1YLTA

Atomic resolution structure of ctx-m-14 beta-lactamase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-lactamase CTX-M-14
publication title Atomic Resolution Structures of CTX-M beta-Lactamases: Extended Spectrum Activities from Increased Mobility and Decreased Stability.
pubmed doi rcsb
source organism Escherichia coli
total genus 97
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1yltA00
4X53A 4FH2A 1MY8A 2PBYA 4RYEA 1W7FA 3ZDJA 4WMCA 1YMSA 2EXBA 4PMAA 4WMCD 4X6TA 1YLTA 2XK1A 1U60A 1YLJA 3D4FA 2R9XA 2Y59A 2ZQ9A 3BYDA 3O87A 2X01A 5E2FA 5DF7A 2QZ6A 1TDGA 3HLBA 1L0DA 5FAPA 5JYOA 1E25A 3RXXA 4GD6A 1ESIA 1DJBA 2XFTA 1DJCA 2FFFB 1K54C 4A5RA 2WKHA 3IH9A 2EFXA 2XD5A 4UA9A 4JF6A 1JWZA 4X56A 1PIOA 3OPHA 3V5MA 1RP5A 4N1HA 4WZ4A 1SKFA 2H5SA 2HP5A 4S2PA 5DTTA 3VFHA 1FSWA 1K6SA 3G2YA 5FAOA 2ZMAA 3Q7VA 4RX2A 3AGFA 5CRFA 5L2FA 1JTGA 3VP1A 3HLCA 2C5WB 4R4SA 3BEBA 1IYQA 3SH9A 4OONA 2OLUA 4C3QA 4KZ9A 5TGFA 2Q9MA 4H8RA 3WS1A 3PBOA 3PBQA 3GRJA 2WKIA 4QY5A 2ZQ8A 2Y2QA 3W4QA 3NC8A 3EQUA 1CI8A 4Y7PA 2XF3A 2RCXA 4QHCA 5HARA 1GHIA 4OOYA 3LCEA 3VP0A 1JWVA 3S1YA 4GKUA 3V39A 1SCWA 4R3BA 1M40A 3IH8A 3MZDA 1KDWA 5FQQA 2JCHA 1KVMA 1K57C 4EUZA 5A92A 1FR6A 1BTLA 1ERMA 4IBRA 4OOLA 1ERQA 2ZJ9A 3W4OA 1GHPA 4KZ7A 1FCOA 3HVFA 1MKIA 4MBHA 5EVIB 4PM8A 4OVDA 1HTZA 5GHYA 2P9VB 4P0MA 3IWQA 2CC1A 3TSGA 2BG1A 3Q82A 1PI4A 1S0WA 1FOFA 4PPRA 4GB7A 4OP5A 5AQ9A 2IWCA 4S2LA 1I2WA 1Y54A 3M2KA 4GNUA 4Y0UA 1BLHA 2XLNA 5DF8A 4KZBA 5DVAA 2WK0A 3N8LA 1GA0A 2HDUA 4JF4A 3SH8A 4EBPA 4Q8IA 1MXOA 1VM1A 4DDSA 2XEPA 5KZHA 4N9LA 5E2HA 3HUOA 1NYMA 2GDNA 4U3TA 3FZCA 1ONGA 1K54A 5HL1A 4GDBA 4EBNA 5DF9A 3Q07A 4QY6A 4LV1A 3PBNA 5EE8A 3G30A 1K38A 1KE4A 1XX2A 3UE3A 2VGKA 1JVJA 1Q2QA 4OH0A 4WELA 1OMEA 3TG9A 3UO9A 1EROA 3A3DA 5TR7A 5TFQA 3ISGA 3BLMA 4R23A 3CZDA 3C7UA 1KDSA 1KE3A 4E3NA 2ZC3B 4N9KA 2XD1A 1IELA 1KE0A 4FSFA 1YLPA 5FI2A 4N1XA 1KGFA 2OLVA 3G4PA 4WZ5C 3BFFA 4LV2A 2B5RA 3ZNYA 5KMWA 2ZQCA 2Y2LA 3RXWA 1MWRA 3HLFA 3VSLA 4S2IA 3E2LA 5CECA 3OCLA 1CEGA 3I7JA 4BD1A 3PBSA 1PWGA 5F83A 5A93A 2WZZA 4OKPA 4K0WA 3NCKA 2VGJA 1O7EA 1XA7A 3MZEA 4DE0A 1BLCA 1NJ4A 3AGDA 3NI9A 5GL9A 1K57A 4JBFA 1NRFA 1IYOA 4DXBA 3N8RA 1WYBA 4KZ4A 3BFCA 1LL9A 2WGWA 4U0TA 3ZFZA 3S22A 4IVIA 4EWFA 5I94A 5EOEA 2ZC6B 5CGXA 4DE2A 3MXSA 3VSKA 4ZDXA 4S2OA 1E3UA 1NXYA 5E43A 1E3UD 5FAQA 3B3XA 4MEZA 3ZVWA 3ITAA 2Z2MB 1FCMA 3QNBA 1I2SA 4K0XA 4JXGA 1JWPA 5EPHA 1XXMA 2G2WA 5AQAA 2Y2IA 3EQVA 4B88A 1YLZA 1XGJA 3OPPA 4JXVA 3BFGA 3BM6A 2PU2A 4Y0OA 3UPOA 1FQGA 1AXBA 4UA6A 3GR2A 3OPLA 4KQRA 1PI5A 3WS4A 3FWLA 3GVBA 1RGYA 5EOOA 3Q7VB 2HDSA 2J8YA 1N4OA 1NY0A 3ZGAB 3MKFA 2Y2GA 2X71A 1W79A 3A3JA 4OP8A 4ZJ3A 5CHUA 4E3JA 1IYSA 1GHMA 4C75A 2EXAA 3NDEA 4R3JA 5HAPA 1K55C 1CK3A 4E3OA 3IWIA 1GCEA 3A3FA 1ZC2A 4X69A 4ZJ1A 3ZVTA 1BUEA 1M6KA 2QPNA 4HBTA 4E3KA 2JC7A 3RJUA 1K25A 3JYIA 2IWBA 3PBRA 3HLWA 1PYYA 4RX3A 1H5XA 3WS0A 1L0FA 4HEFA 3UPPA 3WWXA 1FR1A 3DWKA 3TOIA 3ZCZA 5CEBA 4WZ5A 5DTSA 4E3MA 1IYPA 2UWXA 4GOGA 4P85A 4B4XA 5CXWA 3C5AA 3WS5A 5KSCA 2XH9A 3C7VA 3UDIA 1NYYA 3V3RA 4LCMA 4FCFA 5FASA 3BLSA 5CGWA 1K4FA 4OQGA 4DF6A 4MBFA 4B4ZA 5M18A 2WAFA 4MBKA 1H8YA 3HUNA 3ZHHA 3HBRA 3N8SA 3P09A 1ES2A 4OPRA 4WEJA 2R9WA 3AGEA 3QHYA 2EX9A 1HD8A 3BRMA 4PM6A 4S2NA 4KZ6A 3SS4A 3UNWA 1IEMA 3WRZA 3SOIA 3G32A 3O86A 3IF6B 3S4XA 1C3BA 2Y2MA 4LV3A 1YLWA 2JBFA 3LO7A 3HL9A 1Z6FA 3MBZA 3NIAA 5FQIA 4WBGA 1W5DA 4DKIA 2BLSA 3HLEA 5FI6A 3PBTA 3IXGA 4BJPA 4XXRA 5EVIA 5FQKA 3IXHA 1KGGA 4JKTA 4KENB 1K56A 4E3LA 1ESUA 4BQMA 4YFMA 4E3IA 2V20A 3UY6A 3BECA 3LY4A 3UDXA 2WKEA 3W8KA 5DTKA 5M19A 5FDHA 2Y2OA 5FQMA 5BOHA 1HZOA 3FKVA 4BL3A 2Y91A 1CEFA 4GDNA 2J7VA 4JXWA 2EX6A 3QNCA 5CERA 4OQ0A 3N4IA 4OOMA 1TDLA 2ZC7A 1JTDA 1W8YA 2WGIA 3IQAA 4EV4A 4D2OA 4XUXA 4NK3A 4JXSA 1K55A 4KZ8A 1O07A 4OPQA 4S2KA 1YMXA 1G6AA 2Y55A 4RA7A 2Y2HA 5CEDA 2DRWA 4KG5A 5HAIA 3OZHA 3SH7A 3C4PA 3BFEA 3GMWA 4O7DA 4U0XA 5GLAA 4L0LA 2QMIA 4R1GA 1MBLA 2PU4A 3DWZA 2WZXA 1LHYA 2Y2KA 2ZC5B 4S2NC 4PM9A 5FI7A 3UN7A 4M3KA 4RVAA 5CGSA 1L0GA 4FD8A 4DDYA 4OLGA 3ZG9B 3V3SA 2J9OA 4BL2A 4Y0TA 4QD4A 2I72A 1BSGA 4CPKA 3NDGA 2XR0A 5HAQA 3ZG8B 4QU3A 5EECA 4KZ5A 3ZG0A 1YQSA 1KVLA 2JE5A 4OPZA 4LENA 5EVIC 4E6WA 2IWDA 1K4EA 2HP6A 1KGEA 4ID4A 1ZKJA 4P6BA 3VOZA 3Q7ZA 4WM9A 3VP4A 1ONHA 3A3IA 2A49A 4MNRA 1MPLA 5GLBA 4QB8A 1TEMA 1SDEA 1MWTA 2ZQ7A 2DNSA 5CTNA 3VFFA 4HESA 4S2JA 4CJNA 3BFDA 1ES4A 4ZJ2A 4EBLA 3OPRA 4GD8A 1LI9A 1L0EA 5CTMA 4HBUA 5A90A 1YT4A 3GQZA 3SS5A 5FA7A 3SS3A 2ZQAA 3IHAA 4GN2A 2XQZA 3NY4A 5E2EA 4LV0A 5EUAA 2OSUA 1DY6A 2ZD8A 2ZM8A 1NZUA 2C6WB 4X68A 3W4PA 1Q2PA 2A3UA 2WUQA 4KQQA 2EX8A 4OPYA 4EQIA 1LL5A 5F1GA 1GA9A 1ES5A 5HW3A 5M1AA 1XA1A 2G2UA 4JLFA 5FSRA 4ZAMA 1XGIA 4IBXA 3GV9A 5EVLA 2P74A 5U47A 3IWOA 4BENA 2ZM2A 1PWDA 1EI5A 4KG6A 1H8ZA 4UAAA 1RGZA 5HFOA 1IKIA 3MZFA 4UHUA 2ZM0A 3ZG7B 2Z2LB 3IXBA 4P87A 4ZBEA 3HUMA 2OV5A 1ZG6A 2H10A 1BZAA 2Y2NA 3M2JA 4LCLA 1YLYA 4KZAA 4BLMA 3HREA 3N7WA 4KQOA 1FSYA 2Y2JA 1DJAA 3HLGA 2HPBA 3OC2A 4UA7A 1TVFA 1IKGA 5FATA 3DW0A 2ZLYA 3FV7A 1W8QA 5J8XA 4GZBA 4X55A 5GHZA 5A91A 4Z9QA 1PW1A 3WS2A 3UE0A 5GHXA 1VQQA 2XDMA 4R0QA 1YM1A 1ALQA 2XFSA 3CJMA 1BT5A 2EX2A 3CMZA 3FKWA 1MWUA 3V50A 2ZC4B 3M6HA 3G31A 4KZ3A 4OLDA 4N92A 5EVID 4DE3A 3PAEA 2H0TA 1MWSA 2P9VA 3O88A 4C6YA 3UPNA 1ES3A 1CI9A 3NBLA 3WRTA 4DRTA 2X02A 5KSHA 4DE1A 1K56D 3IHBA 3GTCA 2RL3A 3PAGA 2V1ZA 3IF6A 4FH4A 3LY3A 4QJGA 1PZPA 3P98A 3E2KA 5E2GA 4KG2A 4K91A 2E8IA 2WAEA 1LLBA 5CHMA 3GSGA 2V2FF 2ZQDA 3DTMA 1LI0A 4MLLA 4DXCA 4WEKA 3VOYA 1EWZA 4WYYA 2H0YA 3C4OA 4R4RA 1XPBA 3O3VA 2HP9A 3UDFA 3IF5A 2FFYA 3IXDA 3G2ZA 4YINA 5D3OA 1E4DA 3ZNTA 3A3EA 4F94A 1WE4A 1WYCA 1L2SA 3Q1FA 4OQIA 2Y4AA 4IEDA 2J9PA 4S2MA 5AQ7A 4ZTKA 1PWCA 3ITBA 1SDNA 3VMAA 4OQHA 5FQJA 5JYPA 1BULA 2HDRA 4PM5A 1ZG4A 1G68A 1SHVA 2DCFA 3G35A 2Y2PA 4NETA 5HX9A 4IVKA 1HVBA 1J9MA 3FYZA 5GLDA 3PTEA 3M6BA 1N9BA 2WGWB 4PM7A 5F1FA 5CHJA 4JF5A 3CG5A 3VP2A 1BLSA 2XGNA 2EFUA 4JPMA 4XUZA 1RCJA 1PW8A 1XP4A 4E6XA 1NZOA 1QMFA 3MKEA 5AQBA 5F82A 3MFDA 5GLCA 2Q9NA 1S6RA 2WYXA 3N6IA 3MXRA 1K6RA 3UE1A 1PZOA 4BD0A 1XKZA 3OCNA 2WGVA 5FQ9A 5IHVA 1I5QA 3IF6C 2WADA 1BLPA 1FCNA 3LEZA 3Q81A 1QMEA 2HDQA 3G34A 5G18A 3IT9A 3VP3A 3HLDA 3ZG5A
chains in the Genus database with same CATH superfamily
