1D1JA

Crystal structure of human profilin ii
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
138
structure length
138
Chain Sequence
AGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVHGGTLNKKAYELALYLRRSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords PROFILIN II
publication title X-ray structure determination of human profilin II: A comparative structural analysis of human profilins.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1d1jA00
1CF0A 1D1JA 3T1SA 1Z09A 3D9YA 4X1LA 1VETB 5EM1A 4FTXA 4D60A 3CPTB 2JKFA 4ESPA 3MSHA 5FEFA 5EVEA 3T12B 1SKOB 1YPRA 2PAVP 1FILA 2ZL1B 5EV0A 1FIKA 3NULA 1VEUA 1F2KA 1PNEA 1Y4OA 3T1QB 1K0KA 2V8CA 2B95A 1CQAA 1ACFA 1AWIA 3T1RA 5FEGA 3MS6A 2HZ5A 3LEQA 3DAVA 5EM0A 4X1MA 1SZVA 1HLUP 1VETA 3KYEA 2V8FA 1VEUB 3L9KA 2E8JA 1PRQA 2JKGA 5FDSA 1J3WA 3U4LP 2VK3A 3L7HA 2PRFA 1CJFA 1SKOA 3LGOA 1G5UA 4QWOA 2ZL1A 2PBDP 3NECA 3CHWP 2ACGA 4X25A 4FUWA 1A0KA 3CPTA 1PFLA 3UB5P 3T1XA 2BTFP
chains in the Genus database with same CATH superfamily
2XFSA 4B93A 3LY3A 1W5DA 4CJNA 2MJ6A 4D60A 3WS0A 4IEDA 4GHIB 1DP6A 1Q2QA 2PYPA 2X02A 1KOUA 4XUXA 3T4JA 1YLPA 4JGPA 3HLWA 3IWOA 3GRJA 4S2OA 2LB9A 1OTBA 5EOEA 1K6RA 2NUTC 5HZHA 5KIZA 2W3FA 5LBRA 1I2WA 2HDQA 4CLCA 4F3LB 3FWLA 1FR6A 4IUHA 4MBHA 4UA6A 3EWKA 4ZDXA 1FQGA 3T4LA 1Y4OA 3MMHA 5TJJA 1V9YA 1H3QA 3GV9A 2EX6A 3CZDA 1YT4A 4IHQA 4GZBA 2PU2A 4NXFA 3C4OA 1HLUP 1LL9A 3NCKA 3LIEA 1BLCA 1TS0A 3LYXA 2M7VA 5JYOA 2E8IA 4E6XA 1W8YA 2I72A 3UB6A 2WGWA 2JC7A 2ZL1A 4BD0A 1P0ZA 2JKTI 2V2FF 4FUWA 3G32A 4H6JA 5HWTA 1ZG6A 3A0VA 4X1LA 3F1PA 1WYCA 4GS9B 2WZZA 3W4QA 5DVAA 3IS2B 1OMEA 1W7FA 1MWTA 3Q81A 4HNBA 4IVIA 1MWUA 3GECA 4U0TA 5HAIA 1JWPA 5IHVA 4HOIA 1FSWA 3P01A 3OC2A 4IBRA 1KE0A 1S67L 3LCEA 3FG8A 2PU4A 4FOFA 4NG2A 1LLBA 1PNEA 2QYBA 5CHMA 5FQKA 3T1QB 4WZ5A 3IX8A 5AQBA 3V67A 4WELA 3BQ8A 2GJ3A 3MS6A 4Y3IA 4X68A 1NXYA 4DDSA 3TJZC 4GDNA 2Q9NA 1P97A 4OLGA 3UB8A 1TDGA 4N9KA 1K25A 3SW1A 5KSHA 4RVAA 1NLYA 2WKEA 5AQAA 1VHMA 1W63Q 3JPUA 2Z2MB 5DFYA 2E8JA 3QP5A 3EGXC 3DTMA 1U60A 3EQVA 4EETB 4JBFA 4E6WA 4X69A 1S4SA 1KGFA 1BLHA 4YFMA 4NXEA 5FQMA 2LB5A 1LL8A 4JGQA 2KX6A 2K7SA 2FFFB 4G3WA 1T1AA 2G7UA 4KZBA 3T1SA 1Z09A 1OT6A 5GLDA 1H8MA 4QB8A 4MCWA 2L0WA 2V1BA 1K55C 3Q82A 3ZNYA 1FCOA 1ZHHB 3TSGA 4ZRRA 2ZQDA 5DJTA 5TGFA 3ZG9B 4XT2B 3BFGA 1SCWA 3VSLA 2GX5A 5DKKA 4UA9A 1XGIA 4UA7A 1JVJA 4HJ6A 2QHKA 2IA2A 5HL6A 4BQMA 4HIAA 1WA9A 1OTAA 3BM6A 1UWNX 4WN5A 4S2NA 1ONGA 3UMEA 2V9AA 1GCEA 4R3BA 1KDSA 1MY8A 5J3WA 5U47A 5EFWA 5E2GA 3W4OA 4WMCD 3IH8A 3KSIA 4KZAA 1SZVA 4R3AA 3TW8A 2Y2IA 3T50A 3UDIA 2UV0E 3F1NB 4EERA 1VEUB 3HVFA 4HP9A 2C6WB 3QP2A 4R70A 3IF6C 3UY6A 3CMZA 2V0UA 2VEAA 1J3WA 1QMFA 2VK3A 2QJ5A 5GL9A 1PYYA 1FOFA 1FR1A 5HWVA 4UAAA 3LIBA 1OJ5A 2P9VB 4HBUA 1PIOA 1HD8A 3A0SA 1BT5A 3NHQA 4HHDA 4R1GA 4KUOA 5FAPA 3FKWA 4E3NA 1K54C 3WRZA 2ZC7A 2OAQ1 5I5LA 3OPHA 3UE1A 2OV5A 3UE0A 5L09A 4KQDA 1BLPA 1GA9A 4NXBA 3DTIA 5HDSA 1CI8A 2CC1A 3IBRA 3M2JA 2P7JA 4LRYC 1F2KA 4WUJA 5AJGA 4EV4A 3B47A 2JKTM 3P09A 1P9RA 2HDSA 2Y4AA 3OOVA 2ZQ9A 1O7EA 4PAUA 2V8CA 2V0WA 4KZ5A 1QMEA 4XUZA 3CLOA 2VV8A 3HJKA 1AWIA 3ICYA 1EROA 3S4XA 3IQAA 2A3UA 1PZOA 2YKFA 5EVID 3SH9A 4MBFA 3IF5A 3LUQA 4RA7A 2AVXA 4Y2FA 2EWWA 1K56A 2C5WB 2Z2LB 4P6ZM 4GNUA 5GHZA 3VOYA 3G4PA 1RP5A 1XKZA 3L9KA 3I7JA 1DJBA 2JKGA 1NY0A 4ETZA 3MF0A 2XA7M 3BLSA 4GKUA 5HDDA 3ULFA 5G4ZA 2JE5A 1VQQA 3FKVA 5DF9A 3U4LP 2W27A 2A24B 1PWCA 1XJ4A 4KZ8A 1MKMA 4JKTA 3RXXA 2K31A 4IBXA 3UPNA 1MWSA 2XSSA 3IWIA 3H9WA 4LFUA 2PR6A 5GHYA 2EXAA 1T19A 1WYBA 