1D1JA

Crystal structure of human profilin ii
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
138
structure length
138
Chain Sequence
AGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVHGGTLNKKAYELALYLRRSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN II
publication title X-ray structure determination of human profilin II: A comparative structural analysis of human profilins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 38
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1d1jA00
3UB5P 3T1XA 2ZL1B 1CF0A 3LGOA 5EM0A 1SKOA 1ACFA 4X25A 3L9KA 3T12B 1K0KA 1VETB 2JKGA 4X1LA 3NULA 3D9YA 2HZ5A 5FEGA 3KYEA 1PFLA 3T1SA 1J3WA 1Z09A 3L7HA 2BTFP 1SKOB 3T1QB 2B95A 3MSHA 1A0KA 1CQAA 1SZVA 1PRQA 5EVEA 1FIKA 1VEUA 5EV0A 2PBDP 2V8CA 2JKFA 2VK3A 2V8FA 1AWIA 1F2KA 2ZL1A 1D1JA 4X1MA 3CPTA 3DAVA 1VEUB 1CJFA 2PRFA 1VETA 3T1RA 3LEQA 1Y4OA 1YPRA 3NECA 5FEFA 1G5UA 2PAVP 3CHWP 4D60A 3CPTB 2E8JA 4QWOA 5FDSA 1FILA 2ACGA 4FUWA 4ESPA 1HLUP 3MS6A 1PNEA 4FTXA 3U4LP 5EM1A
chains in the Genus database with same CATH superfamily
1YSQA 3G34A 4F94A 3IBRA 2GNXA 3CUEA 1MKIA 3B33A 5DFXA 2ZMAA 1SKOA 3TE8A 2OWHA 5HARA 1YLWA 4LV3A 3IWQA 5J7EA 1KE0A 4IEDA 4GD6A 4RA7A 4EEPA 5HAIA 2ZC7A 4FH2A 3MMHA 1PW1A 2WKRA 3OPLA 1BLHA 1SDEA 2B95A 4JGOA 3MZDA 4Q0HA 3G2YA 5HAQA 3HJKA 5EV0A 4UA6A 2ZC5B 5L09A 3E4OA 3FG8A 4IHQA 4EUZA 2EX2A 3LIFA 2KOIA 2ZL1A 1JWZA 3RJUA 5HL6A 3IWOA 2L1MA 4H6JB 1GSVA 1S6RA 1YT4A 3UDIA 1TD5A 3NBLA 3LR4A 4S2JA 3HLWA 1OJ5A 2G2WA 2P08A 4WYYA 4QWOA 1KGGA 1IFQA 3HREA 1N9OA 1N9NA 5DJTA 5E2GA 1DP9A 2HJ9C 4UHUA 3ZG7B 3IHAA 1U60A 1LLBA 4ZTKA 1EI5A 4ZRRA 2V0UA 2IWBA 2O9BA 3PAGA 3F1OB 1W63Q 2Y2HA 4Y3IA 4KZ8A 4E3NA 1Y54A 4HY8A 3BFDA 3G30A 4IBRA 4M4XA 3IBJA 4IVIA 3E4PA 4HHDA 3C2WA 3MFXA 4KZ4A 2BLSA 2W1TA 3PBOA 4JLFA 2JC7A 3PBRA 5F1GA 4GS9B 1KDWA 3NOTC 3KSFA 1A0KA 1LI0A 5IT5A 3WS4A 4WEJA 1LHYA 4EETB 3F1PA 2XLNA 5FQ9A 2RCXA 1ZG4A 5DF8A 4HIAA 4Y17A 2PR6A 5A93A 4DDSA 2JHEA 1LL5A 3DAVA 4OOYA 1VEUB 3FPVA 4KQDA 4DJ3A 1TVFA 1MZUA 4E6XA 4OKPA 4EW7A 1I2WA 4HP9A 2Y2NA 1MWRA 4NEED 3C4PA 2ZC6B 2X01A 2QKPA 4DE3A 4EQ1A 1RCJA 1MC0A 3EWKA 3GDIA 3K3DA 1J9MA 1NWZA 1XJ3A 1ERQA 3ULFA 2O0YA 3HLCA 1ONGA 2H10A 4MBHA 3ITBA 4L9GA 4FTXA 5HWTA 4N9LA 3C4OA 3KYZA 3LGOA 1K4EA 2ZQ8A 4EBNA 1T18A 3BLSA 2JKGA 5FASA 3R7WA 1YQSA 4BQMA 2WK0A 3LFVA 4BLMA 1FR6A 4OQ0A 5FEGA 5FL3A 1K56D 2ZC3B 1K55A 4ARZB 4K08A 4QB8A 1J3WA 1NYMA 3EEAA 1YKDA 1H8YA 4Y13A 4GCZA 4K0WA 3PXPA 4K91A 5DKKA 1S0WA 3ZFZA 1F9IA 1DP8A 5F83A 5TBMB 2XA7M 4KENB 5M1AA 1TEMA 2QJ5A 5FI2A 1BT5A 1NY0A 1GHIA 2K2NA 3RXWA 4DE1A 4UAAA 1WE4A 3NHQA 4Y0TA 4N9KA 2V20A 2PRFA 1SKFA 5FAQA 4ZBEA 4B4XA 4R6LA 3NECA 1LL9A 1TS7A 1S66L 4P6ZS 4I5SA 3OZHA 3G6OA 1LSXA 1IEMA 3HLBA 4R4RA 4KUKA 2G7UA 4BENA 4MMNA 2XFTA 2OAP1 2XDMA 4S2NA 5LBRA 4N92A 4OPYA 2A3UA 4MLLA 5A90A 1K55C 3FYZA 5GL9A 2WUQA 5JYPA 2ZL1B 4S2MA 2Y2MA 1XPBA 2Q0OA 2PYRA 1K38A 4DXBA 3LIEA 4X53A 4O8GA 2JKTI 5CEBA 4R3AA 4S2IA 3SS4A 1PI5A 1BLCA 4E3OA 3UPOA 5E2HA 3F1NB 2HZ5A 4JXVA 4DF6A 3P09A 4I39A 3T1QB 4Y5FA 1XFNA 5FQKA 4E3IA 3GR2A 3MKEA 3DTIA 4LRYC 4LV1A 2PU4A 4JBFA 4E6WA 3QP2A 3HLDA 4H6JA 5BOHA 2PBDP 1O07A 2B18A 4Y0OA 3UDXA 3NI9A 3D3OA 1GA0A 2M7UA 3UB9A 3GMWA 3OBFA 1PYYA 3Q1FA 2IWCA 4S2NC 1GA9A 1F98A 4OONA 2R9XA 3VOYA 4OPQA 3GRJA 1ESIA 3BFFA 2Y2GA 3UE0A 4OH0A 3T1RA 3LIDA 1YPRA 3BFGA 3RFBA 4JPMA 1BLSA 1KGEA 3CPTB 4L0LA 3TRCA 4B4ZA 3NCKA 3F1OA 3KO6A 4JXWA 5FAOA 4DRTA 5GLDA 1F5MA 4KZ3A 4EU0A 3PAEA 2V1BA 3HUMA 3LIAA 1K57A 4ZDXA 3LR0A 5F1FA 5C5KA 1NLYA 1XGJA 3B42A 4GS9A 