3U4LP

Cryocooled bovine profilin:actin crystal structure to 2.4 a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
139
structure length
139
Chain Sequence
AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVHGGMINKKCYEMASHLRRSQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin, cytoplasmic 1
publication title Structural basis for profilin-mediated actin nucleotide exchange.
pubmed doi rcsb
total genus 38
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2011-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3u4lP00
4QWOA 1HLUP 2JKFA 1D1JA 2PAVP 1ACFA 3T1QB 3CHWP 2PBDP 5FDSA 1PFLA 3T1SA 1CF0A 3L9KA 4X1MA 1VEUB 1Y4OA 3U4LP 1FILA 3MSHA 5EM1A 3T1RA 1Z09A 3LGOA 5EVEA 1SKOA 4FUWA 5FEGA 4ESPA 3CPTB 4X25A 1CQAA 4X1LA 2ACGA 1FIKA 1VETA 1AWIA 1CJFA 3NULA 1F2KA 2B95A 3T12B 1G5UA 3KYEA 1J3WA 3UB5P 3MS6A 2ZL1B 2HZ5A 2V8CA 1K0KA 1SZVA 3LEQA 2VK3A 1YPRA 2E8JA 3L7HA 3T1XA 1A0KA 3DAVA 5EM0A 1SKOB 1VEUA 2BTFP 2V8FA 1PNEA 2JKGA 2PRFA 1PRQA 4D60A 3NECA 2ZL1A 1VETB 5EV0A 5FEFA 3D9YA 4FTXA 3CPTA
chains in the Genus database with same CATH superfamily
1G6OA 5CERA 5FQIA 4F3LB 3TE8A 2WGWA 4ME4A 1K6SA 5D3OA 3KSFA 3TG9A 1MXOA 1JVJA 4MN6A 3ZG8B 2XH9A 3OPHA 5FQJA 3C38A 3VFHA 4KENB 5EVIB 4GS9A 1EI5A 4P85A 4WZ5A 4PKYA 2Z2LB 3W8KA 3T4TA 3Q7ZA 4DJ2A 5E43A 1IELA 4FUWA 2PU2A 3F1NA 4ESPA 3BM6A 2B18A 2M7UA 1J9MA 4JGOA 1PZOA 3G2YA 2H0YA 5HD3A 2ZL1B 3VV4A 2K31A 3SS5A 2HZ5A 2WADA 2V1ZA 3KSGA 2DNSA 3HLWA 4Y5FA 1XJ2A 3LEQA 1DRMA 5HZHA 4QD4A 5L8MA 3PBOA 3T4OA 4EBLA 4YNRA 1N9LA 3FKVA 4KZ4A 4U3TA 4JXVA 4E3KA 2Y79A 2XSSA 3IHAA 4LV2A 2QYBA 3D4FA 2V0UA 4E3IA 2Q9MA 3OLOA 4ZTKA 1S1ZA 4IVIA 3MQOA 5FEFA 3LR5A 2C6WB 1MY8A 4K91A 1ES4A 3ITBA 4R23A 1HZOA 4L9EA 1T19A 2GX5A 2A49A 4C75A 4O01A 1MBLA 4S2OA 4XUZA 1IYOA 2PAVP 5HX9A 2ZOHA 1ACFA 3LIEA 3IHBA 3MZFA 5J7EA 3BJNA 4JGRA 3L9KA 1K55C 1Y4OA 3ICYA 4B9OA 1NRJA 2KX6A 4OKPA 1WA9A 2ZC3B 3IF6C 3VOYA 1CK3A 3VSLA 2I72A 2WYXA 3LR3A 3UB8A 3EQUA 5KIZA 2EFUA 4GZBA 4IBRA 1CQAA 2Z2MB 3IS2A 5E2FA 1FIKA 1ONHA 1VETA 3Q81A 1SDEA 4NEED 2H28A 1E4DA 2GJ3A 4Q0IA 1W79A 4X69A 4OPQA 1J3WA 3C8CA 4X55A 4Y2FA 2PD8A 2EX2A 5HAPA 3E2KA 2OAQ1 2Y55A 5DF7A 1SZVA 3IXGA 3UN7A 1NLYA 3PAEA 4IUKA 1Y28A 2JKRM 4GDBA 1K54C 4NXGA 4DDYA 4YOFA 1LL9A 3A0SA 4HBTA 1IYQA 4R4SA 1S4RA 4ZJ3A 2ZL1A 4BL3A 1T1AA 4JKTA 4FTXA 1M6KA 4R3AA 4HOIA 2ZMAA 4MN7A 3TRCA 3LIDA 1JWVA 1F98A 1IEMA 3K2NA 1Q2QA 4S2PA 3LICA 3B33A 1PFLA 4E6WA 1XGJA 3UPNA 5F1GA 2BASA 4OQIA 2XK1A 1BYWA 3CUEC 5CECA 3EGXC 3NDEA 3CLOA 1ERMA 3S7QA 1K55A 3R7WB 2UWXA 3IF6A 5CHUA 2Y2QA 5GHYA 3JYIA 1TEMA 1T18A 1QMFA 1G28A 3S1YA 3QP4A 1K6RA 2B95A 1ODVA 2OLUA 3E0YA 4WMCA 3RXXA 3T12B 1MKIA 2JE5A 3HL9A 4RX2A 1OTIA 4EBPA 4PM5A 3LFVA 3O87A 3P7NA 2K2NA 3CZDA 1YLYA 4II7A 1ZKJA 4E6XA 1K25A 3UDXA 2ZQCA 4OQ0A 5A92A 4LFUA 1NZOA 1P97A 2M1CA 3NIAA 5CEBA 2P9VB 2WKHA 1N9NA 1BZAA 4C3QA 4Q8IA 2A2LA 5DKLA 4DXBA 1H3QA 2WGIA 1K54A 1MWRA 2W27A 1ZC2A 4P0MA 4S2JA 5DVAA 4FH2A 3BEBA 1FSYA 2V9AA 4EV4A 4JGPA 2FFFB 4UA7A 5DTKA 5FASA 1L0DA 2XF3A 5BOHA 1VQQA 2G2UA 4X6TA 3S7OA 3UE3A 3GRJA 5KMWA 3T4QA 4OH0A 5FDSA 3ZFZA 1MZUA 5HFOA 2Y2KA 5G4YA 3WS1A 3MFXA 1NJ4A 4X1MA 4I3IA 4KUKA 1PYYA 4DF6A 3V67A 5DFXA 3G2ZA 3GR2A 4PM9A 4ZBEA 3T1RA 3LY4A 3VP3A 4LRXC 1DJAA 3CUEA 4RX3A 3ZCZA 4FOFA 1KE4A 3ZQ5A 4UQIS 2K7SA 3G34A 3CPTB 2VEAA 2BLSA 4BENA 3W4PA 4XXRA 2JKTM 3N4IA 5GLDA 3PBTA 2HJEA 2QPNA 4KZ3A 2XFTA 2V20A 4LV0A 2Y59A 3ZYTA 4EEUA 3R7WA 4BMWA 2AVXA 5L2FA 1STZA 3LCEA 3NC8A 3HVFA 5JYPA 4DE3A 3PTEA 1V9ZA 4DMZA 2DCFA 3SS4A 3MFDA 1TDGA 1LL8A 4L0LA 