3U4LP

Cryocooled bovine profilin:actin crystal structure to 2.4 a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
139
structure length
139
Chain Sequence
AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVHGGMINKKCYEMASHLRRSQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin, cytoplasmic 1
publication title Structural basis for profilin-mediated actin nucleotide exchange.
pubmed doi rcsb
molecule tags Structural protein
total genus 38
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2011-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3u4lP00
1FIKA 3MS6A 1CQAA 2V8CA 1Y4OA 1YPRA 5EM0A 3T1XA 1PRQA 4FTXA 3D9YA 1VETA 3NECA 4QWOA 1SZVA 3CHWP 1HLUP 2B95A 1SKOB 1VEUA 1PNEA 3NULA 4X1MA 3CPTB 1K0KA 3T1QB 5FDSA 1D1JA 2HZ5A 1PFLA 4FUWA 2JKGA 3L7HA 2BTFP 5EVEA 3U4LP 4X25A 3LEQA 3DAVA 1AWIA 2JKFA 5FEFA 1J3WA 5EM1A 1FILA 3KYEA 3UB5P 3LGOA 1F2KA 4D60A 1CJFA 5FEGA 3L9KA 2PBDP 1VETB 3T1SA 2PAVP 5EV0A 1SKOA 2ZL1A 1VEUB 1G5UA 2ACGA 4X1LA 3CPTA 3T1RA 2E8JA 1ACFA 3MSHA 2PRFA 3T12B 1A0KA 1CF0A 1Z09A 2VK3A 4ESPA 2V8FA 2ZL1B
chains in the Genus database with same CATH superfamily
3LIDA 3VE3A 4OLGA 4WM9A 4E6WA 1Y4OA 4CQHA 5F5YA 3A3EA 2B5RA 3QP5A 1LHYA 3NI9A 3F1PB 5A92A 2ZQCA 4BLMA 3MBZA 3PBRA 4EQ1A 4HIAA 5FAQA 4S2KA 4XUZA 1BTLA 3IX8A 2XA7M 4HI4A 5FDSA 4GB7A 1IYOA 2KX6A 4UA9A 5IS1A 2FFYA 1KGEA 2FH5A 5L09A 4HNBA 2NUPC 3QHYA 3MKFA 2PR6A 4GHIB 5EM1A 1XA1A 3QNBA 1ZG6A 1LI9A 3CUEC 4LRZE 1K4EA 5E2HA 3UDXA 5HZHA 4MMNA 1TVFA 3T50A 2XRNA 1Z6FA 5BOHA 1RGZA 3IWIA 1K55C 3L9KA 1VETB 5AQ9A 2EWWA 3E4OA 3NOPC 5HARA 2B02A 3CPTA 4EESA 4ID4A 3HLGA 3GECA 4N1HA 4WZ4A 3LIAA 3PBOA 2PYPA 3EOIA 4ESPA 4IEDA 5HWWA 4EEPA 1YSQA 1NJ4A 4I3AA 5G18A 4KZBA 3VP2A 1W63Q 3IF6C 1S4SA 4HH2A 4HQAA 5KIZA 4BL2A 4FTXA 1ESIA 1ODVA 4ME4A 1MC0A 3C30A 2ZC7A 2HJEA 3CG5A 4OQIA 1E3UA 4JBFA 3C4PA 4H6JA 3A0RA 2Y2NA 3IHBA 3UPNA 1Q2QA 5M1AA 2ZMFA 3FPWA 5CECA 1PW1A 5F83A 3N6IA 3MKEA 1NLZA 3IS2A 4GJ4A 2HZ5A 2Z6CA 2WADA 2PD8A 2INWA 1K38A 4ZRRA 4BD0A 1YAXA 1MWUA 3K3DA 3T4LA 2OWJA 1K55A 3K3CA 1EWZA 4II7A 4X25A 2GNXA 3DAVA 3E2LA 4OOLA 4E3NA 2YKFA 1X0OA 3P7NA 1EROA 3JPUA 3JVVA 2ZOHA 1L0FA 3UE3A 3LY4A 1CEFA 3LIBA 5EUAA 3MXRA 3FYZA 3H7WA 2ACGA 2ZM0A 3Q07A 4X53A 2W1TB 3ZGAB 4PPRA 3WS5A 4DRTA 3LIFA 1U60A 4R23A 2M1CA 4Y2FA 5DJUA 3O88A 4DXCA 4JGQA 1YMSA 2VJWA 2Y2OA 4GD8A 1GA0A 3MQ0A 4E3IA 3ZCZA 3GQZA 1EI5A 3NHQA 5A93A 3T1XA 1I2WA 2K31A 1LSWA 1OJ5A 3W2ZA 1FCNA 1HD8A 2H0TA 4M3KA 4YOFA 4OP5A 3BEBA 4ZJ1A 5EVIC 1PNEA 3TE8A 1SKFA 1YMXA 4U0TA 5I94A 3A3JA 2CMNA 1W63M 2ZQDA 4I39A 4WEKA 1ZTUA 3IWOA 3IXDA 5FQMA 2XDMA 1NYYA 1STZA 2K2NA 5GL9A 3W4PA 2PU2A 3OPHA 5F69A 1OMEA 4OPZA 1XXMA 3LEQA 2JKFA 3G35A 4GKUA 1P97A 1M40A 2P74A 4IBRA 3BLMA 4UEYA 4UA6A 3C7VA 4S2OA 5M19A 3WS4A 1PI4A 2Y2JA 2DMWA 4DJ3A 2WKQA 1KE4A 2A49A 2RL3A 4MN6A 4YFMA 3LI8A 2ZC3B 4F94A 1DP6A 1S1YA 4P85A 1PI5A 1TD5A 1YM1A 2Z2LB 2XD5A 3HL9A 2H10A 1XP4A 1RGYA 2PDRA 2XF3A 4YNRA 2IA2A 1JNUA 5FASA 2Y2QA 1ZG4A 1F9IA 2ZLYA 2ZL1B 2V1AA 2Y2GA 3CJMA 2J9OA 1TEMA 4LPZA 4IBXA 1GSVA 4BBVA 5C5KA 3N8LA 3B42A 4DE0A 2V1ZA 3A0SA 4Q0IA 4R4SA 3T4SA 5JYPA 2J8YA 2XFSA 1CI8A 3VOZA 3PBQA 4X69A 4LCLA 3OPLA 1FOFA 1CK3A 4HP4A 1H8MA 3HUOA 2ZQAA 5E2GA 1S0WA 3PTEA 1K57C 4ETXA 5EVEA 4RVAA 3C7UA 5G4YA 3S7PA 4Y15A 3FZCA 3O86A 3DW0A 2BLSA 5HSQA 3IH9A 2WGWB 3I7JA 1YLTA 2R78A 1XGIA 3G6OA 3WRTA 2QWSA 4JPMA 1ES3A 3PYPA 4WZ5C 1PWDA 2XK1A 3VP0A 1VEUB 4QU3A 5HD3A 4IHQA 2ZQ9A 5HL6A 1OJGA 4LENA 1Z09A 1T18A 1K6SA 2WZZA 