3PAGA

Crystal structure of the v130d mutant of oxa-24/40 in complex with doripenem
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
245
structure length
245
Chain Sequence
b'MHISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSADPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structures of the Class D Carbapenemase OXA-24 from Acinetobacter baumannii in Complex with Doripenem.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase/antibiotic
total genus 80
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3pagA00
3HLCA 3HLGA 4OLGA 4S2MA 3FYZA 4MBKA 3C4PA 4DDYA 1NXYA 4OPRA 2QMIA 4JF4A 1XGJA 3OPPA 4JPMA 1Q2QA 3QNCA 3S22A 3M6BA 1DJAA 4QD4A 5CTNA 1BULA 4K91A 2RL3A 4OLDA 2CC1A 5CEDA 4R3JA 4B4ZA 5HAPA 1FSWA 2WAEA 5FQMA 2PU4A 2X71A 3IQAA 3TOIA 2WGWB 5EECA 5FAOA 1XA7A 3AGEA 4E3JA 3ZVTA 4KQOA 4UA7A 4D2OA 3UDIA 5GL9A 1ESIA 1EROA 4FCFA 3MKFA 5A90A 1GHMA 3BFDA 4B88A 3EQVA 5F1FA 1DJCA 4OQGA 5DTTA 4BJPA 3IWOA 1G6AA 3UE0A 4E3OA 2C6WB 4KZBA 2G2WA 4BL3A 3O86A 4IBXA 4HBTA 3WS2A 1NYMA 3M2KA 1HTZA 4MBFA 3UDXA 1BTLA 1RGZA 1U60A 1NY0A 1Y54A 2ZC7A 3GMWA 3ISGA 3VOYA 1I2SA 3ZFZA 4KZAA 1E4DA 2ZQAA 1BT5A 2P9VA 3ZHHA 4DDSA 4DF6A 1K57C 2EX9A 3Q82A 4JXWA 4S2JA 4IEDA 1K57A 4OQIA 5EVIA 3GVBA 1ALQA 3LY3A 3BLMA 4OPZA 4ZDXA 3NIAA 5GHXA 3BM6A 4KENB 3ZGAB 4EV4A 1K54C 4KZ5A 3SH8A 4OQ0A 1K54A 2Y55A 3OPRA 1FOFA 1SKFA 1FCMA 1O7EA 1FQGA 4JKTA 4OOYA 2J9PA 4KQQA 1S6RA 3GV9A 4WMCA 5F1GA 4E3LA 5BOHA 3G34A 4QB8A 5DVAA 1ZG4A 1O07A 1M6KA 2DCFA 4MEZA 4CPKA 3MXSA 3Q7ZA 5CXWA 3GRJA 1J9MA 3MXRA 3V3RA 2XK1A 5KZHA 4RX3A 3ITAA 4EBPA 1ONHA 2HP6A 1ONGA 3UPOA 3M2JA 4ZJ3A 2X02A 4XXRA 1PI4A 2Y2NA 1XKZA 4ZTKA 4Q8IA 5FATA 3ZDJA 2WKEA 3VSLA 4DE2A 4BLMA 3Q81A 1ZC2A 4PM7A 3VOZA 4YINA 3PBSA 1ES5A 2Y2IA 1RCJA 2VGKA 1E3UA 3G2ZA 3N7WA 3O87A 1PW1A 4KZ3A 5FAQA 3G30A 3UPNA 4EWFA 3Q1FA 1K55C 4UAAA 1K55A 5AQ7A 1N4OA 1FCOA 5FI2A 4QHCA 4WM9A 1K6SA 5AQBA 5FASA 1PI5A 3ZG9B 3E2LA 3VP4A 1PZOA 2XD1A 4PM8A 5F82A 3NDGA 2J9OA 3VFFA 5A93A 5E43A 1RP5A 3ZG5A 4U3TA 1PWCA 1BLCA 1SDNA 1L0FA 3PBNA 1VQQA 1KDSA 5EE8A 3NBLA 1L0EA 5AQAA 3HLBA 3HREA 4GZBA 3PAEA 4Y7PA 2WGIA 1BSGA 4JLFA 4OQHA 2Y2JA 1XA1A 4DXBA 1YLJA 2Z2LB 3A3JA 2EFUA 4DE0A 4LCMA 1YLYA 1KGFA 1IYPA 4X56A 4E3NA 3BLSA 2WUQA 3WS4A 1QMEA 4OPQA 1QMFA 3VP3A 2JC7A 4UA9A 3GQZA 2ZM0A 3DWKA 3QNBA 1YLTA 3B3XA 2V1ZA 4K0XA 5GLDA 3VSKA 1KE3A 3IH8A 1IYQA 1YLWA 4WBGA 4XUXA 1MWUA 3ZVWA 3ZG7B 4P85A 2HDSA 1KGGA 1YMXA 3ITBA 5CHJA 2Y4AA 3FWLA 1JWPA 1XX2A 4P6BA 2ZJ9A 4HEFA 4IVIA 2HP9A 2ZQCA 5A91A 1MPLA 2WKHA 4Y0UA 2H0TA 3HLFA 3NDEA 4WYYA 3VP1A 1LL9A 2XFSA 4C6YA 2Y2HA 3EQUA 2EX6A 3WS0A 4F94A 3ZNTA 3PBTA 1NJ4A 4N1HA 3VP2A 3AGFA 2VGJA 3IH9A 4WEJA 3P09A 4FD8A 3W4QA 4CJNA 1GHPA 1AXBA 3GR2A 3N4IA 2XEPA 4XUZA 1IKIA 4KZ7A 5EOOA 3Q7VA 5E2EA 2J8YA 3WS1A 1W8QA 3C7UA 4N1XA 4GDNA 5KMWA 3A3FA 2JCHA 2X01A 4BL2A 4Y0OA 2DRWA 3BFFA 1PIOA 1TVFA 1W8YA 2Q9MA 3Q07A 5E2FA 3LCEA 3ZCZA 2WGVA 2B5RA 3RXWA 1BZAA 1PW8A 2JBFA 1K38A 4FH2A 4JXGA 2H10A 2EXBA 1HZOA 4WZ4A 4JXVA 2EFXA 2FFYA 5CHUA 3ZNYA 4A5RA 4BD1A 1JTGA 3BRMA 3UE3A 2XDMA 2ZQ7A 1GA9A 1LI9A 2BLSA 5CGSA 2Y91A 2ZM2A 1I5QA 3G2YA 2ZM8A 3G31A 3DW0A 1SDEA 1YMSA 2XF3A 3LEZA 4LCLA 4PM9A 3CJMA 2ZC4B 4MNRA 2Y2GA 4S2OA 5HAIA 3IF6B 3UPPA 4KZ6A 3WWXA 2JE5A 3NI9A 4NK3A 3PTEA 2A3UA 4UHUA 3D4FA 5HFOA 3HLEA 4EBNA 5L2FA 1YLPA 2V2FF 3I7JA 1K56D 2ZMAA 5HX9A 1SCWA 1YQSA 1YM1A 4QU3A 4N9KA 4RYEA 2Y2PA 4ZJ1A 4GD8A 4E3KA 2WKIA 3A3EA 3DWZA 4BENA 4DE1A 4JF6A 5E2HA 2OV5A 3C7VA 3BFGA 2QZ6A 3A3DA 2XH9A 3PAGA 4JBFA 1WE4A 4R4SA 5JYPA 2RCXA 5HARA 5D3OA 1TEMA 3PBOA 2ZC6B 5GLBA 5HAQA 2OLVA 2UWXA 1W5DA 3O88A 4GOGA 2WADA 4GNUA 4U0TA 3CMZA 4EQIA 3V5MA 2Y59A 4OONA 3CZDA 1W7FA 1NRFA 1K4FA 5FSRA 4E6XA 3ZG0A 5J8XA 1ES3A 2HDUA 1PYYA 4HESA 4QY5A 4RX2A 1EWZA 3TG9A 1RGYA 2WGWA 2Y2KA 5GLAA 4R23A 3IXDA 3C5AA 1KDWA 5FAPA 4N9LA 1M40A 2V20A 2Y2OA 1NZUA 4FSFA 1ERQA 4MBHA 4ZAMA 4DRTA 3WRZA 3HLWA 5DF7A 3IT9A 4LV3A 2Y2MA 3RJUA 1L0DA 3BYDA 2Y2QA 3QHYA 4OP5A 5FA7A 5A92A 3PBRA 4GN2A 2I72A 4WELA 1CK3A 3C4OA 3HBRA 5FQQA 5GHZA 1ZKJA 2Z2MB 3IF5A 4JXSA 5KSHA 3M6HA 2Y2LA 4E6WA 4QY6A 3SH9A 3N8RA 4GB7A 2ZQDA 4S2LA 1N9BA 3HVFA 3P98A 5DF8A 1IKGA 1K56A 3GSGA 1GA0A 4DE3A 4LV2A 1BLHA 3OZHA 3IXBA 1G68A 4S2PA 5HW3A 5I94A 2HDQA 1ZG6A 3IF6C 4ID4A 4KZ9A 4E3IA 3IF6A 3IXHA 2BG1A 4C75A 2IWCA 5GHYA 5IHVA 5JYOA 1IYSA 1MY8A 3OPHA 3FKWA 2ZLYA 5TR7A 2WK0A 2XR0A 3BFCA 3V39A 3G35A 1JWZA 4E3MA 4JF5A 3N6IA 4H8RA 5FQIA 2P9VB 2FFFB 4X55A 2HP5A 1TDLA 5FQKA 1IEMA 5EVIB 5G18A 3NC8A 4U0XA 1IYOA 3IXGA 5M18A 1NZOA 2XQZA 4FH4A 3E2KA 1HVBA 5TGFA 4P87A 5CGXA 1CI9A 2HDRA 3LO7A 4KQRA 2PU2A 3JYIA 4OVDA 4R1GA 5FI6A 5FQ9A 3SH7A 1JWVA 2ZC5B 2IWDA 3HLDA 5EVID 3UDFA 4X68A 5CTMA 3NCKA 3CG5A 5M1AA 4OKPA 1KVMA 4Z9QA 4B4XA 3SOIA 1ESUA 1PWDA 3DTMA 3VMAA 3S1YA 3G4PA 3HUMA 1LHYA 4OP8A 4OPYA 4GD6A 4L0LA 4KZ8A 5DTKA 1MXOA 5FDHA 4WMCD 4DKIA 4R3BA 5DF9A 3RXXA 3LY4A 4X53A 3W8KA 1VM1A 3MZEA 4BD0A 4O7DA 5CGWA 4MLLA 3MFDA 3NY4A 1CEGA 4K0WA 4PMAA 1BUEA 1TDGA 2EXAA 2QPNA 4PPRA 2IWBA 3SS5A 2XGNA 3WS5A 3SS4A 1BLSA 1K25A 1DJBA 1ES2A 3OC2A 1Z6FA 4S2NC 1XGIA 1JTDA 4S2NA 2OSUA 1H5XA 1MWSA 3HUOA 5F83A 1H8YA 1IELA 1MKIA 4KG5A 5FQJA 1OMEA 1E3UD 2EX8A 3W4PA 5M19A 2XLNA 2ZC3B 4ZBEA 1CI8A 5TFQA 2G2UA 1XP4A 5CHMA 4NETA 4GKUA 3W4OA 5EVLA 4KG6A 3HUNA 3O3VA 3HL9A 3OCNA 2DNSA 2H5SA 2OLUA 3MZDA 4ZJ2A 5KSCA 1C3BA 1FR1A 4KZ4A 5EVIC 1FCNA 1ES4A 4OH0A 1ERMA 2ZD8A 1NYYA 3MZFA 3G32A 2J7VA 5HL1A 4UA6A 2A49A 3S4XA 5GLCA 2PBYA 1H8ZA 3ZG8B 2XFTA 3SS3A 1HD8A 4M3KA 3IWQA 4IVKA 1W79A 4RA7A 4R0QA 2P74A 3N8SA 4LENA 3TSGA 4HBUA 3OPLA 1YT4A 2R9WA 2ZQ9A 1FR6A 4EUZA 5AQ9A 1JVJA 5EUAA 2EX2A 4R4RA 3BEBA 3FZCA 2WYXA 1YLZA 5E2GA 1GCEA 4S2IA 5EPHA 1MWTA 3UY6A 1KVLA 4RVAA 3FKVA 4S2KA 5FI7A 1L2SA 1KGEA 5CERA 4BQMA 3IHBA 1KE4A 3BFEA 3N8LA 3VP0A 1XXMA 2WAFA 2WZXA 3Q7VB 4WZ5C 4C3QA 1DY6A 3OCLA 1XPBA 4WZ5A 1PWGA 4LV1A 5U47A 3UE1A 3AGDA 4X6TA 3VFHA 1SHVA 1MWRA 4PM6A 2WZZA 4X69A 1L0GA 4QJGA 4WEKA 2HPBA 4KG2A 4N92A 1FSYA 4LV0A 1BLPA 2R9XA 3WRTA 1LL5A 4GDBA 4IBRA 5EOEA 3GTCA 4YFMA 2E8IA 4EBLA 1CEFA 1GHIA 1LLBA 2GDNA 4DXCA 3UO9A 3V50A 2XD5A 1EI5A 4OOMA 3MKEA 3PBQA 3IHAA 1KE0A 1K4EA 4PM5A 1WYBA 2C5WB 1I2WA 1LI0A 2Q9NA 3FV7A 3V3SA 2ZQ8A 1S0WA 1K6RA 5CECA 2H0YA 4P0MA 5CRFA 4OOLA 3UNWA 5DTSA 1Q2PA 1E25A 1WYCA 3A3IA 1PZPA 3IWIA 5CEBA 1MBLA 4Y0TA 3BECA 3UN7A 3MBZA
chains in the Genus database with same CATH superfamily
