;  1NRF A;  4S2P A;  1KVL A;  4GDN A;  4ZJ1 A;  2CC1 A;  3AGD A;  4JF5 A;  4KZ9 A;  4MEZ A;  1NJ4 A;  5BOH A;  1KGE A;  3S22 A;  4WBG A;  2X71 A;  4FH4 A;  4LCM A;  3C7U A;  4NK3 A;  5CGX A;  2H0Y A;  1W5D A;  1L0D A;  4P6B A;  2ZLY A;  4FD8 A;  1U60 A;  5EEC A;  3ZVT A;  1IYP A;  1K56 D;  3BFD A;  1YMS A;  2XEP A;  1IKG A;  3TSG A;  1TEM A;  3HL9 A;  5GLD A;  4JKT A;  5HAI A;  1XGI A;  3Q7Z A;  4P0M A;  3PBN A;  4U0T A; 
#chains in the Genus database with same CATH topology
 3BQA A;  1KVM A;  2J3T D;  4IBX A;  3RH8 B;  1CI8 A;  1S4S A;  4JXS A;  5EPH A;  4IJG A;  1FCN A;  1ZKJ A;  2BG1 A;  4OON A;  5M1A A;  4XUX A;  4GHI A;  4WZ4 A;  1M40 A;  3H82 A;  2V1A A;  4XXR A;  3LIB A;  4LV1 A;  3IX8 A;  2GNX A;  1GHP A;  4I3A A;  5EV0 A;  1UWP X;  4ESP A;  3JYI A;  1XPB A;  5HWT A;  4GKU A;  5FAT A;  3UPN A;  2HDU A;  3VE3 A;  3MS6 A;  1MZU A;  2A24 B;  5HD5 A;  2A2L A;  4WEL A;  3KX0 X;  5J4E A;  3SH9 A;  3A3I A;  1CEG A;  3OPP A;  5CHU A;  4DMZ A;  2XD1 A;  4WZ5 A;  4DJ3 A;  1NYM A;  3MKE A;  3E98 A;  4CLC C;  1F5M A;  2UV0 E;  2Y4A A;  2J9O A;  5EOO A;  3E4P A;  1NLZ A;  2C5W B;  3OCL A;  2UWX A;  2O9B A;  4LLO B;  3P01 A;  4CLC E;  4E6X A;  1L0E A;  3UDF A;  2WKQ A;  4IVI A;  3DTE A;  4B4X A;  3L9K A;  1AWI A;  3LO7 A;  1YM1 A;  5CEC A;  5CRF A;  3ICY A;  4M3K A;  1GA0 A;  3Q7V A;  3FKW A;  3UPP A;  1P9W A;  1ERQ A;  5M19 A;  2PR5 A;  5CGS A;  4DXC A;  5TBM A;  2M7V A;  1W63 Q;  2HDR A;  4WEK A;  4X1L A;  2KX6 A;  5FQM A;  1ES2 A;  1VQQ A;  4EUZ A;  2Y55 A;  3BLM A;  3BEC A;  2ZL1 A;  3TJZ C;  3ZFZ A;  2WGI A;  4QY6 A;  4KUK A;  1EWZ A;  4ZTK A;  2H5S A;  5E2E A;  3GRJ A;  1PWD A;  1I5Q A;  2W0N A;  4JBF A;  4X55 A;  5E2H A;  4OP8 A;  3G35 A;  4HNB A;  4JPM A;  1DP8 A;  2W3G A;  3OPL A;  1N9O A;  3MQO A;  4PMA A;  1SKO A;  4KZ6 A;  1VHM A;  3EQU A;  5EOE A;  3V50 A;  5AQ9 A;  2Y59 A;  3VOY A;  3G2Y A;  3NOP C;  1Z6F A;  3ZNT A;  1OT6 A;  4HP4 A;  2L0W A;  2J3W A;  3QP6 A;  2XGN A;  1E3U D;  1PI4 A;  1K54 A;  3CZD A;  2D01 A;  2V2F F;  3W2Z A;  1N9L A;  4HH2 A;  4WUJ A;  4DRT A;  3R7W B;  2PU4 A;  2PT7 A;  3WS0 A;  4KG2 A;  2VGL S;  5HDC A;  3F1O B;  2OAQ 1;  3PBS A;  4WYY A;  4X6T A;  2Y2J A;  2EWV A;  4P87 A;  2PHY A;  4BBU A;  1S4R A;  1LHY A;  3PYP A;  4E3O A;  5KZH A;  4UA6 A;  2NUP C;  3MFX A;  2NUT C;  3T4J A;  3HLW A;  1GA9 A;  2ZOH A;  2JE5 A;  5HDD A;  3DBA A;  2P08 A;  2PBY A;  3QNC A;  1ALQ A;  1XJ6 A;  3HCY A;  1N9N A;  4Y0O A;  5AJG A;  1HTZ A;  1P97 A;  1XJ3 A;  3WRZ A;  1KE3 A;  4S2O A;  4WZ5 C;  2Q9N A;  1K6S A;  4UAA A;  3UB7 A;  2IA2 A;  4WM9 A;  3BY9 A;  4DE2 A;  2EX6 A;  2W1T B;  3W4Q A;  2Y2H A;  4KZB A;  1XXM A;  4RA7 A;  5GLB A;  3MSH A;  1TDL A;  2J3T C;  4DJ2 A;  2WYX A;  5EUA A;  1CF0 A;  1E3U A;  1ES5 A;  1YLZ A;  4EQI A;  4K0W A;  4PHT A;  1RCJ A;  1Y54 A;  2G7U A;  1YT4 A;  1W7F A;  2JKT M;  5DTT A;  5GLA A;  5FI6 A;  2J8Y A;  1W8Y A;  2EX8 A;  1ZHH B;  4NKP A;  4EXO A;  4F94 A;  5CTN A;  5FQQ A;  4P6Z