4OOMA 3N8LA 1ZG4A 1K56A 1FOFA 1K38A 1PRQA 5J4EA 1H0MA 3EQVA 4UHUA 4PM6A 4EQIA 4Y0TA 3CMZA 4KQQA 3K3DA 3UE1A 5EVID 3S7PA 1YAXA 2Y2GA 1S4SA 3BLSA 1TS7A 3V5MA 2Y2IA 3HLFA 5TBMA 3FZCA 2XEPA 4S2MA 3I7JA 5L09A 3K3CA 2WZZA 5CXWA 1AXBA 4LCMA 1L2SA 2I9VA 4ETZA 1SKOA 5FAQA 3AGFA 1XXMA 3LYXA 4WUJA 3DTEA 5F69A 5HWWA 2WKEA 3N7WA 1LI0A 3DWZA 2R9XA 4OONA 3C5AA 3UDIA 3TSGA 3O3VA 1W8QA 4PKYG 1OTDA 5FI2A 2ZQ8A 1PI4A 1KOUA 4OLGA 1OJGA 1X0OA 4IJGA 1S1YA 1MWSA 4S2IA 2J9OA 5HARA 3LI9A 4QPRA 3RFBA 1GA9A 2PT7A 3G35A 3ZG9B 4YFMA 2QHKA 1JTDA 3G31A 4IEDA 3LIAA 1TF1A 1CI8A 1D7EA 4DJ3A 1S67L 2JCHA 3LY3A 3ZDJA 1GHMA 2H5SA 3EEAA 4WF0A 3OPRA 5G4ZA 3RJUA 1WYBA 1OPXA 2XDMA 3FV7A 4OVDA 5GLCA 4GKUA 4QU3A 1HTZA 3AGEA 3MKFA 4O7DA 3WS5A 2J80A 2JBFA 1DP9A 4RYEA 3ZHHA 4DKIA 4DRTA 4E3MA 3BQ8A 5TGFA 1TDLA 1VEUB 3QHYA 3FKWA 2OLVA 2NUPC 1GSXA 1YLZA 4Y3IA 4JGQA 1RP5A 4E3JA 4E3OA 3M2KA 1W63Q 1Y54A 3QNBA 3SW1A 5GLBA 3O86A 3Q82A 5I94A 3N6IA 3BFCA 2VJWA 5FEGA 2JC7A 2FZ0A 3DWKA 4BQMA 3UB6A 3ZG7B 5FL3A 1KVMA 3MR0A 4QJGA 1LHYA 4WYYA 3HLEA 3KYQA 5KSCA 4I5SA 1K57C 3D72A 4LCLA 3MF0A 4NG2A 3TOIA 2Y2NA 3BFDA 4N9LA 3UPPA 2MJ6A 5FQQA 1MKMA 2A24B 3Q7VB 5EVIC 3UB9A 1NY0A 4M4XA 3BECA 3E4OA 5EM0A 4GCZA 3NDGA 2P74A 2O9CA 2OWJA 4R4RA 2XQZA 4XT2A 2EX8A 4IVKA 4D60A 1XJ6A 1GCEA 4QY6A 3F1PA 5F68A 5I5LA 2J9PA 3ZG5A 2XR0A 3HJKA 4WN5A 4HP4A 1DP8A 3VSKA 1KGEA 1GHPA 2P04A 2Z6DA 3EGDC 4NXEA 2KDKA 3SZTA 4ZAMA 1ONGA 1FCMA 1D1JA 3UNWA 4KZAA 5IT5A 3LI8A 3MXQA 4P6ZS 3IX8A 2XA7M 3T4JA 4BBUA 5IHVA 4HNBA 4PM7A 3BLMA 4JXGA 1FILA 4H6JA 1YLPA 4JLFA 4A5RA 1K56D 5FI7A 1YLTA 1Z09A 4DE2A 2C5WB 2W1TB 3G4PA 5G18A 1OTEA 4QY5A 2PYRA 3QNCA 1XA1A 4GB7A 3MXSA 4HIAA 3WWXA 1NLZA 2WKPA 3P09A 1PW1A 2VGLM 2WKIA 3G6OA 3EWKA 3MS6A 5FDHA 1ESIA 4R70A 1YT4A 4ZRRA 4N1XA 4F3LA 1K57A 4OPZA 1LI9A 3ZVTA 4PM8A 4O8GA 1BLCA 3BW6A 4LGWA 4UEYA 3DAVA 2X71A 5EVIA 3LR4A 1S0WA 5DFYA 1BUEA 2PU4A 2XLNA 3S7NA 3A3JA 2HP6A 4IHQA 4LRYC 1UGUA 2YKHA 5KSHA 3H82B 4B4ZA 2A24A 5HDCA 1L0EA 4JBFA 1YM1A 5CGWA 4E3NA 4ID4A 3HJIA 4MCWA 5K5BA 2X01A 1SCWA 2EX6A 3T1QB 5A93A 1FR1A 4DXCA 4S2NC 2PDRA 4EXOA 4RQ9A 2G7UA 3HUOA 4IUHA 2GNXA 2W3EA 4ZJ1A 4GOGA 3IH8A 3S22A 3T4KA 1XFNA 3WS4A 1MC0A 2BG1A 3BFEA 4WELA 4ETXA 4ZDXA 4GNUA 2W0NA 1KE3A 1SHVA 2OAP1 3UPOA 5EOEA 1ES5A 3C4PA 1KVLA 1E3UA 2R78A 2WAEA 4OQHA 1BT5A 1FQGA 3IXBA 3LEZA 4HH3A 3G32A 1LL5A 3HLDA 4GHIB 4HQAA 4EBNA 2ZLYA 2HP5A 4CQHA 1YSPA 4X68A 2G2WA 3CAXA 5F5YA 1PW8A 3UB5P 4H8RA 1NRFA 4EW7A 4GD8A 4X56A 2L1MA 2W1TA 2V8CA 2PD7A 2VGJA 1DY6A 3SOIA 2ZQ9A 4R1GA 4MN5A 1OT6A 2ZQ7A 1A0KA 2ZD8A 3OOVA 4IBXA 4FD8A 4HBUA 3SH8A 1O07A 4S2KA 3OC2A 5C5KA 2PRFA 4ARZB 5HPFA 5FAPA 3WRZA 4CLCB 4AFIA 4D2OA 5A90A 4UQIM 3V50A 5EFWA 1PI5A 2V0WA 2LB5A 4G3KA 3MQQA 1TS8A 2O99A 3M6BA 4KG5A 3GMWA 4JXWA 4UAAA 3QP5A 3UMDA 2VKSA 3T50A 1H8MA 4FCFA 3G30A 3UE6A 5M19A 2DRWA 4S2NA 5J8XA 1JWZA 4PMAA 5TFQA 3S4XA 2V1AA 3C7VA 3JVVA 2XGNA 4HJ3A 4KQOA 3EOIA 2IWCA 5GHZA 4QHCA 3PYPA 2JKRI 2J3TC 2HJ9C 3UMEA 3NOUC 4UA9A 1W5DA 5FQMA 3M2JA 2LB9A 4BBVA 4EESA 3KYEA 3ISGA 3H7WB 4MBFA 3PR6A 3UDFA 2PR6A 5CEDA 2IA2A 2KOIA 1WE4A 2Y2HA 1YPRA 1LSWA 5F6AA 4MLLA 3QP6A 2NUTC 3FPVA 5DF8A 5HD5A 1VHMA 3A3FA 1IYSA 1OJ5A 4NK3A 4KQRA 3OBFA 2J3WA 1FCNA 1BLSA 1T1CA 2VZWA 3F1OB 1KDWA 3GTCA 3HLCA 5CX7A 3BRMA 2IWDA 2Q9NA 3C7UA 5A8BA 4LLOB 3HCYA 3KX0X 1O7EA 1ZHHB 3BY9A 1XJ3A 3M6HA 4DE1A 4N1HA 2EX9A 3IX3A 1HLUP 3OZHA 4I38A 2INWA 5DTTA 3MZDA 3A0RA 1D06A 3T1SA 1CF0A 3VP2A 2J8YA 1SKFA 2QMIA 2OWHA 2ZC4B 4O0PA 5DJUA 4YINA 2VLGA 4X53A 1N9OA 5AQ9A 2P9VA 4Y13A 3FC7A 3AGDA 3W4QA 3RTYA 