3HLGA 4OLGA 3W2ZA 4OPRA 3S22A 5CTNA 4O01A 2PAVP 2RL3A 5CEDA 4R3JA 4B4ZA 2WAEA 2P08A 2X71A 3IQAA 5FAOA 3ZVTA 4KQOA 4D2OA 1EROA 1GHMA 3EQVA 4NKPA 2OAQ1 4HBTA 3BY8A 1NYMA 3M2KA 4MBFA 4KUKA 1BTLA 2IA2A 3LICA 3F1NB 1BT5A 1H8MA 1K57C 4DF6A 4IEDA 3JPUA 4OQIA 1ALQA 2ZL1B 3ZQ5A 4OPZA 4NXGA 2GNXA 5AVEA 4ZDXA 3BM6A 4HH2A 4KENB 1KOUA 1Y28A 1FQGA 5HDSA 1S6RA 2PYPA 1G6OA 3UB7A 1CF0A 3G34A 4QB8A 2OAP1 3GRJA 3V3RA 2XK1A 3ITAA 1ONGA 5HPIA 5L09A 1ZC2A 4YINA 2V0UA 3WRZA 2ACGA 1E3UA 3T50A 3GECA 4I38A 2PD7A 1K6SA 3B47A 1P9RA 2XD1A 4PM8A 4G3VA 5A93A 5E43A 1BLCA 1KDSA 1CJFA 2HJEA 2Y2JA 1XA1A 1DP9A 3A3JA 4LCMA 4E3NA 3BLSA 3CUEA 4YNRA 3VP3A 4UA9A 2W0NA 3VSKA 1KE3A 1H0MA 1IYQA 4P85A 2HDSA 1H3QA 5L07A 3ITBA 4I3AA 2LB5A 1F2KA 3VP1A 1NLYA 4AFIA 2EX6A 3ZNTA 3NECA 3AGFA 3IH9A 3P09A 1N9OA 3NOUC 1AXBA 5HZHA 3Q7VA 5E2EA 2KLIA 1W8QA 4GW9A 4GDNA 3A3FA 2JCHA 2WKPA 4G3WA 1DP6A 4BL2A 3BFFA 2Q9MA 5I5LA 2B5RA 1XJ6A 1BZAA 1PW8A 4F3LA 4H6JA 1ODVA 4WZ4A 2FFYA 4BD1A 3BRMA 3UE3A 2BLSA 2Y91A 1I5QA 3CLOA 4IUKA 4LCLA 3O5YA 2ZC4B 2W1TB 2JE5A 3HLEA 3UB8A 1YLPA 2K2NA 1YQSA 4QU3A 4ZJ1A 4CLCD 5HWWA 3C7VA 3A3DA 1WE4A 5JYPA 3BW6A 2CMNA 4XT2B 2OLVA 2UWXA 1W5DA 1FIKA 3O88A 4GNUA 4U0TA 3CMZA 3V5MA 2VV7A 4E6XA 3IS2B 5J8XA 2JKTI 4RX2A 2HDUA 1PYYA 3KSIA 3TG9A 3LI8A 4R23A 3BY9A 1KDWA 1XJ3A 4N9LA 1M40A 2V20A 4FSFA 3EOIA 4LV3A 2Y2MA 3BYDA 1FILA 5EM1A 5A92A 3C4OA 3HBRA 4JXSA 3C38A 2M7VA 5KSHA 3M6HA 4E6WA 3SH9A 1IFQA 2QJ7A 4X1MA 3IX3A 4S2LA 3GSGA 3F1NA 2BASA 3IXBA 1G68A 5IU1A 1ZG6A 3K2NA 4ID4A 3T1RA 2ZL1A 2IWCA 5IHVA 1MY8A 3NOTC 2INWA 3FKWA 2ZLYA 5TR7A 3BFCA 3H9WA 3DTIA 1JWZA 4JF5A 4DJ2A 5FQIA 5FQKA 2EWVA 5G18A 2PR6A 3MF0A 4FH4A 2HDRA 4OVDA 2V1BA 3D3OA 2ZC5B 5AJGA 2IWDA 2O9AA 5K5BA 4NXBA 3T4JA 5M1AA 3NCKA 2JKFA 4OKPA 4FTXA 3VMAA 4IHQA 2J3TD 3TW8A 1NWZA 4L0LA 4MCWA 4DN0A 2KDKA 1VEUB 4WMCD 4DKIA 5DF9A 3RXXA 2I9VA 4EU0A 3QP5A 4PMAA 2IWBA 2XGNA 3OC2A 4S2NC 3CAXA 4HP9A 4L9EA 1H8YA 1IELA 1MKIA 1OMEA 2EX8A 3UB5P 4ZBEA 3LI9A 1LSWA 1XP4A 1SKOB 3U4LP 1HLUP 2OLUA 5KSCA 1C3BA 4EW7A 1NLZA 3MZFA 2J80A 1DP8A 2PBYA 5FDSA 3G6OA 2VX8A 3IWQA 4IVKA 3TSGA 4HBUA 1PRQA 4JGPA 5HSQA 4R70A 5AQ9A 5EUAA 3LUQA 5E2GA 4DJ3A 1GCEA 4S2IA 3FKVA 4HOIA 1STZA 5CERA 4C3QA 1XPBA 3LGOA 4LV1A 5U47A 4L9FA 3BQ8A 4NXEA 1SHVA 4BMWA 4QJGA 4HH3A 3P7NA 3WRTA 3BWLA 1LL5A 4GDBA 5EOEA 1V9YA 2VGLM 4YFMA 4EBLA 1CEFA 1GHIA 2GDNA 4DXCA 3V50A 2XD5A 3MKEA 3V3SA 2Q9NA 1LI0A 1ACFA 2G7UA 1K6RA 3KYQA 4XT2A 3S7QA 3TE8A 3IS2A 1F9IA 2VV6A 3NHQA 1NRJA 4NEED 1P9WA 3C4PA 2QMIA 1XGJA 3OPPA 3QNCA 3M6BA 4QD4A 3T4SA 4K91A 4OLDA 2VV8A 2P7JA 5HAPA 2PR5A 5FQMA 3IX8A 2WGWB 1XA7A 4E3JA 4UA7A 3UDIA 4FCFA 5A90A 4MN7A 2B18A 4BJPA 3D72A 2M1CA 3IWOA 1G6AA 3F1OB 2C6WB 4KZBA 4BL3A 3O86A 5G4YA 3WS2A 3UDXA 1NY0A 1I2SA 3MXQA 2ZQAA 2VK3A 2ZOIA 4CLCB 3VE4A 3NIAA 1V9ZA 4EV4A 3SH8A 2OOLA 2W3HA 5KIZA 2H28A 2ZMFA 2ZMVA 4MEZA 3MXSA 1J9MA 4RX3A 5IT5A 3A0RA 3RTYA 4NG2A 1LT0A 3ZDJA 2WKEA 3VSLA 1VEUA 1D06A 3E4QA 4WLAA 3VOZA 4CLCE 1ES5A 2Y2IA 3G2ZA 2VGKA 4KZ3A 3UPNA 1PW1A 5FAQA 2Y8HA 3G30A 4EWFA 3Q1FA 4R6LA 4UAAA 3MR0A 1K55A 5AQ7A 1FCOA 5FI2A 5DFXA 5FASA 2JKRI 1PI5A 3E2LA 1PZOA 5F82A 1S1ZA 3NDGA 5FL3A 3VFFA 4I3IA 1RP5A 1SDNA 1L0FA 1VQQA 3T4OA 3L7HA 1SKOA 3A0SA 1A0KA 4DXBA 2Z2LB 1YLYA 1D7EA 2FZ0A 3CUEC 5LBRA 3MJQA 1QMEA 4LPZA 1QMFA 2JN7A 2ZM0A 3DWKA 4K0XA 2R78A 5GLDA 1ZTUA 3IH8A 1KGGA 3FWLA 4BWIA 4IVIA 5A91A 2WKHA 2VLGA 2H0TA 3HLFA 5DJUA 1LL9A 4C6YA 3WS0A 3TRCA 4N1HA 3VP2A 4FD8A 3GR2A 3N4IA 1IOUA 2J8YA 4N1XA 3EGXC 2NUPC 3Q07A 4G3KA 4EUVA 1K38A 2H10A 4IJGA 4KQDA 4JXVA 4WUJA 1JTGA 1XJ2A 1LI9A 1OJGA 3MQOA 3G2YA 1YMSA 4JGOA 2Y2GA 3CHWP 4KZ6A 3B42A 3PTEA 4EBNA 2E8JA 1F5MA 1K56D 1TS8A 4Z1WA 3MQQA 1YM1A 5TBMB 4DE1A 3DWZA 3L9KA 4JF6A 5E2HA 3BFGA 4JBFA 3HCYA 2RCXA 3A0VA 3LFVA 5G4ZA 2ZC6B 5HL6A 3KX0X 5GLBA 5F68A 5HAQA 5A8BA 5HPFA 3E4OA 4Y2FA 1K4FA 2WGWA 4Y5FA 3IXDA 3C5AA 3T1XA 2Y2OA 1NZUA 4EQ1A 3HLWA 4GCZA 5DF7A 3IT9A 1L0DA 3F1OA 4OP5A 4LRXC 4WELA 5GHZA 1ZKJA 2EWWA 3NOPC 2VGLS 1VHMA 2L0WA 4QY6A 3N8RA 4I5SA 1IKGA 4CLCA 5HW3A 4WL9A 2HDQA 3IF6A 5GHYA 3KYEA 3ULFA 5TJJA 2GX5A 3PXPA 2WKRA 3DAVA 2FFFB 4X55A 1IEMA 5EVIB 4DMZA 3NC8A 1IYOA 2XQZA 4M4XA 2Q0OA 4KQRA 3SH7A 4R1GA 1LSVA 4B4XA 4OPYA 1UWPX 5DKKA 3K3CA 5DTKA 3PYPA 2PBDP 1G28A 3MZEA 3KO6A 4MLLA 1CEGA 1S66L 3C2WA 2QPNA 4LFUA 2XA7S 2Z6DA 3SS4A 3UB9A 1Z6FA 3HUOA 4KG5A 5FQJA 1E3UD 2ZC3B 2L1MA 3T12B 1CI8A 3S7PA 2EA9A 5TFQA 5DFYA 5CHMA 1OTAA 3HL9A 5FEFA 3OCNA 2DNSA 2H5SA 4EESA 2PYRA 1FR1A 5EVIC 1J3WA 1ERMA 1NYYA 2PDRA 1Y4OA 5HL1A 4L9GA 3ZG8B 2XFTA 3SS3A 1HD8A 4B93A 2P74A 4LENA 1SZVA 1FR6A 2EX2A 1MC0A 3SZTA 5EPHA 1MWTA 4RVAA 4KUOA 5FI7A 4EXOA 1L2SA 3RH8B 2WZXA 3OCLA 4WZ5A 1PWGA 1OJ5A 3B33A 4X6TA 3VFHA 3EEAA 2WZZA 4PM6A 1TS6A 3BQAA 2XSSA 4KG2A 4N92A 2R9XA 5HDDA 3LIEA 5TBMA 1LLBA 3UO9A 3MQ0A 5FEGA 2K31A 1KE0A 4PM5A 4HJ3A 2ZQ8A 4WN5A 1S1YA 4P0MA 3UNWA 5DTSA 1E25A 1MKMA 1WYCA 3LEQA 4RQ9A 2W3DA 1MBLA 4Y0TA 3BECA 3UDFA 2L4RA 4S2MA 3FYZA 3DBAA 4JF4A 5DJTA 3E0YA 1Q2QA 1DJAA 1BULA 2CC1A 2OWJA 1FSWA 5HD5A 2PU4A 3LR4A 1N9NA 3VE3A 5EECA 1ESIA 3MKFA 3BFDA 1DJCA 4OQGA 5DTTA 2V8FA 4E3OA 1OTEA 3LIDA 1HTZA 1U60A 1Y54A 3ISGA 3ZFZA 1E4DA 3ZHHA 4DDSA 3Q82A 4JXWA 4S2JA 4EEUA 5EVIA 2V8CA 3BLMA 4HP4A 4BBVA 5GHXA 2B02A 3ZGAB 3UE6A 4OQ0A 1K54A 3OPRA 1GSVA 4ESPA 1FCMA 3FPWA 4OOYA 1W63Q 4UQIS 4KQQA 3NULA 3GV9A 5DKLA 3GDIA 5F1GA 5BOHA 2PT7A 5EVEA 1XFNA 1M6KA 5CXWA 1WA9A 2OWHA 4EBPA 3M2JA 3JVUA 2X02A 1PI4A 2Y2NA 4ZTKA 4Q8IA 2B95A 4FUWA 3PBSA 3LIAA 1RCJA 5EV0A 3N7WA 1K55C 4GS9B 1S4SA 4WM9A 5CX7A 5AQBA 3VP4A 4ZRRA 3K3DA 3ZG5A 1PWCA 2D02A 3NBLA 5AQAA 3HLBA 1EW0A 2WGIA 4B9OA 1YKDA 4JLFA 4OQHA 1YLJA 2EFUA 2LB9A 3T4QA 1KGFA 4X56A 4R3AA 3WS4A 4OPQA 3FC7A 3GQZA 2ZBBA 3F1PB 1YLTA 3B3XA 3MS6A 1YLWA 4XUXA 4WBGA 1ZHHB 1MWUA 3VV4A 3ZVWA 1YMXA 5CHJA 1XX2A 4P6BA 2ZJ9A 3EWKA 2ZQCA 1MPLA 3NDEA 2XFSA 2Y2HA 4F94A 2WKQA 2O9CA 4CJNA 1GHPA 2GZAA 1IKIA 4KZ7A 5EOOA 3CWFA 3WS1A 1P97A 2DRWA 5E2FA 1W8YA 3LCEA 2WGVA 3RXWA 2JBFA 1HZOA 2EFXA 3ZNYA 4A5RA 5F6AA 1OT6A 2ZQ7A 1PNEA 5CGSA 3QP4A 3G31A 3DW0A 4HHDA 3MSHA 4MNRA 2XA7M 3IF6B 3UPPA 3WWXA 1P0ZA 2A3UA 5L2FA 3I7JA 5IS1A 5HX9A 1SCWA 4N9KA 4RYEA 2Y2PA 2WKIA 2J3WA 3A3EA 1T1AA 1YSPA 2OV5A 2QZ6A 2YKHA 5D3OA 1K0KA 1TEMA 4QPRA 3PBOA 3QP8A 2VKSA 3IX4A 4GOGA 2WADA 4EQIA 3H82B 2W3GA 3CZDA 1W7FA 5HD3A 5FSRA 2AVXA 3ZG0A 1ES3A 4HESA 4QY5A 1RGYA 2Y2KA 3OBFA 2JKRM 3OLOA 5FAPA 1TF1A 4ZAMA 4MBHA 1ERQA 3UMDA 3D9YA 3RJUA 4Y15A 2K7SA 1Z09A 2I72A 5FQQA 3QP6A 1W63M 3KSHA 4GB7A 5J4EA 3DTKA 1N9BA 3HVFA 5J7EA 1K56A 3LYXA 4CLCC 4DE3A 4Q0JA 3OZHA 4S2PA 5I94A 3IF6C 3LR0A 2BG1A 3OPHA 1S67L 4H8RA 2P9VB 4PKYG 1TDLA 4UEYA 4U0XA 3IXGA 1NZOA 2VJWA 2FH5A 1YSQA 5TGFA 5CGXA 2Z6CA 5FQ9A 3JYIA 5FI6A 1JWVA 3P01A 4P6ZM 4X68A 3CG5A 2MJ6A 4GS9A 1ESUA 3DTMA 3S1YA 3G4PA 5HWVA 2VA0A 4KZ8A 5FDHA 1MXOA 2QJ5A 4O8GA 4I3JA 3LY4A 3W8KA 1VM1A 4O7DA 1L3LA 3NY4A 4K0WA 1TDGA 2EXAA 3SS5A 2HZ5A 4Y3IA 1K25A 1ES2A 1DJBA 1XGIA 4YOFA 1H5XA 2V9AA 2Y79A 3W4PA 3T4KA 3F1PA 2G2UA 4NETA 3W4OA 2A24B 5EM0A 5EVLA 4KG6A 3HUNA 3O3VA 3MZDA 4ZJ2A 4CQHA 1FCNA 4EERA 1ES4A 4OH0A 2P04A 3BJNA 4JGRA 3G32A 2J7VA 4UA6A 2JHEA 3S4XA 3TJZC 5GLCA 2J3TC 1W79A 4RA7A 4R0QA 2PRFA 4UQIM 1F98A 3OPLA 1TS0A 4X25A 1YT4A 2R9WA 3IBRA 2ZQ9A 4EUZA 3FG8A 3VOLA 4HIAA 3BEBA 2VZWA 4JGQA 3UY6A 1KVLA 2O99A 4LRZE 3CPTB 3CI6A 5HWTA 4BQMA 