2K31A 5HDCA 1N9BA 5HWVA 3O88A 3VMAA 4KG2A 4E3JA 1P9RA 2HDRA 2EFXA 2WKIA 3SS3A 4I3IA 1W8YA 2CC1A 1XFQA 1BTLA 3ZQ5A 5K5BA 1EW0A 3VP1A 2PHYA 3EEHA 3SH7A 3D4FA 4YNRA 2PR5A 3C5AA 1NRFA 5CHMA 2JKRM 4GW9A 4D2OA 3A3DA 1VEUA 3JPUA 3BECA 2WZXA 3GVBA 2C6WB 2FH5A 5FDHA 3FV7A 2VV8A 4P85A 2D01A 3SH9A 2XROA 4O01A 5G4YA 4WMCA 1UWNX 4X55A 3R7WB 4Y0UA 2ZQCA 2G2UA 3TG9A 4YOFA 3P98A 1KOUA 3V50A 3IT9A 1LL8A 1ES4A 1K56A 4JXSA 4UEYA 3D72A 3KX0X 2GX5A 3SOIA 4FCFA 1ZC2A 5AQBA 5CTNA 1PZOA 1H8MA 4E04A 2Z2LB 4JGRA 4EV4A 3CJMA 5TGFA 5EM1A 1SDNA 2J3TC 4EUVA 3B47A 4BMWA 2CMNA 2Y8HA 3A3EA 3T1XA 2PD8A 3QP5A 4K0XA 2P7JA 5HX9A 2HP6A 3DWKA 4DXCA 1RP5A 4ARZA 5GHYA 5EM0A 3VP2A 1OPXA 4MDZA 5HWWA 2PYPA 4PM6A 4OQHA 2VJWA 4YFMA 3OCLA 5EPHA 4X69A 5CHJA 3HUNA 1SHVA 5TBMA 2GJ3A 3N4IA 1ALQA 3JYIA 1I2SA 2Y2JA 4OVDA 5HD3A 3M2KA 4Y2FA 1VHMA 3AGDA 3ZG8B 1FOFA 3E4QA 3QP4A 2XR0A 1FIKA 3I7JA 5E2FA 2BG1A 2XQZA 3LI9A 4HH2A 3UNWA 3BW6A 4S2OA 4IJGA 2H0TA 3VSLA 4R1GA 3ZCZA 3N7WA 3P01A 2ZQDA 4BD0A 5HPFA 2ZD8A 4NKPA 2Y2IA 2ZOHA 1DY6A 2J80A 2EFUA 5J8XA 2X02A 1P9WA 1V9YA 4HEFA 1YMXA 4OP5A 1G5UA 3EQUA 5DTKA 1PI4A 1TDGA 2DMWA 3ZNTA 3IF6A 1NRJA 4IUKA 4GOGA 3DWZA 2HV1A 1DRMA 4QHCA 2QHKA 5FDSA 4WEKA 2MJ6A 4FH4A 1S1ZA 3S22A 5FQQA 4FSFA 1GCEA 2XD5A 3WS0A 3UDFA 3G2ZA 2WKQA 1IYPA 3IWIA 4PAUA 3ZG5A 3F1NA 1IKGA 1GSWA 4ZJ1A 3IXHA 4N1XA 1W8QA 3LR5A 3CAXA 1L2SA 3HLEA 3L9KA 4KQQA 4WELA 1S1YA 1K6SA 2XH9A 4GDNA 1MPLA 3GQZA 3MQOA 3DTKA 2EX6A 4X1LA 1FQGA 3A3FA 2XF3A 4HJ6A 2J9OA 2V1ZA 1CEGA 2V0WA 4U0TA 1OMEA 5M18A 3N8SA 1T19A 3E0YA 3BQ8A 2O9AA 4A5RA 1H5XA 3CMZA 3VOLA 5EVEA 2V9AA 1VM1A 2VK3A 4DDYA 3IF6C 2V8FA 2ZQ7A 1LSWA 2W3DA 1WYCA 2WAFA 4NK3A 5E43A 1WA9A 4PHTA 3CPTA 3KSGA 3T4JA 3T4KA 2W27A 1STZA 2GDNA 5GHZA 3IX3A 2DRWA 3CHWP 3QNCA 1K25A 5F68A 2QMIA 4HBUA 3WS1A 4NG2A 5HD5A 3KYQA 2ACGA 1DJBA 1V9ZA 3O87A 4HQAA 5I5LA 1DJAA 3PBSA 4LCLA 3G4PA 4L9FA 2EXBA 4RVAA 1RGZA 1TF1A 1NXYA 1PNEA 3UB8A 5KSCA 2ZLYA 3E2KA 2J3TD 2IWDA 5IS1A 2FFFB 4NXBA 5HZHA 2LB5A 3G32A 1CF0A 5TR7A 1XX2A 3LY3A 2W0NA 5KIZA 4S2LA 2Y55A 1ES5A 4JF4A 1WYBA 2XSSA 3VE4A 2WYXA 1PFLA 4CLCA 4O7DA 1MWTA 1TS0A 2VKSA 3WS2A 1E25A 1QMFA 5JYOA 4WMCD 3O3VA 1VQQA 1X0OA 1S4RA 3OLOA 4E3LA 3CI6A 2W3HA 4EWFA 5HAPA 2VLGA 1TS8A 4R38A 4YWZA 3UPNA 4G3KA 4HJ4A 2XRNA 5EVIB 5CECA 4EERA 3HVFA 3NDGA 3DTEA 3MF0A 3E98A 1L0DA 2EX9A 5D3OA 5HL1A 4OOMA 1XA1A 3CLOA 3IQAA 1CI8A 1XP4A 2Y79A 4FOFA 1FSWA 5EVID 4L9EA 1XGIA 4BBTA 3Q82A 3WRZA 4I38A 1JNUA 5CGWA 4GN2A 1FILA 2Q9MA 3V5MA 1HLUP 5TFQA 4OPRA 4CJNA 4Q0JA 4F3LB 4CLCC 4MEZA 1DP6A 2VV6A 1XXMA 3ZVWA 1LI9A 3O5YA 3EOIA 3T4LA 3A3IA 2H28A 5F82A 3TJZC 5FAPA 1KVLA 3LUQA 4I3JA 3ITAA 4EEUA 5G18A 1MWSA 1KE4A 3ZG0A 2XK1A 5CEDA 5FI7A 1IOUA 3IF6B 3SZTA 1ZKJA 4GLQA 3DBAA 4HESA 3L7HA 4IVKA 1BYWA 4B93A 1L0FA 4XT2B 3LCEA 4R23A 1W7FA 1ZHHB 4CQHA 2QPNA 4X68A 3ZHHA 2JKTM 2XD1A 3UPPA 2JBFA 2FFYA 1AWIA 1OTAA 3MFDA 2YKHA 4X1MA 4G3VA 2KX6A 3VP4A 5FQJA 3IHBA 1MWUA 1PWCA 3NY4A 3FC7A 3AGFA 3FKVA 3NC8A 1PW8A 1JWVA 2IA2A 3RXXA 2JN7A 1XJ2A 4DMZA 1ONHA 3M2JA 1W63M 3N8LA 4PM9A 5A8BA 2NUTC 4IBXA 4FUWA 1KDSA 1LT0A 1HZOA 2ZM8A 3G35A 3S7OA 1FR1A 2OOLA 5FSRA 3BEBA 3ZGAB 2ZMFA 4BBVA 2VGJA 3W4OA 4Y7PA 3IH8A 4LPZA 2VA0A 1HD8A 3DTMA 3T4SA 2ZC4B 3A0VA 3NDEA 2BASA 3UMDA 3IXBA 1OTEA 3Q81A 4WL9A 3O86A 4JGPA 4C75A 3PR6A 4GJ4A 3PYPA 3KYEA 4KZ9A 4JF5A 1LSVA 4Q0IA 4N1HA 4KZ6A 5DJUA 1OTDA 4B9OA 1CEFA 4KZBA 1BULA 2WGIA 1I5QA 3MJQA 4QJGA 5E2EA 3V3RA 3C38A 3C7VA 3ZYTA 4EBLA 2XFSA 1P0ZA 2FZ0A 2ZM0A 4AFIA 3E2LA 3OC2A 3IX8A 3UN7A 1HVBA 4WN5A 4OQGA 4KQOA 3Q7VB 4ZJ3A 