4X53A 1OTIA 4WMCD 4X6TA 4M4XA 2XA7M 4BBUA 2QZ6A 3CPTB 5FAPA 3MSHA 3RXXA 4GD6A 4F3LB 1DJBA 3T50A 1K54C 3IH9A 2EFXA 4CLCD 3LIBA 1SKOB 4N1HA 3VFHA 1FSWA 5FAOA 4RX2A 5L2FA 1JTGA 3VP1A 3HLCA 4KZ9A 3PBOA 3UMEA 1XFNA 2ZQ8A 3NC8A 1CI8A 3LCEA 3VP0A 3S1YA 3LFVA 5HSQA 3H7WA 4G3KA 4EUZA 4OOLA 1ERQA 4ETXA 1XJ6A 3HVFA 4LRZE 4WF0A 2BG1A 4OP5A 3SZTA 2IWCA 4L9FA 1Y54A 3BY9A 4Y0UA 5F68A 1GA0A 3SH8A 1S67L 4Q8IA 4DDSA 5KZHA 1K54A 1UWPX 5HD3A 1DRMA 3E4QA 3MQOA 5TR7A 2HV1A 3CZDA 4NEED 3C7UA 1KDSA 4BWIA 1KE3A 4Y5FA 1S4RA 4N1XA 1LT0A 2O9AA 2ZQCA 3RXWA 1MWRA 3HLFA 3OCLA 4GW9A 3LR5A 3PBSA 1PWGA 4K0WA 3MZEA 1NJ4A 1NRFA 1WYBA 2ZMVA 4KZ4A 3L7HA 5I94A 4IVIA 5EOEA 3DAVA 5E43A 1E3UD 3ITAA 1LSVA 3QNBA 4Q0HA 3MR0A 2NUPC 2HGVA 1YLZA 1XGJA 3BFGA 4Y0OA 1FQGA 4EEUA 5HWTA 1RGYA 5EOOA 2HDSA 3MKFA 5F5YA 1T1BA 4R3JA 4E3KA 3NOTC 2P04A 1PYYA 3UPPA 5CEBA 1PFLA 4KUOA 5DJTA 4GOGA 4MCWA 4P85A 1CJFA 4LCMA 3NOUC 4MBKA 5AJGA 1OJGA 3P09A 2BTFP 1HD8A 3BRMA 4PM6A 4S2NA 1IEMA 1C3BA 4JGPA 1ZHHB 2JBFA 3HL9A 3NIAA 5FQIA 2PRFA 5A8BA 1W5DA 3PBTA 5EVIA 5L8MA 2A2LA 5FEGA 2IA2A 2VKSA 3BECA 3W8KA 4I38A 5BOHA 2M7UA 2K7SA 2Y91A 1CEFA 4R38A 2J7VA 2EX6A 1W8YA 4XUXA 2PT7A 4NK3A 4KZ8A 4OPQA 1G6AA 3H82A 3MQQA 3SH7A 3C4PA 3BFEA 4U0XA 3DWZA 4EERA 2R78A 1L0GA 2YKHA 4Y0TA 2I72A 1H3QA 2V0WA 5EECA 4KZ5A 4EQ1A 2JE5A 4LENA 2GNXA 4HNBA 4E6WA 1H8MA 2HP6A 1KGEA 1ZKJA 4P6BA 3A3IA 1IOUA 3BW6A 1MPLA 1SDEA 2DNSA 3VFFA 4HESA 1OTBA 4S2JA 2V1AA 3BFDA 4UQIS 5A90A 2VZWA 5HL6A 1OTEA 2DMWA 1P97A 2KOIA 1TS7A 4F3LA 4GN2A 3F1PA 5E2EA 3OLOA 3P01A 4H6JA 4HOIA 2ZOHA 2ZD8A 4X68A 2C6WB 3T1QB 5HD5A 1Q2PA 2FH5A 3B47A 4Y2FA 3A0SA 4OPYA 2W3EA 3P7NA 5HW3A 2PBDP 4IBXA 3GV9A 5EVLA 5U47A 3H7WB 4CLCE 4NKPA 1EI5A 4L9EA 4WUJA 2OV5A 2H10A 1BZAA 4KZAA 3C38A 3ULFA 2HJEA 2ZLYA 3FV7A 4GZBA 5GHZA 3WS2A 1VQQA 3CMZA 1NRJA 3M6HA 3G31A 4YOFA 2H0TA 3O88A 1ES3A 2W3HA 5KSHA 4DE1A 4GS9A 3LY3A 4Q0JA 1PZPA 1YPRA 5E2GA 2E8IA 2WAEA 2ZQDA 4MLLA 4EETB 1EWZA 1XPBA 2FFYA 1E4DA 3F1NA 3T1RA 1WYCA 1L2SA 4O01A 1T1AA 1K0KA 1LSWA 2J9PA 3PR6A 1SDNA 2K2NA 5JYPA 2HDRA 3G35A 3W2ZA 1J9MA 5HPFA 5CHJA 2PD8A 3VP2A 1BLSA 4EESA 2ACGA 2EFUA 1NZOA 5F82A 3MFDA 5GLCA 1S6RA 3N6IA 1D7EA 3LUQA 1G28A 4BD0A 1XKZA 2WGVA 2WADA 1BLPA 1F98A 3Q81A 1QMEA 2HDQA 3G34A 3HLDA 1MY8A 5AVFA 4RYEA 2EXBA 4PMAA 1YLTA 2M1CA 1YLJA 2X01A 2D01A 1TDGA 3HLBA 2CMNA 1E25A 1ESIA 2XD5A 4UA9A 2WKPA 1PIOA 2JKTI 1SKFA 1K6SA 3CITA 5CRFA 2C5WB 4I3AA 1IYQA 5TGFA 2VV6A 2Y2QA 4MN6A 2PR5A 4HQAA 1STZA 1JWVA 1L3LA 1M40A 4ZRRA 3IH8A 5FQQA 4NXGA 4R70A 5A92A 4IBRA 1X0OA 3NECA 3W4OA 2OOLA 1N9NA 4KZ7A 4DMZA 5EVIB 5DKKA 5GHYA 3DBAA 2P9VB 5AVEA 3IWQA 3TSGA 4LPZA 2OWJA 1FOFA 4II7A 1Y4OA 1F2KA 3EEAA 4GNUA 1G6OA 5DVAA 2HDUA 1W63M 2QHKA 1G5UA 4N9LA 5E2HA 3HUOA 4CQHA 2GDNA 1P9RA 1P0ZA 4GDBA 1XJ2A 1T19A 4EBNA 4LV1A 3LGOA 3G30A 1FIKA 1KE4A 2EA9A 3UE3A 1JVJA 4WELA 5IT5A 4I3IA 5J4EA 3H82B 3EEHA 5DKLA 5TFQA 4GCZA 4E3NA 1IELA 1KE0A 4FSFA 1YLPA 5FI2A 1KGFA 3BFFA 2Y2LA 3VSLA 4S2IA 3E2LA 1CEGA 3R7WB 5A93A 2W1TB 2WZZA 3NCKA 1O7EA 1XA7A 1YSPA 1BLCA 3AGDA 3NI9A 5GL9A 2OWHA 3QP4A 4JBFA 1IYOA 4PHTA 3SW1A 4EWFA 4DJ2A 5CGXA 4DE2A 3MXSA 3VSKA 2Z2MB 2V8CA 4O8GA 1I2SA 3F1PB 4K0XA 2G7UA 5EPHA 4H6JB 4I3JA 4CLCB 4JXVA 3BM6A 1AXBA 1ODVA 3GR2A 3OPLA 4KQRA 1PI5A 3LR3A 3WS4A 3FWLA 3E4PA 2J8YA 1N4OA 2VV8A 1W79A 5CHUA 2ZL1B 2UV0E 1GHMA 3NDEA 2J3TC 2E8JA 4E3OA 4ZJ1A 1ZC2A 2O9CA 2OAQ1 1M6KA 4JGOA 1K25A 2IWBA 3PBRA 3HLWA 3HCYA 5L10A 3DWKA 3TOIA 2XRNA 5CXWA 1Y28A 2XH9A 3UDIA 1NYYA 3T4TA 1K4FA 3QP6A 3HBRA 3KYQA 3CWFA 4E04A 3DTKA 1XFQA 4R6LA 3QHYA 2EX9A 1NLYA 4GS9B 3SS4A 3O86A 4Y15A 1VETA 2I9VA 3BWLA 1Z6FA 4EU0A 4DKIA 3HLEA 4RQ9A 3IXGA 2GX5A 4BJPA 4XXRA 1KGGA 3MFXA 3F1NB 2V20A 3UY6A 3DTIA 1N9OA 3OBFA 4GDNA 3N4IA 2LB5A 1TDLA 1UWNX 3LIAA 2Y2HA 5GLAA 5K5BA 1OPXA 4HJ3A 1LHYA 4S2NC 2ZC5B 3UN7A 4FD8A 4IUKA 1GSWA 4DDYA 3V3SA 3NDGA 2XR0A 1YAXA 4HIAA 3ZG0A 4JGQA 1YQSA 4OPZA 5EVIC 5F69A 1K4EA 3VOZA 5FEFA 2A49A 3TRCA 5GLBA 1TEMA 2ZQ7A 5CTNA 2D02A 4ZJ2A 3VE3A 1YT4A 2P08A 4L9GA 2ZQAA 2W27A 4YNRA 1SZVA 3E98A 2XQZA 2B02A 5EUAA 4D60A 2XROA 5CX7A 2ZM8A 1NZUA 2A3UA 2PAVP 4KQQA 5F1GA 5M1AA 1XA1A 2G2UA 4ZAMA 1PRQA 2P74A 4K08A 4BENA 2YKFA 4KG6A 1RGZA 3FPVA 4GLQA 1IKIA 3ZG7B 4ZBEA 4LCLA 2JKGA 4BLMA 3HREA 1OTDA 1DJAA 2Y2JA 3IX8A 1TVFA 5J8XA 4EW7A 4Z9QA 4R0QA 1YM1A 3H9WA 2VA0A 2VX8A 3V50A 4KZ3A 1MWSA 2P9VA 4C6YA 3WRTA 4DRTA 2INWA 3B42A 2V1ZA 3IF6A 4FH4A 4BBTA 3E2KA 4K91A 4CLCC 3GSGA 2V2FF 1LI0A 4HP4A 3BY8A 4WYYA 4R4RA 3O3VA 3A3EA 3TJZC 3JVUA 4F94A 4ESPA 4ZTKA 3D3OA 4OQHA 2QWSA 2Y79A 1SHVA 2Y2PA 3QP1A 4IVKA 3UB9A 5TBMA 4JF5A 3CG5A 2XGNA 5LBRA 1D06A 1XP4A 1PW8A 3R7WA 4KQDA 2W1TA 4O0PA 1LSXA 2Q9NA 1K6RA 3UE1A 3OCNA 3LICA 3K3DA 1I5QA 4IHQA 3LEZA 2AVXA 5G18A 3D9YA 4FH2A 1W7FA 4WMCA 2XK1A 1U60A 2R9XA 2Y59A 2ZQ9A 3O87A 2XFTA 2FFFB 3T4JA 3KSGA 4CLCA 2M7VA 4JF6A 1JWZA 4X56A 3OPHA 3V5MA 2NUTC 1RP5A 1A0KA 2H5SA 4S2PA 5DTTA 3G2YA 2ZMAA 3CUEC 4FUWA 5DFXA 3S7QA 3BEBA 5HZHA 2ZL1A 4C3QA 2Q9MA 3IS2A 4H8RA 1P9WA 3OOVA 4QY5A 2WKIA 3IBRA 3W4QA 3EQUA 2XF3A 3KSIA 4B9OA 5HDSA 1GHIA 3F1OB 3T1XA 4WN5A 4OOYA 3VOLA 2VJWA 3CI6A 2HF6A 3V39A 4GKUA 1SCWA 3MZDA 1KDWA 3T4QA 4X1LA 2JCHA 1KVMA 1VETB 1K57C 1FR6A 1ERMA 2ZJ9A 3HJIA 3CHWP 1GHPA 2O0YA 1FCOA 4MBHA 4P0MA 3KYZA 4BMWA 3Q82A 1PI4A 4PPRA 1W63Q 1I2WA 5HDCA 2XLNA 4KZBA 3N8LA 2XEPA 2A24A 3NOPC 1FILA 3FG8A 3R4KA 4G3VA 2LB9A 1NYMA 4U3TA 5DF9A 3Q07A 4QY6A 1TD5A 3PBNA 5EE8A 1S4SA 1K38A 3TG9A 1Q2QA 3LI8A 3UO9A 1EROA 3A3DA 3CUEA 1DP6A 3NULA 3ISGA 4R23A 4ARZB 4UEYA 1LL8A 2ZC3B 2XD1A 3TW8A 2KLIA 3LYXA 2B5RA 5CECA 1XJ3A 2JN7A 1UGUA 4MDZA 2JKFA 1K57A 5F6AA 4DXBA 3BFCA 1LL9A 2WGWA 3ZFZA 3S22A 4PAUA 2ZC6B 1E3UA 3CLOA 4MN5A 3B3XA 4MEZA 2V8FA 1XXMA 2G2WA 3EQVA 4B88A 3OPPA 3UPOA 3Q7VB 2Y2GA 3A3JA 1F5MA 4C75A 2EXAA 5HAPA 1CK3A 2B18A 2K31A 2W3DA 4X69A 1BUEA 3C2WA 1TF1A 3RJUA 3JYIA 4HEFA 3WWXA 1FR1A 3ZCZA 2ZOIA 2O99A 1IYPA 2UWXA 4B4XA 3MJQA 3C5AA 3WS5A 3V3RA 3LIDA 4FCFA 3BLSA 1EW0A 4OQGA 4DF6A 2W3FA 4MBFA 5M18A 4JGRA 1H8YA 3HUNA 3ZHHA 3KX0X 1ES2A 4OPRA 4WEJA 2R9WA 3UB5P 3UNWA 4KZ6A 3IF6B 2KX6A 2BLSA 5FI6A 3ZQ5A 1ZTUA 5FQKA 4DN0A 4Y17A 3IXHA 4BBVA 3BQAA 1ESUA 4LGWA 5EVEA 1TS0A 4E3IA 5M19A 2WKEA 5DTKA 5FDHA 1GSXA 2Y2OA 5FQMA 3FKVA 4BL3A 2GJ3A 3QNCA 5CERA 4OQ0A 2ZC7A 4EV4A 3IQAA 4JXSA 5TBMB 4S2KA 2VGLM 3EGDC 5J7EA 3KYEA 5HAIA 3OZHA 4P6ZM 4O7DA 2Z6CA 4ETZA 4LFUA 4L0LA 4R1GA 4LRXC 5FI7A 2HZ5A 2Y2KA 4M3KA 4RVAA 1DP9A 3ZG9B 4QD4A 1BSGA 2Y8HA 1HLUP 5HAQA 5MC7A 4I5SA 1KVLA 3Q7ZA 4WM9A 3VP4A 2P7JA 4MNRA 1S1YA 2WKRA 3D72A 4CJNA 5DFYA 4EBLA 3G6OA 3OPRA 4GD8A 5CTMA 3HJKA 4HBUA 2L4RA 1OTAA 3GQZA 3SS5A 5FA7A 3SS3A 3JVVA 4LV0A 3IS2B 3UE6A 5I5LA 4DJ3A 2OSUA 1DY6A 2PYPA 2W0NA 2WUQA 2EX8A 4EQIA 3VV4A 1LL5A 1VHMA 3FC7A 3DTEA 1XGIA 3S7NA 3IWOA 2ZM2A 2ZBBA 1WA9A 1PWDA 1H8ZA 4UAAA 5HFOA 3MZFA 3F1OA 3HUMA 1D1JA 4GHIB 1YLYA 2L1MA 4EXOA 1FSYA 1T18A 4UA7A 5FATA 3DW0A 5A91A 3NJAA 3UE0A 3KSFA 1OJ5A 5DJUA 1ALQA 1BT5A 3FKWA 3GECA 2ZC4B 4OLDA 4DE3A 2A24B 1S1ZA 1CI9A 1K56D 3UB8A 4PKYA 5FDSA 3U4LP 1VEUB 4QJGA 3MMHA 5CHMA 4WEKA 4G3WA 3VOYA 5G4ZA 3UDFA 3C30A 4YINA 3ZNTA 4HJ6A 1WE4A 3Q1FA 3T12B 2Y4AA 4IEDA 4PKYG 5AQ7A 3ITBA 1BULA 4ARZA 3RH8B 1ZG4A 2DCFA 5HX9A 1YSQA 5EM1A 3LEQA 2PDRA 1Z09A 3PTEA 2WGWB 4PM7A 5F1FA 3B33A 3QP8A 4HH3A 4JPMA 4XUZA 2XSSA 4E6XA 3MKEA 3QP5A 3KSHA 4GJ4A 4AFIA 2ZMFA 5IHVA 3IF6C 1YKDA 3IT9A 2FZ0A 4RA7A 5IU1A 2PBYA 5EM0A 3ZDJA 1YMSA 2EWWA 2JHEA 3D4FA 2V1BA 3BYDA 5E2FA 