3N8LA 3VP0A 3T1SA 1XXMA 2WAFA 4WZ5C 4K08A 1DY6A 3MMHA 3QP2A 2UV0E 3AGDA 4MMNA 1MWRA 1L0GA 1S4RA 3LIFA 2HPBA 1XFQA 1VETB 2PHYA 1BLPA 3GTCA 2XRNA 4GHIB 4HI4A 4OOMA 4YWZA 3LR5A 1YAXA 3IHAA 3FV7A 1I2WA 1GSWA 2H0YA 4OOLA 1Q2PA 2VEAA 3A3IA 1PZPA 3H82A 4WF0A 4II7A 4ETXA 1OTIA 3HLCA 2O9BA 4MBKA 4DDYA 1NXYA 4JPMA 1LSXA 4LRYC 2M7UA 2V0WA 1UWNX 4MDZA 3TOIA 3S7NA 3AGEA 4BBTA 5GL9A 1G5UA 4B88A 5F1FA 1YPRA 3UE0A 2G2WA 3V67A 4IBXA 1RGZA 2ZC7A 3GMWA 3VOYA 4KZAA 2P9VA 2EX9A 5L8MA 1K57A 3ICYA 3GVBA 3LY3A 1OTBA 1D1JA 4ARZB 2JKTM 3R7WB 3T4LA 1K54C 4KZ5A 4MN5A 2Y55A 1FOFA 1SKFA 1O7EA 4JKTA 2J9PA 4WMCA 4R38A 2HV1A 5DVAA 1OTDA 1ZG4A 1O07A 2DCFA 4CPKA 4ETZA 5MC7A 3Q7ZA 3MXRA 5KZHA 1ONHA 2HP6A 3UPOA 4ZJ3A 2QYBA 3EGDC 4XXRA 1XKZA 3HJIA 5FATA 1BYWA 4BLMA 5J3WA 5HDCA 3E98A 3Q81A 4PM7A 3O87A 3T4TA 3EEHA 1N4OA 4QHCA 4Y17A 3DTEA 3ZG9B 4Q0HA 2J9OA 3H7WB 3LR3A 1T1BA 4U3TA 3PBNA 2DMWA 5EE8A 1L0EA 3HREA 4GZBA 3PAEA 4Y7PA 2A24A 1BSGA 4LGWA 4O0PA 4DE0A 2W3FA 1IYPA 2QWSA 1T1CA 2WUQA 2JC7A 4P6ZS 2V1AA 3QNBA 1UGUA 2V1ZA 2W27A 3ZG7B 2Y4AA 3S7OA 1JWPA 4HEFA 2HP9A 4Y0UA 4WYYA 4ME4A 3EQUA 1LL8A 3C30A 3PBTA 1NJ4A 4PHTA 2VGJA 4WEJA 3CPTA 3W4QA 4XUZA 2XEPA 2D01A 3C7UA 3T1QB 5KMWA 4GJ4A 2X01A 4Y0OA 1PIOA 1TVFA 4HY8A 3ZCZA 4IUHA 3KSFA 4FH2A 4JXGA 2EXBA 1CQAA 5CHUA 4HNBA 2W3EA 1VETA 2XDMA 2O0YA 1GA9A 2ZM2A 4M3KA 2ZM8A 3LEZA 1SDEA 2XF3A 4PM9A 3CJMA 3SW1A 4GHIA 2BTFP 3KSGA 4S2OA 5HAIA 3NI9A 4NK3A 4UHUA 3D4FA 5HFOA 2V2FF 2ZMAA 3RFBA 2HGVA 4GD8A 4E3KA 2NUTC 5AVFA 4BENA 4HQAA 2XH9A 3PAGA 4R4SA 5HARA 1JNUA 4HJ4A 4I39A 1T19A 2Y59A 4OONA 1NRFA 1EWZA 3QP1A 5GLAA 4PAUA 5EFWA 3UB6A 4E3LA 4DRTA 1AWIA 2QKPA 2PD8A 3E4PA 4FOFA 2Y2QA 1N9LA 3QHYA 5FA7A 1OT9A 3PBRA 4GN2A 4EETB 1CK3A 2Z2MB 3IF5A 2Y2LA 4Y13A 2ZQDA 5DF8A 3P98A 1GA0A 4LV2A 3OOVA 1BLHA 4KZ9A 4GLQA 4E3IA 2W1TA 5F5YA 3IXHA 4C75A 2ZOHA 5JYOA 1IYSA 4ARZA 1OPXA 3R7WA 2WK0A 3MFXA 3ZYTA 2XR0A 3NJAA 3V39A 3G35A 4E3MA 3C8CA 3N6IA 3FPVA 1MZUA 2HJ9C 1PFLA 2HP5A 4NXFA 5L10A 5M18A 3UMEA 4HJ6A 3E2KA 1HVBA 2A2LA 4P87A 1CI9A 3LO7A 4DE2A 2PU2A 3CITA 3HLDA 5EVID 5CTMA 1KVMA 4Z9QA 4EEPA 3SOIA 4LLOB 1PWDA 3HUMA 1LHYA 4OP8A 4GD6A 1TD5A 3H7WA 4R3BA 2KX6A 4X53A 5CGWA 3R4KA 1DRMA 3MFDA 1BUEA 5F69A 4PPRA 2YKFA 3WS5A 1BLSA 5C5KA 2JKGA 1JTDA 4S2NA 2OSUA 1MWSA 5F83A 4MN6A 3JVVA 5M19A 1XJ4A 2XLNA 3PR6A 4GKUA 3PHYA 4X1LA 4KZ4A 4Q0IA 2ZD8A 2GJ3A 3LIBA 2A49A 1X0OA 1H8ZA 3N8SA 2W1RA 1JVJA 4R4RA 3FZCA 2WYXA 1YLZA 4S2KA 1VB6A 1TS7A 1GSXA 1KGEA 2QHKA 3HJKA 3IHBA 1KE4A 3BFEA 4PKYA 3Q7VB 4BBUA 3UE1A 4X69A 4F3LB 4H6JB 2KOIA 1T18A 4WEKA 1FSYA 4LV0A 2XROA 4IBRA 2E8IA 4E04A 3IBJA 1EI5A 3PBQA 1K4EA 3U2AA 1WYBA 2C5WB 3KYZA 1S0WA 5CECA 4D60A 5CRFA 2HF6A 4QWOA 3IWIA 5CEBA 4BD0A 3UN7A 3MBZA
chains in the Genus database with same CATH topology
3HLCA 3HLGA 4OLGA 4S2MA 3FYZA 4MBKA 3C4PA 4DDYA 1NXYA 4OPRA 2QMIA 4JF4A 1XGJA 3OPPA 4JPMA 1Q2QA 3QNCA 3S22A 3M6BA 1DJAA 4QD4A 5CTNA 1BULA 4K91A 2RL3A 4OLDA 2CC1A 5CEDA 4R3JA 4B4ZA 5HAPA 1FSWA 2WAEA 5FQMA 2PU4A 2X71A 3IQAA 3TOIA 2WGWB 5EECA 5FAOA 1XA7A 3AGEA 4E3JA 3ZVTA 4KQOA 4UA7A 4D2OA 3UDIA 5GL9A 1ESIA 1EROA 4FCFA 3MKFA 5A90A 1GHMA 3BFDA 4B88A 3EQVA 5F1FA 1DJCA 4OQGA 5DTTA 4BJPA 3IWOA 1G6AA 3UE0A 4E3OA 2C6WB 4KZBA 2G2WA 4BL3A 3O86A 4IBXA 4HBTA 3WS2A 1NYMA 3M2KA 1HTZA 4MBFA 3UDXA 1BTLA 1RGZA 1U60A 1NY0A 1Y54A 2ZC7A 3GMWA 3ISGA 3VOYA 1I2SA 3ZFZA 4KZAA 1E4DA 2ZQAA 1BT5A 2P9VA 3ZHHA 4DDSA 4DF6A 1K57C 2EX9A 3Q82A 4JXWA 4S2JA 4IEDA 1K57A 4OQIA 5EVIA 3GVBA 1ALQA 3LY3A 3BLMA 4OPZA 4ZDXA 3NIAA 5GHXA 3BM6A 4KENB 3ZGAB 4EV4A 1K54C 4KZ5A 3SH8A 4OQ0A 1K54A 2Y55A 3OPRA 1FOFA 1SKFA 1FCMA 1O7EA 1FQGA 4JKTA 4OOYA 2J9PA 4KQQA 1S6RA 3GV9A 4WMCA 5F1GA 4E3LA 5BOHA 3G34A 4QB8A 5DVAA 1ZG4A 1O07A 1M6KA 2DCFA 4MEZA 4CPKA 3MXSA 3Q7ZA 5CXWA 3GRJA 1J9MA 3MXRA 3V3RA 2XK1A 5KZHA 4RX3A 3ITAA 4EBPA 1ONHA 2HP6A 1ONGA 3UPOA 3M2JA 4ZJ3A 2X02A 4XXRA 1PI4A 2Y2NA 1XKZA 4ZTKA 4Q8IA 5FATA 3ZDJA 2WKEA 3VSLA 4DE2A 4BLMA 3Q81A 1ZC2A 4PM7A 3VOZA 4YINA 3PBSA 1ES5A 2Y2IA 1RCJA 2VGKA 1E3UA 3G2ZA 3N7WA 3O87A 1PW1A 4KZ3A 5FAQA 3G30A 3UPNA 4EWFA 3Q1FA 1K55C 4UAAA 1K55A 5AQ7A 1N4OA 1FCOA 5FI2A 4QHCA 4WM9A 1K6SA 5AQBA 5FASA 1PI5A 3ZG9B 3E2LA 3VP4A 1PZOA 2XD1A 4PM8A 5F82A 3NDGA 2J9OA 3VFFA 5A93A 5E43A 1RP5A 3ZG5A 4U3TA 1PWCA 1BLCA 1SDNA 1L0FA 3PBNA 1VQQA 1KDSA 5EE8A 3NBLA 1L0EA 5AQAA 3HLBA 3HREA 4GZBA 3PAEA 4Y7PA 2WGIA 1BSGA 4JLFA 4OQHA 2Y2JA 1XA1A 4DXBA 1YLJA 2Z2LB 3A3JA 2EFUA 4DE0A 4LCMA 1YLYA 1KGFA 1IYPA 4X56A 4E3NA 3BLSA 2WUQA 3WS4A 1QMEA 4OPQA 1QMFA 3VP3A 2JC7A 4UA9A 3GQZA 2ZM0A 3DWKA 3QNBA 1YLTA 3B3XA 2V1ZA 4K0XA 5GLDA 3VSKA 1KE3A 3IH8A 1IYQA 1YLWA 4WBGA 4XUXA 1MWUA 3ZVWA 3ZG7B 4P85A 2HDSA 1KGGA 1YMXA 3ITBA 5CHJA 2Y4AA 3FWLA 1JWPA 1XX2A 4P6BA 2ZJ9A 4HEFA 4IVIA 2HP9A 2ZQCA 5A91A 1MPLA 2WKHA 4Y0UA 2H0TA 3HLFA 3NDEA 4WYYA 3VP1A 1LL9A 2XFSA 4C6YA 2Y2HA 3EQUA 2EX6A 3WS0A 4F94A 3ZNTA 3PBTA 1NJ4A 4N1HA 3VP2A 3AGFA 2VGJA 3IH9A 4WEJA 3P09A 4FD8A 3W4QA 4CJNA 1GHPA 1AXBA 3GR2A 3N4IA 2XEPA 4XUZA 1IKIA 4KZ7A 5EOOA 3Q7VA 5E2EA 2J8YA 3WS1A 1W8QA 3C7UA 4N1XA 4GDNA 5KMWA 3A3FA 2JCHA 2X01A 4BL2A 4Y0OA 2DRWA 3BFFA 1PIOA 1TVFA 1W8YA 2Q9MA 3Q07A 5E2FA 3LCEA 3ZCZA 2WGVA 2B5RA 3RXWA 1BZAA 1PW8A 2JBFA 1K38A 4FH2A 4JXGA 2H10A 2EXBA 1HZOA 4WZ4A 4JXVA 2EFXA 2FFYA 5CHUA 3ZNYA 4A5RA 4BD1A 1JTGA 3BRMA 3UE3A 2XDMA 2ZQ7A 1GA9A 1LI9A 2BLSA 5CGSA 2Y91A 2ZM2A 1I5QA 3G2YA 2ZM8A 3G31A 3DW0A 1SDEA 1YMSA 2XF3A 3LEZA 4LCLA 4PM9A 3CJMA 2ZC4B 4MNRA 2Y2GA 4S2OA 5HAIA 3IF6B 3UPPA 4KZ6A 3WWXA 2JE5A 3NI9A 4NK3A 3PTEA 2A3UA 4UHUA 3D4FA 5HFOA 3HLEA 4EBNA 5L2FA 1YLPA 2V2FF 3I7JA 1K56D 2ZMAA 5HX9A 1SCWA 1YQSA 1YM1A 4QU3A 4N9KA 4RYEA 2Y2PA 4ZJ1A 4GD8A 4E3KA 2WKIA 3A3EA 3DWZA 4BENA 4DE1A 4JF6A 5E2HA 2OV5A 3C7VA 3BFGA 2QZ6A 3A3DA 2XH9A 3PAGA 4JBFA 1WE4A 4R4SA 5JYPA 2RCXA 5HARA 5D3OA 1TEMA 3PBOA 2ZC6B 5GLBA 5HAQA 2OLVA 2UWXA 1W5DA 3O88A 4GOGA 2WADA 4GNUA 4U0TA 3CMZA 4EQIA 3V5MA 2Y59A 4OONA 3CZDA 1W7FA 1NRFA 1K4FA 5FSRA 4E6XA 3ZG0A 5J8XA 1ES3A 2HDUA 1PYYA 4HESA 4QY5A 4RX2A 1EWZA 3TG9A 1RGYA 2WGWA 2Y2KA 5GLAA 4R23A 3IXDA 3C5AA 1KDWA 5FAPA 4N9LA 1M40A 2V20A 2Y2OA 1NZUA 4FSFA 1ERQA 4MBHA 4ZAMA 4DRTA 3WRZA 3HLWA 5DF7A 3IT9A 4LV3A 2Y2MA 3RJUA 1L0DA 3BYDA 2Y2QA 3QHYA 4OP5A 5FA7A 5A92A 3PBRA 4GN2A 2I72A 4WELA 1CK3A 3C4OA 3HBRA 5FQQA 5GHZA 1ZKJA 2Z2MB 3IF5A 4JXSA 5KSHA 3M6HA 2Y2LA 4E6WA 4QY6A 3SH9A 3N8RA 4GB7A 2ZQDA 4S2LA 1N9BA 3HVFA 3P98A 5DF8A 1IKGA 1K56A 3GSGA 1GA0A 4DE3A 4LV2A 1BLHA 3OZHA 3IXBA 1G68A 4S2PA 5HW3A 5I94A 2HDQA 1ZG6A 3IF6C 4ID4A 4KZ9A 4E3IA 3IF6A 3IXHA 2BG1A 4C75A 2IWCA 5GHYA 5IHVA 5JYOA 1IYSA 1MY8A 3OPHA 3FKWA 2ZLYA 5TR7A 2WK0A 2XR0A 3BFCA 3V39A 3G35A 1JWZA 4E3MA 4JF5A 3N6IA 4H8RA 5FQIA 2P9VB 2FFFB 4X55A 2HP5A 1TDLA 5FQKA 1IEMA 5EVIB 5G18A 3NC8A 4U0XA 1IYOA 3IXGA 5M18A 1NZOA 2XQZA 4FH4A 3E2KA 1HVBA 5TGFA 4P87A 5CGXA 1CI9A 2HDRA 3LO7A 4KQRA 2PU2A 3JYIA 4OVDA 4R1GA 5FI6A 