3PAGA

Crystal structure of the v130d mutant of oxa-24/40 in complex with doripenem
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
245
structure length
245
Chain Sequence
MHISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSADPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/antibiotic
molecule keywords Beta-lactamase
publication title Structures of the Class D Carbapenemase OXA-24 from Acinetobacter baumannii in Complex with Doripenem.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 80
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3pagA00
3ZG0A 1JVJA 2Q9MA 3VOYA 4E3OA 4GNUA 5JYOA 2HPBA 2Y55A 2ZC5B 1MPLA 5M18A 4KENB 1YLYA 1XA1A 3Q7VB 2OSUA 2ZQ7A 3VP4A 3E2LA 4HESA 3S4XA 2ZM2A 1H5XA 5GL9A 2EFXA 4P87A 4C3QA 3WS5A 1KGGA 1TVFA 3BLMA 1FSWA 3UNWA 3ZVWA 1YLPA 2ZQ8A 5EOEA 5FAPA 1K55A 1BTLA 2XFTA 3BRMA 4FSFA 3Q7VA 2XD5A 5A92A 3PBNA 5I94A 3Q7ZA 2XEPA 3C4PA 3HVFA 1KDSA 3IXBA 5EECA 4S2IA 1JTGA 1IYOA 3LCEA 1IYPA 4KG5A 1O7EA 1FCNA 1CEGA 1W8QA 3MZFA 4NK3A 4O7DA 3UE1A 4WMCD 5CGXA 3ZNTA 4S2LA 3GMWA 1RGYA 3NY4A 3N4IA 3D4FA 2WGWB 5EVID 2J9OA 1JWZA 4UHUA 4H8RA 5A91A 3VOZA 2XF3A 1HVBA 1W8YA 5HL1A 5HFOA 5TR7A 1KE0A 4OPZA 4ZDXA 2EX9A 1CI9A 5A93A 4ZJ2A 5FDHA 4CPKA 1LI9A 1OMEA 3GV9A 1MWRA 4MLLA 2IWBA 1XGJA 2I72A 4JF5A 1KVLA 2HDQA 2ZMAA 4GB7A 4BLMA 4S2PA 4WZ4A 4UA6A 5HAQA 3A3FA 5FA7A 5FSRA 1IKIA 3VFHA 4KZ9A 5GHYA 1GHIA 5GLBA 1HTZA 3CZDA 5E2EA 1KVMA 3EQVA 3SS4A 4MEZA 4ZJ1A 5GHXA 4BD1A 1MY8A 2ZM0A 3Q1FA 4B88A 4QD4A 3M6BA 1W79A 5M19A 2ZJ9A 5EE8A 1BLSA 3A3JA 4RX2A 1PW8A 4WZ5C 5EVIC 4MBFA 1NJ4A 4KZAA 4KZBA 3MBZA 3WWXA 3IF6B 3IXGA 3QNBA 4JXVA 5E2GA 4DF6A 4FCFA 4M3KA 3SH7A 1GA9A 1PI5A 1QMFA 4RA7A 4E3NA 1U60A 3FV7A 1L0FA 1NRFA 2HDSA 1G6AA 3BFGA 3NIAA 3V50A 3PBOA 5DTKA 3G31A 5GLCA 1KGEA 5HAPA 3W4OA 3ZG7B 3IF6A 4WYYA 4N1XA 1YMXA 4ZTKA 2G2WA 3ZG9B 1PYYA 4R4SA 1K56D 5HAIA 3ZFZA 2Y59A 4LV0A 3NDEA 4DE3A 5J8XA 1ES2A 1EWZA 4PM6A 2Y2JA 1SHVA 1MXOA 1HD8A 5JYPA 1K38A 1GA0A 1K6RA 4OPYA 3WS2A 1TDGA 1FOFA 2Y2PA 5DF9A 1DJAA 2A49A 5CHMA 1I2SA 1K25A 3HREA 4R1GA 2B5RA 2ZM8A 1BT5A 3BFEA 3DW0A 3HLCA 3UPPA 1LL9A 1KE4A 2XH9A 3EQUA 1HZOA 4EUZA 1PWGA 3VP1A 4ID4A 3G30A 4GDNA 4GZBA 3RXXA 3MKFA 3TOIA 5CHJA 3WS0A 2C5WB 2H0YA 4LV3A 3ZDJA 4GD8A 4E3IA 2EXAA 1O07A 3WRTA 2EX2A 4BQMA 4XUXA 4IBXA 2HDUA 4P85A 4EBNA 2Y2LA 3PBRA 2J7VA 2ZD8A 3GSGA 1XPBA 3O88A 1K57A 3E2KA 5FI6A 4C6YA 1KGFA 3OCNA 1MWUA 4OPQA 2WGVA 3OZHA 4E3LA 1GCEA 1ZG6A 1NZOA 1N9BA 1ZG4A 1SDNA 1BLCA 1K4EA 2ZQCA 4HEFA 3WRZA 1XXMA 3PBQA 4QB8A 1Y54A 4EQIA 1KDWA 3O86A 5FQKA 4DE0A 4N1HA 2JE5A 1WYBA 4U0XA 3C7UA 3O87A 2H5SA 5DF7A 3IWQA 2WGIA 1Q2PA 2ZC3B 3ITAA 3JYIA 4HBUA 4XUZA 5GLDA 2P9VB 3M2KA 2R9WA 5CGSA 5U47A 3P98A 5GLAA 3LY4A 1IYSA 4KZ5A 4E6WA 3VFFA 2ZQAA 1JWVA 5AQ7A 5TFQA 2Y2IA 3I7JA 3OPRA 3DWZA 4BENA 1YLZA 3GQZA 2H10A 2OLUA 3ZG8B 1L0EA 2XLNA 1KE3A 3M6HA 2P9VA 1RGZA 3G4PA 5GHZA 3MZEA 4UA9A 3IXDA 4GD6A 2HDRA 4R3BA 1MWTA 5CXWA 2IWCA 3GTCA 4HBTA 2WAFA 3ZVTA 1ESUA 1RCJA 4RVAA 4YINA 4IBRA 4KQOA 2Y91A 5F1GA 1Q2QA 1FCMA 1XP4A 1JWPA 5F82A 3C5AA 1IYQA 1K6SA 3BLSA 1XGIA 1YT4A 1K55C 3CG5A 4FH4A 5DTSA 2XK1A 5EUAA 5F83A 3WS4A 5FAOA 5FASA 3RJUA 3VMAA 2WGWA 1BZAA 3NCKA 1K54A 3NC8A 4QY6A 3BFFA 4KZ7A 3W4PA 2A3UA 4S2NA 1H8YA 2WZXA 2Z2MB 3MZDA 4WELA 5CHUA 3FWLA 1SDEA 4DKIA 3Q81A 1EI5A 5A90A 4JF4A 4KG2A 3TSGA 2ZQ9A 3LEZA 4WM9A 2X02A 1CI8A 4OVDA 5FI7A 4PMAA 3NBLA 5F1FA 1BLHA 2WADA 3QHYA 1LL5A 2PBYA 4S2OA 1MBLA 4B4ZA 2WKIA 2Q9NA 3A3IA 1FCOA 1ERQA 1DJCA 3HUMA 4S2KA 4WEKA 1WE4A 3BECA 3HLDA 5G18A 4C75A 1ZC2A 1CK3A 1EROA 1GHPA 1YMSA 3GRJA 3IWOA 4RYEA 5E43A 5D3OA 5CECA 1DY6A 2HP6A 1I5QA 3IT9A 3OC2A 3G2ZA 1FQGA 4X69A 4WBGA 2Y2OA 4E6XA 1H8ZA 4Y0UA 2IWDA 4OOYA 4JPMA 4KZ6A 1C3BA 1ES4A 3ISGA 3Q07A 4S2MA 1PIOA 3HLGA 4BJPA 4KZ8A 4BL3A 3HLFA 1NY0A 1NYMA 3VP0A 2ZLYA 4GKUA 1PZPA 1ESIA 2Y2QA 4X68A 3W8KA 2EFUA 4U3TA 4DDSA 5KSHA 2X71A 2P74A 5KSCA 1LHYA 2R9XA 2JC7A 4Y0OA 4ZBEA 1PWDA 1TDLA 1TEMA 3G34A 4K0WA 3FKVA 3AGEA 4EWFA 1DJBA 2XGNA 3ZHHA 1IELA 4ZJ3A 3BEBA 3O3VA 3FZCA 4OONA 4KG6A 4OQIA 1SKFA 4KZ3A 4LV1A 4MBKA 2J9PA 4MBHA 4JXGA 1ONHA 4LV2A 2XR0A 4A5RA 2ZC7A 3G2YA 3A3DA 2V20A 1M6KA 1L2SA 2Y2NA 5FATA 3IF6C 2VGJA 5CEDA 1NXYA 5HW3A 3GVBA 1L0DA 5FQIA 1K56A 2BLSA 4JF6A 4QY5A 1FR6A 3DTMA 2WZZA 2VGKA 2Z2LB 3IF5A 3IXHA 3V39A 5CEBA 2EXBA 3VSLA 3NDGA 4K0XA 5DVAA 5L2FA 4OP8A 3ZNYA 4UAAA 1YQSA 3WS1A 3HLEA 4PM7A 4BL2A 2XDMA 3BFCA 4NETA 3MXSA 3S1YA 2Y4AA 3UPNA 1XA7A 1L0GA 2PU4A 2H0TA 4CJNA 3BM6A 2RL3A 2WKHA 4S2JA 4QJGA 3PAEA 4QHCA 5HX9A 1AXBA 4E3MA 1IEMA 4GN2A 1ALQA 1ES5A 2QZ6A 4IVKA 2FFYA 2WUQA 2XD1A 5M1AA 2V2FF 3AGFA 3PAGA 2Y2GA 3BFDA 3LO7A 3SS3A 4X6TA 2DCFA 2WK0A 5DTTA 1RP5A 3N8LA 3QNCA 3P09A 1YLJA 4X56A 4LCLA 5AQBA 2OV5A 3IH9A 4Y7PA 4KQRA 4PM5A 1S0WA 3IH8A 1XKZA 3IHAA 5BOHA 2ZC6B 1YLWA 1E3UA 4RX3A 1PWCA 1K57C 2QMIA 2V1ZA 1N4OA 2Y2HA 2X01A 3UE3A 4EBPA 3GR2A 4B4XA 4JBFA 4KQQA 4OQHA 3SH8A 5CERA 4OOMA 5FQJA 4DRTA 1SCWA 4OLDA 2EX8A 3C4OA 3CJMA 3B3XA 4JLFA 4MNRA 1W5DA 4U0TA 1JTDA 3V3SA 5EPHA 3PTEA 5CRFA 4PM8A 2E8IA 2JCHA 1BSGA 3HUNA 4N9LA 1BUEA 1ES3A 1XX2A 3PBSA 3UY6A 3HLWA 2BG1A 3SS5A 1PW1A 4L0LA 4DE1A 1G68A 1WYCA 2JBFA 3ZG5A 5TGFA 5EVIB 2ZQDA 5CTNA 3UDXA 3UDFA 5KZHA 4R3JA 1CEFA 3PBTA 3VSKA 3RXWA 4WMCA 4ZAMA 3FYZA 1J9MA 1S6RA 1I2WA 5FI2A 4WZ5A 1BLPA 5CGWA 1FSYA 1LI0A 1E25A 3N8RA 5EVIA 3VP2A 4EV4A 3FKWA 2EX6A 4N9KA 1MKIA 3MKEA 1K4FA 4D2OA 3NI9A 5DF8A 3UE0A 2OLVA 4EBLA 2DNSA 1NYYA 3AGDA 3UO9A 5AQ9A 4WEJA 4OH0A 3A3EA 1K54C 1QMEA 4GOGA 3CMZA 2QPNA 2HP5A 3OPLA 4R0QA 4FD8A 4JXWA 4N92A 4OQ0A 4S2NC 2RCXA 1YLTA 3ITBA 3IQAA 4X55A 3IHBA 2DRWA 5KMWA 5FQMA 4E3JA 2XFSA 4R4RA 4P0MA 4FH2A 1BULA 3ZCZA 2PU2A 4JXSA 4OP5A 4JKTA 1ERMA 4X53A 2WAEA 4E3KA 4IVIA 3N8SA 4Z9QA 1W7FA 4IEDA 1GHMA 5E2FA 4K91A 4P6BA 3MFDA 5CTMA 5HARA 2ZC4B 3SH9A 5E2HA 3DWKA 5FAQA 4UA7A 4Y0TA 4OOLA 1PI4A 1YM1A 2GDNA 4F94A 3OCLA 4BD0A 3OPHA 1FR1A 4OKPA 4PM9A 3UDIA 1Z6FA 2WYXA 1M40A 4PPRA 3ZGAB 3UPOA 3V5MA 1NZUA 2UWXA 2J8YA 3HBRA 2FFFB 4Q8IA 4YFMA 4OPRA 2Y2KA 1ONGA 4DXBA 2C6WB 4DXCA 3HL9A 4QU3A 3OPPA 3BYDA 1E4DA 4KZ4A 3C7VA 4DE2A 5IHVA 1PZOA 5AQAA 3G32A 4LCMA 4DDYA 1VQQA 2G2UA 2CC1A 5EVLA 3LY3A 5FQ9A 3N6IA 1MWSA 3UN7A 3HUOA 1LLBA 3M2JA 3Q82A 1ZKJA 2Y2MA 3TG9A 3W4QA 3S22A 1VM1A 3MXRA 3HLBA 5EOOA 5FQQA 4LENA 4GDBA 3VP3A 3SOIA 2XQZA 3IWIA 3V3RA 2WKEA 4R23A 3N7WA 4OQGA 2HP9A 4OLGA 1IKGA 4XXRA 3G35A 1E3UD
chains in the Genus database with same CATH superfamily