5DF7A 1L0DA 5JYOA 4R3AA 1DJCA 3LR0A 4A5RA 2WKHA 2J80A 3PHYA 1NLZA 3T4SA 3T1SA 4WZ4A 2HP5A 4WLAA 4HH2A 3Q7VA 3AGFA 3S7OA 5KIZA 4R4SA 3SH9A 4OONA 2VV7A 2OLUA 3RTYA 2JKRI 5C5KA 3WS1A 2PD7A 3PBQA 3GRJA 4Y7PA 2RCXA 4QHCA 5HARA 4IJGA 1J3WA 4R3BA 3A0RA 2JKRM 1TS6A 3MQ0A 4NXFA 3E4OA 1BTLA 4ME4A 1MKIA 4PM8A 4OVDA 1HTZA 1OT6A 4MMNA 4LRYC 2CC1A 3T4OA 1S0WA 4GB7A 5AQ9A 5L07A 4S2LA 3M2KA 3BQ8A 1BLHA 5DF8A 1IFQA 4B93A 5EFWA 2WK0A 4Y13A 1CF0A 4JF4A 4EBPA 2O9BA 1MXOA 1VM1A 4Z1WA 3FZCA 1ONGA 5HL1A 1DP8A 1F9IA 2B95A 1XX2A 2VGKA 4OH0A 1OMEA 2Z6DA 1KOUA 3BLMA 1CQAA 4N9KA 3IX3A 4EEPA 2OLVA 3G4PA 4WZ5C 3ZNYA 4LV2A 5KMWA 5J3WA 3UB7A 3EOIA 2QYBA 3I7JA 4BD1A 3FPWA 5F83A 4OKPA 2VGJA 1GSVA 1VB6A 4DE0A 5TJJA 2QKPA 1H0MA 4XT2A 3N8RA 2OAP1 1AWIA 4U0TA 1XJ4A 4YWZA 4ZDXA 4S2OA 1NXYA 5FAQA 3ZVWA 1FCMA 4NG2A 3KO6A 4JXGA 1JWPA 5AQAA 2Y2IA 3RFBA 4HJ4A 2PU2A 2W3GA 4UA6A 3GVBA 2VK3A 2V9AA 1NY0A 3ZGAB 4OP8A 2X71A 4ZJ3A 4E3JA 2L0WA 5FL3A 4X25A 1IYSA 3CPTA 2EWVA 1K55C 4MN7A 3IWIA 1GCEA 3A3FA 3ZVTA 1SKOA 2QPNA 4HBTA 2W1RA 2JC7A 4RX3A 1H5XA 4FTXA 3WS0A 1L0FA 4Q0IA 4WL9A 2PYRA 4WZ5A 1BYWA 5DTSA 4E3MA 4EUVA 5EV0A 5KSCA 3C7VA 5FASA 5CGWA 4B4ZA 2WAFA 4GHIA 3BJNA 1S66L 3N8SA 3PXPA 3AGEA 2BASA 3WRZA 3SOIA 3G32A 3S4XA 2MJ6A 2Y2MA 4LV3A 1YLWA 2Q0OA 3ICYA 3LO7A 3MBZA 4WBGA 4HY8A 3U2AA 4JKTA 4KENB 1K56A 4E3LA 4BQMA 4HI4A 1VEUA 4YFMA 3UMDA 3LY4A 3UDXA 1HZOA 2VLGA 4JXWA 3CAXA 1JNUA 3O5YA 4OOMA 4UQIM 1JTDA 2WGIA 5HDDA 4D2OA 2J3TD 3C8CA 1K55A 3EWKA 1O07A 2WKQA 3GDIA 1YMXA 1TS8A 4Y3IA 2Y55A 4I39A 5CEDA 2DRWA 4KG5A 3L9KA 5HWVA 3GMWA 2QMIA 1MBLA 2PU4A 2WZXA 4PM9A 3JPUA 5CGSA 3LIEA 4OLGA 4BL2A 2J9OA 4FOFA 2QJ5A 4CPKA 3MF0A 1T1CA 1OT9A 3MS6A 3ZG8B 4QU3A 2PR6A 4HHDA 2IWDA 4ID4A 3K3CA 1ONHA 2QJ7A 3IBJA 1MZUA 4QB8A 3T4KA 1MWTA 3UB6A 1PNEA 1ES4A 1LI9A 1L0EA 3S7PA 3MXQA 2VGLS 3IHAA 3NY4A 4P6ZS 1NWZA 3W4PA 1GA9A 1ES5A 4JLFA 5FSRA 2PHYA 1V9YA 3VE4A 2HJ9C 4UHUA 2ZM0A 2JKTM 2Z2LB 3IXBA 4P87A 4X1MA 1ZG6A 3M2JA 2Y2NA 1ACFA 3NHQA 3N7WA 4KQOA 3HLGA 5IS1A 2HPBA 3OC2A 3T4LA 1IKGA 1W8QA 4X55A 1PW1A 5GHXA 2XDMA 2VEAA 2XFSA 3CJMA 2EX2A 2XA7S 1MWUA 3TE8A 4NXEA 4N92A 5G4YA 5EVID 5HPIA 2H28A 3PAEA 4IUHA 3UPNA 3NBLA 2X02A 3IHBA 3GTCA 2RL3A 3PAGA 3E0YA 3P98A 4KG2A 1LLBA 3DTMA 4DXCA 4HP9A 3A0VA 3LI9A 2H0YA 3C4OA 2HP9A 3IF5A 3IXDA 4QPRA 4LLOB 3G2ZA 5D3OA 3ZYTA 4OQIA 4S2MA 1PWCA 3EGXC 3VMAA 5FQJA 3V67A 4PM5A 1G68A 2J3WA 4NETA 1HVBA 4QWOA 4XT2B 5L09A 3FYZA 5GLDA 3M6BA 1N9BA 2V0UA 2KDKA 1MKMA 3LIFA 1MC0A 1RCJA 3LR4A 1QMFA 3PYPA 5AQBA 5HWWA 2WYXA 3QP2A 3MXRA 3K2NA 1V9ZA 1PZOA 2GZAA 3IX4A 5FQ9A 1N9LA 1FCNA 4NXBA 3VP3A 4KUKA 3ZG5A
chains in the Genus database with same CATH topology
4X53A 4FH2A 1MY8A 2PBYA 4RYEA 1W7FA 3ZDJA 4WMCA 1YMSA 2EXBA 4PMAA 4WMCD 4X6TA 1YLTA 2XK1A 1U60A 1YLJA 3D4FA 2R9XA 2Y59A 2ZQ9A 3BYDA 3O87A 2X01A 5E2FA 5DF7A 2QZ6A 1TDGA 3HLBA 1L0DA 5FAPA 5JYOA 1E25A 3RXXA 4GD6A 1ESIA 1DJBA 2XFTA 1DJCA 2FFFB 1K54C 4A5RA 2WKHA 3IH9A 2EFXA 2XD5A 4UA9A 4JF6A 1JWZA 4X56A 1PIOA 3OPHA 3V5MA 1RP5A 4N1HA 4WZ4A 1SKFA 2H5SA 2HP5A 4S2PA 5DTTA 3VFHA 1FSWA 1K6SA 3G2YA 5FAOA 2ZMAA 3Q7VA 4RX2A 3AGFA 5CRFA 5L2FA 1JTGA 3VP1A 3HLCA 2C5WB 4R4SA 3BEBA 1IYQA 3SH9A 4OONA 2OLUA 4C3QA 4KZ9A 5TGFA 2Q9MA 4H8RA 3WS1A 3PBOA 3PBQA 3GRJA 2WKIA 4QY5A 2ZQ8A 2Y2QA 3W4QA 3NC8A 3EQUA 1CI8A 4Y7PA 2XF3A 2RCXA 4QHCA 5HARA 1GHIA 4OOYA 3LCEA 3VP0A 1JWVA 3S1YA 4GKUA 3V39A 1SCWA 4R3BA 1M40A 3IH8A 3MZDA 1KDWA 5FQQA 2JCHA 1KVMA 1K57C 4EUZA 5A92A 1FR6A 1BTLA 1ERMA 4IBRA 4OOLA 1ERQA 2ZJ9A 3W4OA 1GHPA 4KZ7A 1FCOA 3HVFA 1MKIA 4MBHA 5EVIB 4PM8A 4OVDA 1HTZA 5GHYA 2P9VB 4P0MA 3IWQA 2CC1A 3TSGA 2BG1A 3Q82A 1PI4A 1S0WA 1FOFA 4PPRA 4GB7A 4OP5A 5AQ9A 2IWCA 4S2LA 1I2WA 1Y54A 3M2KA 4GNUA 4Y0UA 1BLHA 2XLNA 5DF8A 4KZBA 5DVAA 2WK0A 3N8LA 1GA0A 2HDUA 4JF4A 3SH8A 4EBPA 4Q8IA 1MXOA 1VM1A 4DDSA 2XEPA 5KZHA 4N9LA 5E2HA 3HUOA 1NYMA 2GDNA 4U3TA 3FZCA 1ONGA 1K54A 5HL1A 4GDBA 4EBNA 5DF9A 3Q07A 4QY6A 4LV1A 3PBNA 5EE8A 3G30A 1K38A 1KE4A 1XX2A 3UE3A 2VGKA 1JVJA 1Q2QA 4OH0A 4WELA 1OMEA 3TG9A 3UO9A 1EROA 3A3DA 5TR7A 5TFQA 3ISGA 3BLMA 4R23A 3CZDA 3C7UA 1KDSA 1KE3A 4E3NA 2ZC3B 4N9KA 2XD1A 1IELA 1KE0A 4FSFA 1YLPA 5FI2A 4N1XA 1KGFA 2OLVA 3G4PA 4WZ5C 3BFFA 4LV2A 2B5RA 3ZNYA 5KMWA 2ZQCA 2Y2LA 3RXWA 1MWRA 3HLFA 3VSLA 4S2IA 3E2LA 5CECA 3OCLA 1CEGA 3I7JA 4BD1A 3PBSA 1PWGA 5F83A 5A93A 2WZZA 4OKPA 4K0WA 3NCKA 2VGJA 1O7EA 1XA7A 3MZEA 4DE0A 1BLCA 1NJ4A 3AGDA 3NI9A 5GL9A 1K57A 4JBFA 1NRFA 1IYOA 4DXBA 3N8RA 1WYBA 4KZ4A 3BFCA 1LL9A 2WGWA 4U0TA 3ZFZA 3S22A 4IVIA 4EWFA 5I94A 5EOEA 2ZC6B 5CGXA 4DE2A 3MXSA 3VSKA 4ZDXA 4S2OA 1E3UA 1NXYA 5E43A 1E3UD 5FAQA 3B3XA 4MEZA 3ZVWA 3ITAA 2Z2MB 1FCMA 3QNBA 1I2SA 4K0XA 4JXGA 1JWPA 5EPHA 1XXMA 2G2WA 5AQAA 2Y2IA 3EQVA 4B88A 1YLZA 1XGJA 3OPPA 4JXVA 3BFGA 3BM6A 2PU2A 4Y0OA 3UPOA 1FQGA 1AXBA 4UA6A 3GR2A 3OPLA 4KQRA 1PI5A 3WS4A 3FWLA 3GVBA 1RGYA 5EOOA 3Q7VB 2HDSA 2J8YA 1N4OA 1NY0A 3ZGAB 3MKFA 2Y2GA 2X71A 1W79A 3A3JA 4OP8A 4ZJ3A 5CHUA 4E3JA 1IYSA 1GHMA 4C75A 2EXAA 3NDEA 4R3JA 5HAPA 1K55C 1CK3A 4E3OA 3IWIA 1GCEA 3A3FA 1ZC2A 4X69A 4ZJ1A 3ZVTA 1BUEA 1M6KA 2QPNA 4HBTA 4E3KA 2JC7A 3RJUA 1K25A 3JYIA 2IWBA 3PBRA 3HLWA 1PYYA 4RX3A 1H5XA 3WS0A 1L0FA 4HEFA 3UPPA 3WWXA 1FR1A 3DWKA 3TOIA 3ZCZA 5CEBA 4WZ5A 5DTSA 4E3MA 1IYPA 2UWXA 4GOGA 4P85A 4B4XA 5CXWA 3C5AA 3WS5A 5KSCA 2XH9A 3C7VA 3UDIA 1NYYA 3V3RA 4LCMA 4FCFA 5FASA 3BLSA 5CGWA 1K4FA 4OQGA 4DF6A 4MBFA 4B4ZA 5M18A 2WAFA 4MBKA 1H8YA 3HUNA 3ZHHA 3HBRA 3N8SA 3P09A 1ES2A 4OPRA 4WEJA 2R9WA 3AGEA 3QHYA 2EX9A 1HD8A 3BRMA 4PM6A 4S2NA 4KZ6A 3SS4A 3UNWA 1IEMA 3WRZA 3SOIA 3G32A 3O86A 3IF6B 3S4XA 1C3BA 2Y2MA 4LV3A 1YLWA 2JBFA 3LO7A 3HL9A 1Z6FA 3MBZA 3NIAA 5FQIA 4WBGA 1W5DA 4DKIA 2BLSA 3HLEA 5FI6A 3PBTA 3IXGA 4BJPA 4XXRA 5EVIA 5FQKA 3IXHA 1KGGA 4JKTA 4KENB 1K56A 4E3LA 1ESUA 4BQMA 4YFMA 4E3IA 2V20A 3UY6A 3BECA 3LY4A 3UDXA 2WKEA 3W8KA 5DTKA 5M19A 5FDHA 2Y2OA 5FQMA 5BOHA 1HZOA 3FKVA 4BL3A 2Y91A 1CEFA 4GDNA 2J7VA 4JXWA 2EX6A 3QNCA 5CERA 4OQ0A 3N4IA 4OOMA 1TDLA 2ZC7A 1JTDA 1W8YA 2WGIA 3IQAA 4EV4A 4D2OA 4XUXA 4NK3A 4JXSA 1K55A 4KZ8A 1O07A 4OPQA 4S2KA 1YMXA 1G6AA 2Y55A 4RA7A 2Y2HA 5CEDA 2DRWA 4KG5A 5HAIA 3OZHA 3SH7A 3C4PA 3BFEA 3GMWA 4O7DA 4U0XA 5GLAA 4L0LA 2QMIA 4R1GA 1MBLA 2PU4A 3DWZA 2WZXA 1LHYA 2Y2KA 2ZC5B 4S2NC 4PM9A 5FI7A 3UN7A 4M3KA 4RVAA 5CGSA 1L0GA 4FD8A 4DDYA 4OLGA 3ZG9B 3V3SA 2J9OA 4BL2A 4Y0TA 4QD4A 2I72A 1BSGA 4CPKA 3NDGA 2XR0A 5HAQA 3ZG8B 4QU3A 5EECA 4KZ5A 3ZG0A 1YQSA 1KVLA 2JE5A 4OPZA 4LENA 5EVIC 4E6WA 2IWDA 1K4EA 2HP6A 1KGEA 4ID4A 1ZKJA 4P6BA 3VOZA 3Q7ZA 4WM9A 3VP4A 1ONHA 3A3IA 2A49A 4MNRA 1MPLA 5GLBA 4QB8A 1TEMA 1SDEA 1MWTA 2ZQ7A 2DNSA 5CTNA 3VFFA 4HESA 4S2JA 4CJNA 3BFDA 1ES4A 4ZJ2A 4EBLA 3OPRA 4GD8A 1LI9A 1L0EA 5CTMA 4HBUA 5A90A 1YT4A 3GQZA 3SS5A 5FA7A 3SS3A 2ZQAA 3IHAA 4GN2A 2XQZA 3NY4A 5E2EA 4LV0A 5EUAA 2OSUA 1DY6A 2ZD8A 2ZM8A 1NZUA 2C6WB 4X68A 3W4PA 