2UWXA 4DE2A 2EX9A 3MMHA 2ZD8A 5FA7A 2V20A 5CHJA 3D72A 4BWIA 5CRFA 1T1AA 2W27A 1TS6A 5F82A 4IJGA 5FQKA 2PD7A 4F3LB 2EFXA 5GHYA 2WZXA 4K0XA 4RQ9A 2Y2LA 1KE3A 4P87A 4PHTA 3BLSA 3OLOA 1DRMA 3H82B 4IVIA 1BLPA 3CZDA 3HUMA 4X1MA 4JXSA 3KSHA 1YQSA 4LRXC 1UWNX 1D1JA 3N7WA 3IX3A 1GA9A 3QP1A 2PU4A 4XXRA 3BECA 4KENB 4O7DA 2OAP1 4KG6A 1XJ4A 3LY3A 3ZNYA 3DWKA 4FD8A 2HP6A 5CX7A 3WS2A 3BJNA 4R70A 3QP6A 4X56A 2OWHA 2VZWA 1IYPA 3VE4A 2I72A 3NDGA 1ONHA 1XFQA 3QP4A 4S2IA 3F1PA 4QB8A 2WKPA 1K56D 2ZMVA 4LFUA 4H8RA 4BQMA 4OPQA 1YLZA 2O99A 2PAVP 3VMAA 4NKPA 2V2FF 3NY4A 1H3QA 3DTKA 2O0YA 1BLHA 1CEGA 4BMWA 5A8BA 4GLQA 1AXBA 2A24B 1JTGA 2H0YA 3V3RA 1YSPA 3BFCA 3RXWA 4Q0JA 1QMFA 1MKMA 3MZFA 1O07A 4GHIA 4OPRA 4LV1A 4KZ7A 4MCWA 4HBTA 2ZM2A 1S67L 3LEZA 5FQQA 5FQIA 3N8RA 1SDEA 4Y5FA 1LSXA 4K0WA 2OV5A 3PBTA 2PYRA 2C6WB 3KSGA 1VETA 4M4XA 4QPRA 3BWLA 5HDSA 1ESUA 3NCKA 4JXVA 3C2WA 4NXFA 4JGRA 3FPVA 1SKOB 3V39A 3EGXC 5HPFA 3CI6A 3TRCA 5CEDA 1SCWA 5GHZA 4JKTA 2ZC6B 3WS1A 3ITBA 2W3GA 4NG2A 4S2NA 1MWSA 2A3UA 5FATA 1WYCA 5EVID 1NYMA 1J3WA 4NXBA 3KSIA 2UV0E 4HJ3A 1OT6A 2VV8A 3S4XA 3E2KA 3LYXA 1PWCA 2W1RA 4LV2A 4KQOA 3D3OA 3EEHA 2XEPA 3E4PA 2PBDP 3IQAA 3T1SA 5A91A 3P01A 2CC1A 1ERQA 2GJ3A 4N9LA 1DJBA 2PRFA 4OOYA 4ZAMA 1H5XA 3GVBA 2R9WA 4HJ6A 4RYEA 3N4IA 5HPIA 5MC7A 2W3EA 5TGFA 1K54C 3OZHA 3RH8B 3SW1A 3GTCA 3ZDJA 1RCJA 3A0VA 4P0MA 4MBKA 4S2JA 4R1GA 5HAPA 5FAOA 4GS9B 5HAIA 3FKWA 2L4RA 5CTMA 3PHYA 2HDSA 4HESA 5AQ7A 3G2ZA 1K4FA 4QWOA 1OTAA 4LCMA 2VEAA 3B3XA 4EUVA 3W4OA 5HL1A 4B88A 3BW6A 5M18A 3R7WA 2XR0A 3P09A 3R4KA 1OTEA 1F5MA 1PFLA 2WGIA 3MJQA 3S1YA 2ZC4B 5AQAA 3VP4A 5GLAA 5K5BA 3EQVA 4I3JA 4Y7PA 1KDSA 4EBLA 3KYEA 5HW3A 1PYYA 4JGPA 4PKYA 4RA7A 4YINA 4BD1A 5FSRA 1P9WA 4MN7A 3WRZA 4D60A 4JXWA 5F68A 1YT4A 3UB6A 2PT7A 4C3QA 2OSUA 3UE1A 3RFBA 1IEMA 4HHDA 4OP8A 5DKLA 4GOGA 4DN0A 1K54A 2OOLA 4CLCC 4EERA 5G4ZA 2NUTC 1FQGA 3UE6A 2EX6A 1TF1A 3SS3A 3F1OB 2EX8A 3NOTC 5EOOA 2ZQ7A 4OPYA 3LICA 3UNWA 3MXQA 3ZG8B 3LI9A 1XGJA 3KX0X 3PR6A 5L8MA 3E4QA 4HH3A 2QPNA 5AJGA 5GLDA 1L2SA 3SH8A 2KDKA 3ITAA 2WAEA 3HLBA 4MNRA 1W7FA 3ZVTA 4U0XA 3KYQA 2QZ6A 2P04A 4DF6A 1UGUA 3P98A 4MLLA 3ICYA 3BY9A 4ETZA 1SZVA 2EFUA 1HTZA 3MXSA 2B95A 4LV3A 4P6ZS 4PKYG 4WYYA 5DVAA 4QY5A 1I2SA 5HD5A 1PZPA 3T1QB 3MQOA 3IX4A 4ARZA 4E3LA 1KGGA 4E3OA 1WE4A 4WMCA 2JKGA 4UQIS 2JN7A 3AGDA 1I5QA 3VFFA 1IKGA 4GW9A 3T4KA 1NWZA 1Y54A 4H6JB 5EECA 2VGKA 1IELA 4GNUA 4L9EA 4OKPA 4CLCA 4NEED 3OC2A 1S1ZA 3W4QA 1DP9A 2J9PA 5D3OA 3IS2B 3MZEA 2Y79A 4ZJ3A 2J3TD 2X01A 5FEGA 5J4EA 3C5AA 2P7JA 3HLCA 1KDWA 3TJZC 1LSVA 3MFDA 5EV0A 3OPRA 4K08A 3ZHHA 4B9OA 2Z2MB 3K2NA 3KYZA 3T12B 1JWZA 5L2FA 3JYIA 3ZFZA 3EGDC 4X55A 5IU1A 3C38A 1JWPA 4OH0A 2RCXA 4KUOA 3HVFA 4JXGA 3MR0A 4R4RA 4GCZA 3VFHA 3T4JA 3A3IA 2O9AA 3HLFA 5L07A 3MS6A 4P6ZM 4JLFA 1HZOA 5EM0A 3IF6B 3HLEA 1BUEA 1GSWA 3S7QA 3NECA 4PAUA 4O01A 3CHWP 5HWVA 4DXBA 4UQIM 1VEUA 3NULA 3O3VA 3UDIA 3GDIA 3OOVA 2Q9NA 2H28A 2XGNA 1XJ3A 2EWVA 1S6RA 5CGSA 1IFQA 2EXBA 2Y2PA 5KMWA 3V50A 1BSGA 2KLIA 2VV6A 3BQAA 5DFXA 1V9ZA 3VSKA 4QY6A 1AWIA 2C5WB 5FEFA 5FI7A 2H5SA 3CWFA 4B93A 5DFYA 4E3KA 5F6AA 4WUJA 2EXAA 4ZDXA 4F3LA 4O0PA 3V5MA 2WKEA 5F1GA 5IHVA 2X02A 3NBLA 3PXPA 3ISGA 3SH7A 4MBHA 4EQIA 4QHCA 3O87A 4O8GA 4HEFA 2EX2A 4EWFA 4DDYA 1DP8A 1E25A 1E3UD 1NRJA 4PM7A 2XQZA 3GSGA 1DJCA 1PIOA 2V8FA 1WYBA 4PM5A 4JF4A 1LT0A 2M7VA 4I5SA 2ZQ8A 4ZBEA 3C4OA 1NRFA 5GHXA 4RX2A 2VA0A 1P0ZA 1BT5A 2Y8HA 4L9FA 1ES5A 2O9CA 4YWZA 3E98A 3DWZA 2MJ6A 1OTDA 5EPHA 3N8SA 5DF7A 1E4DA 