M;  3LFV A;  5LBR A;  4CPK A;  2O9A A;  2QHK A;  4OLD A;  3E4O A;  4HJ6 A;  1N9B A;  3N8R A;  3KYE A;  4EBP A;  4Y0T A;  2G2U A;  5IT5 A;  1KGG A;  3IXG A;  1TF1 A;  4X69 A;  5A8B A;  4BL2 A;  3UE0 A;  3E4Q A;  3LEZ A;  2XFS A;  3LI8 A;  2H28 A;  4Z9Q A;  4DN0 A;  4OOL A;  3T50 A;  5FAP A;  1GHM A;  3BFC A;  4UHU A;  1TD5 A;  3S7Q A;  2WKR A;  4FSF A;  1V9Y A;  4GDB A;  3S1Y A;  1JTG A;  5EVL A;  4OQH A;  1F9I A;  3D4F A;  1FSY A;  5EE8 A;  5F5Y A;  2YKH A;  4OQ0 A;  3C2W A;  5CX7 A;  5MC7 A;  2FZ0 A;  3IT9 A;  4UQI S;  4B9O A;  2ZMA A;  2ZOI A;  3RJU A;  5HZH A;  4Y3I A;  5HPI A;  1TDG A;  3NIA A;  2WGW B;  1T1B A;  3C8C A;  5F82 A;  4R0Q A;  3MJQ A;  4B4Z A;  4OH0 A;  4BD1 A;  2W3H A;  3AGE A;  3V67 A;  4E04 A;  3T1S A;  1DRM A;  3VP1 A;  2QMI A;  4IUK A;  4YIN A;  4OPQ A;  3IQA A;  2J9P A;  5FI7 A;  2EX9 A;  5HL1 A;  1MBL A;  3DWK A;  1KOU A;  3K2N A;  2VA0 A;  4C75 A;  3VP2 A;  3OBF A;  2PU2 A;  4QHC A;  3KSI A;  4WEJ A;  1L3L A;  1PIO A;  5CHM A;  1WYB A;  3BM6 A;  1H8Z A;  4EW7 A;  3PR6 A;  4D2O A;  3FWL A;  3SH8 A;  2JHE A;  1GSX A;  1IEM A;  4GDN A;  3AGD A;  4NXG A;  2KLI A;  4HQA A;  2INW A;  3S22 A;  2X71 A;  3CHW P;  4NK3 A;  3ZVT A;  1U60 A;  4Q0J A;  5HPF A;  2XEP A;  1IKG A;  5I5L A;  3HL9 A;  2PBD P;  3Q7Z A;  1VB6 A;  1ERM A;  2EWW A;  3D9Y A;  4ETZ A;  3K3C A;  3NUL A;  3T4T A;  3CWF A;  2WZX A;  3ITA A;  4QY5 A;  1BLH A;  1LL9 A;  3UN7 A;  4PM6 A;  4S2J A;  3NC8 A;  4KG5 A;  2WUQ A;  4L9F A;  4F3L A;  3BRM A;  3V5M A;  1G6O A;  2OWJ A;  4NXE A;  4PAU A;  4HIA A;  5D3O A;  4II7 A;  2C6W B;  5CER A;  4Q0I A;  1DJB A;  2JC7 A;  3IF6 B;  4KQQ A;  4MN6 A;  2VV8 A;  3VSL A;  2VV7 A;  3ITB A;  4KUO A;  4Y0U A;  4RQ9 A;  4IUH A;  4NET A;  1YMX A;  3BFE A;  4HBU A;  4H6J A;  3E2K A;  2HDS A;  2QJ7 A;  2DMW A;  3C38 A;  5KSH A;  3V3S A;  2L1M A;  4N9L A;  3CUE C;  3F1N B;  5G18 A;  1G28 A;  1ESI A;  3A3J A;  1JWP A;  1NZU A;  3MZD A;  1CEF A;  1ZTU A;  1PZP A;  1S0W A;  1SKF A;  4X53 A;  4C3Q A;  4S2L A;  3VOZ A;  4KQD A;  1W63 M;  3IWI A;  1TS6 A;  1PW8 A;  4WMC D;  1EI5 A;  5GHZ A;  1PWC A;  1YLJ A;  2Y2O A;  2OV5 A;  3MFD A;  3B33 A;  1CK3 A;  3NOU C;  4JF4 A;  4LRX C;  4K0X A;  5TGF A;  2OOL A;  4EU0 A;  2BTF P;  2Q0O A;  2R9W A;  2JBF A;  2V1Z A;  3CG5 A;  1BYW A;  5EVE A;  1E25 A;  2Z6D A;  3ZG5 A;  1HZO A;  4KEN B;  3LCE A;  5DVA A;  4IED A;  2ZM0 A;  1XGJ A;  3G4P A;  1K4E A;  4BL3 A;  3QNB A;  3O5Y A;  2W1R A;  5L09 A;  3CIT A;  1LLB A;  3IHA A;  2HF6 A;  4XT2 B;  4LRZ E;  1UGU A;  5GHX A;  5GL9 A;  3B42 A;  4KZ8 A;  4LV0 A;  4GW9 A;  1RGZ A;  2HPB A;  3SS3 A;  2PRF A;  2BAS A;  2GDN A;  1PI5 A;  4OPR A;  4FTX A;  4JXG A;  3Q81 A;  4M4X A;  1IYQ A;  1FCO A;  5F1F A;  4Y17 A;  2B95 A;  4GD8 A;  4WMC A;  4BJP A;  3MXS A;  4MMN A;  3UDI A;  4CLC B;  2XRN A;  4X1M A;  2VJW A;  5GHY A;  3A0V A;  3ZNY A;  3S7N A;  5F69 A;  5DF7 A;  4CQH A;  4MLL A;  3DTM A;  3R7W A;  2QPN A;  3MQ0 A;  2XF3 A;  3F1P A;  2DRW A;  1W79 A;  4QJG A;  4PM9 A;  1V9Z A;  4FUW A;  3BFF A;  5FEG A;  4ARZ B;  2B18 A;  1XP4 A;  1MC0 A;  3N8S A;  2PD8 A;  1P0Z A;  5DTK A;  2WGV A;  5DFY A;  3FPW A;  1DJA A;  1J9M A;  3GSG A;  1VET B;  3OPH A;  2AVX A;  1HD8 A;  5EM0 A;  4LCL A;  3S4X A;  2JN7 A;  2A49 A;  4S2N A;  2WKP A;  1TVF A;  2V20 A;  1ZG4 A;  4K91 A;  2E8J A;  1FOF A;  3O88 A;  3CI6 A;  5A93 A;  5FAQ A;  5KMW A;  4MN5 A;  1PYY A;  5FQ9 A;  1Q2Q A;  2VKS A;  1NWZ A;  3VFH A;  4GN2 A;  3WS2 A;  2P7J A;  3KYQ A;  1PWG A;  3FKV A;  3O87 A;  1ESU A;  5EVI D;  2I9V A;  3NHQ A;  4D60 A;  3C4P A;  4P85 A;  1OTI A;  4GS9 A;  3LI9 A;  3HLF A;  1MWU A;  3NCK A;  4BLM A;  1L2S A;  1CJF A;  4GHI B;  3MR0 A;  4UA7 A;  2G2W A;  2V8C A;  3SS5 A;  1D7E A;  5AVF A;  1S67 L;  1T18 A;  4GJ4 A;  3H82 B;  4O8G A;  2XDM A;  2VGL M;  1XKZ A;  3ZG7 B;  5DF9 A;  4N9K A;  4S2M A;  4BBV A;  1SDE A;  2HP6 A;  2WAE A;  2ZC5 B;  3L7H A;  4A5R A;  3H7W A;  3LIC A;  1K6R A;  3ZG9 B;  4O0P A;  5U47 A;  4X56 A;  3U4L P;  2Y2M A;  2MJ6 A;  3NOT C;  2ZQ8 A;  3TE8 A;  3TW8 A;  1CQA A;  1YKD A;  3D3O A;  5E43 A;  1DY6 A;  4R4R A;  1YSP A;  1XFN A;  1MXO A;  3IX3 A;  3MXR A;  4EER A;  4X68 A;  4I5S A;  2IWB A;  5EVI A;  3WS5 A;  1ODV A;  1XX2 A;  2ZC7 A;  1OJG A;  1VEU A;  3VV4 A;  4R38 A;  2ZQA A;  1KE0 A;  1H5X A;  4OOM A;  4R3A A;  2Y2P A;  3FG8 A;  4R4S A;  1BTL A;  2XLN A;  1UWN X;  1K57 A;  4Z1W A;  2ZQD A;  4LPZ A;  3GTC A;  4H8R A;  1S1Z A;  3Q7V B;  3ZQ5 A;  1O7E A;  1XA1 A;  2JKR I;  5TBM B;  2Y2I A;  1SDN A;  1MWR A;  3TG9 A;  1JVJ A;  1LL5 A;  4B93 A;  4S2N C;  5HWW A;  2GJ3 A;  2ZL1 B;  3NDE A;  3MZF A;  3ISG A;  2HJ9 C;  1KDS A;  3QP1 A;  3A3F A;  2VV6 A;  3MXQ A;  1G68 A;  4HJ3 A;  1G5U A;  1KVL A;  4ZJ1 A;  2CC1 A;  4JF5 A;  2V8F A;  2O99 A;  4LCM A;  2QJ5 A;  4P6B A;  1K56 D;  3BFD A;  1YMS A;  3TSG A;  1TEM A;  2K31 A;  4DE1 A;  4U0T A;  2VX8 A;  1LSW A;  1K55 A;  2VEA A;  2Y2Q A;  3DWZ A;  2ZD8 A;  3PAG A;  3IXB A;  2ZM8 A;  2PD7 A;  3LEQ A;  1FCM A;  1K4F A;  2HP5 A;  4MN7 A;  3DAV A;  3N8L A;  4GB7 A;  1LSV A;  4LV2 A;  4EEU A;  4HOI A;  2JCH A;  3RXW A;  4QU3 A;  3LYX A;  5J7E A;  3EQV A;  4DF6 A;  5JYO A;  4Y13 A;  3KYZ A;  1K54 C;  3BYD A;  3OC2 A;  2IWD A;  5G4Z A;  4KZA A;  2V1B A;  5G4Y A;  3DW0 A;  3LY3 A;  3OCN A;  3LGO A;  4EES A;  3JPU A;  4UQI M;  3IX4 A;  1S66 L;  2A3U A;  3M2K A;  4EWF A;  3Q82 A;  4L9E A;  4L9G A;  3R4K A;  1XJ2 A;  3B3X A;  1BLC A;  3IS2 A;  4I39 A;  3M6B A;  2WKH A;  3BQ8 A;  3D72 A;  4OPZ A;  4PM7 A;  3CJM A;  3SZT A;  4Y7P A;  1K56 A;  1FIL A;  2WK0 A;  3IXH A;  1PNE A;  3F1N A;  4NG2 A;  1OPX A;  5F1G A;  4OP5 A;  5EVI C;  1FSW A;  1MWT A;  4LFU A;  5L07 A;  4AFI A;  1EW0 A;  4X25 A;  3T4K A;  5EFW A;  5FQK A;  3BWL A;  3T4S A;  2WAD A;  3KSF A;  5FDH A;  2M7U A;  1JWV A;  4ETX A;  2XA7 S;  4MBF A;  3UB8 A;  2Y2N A;  5TR7 A;  3KO6 A;  3NEC A;  3NI9 A;  3MKF A;  4E3I A;  4Q8I A;  2J7V A;  2ZQ9 A;  3V3R A;  5AQA A;  3Q1F A;  5L2F A;  1MWS A;  