1JVJA 2Q9MA 3VOYA 4NKPA 4E3OA 2ZC5B 1XA1A 1LSWA 1UWNX 5GL9A 1TVFA 3QP6A 5EOEA 2XFTA 5I94A 3Q7ZA 3C4PA 3HVFA 1KDSA 1XJ6A 1IYOA 3LCEA 1W8QA 4NK3A 4O7DA 2GJ3A 4MN7A 4KUOA 3EWKA 2INWA 4ME4A 1FIKA 5EVID 2J9OA 3H82B 2PRFA 4H8RA 5A91A 3G6OA 1W8YA 3K3CA 3QP1A 3ZYTA 5L8MA 2EX9A 4ZJ2A 5FDHA 1MWRA 4MLLA 2HDQA 4S2PA 4WZ4A 5HAQA 1OTAA 5FSRA 1GHIA 3CZDA 5E2EA 5GHXA 2ZM0A 2W27A 4R38A 3M6BA 1W79A 4I3AA 5DJUA 5EE8A 3F1OB 2XSSA 4Q0HA 2ACGA 3T1SA 3IF6B 3QNBA 2A24B 4FCFA 4RA7A 1U60A 4R3AA 1NRFA 2JHEA 5DTKA 3G31A 1KGEA 5EFWA 2JKFA 5HWTA 4K08A 4R4SA 1K56D 3CLOA 2Y59A 4YWZA 3P7NA 1OJ5A 2PAVP 1MXOA 3CUEA 1DP6A 4OPYA 2Y2PA 2A49A 4CLCB 1I2SA 3HREA 4R1GA 3JVUA 2B5RA 3DW0A 3MXQA 3T4SA 4YNRA 5CHJA 2C5WB 4LV3A 3ZDJA 2EXAA 1O07A 3F1PB 2HDUA 2ZD8A 1XPBA 3E2KA 1KGFA 4LRXC 1K0KA 1N9BA 1ZG4A 4HJ4A 1JNUA 4EQIA 1UWPX 4N1HA 1WYBA 4HBUA 4XUZA 2R9WA 5CGSA 3NJAA 3P98A 5GLAA 1IYSA 1JWVA 3UB6A 3I7JA 3GQZA 2H10A 2OWHA 3ZG8B 1L0EA 1KE3A 3IXDA 5HDDA 4GD6A 2KDKA 3ZVTA 1ESUA 1GSXA 1LT0A 2PD7A 2R78A 1XP4A 1D7EA 3C5AA 1K6SA 3BLSA 1XGIA 4H6JA 3CG5A 3VMAA 1K54A 3LIDA 3NC8A 1DP8A 3W4PA 2A3UA 1YSQA 2WZXA 5CHUA 3K3DA 1SDEA 4DKIA 5A90A 1H8MA 3KYQA 4JF4A 5F1FA 1A0KA 1BLHA 1FILA 1DJCA 4S2KA 3BECA 4C75A 3GRJA 3V67A 1DY6A 2HP6A 1I5QA 4E6XA 4GJ4A 3MQ0A 4OOYA 3T4OA 4BJPA 4BL3A 1ESIA 4RQ9A 4X68A 2EFUA 2X71A 2GX5A 1DJBA 2XGNA 3BEBA 4P6ZS 1SKFA 4KZ3A 5HD5A 2J9PA 4MBHA 4CLCD 4LV2A 2ZMVA 2OAP1 4L9EA 3UB7A 5FQIA 1K56A 2VGKA 2Z2LB 3IXHA 3VSLA 4OP8A 3ZNYA 4FTXA 2V8FA 4NETA 1ZHHB 4CJNA 3PAEA 3UB5P 2B18A 1IEMA 4NXGA 5M1AA 3ULFA 2FFYA 2XD1A 5EM0A 2V2FF 3SS3A 1G6OA 4LGWA 2XROA 3N8LA 2OWJA 3U2AA 4PM5A 4LPZA 1YLWA 4X1LA 1PWCA 2JKTI 3JVVA 3UE3A 3C2WA 3GR2A 2VGLS 3DAVA 3SH8A 3FPWA 3MS6A 4OOMA 4DRTA 2QJ5A 3CJMA 4MNRA 3MQQA 1T1CA 3NULA 4PM8A 1BSGA 3CPTA 1XX2A 2D02A 3PBSA 4LLOB 3FG8A 4MN6A 2PYPA 1PW1A 2W0NA 3IBRA 4L0LA 4DE1A 2ZL1A 1YKDA 5TGFA 2W3DA 2ZQDA 4WLAA 4R3JA 1CJFA 2QWSA 3UMEA 2K31A 4WMCA 3NOUC 5CGWA 1E25A 3VP2A 4JGOA 1TS7A 3FKWA 4N9KA 2VLGA 3NI9A 4KUKA 4WN5A 4EBLA 1NYYA 3A3EA 4R0QA 2JKRI 4X55A 1S4SA 2DRWA 3HJKA 4IUHA 5FQMA 1W63M 2XFSA 1LSXA 3ZCZA 4OP5A 4JKTA 1ERMA 4JGRA 2WAEA 2V8CA 3N8SA 4IEDA 2VGLM 1P9WA 5AVEA 5HARA 2VV8A 3DWKA 3MR0A 2PYRA 4XT2B 3OCLA 4F94A 4HOIA 2VV7A 4Y5FA 1Z6FA 2WYXA 3V5MA 2J8YA 3P01A 4Q8IA 4F3LA 1ONGA 1HLUP 3OPPA 3BYDA 4KZ4A 3SZTA 3C7VA 3QP4A 5AQAA 3LR5A 1X0OA 4LCMA 1VQQA 5EVLA 3VE4A 4ZRRA 3TG9A 3M2JA 2NUTC 1ZKJA 2Y2MA 3W4QA 1VM1A 3HLBA 3SOIA 2PD8A 4Y13A 2B95A 3RH8B 1IKGA 4XXRA 3KSFA 4GS9A 1OT9A 3IX4A 3DTKA 2ZQ7A 4HESA 3S4XA 2EFXA 1Y4OA 3LUQA 5FAPA 3T1RA 1BTLA 5TJJA 3Q7VA 3IXBA 4Y3IA 4S2IA 4CQHA 1IYPA 1VEUB 5MC7A 1O7EA 1FCNA 4HH2A 5DKLA 5HWVA 3UE1A 3H9WA 3GDIA 3ZNTA 3S7PA 3N4IA 3UMDA 1VB6A 1JWZA 4UHUA 4DN0A 1HVBA 5TR7A 1KE0A 4OPZA 4CPKA 1G28A 5I5LA 1LI9A 5AJGA 2IWBA 5TBMB 2ZMAA 4GB7A 4BLMA 4MCWA 4UA6A 3A3FA 3VFHA 1HTZA 3EQVA 5DJTA 4ZJ1A 4WL9A 3O5YA 1BLSA 4RX2A 5EVIC 3MBZA 4JXVA 2CMNA 1PI5A 4E3NA 3BFGA 3V50A 5GLCA 3EEAA 2ZBBA 5HAPA 3W4OA 2BASA 1GSWA 1KOUA 2G2WA 5HAIA 4HNBA 3NDEA 5J8XA 1N9OA 4PM6A 1SHVA 1HD8A 5JYPA 1GA0A 1K6RA 5DF9A 2O9AA 1BYWA 1K25A 2ZM8A 2XRNA 3UPPA 2XH9A 3EQUA 4ID4A 3G30A 3MKFA 4GD8A 3WRTA 4XUXA 4EBNA 4P85A 2Y2LA 3PBRA 2J7VA 3O88A 2HGVA 5HWWA 2PR6A 3MFXA 1BLCA 2ZQCA 1XXMA 1Y54A 2GNXA 2W1RA 3LR4A 2O99A 3E4OA 4GW9A 3C7UA 3O87A 3JYIA 2P9VB 3RTYA 2J80A 4KZ5A 4E6WA 3VFFA 2ZQAA 1H0MA 5TFQA 1OJGA 3L7HA 3DWZA 4BENA 1YLZA 5DFXA 3B47A 2OLUA 2XLNA 1RGZA 1NRJA 2V0WA 3CPTB 5GHZA 3T4KA 4UA9A 2A2LA 2O9CA 4G3VA 4YINA 1RCJA 4KQOA 2Y91A 4GCZA 1FCMA 4HJ3A 1K55C 5EUAA 5F83A 3F1NA 5FAOA 3NCKA 4QY6A 1H8YA 3FWLA 3Q81A 1EI5A 4KG2A 3LEZA 4I3IA 4EEUA 4OVDA 5FI7A 4PMAA 4X25A 3TJZC 2WADA 4S2OA 4R70A 3S7OA 1MBLA 5F5YA 4HQAA 1FCOA 5G18A 1ZC2A 5FEGA 1CK3A 1EROA 1GHPA 1YMSA 3IWOA 5CECA 3BJNA 3IT9A 3NHQA 4JPMA 3Q07A 2M1CA 4S2MA 5HZHA 1PIOA 3HLGA 4KZ8A 1NY0A 1PZPA 3W8KA 4PKYG 3G34A 1CF0A 3FKVA 3JPUA 3BW6A 1P97A 4OONA 4Y17A 4OQIA 2Z6CA 4LV1A 4MBKA 4M4XA 4HHDA 2WKRA 3T4JA 4JXGA 2XR0A 1M6KA 1L2SA 3T1XA 3IF6C 4PHTA 4QY5A 4JF6A 4BBVA 2EXBA 3NDGA 5DVAA 3HLEA 4PM7A 4BL2A 1XA7A 4HH3A 2J3TD 1TD5A 4LRZE 1L0GA 1S1ZA 2L1MA 3BM6A 4QJGA 2WKHA 5HX9A 4GHIA 4ARZA 5DFYA 1AXBA 4GN2A 4IVKA 3PAGA 4CLCC 4X6TA 5DTTA 5A8BA 1YLJA 4LCLA 1XJ4A 5AQBA 2OV5A 1S0WA 1XKZA 5BOHA 1E3UA 4RX3A 1K57C 2Y2HA 1N4OA 2L0WA 4O01A 4EW7A 3LGOA 4Z1WA 1SCWA 1V9YA 4U0TA 1JTDA 1D06A 3PTEA 2E8IA 2I9VA 1BUEA 5HL6A 1XFNA 5EV0A 2JBFA 4HI4A 3ZG5A 2W1TA 1H3QA 2GZAA 5IS1A 1CEFA 3PBTA 2YKHA 3RXWA 3T4LA 4ZAMA 3EOIA 2Q0OA 1I2WA 1LI0A 2FH5A 4YOFA 3N8RA 4G3WA 5EVIA 4EV4A 3ICYA 2EWWA 2DNSA 4WEJA 3EGXC 4OH0A 1QMEA 2HP5A 3QP2A 4FD8A 4JXWA 5IU1A 2RCXA 3IHBA 4R4RA 1DRMA 5EVEA 1BULA 4CLCE 2PU2A 4E3KA 5EM1A 1W7FA 2ZOIA 1XJ2A 2M7VA 2ZC4B 5FAQA 4OOLA 3KSGA 1VHMA 1DP9A 2GDNA 3R7WA 3LR0A 2B02A 3S7QA 3UDIA 3EEHA 1N9NA 3ZGAB 4EEPA 2UWXA 4HP9A 4NEED 4YFMA 4DXBA 5HDCA 2P7JA 2W3EA 1PZOA 3FPVA 2G2UA 2CC1A 3N6IA 3PHYA 3HUOA 5FQQA 4GDBA 3C38A 3IWIA 4ESPA 3VV4A 2E8JA 1L3LA 4OQGA 2HP9A 4OLGA 1F98A 3ZG0A 4GNUA 2Y55A 3KX0X 1MPLA 5M18A 3B42A 3VP4A 3E2LA 1H5XA 3WS5A 1KGGA 3FC7A 2V1AA 1YLPA 2W3FA 2ZQ8A 3ZVWA 1K55A 3CITA 3BRMA 4FSFA 2XD5A 3PBNA 2PHYA 2G7UA 1JTGA 4B93A 2Z6DA 4JGQA 3MZFA 1XJ3A 3BQ8A 5CGXA 2W3GA 4PAUA 4S2LA 4I39A 3DBAA 3F1NB 1RGYA 1YSPA 3D72A 4B9OA 5HL1A 5HFOA 4II7A 1IOUA 1CI9A 1Y28A 1NLZA 1T1BA 1XGJA 2I72A 4JF5A 2JKTM 4I5SA 1IKIA 5GHYA 5GLBA 3LIBA 2UV0E 1KVMA 2V9AA 3SS4A 4MEZA 4QD4A 3DTEA 2QKPA 2ZJ9A 3A3JA 1PW8A 4WUJA 1NJ4A 4KZAA 4KZBA 1F2KA 3WWXA 4DF6A 5E2GA 4EESA 4M3KA 3SH7A 1G6AA 4FOFA 2K7SA 3PXPA 5IT5A 3ZG7B 2AVXA 1YAXA 3IF6A 2A24A 4WYYA 3HCYA 3VOLA 3T1QB 1OTIA 3ZG9B 3R4KA 3VE3A 2MJ6A 3ZFZA 3LIAA 1ES2A 3E0YA 2Y2JA 2QYBA 4Q0IA 1TDGA 1FOFA 2H28A 1S4RA 5CHMA 2PBDP 2JKRM 3BFEA 1LL9A 4EUZA 1PWGA 3VP1A 4GDNA 4GZBA 3RXXA 3TOIA 4Y2FA 4CLCA 3WS0A 2H0YA 4DJ2A 4E3IA 4BQMA 4GHIB 4ARZB 1K57A 4C6YA 5FI6A 5HPFA 3OCNA 1MWUA 3OZHA 1P9RA 1GCEA 4JGPA 3WRZA 3PBQA 4QB8A 1VETA 1KDWA 4UQIS 4DE0A 2JE5A 1WA9A 3IWQA 3ITAA 2HF6A 3M2KA 3LY4A 5AQ7A 2Y2IA 3MQOA 5L09A 4O8GA 3G4PA 1TF1A 3MZEA 2V0UA 5DKKA 3U4LP 4H6JB 5CXWA 4KQDA 1MWTA 3DTIA 3GTCA 4HBTA 1TS0A 4MMNA 4IUKA 5F1GA 1JWPA 1IYQA 4X1MA 1YT4A 4Y15A 5FASA 3RJUA 2HZ5A 2WGWA 1BZAA 2Z2MB 2XA7S 3MZDA 5G4YA 3H7WA 3TSGA 2HJ9C 2X02A 5FDSA 1CI8A 3NBLA 3CAXA 3QHYA 1LL5A 3KYZA 1MKMA 1PFLA 4WEKA 5J3WA 4QPRA 3KYEA 4UQIM 2ZMFA 2Y8HA 4WBGA 2IA2A 1PNEA 3UE6A 5J7EA 4KZ6A 1C3BA 1ES4A 3HLFA 2ZLYA 4GKUA 5KSHA 2P74A 1LHYA 2JC7A 4ZBEA 1PWDA 1TDLA 3CHWP 4EWFA 3ZHHA 4IJGA 4ZJ3A 5F6AA 3O3VA 3MMHA 4KG6A 1GSVA 3LI8A 4EETB 1ONHA 4A5RA 3G2YA 2Y2NA 5C5KA 2VGJA 5CEDA 1NXYA 5HW3A 3GVBA 1L0DA 2BLSA 5CX7A 2J3WA 2WZZA 2XA7M 3IF5A 3IBJA 5CEBA 4K0XA 2EWVA 5L2FA 4HY8A 5AVFA 2XDMA 3MXSA 2K2NA 1TS8A 2PU4A 4S2JA 1ALQA 2QZ6A 2Y2GA 5LBRA 2DCFA 1RP5A 3OBFA 5F69A 3QNCA 3IH8A 2VA0A 3IHAA 2ZC6B 4E04A 3HJIA 2V1ZA 4EBPA 4JBFA 4KQQA 3IX8A 4OLDA 2EX8A 2ZL1B 2J3TC 1W5DA 5CRFA 2LB9A 5HSQA 2JCHA 3K2NA 4N9LA 3PR6A 3UY6A 1SKOA 3SS5A 3D3OA 1OPXA 3UB8A 1F9IA 5CTNA 3UDFA 1AWIA 3VSKA 1OTEA 2VK3A 2KOIA 4L9GA 4MN5A 3LFVA 3MKEA 1K4FA 5KIZA 2OLVA 4LRYC 3AGDA 1IFQA 4NXEA 4D60A 2VEAA 4GOGA 3EGDC 3OPLA 4S2NC 4N92A 2HJEA 2Y79A 3KSHA 1YLTA 5HDSA 3T12B 5KMWA 4NG2A 4FH2A 2M7UA 3MJQA 1MZUA 4NXBA 4X53A 4IVIA 4EERA 4K91A 4P6BA 3MFDA 1SZVA 2YKFA 1PI4A 