1XA1A 4LCMA 1NWZA 1CF0A 1D1JA 4Y5FA 5AQ7A 1VETB 2H10A 5EM1A 4BWIA 4HH3A 3NDGA 4JXVA 2X01A 2PDRA 4BD1A 5J8XA 3AGFA 1X0OA 3LR5A 1SKOB 1ES2A 2W3HA 3V3SA 5CEBA 1V9ZA 3WS4A 1W79A 4OLDA 4DJ2A 1L0FA 3O5YA 4OH0A 4AFIA 2M7UA 4E3MA 3DBAA 2GDNA 2VJWA 3C7UA 1OJGA 4Y0TA 1K4FA 4E3OA 3D72A 1ACFA 2HDRA 3Q7ZA 3WS5A 3UPOA 1CEGA 4GJ4A 1NZOA 3ZVWA 2Y2OA 2INWA 4JXSA 4PM9A 4QPRA 5L8MA 1GSXA 4DKIA 5A91A 2Z6CA 3E4OA 1NJ4A 5M19A 3PBNA 5G18A 3IXBA 4CLCB 2WAEA 3P7NA 3FC7A 2CMNA 3LO7A 1LHYA 5DFXA 1D06A 1CJFA 3ZHHA 1N9NA 1PI5A 1NRFA 1K57C 4XXRA 2DMWA 2IWDA 4N9LA 3UB5P 1PFLA 2JHEA 3A3JA 5DTSA 4GN2A 4LCLA 5MC7A 4K91A 1NYYA 3CPTB 1EWZA 4MDZA 3H7WB 4QU3A 4WLAA 1MXOA 4KQQA 2PD8A 3LR4A 2R9XA 2WGWB 3IX4A 4DE3A 3A3DA 3MJQA 3VP0A 1BZAA 4JF4A 3C2WA 5IS1A 2ZL1B 3GSGA 2IWBA 3UE3A 2QJ7A 4Q8IA 2Y2HA 4UEYA 3HLBA 3IHAA 5G4YA 3S22A 3UB7A 4H6JB 4OQHA 5F6AA 1ZG4A 3ZCZA 1YSPA 3F1PB 5AQ9A 4GD6A 5F69A 1BLSA 1IYPA 4OOMA 4A5RA 3IXGA 5FQIA 2D01A 2XQZA 1K4EA 2J9OA 1E3UD 4IJGA 2B02A 5A93A 1JTDA 4KZ7A 1HTZA 1XGJA 3MQQA 2Y8HA 2A2LA 2O9BA 2JN7A 3RFBA 1L0GA 1EW0A 3PBRA 3WRTA 5FAOA 3MKEA 4EWFA 4GOGA 1SDNA 1H8YA 2ZOIA 4EW7A 3ZG7B 3IF6B 4YNRA 5IT5A 1PRQA 5EVIA 3C8CA 1S1ZA 2VA0A 4Q0IA 4BL3A 3WS1A 1OT9A 5L2FA 4Q0HA 3L7HA 1STZA 4QY6A 3ZYTA 5CGSA 4EXOA 1ERQA 1T1CA 2J80A 1NRJA 5KSCA 4B9OA 4UHUA 2ZC6B 4FH4A 1K55A 3CPTA 3NJAA 2Y91A 3Q07A 3O88A 2ZQ8A 1ZC2A 3D9YA 1PW1A 2Y2JA 3H7WA 4PM5A 5CHJA 4FTXA 2HV1A 3PBOA 2FH5A 2BASA 5IU1A 3DW0A 3AGDA 5HW3A 1E4DA 3PTEA 5FATA 4WZ4A 3R4KA 1GHMA 3MBZA 5HX9A 4QJGA 4E3JA 1TEMA 1YLJA 3VP3A 3DTKA 4BENA 3NULA 2Y2QA 1S4RA 4B4ZA 3UO9A 3MZEA 4CPKA 1BYWA 1T18A 2RL3A 2ZD8A 2VV7A 2VGKA 4CLCE 4E3IA 3FV7A 1L2SA 3VFFA 4OP5A 1RGZA 2Y55A 4YINA 3DAVA 3MQOA 1S0WA 3IF6A 4E04A 3VE3A 2A49A 1D7EA 5HAQA 1IYQA 2J8YA 2Y2KA 1S6RA 3G2ZA 2WKHA 4RQ9A 3MXQA 3GTCA 3H82A 2XLNA 1JWVA 4WEKA 5DF7A 1IELA 4OQ0A 4G3KA 3MFXA 1K54A 1DP8A 2PBDP 3N6IA 1IKIA 3LIFA 4EESA 2KLIA 4HY8A 3CWFA 2VGJA 4L9EA 4KZ9A 5A8BA 2W1RA 1SKFA 3IX3A 1Y54A 1ERMA 5EVLA 4PKYG 1BUEA 1S1YA 1JTGA 1MKIA 2Y2GA 1S66L 1PW8A 2VGLS 2R78A 2IWCA 5EVIC 4OQGA 3ITAA 5F82A 4JF5A 4E3KA 3HJIA 2FZ0A 4OVDA 3F1OA 2PHYA 3A3IA 3FYZA 4MNRA 4Z9QA 1MC0A 2V20A 4R6LA 5BOHA 5CERA 1SDEA 3QP4A 3T4QA 2P74A 2Y59A 4RYEA 3G31A 3E0YA 2H5SA 4Y15A 2W0NA 4KENB 4OOYA 4OQIA 2W1TA 2EX8A 5HL1A 4I3IA 3MXRA 1VB6A 4DXCA 1ES5A 4GB7A 2W3GA 3E4QA 3MR0A 1E3UA 4R23A 4KZ4A 3GQZA 2ZJ9A 1YQSA 2ZLYA 4QY5A 3MXSA 3M2KA 5F5YA 2XR0A 2BG1A 4S2LA 3OCLA 2W3EA 4GW9A 3JVVA 1O07A 3NOUC 2WADA 4P6BA 4GD8A 3V3RA 2EX2A 3PBTA 2JBFA 3LIAA 2JCHA 4P85A 4MN5A 1XJ3A 1IYSA 4NETA 2QPNA 2FFYA 3E2LA 1XFNA 4OPZA 3TOIA 1LI0A 3BFEA 2HJEA 4MLLA 2JKFA 4DJ3A 1VM1A 3EEAA 5HWWA 2XK1A 4PM7A 4M3KA 2WUQA 4KQOA 1KGGA 3TRCA 3E2KA 3CI6A 5CXWA 3CG5A 4EBNA 4EUVA 1I2SA 3ZNTA 1C3BA 2ZM2A 1ZKJA 3IHBA 4YOFA 3WS2A 4NXGA 4KG6A 1K0KA 1FSYA 1YLTA 5M18A 1UGUA 1J9MA 1XX2A 2B95A 4S2IA 4HI4A 3ZVTA 2WAFA 2ZMAA 3T1RA 3C38A 5FEGA 4ARZA 5DTTA 3B42A 1F5MA 2VZWA 4KG2A 4ZJ3A 4PMAA 3MFDA 4OPQA 1ESIA 1LSXA 1Z6FA 5C5KA 4DDYA 1K57A 1TS7A 3M6HA 4EEUA 3WWXA 3QP1A 3OCNA 3QNBA 4BBTA 1CEFA 4CLCD 3IXDA 3QHYA 4WBGA 3HREA 2HJ9C 5EOOA 3IBJA 4S2PA 4EUZA 2OSUA 4IUKA 1MZUA 3BFFA 3KYZA 1YMXA 4NKPA 5HDCA 2BTFP 4GLQA 4UQIS 1PWDA 2OOLA 1Q2PA 2XD1A 2QKPA 5CGXA 4E3LA 1K38A 3SZTA 2ZC5B 3RJUA 1EI5A 1ONHA 3UDXA 2VKSA 2OWHA 5EVEA 5AVEA 4Q0JA 2Y79A 1YMSA 1YKDA 3T12B 3CITA 1TD5A 4LV3A 4ZJ2A 3W4PA 3OBFA 5HFOA 4EEPA 3OLOA 2Q0OA 4FCFA 4JXWA 5EV0A 1LSWA 1MBLA 1DJAA 4WM9A 5E2EA 5FL3A 1YLZA 3N7WA 3OPRA 5GLAA 1XXMA 2HGVA 5HARA 2HP9A 4MMNA 5DKLA 4PKYA 