4MDZA 5EVIB 1BLSA 5TR7A 1ALQA 2P9VA 4KZ6A 3UO9A 1TS7A 2WKIA 2XFTA 4KQQA 3CLOA 3ZQ5A 5FAPA 3RTYA 2HDRA 4EW7A 1LL9A 2QJ7A 3MFXA 1FILA 4XT2A 4BBTA 3UB5P 4KQDA 3EQUA 4G3KA 1K25A 5L10A 4PM6A 5LBRA 4BL3A 4KZ8A 2PBYA 3TW8A 2Y2KA 1LI0A 4EUZA 3HBRA 1S4RA 1NY0A 2X71A 4Y0OA 2LB9A 2ZC5B 2QMIA 3B47A 5GLBA 4HY8A 1SKOA 1KGFA 4JF5A 3IXGA 2VKSA 1HVBA 1G5UA 4BENA 3T1RA 2HF6A 2HV1A 5KSHA 2V9AA 1H8YA 1YLJA 4WMCD 1OT9A 4E04A 3TOIA 2AVXA 4S2NC 4FCFA 4WN5A 1LL5A 4R3JA 1L0DA 2XD1A 4CLCD 5FI2A 4R38A 4LV0A 2WUQA 3DTMA 3BYDA 1Y28A 4S2LA 2Y2IA 4E6XA 2O9BA 5HAQA 3VP1A 2W0NA 2B18A 3WS0A 1ES2A 3V67A 1SDNA 1L3LA 5TBMB 2Y59A 3BRMA 4LGWA 4GD6A 1MWRA 2GX5A 4MEZA 4GDNA 2I9VA 3SH9A 1BLCA 1XJ2A 5TFQA 3BFGA 3IF5A 2Y4AA 3HLWA 1QMEA 1FCOA 1SHVA 4FH2A 2PR5A 3T4OA 4OLDA 4Y17A 1H8ZA 3NC8A 4GZBA 2HPBA 2JCHA 4LLOB 2IWDA 3LR4A 3BQ8A 3M2KA 1PW8A 3UB9A 1YLPA 3BFDA 4G3WA 4OOMA 4Y0UA 1GSXA 4MBFA 2W3DA 4WF0A 4GS9A 1UWPX 3TSGA 1ERMA 1G6AA 1MZUA 4WL9A 1XPBA 1XA7A 4BJPA 3F1NB 4OONA 3LCEA 3BFEA 2QYBA 2Y2HA 3ULFA 2W3FA 5IT5A 4NETA 3GV9A 4EBNA 1ZC2A 1N9BA 3IXBA 5DF8A 2KOIA 3Q7VB 4KZ5A 1CF0A 1G28A 2DCFA 2V0WA 2FZ0A 3Q81A 1T1BA 1T1CA 2D01A 5CXWA 3UB8A 4A5RA 1N9NA 2XH9A 5CHUA 2Q9MA 2V0UA 3OCLA 5TJJA 3IXHA 4U3TA 3A3DA 3V3SA 4KQRA 1MXOA 2DRWA 1M6KA 2HJ9C 1GHPA 1O7EA 1BYWA 3F1OA 3SS5A 4DE1A 5CEBA 4LRYC 1K0KA 3HCYA 1MKIA 3D4FA 2M7UA 1NXYA 3CMZA 4WBGA 4HJ4A 4KG5A 2J3WA 3ZYTA 3AGFA 3TG9A 3SZTA 3G4PA 4OQGA 3Q1FA 3NDEA 5DKKA 4WLAA 3HJKA 2W1TA 3QP2A 1H0MA 4L9GA 3O5YA 5JYOA 2W3HA 4S2MA 5J7EA 1VB6A 3FWLA 1D06A 4R3BA 2WAFA 4QD4A 4Y0TA 4PM9A 3A3FA 2XSSA 3G32A 3IHAA 3BY8A 3LR5A 1LLBA 1IOUA 2WYXA 3ZG7B 5DTTA 1XKZA 3UN7A 3UE0A 3UY6A 3UMEA 2DNSA 1C3BA 3GMWA 4IUKA 5HFOA 1G68A 4CPKA 3UB7A 3SOIA 5E2FA 4PMAA 2HDUA 4NXGA 4KZ4A 4UAAA 1KE0A 3CUEA 2BASA 4KZAA 4E3MA 2HGVA 3H9WA 3LFVA 3HLDA 2WKHA 5CERA 4X6TA 3DBAA 4EXOA 4OQ0A 2Q0OA 4HOIA 4FOFA 1W79A 3CPTB 2JKRM 4N92A 3FKVA 1GHIA 2ZOIA 1NLYA 2ZBBA 3RXXA 1L0GA 3U4LP 3AGEA 4ZJ2A 2Z6DA 4JF6A 3CAXA 2HP9A 5FL3A 1MY8A 3R7WB 4DMZA 1TS8A 1W5DA 2V1BA 2G7UA 4K91A 2Y2MA 3IF6A 5DTSA 1FCMA 3ZG9B 1CI9A 2IWBA 1WA9A 4I3IA 1BULA 4WELA 4DE3A 2G2WA 1FR6A 3T4QA 2ZL1A 3VOYA 1GCEA 4QJGA 4DKIA 4KZ9A 1XJ6A 1OPXA 5F1FA 4CJNA 5CGWA 2OLVA 3G30A 2LB5A 3IWQA 5KZHA 3EEAA 1N9LA 4IVKA 2L0WA 2Y55A 1ZHHB 3VP3A 3Q7ZA 3SS4A 4NXEA 1K56A 2PHYA 2K7SA 3M2JA 4Y13A 2E8IA 1CQAA 1XFNA 2V8CA 2FFFB 1ZKJA 2JKRI 5EVLA 1OTBA 4EU0A 4HP9A 3IH8A 4KZ3A 5EFWA 3KO6A 3BM6A 4N9KA 4Z9QA 1VM1A 3MF0A 2P08A 3H7WB 3LR3A 4B4ZA 4NK3A 2WGWA 1TDLA 1DY6A 2L1MA 3S22A 1VQQA 3KSFA 3OPPA 4EV4A 2EA9A 4Z1WA 5J3WA 5FQJA 2OAQ1 2BTFP 4DDSA 2G2UA 2XROA 2JC7A 5I5LA 2VGJA 4XUXA 3PAEA 3VV4A 3PBNA 1FSYA 2A2LA 3UMDA 4ARZB 5A90A 3UDFA 1ES4A 3HREA 4GDBA 4Q0HA 4FH4A 4IUHA 1KOUA 3DTEA 4CLCB 5EVIA 4FSFA 2YKHA 2HDQA 2WKRA 3MSHA 2VX8A 5HWTA 4R6LA 3DTIA 1L0EA 1T19A 1TS0A 4GN2A 3LR0A 2VK3A 2IWCA 5DJTA 4HBUA 3ZNTA 5GLCA 3FC7A 1EW0A 5CGXA 3S7OA 1IYSA 1VHMA 5DTKA 3H82A 3WWXA 1FIKA 1PZOA 2JE5A 1YLYA 5E2EA 1DJAA 5U47A 2QHKA 1N9OA 1YPRA 4OVDA 3G31A 1V9YA 4B4XA 3G34A 3FG8A 1PRQA 1JTDA 1FSWA 3IBRA 3M6HA 1J9MA 1W8QA 5KSCA 5HDDA 4WEJA 3CITA 3VOLA 1FR1A 1MBLA 4DJ2A 3LO7A 2R9XA 2WGVA 1ONGA 4CLCE 3ZG5A 5FDHA 4EETB 5EE8A 5HDCA 3NJAA 3RJUA 4Q8IA 2J80A 3UPOA 1XX2A 3GRJA 5CTNA 5E43A 4C75A 1MWTA 4EEUA 1NZOA 1P9RA 1MPLA 3LGOA 1JWVA 2VGLS 5AQBA 5EOEA 4UHUA 4OQHA 4X68A 1KVMA 3E0YA 3W8KA 3PAGA 1KVLA 2ZMAA 1K6RA 1N4OA 3IBJA 5TBMA 2A24A 5AVFA 1IKIA 5J8XA 4G3VA 4Y3IA 4P6BA 4PM8A 3ZVWA 4C6YA 2GDNA 2JKTM 2HP5A 