5FQ9A 3SH7A 1JWVA 2ZC5B 2IWDA 3HLDA 5EVID 3UDFA 4X68A 5CTMA 3NCKA 3CG5A 5M1AA 4OKPA 1KVMA 4Z9QA 4B4XA 3SOIA 1ESUA 1PWDA 3DTMA 3VMAA 3S1YA 3G4PA 3HUMA 1LHYA 4OP8A 4OPYA 4GD6A 4L0LA 4KZ8A 5DTKA 1MXOA 5FDHA 4WMCD 4DKIA 4R3BA 5DF9A 3RXXA 3LY4A 4X53A 3W8KA 1VM1A 3MZEA 4BD0A 4O7DA 5CGWA 4MLLA 3MFDA 3NY4A 1CEGA 4K0WA 4PMAA 1BUEA 1TDGA 2EXAA 2QPNA 4PPRA 2IWBA 3SS5A 2XGNA 3WS5A 3SS4A 1BLSA 1K25A 1DJBA 1ES2A 3OC2A 1Z6FA 4S2NC 1XGIA 1JTDA 4S2NA 2OSUA 1H5XA 1MWSA 3HUOA 5F83A 1H8YA 1IELA 1MKIA 4KG5A 5FQJA 1OMEA 1E3UD 2EX8A 3W4PA 5M19A 2XLNA 2ZC3B 4ZBEA 1CI8A 5TFQA 2G2UA 1XP4A 5CHMA 4NETA 4GKUA 3W4OA 5EVLA 4KG6A 3HUNA 3O3VA 3HL9A 3OCNA 2DNSA 2H5SA 2OLUA 3MZDA 4ZJ2A 5KSCA 1C3BA 1FR1A 4KZ4A 5EVIC 1FCNA 1ES4A 4OH0A 1ERMA 2ZD8A 1NYYA 3MZFA 3G32A 2J7VA 5HL1A 4UA6A 2A49A 3S4XA 5GLCA 2PBYA 1H8ZA 3ZG8B 2XFTA 3SS3A 1HD8A 4M3KA 3IWQA 4IVKA 1W79A 4RA7A 4R0QA 2P74A 3N8SA 4LENA 3TSGA 4HBUA 3OPLA 1YT4A 2R9WA 2ZQ9A 1FR6A 4EUZA 5AQ9A 1JVJA 5EUAA 2EX2A 4R4RA 3BEBA 3FZCA 2WYXA 1YLZA 5E2GA 1GCEA 4S2IA 5EPHA 1MWTA 3UY6A 1KVLA 4RVAA 3FKVA 4S2KA 5FI7A 1L2SA 1KGEA 5CERA 4BQMA 3IHBA 1KE4A 3BFEA 3N8LA 3VP0A 1XXMA 2WAFA 2WZXA 3Q7VB 4WZ5C 4C3QA 1DY6A 3OCLA 1XPBA 4WZ5A 1PWGA 4LV1A 5U47A 3UE1A 3AGDA 4X6TA 3VFHA 1SHVA 1MWRA 4PM6A 2WZZA 4X69A 1L0GA 4QJGA 4WEKA 2HPBA 4KG2A 4N92A 1FSYA 4LV0A 1BLPA 2R9XA 3WRTA 1LL5A 4GDBA 4IBRA 5EOEA 3GTCA 4YFMA 2E8IA 4EBLA 1CEFA 1GHIA 1LLBA 2GDNA 4DXCA 3UO9A 3V50A 2XD5A 1EI5A 4OOMA 3MKEA 3PBQA 3IHAA 1KE0A 1K4EA 4PM5A 1WYBA 2C5WB 1I2WA 1LI0A 2Q9NA 3FV7A 3V3SA 2ZQ8A 1S0WA 1K6RA 5CECA 2H0YA 4P0MA 5CRFA 4OOLA 3UNWA 5DTSA 1Q2PA 1E25A 1WYCA 3A3IA 1PZPA 3IWIA 5CEBA 1MBLA 4Y0TA 3BECA 3UN7A 3MBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HLC A;  3HLG A;  4OLG A;  4S2M A;  3FYZ A;  4MBK A;  3C4P A;  4DDY A;  1NXY A;  4OPR A;  2QMI A;  4JF4 A;  1XGJ A;  3OPP A;  4JPM A;  1Q2Q A;  3QNC A;  3S22 A;  3M6B A;  1DJA A;  4QD4 A;  5CTN A;  1BUL A;  4K91 A;  2RL3 A;  4OLD A;  2CC1 A;  5CED A;  4R3J A;  4B4Z A;  5HAP A;  1FSW A;  2WAE A;  5FQM A;  2PU4 A;  2X71 A;  3IQA A;  3TOI A;  2WGW B;  5EEC A;  5FAO A;  1XA7 A;  3AGE A;  4E3J A;  3ZVT A;  4KQO A;  4UA7 A;  4D2O A;  3UDI A;  5GL9 A;  1ESI A;  1ERO A;  4FCF A;  3MKF A;  5A90 A;  1GHM A;  3BFD A;  4B88 A;  3EQV A;  5F1F A;  1DJC A;  4OQG A;  5DTT A;  4BJP A;  3IWO A;  1G6A A;  3UE0 A;  4E3O A;  2C6W B;  4KZB A;  2G2W A;  4BL3 A;  3O86 A;  4IBX A;  4HBT A;  3WS2 A;  1NYM A;  3M2K A;  1HTZ A;  4MBF A;  3UDX A;  1BTL A;  1RGZ A;  1U60 A;  1NY0 A;  1Y54 A;  2ZC7 A;  3GMW A;  3ISG A;  3VOY A;  1I2S A;  3ZFZ A;  4KZA A;  1E4D A;  2ZQA A;  1BT5 A;  2P9V A;  3ZHH A;  4DDS A;  4DF6 A;  1K57 C;  2EX9 A;  3Q82 A;  4JXW A;  4S2J A;  4IED A;  1K57 A;  4OQI A;  5EVI A;  3GVB A;  1ALQ A;  3LY3 A;  3BLM A;  4OPZ A;  4ZDX A;  3NIA A;  5GHX A;  3BM6 A;  4KEN B;  3ZGA B;  4EV4 A;  1K54 C;  4KZ5 A;  3SH8 A;  4OQ0 A;  1K54 A;  2Y55 A;  3OPR A;  1FOF A;  1SKF A;  1FCM A;  1O7E A;  1FQG A;  4JKT A;  4OOY A;  2J9P A;  4KQQ A;  1S6R A;  3GV9 A;  4WMC A;  5F1G A;  4E3L A;  5BOH A;  3G34 A;  4QB8 A;  5DVA A;  1ZG4 A;  1O07 A;  1M6K A;  2DCF A;  4MEZ A;  4CPK A;  3MXS A;  3Q7Z A;  5CXW A;  3GRJ A;  1J9M A;  3MXR A;  3V3R A;  2XK1 A;  5KZH A;  4RX3 A;  3ITA A;  4EBP A;  1ONH A;  2HP6 A;  1ONG A;  3UPO A;  3M2J A;  4ZJ3 A;  2X02 A;  4XXR A;  1PI4 A;  2Y2N A;  1XKZ A;  4ZTK A;  4Q8I A;  5FAT A;  3ZDJ A;  2WKE A;  3VSL A;  4DE2 A;  4BLM A;  3Q81 A;  1ZC2 A;  4PM7 A;  3VOZ A;  4YIN A;  3PBS A;  1ES5 A;  2Y2I A;  1RCJ A;  2VGK A;  1E3U A;  3G2Z A;  3N7W A;  3O87 A;  1PW1 A;  4KZ3 A;  5FAQ A;  3G30 A;  3UPN A;  4EWF A;  3Q1F A;  1K55 C;  4UAA A;  1K55 A;  5AQ7 A;  1N4O A;  1FCO A;  5FI2 A;  4QHC A;  4WM9 A;  1K6S A;  5AQB A;  5FAS A;  1PI5 A;  3ZG9 B;  3E2L A;  3VP4 A;  1PZO A;  2XD1 A;  4PM8 A;  5F82 A;  3NDG A;  2J9O A;  3VFF A;  5A93 A;  5E43 A;  1RP5 A;  3ZG5 A;  4U3T A;  1PWC A;  1BLC A;  1SDN A;  1L0F A;  3PBN A;  1VQQ A;  1KDS A;  5EE8 A;  3NBL A;  1L0E A;  5AQA A;  3HLB A;  3HRE A;  4GZB A;  3PAE A;  4Y7P A;  2WGI A;  1BSG A;  4JLF A;  4OQH A;  2Y2J A;  1XA1 A;  4DXB A;  1YLJ A;  2Z2L B;  3A3J A;  2EFU A;  4DE0 A;  4LCM A;  1YLY A;  1KGF A;  1IYP A;  4X56 A;  4E3N A;  3BLS A;  2WUQ A;  3WS4 A;  1QME A;  4OPQ A;  1QMF A;  3VP3 A;  2JC7 A;  4UA9 A;  3GQZ A;  2ZM0 A;  3DWK A;  3QNB A;  1YLT A;  3B3X A;  2V1Z A;  4K0X A;  5GLD A;  3VSK A;  1KE3 A;  3IH8 A;  1IYQ A;  1YLW A;  4WBG A;  4XUX A;  1MWU A;  3ZVW A;  3ZG7 B;  4P85 A;  2HDS A;  1KGG A;  1YMX A;  3ITB A;  5CHJ A;  2Y4A A;  3FWL A;  1JWP A;  1XX2 A;  4P6B A;  2ZJ9 A;  4HEF A;  4IVI A;  2HP9 A;  2ZQC A;  5A91 A;  1MPL A;  2WKH A;  4Y0U A;  2H0T A;  3HLF A;  3NDE A;  4WYY A;  3VP1 A;  1LL9 A;  2XFS A;  4C6Y A;  2Y2H A;  3EQU A;  2EX6 A;  3WS0 A;  4F94 A;  3ZNT A;  3PBT A;  1NJ4 A;  4N1H A;  3VP2 A;  3AGF A;  2VGJ A;  3IH9 A;  4WEJ A;  3P09 A;  4FD8 A;  3W4Q A;  4CJN A;  1GHP A;  1AXB A;  3GR2 A;  3N4I A;  2XEP A;  4XUZ A;  1IKI A;  4KZ7 A;  5EOO A;  3Q7V A;  5E2E A;  2J8Y A;  3WS1 A;  1W8Q A;  3C7U A;  4N1X A;  4GDN A;  5KMW A;  3A3F A;  2JCH A;  2X01 A;  4BL2 A;  4Y0O A;  2DRW A;  3BFF A;  1PIO A;  1TVF A;  1W8Y A;  2Q9M A;  3Q07 A;  5E2F A;  3LCE A;  3ZCZ A;  2WGV A;  2B5R A;  3RXW A;  1BZA A;  1PW8 A;  2JBF A;  1K38 A;  4FH2 A;  4JXG A;  2H10 A;  2EXB A;  1HZO A;  4WZ4 A;  4JXV A;  2EFX A;  2FFY A;  5CHU A;  3ZNY A;  4A5R A;  4BD1 A;  1JTG A;  3BRM A;  3UE3 A;  2XDM A;  2ZQ7 A;  1GA9 A;  1LI9 A;  2BLS A;  5CGS A;  2Y91 A;  2ZM2 A;  1I5Q A;  3G2Y A;  2ZM8 A;  3G31 A;  3DW0 A;  1SDE A;  1YMS A;  2XF3 A;  3LEZ A;  4LCL A;  4PM9 A;  3CJM A;  2ZC4 B;  4MNR A;  2Y2G A;  4S2O A;  5HAI A;  3IF6 B;  3UPP A;  4KZ6 A;  3WWX A;  2JE5 A;  3NI9 A;  4NK3 A;  3PTE A;  2A3U A;  4UHU A;  3D4F A;  5HFO A;  3HLE A;  4EBN A;  5L2F A;  1YLP A;  2V2F F;  3I7J A;  1K56 D;  2ZMA A;  5HX9 A;  1SCW A;  1YQS A;  1YM1 A;  4QU3 A;  4N9K A;  4RYE A;  2Y2P A;  4ZJ1 A;  4GD8 A;  4E3K A;  2WKI A;  3A3E A;  3DWZ A;  4BEN A;  4DE1 A;  4JF6 A;  5E2H A;  2OV5 A;  3C7V A;  3BFG A;  2QZ6 A;  3A3D A;  2XH9 A;  3PAG A;  4JBF A;  1WE4 A;  4R4S A;  5JYP A;  2RCX A;  5HAR A;  5D3O A;  1TEM A;  3PBO A;  2ZC6 B;  5GLB A;  5HAQ A;  2OLV A;  2UWX A;  1W5D A;  3O88 A;  4GOG A;  2WAD A;  4GNU A;  4U0T A;  3CMZ A;  4EQI A;  3V5M A;  2Y59 A;  4OON A;  3CZD A;  1W7F A;  1NRF A;  1K4F A;  5FSR A;  4E6X A;  3ZG0 A;  5J8X A;  1ES3 A;  2HDU A;  1PYY A;  4HES A;  4QY5 A;  4RX2 A;  1EWZ A;  3TG9 A;  1RGY A;  2WGW A;  2Y2K A;  5GLA A;  4R23 A;  3IXD A;  3C5A A;  1KDW A;  5FAP A;  4N9L A;  1M40 A;  2V20 A;  2Y2O A;  1NZU A;  4FSF A;  1ERQ A;  4MBH A;  4ZAM A;  4DRT A;  3WRZ A;  3HLW A;  5DF7 A;  3IT9 A;  4LV3 A;  2Y2M A;  3RJU A;  1L0D A;  3BYD A;  2Y2Q A;  3QHY A;  