1Q2PA 2A3UA 2WUQA 4KQQA 2EX8A 4OPYA 4EQIA 1LL5A 5F1GA 1GA9A 1ES5A 5HW3A 5M1AA 1XA1A 2G2UA 4JLFA 5FSRA 4ZAMA 1XGIA 4IBXA 3GV9A 5EVLA 2P74A 5U47A 3IWOA 4BENA 2ZM2A 1PWDA 1EI5A 4KG6A 1H8ZA 4UAAA 1RGZA 5HFOA 1IKIA 3MZFA 4UHUA 2ZM0A 3ZG7B 2Z2LB 3IXBA 4P87A 4ZBEA 3HUMA 2OV5A 1ZG6A 2H10A 1BZAA 2Y2NA 3M2JA 4LCLA 1YLYA 4KZAA 4BLMA 3HREA 3N7WA 4KQOA 1FSYA 2Y2JA 1DJAA 3HLGA 2HPBA 3OC2A 4UA7A 1TVFA 1IKGA 5FATA 3DW0A 2ZLYA 3FV7A 1W8QA 5J8XA 4GZBA 4X55A 5GHZA 5A91A 4Z9QA 1PW1A 3WS2A 3UE0A 5GHXA 1VQQA 2XDMA 4R0QA 1YM1A 1ALQA 2XFSA 3CJMA 1BT5A 2EX2A 3CMZA 3FKWA 1MWUA 3V50A 2ZC4B 3M6HA 3G31A 4KZ3A 4OLDA 4N92A 5EVID 4DE3A 3PAEA 2H0TA 1MWSA 2P9VA 3O88A 4C6YA 3UPNA 1ES3A 1CI9A 3NBLA 3WRTA 4DRTA 2X02A 5KSHA 4DE1A 1K56D 3IHBA 3GTCA 2RL3A 3PAGA 2V1ZA 3IF6A 4FH4A 3LY3A 4QJGA 1PZPA 3P98A 3E2KA 5E2GA 4KG2A 4K91A 2E8IA 2WAEA 1LLBA 5CHMA 3GSGA 2V2FF 2ZQDA 3DTMA 1LI0A 4MLLA 4DXCA 4WEKA 3VOYA 1EWZA 4WYYA 2H0YA 3C4OA 4R4RA 1XPBA 3O3VA 2HP9A 3UDFA 3IF5A 2FFYA 3IXDA 3G2ZA 4YINA 5D3OA 1E4DA 3ZNTA 3A3EA 4F94A 1WE4A 1WYCA 1L2SA 3Q1FA 4OQIA 2Y4AA 4IEDA 2J9PA 4S2MA 5AQ7A 4ZTKA 1PWCA 3ITBA 1SDNA 3VMAA 4OQHA 5FQJA 5JYPA 1BULA 2HDRA 4PM5A 1ZG4A 1G68A 1SHVA 2DCFA 3G35A 2Y2PA 4NETA 5HX9A 4IVKA 1HVBA 1J9MA 3FYZA 5GLDA 3PTEA 3M6BA 1N9BA 2WGWB 4PM7A 5F1FA 5CHJA 4JF5A 3CG5A 3VP2A 1BLSA 2XGNA 2EFUA 4JPMA 4XUZA 1RCJA 1PW8A 1XP4A 4E6XA 1NZOA 1QMFA 3MKEA 5AQBA 5F82A 3MFDA 5GLCA 2Q9NA 1S6RA 2WYXA 3N6IA 3MXRA 1K6RA 3UE1A 1PZOA 4BD0A 1XKZA 3OCNA 2WGVA 5FQ9A 5IHVA 1I5QA 3IF6C 2WADA 1BLPA 1FCNA 3LEZA 3Q81A 1QMEA 2HDQA 3G34A 5G18A 3IT9A 3VP3A 3HLDA 3ZG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X53 A;  4FH2 A;  1MY8 A;  2PBY A;  4RYE A;  1W7F A;  3ZDJ A;  4WMC A;  1YMS A;  2EXB A;  4PMA A;  4WMC D;  4X6T A;  1YLT A;  2XK1 A;  1U60 A;  1YLJ A;  3D4F A;  2R9X A;  2Y59 A;  2ZQ9 A;  3BYD A;  3O87 A;  2X01 A;  5E2F A;  5DF7 A;  2QZ6 A;  1TDG A;  3HLB A;  1L0D A;  5FAP A;  5JYO A;  1E25 A;  3RXX A;  4GD6 A;  1ESI A;  1DJB A;  2XFT A;  1DJC A;  2FFF B;  1K54 C;  4A5R A;  2WKH A;  3IH9 A;  2EFX A;  2XD5 A;  4UA9 A;  4JF6 A;  1JWZ A;  4X56 A;  1PIO A;  3OPH A;  3V5M A;  1RP5 A;  4N1H A;  4WZ4 A;  1SKF A;  2H5S A;  2HP5 A;  4S2P A;  5DTT A;  3VFH A;  1FSW A;  1K6S A;  3G2Y A;  5FAO A;  2ZMA A;  3Q7V A;  4RX2 A;  3AGF A;  5CRF A;  5L2F A;  1JTG A;  3VP1 A;  3HLC A;  2C5W B;  4R4S A;  3BEB A;  1IYQ A;  3SH9 A;  4OON A;  2OLU A;  4C3Q A;  4KZ9 A;  5TGF A;  2Q9M A;  4H8R A;  3WS1 A;  3PBO A;  3PBQ A;  3GRJ A;  2WKI A;  4QY5 A;  2ZQ8 A;  2Y2Q A;  3W4Q A;  3NC8 A;  3EQU A;  1CI8 A;  4Y7P A;  2XF3 A;  2RCX A;  4QHC A;  5HAR A;  1GHI A;  4OOY A;  3LCE A;  3VP0 A;  1JWV A;  3S1Y A;  4GKU A;  3V39 A;  1SCW A;  4R3B A;  1M40 A;  3IH8 A;  3MZD A;  1KDW A;  5FQQ A;  2JCH A;  1KVM A;  1K57 C;  4EUZ A;  5A92 A;  1FR6 A;  1BTL A;  1ERM A;  4IBR A;  4OOL A;  1ERQ A;  2ZJ9 A;  3W4O A;  1GHP A;  4KZ7 A;  1FCO A;  3HVF A;  1MKI A;  4MBH A;  5EVI B;  4PM8 A;  4OVD A;  1HTZ A;  5GHY A;  2P9V B;  4P0M A;  3IWQ A;  2CC1 A;  3TSG A;  2BG1 A;  3Q82 A;  1PI4 A;  1S0W A;  1FOF A;  4PPR A;  4GB7 A;  4OP5 A;  5AQ9 A;  2IWC A;  4S2L A;  1I2W A;  1Y54 A;  3M2K A;  4GNU A;  4Y0U A;  1BLH A;  2XLN A;  5DF8 A;  4KZB A;  5DVA A;  2WK0 A;  3N8L A;  1GA0 A;  2HDU A;  4JF4 A;  3SH8 A;  4EBP A;  4Q8I A;  1MXO A;  1VM1 A;  4DDS A;  2XEP A;  5KZH A;  4N9L A;  5E2H A;  3HUO A;  1NYM A;  2GDN A;  4U3T A;  3FZC A;  1ONG A;  1K54 A;  5HL1 A;  4GDB A;  4EBN A;  5DF9 A;  3Q07 A;  4QY6 A;  4LV1 A;  3PBN A;  5EE8 A;  3G30 A;  1K38 A;  1KE4 A;  1XX2 A;  3UE3 A;  2VGK A;  1JVJ A;  1Q2Q A;  4OH0 A;  4WEL A;  1OME A;  3TG9 A;  3UO9 A;  1ERO A;  3A3D A;  5TR7 A;  5TFQ A;  3ISG A;  3BLM A;  4R23 A;  3CZD A;  3C7U A;  1KDS A;  1KE3 A;  4E3N A;  2ZC3 B;  4N9K A;  2XD1 A;  1IEL A;  1KE0 A;  4FSF A;  1YLP A;  5FI2 A;  4N1X A;  1KGF A;  2OLV A;  3G4P A;  4WZ5 C;  3BFF A;  4LV2 A;  2B5R A;  3ZNY A;  5KMW A;  2ZQC A;  2Y2L A;  3RXW A;  1MWR A;  3HLF A;  3VSL A;  4S2I A;  3E2L A;  5CEC A;  3OCL A;  1CEG A;  3I7J A;  4BD1 A;  3PBS A;  1PWG A;  5F83 A;  5A93 A;  2WZZ A;  4OKP A;  4K0W A;  3NCK A;  2VGJ A;  1O7E A;  1XA7 A;  3MZE A;  4DE0 A;  1BLC A;  1NJ4 A;  3AGD A;  3NI9 A;  5GL9 A;  1K57 A;  4JBF A;  1NRF A;  1IYO A;  4DXB A;  3N8R A;  1WYB A;  4KZ4 A;  3BFC A;  1LL9 A;  2WGW A;  4U0T A;  3ZFZ A;  3S22 A;  4IVI A;  4EWF A;  5I94 A;  5EOE A;  2ZC6 B;  5CGX A;  4DE2 A;  3MXS A;  3VSK A;  4ZDX A;  4S2O A;  1E3U A;  1NXY A;  5E43 A;  1E3U D;  5FAQ A;  3B3X A;  4MEZ A;  3ZVW A;  3ITA A;  2Z2M B;  1FCM A;  3QNB A;  1I2S A;  4K0X A;  4JXG A;  1JWP A;  5EPH A;  1XXM A;  2G2W A;  5AQA A;  2Y2I A;  3EQV A;  4B88 A;  1YLZ A;  1XGJ A;  3OPP A;  4JXV A;  3BFG A;  3BM6 A;  2PU2 A;  4Y0O A;  3UPO A;  1FQG A;  1AXB A;  4UA6 A;  3GR2 A;  3OPL A;  4KQR A;  1PI5 A;  3WS4 A;  3FWL A;  3GVB A;  1RGY A;  5EOO A;  3Q7V B;  2HDS A;  2J8Y A;  1N4O A;  1NY0 A;  3ZGA B;  3MKF A;  2Y2G A;  2X71 A;  1W79 A;  3A3J A;  4OP8 A;  4ZJ3 A;  5CHU A;  4E3J A;  1IYS A;  1GHM A;  4C75 A;  2EXA A;  3NDE A;  4R3J A;  5HAP A;  1K55 C;  1CK3 A;  4E3O A;  3IWI A;  1GCE A;  3A3F A;  1ZC2 A;  4X69 A;  4ZJ1 A;  3ZVT A;  1BUE A;  1M6K A;  2QPN A;  4HBT A;  4E3K A;  2JC7 A;  3RJU A;  1K25 A;  3JYI A;  2IWB A;  3PBR A;  3HLW A;  1PYY A;  4RX3 A;  1H5X A;  3WS0 A;  1L0F A;  4HEF A;  3UPP A;  3WWX A;  1FR1 A;  3DWK A;  3TOI A;  3ZCZ A;  5CEB A;  4WZ5 A;  5DTS A;  4E3M A;  1IYP A;  2UWX A;  4GOG A;  4P85 A;  4B4X A;  5CXW A;  3C5A A;  3WS5 A;  5KSC A;  2XH9 A;  3C7V A;  3UDI A;  1NYY A;  3V3R A;  4LCM A;  4FCF A;  5FAS A;  3BLS A;  5CGW A;  1K4F A;  4OQG A;  4DF6 A;  4MBF A;  4B4Z A;  5M18 A;  2WAF A;  4MBK A;  1H8Y A;  3HUN A;  3ZHH A;  3HBR A;  3N8S A;  3P09 A;  1ES2 A;  4OPR A;  4WEJ A;  2R9W A;  3AGE A;  3QHY A;  2EX9 A;  1HD8 A;  3BRM A;  4PM6 A;  4S2N A;  4KZ6 A;  3SS4 A;  3UNW A;  1IEM A;  3WRZ A;  3SOI A;  3G32 A;  3O86 A;  3IF6 B;  3S4X A;  1C3B A;  2Y2M A;  4LV3 A;  1YLW A;  2JBF A;  3LO7 A;  3HL9 A;  1Z6F A;  3MBZ A;  3NIA A;  5FQI A;  4WBG A;  1W5D A;  4DKI A;  2BLS A;  3HLE A;  5FI6 A;  3PBT A;  3IXG A;  4BJP A;  4XXR A;  5EVI A;  5FQK A;  3IXH A;  1KGG A;  4JKT A;  4KEN B;  1K56 A;  4E3L A;  1ESU A;  4BQM A;  4YFM A;  4E3I A;  2V20 A;  3UY6 A;  3BEC A;  3LY4 A;  3UDX A;  2WKE A;  3W8K A;  5DTK A;  5M19 A;  5FDH A;  2Y2O A;  5FQM A;  5BOH A;  1HZO A;  3FKV A;  4BL3 A;  2Y91 A;  1CEF A;  4GDN A;  2J7V A;  4JXW A;  2EX6 A;  3QNC A;  5CER A;  4OQ0 A;  3N4I A;  4OOM A;  1TDL A;  2ZC7 A;  1JTD A;  1W8Y A;  2WGI A;  3IQA A;  4EV4 A;  4D2O A;  4XUX A;  4NK3 A;  4JXS A;  1K55 A;  4KZ8 A;  1O07 A;  4OPQ A;  4S2K A;  1YMX A;  1G6A A;  2Y55 A;  4RA7 A;  2Y2H A;  5CED A;  2DRW A;  4KG5 A;  5HAI A;  3OZH A;  3SH7 A;  3C4P