4EXOA 3IS2A 4F3LB 4BBUA 4PPRA 3UPOA 4EU0A 4XT2A 2Y2KA 4DXCA 3T4QA 3B33A 3HL9A 1W63Q 4DMZA 4DDYA 5FQ9A 5K5BA 3ZQ5A 3UN7A 1LLBA 3Q82A 3BWLA 3S22A 1Z09A 5EOOA 4GS9B 3VP3A 2P08A 2WKEA 3W2ZA 1VETB 2FZ0A 2L4RA 2KX6A 3IX3A 5JYOA 2HPBA 4KENB 1YLYA 3Q7VB 2OSUA 1NLYA 2ZM2A 2BTFP 4P87A 4C3QA 1OT6A 3BLMA 1FSWA 3UNWA 1ZTUA 4WF0A 5A92A 2XEPA 4G3KA 5EECA 4KG5A 1CEGA 4WMCD 3LIEA 3GMWA 3NY4A 4DJ3A 3D4FA 2WGWB 1N9LA 3S7NA 4ETXA 1VEUA 3VOZA 2XF3A 3LR3A 3H7WB 4ZDXA 2ZOHA 5A93A 4HIAA 1OMEA 3GV9A 1ODVA 1KVLA 4GLQA 5FA7A 4KZ9A 3OLOA 5F68A 3BY8A 3NECA 4BD1A 1MY8A 4O0PA 5TBMA 1F5MA 3Q1FA 4B88A 4I38A 5M19A 4WZ5C 2VJWA 2VZWA 4I3JA 5HPIA 4MBFA 3IXGA 2VKSA 1EW0A 1GA9A 2QHKA 1QMFA 3FV7A 1L0FA 2HDSA 5HD3A 3NIAA 3PBOA 4AFIA 4QWOA 4N1XA 1T1AA 1G5UA 1YMXA 4ZTKA 1PYYA 2WKPA 1XFQA 4LV0A 3BQAA 4DE3A 1EWZA 1K38A 3WS2A 1DJAA 1BT5A 3HLCA 4BWIA 1KE4A 2O0YA 1HZOA 1J3WA 3A0SA 1V9ZA 2DMWA 2VV6A 3L9KA 2EX2A 4IBXA 2V1BA 3GSGA 3CWFA 2WKQA 4OPQA 4FUWA 2WGVA 4E3LA 1ZG6A 1NZOA 1SDNA 1K4EA 4HEFA 5FQKA 3O86A 4U0XA 2H5SA 5DF7A 5GLDA 2WGIA 1Q2PA 2ZC3B 5U47A 1OTBA 3GECA 2LB5A 3KSIA 3OPRA 1T19A 3M6HA 2P9VA 2PDRA 3MF0A 3PYPA 1S66L 2HDRA 4R3BA 1SKOB 2IWCA 5FEFA 2WAFA 4RVAA 4IBRA 3QP8A 1Q2QA 5F82A 4Q0JA 4P6ZM 3WS4A 5DTSA 4FH4A 2XK1A 3OOVA 3H82A 3BFFA 4KZ7A 3LEQA 4S2NA 3E98A 4WELA 1OTDA 3C8CA 2ZQ9A 4WM9A 3TE8A 2PBYA 4B4ZA 2WKIA 2Q9NA 3A3IA 4EUVA 1ERQA 3HUMA 5G4ZA 1WE4A 3HLDA 5E43A 4RYEA 5D3OA 4X69A 3OC2A 3G2ZA 1FQGA 1STZA 2Y2OA 3F1OA 1H8ZA 1PRQA 4Y0UA 2IWDA 3ISGA 3E4QA 1NYMA 3VP0A 2Y2QA 4U3TA 4DDSA 3E4PA 5KSCA 2R9XA 4Y0OA 3D9YA 3IS2B 1TEMA 3BY9A 4K0WA 4NXFA 3AGEA 4UEYA 2D01A 1IELA 3FZCA 3C30A 2ZC7A 2PR5A 3A3DA 2V20A 1ACFA 5FATA 1YPRA 1LL8A 1FR6A 3DTMA 3V39A 2JKGA 4UAAA 2KLIA 1YQSA 3WS1A 3CUEC 3BFCA 3LI9A 3S1YA 2Y4AA 3UPNA 5J4EA 1NWZA 2H0TA 2RL3A 3F1PA 4QHCA 4HJ6A 3SW1A 4E3MA 1ES5A 2WUQA 1S67L 3T4TA 3AGFA 3BFDA 3LO7A 4HP4A 1P0ZA 2WK0A 3MSHA 3NOTC 5L10A 3P09A 3LYXA 4X56A 3IH9A 4Y7PA 4KQRA 5FL3A 2QMIA 2X01A 2VX8A 4B4XA 4OQHA 4EQ1A 3LICA 1TS6A 5CERA 1T18A 5FQJA 3C4OA 3B3XA 4JLFA 3V3SA 5EPHA 2W1TB 3HUNA 3TRCA 1ES3A 3HLWA 2BG1A 2HV1A 2NUPC 1G68A 1WYCA 4LFUA 5EVIB 3UDXA 5KZHA 1MC0A 2QJ7A 3FYZA 1J9MA 1S6RA 2O9BA 5FI2A 4WZ5A 1BLPA 1FSYA 1CQAA 3TW8A 2EX6A 2JN7A 1MKIA 2W3HA 4D2OA 5DF8A 3UE0A 1LSVA 3UO9A 5AQ9A 2OOLA 1K54C 3UB9A 3CMZA 2QPNA 4OQ0A 3ITBA 3IQAA 1S1YA 3NOPC 4E3JA 4P0MA 3RFBA 4IHQA 3QP5A 4JXSA 3R7WB 2PT7A 4Z9QA 1GHMA 2EA9A 5E2FA 5CTMA 4BMWA 3SH9A 4MDZA 5E2HA 4UA7A 4Y0TA 1UGUA 1YM1A 4ETZA 4BD0A 3OPHA 1FR1A 5L07A 4OKPA 4PM9A 1M40A 3A0RA 1NZUA 3HBRA 2FFFB 4PKYA 4OPRA 2C6WB 4QU3A 1E4DA 4DE2A 5IHVA 1D1JA 3G32A 3KO6A 2P04A 3A0VA 3LY3A 1MWSA 3MXRA 4R6LA 4LENA 3T50A 3LIFA 2XQZA 2OAQ1 4L9FA 3V3RA 3CI6A 4R23A 3N7WA 4BBTA 3G35A 1E3UD
chains in the Genus database with same CATH topology
3ZG0A 1JVJA 2Q9MA 3VOYA 4E3OA 4GNUA 5JYOA 2HPBA 2Y55A 2ZC5B 1MPLA 5M18A 4KENB 1YLYA 1XA1A 3Q7VB 2OSUA 2ZQ7A 3VP4A 3E2LA 4HESA 3S4XA 2ZM2A 1H5XA 5GL9A 2EFXA 4P87A 4C3QA 3WS5A 1KGGA 1TVFA 3BLMA 1FSWA 3UNWA 3ZVWA 1YLPA 2ZQ8A 5EOEA 5FAPA 1K55A 1BTLA 2XFTA 3BRMA 4FSFA 3Q7VA 2XD5A 5A92A 3PBNA 5I94A 3Q7ZA 2XEPA 3C4PA 3HVFA 1KDSA 3IXBA 5EECA 4S2IA 1JTGA 1IYOA 3LCEA 1IYPA 4KG5A 1O7EA 1FCNA 1CEGA 1W8QA 3MZFA 4NK3A 4O7DA 3UE1A 4WMCD 5CGXA 3ZNTA 4S2LA 3GMWA 1RGYA 3NY4A 3N4IA 3D4FA 2WGWB 5EVID 2J9OA 1JWZA 4UHUA 4H8RA 5A91A 3VOZA 2XF3A 1HVBA 1W8YA 5HL1A 5HFOA 5TR7A 1KE0A 4OPZA 4ZDXA 2EX9A 1CI9A 5A93A 4ZJ2A 5FDHA 4CPKA 1LI9A 1OMEA 3GV9A 1MWRA 4MLLA 2IWBA 1XGJA 2I72A 4JF5A 1KVLA 2HDQA 2ZMAA 4GB7A 4BLMA 4S2PA 4WZ4A 4UA6A 5HAQA 3A3FA 5FA7A 5FSRA 1IKIA 3VFHA 4KZ9A 5GHYA 1GHIA 5GLBA 1HTZA 3CZDA 5E2EA 1KVMA 3EQVA 3SS4A 4MEZA 4ZJ1A 5GHXA 4BD1A 1MY8A 2ZM0A 3Q1FA 4B88A 4QD4A 3M6BA 1W79A 5M19A 2ZJ9A 5EE8A 1BLSA 3A3JA 4RX2A 1PW8A 4WZ5C 5EVIC 4MBFA 1NJ4A 4KZAA 4KZBA 3MBZA 3WWXA 3IF6B 3IXGA 3QNBA 4JXVA 5E2GA 4DF6A 4FCFA 4M3KA 3SH7A 1GA9A 1PI5A 1QMFA 4RA7A 4E3NA 1U60A 3FV7A 1L0FA 1NRFA 2HDSA 1G6AA 3BFGA 3NIAA 3V50A 3PBOA 5DTKA 3G31A 5GLCA 1KGEA 5HAPA 3W4OA 3ZG7B 3IF6A 4WYYA 4N1XA 1YMXA 4ZTKA 2G2WA 3ZG9B 1PYYA 4R4SA 1K56D 5HAIA 3ZFZA 2Y59A 4LV0A 3NDEA 4DE3A 5J8XA 1ES2A 1EWZA 4PM6A 2Y2JA 1SHVA 1MXOA 1HD8A 5JYPA 1K38A 1GA0A 1K6RA 4OPYA 3WS2A 1TDGA 1FOFA 2Y2PA 5DF9A 1DJAA 2A49A 5CHMA 1I2SA 1K25A 3HREA 4R1GA 2B5RA 2ZM8A 1BT5A 3BFEA 3DW0A 3HLCA 3UPPA 1LL9A 1KE4A 2XH9A 3EQUA 1HZOA 4EUZA 1PWGA 3VP1A 4ID4A 3G30A 4GDNA 4GZBA 3RXXA 3MKFA 3TOIA 5CHJA 3WS0A 2C5WB 2H0YA 4LV3A 3ZDJA 4GD8A 4E3IA 2EXAA 1O07A 3WRTA 2EX2A 4BQMA 4XUXA 4IBXA 2HDUA 4P85A 4EBNA 2Y2LA 3PBRA 2J7VA 2ZD8A 3GSGA 1XPBA 3O88A 1K57A 3E2KA 5FI6A 4C6YA 1KGFA 3OCNA 1MWUA 4OPQA 2WGVA 3OZHA 4E3LA 1GCEA 1ZG6A 1NZOA 1N9BA 1ZG4A 1SDNA 1BLCA 1K4EA 2ZQCA 4HEFA 3WRZA 1XXMA 3PBQA 4QB8A 1Y54A 4EQIA 1KDWA 3O86A 5FQKA 4DE0A 4N1HA 2JE5A 1WYBA 4U0XA 3C7UA 3O87A 2H5SA 5DF7A 3IWQA 2WGIA 1Q2PA 2ZC3B 3ITAA 3JYIA 4HBUA 4XUZA 5GLDA 2P9VB 3M2KA 2R9WA 5CGSA 5U47A 3P98A 5GLAA 3LY4A 1IYSA 4KZ5A 4E6WA 3VFFA 2ZQAA 1JWVA 5AQ7A 5TFQA 2Y2IA 3I7JA 3OPRA 3DWZA 4BENA 1YLZA 3GQZA 2H10A 2OLUA 3ZG8B 1L0EA 2XLNA 1KE3A 3M6HA 2P9VA 1RGZA 3G4PA 5GHZA 3MZEA 4UA9A 3IXDA 4GD6A 2HDRA 4R3BA 1MWTA 5CXWA 2IWCA 3GTCA 4HBTA 2WAFA 3ZVTA 1ESUA 1RCJA 4RVAA 4YINA 4IBRA 4KQOA 2Y91A 5F1GA 1Q2QA 1FCMA 1XP4A 1JWPA 5F82A 3C5AA 1IYQA 1K6SA 3BLSA 1XGIA 1YT4A 1K55C 3CG5A 4FH4A 5DTSA 2XK1A 5EUAA 5F83A 3WS4A 5FAOA 5FASA 3RJUA 3VMAA 2WGWA 1BZAA 3NCKA 1K54A 3NC8A 4QY6A 3BFFA 4KZ7A 3W4PA 2A3UA 4S2NA 1H8YA 2WZXA 2Z2MB 3MZDA 4WELA 5CHUA 3FWLA 1SDEA 4DKIA 3Q81A 1EI5A 5A90A 4JF4A 4KG2A 3TSGA 2ZQ9A 3LEZA 4WM9A 2X02A 1CI8A 4OVDA 5FI7A 4PMAA 3NBLA 5F1FA 1BLHA 2WADA 3QHYA 1LL5A 2PBYA 4S2OA 1MBLA 4B4ZA 2WKIA 2Q9NA 3A3IA 1FCOA 1ERQA 1DJCA 3HUMA 4S2KA 4WEKA 1WE4A 3BECA 3HLDA 5G18A 4C75A 1ZC2A 1CK3A 1EROA 1GHPA 1YMSA 3GRJA 3IWOA 4RYEA 5E43A 5D3OA 5CECA 1DY6A 2HP6A 1I5QA 3IT9A 3OC2A 3G2ZA 1FQGA 4X69A 4WBGA 2Y2OA 4E6XA 1H8ZA 4Y0UA 2IWDA 4OOYA 4JPMA 4KZ6A 1C3BA 1ES4A 3ISGA 3Q07A 4S2MA 1PIOA 3HLGA 4BJPA 4KZ8A 4BL3A 3HLFA 1NY0A 1NYMA 3VP0A 2ZLYA 4GKUA 1PZPA 1ESIA 2Y2QA 4X68A 3W8KA 2EFUA 4U3TA 4DDSA 5KSHA 2X71A 2P74A 5KSCA 1LHYA 2R9XA 2JC7A 4Y0OA 4ZBEA 1PWDA 1TDLA 1TEMA 3G34A 4K0WA 3FKVA 3AGEA 4EWFA 1DJBA 2XGNA 3ZHHA 1IELA 4ZJ3A 3BEBA 3O3VA 3FZCA 4OONA 4KG6A 4OQIA 1SKFA 4KZ3A 4LV1A 4MBKA 2J9PA 4MBHA 4JXGA 1ONHA 4LV2A 2XR0A 4A5RA 2ZC7A 3G2YA 3A3DA 2V20A 1M6KA 1L2SA 2Y2NA 5FATA 3IF6C 2VGJA 5CEDA 1NXYA 5HW3A 3GVBA 1L0DA 5FQIA 1K56A 2BLSA 4JF6A 4QY5A 1FR6A 3DTMA 2WZZA 2VGKA 2Z2LB 3IF5A 3IXHA 3V39A 5CEBA 2EXBA 3VSLA 3NDGA 4K0XA 5DVAA 5L2FA 4OP8A 3ZNYA 4UAAA 1YQSA 3WS1A 3HLEA 4PM7A 4BL2A 2XDMA 3BFCA 4NETA 3MXSA 3S1YA 2Y4AA 3UPNA 1XA7A 1L0GA 2PU4A 2H0TA 4CJNA 3BM6A 2RL3A 2WKHA 4S2JA 4QJGA 3PAEA 4QHCA 5HX9A 1AXBA 4E3MA 1IEMA 4GN2A 1ALQA 1ES5A 2QZ6A 4IVKA 2FFYA 2WUQA 2XD1A 5M1AA 2V2FF 3AGFA 3PAGA 2Y2GA 3BFDA 3LO7A 3SS3A 4X6TA 