3CPT B;  5FI2 A;  2P9V A;  1SZV A;  4MDZ A;  5CTM A;  1J3W A;  3N7W A;  1E4D A;  1K38 A;  2O0Y A;  5HFO A;  3BJN A;  3A0S A;  3MZE A;  2HZ5 A;  2LB5 A;  2PDR A;  5CEB A;  2P04 A;  1YPR A;  1DP9 A;  1H3Q A;  1BSG A;  4EBL A;  3PBR A;  1BUE A;  2B5R A;  3A3E A;  1GSW A;  2P74 A;  3HUN A;  3GEC A;  3PAE A;  5FQJ A;  1O07 A;  3NY4 A;  1SCW A;  3T4O A;  4NXF A;  1FR1 A;  4E3J A;  1K55 C;  1WA9 A;  4R3J A;  4LGW A;  4HES A;  3VP3 A;  3LR5 A;  1YLT A;  3MQQ A;  3E2L A;  3HLC A;  4UA9 A;  3OZH A;  4ZJ2 A;  1BZA A;  5DJU A;  1G6A A;  3GDI A;  4O01 A;  5F83 A;  1C3B A;  3ZG8 B;  5TFQ A;  4BBT A;  4DDY A;  1PZO A;  4E3K A;  3T1X A;  3UMD A;  1KE4 A;  2HV1 A;  1MKM A;  2A24 A;  3RTY A;  4DE0 A;  2H10 A;  3SOI A;  3PXP A;  3OPR A;  4N1X A;  1L0G A;  4ME4 A;  4U3T A;  1LI9 A;  2WKI A;  1SHV A;  3G2Z A;  2VGJ A;  2XK1 A;  3ZCZ A;  3DTI A;  4ARZ A;  1S1Y A;  4QPR A;  4DXB A;  1KGF A;  5GLC A;  5IU1 A;  2ZM2 A;  2JKT I;  1N4O A;  3B47 A;  3NDG A;  1OTE A;  3HBR A;  3G32 A;  3MF0 A;  4S2K A;  1OME A;  5HL6 A;  3C5A A;  1ACF A;  1XA7 A;  3UB5 P;  1YLY A;  1I2S A;  3ZG0 A;  2Y2K A;  3IF5 A;  4WN5 A;  4K08 A;  4BWI A;  3HLG A;  4HEF A;  2OWH A;  3MBZ A;  2L4R A;  3H9W A;  4BEN A;  4KZ5 A;  4MCW A;  2I72 A;  1T1C A;  3EGD C;  3UPO A;  3QP4 A;  5A91 A;  4RX2 A;  3LR4 A;  5DKL A;  1YLP A;  2ZMF A;  2OLV A;  4OQG A;  5E2F A;  3S7O A;  4OLG A;  4YWZ A;  5E2G A;  4EEP A;  2EFU A;  5DF8 A;  2B02 A;  5AQB A;  4BQM A;  4KQR A;  1OJ5 A;  1MPL A;  5A90 A;  3GVB A;  1A0K A;  1Q2P A;  4FOF A;  1PW1 A;  4HHD A;  4E3N A;  2DNS A;  2JKR M;  2PAV P;  2E8I A;  3UB6 A;  4HI4 A;  1I2W A;  3PHY A;  3SS4 A;  4NEE D;  2VK3 A;  1NXY A;  3WS4 A;  1YLW A;  3P98 A;  4G3K A;  3CAX A;  5FEF A;  1L0F A;  3G30 A;  4JGQ A;  1WE4 A;  4F3L B;  3HJK A;  5HW3 A;  3TRC A;  4JGP A;  2ACG A;  5CED A;  4N1H A;  3OOV A;  1QME A;  5F6A A;  2FFF B;  2O9C A;  3PBQ A;  1IOU A;  1LSX A;  3IWO A;  2FFY A;  4L0L A;  1DJC A;  5AQ7 A;  5FAS A;  4H6J B;  1IYO A;  3E0Y A;  3F1O A;  3S7P A;  5HDS A;  1X0O A;  4ZDX A;  3G6O A;  2DCF A;  3UE1 A;  3V39 A;  1P9R A;  3GV9 A;  4CJN A;  4R3B A;  3P09 A;  2FH5 A;  2ZC4 B;  1NYY A;  5I94 A;  3C30 A;  2WZZ A;  3UO9 A;  1NY0 A;  3EEA A;  3WWX A;  3IHB A;  4GZB A;  3UE6 A;  3LR0 A;  2X02 A;  5FL3 A;  4EET B;  3IXD A;  3VSK A;  4I3I A;  1H0M A;  2LB9 A;  3W4P A;  3HLE A;  2X01 A;  1Y28 A;  2XR0 A;  1DP6 A;  1TS7 A;  1RP5 A;  1BT5 A;  2J80 A;  1ONH A;  3M2J A;  2Y91 A;  2W1T A;  4G3V A;  3OLO A;  3A3D A;  3LID A;  3QHY A;  3Q07 A;  5M18 A;  2ZJ9 A;  4S2P A;  4KZ9 A;  3A0R A;  1NJ4 A;  5DJT A;  4WBG A;  1HLU P;  3C7U A;  1LL8 A;  5HD3 A;  5CGX A;  2H0Y A;  4HP9 A;  1IYP A;  4PKY A;  4HH3 A;  5GLD A;  4JKT A;  4WL9 A;  4P0M A;  3PBN A;  2OLU A;  5HX9 A;  3KSH A;  3ZDJ A;  2VGK A;  4Q0H A;  4YFM A;  4XUZ A;  2WKE A;  2PYR A;  2QWS A;  1ERO A;  4ZJ3 A;  3LUQ A;  1OTA A;  4DKI A;  4OKP A;  3VE4 A;  4RVA A;  4JXV A;  2XD5 A;  1MY8 A;  4ZBE A;  1H8M A;  1YAX A;  2HDQ A;  