4OP5 A;  5FA7 A;  5A92 A;  3PBR A;  4GN2 A;  2I72 A;  4WEL A;  1CK3 A;  3C4O A;  3HBR A;  5FQQ A;  5GHZ A;  1ZKJ A;  2Z2M B;  3IF5 A;  4JXS A;  5KSH A;  3M6H A;  2Y2L A;  4E6W A;  4QY6 A;  3SH9 A;  3N8R A;  4GB7 A;  2ZQD A;  4S2L A;  1N9B A;  3HVF A;  3P98 A;  5DF8 A;  1IKG A;  1K56 A;  3GSG A;  1GA0 A;  4DE3 A;  4LV2 A;  1BLH A;  3OZH A;  3IXB A;  1G68 A;  4S2P A;  5HW3 A;  5I94 A;  2HDQ A;  1ZG6 A;  3IF6 C;  4ID4 A;  4KZ9 A;  4E3I A;  3IF6 A;  3IXH A;  2BG1 A;  4C75 A;  2IWC A;  5GHY A;  5IHV A;  5JYO A;  1IYS A;  1MY8 A;  3OPH A;  3FKW A;  2ZLY A;  5TR7 A;  2WK0 A;  2XR0 A;  3BFC A;  3V39 A;  3G35 A;  1JWZ A;  4E3M A;  4JF5 A;  3N6I A;  4H8R A;  5FQI A;  2P9V B;  2FFF B;  4X55 A;  2HP5 A;  1TDL A;  5FQK A;  1IEM A;  5EVI B;  5G18 A;  3NC8 A;  4U0X A;  1IYO A;  3IXG A;  5M18 A;  1NZO A;  2XQZ A;  4FH4 A;  3E2K A;  1HVB A;  5TGF A;  4P87 A;  5CGX A;  1CI9 A;  2HDR A;  3LO7 A;  4KQR A;  2PU2 A;  3JYI A;  4OVD A;  4R1G A;  5FI6 A;  5FQ9 A;  3SH7 A;  1JWV A;  2ZC5 B;  2IWD A;  3HLD A;  5EVI D;  3UDF A;  4X68 A;  5CTM A;  3NCK A;  3CG5 A;  5M1A A;  4OKP A;  1KVM A;  4Z9Q A;  4B4X A;  3SOI A;  1ESU A;  1PWD A;  3DTM A;  3VMA A;  3S1Y A;  3G4P A;  3HUM A;  1LHY A;  4OP8 A;  4OPY A;  4GD6 A;  4L0L A;  4KZ8 A;  5DTK A;  1MXO A;  5FDH A;  4WMC D;  4DKI A;  4R3B A;  5DF9 A;  3RXX A;  3LY4 A;  4X53 A;  3W8K A;  1VM1 A;  3MZE A;  4BD0 A;  4O7D A;  5CGW A;  4MLL A;  3MFD A;  3NY4 A;  1CEG A;  4K0W A;  4PMA A;  1BUE A;  1TDG A;  2EXA A;  2QPN A;  4PPR A;  2IWB A;  3SS5 A;  2XGN A;  3WS5 A;  3SS4 A;  1BLS A;  1K25 A;  1DJB A;  1ES2 A;  3OC2 A;  1Z6F A;  4S2N C;  1XGI A;  1JTD A;  4S2N A;  2OSU A;  1H5X A;  1MWS A;  3HUO A;  5F83 A;  1H8Y A;  1IEL A;  1MKI A;  4KG5 A;  5FQJ A;  1OME A;  1E3U D;  2EX8 A;  3W4P A;  5M19 A;  2XLN A;  2ZC3 B;  4ZBE A;  1CI8 A;  5TFQ A;  2G2U A;  1XP4 A;  5CHM A;  4NET A;  4GKU A;  3W4O A;  5EVL A;  4KG6 A;  3HUN A;  3O3V A;  3HL9 A;  3OCN A;  2DNS A;  2H5S A;  2OLU A;  3MZD A;  4ZJ2 A;  5KSC A;  1C3B A;  1FR1 A;  4KZ4 A;  5EVI C;  1FCN A;  1ES4 A;  4OH0 A;  1ERM A;  2ZD8 A;  1NYY A;  3MZF A;  3G32 A;  2J7V A;  5HL1 A;  4UA6 A;  2A49 A;  3S4X A;  5GLC A;  2PBY A;  1H8Z A;  3ZG8 B;  2XFT A;  3SS3 A;  1HD8 A;  4M3K A;  3IWQ A;  4IVK A;  1W79 A;  4RA7 A;  4R0Q A;  2P74 A;  3N8S A;  4LEN A;  3TSG A;  4HBU A;  3OPL A;  1YT4 A;  2R9W A;  2ZQ9 A;  1FR6 A;  4EUZ A;  5AQ9 A;  1JVJ A;  5EUA A;  2EX2 A;  4R4R A;  3BEB A;  3FZC A;  2WYX A;  1YLZ A;  5E2G A;  1GCE A;  4S2I A;  5EPH A;  1MWT A;  3UY6 A;  1KVL A;  4RVA A;  3FKV A;  4S2K A;  5FI7 A;  1L2S A;  1KGE A;  5CER A;  4BQM A;  3IHB A;  1KE4 A;  3BFE A;  3N8L A;  3VP0 A;  1XXM A;  2WAF A;  2WZX A;  3Q7V B;  4WZ5 C;  4C3Q A;  1DY6 A;  3OCL A;  1XPB A;  4WZ5 A;  1PWG A;  4LV1 A;  5U47 A;  3UE1 A;  3AGD A;  4X6T A;  3VFH A;  1SHV A;  1MWR A;  4PM6 A;  2WZZ A;  4X69 A;  1L0G A;  4QJG A;  4WEK A;  2HPB A;  4KG2 A;  4N92 A;  1FSY A;  4LV0 A;  1BLP A;  2R9X A;  3WRT A;  1LL5 A;  4GDB A;  4IBR A;  5EOE A;  3GTC A;  4YFM A;  2E8I A;  4EBL A;  1CEF A;  1GHI A;  1LLB A;  2GDN A;  4DXC A;  3UO9 A;  3V50 A;  2XD5 A;  1EI5 A;  4OOM A;  3MKE A;  3PBQ A;  3IHA A;  1KE0 A;  1K4E A;  4PM5 A;  1WYB A;  2C5W B;  1I2W A;  1LI0 A;  2Q9N A;  3FV7 A;  3V3S A;  2ZQ8 A;  1S0W A;  1K6R A;  5CEC A;  2H0Y A;  4P0M A;  5CRF A;  4OOL A;  3UNW A;  5DTS A;  1Q2P A;  1E25 A;  1WYC A;  3A3I A;  1PZP A;  3IWI A;  5CEB A;  1MBL A;  4Y0T A;  3BEC A;  3UN7 A;  3MBZ A; 
#chains in the Genus database with same CATH topology
 3HLG A;  4OLG A;  3W2Z A;  4OPR A;  3S22 A;  5CTN A;  4O01 A;  2PAV P;  2RL3 A;  5CED A;  4R3J A;  4B4Z A;  2WAE A;  2P08 A;  2X71 A;  3IQA A;  5FAO A;  3ZVT A;  4KQO A;  4D2O A;  1ERO A;  1GHM A;  3EQV A;  4NKP A;  2OAQ 1;  4HBT A;  3BY8 A;  1NYM A;  3M2K A;  4MBF A;  4KUK A;  1BTL A;  2IA2 A;  3LIC A;  3F1N B;  1BT5 A;  1H8M A;  1K57 C;  4DF6 A;  4IED A;  3JPU A;  4OQI A;  1ALQ A;  2ZL1 B;  3ZQ5 A;  4OPZ A;  4NXG A;  2GNX A;  5AVE A;  4ZDX A;  3BM6 A;  4HH2 A;  4KEN B;  1KOU A;  1Y28 A;  1FQG A;  5HDS A;  1S6R A;  2PYP A;  1G6O A;  3UB7 A;  1CF0 A;  3G34 A;  4QB8 A;  2OAP 1;  3GRJ A;  3V3R A;  2XK1 A;  3ITA A;  1ONG A;  5HPI A;  5L09 A;  1ZC2 A;  4YIN A;  2V0U A;  3WRZ A;  2ACG A;  1E3U A;  3T50 A;  3GEC A;  4I38 A;  2PD7 A;  1K6S A;  3B47 A;  1P9R A;  2XD1 A;  4PM8 A;  4G3V A;  5A93 A;  5E43 A;  1BLC A;  1KDS A;  1CJF A;  2HJE A;  2Y2J A;  1XA1 A;  1DP9 A;  3A3J A;  4LCM A;  4E3N A;  3BLS A;  3CUE A;  4YNR A;  3VP3 A;  4UA9 A;  2W0N A;  3VSK A;  1KE3 A;  1H0M A;  1IYQ A;  4P85 A;  2HDS A;  1H3Q A;  5L07 A;  3ITB A;  4I3A A;  2LB5 A;  1F2K A;  3VP1 A;  1NLY A;  4AFI A;  2EX6 A;  3ZNT A;  3NEC A;  3AGF A;  3IH9 A;  3P09 A;  1N9O A;  3NOU C;  1AXB A;  5HZH A;  3Q7V A;  5E2E A;  2KLI A;  1W8Q A;  4GW9 A;  4GDN A;  3A3F A;  2JCH A;  2WKP A;  4G3W A;  1DP6 A;  4BL2 A;  3BFF A;  2Q9M A;  5I5L A;  2B5R A;  1XJ6 A;  1BZA A;  1PW8 A;  4F3L A;  4H6J A;  1ODV A;  4WZ4 A;  2FFY A;  4BD1 A;  3BRM A;  3UE3 A;  2BLS A;  2Y91 A;  1I5Q A;  3CLO A;  4IUK A;  4LCL A;  3O5Y A;  2ZC4 B;  2W1T B;  2JE5 A;  3HLE A;  3UB8 A;  1YLP A;  2K2N A;  1YQS A;  4QU3 A;  4ZJ1 A;  4CLC D;  5HWW A;  3C7V A;  3A3D A;  1WE4 A;  5JYP A;  3BW6 A;  2CMN A;  4XT2 B;  2OLV A;  2UWX A;  1W5D A;  1FIK A;  3O88 A;  4GNU A;  4U0T A;  3CMZ A;  3V5M A;  2VV7 A;  4E6X A;  3IS2 B;  5J8X A;  2JKT I;  4RX2 A;  2HDU A;  1PYY A;  3KSI A;  3TG9 A;  3LI8 A;  4R23 A;  3BY9 A;  1KDW A;  1XJ3 A;  4N9L A;  1M40 A;  2V20 A;  4FSF A;  3EOI A;  4LV3 A;  2Y2M A;  3BYD A;  1FIL A;  5EM1 A;  5A92 A;  3C4O A;  3HBR A;  4JXS A;  3C38 A;  2M7V A;  5KSH A;  3M6H A;  4E6W A;  3SH9 A;  1IFQ A;  2QJ7 A;  4X1M A;  3IX3 A;  4S2L A;  3GSG A;  3F1N A;  2BAS A;  3IXB A;  1G68 A;  5IU1 A;  1ZG6 A;  3K2N A;  4ID4 A;  3T1R A;  2ZL1 A;  2IWC A;  5IHV A;  1MY8 A;  3NOT C;  2INW A;  3FKW A;  2ZLY A;  5TR7 A;  3BFC A;  3H9W A;  3DTI A;  1JWZ A;  4JF5 A;  4DJ2 A;  5FQI A;  5FQK A;  2EWV A;  5G18 A;  2PR6 A;  3MF0 A;  4FH4 A;  2HDR A;  4OVD A;  2V1B A;  3D3O A;  2ZC5 B;  5AJG A;  2IWD A;  2O9A A;  5K5B A;  4NXB A;  3T4J A;  5M1A A;  3NCK A;  2JKF A;  4OKP A;  4FTX A;  3VMA A;  4IHQ A;  2J3T D;  3TW8 A;  1NWZ A;  4L0L A;  4MCW A;  4DN0 A;  2KDK A;  1VEU B;  4WMC D;  4DKI A;  5DF9 A;  3RXX A;  2I9V A;  4EU0 A;  3QP5 A;  4PMA A;  2IWB A;  2XGN A;  3OC2 A;  4S2N C;  3CAX A;  4HP9 A;  4L9E A;  1H8Y A;  1IEL A;  1MKI A;  1OME A;  2EX8 A;  3UB5 P;  4ZBE A;  3LI9 A;  1LSW A;  1XP4 A;  1SKO B;  3U4L P;  1HLU P;  2OLU A;  5KSC A;  1C3B A;  4EW7 A;  1NLZ A;  3MZF A;  2J80 A;  1DP8 A;  2PBY A;  5FDS A;  3G6O A;  2VX8 A;  3IWQ A;  4IVK A;  3TSG A;  4HBU A;  1PRQ A;  4JGP A;  5HSQ A;  4R70 A;  5AQ9 A;  5EUA A;  3LUQ A;  5E2G A;  