2XA7S 1QMEA 1L3LA 1XJ6A 2H0YA 2UWXA 1BZAA 1XKZA 4KZAA 1N4OA 4JKTA 5F5YA 4CPKA 1OT6A 2OLVA 1KVMA 3N6IA 4OP8A 2Y91A 3OPHA 1Y4OA 2VX8A 3LICA 2E8IA 2PDRA 2W3EA 4CLCB 1G6AA 4CLCE 5A92A 2B5RA 4R3BA 4ME4A 1EROA 2PAVP 2ZMVA 2C5WB 4D60A 2PT7A 4XUZA 4FD8A 1MBLA 1OJGA 4LRZE 2WGWA 1IKIA 2OWJA 5L07A 4LENA 3NIAA 2OAQ1 4MN6A 5CERA 1YLYA 4DN0A 2DNSA 5J3WA 4E3KA 3FWLA 4DE0A 2L0WA 4CLCD 5F69A 3LEZA 2O9CA 4HJ3A 1ERMA 3H9WA 3KSHA 1Z6FA 2NUPC 3ZDJA 4IUHA 4UQIS 3OPRA 3EQVA 3HCYA 4JGQA 3H82A 3CZDA 2ZOIA 5EVIA 5AQ9A 2A24B 5FATA 2RL3A 4ZJ2A 3CG5A 2HP5A 5IU1A 3FZCA 1E3UA 4O0PA 3W4PA 1FCOA 2EWVA 2UV0E 2V1AA 4NXEA 3LIBA 1CK3A 3PTEA 3TOIA 2W3GA 4DKIA 4LV2A 1YLJA 2JKFA 5AQAA 5L8MA 1GHMA 1BSGA 4H8RA 2ZQAA 3U2AA 4GKUA 2ZQ9A 1K54A 4ID4A 1T1CA 1ZG6A 2YKFA 1PIOA 3HLFA 1VETA 1XA7A 3BLMA 1Y28A 4F3LA 1IELA 4B88A 2H5SA 4R70A 4RX2A 4LGWA 2HPBA 3T4OA 4KG5A 3CITA 4ZAMA 2OSUA 2WKEA 3BM6A 4ESPA 3IS2A 2J7VA 4QD4A 2HJEA 5AQ7A 1FSYA 5EVIC 3SW1A 4NETA 4X6TA 4HBTA 3LYXA 3UY6A 1OT9A 4EQIA 4HH3A 2HDUA 5I94A 1L0EA 3MQ0A 1W5DA 4MNRA 2PBYA 4RQ9A 4BL2A 3VSKA 1ACFA 4Q8IA 5IHVA 4XT2A 1K0KA 2A2LA 4GZBA 4GB7A 4KUOA 5EUAA 1K54C 1M6KA 4C6YA 2BTFP 2WAEA 3MSHA 1XJ4A 3ISGA 2VEAA 2OV5A 1BUEA 1CQAA 2XGNA 3BRMA 4G3WA 2V8CA 3CUEC 4X56A 3H7WB 3K2NA 3T4QA 1NJ4A 1D06A 5EOOA 5EVLA 4WZ4A 5CX7A 5HDDA 5CXWA 5EFWA 4BL3A 4DE2A 1CI9A 4LV0A 4WUJA 1P97A 3LR3A 3QHYA 3HLGA 1CJFA 4P6ZM 2INWA 3BFEA 3G31A 3ICYA 4OOLA 2EWWA 3S4XA 3FKWA 2Z6CA 3EGXC 5AVEA 3IH9A 4RX3A 2Y2QA 3BJNA 2HF6A 2K7SA 3MZFA 1FCNA 2XEPA 1IYOA 3GSGA 2KLIA 2QYBA 3UE6A 4BBUA 1IYSA 5U47A 5L2FA 4QY6A 1T1AA 3M6HA 3MS6A 4KQRA 1NZUA 1DJCA 2VV7A 4GDBA 3T4TA 2P04A 1H3QA 4WLAA 3HJIA 3WRTA 2WGVA 4X25A 3W4QA 4S2PA 3T12B 4DJ2A 5G4ZA 1SCWA 2QJ7A 3QNBA 2VGLS 2P9VA 3NULA 1M40A 5J4EA 4LRXC 3BY8A 4Y15A 3K3CA 4PM7A 3BWLA 3V3SA 2KDKA 3S7NA 2WGWB 4PKYG 3Q7VA 5DFYA 2I9VA 2D02A 2HDSA 5EE8A 2PU2A 2J8YA 4JXGA 5DF7A 4E3MA 1TDLA 3PBQA 3IXGA 4HI4A 2B02A 1F2KA 5HFOA 4EXOA 2R9WA 2W3FA 3C8CA 3ZNYA 4WM9A 1OTBA 1YLTA 1YLZA 2Y2PA 2ZJ9A 2Z2MB 3H82B 3BFCA 5DTTA 3MZEA 3NOPC 3OOVA 1MKMA 4MN7A 3JVUA 1PWGA 1O7EA 1YAXA 2Y59A 5EOEA 3PHYA 4XXRA 3LO7A 5EECA 4GNUA 1GHPA 3OCNA 5MC7A 5M19A 2WADA 1HTZA 3VV4A 3U4LP 3UB7A 4II7A 5KZHA 2EA9A 3MXSA 4QU3A 3UO9A 3V39A 4MCWA 3S7PA 4GHIB 4LLOB 4LFUA 2A24A 1E3UD 1Q2QA 2ZM2A 1VETB 1L0GA 1FCMA 1MXOA 3BY9A 3BQAA 3D9YA 4KZ5A 5KSHA 3RTYA 2A49A 3AGEA 5KMWA 1YLPA 3A3JA 3T1SA 1ES2A 4R0QA 3QP8A 4NXFA 1NYYA 3A0SA 1UGUA 1PWDA 1SKOB 3RH8B 1C3BA 4HOIA 3UE3A 1YSPA 3T50A 3IS2B 2O99A 2L4RA 2Y2LA 2Y2OA 2V2FF 2J3WA 1S4SA 4WBGA 4QY5A 4BWIA 1UWPX 4BD1A 5DVAA 2R78A 2JCHA 3P7NA 3VOZA 3LY4A 1D1JA 4OLGA 5DTSA 3IXDA 3PBNA 3Q7ZA 4EESA 2EX8A 2HGVA 4U0XA 3LEQA 1ESUA 3MQQA 4PM5A 3ZG9B 4UQIM 1K6RA 4KZ7A 5GLCA 2PD7A 5HPIA 5CGXA 4PM8A 4R4SA 2QZ6A 4P6BA 1JVJA 4PMAA 1JWPA 2WKHA 3VFHA 5GLAA 4P87A 3MR0A 3WWXA 5FQIA 4WF0A 1VB6A 2JE5A 3N8RA 3MXQA 3DW0A 2HDQA 3MKFA 2WKPA 4P0MA 2VGKA 3H7WA 5F6AA 1Z09A 4R3JA 5FI6A 4C3QA 1KE3A 4EBPA 5CTMA 4S2KA 4I3AA 3KSIA 1JTGA 5TJJA 2W1TB 4QPRA 4ETZA 1OTIA 3JVVA 2Q9NA 1GSXA 3NJAA 5DF9A 5CHUA 3HBRA 5DKLA 2EXAA 3W8KA 4GD8A 1ZTUA 4MBFA 4PPRA 1G68A 3VFFA 3QP1A 3CWFA 2Y2KA 2HP9A 3PBTA 3TW8A 1H0MA 4OLDA 3F1PB 2WZZA 3B3XA 1Q2PA 2P9VB 4HNBA 3WS5A 3M6BA 3V67A 2J9PA 4UA7A 2ZBBA 3LI8A 1G28A 5AVFA 5HSQA 1NZOA 3SS5A 3UE1A 3IF5A 4UA9A 3QP6A 3EGDC 3VP3A 3BYDA 3VE3A 3C30A 2OLUA 3SH8A 1T1BA 1D7EA 4BJPA 1ES3A 3UB5P 1TS6A 1NLZA 3HUOA 4PKYA 4M3KA 1BLPA 2I72A 3TSGA 2JKRI 5FA7A 2AVXA 2Y4AA 4MBKA 2VZWA 5GHXA 5AJGA 4WZ5A 4YINA 4Z9QA 2M7VA 5FQMA 2DCFA 1AXBA 5GLBA 1K4FA 3C7UA 4ETXA 4RYEA 1RGYA 5CGSA 1G6OA 4JF6A 3VP0A 2M1CA 1K57C 2P74A 2X71A 1SZVA 1PRQA 2LB9A 4MN5A 1KGFA 5HW3A 3HL9A 4OPZA 1E4DA 1PZPA 4XUXA 3A0RA 4HP4A 3ZVTA 3GTCA 2QWSA 4Z1WA 4NXGA 3IX4A 1W79A 3OPPA 1JTDA 5A91A 3UMEA 3R4KA 3Q07A 1EWZA 3S7QA 3MXRA 3FPWA 1IYQA 1YMSA 5L10A 4KG6A 2Z6DA 3GV9A 5FEFA 4OQIA 3W2ZA 2VGLM 1ODVA 1S67L 5CRFA 4WZ5C 2E8JA 4GHIA 2GZAA 1H8ZA 3MBZA 3S1YA 1MY8A 4LCMA 1N9LA 3GECA 3UB6A 1YM1A 5HDSA 3NOUC 2W1RA 4U3TA