1RGY A;  4JF6 A;  1BLP A;  4KG6 A;  1IKI A;  1OTB A;  1M6K A;  4EUV A;  4QB8 A;  1JTD A;  4KZ7 A;  2EA9 A;  3N6I A;  3UB9 A;  3F1P B;  4OVD A;  1MKI A;  1OTD A;  3BW6 A;  5JYP A;  2R9X A;  3VOL A;  1IYS A;  1GCE A;  4R70 A;  2RCX A;  3NBL A;  5FDS A;  1ES4 A;  4YOF A;  5FAO A;  4R1G A;  4GOG A;  4BMW A;  3VMA A;  5A92 A;  3UDX A;  5DKK A;  4GD6 A;  3KSG A;  3IBR A;  2W27 A;  4IHQ A;  4U0X A;  4WLA A;  1K0K A;  3VFF A;  3HUM A;  2WGW A;  3IH9 A;  3G34 A;  3FYZ A;  5FSR A;  2YKF A;  5IS1 A;  4C6Y A;  2HP9 A;  2W3D A;  2PR6 A;  4PKY G;  1HVB A;  2Z6C A;  5IHV A;  3PBT A;  1VM1 A;  3GMW A;  1Y4O A;  1H8Y A;  4YNR A;  2JKG A;  1ZG6 A;  3LIF A;  2R78 A;  2M1C A;  2EFX A;  4EBN A;  4RYE A;  4EV4 A;  1GHI A;  3WS1 A;  2D02 A;  1IEL A;  4O7D A;  5EM1 A;  3FV7 A;  1XJ4 A;  2OAP 1;  2W3E A;  4KQO A;  4DE3 A;  3T12 B;  4GS9 B;  3TOI A;  5KIZ A;  5DFX A;  2WAF A;  4JXW A;  1QMF A;  1SKO B;  3IWQ A;  3FZC A;  1F2K A;  5DTS A;  1T19 A;  4JGR A;  3CPT A;  3IH8 A;  2XFT A;  3LY4 A;  2ZC6 B;  3M6H A;  4I38 A;  4OPY A;  2IWC A;  3ZVW A;  4P6Z S;  3C4O A;  4FCF A;  2PYP A;  4JGO A;  4B88 A;  4LEN A;  4LRY C;  4QWO A;  4KZ3 A;  2GZA A;  4N92 A;  2EXB A;  1KDW A;  1CI9 A;  2VZW A;  3BY8 A;  3I7J A;  3CMZ A;  1NLY A;  1S6R A;  5J3W A;  2ZBB A;  2Y2L A;  2HGV A;  3H7W B;  5FA7 A;  1FQG A;  2V9A A;  2Y8H A;  4S2I A;  5HAR A;  1PRQ A;  1JWZ A;  4GCZ A;  3PTE A;  3IF6 A;  5L8M A;  3SW1 A;  3HLD A;  4QD4 A;  3CUE A;  3U2A A;  1Z09 A;  3BEB A;  5EVI B;  2QZ6 A;  4MBH A;  1XFQ A;  3LIE A;  1VEU B;  4R23 A;  4E3M A;  3EOI A;  3O86 A;  1BUL A;  1F98 A;  2XRO A;  3UNW A;  4ZAM A;  3T4Q A;  4E6W A;  2RL3 A;  2VLG A;  3QP5 A;  4HJ4 A;  5CGW A;  3P7N A;  5L10 A;  4OOY A;  3WRT A;  3EWK A;  2V0W A;  2XA7 M;  3VP4 A;  3SH7 A;  1NRJ A;  4GNU A;  1W8Q A;  1K57 C;  4CLC D;  1STZ A;  4PM8 A;  1OT9 A;  4R6L A;  4NXB A;  1YSQ A;  2ZQC A;  4IVK A;  3JVV A;  1D1J A;  2Z2M B;  5TJJ A;  3EEH A;  5FQI A;  5K5B A;  2Z2L B;  1LI0 A;  5HWV A;  1K25 A;  5CXW A;  2ZMV A;  4DDS A;  4UEY A;  3RXX A;  4PPR A;  4ZRR A;  3N4I A;  3AGF A;  1ZC2 A;  3HRE A;  4LV3 A;  3GR2 A;  4JLF A;  3ZGA B;  2ZQ7 A;  3ZHH A;  3BFG A;  1WYC A;  4Y2F A;  4XT2 A;  5KSC A;  3UE3 A;  1ES3 A;  3T4L A;  5J8X A;  2Y79 A;  1FR6 A;  4WF0 A;  2OSU A;  1TS0 A;  3HJI A;  3G31 A;  2GX5 A;  4FH2 A;  4GLQ A;  4EQ1 A;  4MNR A;  4HY8 A;  1JNU A;  4MBK A;  2Y2G A;  2K7S A;  3ZYT A;  4OQI A;  2XQZ A;  5HAP A;  1IFQ A;  3JVU A;  1GSV A;  2H0T A;  2QYB A;  4CLC A;  4KZ4 A;  3VP0 A;  5CHJ A;  4G3W A;  1PFL A;  3C7V A;  3HVF A;  5HSQ A;  2EXA A;  2KDK A;  3UY6 A;  4ID4 A;  1AXB A;  3QP2 A;  3IS2 B;  3EGX C;  3RFB A;  3IBJ A;  1TS8 A;  3HLB A;  3IF6 C;  4E3L A;  3T1Q B;  1ONG A;  2CMN A;  3MMH A;  1NZO A;  2Q9M A;  5AVE A;  3PBO A;  4IBR A;  3W4O A;  3K3D A;  4RX3 A;  1VET A;  1BLS A;  3BLS A;  4I3J A;  2EX2 A;  2K2N A;  3LR3 A;  4HBT A;  4PM5 A;  3O3V A;  4BD0 A;  2QKP A;  2BLS A;  1YQS A;  5F68 A;  3CLO A;  2V0U A;  1T1A A;  2W3F A;  3W8K A;  3UME A;  2XSS A;  3T1R A;  2JKF A;  3GQZ A;  3HUO A;  1D06 A;  3QP8 A;  3DTK A;  2KOI A;  5HAQ A;  2ZC3 B;  2P9V B;  2XH9 A;  3FC7 A;  1NRF A;  3LIA A;  2HJE A;  4MEZ A;  5C5K A;  3NJA A;  5BOH A;  1KGE A;  3FPV A;  4Y15 A;  3ULF A;  4FH4 A;  1LT0 A;  1FIK A;  1W5D A;  1L0D A;  5EEC A;  2ZLY A;  4FD8 A;  4Y5F A;  5HAI A;  1XGI A; 