4DJ3 A;  1GCE A;  4S2I A;  3FKV A;  4HOI A;  1STZ A;  5CER A;  4C3Q A;  1XPB A;  3LGO A;  4LV1 A;  5U47 A;  4L9F A;  3BQ8 A;  4NXE A;  1SHV A;  4BMW A;  4QJG A;  4HH3 A;  3P7N A;  3WRT A;  3BWL A;  1LL5 A;  4GDB A;  5EOE A;  1V9Y A;  2VGL M;  4YFM A;  4EBL A;  1CEF A;  1GHI A;  2GDN A;  4DXC A;  3V50 A;  2XD5 A;  3MKE A;  3V3S A;  2Q9N A;  1LI0 A;  1ACF A;  2G7U A;  1K6R A;  3KYQ A;  4XT2 A;  3S7Q A;  3TE8 A;  3IS2 A;  1F9I A;  2VV6 A;  3NHQ A;  1NRJ A;  4NEE D;  1P9W A;  3C4P A;  2QMI A;  1XGJ A;  3OPP A;  3QNC A;  3M6B A;  4QD4 A;  3T4S A;  4K91 A;  4OLD A;  2VV8 A;  2P7J A;  5HAP A;  2PR5 A;  5FQM A;  3IX8 A;  2WGW B;  1XA7 A;  4E3J A;  4UA7 A;  3UDI A;  4FCF A;  5A90 A;  4MN7 A;  2B18 A;  4BJP A;  3D72 A;  2M1C A;  3IWO A;  1G6A A;  3F1O B;  2C6W B;  4KZB A;  4BL3 A;  3O86 A;  5G4Y A;  3WS2 A;  3UDX A;  1NY0 A;  1I2S A;  3MXQ A;  2ZQA A;  2VK3 A;  2ZOI A;  4CLC B;  3VE4 A;  3NIA A;  1V9Z A;  4EV4 A;  3SH8 A;  2OOL A;  2W3H A;  5KIZ A;  2H28 A;  2ZMF A;  2ZMV A;  4MEZ A;  3MXS A;  1J9M A;  4RX3 A;  5IT5 A;  3A0R A;  3RTY A;  4NG2 A;  1LT0 A;  3ZDJ A;  2WKE A;  3VSL A;  1VEU A;  1D06 A;  3E4Q A;  4WLA A;  3VOZ A;  4CLC E;  1ES5 A;  2Y2I A;  3G2Z A;  2VGK A;  4KZ3 A;  3UPN A;  1PW1 A;  5FAQ A;  2Y8H A;  3G30 A;  4EWF A;  3Q1F A;  4R6L A;  4UAA A;  3MR0 A;  1K55 A;  5AQ7 A;  1FCO A;  5FI2 A;  5DFX A;  5FAS A;  2JKR I;  1PI5 A;  3E2L A;  1PZO A;  5F82 A;  1S1Z A;  3NDG A;  5FL3 A;  3VFF A;  4I3I A;  1RP5 A;  1SDN A;  1L0F A;  1VQQ A;  3T4O A;  3L7H A;  1SKO A;  3A0S A;  1A0K A;  4DXB A;  2Z2L B;  1YLY A;  1D7E A;  2FZ0 A;  3CUE C;  5LBR A;  3MJQ A;  1QME A;  4LPZ A;  1QMF A;  2JN7 A;  2ZM0 A;  3DWK A;  4K0X A;  2R78 A;  5GLD A;  1ZTU A;  3IH8 A;  1KGG A;  3FWL A;  4BWI A;  4IVI A;  5A91 A;  2WKH A;  2VLG A;  2H0T A;  3HLF A;  5DJU A;  1LL9 A;  4C6Y A;  3WS0 A;  3TRC A;  4N1H A;  3VP2 A;  4FD8 A;  3GR2 A;  3N4I A;  1IOU A;  2J8Y A;  4N1X A;  3EGX C;  2NUP C;  3Q07 A;  4G3K A;  4EUV A;  1K38 A;  2H10 A;  4IJG A;  4KQD A;  4JXV A;  4WUJ A;  1JTG A;  1XJ2 A;  1LI9 A;  1OJG A;  3MQO A;  3G2Y A;  1YMS A;  4JGO A;  2Y2G A;  3CHW P;  4KZ6 A;  3B42 A;  3PTE A;  4EBN A;  2E8J A;  1F5M A;  1K56 D;  1TS8 A;  4Z1W A;  3MQQ A;  1YM1 A;  5TBM B;  4DE1 A;  3DWZ A;  3L9K A;  4JF6 A;  5E2H A;  3BFG A;  4JBF A;  3HCY A;  2RCX A;  3A0V A;  3LFV A;  5G4Z A;  2ZC6 B;  5HL6 A;  3KX0 X;  5GLB A;  5F68 A;  5HAQ A;  5A8B A;  5HPF A;  3E4O A;  4Y2F A;  1K4F A;  2WGW A;  4Y5F A;  3IXD A;  3C5A A;  3T1X A;  2Y2O A;  1NZU A;  4EQ1 A;  3HLW A;  4GCZ A;  5DF7 A;  3IT9 A;  1L0D A;  3F1O A;  4OP5 A;  4LRX C;  4WEL A;  5GHZ A;  1ZKJ A;  2EWW A;  3NOP C;  2VGL S;  1VHM A;  2L0W A;  4QY6 A;  3N8R A;  4I5S A;  1IKG A;  4CLC A;  5HW3 A;  4WL9 A;  2HDQ A;  3IF6 A;  5GHY A;  3KYE A;  3ULF A;  5TJJ A;  2GX5 A;  3PXP A;  2WKR A;  3DAV A;  2FFF B;  4X55 A;  1IEM A;  5EVI B;  4DMZ A;  3NC8 A;  1IYO A;  2XQZ A;  4M4X A;  2Q0O A;  4KQR A;  3SH7 A;  4R1G A;  1LSV A;  4B4X A;  4OPY A;  1UWP X;  5DKK A;  3K3C A;  5DTK A;  3PYP A;  2PBD P;  1G28 A;  3MZE A;  3KO6 A;  4MLL A;  1CEG A;  1S66 L;  3C2W A;  2QPN A;  4LFU A;  2XA7 S;  2Z6D A;  3SS4 A;  3UB9 A;  1Z6F A;  3HUO A;  4KG5 A;  5FQJ A;  1E3U D;  2ZC3 B;  2L1M A;  3T12 B;  1CI8 A;  3S7P A;  2EA9 A;  5TFQ A;  5DFY A;  5CHM A;  1OTA A;  3HL9 A;  5FEF A;  3OCN A;  2DNS A;  2H5S A;  4EES A;  2PYR A;  1FR1 A;  5EVI C;  1J3W A;  1ERM A;  1NYY A;  2PDR A;  1Y4O A;  5HL1 A;  4L9G A;  3ZG8 B;  2XFT A;  3SS3 A;  1HD8 A;  4B93 A;  2P74 A;  4LEN A;  1SZV A;  1FR6 A;  2EX2 A;  1MC0 A;  3SZT A;  5EPH A;  1MWT A;  4RVA A;  4KUO A;  5FI7 A;  4EXO A;  1L2S A;  3RH8 B;  2WZX A;  3OCL A;  4WZ5 A;  1PWG A;  1OJ5 A;  3B33 A;  4X6T A;  3VFH A;  3EEA A;  2WZZ A;  4PM6 A;  1TS6 A;  3BQA A;  2XSS A;  4KG2 A;  4N92 A;  2R9X A;  5HDD A;  3LIE A;  5TBM A;  1LLB A;  3UO9 A;  3MQ0 A;  5FEG A;  2K31 A;  1KE0 A;  4PM5 A;  4HJ3 A;  2ZQ8 A;  4WN5 A;  1S1Y A;  4P0M A;  3UNW A;  5DTS A;  1E25 A;  1MKM A;  1WYC A;  3LEQ A;  4RQ9 A;  2W3D A;  1MBL A;  4Y0T A;  3BEC A;  3UDF A;  2L4R A;  4S2M A;  3FYZ A;  3DBA A;  4JF4 A;  5DJT A;  3E0Y A;  1Q2Q A;  1DJA A;  1BUL A;  2CC1 A;  2OWJ A;  1FSW A;  5HD5 A;  2PU4 A;  3LR4 A;  1N9N A;  3VE3 A;  5EEC A;  1ESI A;  3MKF A;  3BFD A;  1DJC A;  4OQG A;  5DTT A;  2V8F A;  4E3O A;  1OTE A;  3LID A;  1HTZ A;  1U60 A;  1Y54 A;  3ISG A;  3ZFZ A;  1E4D A;  3ZHH A;  4DDS A;  3Q82 A;  4JXW A;  4S2J A;  4EEU A;  5EVI A;  2V8C A;  3BLM A;  4HP4 A;  4BBV A;  5GHX A;  2B02 A;  3ZGA B;  3UE6 A;  4OQ0 A;  1K54 A;  3OPR A;  1GSV A;  4ESP A;  1FCM A;  3FPW A;  4OOY A;  1W63 Q;  4UQI S;  4KQQ A;  3NUL A;  3GV9 A;  5DKL A;  3GDI A;  5F1G A;  5BOH A;  2PT7 A;  5EVE A;  1XFN A;  1M6K A;  5CXW A;  1WA9 A;  2OWH A;  4EBP A;  3M2J A;  3JVU A;  2X02 A;  1PI4 A;  2Y2N A;  4ZTK A;  4Q8I A;  2B95 A;  4FUW A;  3PBS A;  3LIA A;  1RCJ A;  5EV0 A;  3N7W A;  1K55 C;  4GS9 B;  1S4S A;  4WM9 A;  5CX7 A;  5AQB A;  3VP4 A;  4ZRR A;  3K3D A;  3ZG5 A;  1PWC A;  2D02 A;  3NBL A;  5AQA A;  3HLB A;  1EW0 A;  2WGI A;  4B9O A;  1YKD A;  4JLF A;  4OQH A;  1YLJ A;  2EFU A;  2LB9 A;  3T4Q A;  1KGF A;  4X56 A;  4R3A A;  3WS4 A;  4OPQ A;  3FC7 A;  3GQZ A;  2ZBB A;  3F1P B;  1YLT A;  3B3X A;  3MS6 A;  1YLW A;  4XUX A;  4WBG A;  1ZHH B;  1MWU A;  3VV4 A;  3ZVW A;  1YMX A;  5CHJ A;  1XX2 A;  4P6B A;  2ZJ9 A;  3EWK A;  2ZQC A;  1MPL A;  3NDE A;  2XFS A;  2Y2H A;  4F94 A;  2WKQ A;  2O9C A;  4CJN A;  1GHP A;  2GZA A;  1IKI A;  4KZ7 A;  5EOO A;  3CWF A;  3WS1 A;  1P97 A;  2DRW A;  5E2F A;  1W8Y A;  3LCE A;  2WGV A;  3RXW A;  2JBF A;  1HZO A;  2EFX A;  3ZNY A;  4A5R A;  5F6A A;  1OT6 A;  2ZQ7 A;  1PNE A;  5CGS A;  3QP4 A;  3G31 A;  3DW0 A;  4HHD A;  3MSH A;  4MNR A;  2XA7 M;  3IF6 B;  3UPP A;  3WWX A;  1P0Z A;  2A3U A;  5L2F A;  3I7J A;  5IS1 A;  5HX9 A;  1SCW A;  4N9K A;  4RYE A;  2Y2P A;  2WKI A;  2J3W A;  3A3E A;  1T1A A;  1YSP A;  2OV5 A;  2QZ6 A;  2YKH A;  5D3O A;  1K0K A;  1TEM A;  4QPR A;  3PBO A;  3QP8 A;  2VKS A;  3IX4 A;  4GOG A;  2WAD A;  4EQI A;  3H82 B;  2W3G A;  3CZD A;  1W7F A;  5HD3 A;  5FSR A;  2AVX A;  3ZG0 A;  1ES3 A;  4HES A;  4QY5 A;  1RGY A;  2Y2K A;  3OBF A;  2JKR M;  3OLO A;  5FAP A;  1TF1 A;  4ZAM A;  4MBH A;  1ERQ A;  3UMD A;  3D9Y A;  3RJU A;  4Y15 A;  2K7S A;  1Z09 A;  2I72 A;  5FQQ A;  3QP6 A;  1W63 M;  3KSH A;  4GB7 A;  5J4E A;  3DTK A;  1N9B A;  3HVF A;  5J7E A;  1K56 A;  3LYX A;  4CLC C;  4DE3 A;  4Q0J A;  3OZH A;  4S2P A;  5I94 A;  3IF6 C;  3LR0 A;  2BG1 A;  3OPH A;  1S67 L;  4H8R A;  2P9V B;  4PKY G;  1TDL A;  4UEY A;  4U0X A;  3IXG A;  1NZO A;  2VJW A;  2FH5 A;  1YSQ A;  5TGF A;  5CGX A;  2Z6C A;  5FQ9 A;  3JYI A;  5FI6 A;  1JWV A;  3P01 A;  4P6Z M;  4X68 A;  3CG5 A;  2MJ6 A;  4GS9 A;  