chains in the Genus database with same CATH topology
3UB5P 3T1XA 2ZL1B 1CF0A 3LGOA 5EM0A 1SKOA 1ACFA 4X25A 3L9KA 3T12B 1K0KA 1VETB 2JKGA 4X1LA 3NULA 3D9YA 2HZ5A 5FEGA 3KYEA 1PFLA 3T1SA 1J3WA 1Z09A 3L7HA 2BTFP 1SKOB 3T1QB 2B95A 3MSHA 1A0KA 1CQAA 1SZVA 1PRQA 5EVEA 1FIKA 1VEUA 5EV0A 2PBDP 2V8CA 2JKFA 2VK3A 2V8FA 1AWIA 1F2KA 2ZL1A 1D1JA 4X1MA 3CPTA 3DAVA 1VEUB 1CJFA 2PRFA 1VETA 3T1RA 3LEQA 1Y4OA 1YPRA 3NECA 5FEFA 1G5UA 2PAVP 3CHWP 4D60A 3CPTB 2E8JA 4QWOA 5FDSA 1FILA 2ACGA 4FUWA 4ESPA 1HLUP 3MS6A 1PNEA 4FTXA 3U4LP 5EM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UB5 P;  3T1X A;  2ZL1 B;  1CF0 A;  3LGO A;  5EM0 A;  1SKO A;  1ACF A;  4X25 A;  3L9K A;  3T12 B;  1K0K A;  1VET B;  2JKG A;  4X1L A;  3NUL A;  3D9Y A;  2HZ5 A;  5FEG A;  3KYE A;  1PFL A;  3T1S A;  1J3W A;  1Z09 A;  3L7H A;  2BTF P;  1SKO B;  3T1Q B;  2B95 A;  3MSH A;  1A0K A;  1CQA A;  1SZV A;  1PRQ A;  5EVE A;  1FIK A;  1VEU A;  5EV0 A;  2PBD P;  2V8C A;  2JKF A;  2VK3 A;  2V8F A;  1AWI A;  1F2K A;  2ZL1 A;  1D1J A;  4X1M A;  3CPT A;  3DAV A;  1VEU B;  1CJF A;  2PRF A;  1VET A;  3T1R A;  3LEQ A;  1Y4O A;  1YPR A;  3NEC A;  5FEF A;  1G5U A;  2PAV P;  3CHW P;  4D60 A;  3CPT B;  2E8J A;  4QWO A;  5FDS A;  1FIL A;  2ACG A;  4FUW A;  4ESP A;  1HLU P;  3MS6 A;  1PNE A;  4FTX A;  3U4L P;  5EM1 A; 
#chains in the Genus database with same CATH topology
 1YSQ A;  3G34 A;  4F94 A;  3IBR A;  2GNX A;  3CUE A;  1MKI A;  3B33 A;  5DFX A;  2ZMA A;  1SKO A;  3TE8 A;  2OWH A;  5HAR A;  1YLW A;  4LV3 A;  3IWQ A;  5J7E A;  1KE0 A;  4IED A;  4GD6 A;  4RA7 A;  4EEP A;  5HAI A;  2ZC7 A;  4FH2 A;  3MMH A;  1PW1 A;  2WKR A;  3OPL A;  1BLH A;  1SDE A;  2B95 A;  4JGO A;  3MZD A;  4Q0H A;  3G2Y A;  5HAQ A;  3HJK A;  5EV0 A;  4UA6 A;  2ZC5 B;  5L09 A;  3E4O A;  3FG8 A;  4IHQ A;  4EUZ A;  2EX2 A;  3LIF A;  2KOI A;  2ZL1 A;  1JWZ A;  3RJU A;  5HL6 A;  3IWO A;  2L1M A;  4H6J B;  1GSV A;  1S6R A;  1YT4 A;  3UDI A;  1TD5 A;  3NBL A;  3LR4 A;  4S2J A;  3HLW A;  1OJ5 A;  2G2W A;  2P08 A;  4WYY A;  4QWO A;  1KGG A;  1IFQ A;  3HRE A;  1N9O A;  1N9N A;  5DJT A;  5E2G A;  1DP9 A;  2HJ9 C;  4UHU A;  3ZG7 B;  3IHA A;  1U60 A;  1LLB A;  4ZTK A;  1EI5 A;  4ZRR A;  2V0U A;  2IWB A;  2O9B A;  3PAG A;  3F1O B;  1W63 Q;  2Y2H A;  4Y3I A;  4KZ8 A;  4E3N A;  1Y54 A;  4HY8 A;  3BFD A;  3G30 A;  4IBR A;  4M4X A;  3IBJ A;  4IVI A;  3E4P A;  4HHD A;  3C2W A;  3MFX A;  4KZ4 A;  2BLS A;  2W1T A;  3PBO A;  4JLF A;  2JC7 A;  3PBR A;  5F1G A;  4GS9 B;  1KDW A;  3NOT C;  3KSF A;  1A0K A;  1LI0 A;  5IT5 A;  3WS4 A;  4WEJ A;  1LHY A;  4EET B;  3F1P A;  2XLN A;  5FQ9 A;  2RCX A;  1ZG4 A;  5DF8 A;  4HIA A;  4Y17 A;  2PR6 A;  5A93 A;  4DDS A;  2JHE A;  1LL5 A;  3DAV A;  4OOY A;  1VEU B;  3FPV A;  4KQD A;  4DJ3 A;  1TVF A;  1MZU A;  4E6X A;  4OKP A;  4EW7 A;  1I2W A;  4HP9 A;  2Y2N A;  1MWR A;  4NEE D;  3C4P A;  2ZC6 B;  2X01 A;  2QKP A;  4DE3 A;  4EQ1 A;  1RCJ A;  1MC0 A;  3EWK A;  3GDI A;  3K3D A;  1J9M A;  1NWZ A;  1XJ3 A;  1ERQ A;  3ULF A;  2O0Y A;  3HLC A;  1ONG A;  2H10 