4U0XA 3UMDA 5FAQA 4HQAA 5CRFA 3VV4A 2GNXA 1HZOA 5EECA 4EU0A 3D4FA 5EM0A 1MPLA 5HPFA 2ZBBA 1G6AA 1G6OA 4P6ZS 3UPPA 2DCFA 2K2NA 2W3DA 3N8SA 3QP6A 4D2OA 4R4SA 4I38A 2XA7S 2D02A 1FCNA 3EOIA 3HUMA 3G35A 3M6BA 1G5UA 1IYOA 5CECA 5EPHA 4U3TA 3N8RA 4DRTA 5FASA 3FPVA 4GDBA 4G3VA 5F1FA 2ZM8A 3K2NA 1W63M 1E25A 3BY8A 4WMCA 3RXWA 3HLGA 1JWZA 3N4IA 3HLDA 5EVIB 1K6SA 3LI9A 5E2FA 5F1GA 3ZDJA 2P08A 2J3TD 5AVFA 1H8ZA 2HP5A 2EFUA 1IKGA 5A90A 4EBPA 2XEPA 2PR5A 1G68A 3QNCA 1ES3A 3VOLA 5GLBA 2WKRA 5GLCA 5J4EA 3CJMA 3NI9A 3LY4A 3RTYA 2DRWA 4EQ1A 1YM1A 3S7NA 2Y2PA 1OPXA 4KQRA 3R7WA 2HZ5A 3MQ0A 4HP4A 3PAEA 4DE2A 4BMWA 5E43A 3QP8A 3GVBA 5FA7A 3IXHA 4ZBEA 4N92A 3RH8B 2ZQAA 4O8GA 4I5SA 4L0LA 1RGYA 1CK3A 1M40A 1ODVA 4LRZE 2XRNA 3NECA 4JXGA 2OAP1 4C6YA 4PM6A 1N9OA 3BYDA 2HF6A 4BJPA 3KSGA 3UNWA 3SH8A 5EUAA 4MN6A 3LR0A 3O87A 5E2HA 2GZAA 1GSVA 4O01A 4QD4A 3U2AA 1IOUA 2HDUA 4X6TA 4BL2A 3MSHA 4X53A 3UB9A 4C75A 2PBYA 4JGRA 5CHUA 3H82B 2PD7A 3UN7A 4P87A 3ISGA 4B88A 5JYPA 2XDMA 1L0EA 3Q7VA 4HEFA 4QHCA 1NZUA 3BEBA 1LT0A 1P9WA 4BBVA 1TS6A 2OWJA 4DMZA 5L07A 1SHVA 2JKRI 5KMWA 2BLSA 1XFQA 4WEJA 5FQ9A 4B4XA 1XJ2A 2OLVA 2XFTA 4Y13A 1L3LA 3FPWA 4JPMA 3CUEC 3GR2A 1TVFA 5TBMA 3LR3A 5HD5A 3K3CA 2ZOHA 4JLFA 4NK3A 4I39A 2DNSA 2KOIA 1LI9A 3HLFA 1KVMA 3KYEA 4ME4A 3F1OB 3BJNA 3O3VA 3KYQA 4GHIA 3SS4A 1OTDA 4II7A 3EGDC 3PBQA 4OPYA 2WZXA 3BRMA 2WYXA 5FQJA 4DN0A 3VP4A 1IEMA 3MKFA 3ZG8B 2PRFA 2W1TB 3CAXA 2VGLM 4YWZA 5L10A 1XJ6A 4F3LA 3UDFA 4OKPA 1RCJA 1Y28A 1DP9A 2VV6A 3VP2A 1I5QA 3E98A 3PBSA 3KO6A 4M4XA 1YLYA 1ALQA 3BFCA 4DF6A 2RCXA 3HBRA 4WF0A 2EX9A 1K56D 2XF3A 3DTEA 3BECA 1CI9A 1N4OA 3D3OA 3V39A 2Y2MA 2WK0A 2QZ6A 2WKPA 4F94A 1XP4A 2H28A 3VFHA 3GDIA 3IH9A 4S2JA 1KE3A 3KSFA 3B33A 1H5XA 5F68A 2WGIA 4CLCC 3GMWA 3BW6A 2V1AA 4I3JA 4PPRA 4L9FA 2Q9MA 1AXBA 3LI8A 4Y7PA 1PZPA 3KSHA 4MEZA 3BWLA 3C4PA 4RX3A 4OONA 3PHYA 3T4TA 4GS9A 3OZHA 5HD3A 3VP1A 4KZ3A 4CQHA 1BTLA 3IS2A 3UE6A 3W2ZA 3HUNA 3IWQA 4BLMA 1LL5A 4ETXA 3LGOA 4ZAMA 2XGNA 2YKHA 5CEDA 3C5AA 1KDWA 4ARZB 3NC8A 3KX0X 4X25A 3BY9A 2XROA 3IT9A 4EBLA 3T1XA 3BQAA 3V5MA 2HP6A 4L9GA 3EEHA 2ZC3B 1UWPX 5DTKA 2J9PA 5J7EA 2ZMFA 5M1AA 3T4KA 4BBUA 2B5RA 1KE4A 1LSVA 2QMIA 1FILA 3EQUA 5FI6A 1YLWA 2PT7A 3ITBA 3NY4A 2H0YA 5HAPA 4LLOB 1TF1A 4RX2A 3SH7A 5EE8A 1KGEA 1NYMA 4LGWA 4Y0UA 4X56A 5DF8A 5HSQA 4I3AA 3E4PA 2O9AA 2O0YA 3T4OA 4KZ6A 2VLGA 3PAGA 5FI2A 3G2YA 2KDKA 1BULA 2PYRA 3LEQA 4Z1WA 4S2MA 2EWVA 3W8KA 2EFXA 4WZ5C 3T4SA 3JVUA 2J3WA 2O99A 1W8QA 3HLCA 1PI4A 3FZCA 5CTMA 4UQIM 4OP8A 4XT2A 1JNUA 1IFQA 4PM8A 4R4RA 2J3TC 3A3FA 4ID4A 2JKRM 2WKIA 2ZM0A 1XPBA 5CTNA 3S7QA 2ZQCA 3P98A 1F9IA 3S7OA 3ZG5A 3VSKA 2EXBA 1XA7A 1OTEA 3N8LA 1ESUA 1WE4A 4IVKA 4K08A 5A92A 5TFQA 3HL9A 3JYIA 4OPRA 3NDEA 3G6OA 5F83A 4FSFA 3OPPA 3LIDA 3LFVA 4DXBA 5FEFA 1TS8A 3LICA 1G28A 1T1BA 4O0PA 5KZHA 3K3DA 1FCMA 4HBTA 4MBKA 1YPRA 2ZMVA 1HVBA 3SS3A 3F1NA 1VEUA 4O7DA 4LPZA 1L0DA 2XH9A 3PXPA 1DJCA 3VMAA 3G30A 2R9WA 1GHPA 4FD8A 3DWZA 2B18A 2HPBA 3MZDA 4HJ4A 2NUPC 4R38A 2P9VA 3NIAA 2EA9A 3HUOA 4LV1A 4N1HA 5FQQA 2QWSA 4FH2A 2G2WA 4S2NC 3PYPA 4H8RA 2X71A 4X1MA 3SS5A 4C3QA 3ZQ5A 4P0MA 4DE0A 1MWRA 1N9BA 3BFDA 2ZQ7A 4PHTA 3B3XA 4LENA 5CX7A 5FDSA 3O86A 4Y17A 2O9CA 3G34A 1M6KA 5HPIA 2XD5A 4Y0OA 2L4RA 2Y2NA 3NOPC 1GHIA 3AGEA 4K0XA 4X55A 4ZJ1A 3ZG0A 3R7WB 3C7VA 4HH2A 2UWXA 4S2KA 5FSRA 4LV2A 1YAXA 2G2UA 4MN7A 5CGWA 4WYYA 3S1YA 4WL9A 1H0MA 4KG5A 1TDLA 4LV0A 3VOZA 2OLUA 4ESPA 4K0WA 4HJ3A 3C30A 5TR7A 3NOTC 3VE4A 5I94A 2PAVP 3SOIA 2WKQA 4JF6A 1GSWA 1ZTUA 1FIKA 1PWGA 2M1CA 2ZC4B 4JGOA 1DY6A 5FI7A 5DJUA 1KVLA 4DE1A 3CUEA 3OPLA 3HLEA 3BLMA 4R0QA 3ZGAB 2A24A 3S7PA 2H0TA 3ZFZA 3Q1FA 1CQAA 3A3EA 3A0RA 1OTIA 3DWKA 4KUKA 4EQIA 2J7VA 1N9LA 3HCYA 4GCZA 5FDHA 2V1ZA 5GHXA 1BSGA 3Q7VB 1VETA 2V8FA 1ES4A 5K5BA 4OOLA 4R3JA 2Y2LA 3LEZA 3MZFA 2L1MA 4ZTKA 4NEED 1GA0A 2WGVA 1YSQA 4N1XA 1SKOA 1F98A 2I9VA 2VX8A 3V50A 3PR6A 4QWOA 3NBLA 2Z6DA 1NLZA 5D3OA 3TG9A 1DRMA 4HESA 3CHWP 3TE8A 2ACGA 5TBMB 1A0KA 4LRXC 2P04A