3T4TA 4R0QA 4UA7A 4MN5A 1YLWA 3G2YA 3NOUC 3EWKA 1Q2PA 3S7NA 1K57A 3B33A 4AFIA 3GR2A 3HUNA 2D02A 2VV7A 3MQQA 1LL8A 2JBFA 1JVJA 1G6OA 4D2OA 4S2PA 3MZDA 2Y91A 3PBSA 2J3TC 2BG1A 3F1NA 3UPPA 3D9YA 3Q82A 4KUKA 1OTIA 4N1XA 3FV7A 3BFFA 4RX3A 1F98A 1HLUP 4WZ5A 3OBFA 3QP8A 1RP5A 3U2AA 3Q7VA 5AVEA 4EBPA 5FI6A 2JHEA 2WK0A 2VGLM 4FUWA 3L7HA 1BZAA 3OCNA 3LIEA 4JGOA 3QNCA 1W8YA 1PWGA 3IT9A 2XA7S 1D7EA 3HJIA 2QKPA 1F2KA 2JKTI 2P9VB 1CJFA 5CHMA 1GHMA 1YKDA 4BBUA 1IYQA 3VSLA 3NIAA 1NZUA 4KG2A 2QJ5A 5HX9A 5FQ9A 4E3JA 1TDGA 2ZM8A 4XT2B 4X1LA 2E8JA 1ACFA 4ZTKA 2J7VA 1A0KA 4L0LA 2VLGA 3ZG0A 3M6BA 1S66L 3JVUA 2ZJ9A 2XLNA 2GZAA 4R3AA 4I38A 3C8CA 3LUQA 5DF9A 2OLUA
chains in the Genus database with same CATH topology
1FIKA 3MS6A 1CQAA 2V8CA 1Y4OA 1YPRA 5EM0A 3T1XA 1PRQA 4FTXA 3D9YA 1VETA 3NECA 4QWOA 1SZVA 3CHWP 1HLUP 2B95A 1SKOB 1VEUA 1PNEA 3NULA 4X1MA 3CPTB 1K0KA 3T1QB 5FDSA 1D1JA 2HZ5A 1PFLA 4FUWA 2JKGA 3L7HA 2BTFP 5EVEA 3U4LP 4X25A 3LEQA 3DAVA 1AWIA 2JKFA 5FEFA 1J3WA 5EM1A 1FILA 3KYEA 3UB5P 3LGOA 1F2KA 4D60A 1CJFA 5FEGA 3L9KA 2PBDP 1VETB 3T1SA 2PAVP 5EV0A 1SKOA 2ZL1A 1VEUB 1G5UA 2ACGA 4X1LA 3CPTA 3T1RA 2E8JA 1ACFA 3MSHA 2PRFA 3T12B 1A0KA 1CF0A 1Z09A 2VK3A 4ESPA 2V8FA 2ZL1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIK A;  3MS6 A;  1CQA A;  2V8C A;  1Y4O A;  1YPR A;  5EM0 A;  3T1X A;  1PRQ A;  4FTX A;  3D9Y A;  1VET A;  3NEC A;  4QWO A;  1SZV A;  3CHW P;  1HLU P;  2B95 A;  1SKO B;  1VEU A;  1PNE A;  3NUL A;  4X1M A;  3CPT B;  1K0K A;  3T1Q B;  5FDS A;  1D1J A;  2HZ5 A;  1PFL A;  4FUW A;  2JKG A;  3L7H A;  2BTF P;  5EVE A;  3U4L P;  4X25 A;  3LEQ A;  3DAV A;  1AWI A;  2JKF A;  5FEF A;  1J3W A;  5EM1 A;  1FIL A;  3KYE A;  3UB5 P;  3LGO A;  1F2K A;  4D60 A;  1CJF A;  5FEG A;  3L9K A;  2PBD P;  1VET B;  3T1S A;  2PAV P;  5EV0 A;  1SKO A;  2ZL1 A;  1VEU B;  1G5U A;  2ACG A;  4X1L A;  3CPT A;  3T1R A;  2E8J A;  1ACF A;  3MSH A;  2PRF A;  3T12 B;  1A0K A;  1CF0 A;  1Z09 A;  2VK3 A;  4ESP A;  2V8F A;  2ZL1 B; 
#chains in the Genus database with same CATH topology
 3LID A;  3VE3 A;  4OLG A;  4WM9 A;  4E6W A;  1Y4O A;  4CQH A;  5F5Y A;  3A3E A;  2B5R A;  3QP5 A;  1LHY A;  3NI9 A;  3F1P B;  5A92 A;  2ZQC A;  4BLM A;  3MBZ A;  3PBR A;  4EQ1 A;  4HIA A;  5FAQ A;  4S2K A;  4XUZ A;  1BTL A;  3IX8 A;  2XA7 M;  4HI4 A;  5FDS A;  4GB7 A;  1IYO A;  2KX6 A;  4UA9 A;  5IS1 A;  2FFY A;  1KGE A;  2FH5 A;  5L09 A;  4HNB A;  2NUP C;  3QHY A;  3MKF A;  2PR6 A;  4GHI B;  5EM1 A;  1XA1 A;  3QNB A;  1ZG6 A;  1LI9 A;  3CUE C;  4LRZ E;  1K4E A;  5E2H A;  3UDX A;  5HZH A;  4MMN A;  1TVF A;  3T50 A;  2XRN A;  1Z6F A;  5BOH A;  1RGZ A;  3IWI A;  1K55 C;  3L9K A;  1VET B;  5AQ9 A;  2EWW A;  3E4O A;  3NOP C;  5HAR A;  2B02 A;  3CPT A;  4EES A;  4ID4 A;  3HLG A;  3GEC A;  4N1H A;  4WZ4 A;  3LIA A;  3PBO A;  2PYP A;  3EOI A;  4ESP A;  4IED A;  5HWW A;  4EEP A;  1YSQ A;  1NJ4 A;  4I3A A;  5G18 A;  4KZB A;  3VP2 A;  1W63 Q;  3IF6 C;  1S4S A;  4HH2 A;  4HQA A;  5KIZ A;  4BL2 A;  4FTX A;  1ESI A;  1ODV A;  4ME4 A;  1MC0 A;  3C30 A;  2ZC7 A;  2HJE A;  3CG5 A;  4OQI A;  1E3U A;  4JBF A;  3C4P A;  4H6J A;  3A0R A;  2Y2N A;  3IHB A;  3UPN A;  1Q2Q A;  5M1A A;  2ZMF A;  3FPW A;  5CEC A;  1PW1 A;  5F83 A;  3N6I A;  3MKE A;  1NLZ A;  3IS2 A;  4GJ4 A;  2HZ5 A;  2Z6C A;  2WAD A;  2PD8 A;  2INW A;  1K38 A;  4ZRR A;  4BD0 A;  1YAX A;  1MWU A;  3K3D A;  3T4L A;  2OWJ A;  1K55 A;  3K3C A;  1EWZ A;  4II7 A;  4X25 A;  2GNX A;  3DAV