2DCFA 2WK0A 5DTTA 1RP5A 3N8LA 3QNCA 3P09A 1YLJA 4X56A 4LCLA 5AQBA 2OV5A 3IH9A 4Y7PA 4KQRA 4PM5A 1S0WA 3IH8A 1XKZA 3IHAA 5BOHA 2ZC6B 1YLWA 1E3UA 4RX3A 1PWCA 1K57C 2QMIA 2V1ZA 1N4OA 2Y2HA 2X01A 3UE3A 4EBPA 3GR2A 4B4XA 4JBFA 4KQQA 4OQHA 3SH8A 5CERA 4OOMA 5FQJA 4DRTA 1SCWA 4OLDA 2EX8A 3C4OA 3CJMA 3B3XA 4JLFA 4MNRA 1W5DA 4U0TA 1JTDA 3V3SA 5EPHA 3PTEA 5CRFA 4PM8A 2E8IA 2JCHA 1BSGA 3HUNA 4N9LA 1BUEA 1ES3A 1XX2A 3PBSA 3UY6A 3HLWA 2BG1A 3SS5A 1PW1A 4L0LA 4DE1A 1G68A 1WYCA 2JBFA 3ZG5A 5TGFA 5EVIB 2ZQDA 5CTNA 3UDXA 3UDFA 5KZHA 4R3JA 1CEFA 3PBTA 3VSKA 3RXWA 4WMCA 4ZAMA 3FYZA 1J9MA 1S6RA 1I2WA 5FI2A 4WZ5A 1BLPA 5CGWA 1FSYA 1LI0A 1E25A 3N8RA 5EVIA 3VP2A 4EV4A 3FKWA 2EX6A 4N9KA 1MKIA 3MKEA 1K4FA 4D2OA 3NI9A 5DF8A 3UE0A 2OLVA 4EBLA 2DNSA 1NYYA 3AGDA 3UO9A 5AQ9A 4WEJA 4OH0A 3A3EA 1K54C 1QMEA 4GOGA 3CMZA 2QPNA 2HP5A 3OPLA 4R0QA 4FD8A 4JXWA 4N92A 4OQ0A 4S2NC 2RCXA 1YLTA 3ITBA 3IQAA 4X55A 3IHBA 2DRWA 5KMWA 5FQMA 4E3JA 2XFSA 4R4RA 4P0MA 4FH2A 1BULA 3ZCZA 2PU2A 4JXSA 4OP5A 4JKTA 1ERMA 4X53A 2WAEA 4E3KA 4IVIA 3N8SA 4Z9QA 1W7FA 4IEDA 1GHMA 5E2FA 4K91A 4P6BA 3MFDA 5CTMA 5HARA 2ZC4B 3SH9A 5E2HA 3DWKA 5FAQA 4UA7A 4Y0TA 4OOLA 1PI4A 1YM1A 2GDNA 4F94A 3OCLA 4BD0A 3OPHA 1FR1A 4OKPA 4PM9A 3UDIA 1Z6FA 2WYXA 1M40A 4PPRA 3ZGAB 3UPOA 3V5MA 1NZUA 2UWXA 2J8YA 3HBRA 2FFFB 4Q8IA 4YFMA 4OPRA 2Y2KA 1ONGA 4DXBA 2C6WB 4DXCA 3HL9A 4QU3A 3OPPA 3BYDA 1E4DA 4KZ4A 3C7VA 4DE2A 5IHVA 1PZOA 5AQAA 3G32A 4LCMA 4DDYA 1VQQA 2G2UA 2CC1A 5EVLA 3LY3A 5FQ9A 3N6IA 1MWSA 3UN7A 3HUOA 1LLBA 3M2JA 3Q82A 1ZKJA 2Y2MA 3TG9A 3W4QA 3S22A 1VM1A 3MXRA 3HLBA 5EOOA 5FQQA 4LENA 4GDBA 3VP3A 3SOIA 2XQZA 3IWIA 3V3RA 2WKEA 4R23A 3N7WA 4OQGA 2HP9A 4OLGA 1IKGA 4XXRA 3G35A 1E3UD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZG0 A;  1JVJ A;  2Q9M A;  3VOY A;  4E3O A;  4GNU A;  5JYO A;  2HPB A;  2Y55 A;  2ZC5 B;  1MPL A;  5M18 A;  4KEN B;  1YLY A;  1XA1 A;  3Q7V B;  2OSU A;  2ZQ7 A;  3VP4 A;  3E2L A;  4HES A;  3S4X A;  2ZM2 A;  1H5X A;  5GL9 A;  2EFX A;  4P87 A;  4C3Q A;  3WS5 A;  1KGG A;  1TVF A;  3BLM A;  1FSW A;  3UNW A;  3ZVW A;  1YLP A;  2ZQ8 A;  5EOE A;  5FAP A;  1K55 A;  1BTL A;  2XFT A;  3BRM A;  4FSF A;  3Q7V A;  2XD5 A;  5A92 A;  3PBN A;  5I94 A;  3Q7Z A;  2XEP A;  3C4P A;  3HVF A;  1KDS A;  3IXB A;  5EEC A;  4S2I A;  1JTG A;  1IYO A;  3LCE A;  1IYP A;  4KG5 A;  1O7E A;  1FCN A;  1CEG A;  1W8Q A;  3MZF A;  4NK3 A;  4O7D A;  3UE1 A;  4WMC D;  5CGX A;  3ZNT A;  4S2L A;  3GMW A;  1RGY A;  3NY4 A;  3N4I A;  3D4F A;  2WGW B;  5EVI D;  2J9O A;  1JWZ A;  4UHU A;  4H8R A;  5A91 A;  3VOZ A;  2XF3 A;  1HVB A;  1W8Y A;  5HL1 A;  5HFO A;  5TR7 A;  1KE0 A;  4OPZ A;  4ZDX A;  2EX9 A;  1CI9 A;  5A93 A;  4ZJ2 A;  5FDH A;  4CPK A;  1LI9 A;  1OME A;  3GV9 A;  1MWR A;  4MLL A;  2IWB A;  1XGJ A;  2I72 A;  4JF5 A;  1KVL A;  2HDQ A;  2ZMA A;  4GB7 A;  4BLM A;  4S2P A;  4WZ4 A;  4UA6 A;  5HAQ A;  3A3F A;  5FA7 A;  5FSR A;  1IKI A;  3VFH A;  4KZ9 A;  5GHY A;  1GHI A;  5GLB A;  1HTZ A;  3CZD A;  5E2E A;  1KVM A;  3EQV A;  3SS4 A;  4MEZ A;  4ZJ1 A;  5GHX A;  4BD1 A;  1MY8 A;  2ZM0 A;  3Q1F A;  4B88 A;  4QD4 A;  3M6B A;  1W79 A;  5M19 A;  2ZJ9 A;  5EE8 A;  1BLS A;  3A3J A;  4RX2 A;  1PW8 A;  4WZ5 C;  5EVI C;  4MBF A;  1NJ4 A;  4KZA A;  4KZB A;  3MBZ A;  3WWX A;  3IF6 B;  3IXG A;  3QNB A;  4JXV A;  5E2G A;  4DF6 A;  4FCF A;  4M3K A;  3SH7 A;  1GA9 A;  1PI5 A;  1QMF A;  4RA7 A;  4E3N A;  1U60 A;  3FV7 A;  1L0F A;  1NRF A;  2HDS A;  1G6A A;  3BFG A;  3NIA A;  3V50 A;  3PBO A;  5DTK A;  3G31 A;  5GLC A;  1KGE A;  5HAP A;  3W4O A;  3ZG7 B;  3IF6 A;  4WYY A;  4N1X A;  1YMX A;  4ZTK A;  2G2W A;  3ZG9 B;  1PYY A;  4R4S A;  1K56 D;  5HAI A;  3ZFZ A;  2Y59 A;  4LV0 A;  3NDE A;  4DE3 A;  5J8X A;  1ES2 A;  1EWZ A;  4PM6 A;  2Y2J A;  1SHV A;  1MXO A;  1HD8 A;  5JYP A;  1K38 A;  1GA0 A;  1K6R A;  4OPY A;  3WS2 A;  1TDG A;  1FOF A;  2Y2P A;  5DF9 A;  1DJA A;  2A49 A;  5CHM A;  1I2S A;  1K25 A;  3HRE A;  4R1G A;  2B5R A;  2ZM8 A;  1BT5 A;  3BFE A;  3DW0 A;  3HLC A;  3UPP A;  1LL9 A;  1KE4 A;  2XH9 A;  3EQU A;  1HZO A;  4EUZ A;  1PWG A;  3VP1 A;  4ID4 A;  3G30 A;  4GDN A;  4GZB A;  3RXX A;  3MKF A;  3TOI A;  5CHJ A;  3WS0 A;  2C5W B;  2H0Y A;  4LV3 A;  3ZDJ A;  4GD8 A;  4E3I A;  2EXA A;  1O07 A;  3WRT A;  2EX2 A;  4BQM A;  4XUX A;  4IBX A;  2HDU A;  4P85 A;  4EBN A;  2Y2L A;  3PBR A;  2J7V A;  2ZD8 A;  3GSG A;  1XPB A;  3O88 A;  1K57 A;  3E2K A;  5FI6 A;  4C6Y A;  1KGF A;  3OCN A;  1MWU A;  4OPQ A;  2WGV A;  3OZH A;  4E3L A;  1GCE A;  1ZG6 A;  1NZO A;  1N9B A;  1ZG4 A;  1SDN A;  1BLC A;  1K4E A;  2ZQC A;  4HEF A;  3WRZ A;  1XXM A;  3PBQ A;  4QB8 A;  1Y54 A;  4EQI A;  1KDW A;  3O86 A;  5FQK A;  4DE0 A;  4N1H A;  2JE5 A;  1WYB A;  4U0X A;  3C7U A;  3O87 A;  2H5S A;  5DF7 A;  3IWQ A;  2WGI A;  1Q2P A;  2ZC3 B;  3ITA A;  3JYI A;  4HBU A;  4XUZ A;  5GLD A;  2P9V B;  3M2K A;  2R9W A;  5CGS A;  5U47 A;  3P98 A;  5GLA A;  3LY4 A;  1IYS A;  4KZ5 A;  4E6W A;  3VFF A;  2ZQA A;  1JWV A;  5AQ7 A;  5TFQ A;  2Y2I A;  3I7J A;  3OPR A;  3DWZ A;  4BEN A;  1YLZ A;  3GQZ A;  2H10 A;  2OLU A;  3ZG8 B;  1L0E A;  2XLN A;  1KE3 A;  3M6H A;  2P9V A;  1RGZ A;  3G4P A;  5GHZ A;  3MZE A;  4UA9 A;  3IXD A;  4GD6 A;  2HDR A;  4R3B A;  1MWT A;  5CXW A;  2IWC A;  3GTC A;  4HBT A;  2WAF A;  3ZVT A;  1ESU A;  1RCJ A;  4RVA A;  4YIN A;  4IBR A;  4KQO A;  2Y91 A;  5F1G A;  1Q2Q A;  1FCM A;  1XP4 A;  1JWP A;  5F82 A;  3C5A A;  1IYQ A;  1K6S A;  3BLS A;  1XGI A;  1YT4 A;  1K55 C;  3CG5 A;  4FH4 A;  5DTS A;  2XK1 A;  5EUA A;  5F83 A;  3WS4 A;  5FAO A;  5FAS A;  3RJU A;  3VMA A;  2WGW A;  1BZA A;  3NCK A;  1K54 A;  3NC8 A;  4QY6 A;  3BFF A;  4KZ7 A;  3W4P A;  2A3U A;  4S2N A;  1H8Y A;  2WZX A;  2Z2M B;  3MZD A;  4WEL A;  5CHU A;  3FWL A;  1SDE A;  4DKI A;  3Q81 A;  1EI5 A;  5A90 A;  4JF4 A;  4KG2 A;  3TSG A;  2ZQ9 A;  3LEZ A;  4WM9 A;  2X02 A;  1CI8 A;  4OVD A;  5FI7 A;  4PMA A;  3NBL A;  5F1F A;  1BLH A;  2WAD A;  3QHY A;  1LL5 A;  2PBY A;  4S2O A;  1MBL A;  4B4Z A;  2WKI A;  2Q9N A;  3A3I A;  1FCO A;  1ERQ A;  1DJC A;  3HUM A;  4S2K A;  4WEK A;  1WE4 A;  3BEC A;  3HLD A;  5G18 A;  4C75 A;  1ZC2 A;  1CK3 A;  1ERO A;  1GHP A;  1YMS A;  3GRJ A;  3IWO A;  4RYE A;  5E43 A;  5D3O A;  5CEC A;  1DY6 A;  2HP6 A;  1I5Q A;  3IT9 A;  3OC2 A;  3G2Z A;  1FQG A;  4X69 A;  4WBG A;  2Y2O A;  4E6X A;  1H8Z A;  4Y0U A;  2IWD A;  4OOY A;  4JPM A;  4KZ6 A;  1C3B A;  1ES4 A;  3ISG A;  3Q07 A;  4S2M A;  1PIO A;  3HLG A;  4BJP A;  4KZ8 A;  4BL3 A;  3HLF A;  1NY0 A;  1NYM A;  3VP0 A;  2ZLY A;  4GKU A;  1PZP A;  1ESI A;  2Y2Q A;  4X68 A;  3W8K A;  2EFU A;  4U3T A;  4DDS A;  5KSH A;  2X71 A;  2P74 A;  5KSC A;  1LHY A;  2R9X A;  2JC7 A;  4Y0O A;  4ZBE A;  1PWD A;  1TDL A;  1TEM A;  3G34 A;  4K0W A;  3FKV A;  3AGE A;  4EWF A;  1DJB A;  2XGN A;  3ZHH