1ESU A;  3DTM A;  3S1Y A;  3G4P A;  5HWV A;  2VA0 A;  4KZ8 A;  5FDH A;  1MXO A;  2QJ5 A;  4O8G A;  4I3J A;  3LY4 A;  3W8K A;  1VM1 A;  4O7D A;  1L3L A;  3NY4 A;  4K0W A;  1TDG A;  2EXA A;  3SS5 A;  2HZ5 A;  4Y3I A;  1K25 A;  1ES2 A;  1DJB A;  1XGI A;  4YOF A;  1H5X A;  2V9A A;  2Y79 A;  3W4P A;  3T4K A;  3F1P A;  2G2U A;  4NET A;  3W4O A;  2A24 B;  5EM0 A;  5EVL A;  4KG6 A;  3HUN A;  3O3V A;  3MZD A;  4ZJ2 A;  4CQH A;  1FCN A;  4EER A;  1ES4 A;  4OH0 A;  2P04 A;  3BJN A;  4JGR A;  3G32 A;  2J7V A;  4UA6 A;  2JHE A;  3S4X A;  3TJZ C;  5GLC A;  2J3T C;  1W79 A;  4RA7 A;  4R0Q A;  2PRF A;  4UQI M;  1F98 A;  3OPL A;  1TS0 A;  4X25 A;  1YT4 A;  2R9W A;  3IBR A;  2ZQ9 A;  4EUZ A;  3FG8 A;  3VOL A;  4HIA A;  3BEB A;  2VZW A;  4JGQ A;  3UY6 A;  1KVL A;  2O99 A;  4LRZ E;  3CPT B;  3CI6 A;  5HWT A;  4BQM A;  3N8L A;  3VP0 A;  3T1S A;  1XXM A;  2WAF A;  4WZ5 C;  4K08 A;  1DY6 A;  3MMH A;  3QP2 A;  2UV0 E;  3AGD A;  4MMN A;  1MWR A;  1L0G A;  1S4R A;  3LIF A;  2HPB A;  1XFQ A;  1VET B;  2PHY A;  1BLP A;  3GTC A;  2XRN A;  4GHI B;  4HI4 A;  4OOM A;  4YWZ A;  3LR5 A;  1YAX A;  3IHA A;  3FV7 A;  1I2W A;  1GSW A;  2H0Y A;  4OOL A;  1Q2P A;  2VEA A;  3A3I A;  1PZP A;  3H82 A;  4WF0 A;  4II7 A;  4ETX A;  1OTI A;  3HLC A;  2O9B A;  4MBK A;  4DDY A;  1NXY A;  4JPM A;  1LSX A;  4LRY C;  2M7U A;  2V0W A;  1UWN X;  4MDZ A;  3TOI A;  3S7N A;  3AGE A;  4BBT A;  5GL9 A;  1G5U A;  4B88 A;  5F1F A;  1YPR A;  3UE0 A;  2G2W A;  3V67 A;  4IBX A;  1RGZ A;  2ZC7 A;  3GMW A;  3VOY A;  4KZA A;  2P9V A;  2EX9 A;  5L8M A;  1K57 A;  3ICY A;  3GVB A;  3LY3 A;  1OTB A;  1D1J A;  4ARZ B;  2JKT M;  3R7W B;  3T4L A;  1K54 C;  4KZ5 A;  4MN5 A;  2Y55 A;  1FOF A;  1SKF A;  1O7E A;  4JKT A;  2J9P A;  4WMC A;  4R38 A;  2HV1 A;  5DVA A;  1OTD A;  1ZG4 A;  1O07 A;  2DCF A;  4CPK A;  4ETZ A;  5MC7 A;  3Q7Z A;  3MXR A;  5KZH A;  1ONH A;  2HP6 A;  3UPO A;  4ZJ3 A;  2QYB A;  3EGD C;  4XXR A;  1XKZ A;  3HJI A;  5FAT A;  1BYW A;  4BLM A;  5J3W A;  5HDC A;  3E98 A;  3Q81 A;  4PM7 A;  3O87 A;  3T4T A;  3EEH A;  1N4O A;  4QHC A;  4Y17 A;  3DTE A;  3ZG9 B;  4Q0H A;  2J9O A;  3H7W B;  3LR3 A;  1T1B A;  4U3T A;  3PBN A;  2DMW A;  5EE8 A;  1L0E A;  3HRE A;  4GZB A;  3PAE A;  4Y7P A;  2A24 A;  1BSG A;  4LGW A;  4O0P A;  4DE0 A;  2W3F A;  1IYP A;  2QWS A;  1T1C A;  2WUQ A;  2JC7 A;  4P6Z S;  2V1A A;  3QNB A;  1UGU A;  2V1Z A;  2W27 A;  3ZG7 B;  2Y4A A;  3S7O A;  1JWP A;  4HEF A;  2HP9 A;  4Y0U A;  4WYY A;  4ME4 A;  3EQU A;  1LL8 A;  3C30 A;  3PBT A;  1NJ4 A;  4PHT A;  2VGJ A;  4WEJ A;  3CPT A;  3W4Q A;  4XUZ A;  2XEP A;  2D01 A;  3C7U A;  3T1Q B;  5KMW A;  4GJ4 A;  2X01 A;  4Y0O A;  1PIO A;  1TVF A;  4HY8 A;  3ZCZ A;  4IUH A;  3KSF A;  4FH2 A;  4JXG A;  2EXB A;  1CQA A;  5CHU A;  4HNB A;  2W3E A;  1VET A;  2XDM A;  2O0Y A;  1GA9 A;  2ZM2 A;  4M3K A;  2ZM8 A;  3LEZ A;  1SDE A;  2XF3 A;  4PM9 A;  3CJM A;  3SW1 A;  4GHI A;  2BTF P;  3KSG A;  4S2O A;  5HAI A;  3NI9 A;  4NK3 A;  4UHU A;  3D4F A;  5HFO A;  2V2F F;  2ZMA A;  3RFB A;  2HGV A;  4GD8 A;  4E3K A;  2NUT C;  5AVF A;  4BEN A;  4HQA A;  2XH9 A;  3PAG A;  4R4S A;  5HAR A;  1JNU A;  4HJ4 A;  4I39 A;  1T19 A;  2Y59 A;  4OON A;  1NRF A;  1EWZ A;  3QP1 A;  5GLA A;  4PAU A;  5EFW A;  3UB6 A;  4E3L A;  4DRT A;  1AWI A;  2QKP A;  2PD8 A;  3E4P A;  4FOF A;  2Y2Q A;  1N9L A;  3QHY A;  5FA7 A;  1OT9 A;  3PBR A;  4GN2 A;  4EET B;  1CK3 A;  2Z2M B;  3IF5 A;  2Y2L A;  4Y13 A;  2ZQD A;  5DF8 A;  3P98 A;  1GA0 A;  4LV2 A;  3OOV A;  1BLH A;  4KZ9 A;  4GLQ A;  4E3I A;  2W1T A;  5F5Y A;  3IXH A;  4C75 A;  2ZOH A;  5JYO A;  1IYS A;  4ARZ A;  1OPX A;  3R7W A;  2WK0 A;  3MFX A;  3ZYT A;  2XR0 A;  3NJA A;  3V39 A;  3G35 A;  4E3M A;  3C8C A;  3N6I A;  3FPV A;  1MZU A;  2HJ9 C;  1PFL A;  2HP5 A;  4NXF A;  5L10 A;  5M18 A;  3UME A;  4HJ6 A;  3E2K A;  1HVB A;  2A2L A;  4P87 A;  1CI9 A;  3LO7 A;  4DE2 A;  2PU2 A;  3CIT A;  3HLD A;  5EVI D;  5CTM A;  1KVM A;  4Z9Q A;  4EEP A;  3SOI A;  4LLO B;  1PWD A;  3HUM A;  1LHY A;  4OP8 A;  4GD6 A;  1TD5 A;  3H7W A;  4R3B A;  2KX6 A;  4X53 A;  5CGW A;  3R4K A;  1DRM A;  3MFD A;  1BUE A;  5F69 A;  4PPR A;  2YKF A;  3WS5 A;  1BLS A;  5C5K A;  2JKG A;  1JTD A;  4S2N A;  2OSU A;  1MWS A;  5F83 A;  4MN6 A;  3JVV A;  5M19 A;  1XJ4 A;  2XLN A;  3PR6 A;  4GKU A;  3PHY A;  4X1L A;  4KZ4 A;  4Q0I A;  2ZD8 A;  2GJ3 A;  3LIB A;  2A49 A;  1X0O A;  1H8Z A;  3N8S A;  2W1R A;  1JVJ A;  4R4R A;  3FZC A;  2WYX A;  1YLZ A;  4S2K A;  1VB6 A;  1TS7 A;  1GSX A;  1KGE A;  2QHK A;  3HJK A;  3IHB A;  1KE4 A;  3BFE A;  4PKY A;  3Q7V B;  4BBU A;  3UE1 A;  4X69 A;  4F3L B;  4H6J B;  2KOI A;  1T18 A;  4WEK A;  1FSY A;  4LV0 A;  2XRO A;  4IBR A;  2E8I A;  4E04 A;  3IBJ A;  1EI5 A;  3PBQ A;  1K4E A;  3U2A A;  1WYB A;  2C5W B;  3KYZ A;  1S0W A;  5CEC A;  4D60 A;  5CRF A;  2HF6 A;  4QWO A;  3IWI A;  5CEB A;  4BD0 A;  3UN7 A;  3MBZ A; 
#chains in the Genus database with same CATH homology
 3HLC A;  3HLG A;  4OLG A;  4S2M A;  3FYZ A;  4MBK A;  3C4P A;  4DDY A;  1NXY A;  4OPR A;  2QMI A;  4JF4 A;  1XGJ A;  3OPP A;  4JPM A;  1Q2Q A;  3QNC A;  3S22 A;  3M6B A;  1DJA A;  4QD4 A;  5CTN A;  1BUL A;  4K91 A;  2RL3 A;  4OLD A;  2CC1 A;  5CED A;  4R3J A;  4B4Z A;  5HAP A;  1FSW A;  2WAE A;  5FQM A;  2PU4 A;  2X71 A;  3IQA A;  3TOI A;  2WGW B;  5EEC A;  5FAO A;  1XA7 A;  3AGE A;  4E3J A;  3ZVT A;  4KQO A;  4UA7 A;  4D2O A;  3UDI A;  5GL9 A;  1ESI A;  1ERO A;  4FCF A;  3MKF A;  5A90 A;  1GHM A;  3BFD A;  4B88 A;  3EQV A;  5F1F A;  1DJC A;  4OQG A;  5DTT A;  4BJP A;  3IWO A;  1G6A A;  3UE0 A;  4E3O A;  2C6W B;  4KZB A;  2G2W A;  4BL3 A;  3O86 A;  4IBX A;  4HBT A;  3WS2 A;  1NYM A;  3M2K A;  1HTZ A;  4MBF A;  3UDX A;  1BTL A;  1RGZ A;  1U60 A;  1NY0 A;  1Y54 A;  2ZC7 A;  3GMW A;  3ISG A;  3VOY A;  1I2S A;  3ZFZ A;  4KZA A;  1E4D A;  2ZQA A;  1BT5 A;  2P9V A;  3ZHH A;  4DDS A;  4DF6 A;  1K57 C;  2EX9 A;  3Q82 A;  4JXW A;  4S2J A;  4IED A;  1K57 A;  4OQI A;  5EVI A;  3GVB A;  1ALQ A;  3LY3 A;  3BLM A;  4OPZ A;  4ZDX A;  3NIA A;  5GHX A;  3BM6 A;  4KEN B;  3ZGA B;  4EV4 A;  1K54 C;  4KZ5 A;  3SH8 A;  4OQ0 A;  1K54 A;  2Y55 A;  3OPR A;  1FOF A;  1SKF A;  1FCM A;  1O7E A;  1FQG A;  4JKT A;  4OOY A;  2J9P A;  4KQQ A;  1S6R A;  3GV9 A;  4WMC A;  5F1G A;  4E3L A;  5BOH A;  3G34 A;  4QB8 A;  5DVA A;  1ZG4 A;  1O07 A;  1M6K A;  2DCF A;  4MEZ A;  4CPK A;  3MXS A;  3Q7Z A;  5CXW A;  3GRJ A;  1J9M A;  3MXR A;  3V3R A;  2XK1 A;  5KZH A;  4RX3 A;  3ITA A;  4EBP A;  1ONH A;  2HP6 A;  1ONG A;  3UPO A;  3M2J A;  4ZJ3 A;  2X02 A;  4XXR A;  1PI4 A;  2Y2N A;  1XKZ A;  4ZTK A;  4Q8I A;  5FAT A;  3ZDJ A;  2WKE A;  3VSL A;  4DE2 A;  4BLM A;  3Q81 A;  1ZC2 A;  4PM7 A;  3VOZ A;  4YIN A;  3PBS A;  1ES5 A;  2Y2I A;  1RCJ A;  2VGK A;  1E3U