1EROA 2O9BA 4EQ1A 2ACGA 3T4SA 5MC7A 3MBZA 3UO9A 1ZG6A 1XX2A 3MMHA 1CJFA 2ZC7A 1F2KA 4G3WA 1G5UA 2EA9A 4EWFA 4GJ4A 4QB8A 1ZTUA 4GS9B 4HP9A 3NBLA 4I3AA 1K0KA 4EUZA 5HSQA 5LBRA 3PBRA 5HPIA 2XD1A 2ZC5B 5EPHA 4JF5A 1PNEA 2JKGA 4LV1A 1IFQA 3O88A 3F1NB 3D3OA 1E3UD 1JTGA 3N8RA 3VP1A 4M3KA 2UV0E 1P0ZA 3IXHA 1XGIA 1L0FA 3UB7A 1Q2PA 3OPLA 2HDQA 3D9YA 4GD6A 1I2WA 4YWZA 2FFYA 3CPTA 4B4XA 3UY6A 4QWOA 3KSIA 1GSWA 3NOTC 3CG5A 1GHIA 1FR6A 1JNUA 4Y7PA 4BWIA 3BFGA 1JWPA 2JKTI 2YKFA 4JPMA 4S2LA 1KE0A 3HREA 3IWQA 1LT0A 2Y2OA 3LR0A 4K0XA 3QP2A 3LGOA 5EVEA 2ZQDA 3C4OA 3VP4A 4OP8A 1OMEA 4X25A 3LIFA 5JYOA 5EVLA 1WYCA 2W3FA 3BQAA 4B93A 3FG8A 4JF6A 1LSXA 4N92A 1ESUA 1W7FA 4OP5A 2PR5A 4LPZA 3OCNA 2Y2PA 1TS6A 3TW8A 3B3XA 3PBNA 3ZNTA 4KG6A 2WAFA 3ZGAB 3B47A 4P6ZM 4WEJA 4MBKA 2E8JA 4KUOA 3A3IA 4BJPA 2VV8A 3IWOA 5AJGA 3A3EA 3KYZA 1XJ4A 3IS2B 5HDSA 3NECA 1GSVA 3NY4A 3PHYA 1VETB 3LUQA 5AQ7A 3R4KA 2W3DA 1CEGA 2VX8A 4PHTA 2GZAA 4OPYA 3BFFA 1C3BA 3V39A 1F9IA 4KZ6A 2HP9A 2Y4AA 4KZ7A 5IS1A 3QP1A 5EE8A 2JHEA 5CRFA 5HWTA 2PBYA 1NXYA 4R3BA 4Q0HA 3VMAA 2V1BA 2W3HA 2O0YA 2HV1A 4MMNA 1YMXA 3U4LP 3DTIA 4ZJ2A 1FSWA 2L4RA 4Q0JA 3GSGA 1V9YA 4FH4A 2XFSA 4BBTA 3VOLA 1L0GA 2A3UA 5F82A 4OPRA 4EU0A 1PWCA 3Q1FA 1S66L 3IBRA 3IWIA 4FSFA 1N4OA 3W4OA 3IQAA 4HEFA 5AVEA 3SS3A 2HF6A 3HLGA 4LENA 3MJQA 4CLCD 5HW3A 4XUXA 3OPPA 4I3JA 3WS2A 3L7HA 1P9WA 2QKPA 3JVUA 1RGYA 2PHYA 1VEUA 4B88A 3BYDA 5E2HA 3IF6B 3VE3A 2J7VA 1XFQA 3NI9A 4PPRA 1W63M 5F83A 3EEHA 2QJ7A 3PBSA 3A0VA 3HBRA 5DF9A 5F1FA 1YMSA 3NCKA 2EFXA 5EV0A 4Y0OA 1ES2A 4DDSA 3GQZA 1N9BA 4WLAA 4OQGA 1OTAA 3WRTA 3IH9A 2J3TD 1LLBA 1ERQA 2WKQA 1ES3A 5DTSA 5EECA 4GLQA 2QZ6A 2R9WA 2WGVA 3C2WA 1BLHA 2PBDP 4KZ9A 3ZNYA 2EWWA 1YLWA 4L9FA 3FYZA 3Q7VA 2GDNA 1PIOA 1TS0A 5CGSA 5FA7A 4EUVA 4KZ8A 3PBQA 5HDDA 3FPWA 3W2ZA 3SH9A 5DKKA 1U60A 2XA7S 1RCJA 1OTBA 4RA7A 4CLCE 2VA0A 1YSQA 5GLAA 4MBHA 3GDIA 1MPLA 5HAIA 2WK0A 1Z6FA 1HD8A 1XP4A 4KG2A 3IF5A 3NHQA 3ZG0A 1CEFA 1UWNX 3GECA 2B02A 2EWVA 4HH2A 2QWSA 4JF4A 5A91A 2ZM2A 2VGLS 3P01A 1DP6A 2VV6A 3LO7A 2DMWA 2ZM8A 5FAOA 1CI9A 5CTMA 3KSHA 5FQ9A 1VB6A 2Y2LA 4K08A 1NYYA 1BLPA 3CJMA 3U2AA 2QJ5A 5HAQA 4G3VA 1KGGA 4EEPA 3V3SA 4OOLA 4LV3A 1NYMA 4WL9A 2EXBA 4BL2A 1YKDA 2W1RA 4WBGA 4Y0UA 3ITAA 4NXBA 4CPKA 1F5MA 3MSHA 3VFFA 3E2LA 5EM1A 1QMEA 2HGVA 4EERA 4HESA 1OT9A 4HJ4A 5CHJA 4HHDA 5GL9A 4CLCC 1SDNA 3JPUA 3HUNA 3MQ0A 4BLMA 2HDRA 3N8SA 1GA0A 3C30A 1S6RA 5GHXA 1P9RA 1AWIA 3H82A 3MKEA 3DBAA 5TBMB 1TVFA 3SH7A 4U0XA 2ZMVA 3KO6A 2RCXA 5HWVA 2P08A 1W8YA 4E3LA 2B5RA 5FATA 2HDUA 2OOLA 5IU1A 4Y17A 3CWFA 5DJTA 2HPBA 2X02A 3GVBA 1XA7A 1IKIA 2L0WA 2ZC6B 3CI6A 1I2SA 1SKOB 2H10A 3WS0A 3IX4A 3MZEA 2EXAA 5HL6A 1G68A 2E8IA 1K4EA 4L9GA 4MNRA 3UE0A 1M40A 4WZ4A 4LRZE 1VM1A 2HDSA 4NETA 4OLDA 4GHIA 1TD5A 2JKFA 3VE4A 5KZHA 3ULFA 2D01A 4R6LA 5CTNA 3DTKA 3P98A 2CMNA 4PAUA 5E2GA 3CHWP 1PWDA 4MDZA 4GDNA 4F94A 5L07A 3VP0A 1ALQA 4Z1WA 3B42A 4E04A 1I5QA 1E25A 1IKGA 4NXFA 4MEZA 4P6BA 5M1AA 2Z6CA 3TJZC 4WM9A 4R3JA 4ARZA 4X1LA 4CLCA 1PWGA 2XRNA 4RVAA 1BTLA 2Y2JA 5AQBA 2WUQA 3T4LA 3IT9A 4N9KA 1DJCA 5HL1A 1H5XA 3DTMA 1MWTA 5EUAA 1YQSA 1XKZA 2ZMFA 3MXRA 2VK3A 2RL3A 4C6YA 2D02A 3H9WA 4BD1A 2WGWB 2XROA 2BTFP 3FWLA 3VOZA 2Y8HA 1UWPX 1BULA 4KZ5A 1PZPA 3OCLA 4GW9A 1EWZA 3HLBA 5U47A 2JN7A 1XPBA 4NKPA 3IBJA 4JXSA 1MWUA 1L3LA 3CITA 5TJJA 5FSRA 1IOUA 5M18A 3A3DA 4HY8A 1KDSA 2W3GA 1G6AA 2OSUA 3H7WA 4KQDA 3Q07A 4OOYA 1LSVA 2WZXA 1BSGA 1YLJA 4WZ5C 1DJBA 2CC1A 3HUMA 3RXWA 1T1BA 1IYPA 2M7VA 4BD0A 4XT2B 3IXDA 4HI4A 4CJNA 5CGXA 5AVFA 3F1PB 3LIBA 1NZUA 4HJ6A 4Y15A 1H8YA 3DW0A 3F1OA 4UA6A 4Z9QA 5CHMA 3GV9A 3E4PA 2PYPA 3E98A 3ZVWA 1NWZA 3NULA 4DN0A 3NOPC 3QP8A 3PAGA 1HVBA 1EW0A 1H8ZA 2P7JA 2ZQAA 4WEKA 2Y2MA 4R38A 2ZJ9A 2H0TA 2IWBA 3O5YA 3NJAA 5AQAA 2XD5A 3BWLA 5FI6A 4DE0A 5FQKA 4H6JB 2FH5A 2VV7A 4KZBA 3V3RA 4WMCD 3T1XA 1K4FA 1RGZA 1FCOA 2KLIA 4R0QA 2ZBBA 2V8FA 4K0WA 5E2EA 1KGFA 4EETB 4GN2A 5EOOA 2OV5A 5TR7A 4I39A 3BY8A 3RH8B 2V2FF 3PXPA 5L10A 4U0TA 2O9AA 2VGKA 4P87A 2ZOIA 2Y91A 2ZM0A 2Q0OA 3E4QA 2WKRA 5J3WA