chains in the Genus database with same CATH topology
1CF0A 1D1JA 3T1SA 1Z09A 3D9YA 4X1LA 1VETB 5EM1A 4FTXA 4D60A 3CPTB 2JKFA 4ESPA 3MSHA 5FEFA 5EVEA 3T12B 1SKOB 1YPRA 2PAVP 1FILA 2ZL1B 5EV0A 1FIKA 3NULA 1VEUA 1F2KA 1PNEA 1Y4OA 3T1QB 1K0KA 2V8CA 2B95A 1CQAA 1ACFA 1AWIA 3T1RA 5FEGA 3MS6A 2HZ5A 3LEQA 3DAVA 5EM0A 4X1MA 1SZVA 1HLUP 1VETA 3KYEA 2V8FA 1VEUB 3L9KA 2E8JA 1PRQA 2JKGA 5FDSA 1J3WA 3U4LP 2VK3A 3L7HA 2PRFA 1CJFA 1SKOA 3LGOA 1G5UA 4QWOA 2ZL1A 2PBDP 3NECA 3CHWP 2ACGA 4X25A 4FUWA 1A0KA 3CPTA 1PFLA 3UB5P 3T1XA 2BTFP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CF0 A;  1D1J A;  3T1S A;  1Z09 A;  3D9Y A;  4X1L A;  1VET B;  5EM1 A;  4FTX A;  4D60 A;  3CPT B;  2JKF A;  4ESP A;  3MSH A;  5FEF A;  5EVE A;  3T12 B;  1SKO B;  1YPR A;  2PAV P;  1FIL A;  2ZL1 B;  5EV0 A;  1FIK A;  3NUL A;  1VEU A;  1F2K A;  1PNE A;  1Y4O A;  3T1Q B;  1K0K A;  2V8C A;  2B95 A;  1CQA A;  1ACF A;  1AWI A;  3T1R A;  5FEG A;  3MS6 A;  2HZ5 A;  3LEQ A;  3DAV A;  5EM0 A;  4X1M A;  1SZV A;  1HLU P;  1VET A;  3KYE A;  2V8F A;  1VEU B;  3L9K A;  2E8J A;  1PRQ A;  2JKG A;  5FDS A;  1J3W A;  3U4L P;  2VK3 A;  3L7H A;  2PRF A;  1CJF A;  1SKO A;  3LGO A;  1G5U A;  4QWO A;  2ZL1 A;  2PBD P;  3NEC A;  3CHW P;  2ACG A;  4X25 A;  4FUW A;  1A0K A;  3CPT A;  1PFL A;  3UB5 P;  3T1X A;  2BTF P; 
#chains in the Genus database with same CATH topology
 2XFS A;  4B93 A;  3LY3 A;  1W5D A;  4CJN A;  2MJ6 A;  4D60 A;  3WS0 A;  4IED A;  4GHI B;  1DP6 A;  1Q2Q A;  2PYP A;  2X02 A;  1KOU A;  4XUX A;  3T4J A;  1YLP A;  4JGP A;  3HLW A;  3IWO A;  3GRJ A;  4S2O A;  2LB9 A;  1OTB A;  5EOE A;  1K6R A;  2NUT C;  5HZH A;  5KIZ A;  2W3F A;  5LBR A;  1I2W A;  2HDQ A;  4CLC A;  4F3L B;  3FWL A;  1FR6 A;  4IUH A;  4MBH A;  4UA6 A;  3EWK A;  4ZDX A;  1FQG A;  3T4L A;  1Y4O A;  3MMH A;  5TJJ A;  1V9Y A;  1H3Q A;  3GV9 A;  2EX6 A;  3CZD A;  1YT4 A;  4IHQ A;  4GZB A;  2PU2 A;  4NXF A;  3C4O A;  1HLU P;  1LL9 A;  3NCK A;  3LIE A;  1BLC A;  1TS0 A;  3LYX A;  2M7V A;  5JYO A;  2E8I A;  4E6X A;  1W8Y A;  2I72 A;  3UB6 A;  2WGW A;  2JC7 A;  2ZL1 A;  4BD0 A;  1P0Z A;  2JKT I;  2V2F F;  4FUW A;  3G32 A;  4H6J A;  5HWT A;  1ZG6 A;  3A0V A;  4X1L A;  3F1P A;  1WYC A;  4GS9 B;  2WZZ A;  3W4Q A;  5DVA A;  3IS2 B;  1OME A;  1W7F A;  1MWT A;  3Q81 A;  4HNB A;  4IVI A;  1MWU A;  3GEC A;  4U0T A;  5HAI A;  1JWP A;  5IHV A;  4HOI A;  1FSW A;  3P01 A;  3OC2 A;  4IBR A;  1KE0 A;  1S67 L;  3LCE A;  3FG8 A;  2PU4 A;  4FOF A;  4NG2 A;  1LLB A;  1PNE A;  2QYB A;  5CHM A;  5FQK A;  3T1Q B;  4WZ5 A;  3IX8 A;  5AQB A;  3V67 A;  4WEL A;  3BQ8 A;  2GJ3 A;  3MS6 A;  4Y3I A;  4X68 A;  1NXY A;  4DDS A;  3TJZ C;  4GDN A;  2Q9N A;  1P97 A;  4OLG A;  3UB8 A;  1TDG A;  4N9K A;  1K25 A;  3SW1 A;  5KSH A;  4RVA A;  1NLY A;  2WKE A;  5AQA A;  1VHM A;  1W63 Q;  3JPU A;  2Z2M B;  5DFY A;  2E8J A;  3QP5 A;  3EGX C;  3DTM A;  1U60 A;  3EQV A;  4EET B;  4JBF A;  4E6W A;  4X69 A;  1S4S A;  1KGF A;  1BLH A;  4YFM A;  4NXE A;  5FQM A;  2LB5 A;  1LL8 A;  4JGQ A;  2KX6 A;  2K7S A;  2FFF B;  4G3W A;  1T1A A;  