#chains in the Genus database with same CATH homology
 2OLU A;  1ERM A;  5HX9 A;  3ZDJ A;  1K55 A;  1KVM A;  4IBX A;  1CI8 A;  2VGK A;  2Y2Q A;  4YFM A;  3DWZ A;  2WKE A;  4XUZ A;  4JXS A;  5EPH A;  2ZD8 A;  1ERO A;  1FCN A;  1ZKJ A;  2BG1 A;  3PAG A;  4ZJ3 A;  3IXB A;  2WZX A;  3ITA A;  4QY5 A;  4OON A;  5M1A A;  4DKI A;  4OKP A;  4XUX A;  2ZM8 A;  1FCM A;  1K4F A;  4RVA A;  2HP5 A;  4JXV A;  4WZ4 A;  2XD5 A;  1BLH A;  1LL9 A;  1MY8 A;  4ZBE A;  3UN7 A;  4PM6 A;  4S2J A;  3NC8 A;  3N8L A;  4GB7 A;  4KG5 A;  2WUQ A;  1M40 A;  3BRM A;  4LV2 A;  4XXR A;  4LV1 A;  3V5M A;  2HDQ A;  1RGY A;  2JCH A;  4JF6 A;  1GHP A;  4QU3 A;  3RXW A;  1BLP A;  3EQV A;  4KG6 A;  1IKI A;  4DF6 A;  5D3O A;  5JYO A;  1M6K A;  2C6W B;  3JYI A;  1XPB A;  4GKU A;  5FAT A;  5CER A;  3UPN A;  4QB8 A;  1DJB A;  1JTD A;  4KZ7 A;  1K54 C;  3BYD A;  2JC7 A;  3IF6 B;  4KQQ A;  3OC2 A;  3VSL A;  2IWD A;  2HDU A;  3N6I A;  4KZA A;  4OVD A;  3ITB A;  1MKI A;  3DW0 A;  3LY3 A;  4Y0U A;  3OCN A;  4WEL A;  5JYP A;  2R9X A;  4NET A;  1YMX A;  3BFE A;  1IYS A;  1GCE A;  4HBU A;  3SH9 A;  2RCX A;  3NBL A;  3A3I A;  1CEG A;  3E2K A;  2A3U A;  3M2K A;  3OPP A;  1ES4 A;  4EWF A;  5CHU A;  2HDS A;  5FAO A;  2XD1 A;  3Q82 A;  5KSH A;  4WZ5 A;  4R1G A;  3V3S A;  4GOG A;  3VMA A;  1NYM A;  4N9L A;  5A92 A;  3MKE A;  3UDX A;  3B3X A;  4GD6 A;  1BLC A;  2Y4A A;  2J9O A;  5EOO A;  5G18 A;  4U0X A;  1ESI A;  2C5W B;  3A3J A;  3OCL A;  1JWP A;  1NZU A;  2UWX A;  2WKH A;  3M6B A;  1CEF A;  3MZD A;  3VFF A;  4OPZ A;  3HUM A;  3CJM A;  2WGW A;  4PM7 A;  1PZP A;  1S0W A;  3IH9 A;  1SKF A;  3G34 A;  3FYZ A;  1K56 A;  4X53 A;  2WK0 A;  3IXH A;  4C3Q A;  5FSR A;  4S2L A;  4E6X A;  1L0E A;  3UDF A;  3VOZ A;  4IVI A;  4B4X A;  5F1G A;  4C6Y A;  4OP5 A;  2HP9 A;  3IWI A;  5EVI C;  1FSW A;  1PW8 A;  1MWT A;  1HVB A;  4WMC D;  5IHV A;  1EI5 A;  3PBT A;  3LO7 A;  5GHZ A;  1VM1 A;  1PWC A;  1YLJ A;  1YM1 A;  2Y2O A;  2OV5 A;  5CRF A;  5CEC A;  4M3K A;  3MFD A;  3GMW A;  5FQK A;  1H8Y A;  1GA0 A;  1CK3 A;  2WAD A;  3Q7V A;  1ZG6 A;  4JF4 A;  3FKW A;  5FDH A;  3UPP A;  1JWV A;  1ERQ A;  5M19 A;  5CGS A;  4DXC A;  2EFX A;  4K0X A;  4MBF A;  5TGF A;  2HDR A;  2Y2N A;  5TR7 A;  4WEK A;  5FQM A;  4EBN A;  4RYE A;  4EV4 A;  1ES2 A;  1GHI A;  1VQQ A;  3WS1 A;  2R9W A;  4EUZ A;  2JBF A;  3NI9 A;  2Y55 A;  3MKF A;  2V1Z A;  3CG5 A;  3BLM A;  4E3I A;  4Q8I A;  2J7V A;  2ZQ9 A;  3BEC A;  3ZFZ A;  2WGI A;  4QY6 A;  1IEL A;  3V3R A;  1E25 A;  4O7D A;  5AQA A;  3ZG5 A;  1EWZ A;  3FV7 A;  3Q1F A;  4ZTK A;  5L2F A;  1MWS A;  2H5S A;  1HZO A;  5FI2 A;  4KQO A;  4DE3 