A;  3BFE A;  3GMW A;  4O7D A;  4U0X A;  5GLA A;  4L0L A;  2QMI A;  4R1G A;  1MBL A;  2PU4 A;  3DWZ A;  2WZX A;  1LHY A;  2Y2K A;  2ZC5 B;  4S2N C;  4PM9 A;  5FI7 A;  3UN7 A;  4M3K A;  4RVA A;  5CGS A;  1L0G A;  4FD8 A;  4DDY A;  4OLG A;  3ZG9 B;  3V3S A;  2J9O A;  4BL2 A;  4Y0T A;  4QD4 A;  2I72 A;  1BSG A;  4CPK A;  3NDG A;  2XR0 A;  5HAQ A;  3ZG8 B;  4QU3 A;  5EEC A;  4KZ5 A;  3ZG0 A;  1YQS A;  1KVL A;  2JE5 A;  4OPZ A;  4LEN A;  5EVI C;  4E6W A;  2IWD A;  1K4E A;  2HP6 A;  1KGE A;  4ID4 A;  1ZKJ A;  4P6B A;  3VOZ A;  3Q7Z A;  4WM9 A;  3VP4 A;  1ONH A;  3A3I A;  2A49 A;  4MNR A;  1MPL A;  5GLB A;  4QB8 A;  1TEM A;  1SDE A;  1MWT A;  2ZQ7 A;  2DNS A;  5CTN A;  3VFF A;  4HES A;  4S2J A;  4CJN A;  3BFD A;  1ES4 A;  4ZJ2 A;  4EBL A;  3OPR A;  4GD8 A;  1LI9 A;  1L0E A;  5CTM A;  4HBU A;  5A90 A;  1YT4 A;  3GQZ A;  3SS5 A;  5FA7 A;  3SS3 A;  2ZQA A;  3IHA A;  4GN2 A;  2XQZ A;  3NY4 A;  5E2E A;  4LV0 A;  5EUA A;  2OSU A;  1DY6 A;  2ZD8 A;  2ZM8 A;  1NZU A;  2C6W B;  4X68 A;  3W4P A;  1Q2P A;  2A3U A;  2WUQ A;  4KQQ A;  2EX8 A;  4OPY A;  4EQI A;  1LL5 A;  5F1G A;  1GA9 A;  1ES5 A;  5HW3 A;  5M1A A;  1XA1 A;  2G2U A;  4JLF A;  5FSR A;  4ZAM A;  1XGI A;  4IBX A;  3GV9 A;  5EVL A;  2P74 A;  5U47 A;  3IWO A;  4BEN A;  2ZM2 A;  1PWD A;  1EI5 A;  4KG6 A;  1H8Z A;  4UAA A;  1RGZ A;  5HFO A;  1IKI A;  3MZF A;  4UHU A;  2ZM0 A;  3ZG7 B;  2Z2L B;  3IXB A;  4P87 A;  4ZBE A;  3HUM A;  2OV5 A;  1ZG6 A;  2H10 A;  1BZA A;  2Y2N A;  3M2J A;  4LCL A;  1YLY A;  4KZA A;  4BLM A;  3HRE A;  3N7W A;  4KQO A;  1FSY A;  2Y2J A;  1DJA A;  3HLG A;  2HPB A;  3OC2 A;  4UA7 A;  1TVF A;  1IKG A;  5FAT A;  3DW0 A;  2ZLY A;  3FV7 A;  1W8Q A;  5J8X A;  4GZB A;  4X55 A;  5GHZ A;  5A91 A;  4Z9Q A;  1PW1 A;  3WS2 A;  3UE0 A;  5GHX A;  1VQQ A;  2XDM A;  4R0Q A;  1YM1 A;  1ALQ A;  2XFS A;  3CJM A;  1BT5 A;  2EX2 A;  3CMZ A;  3FKW A;  1MWU A;  3V50 A;  2ZC4 B;  3M6H A;  3G31 A;  4KZ3 A;  4OLD A;  4N92 A;  5EVI D;  4DE3 A;  3PAE A;  2H0T A;  1MWS A;  2P9V A;  3O88 A;  4C6Y A;  3UPN A;  1ES3 A;  1CI9 A;  3NBL A;  3WRT A;  4DRT A;  2X02 A;  5KSH A;  4DE1 A;  1K56 D;  3IHB A;  3GTC A;  2RL3 A;  3PAG A;  2V1Z A;  3IF6 A;  4FH4 A;  3LY3 A;  4QJG A;  1PZP A;  3P98 A;  3E2K A;  5E2G A;  4KG2 A;  4K91 A;  2E8I A;  2WAE A;  1LLB A;  5CHM A;  3GSG A;  2V2F F;  2ZQD A;  3DTM A;  1LI0 A;  4MLL A;  4DXC A;  4WEK A;  3VOY A;  1EWZ A;  4WYY A;  2H0Y A;  3C4O A;  4R4R A;  1XPB A;  3O3V A;  2HP9 A;  3UDF A;  3IF5 A;  2FFY A;  3IXD A;  3G2Z A;  4YIN A;  5D3O A;  1E4D A;  3ZNT A;  3A3E A;  4F94 A;  1WE4 A;  1WYC A;  1L2S A;  3Q1F A;  4OQI A;  2Y4A A;  4IED A;  2J9P A;  4S2M A;  5AQ7 A;  4ZTK A;  1PWC A;  3ITB A;  1SDN A;  3VMA A;  4OQH A;  5FQJ A;  5JYP A;  1BUL A;  2HDR A;  4PM5 A;  1ZG4 A;  1G68 A;  1SHV A;  2DCF A;  3G35 A;  2Y2P A;  4NET A;  5HX9 A;  4IVK A;  1HVB A;  1J9M A;  3FYZ A;  5GLD A;  3PTE A;  3M6B A;  1N9B A;  2WGW B;  4PM7 A;  5F1F A;  5CHJ A;  4JF5 A;  3CG5 A;  3VP2 A;  1BLS A;  2XGN A;  2EFU A;  4JPM A;  4XUZ A;  1RCJ A;  1PW8 A;  1XP4 A;  4E6X A;  1NZO A;  1QMF A;  3MKE A;  5AQB A;  5F82 A;  3MFD A;  5GLC A;  2Q9N A;  1S6R A;  2WYX A;  3N6I A;  3MXR A;  1K6R A;  3UE1 A;  1PZO A;  4BD0 A;  1XKZ A;  3OCN A;  2WGV A;  5FQ9 A;  5IHV A;  1I5Q A;  3IF6 C;  2WAD A;  1BLP A;  1FCN A;  3LEZ A;  3Q81 A;  1QME A;  2HDQ A;  3G34 A;  5G18 A;  3IT9 A;  3VP3 A;  3HLD A;  3ZG5 A; 
#chains in the Genus database with same CATH topology
 4X53 A;  1OTI A;  4WMC D;  4X6T A;  4M4X A;  2XA7 M;  4BBU A;  2QZ6 A;  3CPT B;  5FAP A;  3MSH A;  3RXX A;  4GD6 A;  4F3L B;  1DJB A;  3T50 A;  1K54 C;  3IH9 A;  2EFX A;  4CLC D;  3LIB A;  1SKO B;  4N1H A;  3VFH A;  1FSW A;  5FAO A;  4RX2 A;  5L2F A;  1JTG A;  3VP1 A;  3HLC A;  4KZ9 A;  3PBO A;  3UME A;  1XFN A;  2ZQ8 A;  3NC8 A;  1CI8 A;  3LCE A;  3VP0 A;  3S1Y A;  3LFV A;  5HSQ A;  3H7W A;  4G3K A;  4EUZ A;  4OOL A;  1ERQ A;  4ETX A;  1XJ6 A;  3HVF A;  4LRZ E;  4WF0 A;  2BG1 A;  4OP5 A;  3SZT A;  2IWC A;  4L9F A;  1Y54 A;  3BY9 A;  4Y0U A;  5F68 A;  1GA0 A;  3SH8 A;  1S67 L;  4Q8I A;  4DDS A;  5KZH A;  1K54 A;  1UWP X;  5HD3 A;  1DRM A;  3E4Q A;  3MQO A;  5TR7 A;  2HV1 A;  3CZD A;  4NEE D;  3C7U A;  1KDS A;  4BWI A;  1KE3 A;  4Y5F A;  1S4R A;  4N1X A;  1LT0 A;  2O9A A;  2ZQC A;  3RXW A;  1MWR A;  3HLF A;  3OCL A;  4GW9 A;  3LR5 A;  3PBS A;  1PWG A;  4K0W A;  3MZE A;  1NJ4 A;  1NRF A;  1WYB A;  2ZMV A;  4KZ4 A;  3L7H A;  5I94 A;  4IVI A;  5EOE A;  3DAV A;  5E43 A;  1E3U D;  3ITA A;  1LSV A;  3QNB A;  4Q0H A;  3MR0 A;  2NUP C;  2HGV A;  1YLZ A;  1XGJ A;  3BFG A;  4Y0O A;  1FQG A;  4EEU A;  5HWT A;  1RGY A;  5EOO A;  2HDS A;  3MKF A;  5F5Y A;  1T1B A;  4R3J A;  4E3K A;  3NOT C;  2P04 A;  1PYY A;  3UPP A;  5CEB A;  1PFL A;  4KUO A;  5DJT A;  4GOG A;  4MCW A;  4P85 A;  1CJF A;  4LCM A;  3NOU C;  4MBK A;  5AJG A;  1OJG A;  3P09 A;  2BTF P;  1HD8 A;  3BRM A;  4PM6 A;  4S2N A;  1IEM A;  1C3B A;  4JGP A;  1ZHH B;  2JBF A;  3HL9 A;  3NIA A;  5FQI A;  2PRF A;  5A8B A;  1W5D A;  3PBT A;  5EVI A;  5L8M A;  2A2L A;  5FEG A;  2IA2 A;  2VKS A;  3BEC A;  3W8K A;  4I38 A;  5BOH A;  2M7U A;  2K7S A;  2Y91 A;  1CEF A;  4R38 A;  2J7V A;  2EX6 A;  1W8Y A;  4XUX A;  2PT7 A;  4NK3 A;  4KZ8 A;  4OPQ A;  1G6A A;  3H82 A;  3MQQ A;  3SH7 A;  3C4P A;  3BFE A;  4U0X A;  3DWZ A;  4EER A;  2R78 A;  1L0G A;  2YKH A;  4Y0T A;  2I72 A;  1H3Q A;  2V0W A;  5EEC A;  4KZ5 A;  4EQ1 A;  2JE5 A;  4LEN A;  2GNX A;  4HNB A;  4E6W A;  1H8M A;  2HP6 A;  1KGE A;  1ZKJ A;  4P6B A;  3A3I A;  1IOU A;  3BW6 A;  1MPL A;  1SDE A;  2DNS A;  3VFF A;  4HES A;  1OTB A;  4S2J A;  2V1A A;  3BFD A;  4UQI S;  5A90 A;  2VZW A;  5HL6 A;  1OTE A;  2DMW A;  1P97 A;  2KOI A;  1TS7 A;  4F3L A;  4GN2 A;  3F1P A;  5E2E A;  3OLO A;  3P01 A;  4H6J A;  4HOI A;  2ZOH A;  2ZD8 A;  4X68 A;  2C6W B;  3T1Q B;  5HD5 A;  1Q2P A;  2FH5 A;  3B47 A;  4Y2F A;  3A0S A;  4OPY A;  2W3E A;  3P7N A;  5HW3 A;  2PBD P;  4IBX A;  3GV9 A;  5EVL A;  5U47 A;  3H7W B;  4CLC E;  4NKP A;  1EI5 A;  4L9E A;  4WUJ A;  2OV5 A;  2H10 A;  1BZA A;  4KZA A;  3C38 A;  3ULF A;  2HJE A;  2ZLY A;  3FV7 A;  4GZB A;  5GHZ A;  3WS2 A;  1VQQ A;  3CMZ A;  1NRJ A;  3M6H A;  3G31 A;  4YOF A;  2H0T A;  3O88 A;  1ES3 A;  2W3H A;  5KSH A;  4DE1 A;  4GS9 A;  3LY3 A;  4Q0J A;  1PZP A;  1YPR A;  5E2G A;  2E8I A;  2WAE A;  2ZQD A;  4MLL A;  4EET B;  1EWZ A;  1XPB A;  2FFY A;  1E4D A;  3F1N A;  3T1R A;  1WYC A;  1L2S A;  4O01 A;  1T1A A;  1K0K A;  1LSW A;  2J9P A;  3PR6 A;  1SDN A;  2K2N A;  5JYP A;  2HDR A;  3G35 A;  3W2Z A;  1J9M A;  5HPF A;  5CHJ A;  2PD8 A;  3VP2 A;  1BLS A;  4EES A;  2ACG A;  2EFU A;  1NZO A;  5F82 A;  3MFD A;  5GLC A;  1S6R A;  3N6I A;  1D7E A;  3LUQ A;  1G28 A;  4BD0 A;  1XKZ A;  2WGV A;  2WAD A;  1BLP A;  1F98 A;  3Q81 A;  1QME A;  2HDQ A;  3G34 A;  3HLD A;  1MY8 A;  5AVF A;  4RYE A;  2EXB A;  4PMA A;  1YLT A;  2M1C A;  1YLJ A;  2X01 A;  2D01 A;  1TDG A;  3HLB A;  2CMN A;  1E25 A;  1ESI A;  2XD5 A;  4UA9 A;  2WKP A;  1PIO A;  2JKT I;  1SKF A;  1K6S A;  3CIT A;  5CRF A;  2C5W B;  4I3A A;  1IYQ A;  5TGF A;  2VV6 A;  2Y2Q A;  4MN6 A;  2PR5 A;  4HQA A;  1STZ A;  1JWV A;  1L3L A;  1M40 A;  4ZRR A;  3IH8 A;  5FQQ A;  4NXG A;  4R70 A;  5A92 A;  4IBR A;  1X0O A;  3NEC A;  3W4O A;  2OOL A;  1N9N A;  4KZ7 A;  4DMZ A;  5EVI B;  5DKK A;  5GHY A;  3DBA A;  2P9V B;  5AVE A;  3IWQ A;  3TSG A;  4LPZ A;  2OWJ A;  1FOF A;  4II7 A;  1Y4O A;  1F2K A;  3EEA A;  4GNU A;  1G6O A;  5DVA A;  2HDU A;  1W63 M;  2QHK A;  1G5U A;  4N9L A;  5E2H A;  3HUO A;  4CQH A;  2GDN A;  1P9R A;  1P0Z A;  4GDB A;  1XJ2 A;  1T19 A;  4EBN A;  4LV1 A;  3LGO A;  3G30 A;  1FIK A;  1KE4 A;  2EA9 A;  3UE3 A;  1JVJ A;  4WEL A;  5IT5 A;  4I3I A;  5J4E A;  3H82 B;  3EEH A;  5DKL A;  5TFQ A;  4GCZ A;  4E3N A;  1IEL A;  1KE0 A;  4FSF A;  1YLP A;  5FI2 A;  1KGF A;  3BFF A;  2Y2L A;  3VSL A;  4S2I A;  3E2L A;  1CEG A;  3R7W B;  5A93 A;  2W1T B;  2WZZ A;  3NCK A;  1O7E A;  1XA7 A;  1YSP A;  1BLC A;  3AGD A;  3NI9 A;  5GL9 A;  2OWH A;  3QP4 A;  4JBF A;  1IYO A;  4PHT A;  3SW1 A;  4EWF A;  4DJ2 A;  5CGX A;  4DE2 A;  3MXS A;  3VSK A;  2Z2M B;  2V8C A;  4O8G A;  1I2S A;  3F1P B;  4K0X A;  2G7U A;  5EPH A;  4H6J B;  4I3J A;  4CLC B;  4JXV A;  3BM6 A;  1AXB A;  1ODV A;  3GR2 A;  3OPL A;  4KQR A;  1PI5 A;  3LR3 A;  3WS4 A;  3FWL A;  3E4P A;  2J8Y A;  1N4O A;  2VV8 A;  1W79 A;  5CHU A;  2ZL1 B;  2UV0 E;  1GHM A;  3NDE A;  2J3T C;  2E8J A;  4E3O A;  4ZJ1 A;  1ZC2 A;  2O9C A;  2OAQ 1;  1M6K A;  4JGO A;  1K25 A;  2IWB A;  3PBR A;  3HLW A;  3HCY A;  5L10 A;  3DWK A;  3TOI A;  2XRN A;  5CXW A;  1Y28 A;  2XH9 A;  3UDI A;  1NYY A;  3T4T A;  1K4F A;  3QP6 A;  3HBR A;  3KYQ A;  3CWF A;  4E04 A;  3DTK A;  1XFQ A;  4R6L A;  3QHY A;  2EX9 A;  1NLY A;  4GS9 B;  3SS4 A;  3O86 A;  4Y15 A;  1VET A;  2I9V A;  3BWL A;  1Z6F A;  4EU0 A;  4DKI A;  3HLE A;  4RQ9 A;  3IXG A;  2GX5 A;  4BJP A;  4XXR A;  1KGG A;  3MFX A;  3F1N B;  2V20 A;  3UY6 A;  3DTI A;  1N9O A;  3OBF A;  4GDN A;  3N4I A;  2LB5 A;  1TDL A;  1UWN X;  3LIA A;  2Y2H A;  5GLA A;  5K5B A;  1OPX A;  4HJ3 A;  1LHY A;  4S2N C;  2ZC5 B;  3UN7 A;  4FD8 A;  4IUK A;  1GSW A;  4DDY A;  3V3S A;  3NDG A;  2XR0 A;  1YAX A;  4HIA A;  3ZG0 A;  4JGQ A;  1YQS A;  4OPZ A;  5EVI C;  5F69 A;  1K4E A;  3VOZ A;  5FEF A;  2A49 A;  3TRC A;  5GLB A;  1TEM A;  2ZQ7 A;  5CTN A;  2D02 A;  4ZJ2 A;  3VE3 A;  1YT4 A;  2P08 A;  4L9G A;  2ZQA A;  2W27 A;  4YNR A;  1SZV A;  3E98 A;  2XQZ A;  2B02 A;  5EUA A;  4D60 A;  2XRO A;  5CX7 A;  2ZM8 A;  1NZU A;  2A3U A;  2PAV P;  4KQQ A;  5F1G A;  5M1A A;  1XA1 A;  2G2U A;  4ZAM A;  1PRQ A;  2P74 A;  4K08 A;  4BEN A;  2YKF A;  4KG6 A;  1RGZ A;  3FPV A;  4GLQ A;  1IKI A;  3ZG7 B;  4ZBE A;  4LCL A;  2JKG A;  4BLM A;  3HRE A;  1OTD A;  1DJA A;  2Y2J A;  3IX8 A;  1TVF A;  5J8X A;  4EW7 A;  4Z9Q A;  4R0Q A;  1YM1 A;  3H9W A;  2VA0 A;  2VX8 A;  3V50 A;  4KZ3 A;  1MWS A;  2P9V A;  4C6Y A;  3WRT A;  4DRT A;  2INW A;  3B42 A;  2V1Z A;  3IF6 A;  4FH4 A;  4BBT A;  3E2K A;  4K91 A;  4CLC C;  3GSG A;  2V2F F;  1LI0 A;  4HP4 A;  3BY8 A;  4WYY A;  4R4R A;  3O3V A;  3A3E A;  3TJZ C;  3JVU A;  4F94 A;  4ESP A;  4ZTK A;  3D3O A;  4OQH A;  2QWS A;  2Y79 A;  1SHV A;  2Y2P A;  3QP1 A;  4IVK A;  3UB9 A;  5TBM A;  4JF5 A;  3CG5 A;  2XGN A;  5LBR A;  1D06 A;  1XP4 A;  1PW8 A;  3R7W A;  4KQD A;  2W1T A;  4O0P A;  1LSX A;  2Q9N A;  1K6R A;  3UE1 A;  3OCN A;  3LIC A;  3K3D A;  1I5Q A;  4IHQ A;  3LEZ A;  2AVX A;  5G18 A;  3D9Y A;  4FH2 A;  1W7F A;  4WMC A;  2XK1 A;  1U60 A;  2R9X A;  2Y59 A;  2ZQ9 A;  3O87 A;  2XFT A;  2FFF B;  3T4J A;  3KSG A;  4CLC A;  2M7V A;  4JF6 A;  1JWZ A;  4X56 A;  3OPH A;  3V5M A;  2NUT C;  1RP5 A;  1A0K A;  2H5S A;  4S2P A;  5DTT A;  3G2Y A;  2ZMA A;  3CUE C;  4FUW A;  5DFX A;  3S7Q A;  3BEB A;  5HZH A;  2ZL1 A;  4C3Q A;  2Q9M A;  3IS2 A;  4H8R A;  1P9W A;  3OOV A;  4QY5 A;  2WKI A;  3IBR A;  3W4Q A;  3EQU A;  2XF3 A;  3KSI A;  4B9O A;  5HDS A;  1GHI A;  3F1O B;  3T1X A;  4WN5 A;  4OOY A;  3VOL A;  2VJW A;  3CI6 A;  2HF6 A;  3V39 A;  4GKU A;  1SCW A;  3MZD A;  1KDW A;  3T4Q A;  4X1L A;  2JCH A;  1KVM A;  1VET B;  1K57 C;  1FR6 A;  1ERM A;  2ZJ9 A;  3HJI A;  3CHW P;  1GHP A;  2O0Y A;  1FCO A;  4MBH A;  4P0M A;  3KYZ A;  4BMW A;  3Q82 A;  1PI4 A;  4PPR A;  1W63 Q;  1I2W A;  5HDC A;  2XLN A;  4KZB A;  3N8L A;  2XEP A;  2A24 A;  3NOP C;  1FIL A;  3FG8 A;  3R4K A;  4G3V A;  2LB9 A;  1NYM A;  4U3T A;  5DF9 A;  3Q07 A;  4QY6 A;  1TD5 A;  3PBN A;  5EE8 A;  1S4S A;  1K38 A;  3TG9 A;  1Q2Q A;  3LI8 A;  3UO9 A;  1ERO A;  3A3D A;  3CUE A;  1DP6 A;  3NUL A;  3ISG A;  4R23 A;  4ARZ B;  4UEY A;  1LL8 A;  2ZC3 B;  2XD1 A;  3TW8 A;  2KLI A;  3LYX A;  2B5R A;  5CEC A;  1XJ3 A;  2JN7 A;  1UGU A;  4MDZ A;  2JKF A;  1K57 A;  5F6A A;  4DXB A;  3BFC A;  1LL9 A;  2WGW A;  3ZFZ A;  3S22 A;  4PAU A;  2ZC6 B;  1E3U A;  3CLO A;  4MN5 A;  3B3X A;  4MEZ A;  2V8F A;  1XXM A;  2G2W A;  3EQV A;  4B88 A;  3OPP A;  3UPO A;  3Q7V B;  2Y2G A;  3A3J A;  1F5M A;  4C75 A;  2EXA A;  5HAP A;  1CK3 A;  2B18 A;  2K31 A;  2W3D A;  4X69 A;  1BUE A;  3C2W A;  1TF1 A;  3RJU A;  3JYI A;  4HEF A;  3WWX A;  1FR1 A;  3ZCZ A;  2ZOI A;  2O99 A;  1IYP A;  2UWX A;  4B4X A;  3MJQ A;  3C5A A;  3WS5 A;  3V3R A;  3LID A;  4FCF A;  3BLS A;  1EW0 A;  4OQG A;  4DF6 A;  2W3F A;  4MBF A;  5M18 A;  4JGR A;  1H8Y A;  3HUN A;  3ZHH A;  3KX0 X;  1ES2 A;  4OPR A;  4WEJ A;  2R9W A;  3UB5 P;  3UNW A;  4KZ6 A;  3IF6 B;  2KX6 A;  2BLS A;  5FI6 A;  3ZQ5 A;  1ZTU A;  5FQK A;  4DN0 A;  4Y17 A;  3IXH A;  4BBV A;  3BQA A;  1ESU A;  4LGW A;  5EVE A;  1TS0 A;  4E3I A;  5M19 A;  2WKE A;  5DTK A;  5FDH A;  1GSX A;  2Y2O A;  5FQM A;  3FKV A;  4BL3 A;  2GJ3 A;  3QNC A;  5CER A;  4OQ0 A;  2ZC7 A;  4EV4 A;  3IQA A;  4JXS A;  5TBM B;  4S2K A;  2VGL M;  3EGD C;  5J7E A;  3KYE A;  5HAI A;  3OZH A;  4P6Z M;  4O7D A;  2Z6C A;  4ETZ A;  4LFU A;  4L0L A;  4R1G A;  4LRX C;  5FI7 A;  2HZ5 A;  2Y2K A;  4M3K A;  4RVA A;  1DP9 A;  3ZG9 B;  4QD4 A;  1BSG A;  2Y8H A;  1HLU P;  5HAQ A;  5MC7 A;  4I5S A;  1KVL A;  3Q7Z A;  4WM9 A;  3VP4 A;  2P7J A;  4MNR A;  1S1Y A;  2WKR A;  3D72 A;  4CJN A;  5DFY A;  4EBL A;  3G6O A;  3OPR A;  4GD8 A;  5CTM A;  3HJK A;  4HBU A;  2L4R A;  1OTA A;  3GQZ A;  3SS5 A;  5FA7 A;  3SS3 A;  3JVV A;  4LV0 A;  3IS2 B;  3UE6 A;  5I5L A;  4DJ3 A;  2OSU A;  1DY6 A;  2PYP A;  2W0N A;  2WUQ A;  2EX8 A;  4EQI A;  3VV4 A;  1LL5 A;  1VHM A;  3FC7 A;  3DTE A;  1XGI A;  3S7N A;  3IWO A;  2ZM2 A;  2ZBB A;  1WA9 A;  1PWD