2G7U A;  4KZB A;  3T1S A;  1Z09 A;  1OT6 A;  5GLD A;  1H8M A;  4QB8 A;  4MCW A;  2L0W A;  2V1B A;  1K55 C;  3Q82 A;  3ZNY A;  1FCO A;  1ZHH B;  3TSG A;  4ZRR A;  2ZQD A;  5DJT A;  5TGF A;  3ZG9 B;  4XT2 B;  3BFG A;  1SCW A;  3VSL A;  2GX5 A;  5DKK A;  4UA9 A;  1XGI A;  4UA7 A;  1JVJ A;  4HJ6 A;  2QHK A;  2IA2 A;  5HL6 A;  4BQM A;  4HIA A;  1WA9 A;  1OTA A;  3BM6 A;  1UWN X;  4WN5 A;  4S2N A;  1ONG A;  3UME A;  2V9A A;  1GCE A;  4R3B A;  1KDS A;  1MY8 A;  5J3W A;  5U47 A;  5EFW A;  5E2G A;  3W4O A;  4WMC D;  3IH8 A;  3KSI A;  4KZA A;  1SZV A;  4R3A A;  3TW8 A;  2Y2I A;  3T50 A;  3UDI A;  2UV0 E;  3F1N B;  4EER A;  1VEU B;  3HVF A;  4HP9 A;  2C6W B;  3QP2 A;  4R70 A;  3IF6 C;  3UY6 A;  3CMZ A;  2V0U A;  2VEA A;  1J3W A;  1QMF A;  2VK3 A;  2QJ5 A;  5GL9 A;  1PYY A;  1FOF A;  1FR1 A;  5HWV A;  4UAA A;  3LIB A;  1OJ5 A;  2P9V B;  4HBU A;  1PIO A;  1HD8 A;  3A0S A;  1BT5 A;  3NHQ A;  4HHD A;  4R1G A;  4KUO A;  5FAP A;  3FKW A;  4E3N A;  1K54 C;  3WRZ A;  2ZC7 A;  2OAQ 1;  5I5L A;  3OPH A;  3UE1 A;  2OV5 A;  3UE0 A;  5L09 A;  4KQD A;  1BLP A;  1GA9 A;  4NXB A;  3DTI A;  5HDS A;  1CI8 A;  2CC1 A;  3IBR A;  3M2J A;  2P7J A;  4LRY C;  1F2K A;  4WUJ A;  5AJG A;  4EV4 A;  3B47 A;  2JKT M;  3P09 A;  1P9R A;  2HDS A;  2Y4A A;  3OOV A;  2ZQ9 A;  1O7E A;  4PAU A;  2V8C A;  2V0W A;  4KZ5 A;  1QME A;  4XUZ A;  3CLO A;  2VV8 A;  3HJK A;  1AWI A;  3ICY A;  1ERO A;  3S4X A;  3IQA A;  2A3U A;  1PZO A;  2YKF A;  5EVI D;  3SH9 A;  4MBF A;  3IF5 A;  3LUQ A;  4RA7 A;  2AVX A;  4Y2F A;  2EWW A;  1K56 A;  2C5W B;  2Z2L B;  4P6Z M;  4GNU A;  5GHZ A;  3VOY A;  3G4P A;  1RP5 A;  1XKZ A;  3L9K A;  3I7J A;  1DJB A;  2JKG A;  1NY0 A;  4ETZ A;  3MF0 A;  2XA7 M;  3BLS A;  4GKU A;  5HDD A;  3ULF A;  5G4Z A;  2JE5 A;  1VQQ A;  3FKV A;  5DF9 A;  3U4L P;  2W27 A;  2A24 B;  1PWC A;  1XJ4 A;  4KZ8 A;  1MKM A;  4JKT A;  3RXX A;  2K31 A;  4IBX A;  3UPN A;  1MWS A;  2XSS A;  3IWI A;  3H9W A;  4LFU A;  2PR6 A;  5GHY A;  2EXA A;  1T19 A;  1WYB A;  1XA1 A;  4LCM A;  1NWZ A;  1CF0 A;  1D1J A;  4Y5F A;  5AQ7 A;  1VET B;  2H10 A;  5EM1 A;  4BWI A;  4HH3 A;  3NDG A;  4JXV A;  2X01 A;  2PDR A;  4BD1 A;  5J8X A;  3AGF A;  1X0O A;  3LR5 A;  1SKO B;  1ES2 A;  2W3H A;  3V3S A;  5CEB A;  1V9Z A;  3WS4 A;  1W79 A;  4OLD A;  4DJ2 A;  1L0F A;  3O5Y A;  4OH0 A;  4AFI A;  2M7U A;  4E3M A;  3DBA A;  2GDN A;  2VJW A;  3C7U A;  1OJG A;  4Y0T A;  1K4F A;  4E3O A;  3D72 A;  1ACF A;  2HDR A;  3Q7Z A;  3WS5 A;  3UPO A;  1CEG A;  4GJ4 A;  1NZO A;  3ZVW A;  2Y2O A;  2INW A;  4JXS A;  4PM9 A;  4QPR A;  5L8M A;  1GSX A;  4DKI A;  5A91 A;  2Z6C A;  3E4O A;  1NJ4 A;  5M19 A;  3PBN A;  5G18 A;  3IXB A;  4CLC B;  2WAE A;  3P7N A;  3FC7 A;  2CMN A;  3LO7 A;  1LHY A;  5DFX A;  1D06 A;  1CJF A;  3ZHH A;  1N9N A;  1PI5 A;  1NRF A;  1K57 C;  4XXR A;  2DMW A;  2IWD A;  4N9L A;  3UB5 P;  1PFL A;  2JHE A;  3A3J A;  5DTS A;  4GN2 A;  4LCL A;  5MC7 A;  4K91 A;  1NYY A;  3CPT B;  1EWZ A;  4MDZ A;  3H7W B;  4QU3 A;  4WLA A;  1MXO A;  4KQQ A;  2PD8 A;  3LR4 A;  2R9X A;  2WGW B;  3IX4 A;  4DE3 A;  3A3D A;  3MJQ A;  3VP0 A;  1BZA A;  4JF4 A;  3C2W A;  5IS1 A;  2ZL1 B;  3GSG A;  2IWB A;  3UE3 A;  2QJ7 A;  4Q8I A;  2Y2H A;  4UEY A;  3HLB A;  3IHA A;  5G4Y A;  3S22 A;  3UB7 A;  4H6J B;  4OQH A;  5F6A A;  1ZG4 A;  3ZCZ A;  1YSP A;  3F1P B;  5AQ9 A;  4GD6 A;  5F69 A;  1BLS A;  1IYP A;  4OOM A;  4A5R A;  3IXG A;  5FQI A;  2D01 A;  2XQZ A;  1K4E A;  2J9O A;  1E3U D;  4IJG A;  2B02 A;  5A93 A;  1JTD A;  