chains in the Genus database with same CATH topology
4QWOA 1HLUP 2JKFA 1D1JA 2PAVP 1ACFA 3T1QB 3CHWP 2PBDP 5FDSA 1PFLA 3T1SA 1CF0A 3L9KA 4X1MA 1VEUB 1Y4OA 3U4LP 1FILA 3MSHA 5EM1A 3T1RA 1Z09A 3LGOA 5EVEA 1SKOA 4FUWA 5FEGA 4ESPA 3CPTB 4X25A 1CQAA 4X1LA 2ACGA 1FIKA 1VETA 1AWIA 1CJFA 3NULA 1F2KA 2B95A 3T12B 1G5UA 3KYEA 1J3WA 3UB5P 3MS6A 2ZL1B 2HZ5A 2V8CA 1K0KA 1SZVA 3LEQA 2VK3A 1YPRA 2E8JA 3L7HA 3T1XA 1A0KA 3DAVA 5EM0A 1SKOB 1VEUA 2BTFP 2V8FA 1PNEA 2JKGA 2PRFA 1PRQA 4D60A 3NECA 2ZL1A 1VETB 5EV0A 5FEFA 3D9YA 4FTXA 3CPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QWO A;  1HLU P;  2JKF A;  1D1J A;  2PAV P;  1ACF A;  3T1Q B;  3CHW P;  2PBD P;  5FDS A;  1PFL A;  3T1S A;  1CF0 A;  3L9K A;  4X1M A;  1VEU B;  1Y4O A;  3U4L P;  1FIL A;  3MSH A;  5EM1 A;  3T1R A;  1Z09 A;  3LGO A;  5EVE A;  1SKO A;  4FUW A;  5FEG A;  4ESP A;  3CPT B;  4X25 A;  1CQA A;  4X1L A;  2ACG A;  1FIK A;  1VET A;  1AWI A;  1CJF A;  3NUL A;  1F2K A;  2B95 A;  3T12 B;  1G5U A;  3KYE A;  1J3W A;  3UB5 P;  3MS6 A;  2ZL1 B;  2HZ5 A;  2V8C A;  1K0K A;  1SZV A;  3LEQ A;  2VK3 A;  1YPR A;  2E8J A;  3L7H A;  3T1X A;  1A0K A;  3DAV A;  5EM0 A;  1SKO B;  1VEU A;  2BTF P;  2V8F A;  1PNE A;  2JKG A;  2PRF A;  1PRQ A;  4D60 A;  3NEC A;  2ZL1 A;  1VET B;  5EV0 A;  5FEF A;  3D9Y A;  4FTX A;  3CPT A; 
#chains in the Genus database with same CATH topology
 1G6O A;  5CER A;  5FQI A;  4F3L B;  3TE8 A;  2WGW A;  4ME4 A;  1K6S A;  5D3O A;  3KSF A;  3TG9 A;  1MXO A;  1JVJ A;  4MN6 A;  3ZG8 B;  2XH9 A;  3OPH A;  5FQJ A;  3C38 A;  3VFH A;  4KEN B;  5EVI B;  4GS9 A;  1EI5 A;  4P85 A;  4WZ5 A;  4PKY A;  2Z2L B;  3W8K A;  3T4T A;  3Q7Z A;  4DJ2 A;  5E43 A;  1IEL A;  4FUW A;  2PU2 A;  3F1N A;  4ESP A;  3BM6 A;  2B18 A;  2M7U A;  1J9M A;  4JGO A;  1PZO A;  3G2Y A;  2H0Y A;  5HD3 A;  2ZL1 B;  3VV4 A;  2K31 A;  3SS5 A;  2HZ5 A;  2WAD A;  2V1Z A;  3KSG A;  2DNS A;  3HLW A;  4Y5F A;  1XJ2 A;  3LEQ A;  1DRM A;  5HZH A;  4QD4 A;  5L8M A;  3PBO A;  3T4O A;  4EBL A;  4YNR A;  1N9L A;  3FKV A;  4KZ4 A;  4U3T A;  4JXV A;  4E3K A;  2Y79 A;  2XSS A;  3IHA A;  4LV2 A;  2QYB A;  3D4F A;  2V0U A;  4E3I A;  2Q9M A;  3OLO A;  4ZTK A;  1S1Z A;  4IVI A;  3MQO A;  5FEF A;  3LR5 A;  2C6W B;  1MY8 A;  4K91 A;  1ES4 A;  3ITB A;  4R23 A;  1HZO A;  4L9E A;  1T19 A;  2GX5 A;  2A49 A;  4C75 A;  4O01 A;  1MBL A;  4S2O A;  4XUZ A;  1IYO A;  2PAV P;  5HX9 A;  2ZOH A;  1ACF A;  3LIE A;  3IHB A;  3MZF A;  5J7E A;  3BJN A;  4JGR A;  3L9K A;  1K55 C;  1Y4O A;  3ICY A;  4B9O A;  1NRJ A;  2KX6 A;  4OKP A;  1WA9 A;  2ZC3 B;  3IF6 C;  3VOY A;  1CK3 A;  3VSL A;  2I72 A;  2WYX A;  3LR3 A;  3UB8 A;  3EQU A;  5KIZ A;  2EFU A;  4GZB A;  4IBR A;  1CQA A;  2Z2M B;  3IS2 A;  5E2F A;  1FIK A;  1ONH A;  1VET A;  3Q81 A;  1SDE A;  4NEE D;  2H28 A;  1E4D A;  2GJ3 A;  4Q0I A;  1W79 A;  4X69 A;  4OPQ A;  1J3W A;  3C8C A;  4X55 A;  4Y2F A;  2PD8 A;  2EX2 A;  5HAP A;  3E2K A;  2OAQ 1;  2Y55 A;  5DF7 A;  1SZV A;  3IXG A;  3UN7 A;  1NLY A;  3PAE A;  4IUK A;  1Y28 A;  2JKR M;  