A;  3G2Z A;  3N7W A;  3O87 A;  1PW1 A;  4KZ3 A;  5FAQ A;  3G30 A;  3UPN A;  4EWF A;  3Q1F A;  1K55 C;  4UAA A;  1K55 A;  5AQ7 A;  1N4O A;  1FCO A;  5FI2 A;  4QHC A;  4WM9 A;  1K6S A;  5AQB A;  5FAS A;  1PI5 A;  3ZG9 B;  3E2L A;  3VP4 A;  1PZO A;  2XD1 A;  4PM8 A;  5F82 A;  3NDG A;  2J9O A;  3VFF A;  5A93 A;  5E43 A;  1RP5 A;  3ZG5 A;  4U3T A;  1PWC A;  1BLC A;  1SDN A;  1L0F A;  3PBN A;  1VQQ A;  1KDS A;  5EE8 A;  3NBL A;  1L0E A;  5AQA A;  3HLB A;  3HRE A;  4GZB A;  3PAE A;  4Y7P A;  2WGI A;  1BSG A;  4JLF A;  4OQH A;  2Y2J A;  1XA1 A;  4DXB A;  1YLJ A;  2Z2L B;  3A3J A;  2EFU A;  4DE0 A;  4LCM A;  1YLY A;  1KGF A;  1IYP A;  4X56 A;  4E3N A;  3BLS A;  2WUQ A;  3WS4 A;  1QME A;  4OPQ A;  1QMF A;  3VP3 A;  2JC7 A;  4UA9 A;  3GQZ A;  2ZM0 A;  3DWK A;  3QNB A;  1YLT A;  3B3X A;  2V1Z A;  4K0X A;  5GLD A;  3VSK A;  1KE3 A;  3IH8 A;  1IYQ A;  1YLW A;  4WBG A;  4XUX A;  1MWU A;  3ZVW A;  3ZG7 B;  4P85 A;  2HDS A;  1KGG A;  1YMX A;  3ITB A;  5CHJ A;  2Y4A A;  3FWL A;  1JWP A;  1XX2 A;  4P6B A;  2ZJ9 A;  4HEF A;  4IVI A;  2HP9 A;  2ZQC A;  5A91 A;  1MPL A;  2WKH A;  4Y0U A;  2H0T A;  3HLF A;  3NDE A;  4WYY A;  3VP1 A;  1LL9 A;  2XFS A;  4C6Y A;  2Y2H A;  3EQU A;  2EX6 A;  3WS0 A;  4F94 A;  3ZNT A;  3PBT A;  1NJ4 A;  4N1H A;  3VP2 A;  3AGF A;  2VGJ A;  3IH9 A;  4WEJ A;  3P09 A;  4FD8 A;  3W4Q A;  4CJN A;  1GHP A;  1AXB A;  3GR2 A;  3N4I A;  2XEP A;  4XUZ A;  1IKI A;  4KZ7 A;  5EOO A;  3Q7V A;  5E2E A;  2J8Y A;  3WS1 A;  1W8Q A;  3C7U A;  4N1X A;  4GDN A;  5KMW A;  3A3F A;  2JCH A;  2X01 A;  4BL2 A;  4Y0O A;  2DRW A;  3BFF A;  1PIO A;  1TVF A;  1W8Y A;  2Q9M A;  3Q07 A;  5E2F A;  3LCE A;  3ZCZ A;  2WGV A;  2B5R A;  3RXW A;  1BZA A;  1PW8 A;  2JBF A;  1K38 A;  4FH2 A;  4JXG A;  2H10 A;  2EXB A;  1HZO A;  4WZ4 A;  4JXV A;  2EFX A;  2FFY A;  5CHU A;  3ZNY A;  4A5R A;  4BD1 A;  1JTG A;  3BRM A;  3UE3 A;  2XDM A;  2ZQ7 A;  1GA9 A;  1LI9 A;  2BLS A;  5CGS A;  2Y91 A;  2ZM2 A;  1I5Q A;  3G2Y A;  2ZM8 A;  3G31 A;  3DW0 A;  1SDE A;  1YMS A;  2XF3 A;  3LEZ A;  4LCL A;  4PM9 A;  3CJM A;  2ZC4 B;  4MNR A;  2Y2G A;  4S2O A;  5HAI A;  3IF6 B;  3UPP A;  4KZ6 A;  3WWX A;  2JE5 A;  3NI9 A;  4NK3 A;  3PTE A;  2A3U A;  4UHU A;  3D4F A;  5HFO A;  3HLE A;  4EBN A;  5L2F A;  1YLP A;  2V2F F;  3I7J A;  1K56 D;  2ZMA A;  5HX9 A;  1SCW A;  1YQS A;  1YM1 A;  4QU3 A;  4N9K A;  4RYE A;  2Y2P A;  4ZJ1 A;  4GD8 A;  4E3K A;  2WKI A;  3A3E A;  3DWZ A;  4BEN A;  4DE1 A;  4JF6 A;  5E2H A;  2OV5 A;  3C7V A;  3BFG A;  2QZ6 A;  3A3D A;  2XH9 A;  3PAG A;  4JBF A;  1WE4 A;  4R4S A;  5JYP A;  2RCX A;  5HAR A;  5D3O A;  1TEM A;  3PBO A;  2ZC6 B;  5GLB A;  5HAQ A;  2OLV A;  2UWX A;  1W5D A;  3O88 A;  4GOG A;  2WAD A;  4GNU A;  4U0T A;  3CMZ A;  4EQI A;  3V5M A;  2Y59 A;  4OON A;  3CZD A;  1W7F A;  1NRF A;  1K4F A;  5FSR A;  4E6X A;  3ZG0 A;  5J8X A;  1ES3 A;  2HDU A;  1PYY A;  4HES A;  4QY5 A;  4RX2 A;  1EWZ A;  3TG9 A;  1RGY A;  2WGW A;  2Y2K A;  5GLA A;  4R23 A;  3IXD A;  3C5A A;  1KDW A;  5FAP A;  4N9L A;  1M40 A;  2V20 A;  2Y2O A;  1NZU A;  4FSF A;  1ERQ A;  4MBH A;  4ZAM A;  4DRT A;  3WRZ A;  3HLW A;  5DF7 A;  3IT9 A;  4LV3 A;  2Y2M A;  3RJU A;  1L0D A;  3BYD A;  2Y2Q A;  3QHY A;  4OP5 A;  5FA7 A;  5A92 A;  3PBR A;  4GN2 A;  2I72 A;  4WEL A;  1CK3 A;  3C4O A;  3HBR A;  5FQQ A;  5GHZ A;  1ZKJ A;  2Z2M B;  3IF5 A;  4JXS A;  5KSH A;  3M6H A;  2Y2L A;  4E6W A;  4QY6 A;  3SH9 A;  3N8R A;  4GB7 A;  2ZQD A;  4S2L A;  1N9B A;  3HVF A;  3P98 A;  5DF8 A;  1IKG A;  1K56 A;  3GSG A;  1GA0 A;  4DE3 A;  4LV2 A;  1BLH A;  3OZH A;  3IXB A;  1G68 A;  4S2P A;  5HW3 A;  5I94 A;  2HDQ A;  1ZG6 A;  3IF6 C;  4ID4 A;  4KZ9 A;  4E3I A;  3IF6 A;  3IXH A;  2BG1 A;  4C75 A;  2IWC A;  5GHY A;  5IHV A;  5JYO A;  1IYS A;  1MY8 A;  3OPH A;  3FKW A;  2ZLY A;  5TR7 A;  2WK0 A;  2XR0 A;  3BFC A;  3V39 A;  3G35 A;  1JWZ A;  4E3M A;  4JF5 A;  3N6I A;  4H8R A;  5FQI A;  2P9V B;  2FFF B;  4X55 A;  2HP5 A;  1TDL A;  5FQK A;  1IEM A;  5EVI B;  5G18 A;  3NC8 A;  4U0X A;  1IYO A;  3IXG A;  5M18 A;  1NZO A;  2XQZ A;  4FH4 A;  3E2K A;  1HVB A;  5TGF A;  4P87 A;  5CGX A;  1CI9 A;  2HDR A;  3LO7 A;  4KQR A;  2PU2 A;  3JYI A;  4OVD A;  4R1G A;  5FI6 A;  5FQ9 A;  3SH7 A;  1JWV A;  2ZC5 B;  2IWD A;  3HLD A;  5EVI D;  3UDF A;  4X68 A;  5CTM A;  3NCK A;  3CG5 A;  5M1A A;  4OKP A;  1KVM A;  4Z9Q A;  4B4X A;  3SOI A;  1ESU A;  1PWD A;  3DTM A;  3VMA A;  3S1Y A;  3G4P A;  3HUM A;  1LHY A;  4OP8 A;  4OPY A;  4GD6 A;  4L0L A;  4KZ8 A;  5DTK A;  1MXO A;  5FDH A;  4WMC D;  4DKI A;  4R3B A;  5DF9 A;  3RXX A;  3LY4 A;  4X53 A;  3W8K A;  1VM1 A;  3MZE A;  4BD0 A;  4O7D A;  5CGW A;  4MLL A;  3MFD A;  3NY4 A;  1CEG A;  4K0W A;  4PMA A;  1BUE A;  1TDG A;  2EXA A;  2QPN A;  4PPR A;  2IWB A;  3SS5 A;  2XGN A;  3WS5 A;  3SS4 A;  1BLS A;  1K25 A;  1DJB A;  1ES2 A;  3OC2 A;  1Z6F A;  4S2N C;  1XGI A;  1JTD A;  4S2N A;  2OSU A;  1H5X A;  1MWS A;  3HUO A;  5F83 A;  1H8Y A;  1IEL A;  1MKI A;  4KG5 A;  5FQJ A;  1OME A;  1E3U D;  2EX8 A;  3W4P A;  5M19 A;  2XLN A;  2ZC3 B;  4ZBE A;  1CI8 A;  5TFQ A;  2G2U A;  1XP4 A;  5CHM A;  4NET A;  4GKU A;  3W4O A;  5EVL A;  4KG6 A;  3HUN A;  3O3V A;  3HL9 A;  3OCN A;  2DNS A;  2H5S A;  2OLU A;  3MZD A;  4ZJ2 A;  5KSC A;  1C3B A;  1FR1 A;  4KZ4 A;  5EVI C;  1FCN A;  1ES4 A;  4OH0 A;  1ERM A;  2ZD8 A;  1NYY A;  3MZF A;  3G32 A;  2J7V A;  5HL1 A;  4UA6 A;  2A49 A;  3S4X A;  5GLC A;  2PBY A;  1H8Z A;  3ZG8 B;  2XFT A;  3SS3 A;  1HD8 A;  4M3K A;  3IWQ A;  4IVK A;  1W79 A;  4RA7 A;  4R0Q A;  2P74 A;  3N8S A;  4LEN A;  3TSG A;  4HBU A;  3OPL A;  1YT4 A;  2R9W A;  2ZQ9 A;  1FR6 A;  4EUZ A;  5AQ9 A;  1JVJ A;  5EUA A;  2EX2 A;  4R4R A;  3BEB A;  3FZC A;  2WYX A;  1YLZ A;  5E2G A;  1GCE A;  4S2I A;  5EPH A;  1MWT A;  3UY6 A;  1KVL A;  4RVA A;  3FKV A;  4S2K A;  5FI7 A;  1L2S A;  1KGE A;  5CER A;  4BQM A;  3IHB A;  1KE4 A;  3BFE A;  3N8L A;  3VP0 A;  1XXM A;  2WAF A;  2WZX A;  3Q7V B;  4WZ5 C;  4C3Q A;  1DY6 A;  3OCL A;  1XPB A;  4WZ5 A;  1PWG A;  4LV1 A;  5U47 A;  3UE1 A;  3AGD A;  4X6T A;  3VFH A;  1SHV A;  1MWR A;  4PM6 A;  2WZZ A;  4X69 A;  1L0G A;  4QJG A;  4WEK A;  2HPB A;  4KG2 A;  4N92 A;  1FSY A;  4LV0 A;  1BLP A;  2R9X A;  3WRT A;  1LL5 A;  4GDB A;  4IBR A;  5EOE A;  3GTC A;  4YFM A;  2E8I A;  4EBL A;  1CEF A;  1GHI A;  1LLB A;  2GDN A;  4DXC A;  3UO9 A;  3V50 A;  2XD5 A;  1EI5 A;  4OOM A;  3MKE A;  3PBQ A;  3IHA A;  1KE0 A;  1K4E A;  4PM5 A;  1WYB A;  2C5W B;  1I2W A;  1LI0 A;  2Q9N A;  3FV7 A;  3V3S A;  2ZQ8 A;  1S0W A;  1K6R A;  5CEC A;  2H0Y A;  4P0M A;  5CRF A;  4OOL A;  3UNW A;  5DTS A;  1Q2P A;  1E25 A;  1WYC A;  3A3I A;  1PZP A;  3IWI A;  5CEB A;  1MBL A;  4Y0T A;  3BEC A;  3UN7 A;  3MBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...