4KZ7 A;  1HTZ A;  1XGJ A;  3MQQ A;  2Y8H A;  2A2L A;  2O9B A;  2JN7 A;  3RFB A;  1L0G A;  1EW0 A;  3PBR A;  3WRT A;  5FAO A;  3MKE A;  4EWF A;  4GOG A;  1SDN A;  1H8Y A;  2ZOI A;  4EW7 A;  3ZG7 B;  3IF6 B;  4YNR A;  5IT5 A;  1PRQ A;  5EVI A;  3C8C A;  1S1Z A;  2VA0 A;  4Q0I A;  4BL3 A;  3WS1 A;  1OT9 A;  5L2F A;  4Q0H A;  3L7H A;  1STZ A;  4QY6 A;  3ZYT A;  5CGS A;  4EXO A;  1ERQ A;  1T1C A;  2J80 A;  1NRJ A;  5KSC A;  4B9O A;  4UHU A;  2ZC6 B;  4FH4 A;  1K55 A;  3CPT A;  3NJA A;  2Y91 A;  3Q07 A;  3O88 A;  2ZQ8 A;  1ZC2 A;  3D9Y A;  1PW1 A;  2Y2J A;  3H7W A;  4PM5 A;  5CHJ A;  4FTX A;  2HV1 A;  3PBO A;  2FH5 A;  2BAS A;  5IU1 A;  3DW0 A;  3AGD A;  5HW3 A;  1E4D A;  3PTE A;  5FAT A;  4WZ4 A;  3R4K A;  1GHM A;  3MBZ A;  5HX9 A;  4QJG A;  4E3J A;  1TEM A;  1YLJ A;  3VP3 A;  3DTK A;  4BEN A;  3NUL A;  2Y2Q A;  1S4R A;  4B4Z A;  3UO9 A;  3MZE A;  4CPK A;  1BYW A;  1T18 A;  2RL3 A;  2ZD8 A;  2VV7 A;  2VGK A;  4CLC E;  4E3I A;  3FV7 A;  1L2S A;  3VFF A;  4OP5 A;  1RGZ A;  2Y55 A;  4YIN A;  3DAV A;  3MQO A;  1S0W A;  3IF6 A;  4E04 A;  3VE3 A;  2A49 A;  1D7E A;  5HAQ A;  1IYQ A;  2J8Y A;  2Y2K A;  1S6R A;  3G2Z A;  2WKH A;  4RQ9 A;  3MXQ A;  3GTC A;  3H82 A;  2XLN A;  1JWV A;  4WEK A;  5DF7 A;  1IEL A;  4OQ0 A;  4G3K A;  3MFX A;  1K54 A;  1DP8 A;  2PBD P;  3N6I A;  1IKI A;  3LIF A;  4EES A;  2KLI A;  4HY8 A;  3CWF A;  2VGJ A;  4L9E A;  4KZ9 A;  5A8B A;  2W1R A;  1SKF A;  3IX3 A;  1Y54 A;  1ERM A;  5EVL A;  4PKY G;  1BUE A;  1S1Y A;  1JTG A;  1MKI A;  2Y2G A;  1S66 L;  1PW8 A;  2VGL S;  2R78 A;  2IWC A;  5EVI C;  4OQG A;  3ITA A;  5F82 A;  4JF5 A;  4E3K A;  3HJI A;  2FZ0 A;  4OVD A;  3F1O A;  2PHY A;  3A3I A;  3FYZ A;  4MNR A;  4Z9Q A;  1MC0 A;  2V20 A;  4R6L A;  5BOH A;  5CER A;  1SDE A;  3QP4 A;  3T4Q A;  2P74 A;  2Y59 A;  4RYE A;  3G31 A;  3E0Y A;  2H5S A;  4Y15 A;  2W0N A;  4KEN B;  4OOY A;  4OQI A;  2W1T A;  2EX8 A;  5HL1 A;  4I3I A;  3MXR A;  1VB6 A;  4DXC A;  1ES5 A;  4GB7 A;  2W3G A;  3E4Q A;  3MR0 A;  1E3U A;  4R23 A;  4KZ4 A;  3GQZ A;  2ZJ9 A;  1YQS A;  2ZLY A;  4QY5 A;  3MXS A;  3M2K A;  5F5Y A;  2XR0 A;  2BG1 A;  4S2L A;  3OCL A;  2W3E A;  4GW9 A;  3JVV A;  1O07 A;  3NOU C;  2WAD A;  4P6B A;  4GD8 A;  3V3R A;  2EX2 A;  3PBT A;  2JBF A;  3LIA A;  2JCH A;  4P85 A;  4MN5 A;  1XJ3 A;  1IYS A;  4NET A;  2QPN A;  2FFY A;  3E2L A;  1XFN A;  4OPZ A;  3TOI A;  1LI0 A;  3BFE A;  2HJE A;  4MLL A;  2JKF A;  4DJ3 A;  1VM1 A;  3EEA A;  5HWW A;  2XK1 A;  4PM7 A;  4M3K A;  2WUQ A;  4KQO A;  1KGG A;  3TRC A;  3E2K A;  3CI6 A;  5CXW A;  3CG5 A;  4EBN A;  4EUV A;  1I2S A;  3ZNT A;  1C3B A;  2ZM2 A;  1ZKJ A;  3IHB A;  4YOF A;  3WS2 A;  4NXG A;  4KG6 A;  1K0K A;  1FSY A;  1YLT A;  5M18 A;  1UGU A;  1J9M A;  1XX2 A;  2B95 A;  4S2I A;  4HI4 A;  3ZVT A;  2WAF A;  2ZMA A;  3T1R A;  3C38 A;  5FEG A;  4ARZ A;  5DTT A;  3B42 A;  1F5M A;  2VZW A;  4KG2 A;  4ZJ3 A;  4PMA A;  3MFD A;  4OPQ A;  1ESI A;  1LSX A;  1Z6F A;  5C5K A;  4DDY A;  1K57 A;  1TS7 A;  3M6H A;  4EEU A;  3WWX A;  3QP1 A;  3OCN A;  3QNB A;  4BBT A;  1CEF A;  4CLC D;  3IXD A;  3QHY A;  4WBG A;  3HRE A;  2HJ9 C;  5EOO A;  3IBJ A;  4S2P A;  4EUZ A;  2OSU A;  4IUK A;  1MZU A;  3BFF A;  3KYZ A;  1YMX A;  4NKP A;  5HDC A;  2BTF P;  4GLQ A;  4UQI S;  1PWD A;  2OOL A;  1Q2P A;  2XD1 A;  2QKP A;  5CGX A;  4E3L A;  1K38 A;  3SZT A;  2ZC5 B;  3RJU A;  1EI5 A;  1ONH A;  3UDX A;  2VKS A;  2OWH A;  5EVE A;  5AVE A;  4Q0J A;  2Y79 A;  1YMS A;  1YKD A;  3T12 B;  3CIT A;  1TD5 