A;  4MBH A;  3ITB A;  4L9G A;  4FTX A;  5HWT A;  4N9L A;  3C4O A;  3KYZ A;  3LGO A;  1K4E A;  2ZQ8 A;  4EBN A;  1T18 A;  3BLS A;  2JKG A;  5FAS A;  3R7W A;  1YQS A;  4BQM A;  2WK0 A;  3LFV A;  4BLM A;  1FR6 A;  4OQ0 A;  5FEG A;  5FL3 A;  1K56 D;  2ZC3 B;  1K55 A;  4ARZ B;  4K08 A;  4QB8 A;  1J3W A;  1NYM A;  3EEA A;  1YKD A;  1H8Y A;  4Y13 A;  4GCZ A;  4K0W A;  3PXP A;  4K91 A;  5DKK A;  1S0W A;  3ZFZ A;  1F9I A;  1DP8 A;  5F83 A;  5TBM B;  2XA7 M;  4KEN B;  5M1A A;  1TEM A;  2QJ5 A;  5FI2 A;  1BT5 A;  1NY0 A;  1GHI A;  2K2N A;  3RXW A;  4DE1 A;  4UAA A;  1WE4 A;  3NHQ A;  4Y0T A;  4N9K A;  2V20 A;  2PRF A;  1SKF A;  5FAQ A;  4ZBE A;  4B4X A;  4R6L A;  3NEC A;  1LL9 A;  1TS7 A;  1S66 L;  4P6Z S;  4I5S A;  3OZH A;  3G6O A;  1LSX A;  1IEM A;  3HLB A;  4R4R A;  4KUK A;  2G7U A;  4BEN A;  4MMN A;  2XFT A;  2OAP 1;  2XDM A;  4S2N A;  5LBR A;  4N92 A;  4OPY A;  2A3U A;  4MLL A;  5A90 A;  1K55 C;  3FYZ A;  5GL9 A;  2WUQ A;  5JYP A;  2ZL1 B;  4S2M A;  2Y2M A;  1XPB A;  2Q0O A;  2PYR A;  1K38 A;  4DXB A;  3LIE A;  4X53 A;  4O8G A;  2JKT I;  5CEB A;  4R3A A;  4S2I A;  3SS4 A;  1PI5 A;  1BLC A;  4E3O A;  3UPO A;  5E2H A;  3F1N B;  2HZ5 A;  4JXV A;  4DF6 A;  3P09 A;  4I39 A;  3T1Q B;  4Y5F A;  1XFN A;  5FQK A;  4E3I A;  3GR2 A;  3MKE A;  3DTI A;  4LRY C;  4LV1 A;  2PU4 A;  4JBF A;  4E6W A;  3QP2 A;  3HLD A;  4H6J A;  5BOH A;  2PBD P;  1O07 A;  2B18 A;  4Y0O A;  3UDX A;  3NI9 A;  3D3O A;  1GA0 A;  2M7U A;  3UB9 A;  3GMW A;  3OBF A;  1PYY A;  3Q1F A;  2IWC A;  4S2N C;  1GA9 A;  1F98 A;  4OON A;  2R9X A;  3VOY A;  4OPQ A;  3GRJ A;  1ESI A;  3BFF A;  2Y2G A;  3UE0 A;  4OH0 A;  3T1R A;  3LID A;  1YPR A;  3BFG A;  3RFB A;  4JPM A;  1BLS A;  1KGE A;  3CPT B;  4L0L A;  3TRC A;  4B4Z A;  3NCK A;  3F1O A;  3KO6 A;  4JXW A;  5FAO A;  4DRT A;  5GLD A;  1F5M A;  4KZ3 A;  4EU0 A;  3PAE A;  2V1B A;  3HUM A;  3LIA A;  1K57 A;  4ZDX A;  3LR0 A;  5F1F A;  5C5K A;  1NLY A;  1XGJ A;  3B42 A;  4GS9 A;  2K31 A;  5HDC A;  1N9B A;  5HWV A;  3O88 A;  3VMA A;  4KG2 A;  4E3J A;  1P9R A;  2HDR A;  2EFX A;  2WKI A;  3SS3 A;  4I3I A;  1W8Y A;  2CC1 A;  1XFQ A;  1BTL A;  3ZQ5 A;  5K5B A;  1EW0 A;  3VP1 A;  2PHY A;  3EEH A;  3SH7 A;  3D4F A;  4YNR A;  2PR5 A;  3C5A A;  1NRF A;  5CHM A;  2JKR M;  4GW9 A;  4D2O A;  3A3D A;  1VEU A;  3JPU A;  3BEC A;  2WZX A;  3GVB A;  2C6W B;  2FH5 A;  5FDH A;  3FV7 A;  2VV8 A;  4P85 A;  2D01 A;  3SH9 A;  2XRO A;  4O01 A;  5G4Y A;  4WMC A;  1UWN X;  4X55 A;  3R7W B;  4Y0U A;  2ZQC A;  2G2U A;  3TG9 A;  4YOF A;  3P98 A;  1KOU A;  3V50 A;  3IT9 A;  1LL8 A;  1ES4 A;  1K56 A;  4JXS A;  4UEY A;  3D72 A;  3KX0 X;  2GX5 A;  3SOI A;  4FCF A;  1ZC2 A;  5AQB A;  5CTN A;  1PZO A;  1H8M A;  4E04 A;  2Z2L B;  4JGR A;  4EV4 A;  3CJM A;  5TGF A;  5EM1 A;  1SDN A;  2J3T C;  4EUV A;  3B47 A;  4BMW A;  2CMN A;  2Y8H A;  3A3E A;  3T1X A;  2PD8 A;  3QP5 A;  4K0X A;  2P7J A;  5HX9 A;  2HP6 A;  3DWK A;  4DXC A;  1RP5 A;  4ARZ A;  5GHY A;  5EM0 A;  3VP2 A;  1OPX A;  4MDZ A;  5HWW A;  2PYP A;  4PM6 A;  4OQH A;  2VJW A;  4YFM A;  3OCL A;  5EPH A;  4X69 A;  5CHJ A;  3HUN A;  1SHV A;  5TBM A;  2GJ3 A;  3N4I A;  1ALQ A;  3JYI A;  1I2S A;  2Y2J A;  4OVD A;  5HD3 A;  3M2K A;  4Y2F A;  1VHM A;  3AGD A;  3ZG8 B;  1FOF A;  3E4Q A;  3QP4 A;  2XR0 A;  1FIK A;  3I7J A;  5E2F A;  2BG1 A;  2XQZ A;  3LI9 A;  4HH2 A;  3UNW A;  3BW6 A;  4S2O A;  4IJG A;  2H0T A;  3VSL A;  4R1G A;  3ZCZ A;  3N7W A;  3P01 A;  2ZQD A;  4BD0 A;  5HPF A;  2ZD8 A;  4NKP A;  2Y2I A;  