A;  1H8Z A;  4UAA A;  5HFO A;  3MZF A;  3F1O A;  3HUM A;  1D1J A;  4GHI B;  1YLY A;  2L1M A;  4EXO A;  1FSY A;  1T18 A;  4UA7 A;  5FAT A;  3DW0 A;  5A91 A;  3NJA A;  3UE0 A;  3KSF A;  1OJ5 A;  5DJU A;  1ALQ A;  1BT5 A;  3FKW A;  3GEC A;  2ZC4 B;  4OLD A;  4DE3 A;  2A24 B;  1S1Z A;  1CI9 A;  1K56 D;  3UB8 A;  4PKY A;  5FDS A;  3U4L P;  1VEU B;  4QJG A;  3MMH A;  5CHM A;  4WEK A;  4G3W A;  3VOY A;  5G4Z A;  3UDF A;  3C30 A;  4YIN A;  3ZNT A;  4HJ6 A;  1WE4 A;  3Q1F A;  3T12 B;  2Y4A A;  4IED A;  4PKY G;  5AQ7 A;  3ITB A;  1BUL A;  4ARZ A;  3RH8 B;  1ZG4 A;  2DCF A;  5HX9 A;  1YSQ A;  5EM1 A;  3LEQ A;  2PDR A;  1Z09 A;  3PTE A;  2WGW B;  4PM7 A;  5F1F A;  3B33 A;  3QP8 A;  4HH3 A;  4JPM A;  4XUZ A;  2XSS A;  4E6X A;  3MKE A;  3QP5 A;  3KSH A;  4GJ4 A;  4AFI A;  2ZMF A;  5IHV A;  3IF6 C;  1YKD A;  3IT9 A;  2FZ0 A;  4RA7 A;  5IU1 A;  2PBY A;  5EM0 A;  3ZDJ A;  1YMS A;  2EWW A;  2JHE A;  3D4F A;  2V1B A;  3BYD A;  5E2F A;  5DF7 A;  1L0D A;  5JYO A;  4R3A A;  1DJC A;  3LR0 A;  4A5R A;  2WKH A;  2J80 A;  3PHY A;  1NLZ A;  3T4S A;  3T1S A;  4WZ4 A;  2HP5 A;  4WLA A;  4HH2 A;  3Q7V A;  3AGF A;  3S7O A;  5KIZ A;  4R4S A;  3SH9 A;  4OON A;  2VV7 A;  2OLU A;  3RTY A;  2JKR I;  5C5K A;  3WS1 A;  2PD7 A;  3PBQ A;  3GRJ A;  4Y7P A;  2RCX A;  4QHC A;  5HAR A;  4IJG A;  1J3W A;  4R3B A;  3A0R A;  2JKR M;  1TS6 A;  3MQ0 A;  4NXF A;  3E4O A;  1BTL A;  4ME4 A;  1MKI A;  4PM8 A;  4OVD A;  1HTZ A;  1OT6 A;  4MMN A;  4LRY C;  2CC1 A;  3T4O A;  1S0W A;  4GB7 A;  5AQ9 A;  5L07 A;  4S2L A;  3M2K A;  3BQ8 A;  1BLH A;  5DF8 A;  1IFQ A;  4B93 A;  5EFW A;  2WK0 A;  4Y13 A;  1CF0 A;  4JF4 A;  4EBP A;  2O9B A;  1MXO A;  1VM1 A;  4Z1W A;  3FZC A;  1ONG A;  5HL1 A;  1DP8 A;  1F9I A;  2B95 A;  1XX2 A;  2VGK A;  4OH0 A;  1OME A;  2Z6D A;  1KOU A;  3BLM A;  1CQA A;  4N9K A;  3IX3 A;  4EEP A;  2OLV A;  3G4P A;  4WZ5 C;  3ZNY A;  4LV2 A;  5KMW A;  5J3W A;  3UB7 A;  3EOI A;  2QYB A;  3I7J A;  4BD1 A;  3FPW A;  5F83 A;  4OKP A;  2VGJ A;  1GSV A;  1VB6 A;  4DE0 A;  5TJJ A;  2QKP A;  1H0M A;  4XT2 A;  3N8R A;  2OAP 1;  1AWI A;  4U0T A;  1XJ4 A;  4YWZ A;  4ZDX A;  4S2O A;  1NXY A;  5FAQ A;  3ZVW A;  1FCM A;  4NG2 A;  3KO6 A;  4JXG A;  1JWP A;  5AQA A;  2Y2I A;  3RFB A;  4HJ4 A;  2PU2 A;  2W3G A;  4UA6 A;  3GVB A;  2VK3 A;  2V9A A;  1NY0 A;  3ZGA B;  4OP8 A;  2X71 A;  4ZJ3 A;  4E3J A;  2L0W A;  5FL3 A;  4X25 A;  1IYS A;  3CPT A;  2EWV A;  1K55 C;  4MN7 A;  3IWI A;  1GCE A;  3A3F A;  3ZVT A;  1SKO A;  2QPN A;  4HBT A;  2W1R A;  2JC7 A;  4RX3 A;  1H5X A;  4FTX A;  3WS0 A;  1L0F A;  4Q0I A;  4WL9 A;  2PYR A;  4WZ5 A;  1BYW A;  5DTS A;  4E3M A;  4EUV A;  5EV0 A;  5KSC A;  3C7V A;  5FAS A;  5CGW A;  4B4Z A;  2WAF A;  4GHI A;  3BJN A;  1S66 L;  3N8S A;  3PXP A;  3AGE A;  2BAS A;  3WRZ A;  3SOI A;  3G32 A;  3S4X A;  2MJ6 A;  2Y2M A;  4LV3 A;  1YLW A;  2Q0O A;  3ICY A;  3LO7 A;  3MBZ A;  4WBG A;  4HY8 A;  3U2A A;  4JKT A;  4KEN B;  1K56 A;  4E3L A;  4BQM A;  4HI4 A;  1VEU A;  4YFM A;  3UMD A;  3LY4 A;  3UDX A;  1HZO A;  2VLG A;  4JXW A;  3CAX A;  1JNU A;  3O5Y A;  4OOM A;  4UQI M;  1JTD A;  2WGI A;  5HDD A;  4D2O A;  2J3T D;  3C8C A;  1K55 A;  3EWK A;  1O07 A;  2WKQ A;  3GDI A;  1YMX A;  1TS8 A;  4Y3I A;  2Y55 A;  4I39 A;  5CED A;  2DRW A;  4KG5 A;  3L9K A;  5HWV A;  3GMW A;  2QMI A;  1MBL A;  2PU4 A;  2WZX A;  4PM9 A;  3JPU A;  5CGS A;  3LIE A;  4OLG A;  4BL2 A;  2J9O A;  4FOF A;  2QJ5 A;  4CPK A;  3MF0 A;  1T1C A;  1OT9 A;  3MS6 A;  3ZG8 B;  4QU3 A;  2PR6 A;  4HHD A;  2IWD A;  4ID4 A;  3K3C A;  1ONH A;  2QJ7 A;  3IBJ A;  1MZU A;  4QB8 A;  3T4K A;  1MWT A;  3UB6 A;  1PNE A;  1ES4 A;  1LI9 A;  1L0E A;  3S7P A;  3MXQ A;  2VGL S;  3IHA A;  3NY4 A;  4P6Z S;  1NWZ A;  3W4P A;  1GA9 A;  1ES5 A;  4JLF A;  5FSR A;  2PHY A;  1V9Y A;  3VE4 A;  2HJ9 C;  4UHU A;  2ZM0 A;  2JKT M;  2Z2L B;  3IXB A;  4P87 A;  4X1M A;  1ZG6 A;  3M2J A;  2Y2N A;  1ACF A;  3NHQ A;  3N7W A;  4KQO A;  3HLG A;  5IS1 A;  2HPB A;  3OC2 A;  3T4L A;  1IKG A;  1W8Q A;  4X55 A;  1PW1 A;  5GHX A;  2XDM A;  2VEA A;  2XFS A;  3CJM A;  2EX2 A;  2XA7 S;  1MWU A;  3TE8 A;  4NXE A;  4N92 A;  5G4Y A;  5EVI D;  5HPI A;  2H28 A;  3PAE A;  4IUH A;  3UPN A;  3NBL A;  2X02 A;  3IHB A;  3GTC A;  2RL3 A;  3PAG A;  3E0Y A;  3P98 A;  4KG2 A;  1LLB A;  3DTM A;  4DXC A;  4HP9 A;  3A0V A;  3LI9 A;  2H0Y A;  3C4O A;  2HP9 A;  3IF5 A;  3IXD A;  4QPR A;  4LLO B;  3G2Z A;  5D3O A;  3ZYT A;  4OQI A;  4S2M A;  1PWC A;  3EGX C;  3VMA A;  5FQJ A;  3V67 A;  4PM5 A;  1G68 A;  2J3W A;  4NET A;  1HVB A;  4QWO A;  4XT2 B;  5L09 A;  3FYZ A;  5GLD A;  3M6B A;  1N9B A;  2V0U A;  2KDK A;  1MKM A;  3LIF A;  1MC0 A;  1RCJ A;  3LR4 A;  1QMF A;  3PYP A;  5AQB A;  5HWW A;  2WYX A;  3QP2 A;  3MXR A;  3K2N A;  1V9Z A;  1PZO A;  2GZA A;  3IX4 A;  5FQ9 A;  1N9L A;  1FCN A;  4NXB A;  3VP3 A;  4KUK A;  3ZG5 A; 
#chains in the Genus database with same CATH homology
 4X53 A;  4FH2 A;  1MY8 A;  2PBY A;  4RYE A;  1W7F A;  3ZDJ A;  4WMC A;  1YMS A;  2EXB A;  4PMA A;  4WMC D;  4X6T A;  1YLT A;  2XK1 A;  1U60 A;  1YLJ A;  3D4F A;  2R9X A;  2Y59 A;  2ZQ9 A;  3BYD A;  3O87 A;  2X01 A;  5E2F A;  5DF7 A;  2QZ6 A;  1TDG A;  3HLB A;  1L0D A;  5FAP A;  5JYO A;  1E25 A;  3RXX A;  4GD6 A;  1ESI A;  1DJB A;  2XFT A;  1DJC A;  2FFF B;  1K54 C;  4A5R A;  2WKH A;  3IH9 A;  2EFX A;  2XD5 A;  4UA9 A;  4JF6 A;  1JWZ A;  4X56 A;  1PIO A;  3OPH A;  3V5M A;  1RP5 A;  4N1H A;  4WZ4 A;  1SKF A;  2H5S A;  2HP5 A;  4S2P A;  5DTT A;  3VFH A;  1FSW A;  1K6S A;  3G2Y A;  5FAO A;  2ZMA A;  3Q7V A;  4RX2 A;  3AGF A;  5CRF A;  5L2F A;  1JTG A;  3VP1 A;  3HLC A;  2C5W B;  4R4S A;  3BEB A;  1IYQ A;  3SH9 A;  4OON A;  2OLU A;  4C3Q A;  4KZ9 A;  5TGF A;  2Q9M A;  4H8R A;  3WS1 A;  3PBO A;  3PBQ A;  3GRJ A;  2WKI A;  4QY5 A;  2ZQ8 A;  2Y2Q A;  3W4Q A;  3NC8 A;  3EQU A;  1CI8 A;  4Y7P A;  2XF3 A;  2RCX A;  4QHC A;  5HAR A;  1GHI A;  4OOY A;  3LCE A;  3VP0 A;  1JWV A;  3S1Y A;  4GKU A;  3V39 A;  1SCW A;  4R3B A;  1M40 A;  3IH8 A;  3MZD A;  1KDW A;  5FQQ A;  2JCH A;  1KVM A;  1K57 C;  4EUZ A;  5A92 A;  1FR6 A;  1BTL A;  1ERM A;  4IBR A;  4OOL A;  1ERQ A;  2ZJ9 A;  3W4O A;  1GHP A;  4KZ7 A;  1FCO A;  3HVF A;  1MKI A;  4MBH A;  5EVI B;  4PM8 A;  4OVD A;  1HTZ A;  5GHY A;  2P9V B;  4P0M A;  3IWQ A;  2CC1 A;  3TSG A;  2BG1 A;  3Q82 A;  1PI4 A;  1S0W A;  1FOF A;  4PPR A;  4GB7 A;  4OP5 A;  5AQ9 A;  2IWC A;  4S2L A;  1I2W A;  1Y54 A;  3M2K A;  4GNU A;  4Y0U A;  1BLH A;  2XLN A;  5DF8 A;  4KZB A;  5DVA A;  2WK0 A;  3N8L A;  1GA0 A;  2HDU A;  4JF4 A;  3SH8 A;  4EBP A;  4Q8I A;  1MXO A;  1VM1 A;  4DDS A;  2XEP A;  5KZH A;  4N9L A;  5E2H A;  3HUO A;  1NYM A;  2GDN A;  4U3T A;  3FZC A;  1ONG A;  1K54 A;  5HL1 A;  4GDB A;  4EBN A;  5DF9 A;  3Q07 