A;  1IEL A;  4ZJ3 A;  3BEB A;  3O3V A;  3FZC A;  4OON A;  4KG6 A;  4OQI A;  1SKF A;  4KZ3 A;  4LV1 A;  4MBK A;  2J9P A;  4MBH A;  4JXG A;  1ONH A;  4LV2 A;  2XR0 A;  4A5R A;  2ZC7 A;  3G2Y A;  3A3D A;  2V20 A;  1M6K A;  1L2S A;  2Y2N A;  5FAT A;  3IF6 C;  2VGJ A;  5CED A;  1NXY A;  5HW3 A;  3GVB A;  1L0D A;  5FQI A;  1K56 A;  2BLS A;  4JF6 A;  4QY5 A;  1FR6 A;  3DTM A;  2WZZ A;  2VGK A;  2Z2L B;  3IF5 A;  3IXH A;  3V39 A;  5CEB A;  2EXB A;  3VSL A;  3NDG A;  4K0X A;  5DVA A;  5L2F A;  4OP8 A;  3ZNY A;  4UAA A;  1YQS A;  3WS1 A;  3HLE A;  4PM7 A;  4BL2 A;  2XDM A;  3BFC A;  4NET A;  3MXS A;  3S1Y A;  2Y4A A;  3UPN A;  1XA7 A;  1L0G A;  2PU4 A;  2H0T A;  4CJN A;  3BM6 A;  2RL3 A;  2WKH A;  4S2J A;  4QJG A;  3PAE A;  4QHC A;  5HX9 A;  1AXB A;  4E3M A;  1IEM A;  4GN2 A;  1ALQ A;  1ES5 A;  2QZ6 A;  4IVK A;  2FFY A;  2WUQ A;  2XD1 A;  5M1A A;  2V2F F;  3AGF A;  3PAG A;  2Y2G A;  3BFD A;  3LO7 A;  3SS3 A;  4X6T A;  2DCF A;  2WK0 A;  5DTT A;  1RP5 A;  3N8L A;  3QNC A;  3P09 A;  1YLJ A;  4X56 A;  4LCL A;  5AQB A;  2OV5 A;  3IH9 A;  4Y7P A;  4KQR A;  4PM5 A;  1S0W A;  3IH8 A;  1XKZ A;  3IHA A;  5BOH A;  2ZC6 B;  1YLW A;  1E3U A;  4RX3 A;  1PWC A;  1K57 C;  2QMI A;  2V1Z A;  1N4O A;  2Y2H A;  2X01 A;  3UE3 A;  4EBP A;  3GR2 A;  4B4X A;  4JBF A;  4KQQ A;  4OQH A;  3SH8 A;  5CER A;  4OOM A;  5FQJ A;  4DRT A;  1SCW A;  4OLD A;  2EX8 A;  3C4O A;  3CJM A;  3B3X A;  4JLF A;  4MNR A;  1W5D A;  4U0T A;  1JTD A;  3V3S A;  5EPH A;  3PTE A;  5CRF A;  4PM8 A;  2E8I A;  2JCH A;  1BSG A;  3HUN A;  4N9L A;  1BUE A;  1ES3 A;  1XX2 A;  3PBS A;  3UY6 A;  3HLW A;  2BG1 A;  3SS5 A;  1PW1 A;  4L0L A;  4DE1 A;  1G68 A;  1WYC A;  2JBF A;  3ZG5 A;  5TGF A;  5EVI B;  2ZQD A;  5CTN A;  3UDX A;  3UDF A;  5KZH A;  4R3J A;  1CEF A;  3PBT A;  3VSK A;  3RXW A;  4WMC A;  4ZAM A;  3FYZ A;  1J9M A;  1S6R A;  1I2W A;  5FI2 A;  4WZ5 A;  1BLP A;  5CGW A;  1FSY A;  1LI0 A;  1E25 A;  3N8R A;  5EVI A;  3VP2 A;  4EV4 A;  3FKW A;  2EX6 A;  4N9K A;  1MKI A;  3MKE A;  1K4F A;  4D2O A;  3NI9 A;  5DF8 A;  3UE0 A;  2OLV A;  4EBL A;  2DNS A;  1NYY A;  3AGD A;  3UO9 A;  5AQ9 A;  4WEJ A;  4OH0 A;  3A3E A;  1K54 C;  1QME A;  4GOG A;  3CMZ A;  2QPN A;  2HP5 A;  3OPL A;  4R0Q A;  4FD8 A;  4JXW A;  4N92 A;  4OQ0 A;  4S2N C;  2RCX A;  1YLT A;  3ITB A;  3IQA A;  4X55 A;  3IHB A;  2DRW A;  5KMW A;  5FQM A;  4E3J A;  2XFS A;  4R4R A;  4P0M A;  4FH2 A;  1BUL A;  3ZCZ A;  2PU2 A;  4JXS A;  4OP5 A;  4JKT A;  1ERM A;  4X53 A;  2WAE A;  4E3K A;  4IVI A;  3N8S A;  4Z9Q A;  1W7F A;  4IED A;  1GHM A;  5E2F A;  4K91 A;  4P6B A;  3MFD A;  5CTM A;  5HAR A;  2ZC4 B;  3SH9 A;  5E2H A;  3DWK A;  5FAQ A;  4UA7 A;  4Y0T A;  4OOL A;  1PI4 A;  1YM1 A;  2GDN A;  4F94 A;  3OCL A;  4BD0 A;  3OPH A;  1FR1 A;  4OKP A;  4PM9 A;  3UDI A;  1Z6F A;  2WYX A;  1M40 A;  4PPR A;  3ZGA B;  3UPO A;  3V5M A;  1NZU A;  2UWX A;  2J8Y A;  3HBR A;  2FFF B;  4Q8I A;  4YFM A;  4OPR A;  2Y2K A;  1ONG A;  4DXB A;  2C6W B;  4DXC A;  3HL9 A;  4QU3 A;  3OPP A;  3BYD A;  1E4D A;  4KZ4 A;  3C7V A;  4DE2 A;  5IHV A;  1PZO A;  5AQA A;  3G32 A;  4LCM A;  4DDY A;  1VQQ A;  2G2U A;  2CC1 A;  5EVL A;  3LY3 A;  5FQ9 A;  3N6I A;  1MWS A;  3UN7 A;  3HUO A;  1LLB A;  3M2J A;  3Q82 A;  1ZKJ A;  2Y2M A;  3TG9 A;  3W4Q A;  3S22 A;  1VM1 A;  3MXR A;  3HLB A;  5EOO A;  5FQQ A;  4LEN A;  4GDB A;  3VP3 A;  3SOI A;  2XQZ A;  3IWI A;  3V3R A;  2WKE A;  4R23 A;  3N7W A;  4OQG A;  2HP9 A;  4OLG A;  1IKG A;  4XXR A;  3G35 A;  1E3U D; 
#chains in the Genus database with same CATH topology
 1JVJ A;  2Q9M A;  3VOY A;  4NKP A;  4E3O A;  2ZC5 B;  1XA1 A;  1LSW A;  1UWN X;  5GL9 A;  1TVF A;  3QP6 A;  5EOE A;  2XFT A;  5I94 A;  3Q7Z A;  3C4P A;  3HVF A;  1KDS A;  1XJ6 A;  1IYO A;  3LCE A;  1W8Q A;  4NK3 A;  4O7D A;  2GJ3 A;  4MN7 A;  4KUO A;  3EWK A;  2INW A;  4ME4 A;  1FIK A;  5EVI D;  2J9O A;  3H82 B;  2PRF A;  4H8R A;  5A91 A;  3G6O A;  1W8Y A;  3K3C A;  3QP1 A;  3ZYT A;  5L8M A;  2EX9 A;  4ZJ2 A;  5FDH A;  1MWR A;  4MLL A;  2HDQ A;  4S2P A;  4WZ4 A;  5HAQ A;  1OTA A;  5FSR A;  1GHI A;  3CZD A;  5E2E A;  5GHX A;  2ZM0 A;  2W27 A;  4R38 A;  3M6B A;  1W79 A;  4I3A A;  5DJU A;  5EE8 A;  3F1O B;  2XSS A;  4Q0H A;  2ACG A;  3T1S A;  3IF6 B;  3QNB A;  2A24 B;  4FCF A;  4RA7 A;  1U60 A;  4R3A A;  1NRF A;  2JHE A;  5DTK A;  3G31 A;  1KGE A;  5EFW A;  2JKF A;  5HWT A;  4K08 A;  4R4S A;  1K56 D;  3CLO A;  2Y59 A;  4YWZ A;  3P7N A;  1OJ5 A;  2PAV P;  1MXO A;  3CUE A;  1DP6 A;  4OPY A;  2Y2P A;  2A49 A;  4CLC B;  1I2S A;  3HRE A;  4R1G A;  3JVU A;  2B5R A;  3DW0 A;  3MXQ A;  3T4S A;  4YNR A;  5CHJ A;  2C5W B;  4LV3 A;  3ZDJ A;  2EXA A;  1O07 A;  3F1P B;  2HDU A;  2ZD8 A;  1XPB A;  3E2K A;  1KGF A;  4LRX C;  1K0K A;  1N9B A;  1ZG4 A;  4HJ4 A;  1JNU A;  4EQI A;  1UWP X;  4N1H A;  1WYB A;  4HBU A;  4XUZ A;  2R9W A;  5CGS A;  3NJA A;  3P98 A;  5GLA A;  1IYS A;  1JWV A;  3UB6 A;  3I7J A;  3GQZ A;  2H10 A;  2OWH A;  3ZG8 B;  1L0E A;  1KE3 A;  3IXD A;  5HDD A;  4GD6 A;  2KDK A;  3ZVT A;  1ESU A;  1GSX A;  1LT0 A;  2PD7 A;  2R78 A;  1XP4 A;  1D7E A;  3C5A A;  1K6S A;  3BLS A;  1XGI A;  4H6J A;  3CG5 A;  3VMA A;  1K54 A;  3LID A;  3NC8 A;  1DP8 A;  3W4P A;  2A3U A;  1YSQ A;  2WZX A;  5CHU A;  3K3D A;  1SDE A;  4DKI A;  5A90 A;  1H8M A;  3KYQ A;  4JF4 A;  5F1F A;  1A0K A;  1BLH A;  1FIL A;  1DJC A;  4S2K A;  3BEC A;  4C75 A;  3GRJ A;  3V67 A;  1DY6 A;  2HP6 A;  1I5Q A;  4E6X A;  4GJ4 A;  3MQ0 A;  4OOY A;  3T4O A;  4BJP A;  4BL3 A;  1ESI A;  4RQ9 A;  4X68 A;  2EFU A;  2X71 A;  2GX5 A;  1DJB A;  2XGN A;  3BEB A;  4P6Z S;  1SKF A;  4KZ3 A;  5HD5 A;  2J9P A;  4MBH A;  4CLC D;  4LV2 A;  2ZMV A;  2OAP 1;  4L9E A;  3UB7 A;  5FQI A;  1K56 A;  2VGK A;  2Z2L B;  3IXH A;  3VSL A;  4OP8 A;  3ZNY A;  4FTX A;  2V8F A;  4NET A;  1ZHH B;  4CJN A;  3PAE A;  3UB5 P;  2B18 A;  1IEM A;  4NXG A;  5M1A A;  3ULF A;  2FFY A;  2XD1 A;  5EM0 A;  2V2F F;  3SS3 A;  1G6O A;  4LGW A;  2XRO A;  3N8L A;  2OWJ A;  3U2A A;  4PM5 A;  4LPZ A;  1YLW A;  4X1L A;  1PWC A;  2JKT I;  3JVV A;  3UE3 A;  3C2W A;  3GR2 A;  2VGL S;  3DAV A;  3SH8 A;  3FPW A;  3MS6 A;  4OOM A;  4DRT A;  2QJ5 A;  3CJM A;  4MNR A;  3MQQ A;  1T1C A;  3NUL A;  4PM8 A;  1BSG A;  3CPT A;  1XX2 A;  2D02 A;  3PBS A;  4LLO B;  3FG8 A;  4MN6 A;  2PYP A;  1PW1 A;  2W0N A;  3IBR A;  4L0L A;  4DE1 A;  2ZL1 A;  1YKD A;  5TGF A;  2W3D A;  2ZQD A;  4WLA A;  4R3J A;  1CJF A;  2QWS A;  3UME A;  2K31 A;  4WMC A;  3NOU C;  5CGW A;  1E25 A;  3VP2 A;  4JGO A;  1TS7 A;  3FKW A;  4N9K A;  2VLG A;  3NI9 A;  4KUK A;  4WN5 A;  4EBL A;  1NYY A;  3A3E A;  4R0Q A;  2JKR I;  4X55 A;  1S4S A;  2DRW A;  3HJK A;  4IUH A;  5FQM A;  1W63 M;  2XFS A;  1LSX A;  3ZCZ A;  4OP5 A;  4JKT A;  1ERM A;  4JGR A;  2WAE A;  2V8C A;  3N8S