4GDB A;  1K54 C;  4NXG A;  4DDY A;  4YOF A;  1LL9 A;  3A0S A;  4HBT A;  1IYQ A;  4R4S A;  1S4R A;  4ZJ3 A;  2ZL1 A;  4BL3 A;  1T1A A;  4JKT A;  4FTX A;  1M6K A;  4R3A A;  4HOI A;  2ZMA A;  4MN7 A;  3TRC A;  3LID A;  1JWV A;  1F98 A;  1IEM A;  3K2N A;  1Q2Q A;  4S2P A;  3LIC A;  3B33 A;  1PFL A;  4E6W A;  1XGJ A;  3UPN A;  5F1G A;  2BAS A;  4OQI A;  2XK1 A;  1BYW A;  3CUE C;  5CEC A;  3EGX C;  3NDE A;  3CLO A;  1ERM A;  3S7Q A;  1K55 A;  3R7W B;  2UWX A;  3IF6 A;  5CHU A;  2Y2Q A;  5GHY A;  3JYI A;  1TEM A;  1T18 A;  1QMF A;  1G28 A;  3S1Y A;  3QP4 A;  1K6R A;  2B95 A;  1ODV A;  2OLU A;  3E0Y A;  4WMC A;  3RXX A;  3T12 B;  1MKI A;  2JE5 A;  3HL9 A;  4RX2 A;  1OTI A;  4EBP A;  4PM5 A;  3LFV A;  3O87 A;  3P7N A;  2K2N A;  3CZD A;  1YLY A;  4II7 A;  1ZKJ A;  4E6X A;  1K25 A;  3UDX A;  2ZQC A;  4OQ0 A;  5A92 A;  4LFU A;  1NZO A;  1P97 A;  2M1C A;  3NIA A;  5CEB A;  2P9V B;  2WKH A;  1N9N A;  1BZA A;  4C3Q A;  4Q8I A;  2A2L A;  5DKL A;  4DXB A;  1H3Q A;  2WGI A;  1K54 A;  1MWR A;  2W27 A;  1ZC2 A;  4P0M A;  4S2J A;  5DVA A;  4FH2 A;  3BEB A;  1FSY A;  2V9A A;  4EV4 A;  4JGP A;  2FFF B;  4UA7 A;  5DTK A;  5FAS A;  1L0D A;  2XF3 A;  5BOH A;  1VQQ A;  2G2U A;  4X6T A;  3S7O A;  3UE3 A;  3GRJ A;  5KMW A;  3T4Q A;  4OH0 A;  5FDS A;  3ZFZ A;  1MZU A;  5HFO A;  2Y2K A;  5G4Y A;  3WS1 A;  3MFX A;  1NJ4 A;  4X1M A;  4I3I A;  4KUK A;  1PYY A;  4DF6 A;  3V67 A;  5DFX A;  3G2Z A;  3GR2 A;  4PM9 A;  4ZBE A;  3T1R A;  3LY4 A;  3VP3 A;  4LRX C;  1DJA A;  3CUE A;  4RX3 A;  3ZCZ A;  4FOF A;  1KE4 A;  3ZQ5 A;  4UQI S;  2K7S A;  3G34 A;  3CPT B;  2VEA A;  2BLS A;  4BEN A;  3W4P A;  4XXR A;  2JKT M;  3N4I A;  5GLD A;  3PBT A;  2HJE A;  2QPN A;  4KZ3 A;  2XFT A;  2V20 A;  4LV0 A;  2Y59 A;  3ZYT A;  4EEU A;  3R7W A;  4BMW A;  2AVX A;  5L2F A;  1STZ A;  3LCE A;  3NC8 A;  3HVF A;  5JYP A;  4DE3 A;  3PTE A;  1V9Z A;  4DMZ A;  2DCF A;  3SS4 A;  3MFD A;  1TDG A;  1LL8 A;  4L0L A;  4OOM A;  3N8L A;  1ZG4 A;  1K56 A;  1FOF A;  1K38 A;  1PRQ A;  5J4E A;  1H0M A;  3EQV A;  4UHU A;  4PM6 A;  4EQI A;  4Y0T A;  3CMZ A;  4KQQ A;  3K3D A;  3UE1 A;  5EVI D;  3S7P A;  1YAX A;  2Y2G A;  1S4S A;  3BLS A;  1TS7 A;  3V5M A;  2Y2I A;  3HLF A;  5TBM A;  3FZC A;  2XEP A;  4S2M A;  3I7J A;  5L09 A;  3K3C A;  2WZZ A;  5CXW A;  1AXB A;  4LCM A;  1L2S A;  2I9V A;  4ETZ A;  1SKO A;  5FAQ A;  3AGF A;  1XXM A;  3LYX A;  4WUJ A;  3DTE A;  5F69 A;  5HWW A;  2WKE A;  3N7W A;  1LI0 A;  3DWZ A;  2R9X A;  4OON A;  3C5A A;  3UDI A;  3TSG A;  3O3V A;  1W8Q A;  4PKY G;  1OTD A;  5FI2 A;  2ZQ8 A;  1PI4 A;  1KOU A;  4OLG A;  1OJG A;  1X0O A;  4IJG A;  1S1Y A;  1MWS A;  4S2I A;  2J9O A;  5HAR A;  3LI9 A;  4QPR A;  3RFB A;  1GA9 A;  2PT7 A;  3G35 A;  3ZG9 B;  4YFM A;  2QHK A;  1JTD A;  3G31 A;  4IED A;  3LIA A;  1TF1 A;  1CI8 A;  1D7E A;  4DJ3 A;  1S67 L;  2JCH A;  3LY3 A;  3ZDJ A;  1GHM A;  2H5S A;  3EEA A;  4WF0 A;  3OPR A;  5G4Z A;  3RJU A;  1WYB A;  1OPX A;  2XDM A;  3FV7 A;  4OVD A;  5GLC A;  4GKU A;  4QU3 A;  1HTZ A;  3AGE A;  3MKF A;  4O7D A;  3WS5 A;  2J80 A;  2JBF A;  1DP9 A;  4RYE A;  3ZHH A;  4DKI A;  4DRT A;  4E3M A;  3BQ8 A;  5TGF A;  1TDL A;  1VEU B;  3QHY A;  3FKW A;  2OLV A;  2NUP C;  1GSX A;  1YLZ A;  4Y3I A;  4JGQ A;  1RP5 A;  4E3J A;  4E3O A;  3M2K A;  1W63 Q;  1Y54 A;  3QNB A;  3SW1 A;  5GLB A;  3O86 A;  3Q82 A;  5I94 A;  3N6I A;  3BFC A;  2VJW A;  5FEG A;  2JC7 A;  2FZ0 A;  3DWK A;  4BQM A;  3UB6 A;  3ZG7 B;  5FL3 A;  1KVM A;  3MR0 A;  4QJG A;  1LHY A;  4WYY A;  