A;  3E2L A;  4OOL A;  4E3N A;  2YKF A;  1X0O A;  3P7N A;  1ERO A;  3JPU A;  3JVV A;  2ZOH A;  1L0F A;  3UE3 A;  3LY4 A;  1CEF A;  3LIB A;  5EUA A;  3MXR A;  3FYZ A;  3H7W A;  2ACG A;  2ZM0 A;  3Q07 A;  4X53 A;  2W1T B;  3ZGA B;  4PPR A;  3WS5 A;  4DRT A;  3LIF A;  1U60 A;  4R23 A;  2M1C A;  4Y2F A;  5DJU A;  3O88 A;  4DXC A;  4JGQ A;  1YMS A;  2VJW A;  2Y2O A;  4GD8 A;  1GA0 A;  3MQ0 A;  4E3I A;  3ZCZ A;  3GQZ A;  1EI5 A;  3NHQ A;  5A93 A;  3T1X A;  1I2W A;  2K31 A;  1LSW A;  1OJ5 A;  3W2Z A;  1FCN A;  1HD8 A;  2H0T A;  4M3K A;  4YOF A;  4OP5 A;  3BEB A;  4ZJ1 A;  5EVI C;  1PNE A;  3TE8 A;  1SKF A;  1YMX A;  4U0T A;  5I94 A;  3A3J A;  2CMN A;  1W63 M;  2ZQD A;  4I39 A;  4WEK A;  1ZTU A;  3IWO A;  3IXD A;  5FQM A;  2XDM A;  1NYY A;  1STZ A;  2K2N A;  5GL9 A;  3W4P A;  2PU2 A;  3OPH A;  5F69 A;  1OME A;  4OPZ A;  1XXM A;  3LEQ A;  2JKF A;  3G35 A;  4GKU A;  1P97 A;  1M40 A;  2P74 A;  4IBR A;  3BLM A;  4UEY A;  4UA6 A;  3C7V A;  4S2O A;  5M19 A;  3WS4 A;  1PI4 A;  2Y2J A;  2DMW A;  4DJ3 A;  2WKQ A;  1KE4 A;  2A49 A;  2RL3 A;  4MN6 A;  4YFM A;  3LI8 A;  2ZC3 B;  4F94 A;  1DP6 A;  1S1Y A;  4P85 A;  1PI5 A;  1TD5 A;  1YM1 A;  2Z2L B;  2XD5 A;  3HL9 A;  2H10 A;  1XP4 A;  1RGY A;  2PDR A;  2XF3 A;  4YNR A;  2IA2 A;  1JNU A;  5FAS A;  2Y2Q A;  1ZG4 A;  1F9I A;  2ZLY A;  2ZL1 B;  2V1A A;  2Y2G A;  3CJM A;  2J9O A;  1TEM A;  4LPZ A;  4IBX A;  1GSV A;  4BBV A;  5C5K A;  3N8L A;  3B42 A;  4DE0 A;  2V1Z A;  3A0S A;  4Q0I A;  4R4S A;  3T4S A;  5JYP A;  2J8Y A;  2XFS A;  1CI8 A;  3VOZ A;  3PBQ A;  4X69 A;  4LCL A;  3OPL A;  1FOF A;  1CK3 A;  4HP4 A;  1H8M A;  3HUO A;  2ZQA A;  5E2G A;  1S0W A;  3PTE A;  1K57 C;  4ETX A;  5EVE A;  4RVA A;  3C7U A;  5G4Y A;  3S7P A;  4Y15 A;  3FZC A;  3O86 A;  3DW0 A;  2BLS A;  5HSQ A;  3IH9 A;  2WGW B;  3I7J A;  1YLT A;  2R78 A;  1XGI A;  3G6O A;  3WRT A;  2QWS A;  4JPM A;  1ES3 A;  3PYP A;  4WZ5 C;  1PWD A;  2XK1 A;  3VP0 A;  1VEU B;  4QU3 A;  5HD3 A;  4IHQ A;  2ZQ9 A;  5HL6 A;  1OJG A;  4LEN A;  1Z09 A;  1T18 A;  1K6S A;  2WZZ A;  2UWX A;  4DE2 A;  2EX9 A;  3MMH A;  2ZD8 A;  5FA7 A;  2V20 A;  5CHJ A;  3D72 A;  4BWI A;  5CRF A;  1T1A A;  2W27 A;  1TS6 A;  5F82 A;  4IJG A;  5FQK A;  2PD7 A;  4F3L B;  2EFX A;  5GHY A;  2WZX A;  4K0X A;  4RQ9 A;  2Y2L A;  1KE3 A;  4P87 A;  4PHT A;  3BLS A;  3OLO A;  1DRM A;  3H82 B;  4IVI A;  1BLP A;  3CZD A;  3HUM A;  4X1M A;  4JXS A;  3KSH A;  1YQS A;  4LRX C;  1UWN X;  1D1J A;  3N7W A;  3IX3 A;  1GA9 A;  3QP1 A;  2PU4 A;  4XXR A;  3BEC A;  4KEN B;  4O7D A;  2OAP 1;  4KG6 A;  1XJ4 A;  3LY3 A;  3ZNY A;  3DWK A;  4FD8 A;  2HP6 A;  5CX7 A;  3WS2 A;  3BJN A;  4R70 A;  3QP6 A;  4X56 A;  2OWH A;  2VZW A;  1IYP A;  3VE4 A;  2I72 A;  3NDG A;  1ONH A;  1XFQ A;  3QP4 A;  4S2I A;  3F1P A;  4QB8 A;  2WKP A;  1K56 D;  2ZMV A;  4LFU A;  4H8R A;  4BQM A;  4OPQ A;  1YLZ A;  2O99 A;  2PAV P;  3VMA A;  4NKP A;  2V2F F;  3NY4 A;  1H3Q A;  3DTK A;  2O0Y A;  1BLH A;  1CEG A;  4BMW A;  5A8B A;  4GLQ A;  1AXB A;  2A24 B;  1JTG A;  2H0Y A;  3V3R A;  1YSP A;  3BFC A;  3RXW A;  4Q0J A;  1QMF A;  1MKM A;  3MZF A;  1O07 A;  4GHI A;  4OPR A;  4LV1 A;  4KZ7 A;  4MCW A;  4HBT A;  2ZM2 A;  1S67 L;  3LEZ A;  5FQQ A;  5FQI A;  3N8R A;  1SDE A;  4Y5F A;  1LSX A;  4K0W A;  2OV5 A;  3PBT A;  2PYR A;  2C6W B;  3KSG A;  1VET A;  4M4X A;  4QPR A;  3BWL A;  5HDS A;  1ESU A;  3NCK A;  4JXV A;  3C2W A;  4NXF A;  4JGR A;  3FPV A;  1SKO B;  3V39 A;  3EGX