A;  4LV3 A;  4ZJ2 A;  3W4P A;  3OBF A;  5HFO A;  4EEP A;  3OLO A;  2Q0O A;  4FCF A;  4JXW A;  5EV0 A;  1LSW A;  1MBL A;  1DJA A;  4WM9 A;  5E2E A;  5FL3 A;  1YLZ A;  3N7W A;  3OPR A;  5GLA A;  1XXM A;  2HGV A;  5HAR A;  2HP9 A;  4MMN A;  5DKL A;  4PKY A;  4U0X A;  3UMD A;  5FAQ A;  4HQA A;  5CRF A;  3VV4 A;  2GNX A;  1HZO A;  5EEC A;  4EU0 A;  3D4F A;  5EM0 A;  1MPL A;  5HPF A;  2ZBB A;  1G6A A;  1G6O A;  4P6Z S;  3UPP A;  2DCF A;  2K2N A;  2W3D A;  3N8S A;  3QP6 A;  4D2O A;  4R4S A;  4I38 A;  2XA7 S;  2D02 A;  1FCN A;  3EOI A;  3HUM A;  3G35 A;  3M6B A;  1G5U A;  1IYO A;  5CEC A;  5EPH A;  4U3T A;  3N8R A;  4DRT A;  5FAS A;  3FPV A;  4GDB A;  4G3V A;  5F1F A;  2ZM8 A;  3K2N A;  1W63 M;  1E25 A;  3BY8 A;  4WMC A;  3RXW A;  3HLG A;  1JWZ A;  3N4I A;  3HLD A;  5EVI B;  1K6S A;  3LI9 A;  5E2F A;  5F1G A;  3ZDJ A;  2P08 A;  2J3T D;  5AVF A;  1H8Z A;  2HP5 A;  2EFU A;  1IKG A;  5A90 A;  4EBP A;  2XEP A;  2PR5 A;  1G68 A;  3QNC A;  1ES3 A;  3VOL A;  5GLB A;  2WKR A;  5GLC A;  5J4E A;  3CJM A;  3NI9 A;  3LY4 A;  3RTY A;  2DRW A;  4EQ1 A;  1YM1 A;  3S7N A;  2Y2P A;  1OPX A;  4KQR A;  3R7W A;  2HZ5 A;  3MQ0 A;  4HP4 A;  3PAE A;  4DE2 A;  4BMW A;  5E43 A;  3QP8 A;  3GVB A;  5FA7 A;  3IXH A;  4ZBE A;  4N92 A;  3RH8 B;  2ZQA A;  4O8G A;  4I5S A;  4L0L A;  1RGY A;  1CK3 A;  1M40 A;  1ODV A;  4LRZ E;  2XRN A;  3NEC A;  4JXG A;  2OAP 1;  4C6Y A;  4PM6 A;  1N9O A;  3BYD A;  2HF6 A;  4BJP A;  3KSG A;  3UNW A;  3SH8 A;  5EUA A;  4MN6 A;  3LR0 A;  3O87 A;  5E2H A;  2GZA A;  1GSV A;  4O01 A;  4QD4 A;  3U2A A;  1IOU A;  2HDU A;  4X6T A;  4BL2 A;  3MSH A;  4X53 A;  3UB9 A;  4C75 A;  2PBY A;  4JGR A;  5CHU A;  3H82 B;  2PD7 A;  3UN7 A;  4P87 A;  3ISG A;  4B88 A;  5JYP A;  2XDM A;  1L0E A;  3Q7V A;  4HEF A;  4QHC A;  1NZU A;  3BEB A;  1LT0 A;  1P9W A;  4BBV A;  1TS6 A;  2OWJ A;  4DMZ A;  5L07 A;  1SHV A;  2JKR I;  5KMW A;  2BLS A;  1XFQ A;  4WEJ A;  5FQ9 A;  4B4X A;  1XJ2 A;  2OLV A;  2XFT A;  4Y13 A;  1L3L A;  3FPW A;  4JPM A;  3CUE C;  3GR2 A;  1TVF A;  5TBM A;  3LR3 A;  5HD5 A;  3K3C A;  2ZOH A;  4JLF A;  4NK3 A;  4I39 A;  2DNS A;  2KOI A;  1LI9 A;  3HLF A;  1KVM A;  3KYE A;  4ME4 A;  3F1O B;  3BJN A;  3O3V A;  3KYQ A;  4GHI A;  3SS4 A;  1OTD A;  4II7 A;  3EGD C;  3PBQ A;  4OPY A;  2WZX A;  3BRM A;  2WYX A;  5FQJ A;  4DN0 A;  3VP4 A;  1IEM A;  3MKF A;  3ZG8 B;  2PRF A;  2W1T B;  3CAX A;  2VGL M;  4YWZ A;  5L10 A;  1XJ6 A;  4F3L A;  3UDF A;  4OKP A;  1RCJ A;  1Y28 A;  1DP9 A;  2VV6 A;  3VP2 A;  1I5Q A;  3E98 A;  3PBS A;  3KO6 A;  4M4X A;  1YLY A;  1ALQ A;  3BFC A;  4DF6 A;  2RCX A;  3HBR A;  4WF0 A;  2EX9 A;  1K56 D;  2XF3 A;  3DTE A;  3BEC A;  1CI9 A;  1N4O A;  3D3O A;  3V39 A;  2Y2M A;  2WK0 A;  2QZ6 A;  2WKP A;  4F94 A;  1XP4 A;  2H28 A;  3VFH A;  3GDI A;  3IH9 A;  4S2J A;  1KE3 A;  3KSF A;  3B33 A;  1H5X A;  5F68 A;  2WGI A;  4CLC C;  3GMW A;  3BW6 A;  2V1A A;  4I3J A;  4PPR A;  4L9F A;  2Q9M A;  1AXB A;  3LI8 A;  4Y7P A;  1PZP A;  3KSH A;  4MEZ A;  3BWL A;  3C4P A;  4RX3 A;  4OON A;  3PHY A;  3T4T A;  4GS9 A;  3OZH A;  5HD3 A;  3VP1 A;  4KZ3 A;  4CQH A;  1BTL A;  3IS2 A;  3UE6 A;  3W2Z A;  3HUN A;  3IWQ A;  4BLM A;  1LL5 A;  4ETX A;  3LGO A;  4ZAM A;  2XGN A;  2YKH A;  5CED A;  3C5A A;  1KDW A;  4ARZ B;  3NC8 A;  3KX0 X;  4X25 A;  3BY9 A;  2XRO A;  3IT9 A;  4EBL A;  3T1X A;  3BQA A;  3V5M A;  2HP6 A;  4L9G A;  3EEH A;  2ZC3 B;  1UWP X;  5DTK A;  2J9P A;  5J7E A;  2ZMF A;  5M1A A;  3T4K A;  4BBU A;  2B5R A;  1KE4 A;  1LSV