2ZOH A;  1DY6 A;  2J80 A;  2EFU A;  5J8X A;  2X02 A;  1P9W A;  1V9Y A;  4HEF A;  1YMX A;  4OP5 A;  1G5U A;  3EQU A;  5DTK A;  1PI4 A;  1TDG A;  2DMW A;  3ZNT A;  3IF6 A;  1NRJ A;  4IUK A;  4GOG A;  3DWZ A;  2HV1 A;  1DRM A;  4QHC A;  2QHK A;  5FDS A;  4WEK A;  2MJ6 A;  4FH4 A;  1S1Z A;  3S22 A;  5FQQ A;  4FSF A;  1GCE A;  2XD5 A;  3WS0 A;  3UDF A;  3G2Z A;  2WKQ A;  1IYP A;  3IWI A;  4PAU A;  3ZG5 A;  3F1N A;  1IKG A;  1GSW A;  4ZJ1 A;  3IXH A;  4N1X A;  1W8Q A;  3LR5 A;  3CAX A;  1L2S A;  3HLE A;  3L9K A;  4KQQ A;  4WEL A;  1S1Y A;  1K6S A;  2XH9 A;  4GDN A;  1MPL A;  3GQZ A;  3MQO A;  3DTK A;  2EX6 A;  4X1L A;  1FQG A;  3A3F A;  2XF3 A;  4HJ6 A;  2J9O A;  2V1Z A;  1CEG A;  2V0W A;  4U0T A;  1OME A;  5M18 A;  3N8S A;  1T19 A;  3E0Y A;  3BQ8 A;  2O9A A;  4A5R A;  1H5X A;  3CMZ A;  3VOL A;  5EVE A;  2V9A A;  1VM1 A;  2VK3 A;  4DDY A;  3IF6 C;  2V8F A;  2ZQ7 A;  1LSW A;  2W3D A;  1WYC A;  2WAF A;  4NK3 A;  5E43 A;  1WA9 A;  4PHT A;  3CPT A;  3KSG A;  3T4J A;  3T4K A;  2W27 A;  1STZ A;  2GDN A;  5GHZ A;  3IX3 A;  2DRW A;  3CHW P;  3QNC A;  1K25 A;  5F68 A;  2QMI A;  4HBU A;  3WS1 A;  4NG2 A;  5HD5 A;  3KYQ A;  2ACG A;  1DJB A;  1V9Z A;  3O87 A;  4HQA A;  5I5L A;  1DJA A;  3PBS A;  4LCL A;  3G4P A;  4L9F A;  2EXB A;  4RVA A;  1RGZ A;  1TF1 A;  1NXY A;  1PNE A;  3UB8 A;  5KSC A;  2ZLY A;  3E2K A;  2J3T D;  2IWD A;  5IS1 A;  2FFF B;  4NXB A;  5HZH A;  2LB5 A;  3G32 A;  1CF0 A;  5TR7 A;  1XX2 A;  3LY3 A;  2W0N A;  5KIZ A;  4S2L A;  2Y55 A;  1ES5 A;  4JF4 A;  1WYB A;  2XSS A;  3VE4 A;  2WYX A;  1PFL A;  4CLC A;  4O7D A;  1MWT A;  1TS0 A;  2VKS A;  3WS2 A;  1E25 A;  1QMF A;  5JYO A;  4WMC D;  3O3V A;  1VQQ A;  1X0O A;  1S4R A;  3OLO A;  4E3L A;  3CI6 A;  2W3H A;  4EWF A;  5HAP A;  2VLG A;  1TS8 A;  4R38 A;  4YWZ A;  3UPN A;  4G3K A;  4HJ4 A;  2XRN A;  5EVI B;  5CEC A;  4EER A;  3HVF A;  3NDG A;  3DTE A;  3MF0 A;  3E98 A;  1L0D A;  2EX9 A;  5D3O A;  5HL1 A;  4OOM A;  1XA1 A;  3CLO A;  3IQA A;  1CI8 A;  1XP4 A;  2Y79 A;  4FOF A;  1FSW A;  5EVI D;  4L9E A;  1XGI A;  4BBT A;  3Q82 A;  3WRZ A;  4I38 A;  1JNU A;  5CGW A;  4GN2 A;  1FIL A;  2Q9M A;  3V5M A;  1HLU P;  5TFQ A;  4OPR A;  4CJN A;  4Q0J A;  4F3L B;  4CLC C;  4MEZ A;  1DP6 A;  2VV6 A;  1XXM A;  3ZVW A;  1LI9 A;  3O5Y A;  3EOI A;  3T4L A;  3A3I A;  2H28 A;  5F82 A;  3TJZ C;  5FAP A;  1KVL A;  3LUQ A;  4I3J A;  3ITA A;  4EEU A;  5G18 A;  1MWS A;  1KE4 A;  3ZG0 A;  2XK1 A;  5CED A;  5FI7 A;  1IOU A;  3IF6 B;  3SZT A;  1ZKJ A;  4GLQ A;  3DBA A;  4HES A;  3L7H A;  4IVK A;  1BYW A;  4B93 A;  1L0F A;  4XT2 B;  3LCE A;  4R23 A;  1W7F A;  1ZHH B;  4CQH A;  2QPN A;  4X68 A;  3ZHH A;  2JKT M;  2XD1 A;  3UPP A;  2JBF A;  2FFY A;  1AWI A;  1OTA A;  3MFD A;  2YKH A;  4X1M A;  4G3V A;  2KX6 A;  3VP4 A;  5FQJ A;  3IHB A;  1MWU A;  1PWC A;  3NY4 A;  3FC7 A;  3AGF A;  3FKV A;  3NC8 A;  1PW8 A;  1JWV A;  2IA2 A;  3RXX A;  2JN7 A;  1XJ2 A;  4DMZ A;  1ONH A;  3M2J A;  1W63 M;  3N8L A;  4PM9 A;  5A8B A;  2NUT C;  4IBX A;  4FUW A;  1KDS A;  1LT0 A;  1HZO A;  2ZM8 A;  3G35 A;  3S7O A;  1FR1 A;  2OOL A;  5FSR A;  3BEB A;  3ZGA B;  2ZMF A;  4BBV A;  2VGJ A;  3W4O A;  4Y7P A;  3IH8 A;  4LPZ A;  2VA0 A;  1HD8 A;  3DTM A;  3T4S A;  2ZC4 B;  3A0V A;  3NDE A;  2BAS A;  3UMD A;  3IXB A;  1OTE A;  3Q81 A;  4WL9 A;  3O86 A;  4JGP A;  4C75 A;  3PR6 A;  4GJ4 A;  3PYP A;  3KYE A;  4KZ9 A;  4JF5 A;  1LSV A;  4Q0I A;  4N1H A;  4KZ6 A;  5DJU A;  1OTD A;  4B9O A;  1CEF A;  4KZB A;  1BUL A;  2WGI A;  