A;  4QY6 A;  4LV1 A;  3PBN A;  5EE8 A;  3G30 A;  1K38 A;  1KE4 A;  1XX2 A;  3UE3 A;  2VGK A;  1JVJ A;  1Q2Q A;  4OH0 A;  4WEL A;  1OME A;  3TG9 A;  3UO9 A;  1ERO A;  3A3D A;  5TR7 A;  5TFQ A;  3ISG A;  3BLM A;  4R23 A;  3CZD A;  3C7U A;  1KDS A;  1KE3 A;  4E3N A;  2ZC3 B;  4N9K A;  2XD1 A;  1IEL A;  1KE0 A;  4FSF A;  1YLP A;  5FI2 A;  4N1X A;  1KGF A;  2OLV A;  3G4P A;  4WZ5 C;  3BFF A;  4LV2 A;  2B5R A;  3ZNY A;  5KMW A;  2ZQC A;  2Y2L A;  3RXW A;  1MWR A;  3HLF A;  3VSL A;  4S2I A;  3E2L A;  5CEC A;  3OCL A;  1CEG A;  3I7J A;  4BD1 A;  3PBS A;  1PWG A;  5F83 A;  5A93 A;  2WZZ A;  4OKP A;  4K0W A;  3NCK A;  2VGJ A;  1O7E A;  1XA7 A;  3MZE A;  4DE0 A;  1BLC A;  1NJ4 A;  3AGD A;  3NI9 A;  5GL9 A;  1K57 A;  4JBF A;  1NRF A;  1IYO A;  4DXB A;  3N8R A;  1WYB A;  4KZ4 A;  3BFC A;  1LL9 A;  2WGW A;  4U0T A;  3ZFZ A;  3S22 A;  4IVI A;  4EWF A;  5I94 A;  5EOE A;  2ZC6 B;  5CGX A;  4DE2 A;  3MXS A;  3VSK A;  4ZDX A;  4S2O A;  1E3U A;  1NXY A;  5E43 A;  1E3U D;  5FAQ A;  3B3X A;  4MEZ A;  3ZVW A;  3ITA A;  2Z2M B;  1FCM A;  3QNB A;  1I2S A;  4K0X A;  4JXG A;  1JWP A;  5EPH A;  1XXM A;  2G2W A;  5AQA A;  2Y2I A;  3EQV A;  4B88 A;  1YLZ A;  1XGJ A;  3OPP A;  4JXV A;  3BFG A;  3BM6 A;  2PU2 A;  4Y0O A;  3UPO A;  1FQG A;  1AXB A;  4UA6 A;  3GR2 A;  3OPL A;  4KQR A;  1PI5 A;  3WS4 A;  3FWL A;  3GVB A;  1RGY A;  5EOO A;  3Q7V B;  2HDS A;  2J8Y A;  1N4O A;  1NY0 A;  3ZGA B;  3MKF A;  2Y2G A;  2X71 A;  1W79 A;  3A3J A;  4OP8 A;  4ZJ3 A;  5CHU A;  4E3J A;  1IYS A;  1GHM A;  4C75 A;  2EXA A;  3NDE A;  4R3J A;  5HAP A;  1K55 C;  1CK3 A;  4E3O A;  3IWI A;  1GCE A;  3A3F A;  1ZC2 A;  4X69 A;  4ZJ1 A;  3ZVT A;  1BUE A;  1M6K A;  2QPN A;  4HBT A;  4E3K A;  2JC7 A;  3RJU A;  1K25 A;  3JYI A;  2IWB A;  3PBR A;  3HLW A;  1PYY A;  4RX3 A;  1H5X A;  3WS0 A;  1L0F A;  4HEF A;  3UPP A;  3WWX A;  1FR1 A;  3DWK A;  3TOI A;  3ZCZ A;  5CEB A;  4WZ5 A;  5DTS A;  4E3M A;  1IYP A;  2UWX A;  4GOG A;  4P85 A;  4B4X A;  5CXW A;  3C5A A;  3WS5 A;  5KSC A;  2XH9 A;  3C7V A;  3UDI A;  1NYY A;  3V3R A;  4LCM A;  4FCF A;  5FAS A;  3BLS A;  5CGW A;  1K4F A;  4OQG A;  4DF6 A;  4MBF A;  4B4Z A;  5M18 A;  2WAF A;  4MBK A;  1H8Y A;  3HUN A;  3ZHH A;  3HBR A;  3N8S A;  3P09 A;  1ES2 A;  4OPR A;  4WEJ A;  2R9W A;  3AGE A;  3QHY A;  2EX9 A;  1HD8 A;  3BRM A;  4PM6 A;  4S2N A;  4KZ6 A;  3SS4 A;  3UNW A;  1IEM A;  3WRZ A;  3SOI A;  3G32 A;  3O86 A;  3IF6 B;  3S4X A;  1C3B A;  2Y2M A;  4LV3 A;  1YLW A;  2JBF A;  3LO7 A;  3HL9 A;  1Z6F A;  3MBZ A;  3NIA A;  5FQI A;  4WBG A;  1W5D A;  4DKI A;  2BLS A;  3HLE A;  5FI6 A;  3PBT A;  3IXG A;  4BJP A;  4XXR A;  5EVI A;  5FQK A;  3IXH A;  1KGG A;  4JKT A;  4KEN B;  1K56 A;  4E3L A;  1ESU A;  4BQM A;  4YFM A;  4E3I A;  2V20 A;  3UY6 A;  3BEC A;  3LY4 A;  3UDX A;  2WKE A;  3W8K A;  5DTK A;  5M19 A;  5FDH A;  2Y2O A;  5FQM A;  5BOH A;  1HZO A;  3FKV A;  4BL3 A;  2Y91 A;  1CEF A;  4GDN A;  2J7V A;  4JXW A;  2EX6 A;  3QNC A;  5CER A;  4OQ0 A;  3N4I A;  4OOM A;  1TDL A;  2ZC7 A;  1JTD A;  1W8Y A;  2WGI A;  3IQA A;  4EV4 A;  4D2O A;  4XUX A;  4NK3 A;  4JXS A;  1K55 A;  4KZ8 A;  1O07 A;  4OPQ A;  4S2K A;  1YMX A;  1G6A A;  2Y55 A;  4RA7 A;  2Y2H A;  5CED A;  2DRW A;  4KG5 A;  5HAI A;  3OZH A;  3SH7 A;  3C4P A;  3BFE A;  3GMW A;  4O7D A;  4U0X A;  5GLA A;  4L0L A;  2QMI A;  4R1G A;  1MBL A;  2PU4 A;  3DWZ A;  2WZX A;  1LHY A;  2Y2K A;  2ZC5 B;  4S2N C;  4PM9 A;  5FI7 A;  3UN7 A;  4M3K A;  4RVA A;  5CGS A;  1L0G A;  4FD8 A;  4DDY A;  4OLG A;  3ZG9 B;  3V3S A;  2J9O A;  4BL2 A;  4Y0T A;  4QD4 A;  2I72 A;  1BSG A;  4CPK A;  3NDG A;  2XR0 A;  5HAQ A;  3ZG8 B;  4QU3 A;  5EEC A;  4KZ5 A;  3ZG0 A;  1YQS A;  1KVL A;  2JE5 A;  4OPZ A;  4LEN A;  5EVI C;  4E6W A;  2IWD A;  1K4E A;  2HP6 A;  1KGE A;  4ID4 A;  1ZKJ A;  4P6B A;  3VOZ A;  3Q7Z A;  4WM9 A;  3VP4 A;  1ONH A;  3A3I A;  2A49 A;  4MNR A;  1MPL A;  5GLB A;  4QB8 A;  1TEM A;  1SDE A;  1MWT A;  2ZQ7 A;  2DNS A;  5CTN A;  3VFF A;  4HES A;  4S2J A;  4CJN A;  3BFD A;  1ES4 A;  4ZJ2 A;  4EBL A;  3OPR A;  4GD8 A;  1LI9 A;  1L0E A;  5CTM A;  4HBU A;  5A90 A;  1YT4 A;  3GQZ A;  3SS5 A;  5FA7 A;  3SS3 A;  2ZQA A;  3IHA A;  4GN2 A;  2XQZ A;  3NY4 A;  5E2E A;  4LV0 A;  5EUA A;  2OSU A;  1DY6 A;  2ZD8 A;  2ZM8 A;  1NZU A;  2C6W B;  4X68 A;  3W4P A;  1Q2P A;  2A3U A;  2WUQ A;  4KQQ A;  2EX8 A;  4OPY A;  4EQI A;  1LL5 A;  5F1G A;  1GA9 A;  1ES5 A;  5HW3 A;  5M1A A;  1XA1 A;  2G2U A;  4JLF A;  5FSR A;  4ZAM A;  1XGI A;  4IBX A;  3GV9 A;  5EVL A;  2P74 A;  5U47 A;  3IWO A;  4BEN A;  2ZM2 A;  1PWD A;  1EI5 A;  4KG6 A;  1H8Z A;  4UAA A;  1RGZ A;  5HFO A;  1IKI A;  3MZF A;  4UHU A;  2ZM0 A;  3ZG7 B;  2Z2L B;  3IXB A;  4P87 A;  4ZBE A;  3HUM A;  2OV5 A;  1ZG6 A;  2H10 A;  1BZA A;  2Y2N A;  3M2J A;  4LCL A;  1YLY A;  4KZA A;  4BLM A;  3HRE A;  3N7W A;  4KQO A;  1FSY A;  2Y2J A;  1DJA A;  3HLG A;  2HPB A;  3OC2 A;  4UA7 A;  1TVF A;  1IKG A;  5FAT A;  3DW0 A;  2ZLY A;  3FV7 A;  1W8Q A;  5J8X A;  4GZB A;  4X55 A;  5GHZ A;  5A91 A;  4Z9Q A;  1PW1 A;  3WS2 A;  3UE0 A;  5GHX A;  1VQQ A;  2XDM A;  4R0Q A;  1YM1 A;  1ALQ A;  2XFS A;  3CJM A;  1BT5 A;  2EX2 A;  3CMZ A;  3FKW A;  1MWU A;  3V50 A;  2ZC4 B;  3M6H A;  3G31 A;  4KZ3 A;  4OLD A;  4N92 A;  5EVI D;  4DE3 A;  3PAE A;  2H0T A;  1MWS A;  2P9V A;  3O88 A;  4C6Y A;  3UPN A;  1ES3 A;  1CI9 A;  3NBL A;  3WRT A;  4DRT A;  2X02 A;  5KSH A;  4DE1 A;  1K56 D;  3IHB A;  3GTC A;  2RL3 A;  3PAG A;  2V1Z A;  3IF6 A;  4FH4 A;  3LY3 A;  4QJG A;  1PZP A;  3P98 A;  3E2K A;  5E2G A;  4KG2 A;  4K91 A;  2E8I A;  2WAE A;  1LLB A;  5CHM A;  3GSG A;  2V2F F;  2ZQD A;  3DTM A;  1LI0 A;  4MLL A;  4DXC A;  4WEK A;  3VOY A;  1EWZ A;  4WYY A;  2H0Y A;  3C4O A;  4R4R A;  1XPB A;  3O3V A;  2HP9 A;  3UDF A;  3IF5 A;  2FFY A;  3IXD A;  3G2Z A;  4YIN A;  5D3O A;  1E4D A;  3ZNT A;  3A3E A;  4F94 A;  1WE4 A;  1WYC A;  1L2S A;  3Q1F A;  4OQI A;  2Y4A A;  4IED A;  2J9P A;  4S2M A;  5AQ7 A;  4ZTK A;  1PWC A;  3ITB A;  1SDN A;  3VMA A;  4OQH A;  5FQJ A;  5JYP A;  1BUL A;  2HDR A;  4PM5 A;  1ZG4 A;  1G68 A;  1SHV A;  2DCF A;  3G35 A;  2Y2P A;  4NET A;  5HX9 A;  4IVK A;  1HVB A;  1J9M A;  3FYZ A;  5GLD A;  3PTE A;  3M6B A;  1N9B A;  2WGW B;  4PM7 A;  5F1F A;  5CHJ A;  4JF5 A;  3CG5 A;  3VP2 A;  1BLS A;  2XGN A;  2EFU A;  4JPM A;  4XUZ A;  1RCJ A;  1PW8 A;  1XP4 A;  4E6X A;  1NZO A;  1QMF A;  3MKE A;  5AQB A;  5F82 A;  3MFD A;  5GLC A;  2Q9N A;  1S6R A;  2WYX A;  3N6I A;  3MXR A;  1K6R A;  3UE1 A;  1PZO A;  4BD0 A;  1XKZ A;  3OCN A;  2WGV A;  5FQ9 A;  5IHV A;  1I5Q A;  3IF6 C;  2WAD A;  1BLP A;  1FCN A;  3LEZ A;  3Q81 A;  1QME A;  2HDQ A;  3G34 A;  5G18 A;  3IT9 A;  3VP3 A;  3HLD A;  3ZG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...