C;  5HPF A;  3CI6 A;  3TRC A;  5CED A;  1SCW A;  5GHZ A;  4JKT A;  2ZC6 B;  3WS1 A;  3ITB A;  2W3G A;  4NG2 A;  4S2N A;  1MWS A;  2A3U A;  5FAT A;  1WYC A;  5EVI D;  1NYM A;  1J3W A;  4NXB A;  3KSI A;  2UV0 E;  4HJ3 A;  1OT6 A;  2VV8 A;  3S4X A;  3E2K A;  3LYX A;  1PWC A;  2W1R A;  4LV2 A;  4KQO A;  3D3O A;  3EEH A;  2XEP A;  3E4P A;  2PBD P;  3IQA A;  3T1S A;  5A91 A;  3P01 A;  2CC1 A;  1ERQ A;  2GJ3 A;  4N9L A;  1DJB A;  2PRF A;  4OOY A;  4ZAM A;  1H5X A;  3GVB A;  2R9W A;  4HJ6 A;  4RYE A;  3N4I A;  5HPI A;  5MC7 A;  2W3E A;  5TGF A;  1K54 C;  3OZH A;  3RH8 B;  3SW1 A;  3GTC A;  3ZDJ A;  1RCJ A;  3A0V A;  4P0M A;  4MBK A;  4S2J A;  4R1G A;  5HAP A;  5FAO A;  4GS9 B;  5HAI A;  3FKW A;  2L4R A;  5CTM A;  3PHY A;  2HDS A;  4HES A;  5AQ7 A;  3G2Z A;  1K4F A;  4QWO A;  1OTA A;  4LCM A;  2VEA A;  3B3X A;  4EUV A;  3W4O A;  5HL1 A;  4B88 A;  3BW6 A;  5M18 A;  3R7W A;  2XR0 A;  3P09 A;  3R4K A;  1OTE A;  1F5M A;  1PFL A;  2WGI A;  3MJQ A;  3S1Y A;  2ZC4 B;  5AQA A;  3VP4 A;  5GLA A;  5K5B A;  3EQV A;  4I3J A;  4Y7P A;  1KDS A;  4EBL A;  3KYE A;  5HW3 A;  1PYY A;  4JGP A;  4PKY A;  4RA7 A;  4YIN A;  4BD1 A;  5FSR A;  1P9W A;  4MN7 A;  3WRZ A;  4D60 A;  4JXW A;  5F68 A;  1YT4 A;  3UB6 A;  2PT7 A;  4C3Q A;  2OSU A;  3UE1 A;  3RFB A;  1IEM A;  4HHD A;  4OP8 A;  5DKL A;  4GOG A;  4DN0 A;  1K54 A;  2OOL A;  4CLC C;  4EER A;  5G4Z A;  2NUT C;  1FQG A;  3UE6 A;  2EX6 A;  1TF1 A;  3SS3 A;  3F1O B;  2EX8 A;  3NOT C;  5EOO A;  2ZQ7 A;  4OPY A;  3LIC A;  3UNW A;  3MXQ A;  3ZG8 B;  3LI9 A;  1XGJ A;  3KX0 X;  3PR6 A;  5L8M A;  3E4Q A;  4HH3 A;  2QPN A;  5AJG A;  5GLD A;  1L2S A;  3SH8 A;  2KDK A;  3ITA A;  2WAE A;  3HLB A;  4MNR A;  1W7F A;  3ZVT A;  4U0X A;  3KYQ A;  2QZ6 A;  2P04 A;  4DF6 A;  1UGU A;  3P98 A;  4MLL A;  3ICY A;  3BY9 A;  4ETZ A;  1SZV A;  2EFU A;  1HTZ A;  3MXS A;  2B95 A;  4LV3 A;  4P6Z S;  4PKY G;  4WYY A;  5DVA A;  4QY5 A;  1I2S A;  5HD5 A;  1PZP A;  3T1Q B;  3MQO A;  3IX4 A;  4ARZ A;  4E3L A;  1KGG A;  4E3O A;  1WE4 A;  4WMC A;  2JKG A;  4UQI S;  2JN7 A;  3AGD A;  1I5Q A;  3VFF A;  1IKG A;  4GW9 A;  3T4K A;  1NWZ A;  1Y54 A;  4H6J B;  5EEC A;  2VGK A;  1IEL A;  4GNU A;  4L9E A;  4OKP A;  4CLC A;  4NEE D;  3OC2 A;  1S1Z A;  3W4Q A;  1DP9 A;  2J9P A;  5D3O A;  3IS2 B;  3MZE A;  2Y79 A;  4ZJ3 A;  2J3T D;  2X01 A;  5FEG A;  5J4E A;  3C5A A;  2P7J A;  3HLC A;  1KDW A;  3TJZ C;  1LSV A;  3MFD A;  5EV0 A;  3OPR A;  4K08 A;  3ZHH A;  4B9O A;  2Z2M B;  3K2N A;  3KYZ A;  3T12 B;  1JWZ A;  5L2F A;  3JYI A;  3ZFZ A;  3EGD C;  4X55 A;  5IU1 A;  3C38 A;  1JWP A;  4OH0 A;  2RCX A;  4KUO A;  3HVF A;  4JXG A;  3MR0 A;  4R4R A;  4GCZ A;  3VFH A;  3T4J A;  3A3I A;  2O9A A;  3HLF A;  5L07 A;  3MS6 A;  4P6Z M;  4JLF A;  1HZO A;  5EM0 A;  3IF6 B;  3HLE A;  1BUE A;  1GSW A;  3S7Q A;  3NEC A;  4PAU A;  4O01 A;  3CHW P;  5HWV A;  4DXB A;  4UQI M;  1VEU A;  3NUL A;  3O3V A;  3UDI A;  3GDI A;  3OOV A;  2Q9N A;  2H28 A;  2XGN A;  1XJ3 A;  2EWV A;  1S6R A;  5CGS A;  1IFQ A;  2EXB A;  2Y2P A;  5KMW A;  3V50 A;  1BSG A;  2KLI A;  2VV6 A;  3BQA A;  5DFX A;  1V9Z A;  3VSK A;  4QY6 A;  1AWI A;  2C5W B;  5FEF A;  5FI7 A;  2H5S A;  3CWF A;  4B93 A;  5DFY A;  4E3K A;  5F6A A;  4WUJ A;  2EXA A;  4ZDX A;  4F3L A;  4O0P A;  3V5M A;  2WKE A;  5F1G A;  5IHV A;  2X02 A;  3NBL A;  3PXP A;  3ISG A;  3SH7 A;  4MBH A;  4EQI A;  4QHC A;  3O87 A;  4O8G A;  4HEF A;  2EX2 A;  4EWF A;  4DDY A;  1DP8 A;  1E25 