3HLE A;  3KYQ A;  5KSC A;  4I5S A;  1K57 C;  3D72 A;  4LCL A;  3MF0 A;  4NG2 A;  3TOI A;  2Y2N A;  3BFD A;  4N9L A;  3UPP A;  2MJ6 A;  5FQQ A;  1MKM A;  2A24 B;  3Q7V B;  5EVI C;  3UB9 A;  1NY0 A;  4M4X A;  3BEC A;  3E4O A;  5EM0 A;  4GCZ A;  3NDG A;  2P74 A;  2O9C A;  2OWJ A;  4R4R A;  2XQZ A;  4XT2 A;  2EX8 A;  4IVK A;  4D60 A;  1XJ6 A;  1GCE A;  4QY6 A;  3F1P A;  5F68 A;  5I5L A;  2J9P A;  3ZG5 A;  2XR0 A;  3HJK A;  4WN5 A;  4HP4 A;  1DP8 A;  3VSK A;  1KGE A;  1GHP A;  2P04 A;  2Z6D A;  3EGD C;  4NXE A;  2KDK A;  3SZT A;  4ZAM A;  1ONG A;  1FCM A;  1D1J A;  3UNW A;  4KZA A;  5IT5 A;  3LI8 A;  3MXQ A;  4P6Z S;  3IX8 A;  2XA7 M;  3T4J A;  4BBU A;  5IHV A;  4HNB A;  4PM7 A;  3BLM A;  4JXG A;  1FIL A;  4H6J A;  1YLP A;  4JLF A;  4A5R A;  1K56 D;  5FI7 A;  1YLT A;  1Z09 A;  4DE2 A;  2C5W B;  2W1T B;  3G4P A;  5G18 A;  1OTE A;  4QY5 A;  2PYR A;  3QNC A;  1XA1 A;  4GB7 A;  3MXS A;  4HIA A;  3WWX A;  1NLZ A;  2WKP A;  3P09 A;  1PW1 A;  2VGL M;  2WKI A;  3G6O A;  3EWK A;  3MS6 A;  5FDH A;  1ESI A;  4R70 A;  1YT4 A;  4ZRR A;  4N1X A;  4F3L A;  1K57 A;  4OPZ A;  1LI9 A;  3ZVT A;  4PM8 A;  4O8G A;  1BLC A;  3BW6 A;  4LGW A;  4UEY A;  3DAV A;  2X71 A;  5EVI A;  3LR4 A;  1S0W A;  5DFY A;  1BUE A;  2PU4 A;  2XLN A;  3S7N A;  3A3J A;  2HP6 A;  4IHQ A;  4LRY C;  1UGU A;  2YKH A;  5KSH A;  3H82 B;  4B4Z A;  2A24 A;  5HDC A;  1L0E A;  4JBF A;  1YM1 A;  5CGW A;  4E3N A;  4ID4 A;  3HJI A;  4MCW A;  5K5B A;  2X01 A;  1SCW A;  2EX6 A;  3T1Q B;  5A93 A;  1FR1 A;  4DXC A;  4S2N C;  2PDR A;  4EXO A;  4RQ9 A;  2G7U A;  3HUO A;  4IUH A;  2GNX A;  2W3E A;  4ZJ1 A;  4GOG A;  3IH8 A;  3S22 A;  3T4K A;  1XFN A;  3WS4 A;  1MC0 A;  2BG1 A;  3BFE A;  4WEL A;  4ETX A;  4ZDX A;  4GNU A;  2W0N A;  1KE3 A;  1SHV A;  2OAP 1;  3UPO A;  5EOE A;  1ES5 A;  3C4P A;  1KVL A;  1E3U A;  2R78 A;  2WAE A;  4OQH A;  1BT5 A;  1FQG A;  3IXB A;  3LEZ A;  4HH3 A;  3G32 A;  1LL5 A;  3HLD A;  4GHI B;  4HQA A;  4EBN A;  2ZLY A;  2HP5 A;  4CQH A;  1YSP A;  4X68 A;  2G2W A;  3CAX A;  5F5Y A;  1PW8 A;  3UB5 P;  4H8R A;  1NRF A;  4EW7 A;  4GD8 A;  4X56 A;  2L1M A;  2W1T A;  2V8C A;  2PD7 A;  2VGJ A;  1DY6 A;  3SOI A;  2ZQ9 A;  4R1G A;  4MN5 A;  1OT6 A;  2ZQ7 A;  1A0K A;  2ZD8 A;  3OOV A;  4IBX A;  4FD8 A;  4HBU A;  3SH8 A;  1O07 A;  4S2K A;  3OC2 A;  5C5K A;  2PRF A;  4ARZ B;  5HPF A;  5FAP A;  3WRZ A;  4CLC B;  4AFI A;  4D2O A;  5A90 A;  4UQI M;  3V50 A;  5EFW A;  1PI5 A;  2V0W A;  2LB5 A;  4G3K A;  3MQQ A;  1TS8 A;  2O99 A;  3M6B A;  4KG5 A;  3GMW A;  4JXW A;  4UAA A;  3QP5 A;  3UMD A;  2VKS A;  3T50 A;  1H8M A;  4FCF A;  3G30 A;  3UE6 A;  5M19 A;  2DRW A;  4S2N A;  5J8X A;  1JWZ A;  4PMA A;  5TFQ A;  3S4X A;  2V1A A;  3C7V A;  3JVV A;  2XGN A;  4HJ3 A;  4KQO A;  3EOI A;  2IWC A;  5GHZ A;  4QHC A;  3PYP A;  2JKR I;  2J3T C;  2HJ9 C;  3UME A;  3NOU C;  4UA9 A;  1W5D A;  5FQM A;  3M2J A;  2LB9 A;  4BBV A;  4EES A;  3KYE A;  3ISG A;  3H7W B;  4MBF A;  3PR6 A;  3UDF A;  2PR6 A;  5CED A;  2IA2 A;  2KOI A;  1WE4 A;  2Y2H A;  1YPR A;  1LSW A;  5F6A A;  4MLL A;  3QP6 A;  2NUT C;  3FPV A;  5DF8 A;  5HD5 A;  1VHM A;  3A3F A;  1IYS A;  1OJ5 A;  4NK3 A;  4KQR A;  3OBF A;  2J3W A;  1FCN A;  1BLS A;  1T1C A;  2VZW A;  3F1O B;  1KDW A;  3GTC A;  3HLC A;  5CX7 A;  3BRM A;  2IWD A;  2Q9N A;  3C7U A;  5A8B A;  4LLO B;  3HCY A;  3KX0 X;  1O7E A;  1ZHH B;  3BY9 A;  1XJ3 A;  3M6H A;  4DE1 A;  4N1H A;  2EX9 A;  3IX3 A;  1HLU P;  3OZH A;  4I38 A;  2INW A;  5DTT A;  3MZD A;  3A0R A;  1D06 