A;  4KEN B;  2P9V A;  3LCE A;  5CTM A;  5DVA A;  5E2E A;  3TOI A;  3GRJ A;  4IED A;  3N7W A;  1PWD A;  1E4D A;  2ZM0 A;  2WAF A;  1K38 A;  1I5Q A;  5HFO A;  4JXW A;  1XGJ A;  3MZE A;  4JBF A;  4X55 A;  1QMF A;  5E2H A;  4OP8 A;  3G35 A;  3IWQ A;  4JPM A;  3FZC A;  3G4P A;  1K4E A;  4BL3 A;  3QNB A;  5DTS A;  5CEB A;  3IH8 A;  2XFT A;  1LLB A;  3LY4 A;  2ZC6 B;  3IHA A;  3M6H A;  1BSG A;  3OPL A;  4EBL A;  5GHX A;  3PBR A;  1BUE A;  4OPY A;  2IWC A;  4PMA A;  5GL9 A;  2B5R A;  3ZVW A;  3C4O A;  3A3E A;  4KZ6 A;  4KZ8 A;  4FCF A;  2P74 A;  4LV0 A;  4B88 A;  3HUN A;  4LEN A;  3EQU A;  5EOE A;  1RGZ A;  2HPB A;  3PAE A;  5FQJ A;  1O07 A;  3SS3 A;  3NY4 A;  3V50 A;  1SCW A;  4KZ3 A;  5AQ9 A;  2Y59 A;  3VOY A;  2GDN A;  4N92 A;  1PI5 A;  4OPR A;  2EXB A;  3G2Y A;  1Z6F A;  1FR1 A;  3ZNT A;  1KDW A;  1K55 C;  4E3J A;  1CI9 A;  4JXG A;  4R3J A;  3Q81 A;  3I7J A;  3CMZ A;  1IYQ A;  1FCO A;  1E3U D;  1PI4 A;  1S6R A;  2XGN A;  4HES A;  5F1F A;  2Y2L A;  1K54 A;  3VP3 A;  3CZD A;  5FA7 A;  4GD8 A;  1FQG A;  2V2F F;  1YLT A;  4DRT A;  4WMC A;  4BJP A;  2PU4 A;  3MXS A;  4S2I A;  5HAR A;  3WS0 A;  3E2L A;  3HLC A;  4UA9 A;  3OZH A;  4KG2 A;  1BZA A;  4ZJ2 A;  3UDI A;  1G6A A;  5GHY A;  3PBS A;  4WYY A;  4X6T A;  2Y2J A;  3ZNY A;  1JWZ A;  4P87 A;  5F83 A;  1C3B A;  1LHY A;  3ZG8 B;  5DF7 A;  5TFQ A;  3PTE A;  4DDY A;  1PZO A;  4MLL A;  3DTM A;  3IF6 A;  4E3K A;  2QPN A;  4E3O A;  5KZH A;  2XF3 A;  3HLD A;  4QD4 A;  1KE4 A;  1W79 A;  2DRW A;  4PM9 A;  4UA6 A;  4QJG A;  3BFF A;  3BEB A;  3HLW A;  5EVI B;  2QZ6 A;  4MBH A;  1XP4 A;  2H10 A;  3SOI A;  4DE0 A;  4N1X A;  1GA9 A;  3OPR A;  1L0G A;  3N8S A;  2JE5 A;  4U3T A;  1LI9 A;  2WKI A;  1SHV A;  4R23 A;  5DTK A;  2PBY A;  4E3M A;  3G2Z A;  2VGJ A;  2XK1 A;  2WGV A;  3QNC A;  1DJA A;  1ALQ A;  1J9M A;  3ZCZ A;  3O86 A;  4Y0O A;  3GSG A;  3OPH A;  1HD8 A;  4DXB A;  1BUL A;  4LCL A;  3S4X A;  1HTZ A;  3WRZ A;  1KE3 A;  4S2O A;  4WZ5 C;  2Q9N A;  1KGF A;  1K6S A;  2A49 A;  4UAA A;  5GLC A;  4ZAM A;  3UNW A;  4E6W A;  2RL3 A;  4S2N A;  2ZM2 A;  5CGW A;  1N4O A;  4WM9 A;  1TVF A;  2V20 A;  4DE1 A;  3NDG A;  1ZG4 A;  3HBR A;  3G32 A;  4OOY A;  3WRT A;  4K91 A;  3VP4 A;  1FOF A;  3O88 A;  4S2K A;  1OME A;  3C5A A;  1XA7 A;  3SH7 A;  5A93 A;  1YLY A;  2EX6 A;  4DE2 A;  1I2S A;  4GNU A;  1W8Q A;  3ZG0 A;  1K57 C;  5FAQ A;  2Y2K A;  3IF5 A;  4PM8 A;  5KMW A;  3W4Q A;  1PYY A;  5FQ9 A;  1Q2Q A;  2Y2H A;  3HLG A;  4KZB A;  4HEF A;  1XXM A;  4RA7 A;  3MBZ A;  5GLB A;  2ZQC A;  1TDL A;  4IVK A;  3VFH A;  4GN2 A;  4BEN A;  3WS2 A;  2WYX A;  5EUA A;  4KZ5 A;  2I72 A;  1E3U A;  3UPO A;  2Z2M B;  1ES5 A;  1YLZ A;  5FQI A;  4EQI A;  1PWG A;  2Z2L B;  3FKV A;  5A91 A;  3O87 A;  4K0W A;  1ESU A;  1RCJ A;  4RX2 A;  1Y54 A;  1LI0 A;  1YT4 A;  5EVI D;  1W7F A;  1K25 A;  1YLP A;  5DTT A;  5GLA A;  5FI6 A;  5CXW A;  2J8Y A;  2OLV A;  4OQG A;  5E2F A;  3C4P A;  4OLG A;  1W8Y A;  2EX8 A;  5E2G A;  4DDS A;  2EFU A;  5DF8 