A;  2QMI A;  1FIL A;  3EQU A;  5FI6 A;  1YLW A;  2PT7 A;  3ITB A;  3NY4 A;  2H0Y A;  5HAP A;  4LLO B;  1TF1 A;  4RX2 A;  3SH7 A;  5EE8 A;  1KGE A;  1NYM A;  4LGW A;  4Y0U A;  4X56 A;  5DF8 A;  5HSQ A;  4I3A A;  3E4P A;  2O9A A;  2O0Y A;  3T4O A;  4KZ6 A;  2VLG A;  3PAG A;  5FI2 A;  3G2Y A;  2KDK A;  1BUL A;  2PYR A;  3LEQ A;  4Z1W A;  4S2M A;  2EWV A;  3W8K A;  2EFX A;  4WZ5 C;  3T4S A;  3JVU A;  2J3W A;  2O99 A;  1W8Q A;  3HLC A;  1PI4 A;  3FZC A;  5CTM A;  4UQI M;  4OP8 A;  4XT2 A;  1JNU A;  1IFQ A;  4PM8 A;  4R4R A;  2J3T C;  3A3F A;  4ID4 A;  2JKR M;  2WKI A;  2ZM0 A;  1XPB A;  5CTN A;  3S7Q A;  2ZQC A;  3P98 A;  1F9I A;  3S7O A;  3ZG5 A;  3VSK A;  2EXB A;  1XA7 A;  1OTE A;  3N8L A;  1ESU A;  1WE4 A;  4IVK A;  4K08 A;  5A92 A;  5TFQ A;  3HL9 A;  3JYI A;  4OPR A;  3NDE A;  3G6O A;  5F83 A;  4FSF A;  3OPP A;  3LID A;  3LFV A;  4DXB A;  5FEF A;  1TS8 A;  3LIC A;  1G28 A;  1T1B A;  4O0P A;  5KZH A;  3K3D A;  1FCM A;  4HBT A;  4MBK A;  1YPR A;  2ZMV A;  1HVB A;  3SS3 A;  3F1N A;  1VEU A;  4O7D A;  4LPZ A;  1L0D A;  2XH9 A;  3PXP A;  1DJC A;  3VMA A;  3G30 A;  2R9W A;  1GHP A;  4FD8 A;  3DWZ A;  2B18 A;  2HPB A;  3MZD A;  4HJ4 A;  2NUP C;  4R38 A;  2P9V A;  3NIA A;  2EA9 A;  3HUO A;  4LV1 A;  4N1H A;  5FQQ A;  2QWS A;  4FH2 A;  2G2W A;  4S2N C;  3PYP A;  4H8R A;  2X71 A;  4X1M A;  3SS5 A;  4C3Q A;  3ZQ5 A;  4P0M A;  4DE0 A;  1MWR A;  1N9B A;  3BFD A;  2ZQ7 A;  4PHT A;  3B3X A;  4LEN A;  5CX7 A;  5FDS A;  3O86 A;  4Y17 A;  2O9C A;  3G34 A;  1M6K A;  5HPI A;  2XD5 A;  4Y0O A;  2L4R A;  2Y2N A;  3NOP C;  1GHI A;  3AGE A;  4K0X A;  4X55 A;  4ZJ1 A;  3ZG0 A;  3R7W B;  3C7V A;  4HH2 A;  2UWX A;  4S2K A;  5FSR A;  4LV2 A;  1YAX A;  2G2U A;  4MN7 A;  5CGW A;  4WYY A;  3S1Y A;  4WL9 A;  1H0M A;  4KG5 A;  1TDL A;  4LV0 A;  3VOZ A;  2OLU A;  4ESP A;  4K0W A;  4HJ3 A;  3C30 A;  5TR7 A;  3NOT C;  3VE4 A;  5I94 A;  2PAV P;  3SOI A;  2WKQ A;  4JF6 A;  1GSW A;  1ZTU A;  1FIK A;  1PWG A;  2M1C A;  2ZC4 B;  4JGO A;  1DY6 A;  5FI7 A;  5DJU A;  1KVL A;  4DE1 A;  3CUE A;  3OPL A;  3HLE A;  3BLM A;  4R0Q A;  3ZGA B;  2A24 A;  3S7P A;  2H0T A;  3ZFZ A;  3Q1F A;  1CQA A;  3A3E A;  3A0R A;  1OTI A;  3DWK A;  4KUK A;  4EQI A;  2J7V A;  1N9L A;  3HCY A;  4GCZ A;  5FDH A;  2V1Z A;  5GHX A;  1BSG A;  3Q7V B;  1VET A;  2V8F A;  1ES4 A;  5K5B A;  4OOL A;  4R3J A;  2Y2L A;  3LEZ A;  3MZF A;  2L1M A;  4ZTK A;  4NEE D;  1GA0 A;  2WGV A;  1YSQ A;  4N1X A;  1SKO A;  1F98 A;  2I9V A;  2VX8 A;  3V50 A;  3PR6 A;  4QWO A;  3NBL A;  2Z6D A;  1NLZ A;  5D3O A;  3TG9 A;  1DRM A;  4HES A;  3CHW P;  3TE8 A;  2ACG A;  5TBM B;  1A0K A;  4LRX C;  2P04 A; 
#chains in the Genus database with same CATH homology
 1CF0 A;  1D1J A;  3T1S A;  1Z09 A;  3D9Y A;  4X1L A;  1VET B;  5EM1 A;  4FTX A;  4D60 A;  3CPT B;  2JKF A;  4ESP A;  3MSH A;  5FEF A;  5EVE A;  3T12 B;  1SKO B;  1YPR A;  2PAV P;  1FIL A;  2ZL1 B;  5EV0 A;  1FIK A;  3NUL A;  1VEU A;  1F2K A;  1PNE A;  1Y4O A;  3T1Q B;  1K0K A;  2V8C A;  2B95 A;  1CQA A;  1ACF A;  1AWI A;  3T1R A;  5FEG A;  3MS6 A;  2HZ5 A;  3LEQ A;  3DAV A;  5EM0 A;  4X1M A;  1SZV A;  1HLU P;  1VET A;  3KYE A;  2V8F A;  1VEU B;  3L9K A;  2E8J A;  1PRQ A;  2JKG A;  5FDS A;  1J3W A;  3U4L P;  2VK3 A;  3L7H A;  2PRF A;  1CJF A;  1SKO A;  3LGO A;  1G5U A;  4QWO A;  2ZL1 A;  2PBD P;  3NEC A;  3CHW P;  2ACG A;  4X25 A;  4FUW A;  1A0K A;  3CPT A;  1PFL A;  3UB5 P;  3T1X A;  2BTF P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...