A;  4IED A;  2VGL M;  1P9W A;  5AVE A;  5HAR A;  2VV8 A;  3DWK A;  3MR0 A;  2PYR A;  4XT2 B;  3OCL A;  4F94 A;  4HOI A;  2VV7 A;  4Y5F A;  1Z6F A;  2WYX A;  3V5M A;  2J8Y A;  3P01 A;  4Q8I A;  4F3L A;  1ONG A;  1HLU P;  3OPP A;  3BYD A;  4KZ4 A;  3SZT A;  3C7V A;  3QP4 A;  5AQA A;  3LR5 A;  1X0O A;  4LCM A;  1VQQ A;  5EVL A;  3VE4 A;  4ZRR A;  3TG9 A;  3M2J A;  2NUT C;  1ZKJ A;  2Y2M A;  3W4Q A;  1VM1 A;  3HLB A;  3SOI A;  2PD8 A;  4Y13 A;  2B95 A;  3RH8 B;  1IKG A;  4XXR A;  3KSF A;  4GS9 A;  1OT9 A;  3IX4 A;  3DTK A;  2ZQ7 A;  4HES A;  3S4X A;  2EFX A;  1Y4O A;  3LUQ A;  5FAP A;  3T1R A;  1BTL A;  5TJJ A;  3Q7V A;  3IXB A;  4Y3I A;  4S2I A;  4CQH A;  1IYP A;  1VEU B;  5MC7 A;  1O7E A;  1FCN A;  4HH2 A;  5DKL A;  5HWV A;  3UE1 A;  3H9W A;  3GDI A;  3ZNT A;  3S7P A;  3N4I A;  3UMD A;  1VB6 A;  1JWZ A;  4UHU A;  4DN0 A;  1HVB A;  5TR7 A;  1KE0 A;  4OPZ A;  4CPK A;  1G28 A;  5I5L A;  1LI9 A;  5AJG A;  2IWB A;  5TBM B;  2ZMA A;  4GB7 A;  4BLM A;  4MCW A;  4UA6 A;  3A3F A;  3VFH A;  1HTZ A;  3EQV A;  5DJT A;  4ZJ1 A;  4WL9 A;  3O5Y A;  1BLS A;  4RX2 A;  5EVI C;  3MBZ A;  4JXV A;  2CMN A;  1PI5 A;  4E3N A;  3BFG A;  3V50 A;  5GLC A;  3EEA A;  2ZBB A;  5HAP A;  3W4O A;  2BAS A;  1GSW A;  1KOU A;  2G2W A;  5HAI A;  4HNB A;  3NDE A;  5J8X A;  1N9O A;  4PM6 A;  1SHV A;  1HD8 A;  5JYP A;  1GA0 A;  1K6R A;  5DF9 A;  2O9A A;  1BYW A;  1K25 A;  2ZM8 A;  2XRN A;  3UPP A;  2XH9 A;  3EQU A;  4ID4 A;  3G30 A;  3MKF A;  4GD8 A;  3WRT A;  4XUX A;  4EBN A;  4P85 A;  2Y2L A;  3PBR A;  2J7V A;  3O88 A;  2HGV A;  5HWW A;  2PR6 A;  3MFX A;  1BLC A;  2ZQC A;  1XXM A;  1Y54 A;  2GNX A;  2W1R A;  3LR4 A;  2O99 A;  3E4O A;  4GW9 A;  3C7U A;  3O87 A;  3JYI A;  2P9V B;  3RTY A;  2J80 A;  4KZ5 A;  4E6W A;  3VFF A;  2ZQA A;  1H0M A;  5TFQ A;  1OJG A;  3L7H A;  3DWZ A;  4BEN A;  1YLZ A;  5DFX A;  3B47 A;  2OLU A;  2XLN A;  1RGZ A;  1NRJ A;  2V0W A;  3CPT B;  5GHZ A;  3T4K A;  4UA9 A;  2A2L A;  2O9C A;  4G3V A;  4YIN A;  1RCJ A;  4KQO A;  2Y91 A;  4GCZ A;  1FCM A;  4HJ3 A;  1K55 C;  5EUA A;  5F83 A;  3F1N A;  5FAO A;  3NCK A;  4QY6 A;  1H8Y A;  3FWL A;  3Q81 A;  1EI5 A;  4KG2 A;  3LEZ A;  4I3I A;  4EEU A;  4OVD A;  5FI7 A;  4PMA A;  4X25 A;  3TJZ C;  2WAD A;  4S2O A;  4R70 A;  3S7O A;  1MBL A;  5F5Y A;  4HQA A;  1FCO A;  5G18 A;  1ZC2 A;  5FEG A;  1CK3 A;  1ERO A;  1GHP A;  1YMS A;  3IWO A;  5CEC A;  3BJN A;  3IT9 A;  3NHQ A;  4JPM A;  3Q07 A;  2M1C A;  4S2M A;  5HZH A;  1PIO A;  3HLG A;  4KZ8 A;  1NY0 A;  1PZP A;  3W8K A;  4PKY G;  3G34 A;  1CF0 A;  3FKV A;  3JPU A;  3BW6 A;  1P97 A;  4OON A;  4Y17 A;  4OQI A;  2Z6C A;  4LV1 A;  4MBK A;  4M4X A;  4HHD A;  2WKR A;  3T4J A;  4JXG A;  2XR0 A;  1M6K A;  1L2S A;  3T1X A;  3IF6 C;  4PHT A;  4QY5 A;  4JF6 A;  4BBV A;  2EXB A;  3NDG A;  5DVA A;  3HLE A;  4PM7 A;  4BL2 A;  1XA7 A;  4HH3 A;  2J3T D;  1TD5 A;  4LRZ E;  1L0G A;  1S1Z A;  2L1M A;  3BM6 A;  4QJG A;  2WKH A;  5HX9 A;  4GHI A;  4ARZ A;  5DFY A;  1AXB A;  4GN2 A;  4IVK A;  3PAG A;  4CLC C;  4X6T A;  5DTT A;  5A8B A;  1YLJ A;  4LCL A;  1XJ4 A;  5AQB A;  2OV5 A;  1S0W A;  1XKZ A;  5BOH A;  1E3U A;  4RX3 A;  1K57 C;  2Y2H A;  1N4O A;  2L0W A;  4O01 A;  4EW7 A;  3LGO A;  4Z1W A;  1SCW A;  1V9Y A;  4U0T A;  1JTD A;  1D06 A;  3PTE A;  2E8I A;  2I9V A;  1BUE A;  5HL6 A;  1XFN A;  5EV0 A;  2JBF A;  4HI4 A;  3ZG5 A;  2W1T A;  1H3Q A;  2GZA A;  5IS1 A;  1CEF A;  3PBT A;  2YKH A;  3RXW A;  3T4L A;  4ZAM A;  3EOI A;  2Q0O A;  1I2W A;  1LI0 A;  2FH5 A;  4YOF A;  3N8R A;  4G3W A;  5EVI A;  4EV4 A;  3ICY A;  2EWW A;  2DNS A;  4WEJ A;  3EGX C;  4OH0 A;  1QME A;  2HP5 A;  3QP2 A;  4FD8 A;  4JXW A;  5IU1 A;  2RCX A;  3IHB A;  4R4R A;  1DRM A;  5EVE A;  1BUL A;  4CLC E;  2PU2 A;  4E3K A;  5EM1 A;  1W7F A;  2ZOI A;  1XJ2 A;  2M7V A;  2ZC4 B;  5FAQ A;  4OOL A;  3KSG A;  1VHM A;  1DP9 A;  2GDN A;  3R7W A;  3LR0 A;  2B02 A;  3S7Q A;  3UDI A;  3EEH A;  1N9N A;  3ZGA B;  4EEP A;  2UWX A;  4HP9 A;  4NEE D;  4YFM A;  4DXB A;  5HDC A;  2P7J A;  2W3E A;  1PZO A;  3FPV A;  2G2U A;  2CC1 A;  3N6I A;  3PHY A;  3HUO A;  5FQQ A;  4GDB A;  3C38 A;  3IWI A;  4ESP A;  3VV4 A;  2E8J A;  1L3L A;  4OQG A;  2HP9 A;  4OLG A;  1F98 A;  3ZG0 A;  4GNU A;  2Y55 A;  3KX0 X;  1MPL A;  5M18 A;  3B42 A;  3VP4 A;  3E2L A;  1H5X A;  3WS5 A;  1KGG A;  3FC7 A;  2V1A A;  1YLP A;  2W3F A;  2ZQ8 A;  3ZVW A;  1K55 A;  3CIT A;  3BRM A;  4FSF A;  2XD5 A;  3PBN A;  2PHY A;  2G7U A;  1JTG A;  4B93 A;  2Z6D A;  4JGQ A;  3MZF A;  1XJ3 A;  3BQ8 A;  5CGX A;  2W3G A;  4PAU A;  4S2L A;  4I39 A;  3DBA A;  3F1N B;  1RGY A;  1YSP A;  3D72 A;  4B9O A;  5HL1 A;  5HFO A;  4II7 A;  1IOU A;  1CI9 A;  1Y28 A;  1NLZ A;  1T1B A;  1XGJ A;  2I72 A;  4JF5 A;  2JKT M;  4I5S A;  1IKI A;  5GHY A;  5GLB A;  3LIB A;  2UV0 E;  1KVM A;  2V9A A;  3SS4 A;  4MEZ A;  4QD4 A;  3DTE A;  2QKP A;  2ZJ9 A;  3A3J A;  1PW8 A;  4WUJ A;  1NJ4 A;  4KZA A;  4KZB A;  1F2K A;  3WWX A;  4DF6 A;  5E2G A;  4EES A;  4M3K A;  3SH7 A;  1G6A A;  4FOF A;  2K7S A;  3PXP A;  5IT5 A;  3ZG7 B;  2AVX A;  1YAX A;  3IF6 A;  2A24 A;  4WYY A;  3HCY A;  3VOL A;  3T1Q B;  1OTI A;  3ZG9 B;  3R4K A;  3VE3 A;  2MJ6 A;  3ZFZ A;  3LIA A;  1ES2 A;  3E0Y A;  2Y2J A;  2QYB A;  4Q0I A;  1TDG A;  1FOF A;  2H28 A;  1S4R A;  5CHM A;  2PBD P;  2JKR M;  3BFE A;  1LL9 A;  4EUZ A;  1PWG A;  3VP1 A;  4GDN A;  4GZB A;  3RXX A;  3TOI A;  4Y2F A;  4CLC A;  3WS0 A;  2H0Y A;  4DJ2 A;  4E3I A;  4BQM A;  4GHI B;  4ARZ B;  1K57 A;  4C6Y A;  5FI6 A;  5HPF A;  3OCN A;  1MWU A;  3OZH A;  1P9R A;  1GCE A;  4JGP A;  3WRZ A;  3PBQ A;  4QB8 A;  1VET A;  1KDW A;  4UQI S;  4DE0 A;  2JE5 A;  1WA9 A;  3IWQ A;  3ITA A;  2HF6 A;  3M2K A;  3LY4 A;  5AQ7 A;  2Y2I A;  3MQO A;  5L09 A;  4O8G A;  3G4P A;  1TF1 A;  3MZE A;  2V0U A;  5DKK A;  3U4L P;  4H6J B;  5CXW A;  4KQD A;  1MWT A;  3DTI A;  3GTC A;  4HBT A;  1TS0 A;  4MMN A;  4IUK A;  5F1G A;  1JWP A;  1IYQ A;  4X1M A;  1YT4 A;  4Y15 A;  5FAS A;  3RJU A;  2HZ5 A;  2WGW A;  1BZA A;  2Z2M B;  2XA7 S;  3MZD A;  5G4Y A;  3H7W A;  3TSG A;  2HJ9 C;  2X02 A;  5FDS A;  1CI8 A;  3NBL A;  3CAX A;  3QHY A;  1LL5 A;  3KYZ A;  1MKM A;  1PFL A;  4WEK A;  5J3W A;  4QPR A;  3KYE A;  4UQI M;  2ZMF A;  2Y8H A;  4WBG A;  2IA2 A;  1PNE A;  3UE6 A;  5J7E A;  4KZ6 A;  1C3B A;  1ES4 A;  3HLF A;  2ZLY A;  4GKU A;  5KSH A;  2P74 A;  1LHY A;  2JC7 A;  4ZBE A;  1PWD A;  1TDL A;  3CHW P;  4EWF A;  3ZHH A;  4IJG A;  4ZJ3 A;  5F6A A;  3O3V A;  3MMH A;  4KG6 A;  1GSV A;  3LI8 A;  4EET B;  1ONH A;  4A5R A;  3G2Y A;  2Y2N A;  5C5K A;  2VGJ A;  5CED A;  1NXY A;  5HW3 A;  3GVB A;  1L0D A;  2BLS A;  5CX7 A;  2J3W A;  2WZZ A;  2XA7 M;  3IF5 A;  3IBJ A;  5CEB A;  4K0X A;  2EWV A;  5L2F A;  4HY8 A;  5AVF A;  2XDM A;  3MXS A;  2K2N A;  1TS8 A;  2PU4 A;  