A;  1E3U D;  1NRJ A;  4PM7 A;  2XQZ A;  3GSG A;  1DJC A;  1PIO A;  2V8F A;  1WYB A;  4PM5 A;  4JF4 A;  1LT0 A;  2M7V A;  4I5S A;  2ZQ8 A;  4ZBE A;  3C4O A;  1NRF A;  5GHX A;  4RX2 A;  2VA0 A;  1P0Z A;  1BT5 A;  2Y8H A;  4L9F A;  1ES5 A;  2O9C A;  4YWZ A;  3E98 A;  3DWZ A;  2MJ6 A;  1OTD A;  5EPH A;  3N8S A;  5DF7 A;  1E4D A;  4MDZ A;  5EVI B;  1BLS A;  5TR7 A;  1ALQ A;  2P9V A;  4KZ6 A;  3UO9 A;  1TS7 A;  2WKI A;  2XFT A;  4KQQ A;  3CLO A;  3ZQ5 A;  5FAP A;  3RTY A;  2HDR A;  4EW7 A;  1LL9 A;  2QJ7 A;  3MFX A;  1FIL A;  4XT2 A;  4BBT A;  3UB5 P;  4KQD A;  3EQU A;  4G3K A;  1K25 A;  5L10 A;  4PM6 A;  5LBR A;  4BL3 A;  4KZ8 A;  2PBY A;  3TW8 A;  2Y2K A;  1LI0 A;  4EUZ A;  3HBR A;  1S4R A;  1NY0 A;  2X71 A;  4Y0O A;  2LB9 A;  2ZC5 B;  2QMI A;  3B47 A;  5GLB A;  4HY8 A;  1SKO A;  1KGF A;  4JF5 A;  3IXG A;  2VKS A;  1HVB A;  1G5U A;  4BEN A;  3T1R A;  2HF6 A;  2HV1 A;  5KSH A;  2V9A A;  1H8Y A;  1YLJ A;  4WMC D;  1OT9 A;  4E04 A;  3TOI A;  2AVX A;  4S2N C;  4FCF A;  4WN5 A;  1LL5 A;  4R3J A;  1L0D A;  2XD1 A;  4CLC D;  5FI2 A;  4R38 A;  4LV0 A;  2WUQ A;  3DTM A;  3BYD A;  1Y28 A;  4S2L A;  2Y2I A;  4E6X A;  2O9B A;  5HAQ A;  3VP1 A;  2W0N A;  2B18 A;  3WS0 A;  1ES2 A;  3V67 A;  1SDN A;  1L3L A;  5TBM B;  2Y59 A;  3BRM A;  4LGW A;  4GD6 A;  1MWR A;  2GX5 A;  4MEZ A;  4GDN A;  2I9V A;  3SH9 A;  1BLC A;  1XJ2 A;  5TFQ A;  3BFG A;  3IF5 A;  2Y4A A;  3HLW A;  1QME A;  1FCO A;  1SHV A;  4FH2 A;  2PR5 A;  3T4O A;  4OLD A;  4Y17 A;  1H8Z A;  3NC8 A;  4GZB A;  2HPB A;  2JCH A;  4LLO B;  2IWD A;  3LR4 A;  3BQ8 A;  3M2K A;  1PW8 A;  3UB9 A;  1YLP A;  3BFD A;  4G3W A;  4OOM A;  4Y0U A;  1GSX A;  4MBF A;  2W3D A;  4WF0 A;  4GS9 A;  1UWP X;  3TSG A;  1ERM A;  1G6A A;  1MZU A;  4WL9 A;  1XPB A;  1XA7 A;  4BJP A;  3F1N B;  4OON A;  3LCE A;  3BFE A;  2QYB A;  2Y2H A;  3ULF A;  2W3F A;  5IT5 A;  4NET A;  3GV9 A;  4EBN A;  1ZC2 A;  1N9B A;  3IXB A;  5DF8 A;  2KOI A;  3Q7V B;  4KZ5 A;  1CF0 A;  1G28 A;  2DCF A;  2V0W A;  2FZ0 A;  3Q81 A;  1T1B A;  1T1C A;  2D01 A;  5CXW A;  3UB8 A;  4A5R A;  1N9N A;  2XH9 A;  5CHU A;  2Q9M A;  2V0U A;  3OCL A;  5TJJ A;  3IXH A;  4U3T A;  3A3D A;  3V3S A;  4KQR A;  1MXO A;  2DRW A;  1M6K A;  2HJ9 C;  1GHP A;  1O7E A;  1BYW A;  3F1O A;  3SS5 A;  4DE1 A;  5CEB A;  4LRY C;  1K0K A;  3HCY A;  1MKI A;  3D4F A;  2M7U A;  1NXY A;  3CMZ A;  4WBG A;  4HJ4 A;  4KG5 A;  2J3W A;  3ZYT A;  3AGF A;  3TG9 A;  3SZT A;  3G4P A;  4OQG A;  3Q1F A;  3NDE A;  5DKK A;  4WLA A;  3HJK A;  2W1T A;  3QP2 A;  1H0M A;  4L9G A;  3O5Y A;  5JYO A;  2W3H A;  4S2M A;  5J7E A;  1VB6 A;  3FWL A;  1D06 A;  4R3B A;  2WAF A;  4QD4 A;  4Y0T A;  4PM9 A;  3A3F A;  2XSS A;  3G32 A;  3IHA A;  3BY8 A;  3LR5 A;  1LLB A;  1IOU A;  2WYX A;  3ZG7 B;  5DTT A;  1XKZ A;  3UN7 A;  3UE0 A;  3UY6 A;  3UME A;  2DNS A;  1C3B A;  3GMW A;  4IUK A;  5HFO A;  1G68 A;  4CPK A;  3UB7 A;  3SOI A;  5E2F A;  4PMA A;  2HDU A;  4NXG A;  4KZ4 A;  4UAA A;  1KE0 A;  3CUE A;  2BAS A;  4KZA A;  4E3M A;  2HGV A;  3H9W A;  3LFV A;  3HLD A;  2WKH A;  5CER A;  4X6T A;  3DBA A;  4EXO A;  4OQ0 A;  2Q0O A;  4HOI A;  4FOF A;  1W79 A;  3CPT B;  2JKR M;  4N92 A;  3FKV A;  1GHI A;  2ZOI A;  1NLY A;  2ZBB A;  3RXX A;  1L0G A;  3U4L P;  3AGE A;  4ZJ2 A;  2Z6D A;  4JF6 A;  3CAX A;  2HP9 A;  5FL3 A;  1MY8 A;  3R7W B;  4DMZ A;  1TS8 A;  1W5D A;  2V1B A;  2G7U A;  4K91 A;  2Y2M A;  3IF6 A;  5DTS A;  1FCM A;  3ZG9 B;  1CI9 A;  2IWB A;  