A;  5CTN A;  4F94 A;  5AQB A;  3RXX A;  4BQM A;  5FQQ A;  4KQR A;  4P85 A;  4PPR A;  3N4I A;  3AGF A;  3HLF A;  1MWU A;  1ZC2 A;  1MPL A;  5A90 A;  3NCK A;  3GVB A;  1Q2P A;  3HRE A;  1PW1 A;  4CPK A;  4E3N A;  2DNS A;  4BLM A;  4LV3 A;  3GR2 A;  4JLF A;  1L2S A;  4OLD A;  3ZGA B;  2ZQ7 A;  2E8I A;  1N9B A;  3ZHH A;  3N8R A;  1I2W A;  3BFG A;  4EBP A;  3SS4 A;  4Y0T A;  2G2U A;  1WYC A;  4UA7 A;  1KGG A;  1NXY A;  3WS4 A;  3IXG A;  4X69 A;  3UE3 A;  1YLW A;  5KSC A;  1ES3 A;  2G2W A;  3P98 A;  4BL2 A;  3SS5 A;  3UE0 A;  3LEZ A;  2XFS A;  5J8X A;  1L0F A;  3G30 A;  1WE4 A;  1FR6 A;  2OSU A;  2XDM A;  5HW3 A;  4Z9Q A;  1XKZ A;  4OOL A;  5DF9 A;  3G31 A;  3ZG7 B;  4FH2 A;  4MNR A;  4N9K A;  4S2M A;  1GHM A;  3BFC A;  4UHU A;  4MBK A;  5FAP A;  5CED A;  1SDE A;  4N1H A;  2HP6 A;  2Y2G A;  4FSF A;  2WAE A;  2ZC5 B;  4GDB A;  3S1Y A;  1QME A;  1JTG A;  5EVL A;  2FFF B;  4A5R A;  4OQH A;  3D4F A;  3PBQ A;  3IWO A;  4OQI A;  1K6R A;  2FFY A;  1FSY A;  5EE8 A;  2XQZ A;  3ZG9 B;  5HAP A;  5U47 A;  4L0L A;  1DJC A;  4X56 A;  2H0T A;  4OQ0 A;  5AQ7 A;  5FAS A;  2Y2M A;  1IYO A;  4KZ4 A;  3VP0 A;  5CHJ A;  2ZQ8 A;  3C7V A;  4ZDX A;  3HVF A;  2DCF A;  2EXA A;  3UE1 A;  5E43 A;  3UY6 A;  1DY6 A;  4ID4 A;  3V39 A;  3GV9 A;  4CJN A;  1AXB A;  4R3B A;  4R4R A;  3IT9 A;  3P09 A;  1MXO A;  3MXR A;  2ZC4 B;  1NYY A;  5I94 A;  2ZMA A;  4X68 A;  3RJU A;  2IWB A;  3HLB A;  5EVI A;  3WS5 A;  3IF6 C;  4E3L A;  1XX2 A;  1TDG A;  2WZZ A;  3NIA A;  2WGW B;  3UO9 A;  5F82 A;  1ONG A;  2ZC7 A;  4R0Q A;  1NY0 A;  4B4Z A;  4OH0 A;  4BD1 A;  1NZO A;  2Q9M A;  2ZQA A;  1KE0 A;  1H5X A;  3AGE A;  3WWX A;  3PBO A;  3IHB A;  4OOM A;  4GZB A;  4IBR A;  3W4O A;  3VP1 A;  2Y2P A;  4RX3 A;  2QMI A;  1BLS A;  3BLS A;  4R4S A;  1BTL A;  2EX2 A;  4Y7P A;  2XLN A;  4HBT A;  1K57 A;  2X02 A;  2ZQD A;  4OPQ A;  4YIN A;  3GTC A;  3IQA A;  4H8R A;  3Q7V B;  4PM5 A;  3O3V A;  1O7E A;  4BD0 A;  2J9P A;  5FI7 A;  3IXD A;  2EX9 A;  1XA1 A;  3VSK A;  5HL1 A;  2BLS A;  1YQS A;  1MBL A;  2Y2I A;  1SDN A;  3DWK A;  1MWR A;  3W4P A;  3HLE A;  2X01 A;  3TG9 A;  1JVJ A;  1LL5 A;  2XR0 A;  4C75 A;  1RP5 A;  4S2N C;  3VP2 A;  1BT5 A;  3W8K A;  1ONH A;  3M2J A;  2Y91 A;  2PU2 A;  4QHC A;  3GQZ A;  3HUO A;  3NDE A;  4WEJ A;  3MZF A;  3ISG A;  1PIO A;  3A3D A;  1WYB A;  3BM6 A;  5CHM A;  1H8Z A;  5HAQ A;  4D2O A;  1KDS A;  3FWL A;  3QHY A;  3SH8 A;  2ZC3 B;  3Q07 A;  5M18 A;  2ZJ9 A;  3A3F A;  1G68 A;  2P9V B;  2XH9 A;  1IEM A;  1NRF A;  4S2P A;  1KVL A;  4GDN A;  4ZJ1 A;  2CC1 A;  3AGD A;  4JF5 A;  4KZ9 A;  4MEZ A;  1NJ4 A;  5BOH A;  1KGE A;  3S22 A;  4WBG A;  2X71 A;  4FH4 A;  4LCM A;  3C7U A;  4NK3 A;  5CGX A;  2H0Y A;  1W5D A;  1L0D A;  4P6B A;  2ZLY A;  4FD8 A;  1U60 A;  5EEC A;  3ZVT A;  1IYP A;  1K56 D;  3BFD A;  1YMS A;  2XEP A;  1IKG A;  3TSG A;  1TEM A;  3HL9 A;  5GLD A;  4JKT A;  5HAI A;  1XGI A;  3Q7Z A;  4P0M A;  3PBN A;  4U0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...