1I5Q A;  3MJQ A;  4QJG A;  5E2E A;  3V3R A;  3C38 A;  3C7V A;  3ZYT A;  4EBL A;  2XFS A;  1P0Z A;  2FZ0 A;  2ZM0 A;  4AFI A;  3E2L A;  3OC2 A;  3IX8 A;  3UN7 A;  1HVB A;  4WN5 A;  4OQG A;  4KQO A;  3Q7V B;  4ZJ3 A;  2XA7 S;  1QME A;  1L3L A;  1XJ6 A;  2H0Y A;  2UWX A;  1BZA A;  1XKZ A;  4KZA A;  1N4O A;  4JKT A;  5F5Y A;  4CPK A;  1OT6 A;  2OLV A;  1KVM A;  3N6I A;  4OP8 A;  2Y91 A;  3OPH A;  1Y4O A;  2VX8 A;  3LIC A;  2E8I A;  2PDR A;  2W3E A;  4CLC B;  1G6A A;  4CLC E;  5A92 A;  2B5R A;  4R3B A;  4ME4 A;  1ERO A;  2PAV P;  2ZMV A;  2C5W B;  4D60 A;  2PT7 A;  4XUZ A;  4FD8 A;  1MBL A;  1OJG A;  4LRZ E;  2WGW A;  1IKI A;  2OWJ A;  5L07 A;  4LEN A;  3NIA A;  2OAQ 1;  4MN6 A;  5CER A;  1YLY A;  4DN0 A;  2DNS A;  5J3W A;  4E3K A;  3FWL A;  4DE0 A;  2L0W A;  4CLC D;  5F69 A;  3LEZ A;  2O9C A;  4HJ3 A;  1ERM A;  3H9W A;  3KSH A;  1Z6F A;  2NUP C;  3ZDJ A;  4IUH A;  4UQI S;  3OPR A;  3EQV A;  3HCY A;  4JGQ A;  3H82 A;  3CZD A;  2ZOI A;  5EVI A;  5AQ9 A;  2A24 B;  5FAT A;  2RL3 A;  4ZJ2 A;  3CG5 A;  2HP5 A;  5IU1 A;  3FZC A;  1E3U A;  4O0P A;  3W4P A;  1FCO A;  2EWV A;  2UV0 E;  2V1A A;  4NXE A;  3LIB A;  1CK3 A;  3PTE A;  3TOI A;  2W3G A;  4DKI A;  4LV2 A;  1YLJ A;  2JKF A;  5AQA A;  5L8M A;  1GHM A;  1BSG A;  4H8R A;  2ZQA A;  3U2A A;  4GKU A;  2ZQ9 A;  1K54 A;  4ID4 A;  1T1C A;  1ZG6 A;  2YKF A;  1PIO A;  3HLF A;  1VET A;  1XA7 A;  3BLM A;  1Y28 A;  4F3L A;  1IEL A;  4B88 A;  2H5S A;  4R70 A;  4RX2 A;  4LGW A;  2HPB A;  3T4O A;  4KG5 A;  3CIT A;  4ZAM A;  2OSU A;  2WKE A;  3BM6 A;  4ESP A;  3IS2 A;  2J7V A;  4QD4 A;  2HJE A;  5AQ7 A;  1FSY A;  5EVI C;  3SW1 A;  4NET A;  4X6T A;  4HBT A;  3LYX A;  3UY6 A;  1OT9 A;  4EQI A;  4HH3 A;  2HDU A;  5I94 A;  1L0E A;  3MQ0 A;  1W5D A;  4MNR A;  2PBY A;  4RQ9 A;  4BL2 A;  3VSK A;  1ACF A;  4Q8I A;  5IHV A;  4XT2 A;  1K0K A;  2A2L A;  4GZB A;  4GB7 A;  4KUO A;  5EUA A;  1K54 C;  1M6K A;  4C6Y A;  2BTF P;  2WAE A;  3MSH A;  1XJ4 A;  3ISG A;  2VEA A;  2OV5 A;  1BUE A;  1CQA A;  2XGN A;  3BRM A;  4G3W A;  2V8C A;  3CUE C;  4X56 A;  3H7W B;  3K2N A;  3T4Q A;  1NJ4 A;  1D06 A;  5EOO A;  5EVL A;  4WZ4 A;  5CX7 A;  5HDD A;  5CXW A;  5EFW A;  4BL3 A;  4DE2 A;  1CI9 A;  4LV0 A;  4WUJ A;  1P97 A;  3LR3 A;  3QHY A;  3HLG A;  1CJF A;  4P6Z M;  2INW A;  3BFE A;  3G31 A;  3ICY A;  4OOL A;  2EWW A;  3S4X A;  3FKW A;  2Z6C A;  3EGX C;  5AVE A;  3IH9 A;  4RX3 A;  2Y2Q A;  3BJN A;  2HF6 A;  2K7S A;  3MZF A;  1FCN A;  2XEP A;  1IYO A;  3GSG A;  2KLI A;  2QYB A;  3UE6 A;  4BBU A;  1IYS A;  5U47 A;  5L2F A;  4QY6 A;  1T1A A;  3M6H A;  3MS6 A;  4KQR A;  1NZU A;  1DJC A;  2VV7 A;  4GDB A;  3T4T A;  2P04 A;  1H3Q A;  4WLA A;  3HJI A;  3WRT A;  2WGV A;  4X25 A;  3W4Q A;  4S2P A;  3T12 B;  4DJ2 A;  5G4Z A;  1SCW A;  2QJ7 A;  3QNB A;  2VGL S;  2P9V A;  3NUL A;  1M40 A;  5J4E A;  4LRX C;  3BY8 A;  4Y15 A;  3K3C A;  4PM7 A;  3BWL A;  3V3S A;  2KDK A;  3S7N A;  2WGW B;  4PKY G;  3Q7V A;  5DFY A;  2I9V A;  2D02 A;  2HDS A;  5EE8 A;  2PU2 A;  2J8Y A;  4JXG A;  5DF7 A;  4E3M A;  1TDL A;  3PBQ A;  3IXG A;  4HI4 A;  2B02 A;  1F2K A;  5HFO A;  4EXO A;  2R9W A;  2W3F A;  3C8C A;  3ZNY A;  4WM9 A;  1OTB A;  1YLT A;  1YLZ A;  2Y2P A;  2ZJ9 A;  2Z2M B;  3H82 B;  3BFC A;  5DTT A;  3MZE A;  3NOP C;  3OOV A;  1MKM A;  4MN7 A;  3JVU A;  1PWG A;  1O7E A;  1YAX A;  2Y59 A;  5EOE A;  3PHY A;  4XXR A;  3LO7 A;  5EEC A;  4GNU A;  1GHP A;  3OCN A;  5MC7 A;  5M19 A;  2WAD A;  1HTZ A;  3VV4 A;  3U4L P;  3UB7 A;  4II7 A;  5KZH