4S2J A;  1ALQ A;  2QZ6 A;  2Y2G A;  5LBR A;  2DCF A;  1RP5 A;  3OBF A;  5F69 A;  3QNC A;  3IH8 A;  2VA0 A;  3IHA A;  2ZC6 B;  4E04 A;  3HJI A;  2V1Z A;  4EBP A;  4JBF A;  4KQQ A;  3IX8 A;  4OLD A;  2EX8 A;  2ZL1 B;  2J3T C;  1W5D A;  5CRF A;  2LB9 A;  5HSQ A;  2JCH A;  3K2N A;  4N9L A;  3PR6 A;  3UY6 A;  1SKO A;  3SS5 A;  3D3O A;  1OPX A;  3UB8 A;  1F9I A;  5CTN A;  3UDF A;  1AWI A;  3VSK A;  1OTE A;  2VK3 A;  2KOI A;  4L9G A;  4MN5 A;  3LFV A;  3MKE A;  1K4F A;  5KIZ A;  2OLV A;  4LRY C;  3AGD A;  1IFQ A;  4NXE A;  4D60 A;  2VEA A;  4GOG A;  3EGD C;  3OPL A;  4S2N C;  4N92 A;  2HJE A;  2Y79 A;  3KSH A;  1YLT A;  5HDS A;  3T12 B;  5KMW A;  4NG2 A;  4FH2 A;  2M7U A;  3MJQ A;  1MZU A;  4NXB A;  4X53 A;  4IVI A;  4EER A;  4K91 A;  4P6B A;  3MFD A;  1SZV A;  2YKF A;  1PI4 A;  4EXO A;  3IS2 A;  4F3L B;  4BBU A;  4PPR A;  3UPO A;  4EU0 A;  4XT2 A;  2Y2K A;  4DXC A;  3T4Q A;  3B33 A;  3HL9 A;  1W63 Q;  4DMZ A;  4DDY A;  5FQ9 A;  5K5B A;  3ZQ5 A;  3UN7 A;  1LLB A;  3Q82 A;  3BWL A;  3S22 A;  1Z09 A;  5EOO A;  4GS9 B;  3VP3 A;  2P08 A;  2WKE A;  3W2Z A;  1VET B;  2FZ0 A;  2L4R A;  2KX6 A;  3IX3 A;  5JYO A;  2HPB A;  4KEN B;  1YLY A;  3Q7V B;  2OSU A;  1NLY A;  2ZM2 A;  2BTF P;  4P87 A;  4C3Q A;  1OT6 A;  3BLM A;  1FSW A;  3UNW A;  1ZTU A;  4WF0 A;  5A92 A;  2XEP A;  4G3K A;  5EEC A;  4KG5 A;  1CEG A;  4WMC D;  3LIE A;  3GMW A;  3NY4 A;  4DJ3 A;  3D4F A;  2WGW B;  1N9L A;  3S7N A;  4ETX A;  1VEU A;  3VOZ A;  2XF3 A;  3LR3 A;  3H7W B;  4ZDX A;  2ZOH A;  5A93 A;  4HIA A;  1OME A;  3GV9 A;  1ODV A;  1KVL A;  4GLQ A;  5FA7 A;  4KZ9 A;  3OLO A;  5F68 A;  3BY8 A;  3NEC A;  4BD1 A;  1MY8 A;  4O0P A;  5TBM A;  1F5M A;  3Q1F A;  4B88 A;  4I38 A;  5M19 A;  4WZ5 C;  2VJW A;  2VZW A;  4I3J A;  5HPI A;  4MBF A;  3IXG A;  2VKS A;  1EW0 A;  1GA9 A;  2QHK A;  1QMF A;  3FV7 A;  1L0F A;  2HDS A;  5HD3 A;  3NIA A;  3PBO A;  4AFI A;  4QWO A;  4N1X A;  1T1A A;  1G5U A;  1YMX A;  4ZTK A;  1PYY A;  2WKP A;  1XFQ A;  4LV0 A;  3BQA A;  4DE3 A;  1EWZ A;  1K38 A;  3WS2 A;  1DJA A;  1BT5 A;  3HLC A;  4BWI A;  1KE4 A;  2O0Y A;  1HZO A;  1J3W A;  3A0S A;  1V9Z A;  2DMW A;  2VV6 A;  3L9K A;  2EX2 A;  4IBX A;  2V1B A;  3GSG A;  3CWF A;  2WKQ A;  4OPQ A;  4FUW A;  2WGV A;  4E3L A;  1ZG6 A;  1NZO A;  1SDN A;  1K4E A;  4HEF A;  5FQK A;  3O86 A;  4U0X A;  2H5S A;  5DF7 A;  5GLD A;  2WGI A;  1Q2P A;  2ZC3 B;  5U47 A;  1OTB A;  3GEC A;  2LB5 A;  3KSI A;  3OPR A;  1T19 A;  3M6H A;  2P9V A;  2PDR A;  3MF0 A;  3PYP A;  1S66 L;  2HDR A;  4R3B A;  1SKO B;  2IWC A;  5FEF A;  2WAF A;  4RVA A;  4IBR A;  3QP8 A;  1Q2Q A;  5F82 A;  4Q0J A;  4P6Z M;  3WS4 A;  5DTS A;  4FH4 A;  2XK1 A;  3OOV A;  3H82 A;  3BFF A;  4KZ7 A;  3LEQ A;  4S2N A;  3E98 A;  4WEL A;  1OTD A;  3C8C A;  2ZQ9 A;  4WM9 A;  3TE8 A;  2PBY A;  4B4Z A;  2WKI A;  2Q9N A;  3A3I A;  4EUV A;  1ERQ A;  3HUM A;  5G4Z A;  1WE4 A;  3HLD A;  5E43 A;  4RYE A;  5D3O A;  4X69 A;  3OC2 A;  3G2Z A;  1FQG A;  1STZ A;  2Y2O A;  3F1O A;  1H8Z A;  1PRQ A;  4Y0U A;  2IWD A;  3ISG A;  3E4Q A;  1NYM A;  3VP0 A;  2Y2Q A;  4U3T A;  4DDS A;  3E4P A;  5KSC A;  2R9X A;  4Y0O A;  3D9Y A;  3IS2 B;  1TEM A;  3BY9 A;  4K0W A;  4NXF A;  3AGE A;  4UEY A;  2D01 A;  1IEL A;  3FZC A;  3C30 A;  2ZC7 A;  2PR5 A;  3A3D A;  2V20 A;  1ACF A;  5FAT A;  1YPR A;  1LL8 A;  1FR6 A;  3DTM A;  3V39 A;  2JKG A;  4UAA A;  2KLI A;  1YQS A;  3WS1 A;  3CUE C;  3BFC A;  3LI9 A;  3S1Y A;  2Y4A A;  3UPN A;  5J4E A;  1NWZ A;  2H0T A;  2RL3 A;  3F1P A;  4QHC A;  4HJ6 A;  3SW1 A;  4E3M A;  1ES5 A;  2WUQ A;  1S67 L;  3T4T A;  3AGF A;  3BFD A;  3LO7 A;  4HP4 A;  1P0Z A;  2WK0 A;  3MSH A;  3NOT C;  5L10 A;  3P09 A;  3LYX A;  4X56 A;  3IH9 A;  4Y7P A;  4KQR A;  5FL3 A;  2QMI A;  2X01 A;  2VX8 A;  4B4X A;  4OQH A;  4EQ1 A;  3LIC A;  1TS6 A;  5CER A;  1T18 A;  5FQJ A;  3C4O A;  3B3X A;  4JLF A;  3V3S A;  5EPH A;  2W1T B;  3HUN A;  3TRC A;  1ES3 A;  3HLW A;  2BG1 A;  2HV1 A;  2NUP C;  1G68 A;  1WYC A;  4LFU A;  5EVI B;  3UDX A;  5KZH A;  1MC0 A;  2QJ7 A;  3FYZ A;  1J9M A;  1S6R A;  2O9B A;  5FI2 A;  4WZ5 A;  1BLP A;  1FSY A;  1CQA A;  3TW8 A;  2EX6 A;  2JN7 A;  1MKI A;  2W3H A;  4D2O A;  5DF8 A;  3UE0 A;  1LSV A;  3UO9 A;  5AQ9 A;  2OOL A;  1K54 C;  3UB9 A;  3CMZ A;  2QPN A;  4OQ0 A;  3ITB A;  3IQA A;  1S1Y A;  3NOP C;  4E3J A;  4P0M A;  3RFB A;  4IHQ A;  3QP5 A;  4JXS A;  3R7W B;  2PT7 A;  4Z9Q A;  1GHM A;  2EA9 A;  5E2F A;  5CTM A;  4BMW A;  3SH9 A;  4MDZ A;  5E2H A;  4UA7 A;  4Y0T A;  1UGU A;  1YM1 A;  4ETZ A;  4BD0 A;  3OPH A;  1FR1 A;  5L07 A;  4OKP A;  4PM9 A;  1M40 A;  3A0R A;  1NZU A;  3HBR A;  2FFF B;  4PKY A;  4OPR A;  2C6W B;  4QU3 A;  1E4D A;  4DE2 A;  5IHV A;  1D1J A;  3G32 A;  3KO6 A;  2P04 A;  3A0V A;  3LY3 A;  1MWS A;  3MXR A;  4R6L A;  4LEN A;  3T50 A;  3LIF A;  2XQZ A;  2OAQ 1;  4L9F A;  3V3R A;  3CI6 A;  4R23 A;  3N7W A;  4BBT A;  3G35 A;  1E3U D; 
#chains in the Genus database with same CATH homology
 3ZG0 A;  1JVJ A;  2Q9M A;  3VOY A;  4E3O A;  4GNU A;  5JYO A;  2HPB A;  2Y55 A;  2ZC5 B;  1MPL A;  5M18 A;  4KEN B;  1YLY A;  1XA1 A;  3Q7V B;  2OSU A;  2ZQ7 A;  3VP4 A;  3E2L A;  4HES A;  3S4X A;  2ZM2 A;  1H5X A;  5GL9 A;  2EFX A;  4P87 A;  4C3Q A;  3WS5 A;  1KGG A;  1TVF A;  3BLM A;  1FSW A;  3UNW A;  3ZVW A;  1YLP A;  2ZQ8 A;  5EOE A;  5FAP A;  1K55 A;  1BTL A;  2XFT A;  3BRM A;  4FSF A;  3Q7V A;  2XD5 A;  5A92 A;  3PBN A;  5I94 A;  3Q7Z A;  2XEP A;  3C4P A;  3HVF A;  1KDS A;  3IXB A;  5EEC A;  4S2I A;  1JTG A;  1IYO A;  3LCE A;  1IYP A;  4KG5 A;  1O7E A;  1FCN A;  1CEG A;  1W8Q A;  3MZF A;  4NK3 A;  4O7D A;  3UE1 A;  4WMC D;  5CGX A;  3ZNT A;  4S2L A;  3GMW A;  1RGY A;  3NY4 A;  3N4I A;  3D4F A;  2WGW B;  5EVI D;  2J9O A;  1JWZ A;  4UHU A;  4H8R A;  5A91 A;  3VOZ A;  2XF3 A;  1HVB A;  1W8Y A;  5HL1 A;  5HFO A;  5TR7 A;  1KE0 A;  4OPZ A;  4ZDX A;  2EX9 A;  1CI9 A;  5A93 A;  4ZJ2 A;  5FDH A;  4CPK A;  1LI9 A;  1OME A;  3GV9 A;  1MWR A;  4MLL A;  2IWB A;  1XGJ A;  2I72 A;  4JF5 A;  1KVL A;  2HDQ A;  2ZMA A;  4GB7 A;  4BLM A;  4S2P A;  4WZ4 A;  4UA6 A;  5HAQ A;  3A3F A;  5FA7 A;  5FSR A;  1IKI A;  3VFH A;  4KZ9 A;  5GHY A;  1GHI A;  5GLB A;  1HTZ A;  3CZD A;  5E2E A;  1KVM A;  3EQV A;  3SS4 A;  4MEZ A;  4ZJ1 A;  5GHX A;  4BD1 A;  1MY8 A;  2ZM0 A;  3Q1F A;  4B88 A;  4QD4 A;  3M6B A;  1W79 A;  5M19 A;  2ZJ9 A;  5EE8 A;  1BLS A;  3A3J A;  4RX2 A;  1PW8 A;  4WZ5 C;  5EVI C;  4MBF A;  1NJ4 A;  4KZA A;  4KZB A;  3MBZ A;  3WWX A;  3IF6 B;  3IXG A;  3QNB A;  4JXV A;  5E2G A;  4DF6 A;  4FCF A;  4M3K A;  3SH7 A;  1GA9 A;  1PI5 A;  1QMF A;  4RA7 A;  4E3N A;  1U60 A;  3FV7 A;  1L0F A;  1NRF A;  2HDS A;  1G6A A;  3BFG A;  3NIA A;  3V50 A;  3PBO A;  5DTK A;  3G31 A;  5GLC A;  1KGE A;  5HAP A;  3W4O A;  3ZG7 B;  3IF6 A;  4WYY