A;  3T1S A;  1CF0 A;  3VP2 A;  2J8Y A;  1SKF A;  2QMI A;  2OWH A;  2ZC4 B;  4O0P A;  5DJU A;  4YIN A;  2VLG A;  4X53 A;  1N9O A;  5AQ9 A;  2P9V A;  4Y13 A;  3FC7 A;  3AGD A;  3W4Q A;  3RTY A;  1ERO A;  2O9B A;  4EQ1 A;  2ACG A;  3T4S A;  5MC7 A;  3MBZ A;  3UO9 A;  1ZG6 A;  1XX2 A;  3MMH A;  1CJF A;  2ZC7 A;  1F2K A;  4G3W A;  1G5U A;  2EA9 A;  4EWF A;  4GJ4 A;  4QB8 A;  1ZTU A;  4GS9 B;  4HP9 A;  3NBL A;  4I3A A;  1K0K A;  4EUZ A;  5HSQ A;  5LBR A;  3PBR A;  5HPI A;  2XD1 A;  2ZC5 B;  5EPH A;  4JF5 A;  1PNE A;  2JKG A;  4LV1 A;  1IFQ A;  3O88 A;  3F1N B;  3D3O A;  1E3U D;  1JTG A;  3N8R A;  3VP1 A;  4M3K A;  2UV0 E;  1P0Z A;  3IXH A;  1XGI A;  1L0F A;  3UB7 A;  1Q2P A;  3OPL A;  2HDQ A;  3D9Y A;  4GD6 A;  1I2W A;  4YWZ A;  2FFY A;  3CPT A;  4B4X A;  3UY6 A;  4QWO A;  3KSI A;  1GSW A;  3NOT C;  3CG5 A;  1GHI A;  1FR6 A;  1JNU A;  4Y7P A;  4BWI A;  3BFG A;  1JWP A;  2JKT I;  2YKF A;  4JPM A;  4S2L A;  1KE0 A;  3HRE A;  3IWQ A;  1LT0 A;  2Y2O A;  3LR0 A;  4K0X A;  3QP2 A;  3LGO A;  5EVE A;  2ZQD A;  3C4O A;  3VP4 A;  4OP8 A;  1OME A;  4X25 A;  3LIF A;  5JYO A;  5EVL A;  1WYC A;  2W3F A;  3BQA A;  4B93 A;  3FG8 A;  4JF6 A;  1LSX A;  4N92 A;  1ESU A;  1W7F A;  4OP5 A;  2PR5 A;  4LPZ A;  3OCN A;  2Y2P A;  1TS6 A;  3TW8 A;  3B3X A;  3PBN A;  3ZNT A;  4KG6 A;  2WAF A;  3ZGA B;  3B47 A;  4P6Z M;  4WEJ A;  4MBK A;  2E8J A;  4KUO A;  3A3I A;  4BJP A;  2VV8 A;  3IWO A;  5AJG A;  3A3E A;  3KYZ A;  1XJ4 A;  3IS2 B;  5HDS A;  3NEC A;  1GSV A;  3NY4 A;  3PHY A;  1VET B;  3LUQ A;  5AQ7 A;  3R4K A;  2W3D A;  1CEG A;  2VX8 A;  4PHT A;  2GZA A;  4OPY A;  3BFF A;  1C3B A;  3V39 A;  1F9I A;  4KZ6 A;  2HP9 A;  2Y4A A;  4KZ7 A;  5IS1 A;  3QP1 A;  5EE8 A;  2JHE A;  5CRF A;  5HWT A;  2PBY A;  1NXY A;  4R3B A;  4Q0H A;  3VMA A;  2V1B A;  2W3H A;  2O0Y A;  2HV1 A;  4MMN A;  1YMX A;  3U4L P;  3DTI A;  4ZJ2 A;  1FSW A;  2L4R A;  4Q0J A;  3GSG A;  1V9Y A;  4FH4 A;  2XFS A;  4BBT A;  3VOL A;  1L0G A;  2A3U A;  5F82 A;  4OPR A;  4EU0 A;  1PWC A;  3Q1F A;  1S66 L;  3IBR A;  3IWI A;  4FSF A;  1N4O A;  3W4O A;  3IQA A;  4HEF A;  5AVE A;  3SS3 A;  2HF6 A;  3HLG A;  4LEN A;  3MJQ A;  4CLC D;  5HW3 A;  4XUX A;  3OPP A;  4I3J A;  3WS2 A;  3L7H A;  1P9W A;  2QKP A;  3JVU A;  1RGY A;  2PHY A;  1VEU A;  4B88 A;  3BYD A;  5E2H A;  3IF6 B;  3VE3 A;  2J7V A;  1XFQ A;  3NI9 A;  4PPR A;  1W63 M;  5F83 A;  3EEH A;  2QJ7 A;  3PBS A;  3A0V A;  3HBR A;  5DF9 A;  5F1F A;  1YMS A;  3NCK A;  2EFX A;  5EV0 A;  4Y0O A;  1ES2 A;  4DDS A;  3GQZ A;  1N9B A;  4WLA A;  4OQG A;  1OTA A;  3WRT A;  3IH9 A;  2J3T D;  1LLB A;  1ERQ A;  2WKQ A;  1ES3 A;  5DTS A;  5EEC A;  4GLQ A;  2QZ6 A;  2R9W A;  2WGV A;  3C2W A;  1BLH A;  2PBD P;  4KZ9 A;  3ZNY A;  2EWW A;  1YLW A;  4L9F A;  3FYZ A;  3Q7V A;  2GDN A;  1PIO A;  1TS0 A;  5CGS A;  5FA7 A;  4EUV A;  4KZ8 A;  3PBQ A;  5HDD A;  3FPW A;  3W2Z A;  3SH9 A;  5DKK A;  1U60 A;  2XA7 S;  1RCJ A;  1OTB A;  4RA7 A;  4CLC E;  2VA0 A;  1YSQ A;  5GLA A;  4MBH A;  3GDI A;  1MPL A;  5HAI A;  2WK0 A;  1Z6F A;  1HD8 A;  1XP4 A;  4KG2 A;  3IF5 A;  3NHQ A;  3ZG0 A;  1CEF A;  1UWN X;  3GEC A;  2B02 A;  2EWV A;  4HH2 A;  2QWS A;  4JF4 A;  5A91 A;  2ZM2 A;  2VGL S;  3P01 A;  1DP6 A;  2VV6 A;  3LO7 A;  2DMW A;  2ZM8 A;  5FAO A;  1CI9 A;  5CTM A;  3KSH A;  5FQ9 A;  1VB6 A;  2Y2L A;  4K08 A;  1NYY A;  1BLP A;  3CJM A;  3U2A A;  2QJ5 A;  5HAQ A;  4G3V A;  1KGG A;  4EEP A;  3V3S A;  4OOL A;  4LV3 A;  1NYM A;  4WL9 A;  2EXB A;  4BL2 A;  1YKD A;  2W1R A;  