A;  2EA9 A;  3MXS A;  4QU3 A;  3UO9 A;  3V39 A;  4MCW A;  3S7P A;  4GHI B;  4LLO B;  4LFU A;  2A24 A;  1E3U D;  1Q2Q A;  2ZM2 A;  1VET B;  1L0G A;  1FCM A;  1MXO A;  3BY9 A;  3BQA A;  3D9Y A;  4KZ5 A;  5KSH A;  3RTY A;  2A49 A;  3AGE A;  5KMW A;  1YLP A;  3A3J A;  3T1S A;  1ES2 A;  4R0Q A;  3QP8 A;  4NXF A;  1NYY A;  3A0S A;  1UGU A;  1PWD A;  1SKO B;  3RH8 B;  1C3B A;  4HOI A;  3UE3 A;  1YSP A;  3T50 A;  3IS2 B;  2O99 A;  2L4R A;  2Y2L A;  2Y2O A;  2V2F F;  2J3W A;  1S4S A;  4WBG A;  4QY5 A;  4BWI A;  1UWP X;  4BD1 A;  5DVA A;  2R78 A;  2JCH A;  3P7N A;  3VOZ A;  3LY4 A;  1D1J A;  4OLG A;  5DTS A;  3IXD A;  3PBN A;  3Q7Z A;  4EES A;  2EX8 A;  2HGV A;  4U0X A;  3LEQ A;  1ESU A;  3MQQ A;  4PM5 A;  3ZG9 B;  4UQI M;  1K6R A;  4KZ7 A;  5GLC A;  2PD7 A;  5HPI A;  5CGX A;  4PM8 A;  4R4S A;  2QZ6 A;  4P6B A;  1JVJ A;  4PMA A;  1JWP A;  2WKH A;  3VFH A;  5GLA A;  4P87 A;  3MR0 A;  3WWX A;  5FQI A;  4WF0 A;  1VB6 A;  2JE5 A;  3N8R A;  3MXQ A;  3DW0 A;  2HDQ A;  3MKF A;  2WKP A;  4P0M A;  2VGK A;  3H7W A;  5F6A A;  1Z09 A;  4R3J A;  5FI6 A;  4C3Q A;  1KE3 A;  4EBP A;  5CTM A;  4S2K A;  4I3A A;  3KSI A;  1JTG A;  5TJJ A;  2W1T B;  4QPR A;  4ETZ A;  1OTI A;  3JVV A;  2Q9N A;  1GSX A;  3NJA A;  5DF9 A;  5CHU A;  3HBR A;  5DKL A;  2EXA A;  3W8K A;  4GD8 A;  1ZTU A;  4MBF A;  4PPR A;  1G68 A;  3VFF A;  3QP1 A;  3CWF A;  2Y2K A;  2HP9 A;  3PBT A;  3TW8 A;  1H0M A;  4OLD A;  3F1P B;  2WZZ A;  3B3X A;  1Q2P A;  2P9V B;  4HNB A;  3WS5 A;  3M6B A;  3V67 A;  2J9P A;  4UA7 A;  2ZBB A;  3LI8 A;  1G28 A;  5AVF A;  5HSQ A;  1NZO A;  3SS5 A;  3UE1 A;  3IF5 A;  4UA9 A;  3QP6 A;  3EGD C;  3VP3 A;  3BYD A;  3VE3 A;  3C30 A;  2OLU A;  3SH8 A;  1T1B A;  1D7E A;  4BJP A;  1ES3 A;  3UB5 P;  1TS6 A;  1NLZ A;  3HUO A;  4PKY A;  4M3K A;  1BLP A;  2I72 A;  3TSG A;  2JKR I;  5FA7 A;  2AVX A;  2Y4A A;  4MBK A;  2VZW A;  5GHX A;  5AJG A;  4WZ5 A;  4YIN A;  4Z9Q A;  2M7V A;  5FQM A;  2DCF A;  1AXB A;  5GLB A;  1K4F A;  3C7U A;  4ETX A;  4RYE A;  1RGY A;  5CGS A;  1G6O A;  4JF6 A;  3VP0 A;  2M1C A;  1K57 C;  2P74 A;  2X71 A;  1SZV A;  1PRQ A;  2LB9 A;  4MN5 A;  1KGF A;  5HW3 A;  3HL9 A;  4OPZ A;  1E4D A;  1PZP A;  4XUX A;  3A0R A;  4HP4 A;  3ZVT A;  3GTC A;  2QWS A;  4Z1W A;  4NXG A;  3IX4 A;  1W79 A;  3OPP A;  1JTD A;  5A91 A;  3UME A;  3R4K A;  3Q07 A;  1EWZ A;  3S7Q A;  3MXR A;  3FPW A;  1IYQ A;  1YMS A;  5L10 A;  4KG6 A;  2Z6D A;  3GV9 A;  5FEF A;  4OQI A;  3W2Z A;  2VGL M;  1ODV A;  1S67 L;  5CRF A;  4WZ5 C;  2E8J A;  4GHI A;  2GZA A;  1H8Z A;  3MBZ A;  3S1Y A;  1MY8 A;  4LCM A;  1N9L A;  3GEC A;  3UB6 A;  1YM1 A;  5HDS A;  3NOU C;  2W1R A;  4U3T A; 
#chains in the Genus database with same CATH homology
 3UB5 P;  3T1X A;  2ZL1 B;  1CF0 A;  3LGO A;  5EM0 A;  1SKO A;  1ACF A;  4X25 A;  3L9K A;  3T12 B;  1K0K A;  1VET B;  2JKG A;  4X1L A;  3NUL A;  3D9Y A;  2HZ5 A;  5FEG A;  3KYE A;  1PFL A;  3T1S A;  1J3W A;  1Z09 A;  3L7H A;  2BTF P;  1SKO B;  3T1Q B;  2B95 A;  3MSH A;  1A0K A;  1CQA A;  1SZV A;  1PRQ A;  5EVE A;  1FIK A;  1VEU A;  5EV0 A;  2PBD P;  2V8C A;  2JKF A;  2VK3 A;  2V8F A;  1AWI A;  1F2K A;  2ZL1 A;  1D1J A;  4X1M A;  3CPT A;  3DAV A;  1VEU B;  1CJF A;  2PRF A;  1VET A;  3T1R A;  3LEQ A;  1Y4O A;  1YPR A;  3NEC A;  5FEF A;  1G5U A;  2PAV P;  3CHW P;  4D60 A;  3CPT B;  2E8J A;  4QWO A;  5FDS A;  1FIL A;  2ACG A;  4FUW A;  4ESP A;  1HLU P;  3MS6 A;  1PNE A;  4FTX A;  3U4L P;  5EM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...