A;  4N1X A;  1YMX A;  4ZTK A;  2G2W A;  3ZG9 B;  1PYY A;  4R4S A;  1K56 D;  5HAI A;  3ZFZ A;  2Y59 A;  4LV0 A;  3NDE A;  4DE3 A;  5J8X A;  1ES2 A;  1EWZ A;  4PM6 A;  2Y2J A;  1SHV A;  1MXO A;  1HD8 A;  5JYP A;  1K38 A;  1GA0 A;  1K6R A;  4OPY A;  3WS2 A;  1TDG A;  1FOF A;  2Y2P A;  5DF9 A;  1DJA A;  2A49 A;  5CHM A;  1I2S A;  1K25 A;  3HRE A;  4R1G A;  2B5R A;  2ZM8 A;  1BT5 A;  3BFE A;  3DW0 A;  3HLC A;  3UPP A;  1LL9 A;  1KE4 A;  2XH9 A;  3EQU A;  1HZO A;  4EUZ A;  1PWG A;  3VP1 A;  4ID4 A;  3G30 A;  4GDN A;  4GZB A;  3RXX A;  3MKF A;  3TOI A;  5CHJ A;  3WS0 A;  2C5W B;  2H0Y A;  4LV3 A;  3ZDJ A;  4GD8 A;  4E3I A;  2EXA A;  1O07 A;  3WRT A;  2EX2 A;  4BQM A;  4XUX A;  4IBX A;  2HDU A;  4P85 A;  4EBN A;  2Y2L A;  3PBR A;  2J7V A;  2ZD8 A;  3GSG A;  1XPB A;  3O88 A;  1K57 A;  3E2K A;  5FI6 A;  4C6Y A;  1KGF A;  3OCN A;  1MWU A;  4OPQ A;  2WGV A;  3OZH A;  4E3L A;  1GCE A;  1ZG6 A;  1NZO A;  1N9B A;  1ZG4 A;  1SDN A;  1BLC A;  1K4E A;  2ZQC A;  4HEF A;  3WRZ A;  1XXM A;  3PBQ A;  4QB8 A;  1Y54 A;  4EQI A;  1KDW A;  3O86 A;  5FQK A;  4DE0 A;  4N1H A;  2JE5 A;  1WYB A;  4U0X A;  3C7U A;  3O87 A;  2H5S A;  5DF7 A;  3IWQ A;  2WGI A;  1Q2P A;  2ZC3 B;  3ITA A;  3JYI A;  4HBU A;  4XUZ A;  5GLD A;  2P9V B;  3M2K A;  2R9W A;  5CGS A;  5U47 A;  3P98 A;  5GLA A;  3LY4 A;  1IYS A;  4KZ5 A;  4E6W A;  3VFF A;  2ZQA A;  1JWV A;  5AQ7 A;  5TFQ A;  2Y2I A;  3I7J A;  3OPR A;  3DWZ A;  4BEN A;  1YLZ A;  3GQZ A;  2H10 A;  2OLU A;  3ZG8 B;  1L0E A;  2XLN A;  1KE3 A;  3M6H A;  2P9V A;  1RGZ A;  3G4P A;  5GHZ A;  3MZE A;  4UA9 A;  3IXD A;  4GD6 A;  2HDR A;  4R3B A;  1MWT A;  5CXW A;  2IWC A;  3GTC A;  4HBT A;  2WAF A;  3ZVT A;  1ESU A;  1RCJ A;  4RVA A;  4YIN A;  4IBR A;  4KQO A;  2Y91 A;  5F1G A;  1Q2Q A;  1FCM A;  1XP4 A;  1JWP A;  5F82 A;  3C5A A;  1IYQ A;  1K6S A;  3BLS A;  1XGI A;  1YT4 A;  1K55 C;  3CG5 A;  4FH4 A;  5DTS A;  2XK1 A;  5EUA A;  5F83 A;  3WS4 A;  5FAO A;  5FAS A;  3RJU A;  3VMA A;  2WGW A;  1BZA A;  3NCK A;  1K54 A;  3NC8 A;  4QY6 A;  3BFF A;  4KZ7 A;  3W4P A;  2A3U A;  4S2N A;  1H8Y A;  2WZX A;  2Z2M B;  3MZD A;  4WEL A;  5CHU A;  3FWL A;  1SDE A;  4DKI A;  3Q81 A;  1EI5 A;  5A90 A;  4JF4 A;  4KG2 A;  3TSG A;  2ZQ9 A;  3LEZ A;  4WM9 A;  2X02 A;  1CI8 A;  4OVD A;  5FI7 A;  4PMA A;  3NBL A;  5F1F A;  1BLH A;  2WAD A;  3QHY A;  1LL5 A;  2PBY A;  4S2O A;  1MBL A;  4B4Z A;  2WKI A;  2Q9N A;  3A3I A;  1FCO A;  1ERQ A;  1DJC A;  3HUM A;  4S2K A;  4WEK A;  1WE4 A;  3BEC A;  3HLD A;  5G18 A;  4C75 A;  1ZC2 A;  1CK3 A;  1ERO A;  1GHP A;  1YMS A;  3GRJ A;  3IWO A;  4RYE A;  5E43 A;  5D3O A;  5CEC A;  1DY6 A;  2HP6 A;  1I5Q A;  3IT9 A;  3OC2 A;  3G2Z A;  1FQG A;  4X69 A;  4WBG A;  2Y2O A;  4E6X A;  1H8Z A;  4Y0U A;  2IWD A;  4OOY A;  4JPM A;  4KZ6 A;  1C3B A;  1ES4 A;  3ISG A;  3Q07 A;  4S2M A;  1PIO A;  3HLG A;  4BJP A;  4KZ8 A;  4BL3 A;  3HLF A;  1NY0 A;  1NYM A;  3VP0 A;  2ZLY A;  4GKU A;  1PZP A;  1ESI A;  2Y2Q A;  4X68 A;  3W8K A;  2EFU A;  4U3T A;  4DDS A;  5KSH A;  2X71 A;  2P74 A;  5KSC A;  1LHY A;  2R9X A;  2JC7 A;  4Y0O A;  4ZBE A;  1PWD A;  1TDL A;  1TEM A;  3G34 A;  4K0W A;  3FKV A;  3AGE A;  4EWF A;  1DJB A;  2XGN A;  3ZHH A;  1IEL A;  4ZJ3 A;  3BEB A;  3O3V A;  3FZC A;  4OON A;  4KG6 A;  4OQI A;  1SKF A;  4KZ3 A;  4LV1 A;  4MBK A;  2J9P A;  4MBH A;  4JXG A;  1ONH A;  4LV2 A;  2XR0 A;  4A5R A;  2ZC7 A;  3G2Y A;  3A3D A;  2V20 A;  1M6K A;  1L2S A;  2Y2N A;  5FAT A;  3IF6 C;  2VGJ A;  5CED A;  1NXY A;  5HW3 A;  3GVB A;  1L0D A;  5FQI A;  1K56 A;  2BLS A;  4JF6 A;  4QY5 A;  1FR6 A;  3DTM A;  2WZZ A;  2VGK A;  2Z2L B;  3IF5 A;  3IXH A;  3V39 A;  5CEB A;  2EXB A;  3VSL A;  3NDG A;  4K0X A;  5DVA A;  5L2F A;  4OP8 A;  3ZNY A;  4UAA A;  1YQS A;  3WS1 A;  3HLE A;  4PM7 A;  4BL2 A;  2XDM A;  3BFC A;  4NET A;  3MXS A;  3S1Y A;  2Y4A A;  3UPN A;  1XA7 A;  1L0G A;  2PU4 A;  2H0T A;  4CJN A;  3BM6 A;  2RL3 A;  2WKH A;  4S2J A;  4QJG A;  3PAE A;  4QHC A;  5HX9 A;  1AXB A;  4E3M A;  1IEM A;  4GN2 A;  1ALQ A;  1ES5 A;  2QZ6 A;  4IVK A;  2FFY A;  2WUQ A;  2XD1 A;  5M1A A;  2V2F F;  3AGF A;  3PAG A;  2Y2G A;  3BFD A;  3LO7 A;  3SS3 A;  4X6T A;  2DCF A;  2WK0 A;  5DTT A;  1RP5 A;  3N8L A;  3QNC A;  3P09 A;  1YLJ A;  4X56 A;  4LCL A;  5AQB A;  2OV5 A;  3IH9 A;  4Y7P A;  4KQR A;  4PM5 A;  1S0W A;  3IH8 A;  1XKZ A;  3IHA A;  5BOH A;  2ZC6 B;  1YLW A;  1E3U A;  4RX3 A;  1PWC A;  1K57 C;  2QMI A;  2V1Z A;  1N4O A;  2Y2H A;  2X01 A;  3UE3 A;  4EBP A;  3GR2 A;  4B4X A;  4JBF A;  4KQQ A;  4OQH A;  3SH8 A;  5CER A;  4OOM A;  5FQJ A;  4DRT A;  1SCW A;  4OLD A;  2EX8 A;  3C4O A;  3CJM A;  3B3X A;  4JLF A;  4MNR A;  1W5D A;  4U0T A;  1JTD A;  3V3S A;  5EPH A;  3PTE A;  5CRF A;  4PM8 A;  2E8I A;  2JCH A;  1BSG A;  3HUN A;  4N9L A;  1BUE A;  1ES3 A;  1XX2 A;  3PBS A;  3UY6 A;  3HLW A;  2BG1 A;  3SS5 A;  1PW1 A;  4L0L A;  4DE1 A;  1G68 A;  1WYC A;  2JBF A;  3ZG5 A;  5TGF A;  5EVI B;  2ZQD A;  5CTN A;  3UDX A;  3UDF A;  5KZH A;  4R3J A;  1CEF A;  3PBT A;  3VSK A;  3RXW A;  4WMC A;  4ZAM A;  3FYZ A;  1J9M A;  1S6R A;  1I2W A;  5FI2 A;  4WZ5 A;  1BLP A;  5CGW A;  1FSY A;  1LI0 A;  1E25 A;  3N8R A;  5EVI A;  3VP2 A;  4EV4 A;  3FKW A;  2EX6 A;  4N9K A;  1MKI A;  3MKE A;  1K4F A;  4D2O A;  3NI9 A;  5DF8 A;  3UE0 A;  2OLV A;  4EBL A;  2DNS A;  1NYY A;  3AGD A;  3UO9 A;  5AQ9 A;  4WEJ A;  4OH0 A;  3A3E A;  1K54 C;  1QME A;  4GOG A;  3CMZ A;  2QPN A;  2HP5 A;  3OPL A;  4R0Q A;  4FD8 A;  4JXW A;  4N92 A;  4OQ0 A;  4S2N C;  2RCX A;  1YLT A;  3ITB A;  3IQA A;  4X55 A;  3IHB A;  2DRW A;  5KMW A;  5FQM A;  4E3J A;  2XFS A;  4R4R A;  4P0M A;  4FH2 A;  1BUL A;  3ZCZ A;  2PU2 A;  4JXS A;  4OP5 A;  4JKT A;  1ERM A;  4X53 A;  2WAE A;  4E3K A;  4IVI A;  3N8S A;  4Z9Q A;  1W7F A;  4IED A;  1GHM A;  5E2F A;  4K91 A;  4P6B A;  3MFD A;  5CTM A;  5HAR A;  2ZC4 B;  3SH9 A;  5E2H A;  3DWK A;  5FAQ A;  4UA7 A;  4Y0T A;  4OOL A;  1PI4 A;  1YM1 A;  2GDN A;  4F94 A;  3OCL A;  4BD0 A;  3OPH A;  1FR1 A;  4OKP A;  4PM9 A;  3UDI A;  1Z6F A;  2WYX A;  1M40 A;  4PPR A;  3ZGA B;  3UPO A;  3V5M A;  1NZU A;  2UWX A;  2J8Y A;  3HBR A;  2FFF B;  4Q8I A;  4YFM A;  4OPR A;  2Y2K A;  1ONG A;  4DXB A;  2C6W B;  4DXC A;  3HL9 A;  4QU3 A;  3OPP A;  3BYD A;  1E4D A;  4KZ4 A;  3C7V A;  4DE2 A;  5IHV A;  1PZO A;  5AQA A;  3G32 A;  4LCM A;  4DDY A;  1VQQ A;  2G2U A;  2CC1 A;  5EVL A;  3LY3 A;  5FQ9 A;  3N6I A;  1MWS A;  3UN7 A;  3HUO A;  1LLB A;  3M2J A;  3Q82 A;  1ZKJ A;  2Y2M A;  3TG9 A;  3W4Q A;  3S22 A;  1VM1 A;  3MXR A;  3HLB A;  5EOO A;  5FQQ A;  4LEN A;  4GDB A;  3VP3 A;  3SOI A;  2XQZ A;  3IWI A;  3V3R A;  2WKE A;  4R23 A;  3N7W A;  4OQG A;  2HP9 A;  4OLG A;  1IKG A;  4XXR A;  3G35 A;  1E3U D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...