4WBG A;  4Y0U A;  3ITA A;  4NXB A;  4CPK A;  1F5M A;  3MSH A;  3VFF A;  3E2L A;  5EM1 A;  1QME A;  2HGV A;  4EER A;  4HES A;  1OT9 A;  4HJ4 A;  5CHJ A;  4HHD A;  5GL9 A;  4CLC C;  1SDN A;  3JPU A;  3HUN A;  3MQ0 A;  4BLM A;  2HDR A;  3N8S A;  1GA0 A;  3C30 A;  1S6R A;  5GHX A;  1P9R A;  1AWI A;  3H82 A;  3MKE A;  3DBA A;  5TBM B;  1TVF A;  3SH7 A;  4U0X A;  2ZMV A;  3KO6 A;  2RCX A;  5HWV A;  2P08 A;  1W8Y A;  4E3L A;  2B5R A;  5FAT A;  2HDU A;  2OOL A;  5IU1 A;  4Y17 A;  3CWF A;  5DJT A;  2HPB A;  2X02 A;  3GVB A;  1XA7 A;  1IKI A;  2L0W A;  2ZC6 B;  3CI6 A;  1I2S A;  1SKO B;  2H10 A;  3WS0 A;  3IX4 A;  3MZE A;  2EXA A;  5HL6 A;  1G68 A;  2E8I A;  1K4E A;  4L9G A;  4MNR A;  3UE0 A;  1M40 A;  4WZ4 A;  4LRZ E;  1VM1 A;  2HDS A;  4NET A;  4OLD A;  4GHI A;  1TD5 A;  2JKF A;  3VE4 A;  5KZH A;  3ULF A;  2D01 A;  4R6L A;  5CTN A;  3DTK A;  3P98 A;  2CMN A;  4PAU A;  5E2G A;  3CHW P;  1PWD A;  4MDZ A;  4GDN A;  4F94 A;  5L07 A;  3VP0 A;  1ALQ A;  4Z1W A;  3B42 A;  4E04 A;  1I5Q A;  1E25 A;  1IKG A;  4NXF A;  4MEZ A;  4P6B A;  5M1A A;  2Z6C A;  3TJZ C;  4WM9 A;  4R3J A;  4ARZ A;  4X1L A;  4CLC A;  1PWG A;  2XRN A;  4RVA A;  1BTL A;  2Y2J A;  5AQB A;  2WUQ A;  3T4L A;  3IT9 A;  4N9K A;  1DJC A;  5HL1 A;  1H5X A;  3DTM A;  1MWT A;  5EUA A;  1YQS A;  1XKZ A;  2ZMF A;  3MXR A;  2VK3 A;  2RL3 A;  4C6Y A;  2D02 A;  3H9W A;  4BD1 A;  2WGW B;  2XRO A;  2BTF P;  3FWL A;  3VOZ A;  2Y8H A;  1UWP X;  1BUL A;  4KZ5 A;  1PZP A;  3OCL A;  4GW9 A;  1EWZ A;  3HLB A;  5U47 A;  2JN7 A;  1XPB A;  4NKP A;  3IBJ A;  4JXS A;  1MWU A;  1L3L A;  3CIT A;  5TJJ A;  5FSR A;  1IOU A;  5M18 A;  3A3D A;  4HY8 A;  1KDS A;  2W3G A;  1G6A A;  2OSU A;  3H7W A;  4KQD A;  3Q07 A;  4OOY A;  1LSV A;  2WZX A;  1BSG A;  1YLJ A;  4WZ5 C;  1DJB A;  2CC1 A;  3HUM A;  3RXW A;  1T1B A;  1IYP A;  2M7V A;  4BD0 A;  4XT2 B;  3IXD A;  4HI4 A;  4CJN A;  5CGX A;  5AVF A;  3F1P B;  3LIB A;  1NZU A;  4HJ6 A;  4Y15 A;  1H8Y A;  3DW0 A;  3F1O A;  4UA6 A;  4Z9Q A;  5CHM A;  3GV9 A;  3E4P A;  2PYP A;  3E98 A;  3ZVW A;  1NWZ A;  3NUL A;  4DN0 A;  3NOP C;  3QP8 A;  3PAG A;  1HVB A;  1EW0 A;  1H8Z A;  2P7J A;  2ZQA A;  4WEK A;  2Y2M A;  4R38 A;  2ZJ9 A;  2H0T A;  2IWB A;  3O5Y A;  3NJA A;  5AQA A;  2XD5 A;  3BWL A;  5FI6 A;  4DE0 A;  5FQK A;  4H6J B;  2FH5 A;  2VV7 A;  4KZB A;  3V3R A;  4WMC D;  3T1X A;  1K4F A;  1RGZ A;  1FCO A;  2KLI A;  4R0Q A;  2ZBB A;  2V8F A;  4K0W A;  5E2E A;  1KGF A;  4EET B;  4GN2 A;  5EOO A;  2OV5 A;  5TR7 A;  4I39 A;  3BY8 A;  3RH8 B;  2V2F F;  3PXP A;  5L10 A;  4U0T A;  2O9A A;  2VGK A;  4P87 A;  2ZOI A;  2Y91 A;  2ZM0 A;  2Q0O A;  3E4Q A;  2WKR A;  5J3W A; 
#chains in the Genus database with same CATH homology
 4QWO A;  1HLU P;  2JKF A;  1D1J A;  2PAV P;  1ACF A;  3T1Q B;  3CHW P;  2PBD P;  5FDS A;  1PFL A;  3T1S A;  1CF0 A;  3L9K A;  4X1M A;  1VEU B;  1Y4O A;  3U4L P;  1FIL A;  3MSH A;  5EM1 A;  3T1R A;  1Z09 A;  3LGO A;  5EVE A;  1SKO A;  4FUW A;  5FEG A;  4ESP A;  3CPT B;  4X25 A;  1CQA A;  4X1L A;  2ACG A;  1FIK A;  1VET A;  1AWI A;  1CJF A;  3NUL A;  1F2K A;  2B95 A;  3T12 B;  1G5U A;  3KYE A;  1J3W A;  3UB5 P;  3MS6 A;  2ZL1 B;  2HZ5 A;  2V8C A;  1K0K A;  1SZV A;  3LEQ A;  2VK3 A;  1YPR A;  2E8J A;  3L7H A;  3T1X A;  1A0K A;  3DAV A;  5EM0 A;  1SKO B;  1VEU A;  2BTF P;  2V8F A;  1PNE A;  2JKG A;  2PRF A;  1PRQ A;  4D60 A;  3NEC A;  2ZL1 A;  1VET B;  5EV0 A;  5FEF A;  3D9Y A;  4FTX A;  3CPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...