1WA9 A;  4I3I A;  1BUL A;  4WEL A;  4DE3 A;  2G2W A;  1FR6 A;  3T4Q A;  2ZL1 A;  3VOY A;  1GCE A;  4QJG A;  4DKI A;  4KZ9 A;  1XJ6 A;  1OPX A;  5F1F A;  4CJN A;  5CGW A;  2OLV A;  3G30 A;  2LB5 A;  3IWQ A;  5KZH A;  3EEA A;  1N9L A;  4IVK A;  2L0W A;  2Y55 A;  1ZHH B;  3VP3 A;  3Q7Z A;  3SS4 A;  4NXE A;  1K56 A;  2PHY A;  2K7S A;  3M2J A;  4Y13 A;  2E8I A;  1CQA A;  1XFN A;  2V8C A;  2FFF B;  1ZKJ A;  2JKR I;  5EVL A;  1OTB A;  4EU0 A;  4HP9 A;  3IH8 A;  4KZ3 A;  5EFW A;  3KO6 A;  3BM6 A;  4N9K A;  4Z9Q A;  1VM1 A;  3MF0 A;  2P08 A;  3H7W B;  3LR3 A;  4B4Z A;  4NK3 A;  2WGW A;  1TDL A;  1DY6 A;  2L1M A;  3S22 A;  1VQQ A;  3KSF A;  3OPP A;  4EV4 A;  2EA9 A;  4Z1W A;  5J3W A;  5FQJ A;  2OAQ 1;  2BTF P;  4DDS A;  2G2U A;  2XRO A;  2JC7 A;  5I5L A;  2VGJ A;  4XUX A;  3PAE A;  3VV4 A;  3PBN A;  1FSY A;  2A2L A;  3UMD A;  4ARZ B;  5A90 A;  3UDF A;  1ES4 A;  3HRE A;  4GDB A;  4Q0H A;  4FH4 A;  4IUH A;  1KOU A;  3DTE A;  4CLC B;  5EVI A;  4FSF A;  2YKH A;  2HDQ A;  2WKR A;  3MSH A;  2VX8 A;  5HWT A;  4R6L A;  3DTI A;  1L0E A;  1T19 A;  1TS0 A;  4GN2 A;  3LR0 A;  2VK3 A;  2IWC A;  5DJT A;  4HBU A;  3ZNT A;  5GLC A;  3FC7 A;  1EW0 A;  5CGX A;  3S7O A;  1IYS A;  1VHM A;  5DTK A;  3H82 A;  3WWX A;  1FIK A;  1PZO A;  2JE5 A;  1YLY A;  5E2E A;  1DJA A;  5U47 A;  2QHK A;  1N9O A;  1YPR A;  4OVD A;  3G31 A;  1V9Y A;  4B4X A;  3G34 A;  3FG8 A;  1PRQ A;  1JTD A;  1FSW A;  3IBR A;  3M6H A;  1J9M A;  1W8Q A;  5KSC A;  5HDD A;  4WEJ A;  3CIT A;  3VOL A;  1FR1 A;  1MBL A;  4DJ2 A;  3LO7 A;  2R9X A;  2WGV A;  1ONG A;  4CLC E;  3ZG5 A;  5FDH A;  4EET B;  5EE8 A;  5HDC A;  3NJA A;  3RJU A;  4Q8I A;  2J80 A;  3UPO A;  1XX2 A;  3GRJ A;  5CTN A;  5E43 A;  4C75 A;  1MWT A;  4EEU A;  1NZO A;  1P9R A;  1MPL A;  3LGO A;  1JWV A;  2VGL S;  5AQB A;  5EOE A;  4UHU A;  4OQH A;  4X68 A;  1KVM A;  3E0Y A;  3W8K A;  3PAG A;  1KVL A;  2ZMA A;  1K6R A;  1N4O A;  3IBJ A;  5TBM A;  2A24 A;  5AVF A;  1IKI A;  5J8X A;  4G3V A;  4Y3I A;  4P6B A;  4PM8 A;  3ZVW A;  4C6Y A;  2GDN A;  2JKT M;  2HP5 A;  3T4T A;  4R0Q A;  4UA7 A;  4MN5 A;  1YLW A;  3G2Y A;  3NOU C;  3EWK A;  1Q2P A;  3S7N A;  1K57 A;  3B33 A;  4AFI A;  3GR2 A;  3HUN A;  2D02 A;  2VV7 A;  3MQQ A;  1LL8 A;  2JBF A;  1JVJ A;  1G6O A;  4D2O A;  4S2P A;  3MZD A;  2Y91 A;  3PBS A;  2J3T C;  2BG1 A;  3F1N A;  3UPP A;  3D9Y A;  3Q82 A;  4KUK A;  1OTI A;  4N1X A;  3FV7 A;  3BFF A;  4RX3 A;  1F98 A;  1HLU P;  4WZ5 A;  3OBF A;  3QP8 A;  1RP5 A;  3U2A A;  3Q7V A;  5AVE A;  4EBP A;  5FI6 A;  2JHE A;  2WK0 A;  2VGL M;  4FUW A;  3L7H A;  1BZA A;  3OCN A;  3LIE A;  4JGO A;  3QNC A;  1W8Y A;  1PWG A;  3IT9 A;  2XA7 S;  1D7E A;  3HJI A;  2QKP A;  1F2K A;  2JKT I;  2P9V B;  1CJF A;  5CHM A;  1GHM A;  1YKD A;  4BBU A;  1IYQ A;  3VSL A;  3NIA A;  1NZU A;  4KG2 A;  2QJ5 A;  5HX9 A;  5FQ9 A;  4E3J A;  1TDG A;  2ZM8 A;  4XT2 B;  4X1L A;  2E8J A;  1ACF A;  4ZTK A;  2J7V A;  1A0K A;  4L0L A;  2VLG A;  3ZG0 A;  3M6B A;  1S66 L;  3JVU A;  2ZJ9 A;  2XLN A;  2GZA A;  4R3A A;  4I38 A;  3C8C A;  3LUQ A;  5DF9 A;  2OLU A; 
#chains in the Genus database with same CATH homology
 1FIK A;  3MS6 A;  1CQA A;  2V8C A;  1Y4O A;  1YPR A;  5EM0 A;  3T1X A;  1PRQ A;  4FTX A;  3D9Y A;  1VET A;  3NEC A;  4QWO A;  1SZV A;  3CHW P;  1HLU P;  2B95 A;  1SKO B;  1VEU A;  1PNE A;  3NUL A;  4X1M A;  3CPT B;  1K0K A;  3T1Q B;  5FDS A;  1D1J A;  2HZ5 A;  1PFL A;  4FUW A;  2JKG A;  3L7H A;  2BTF P;  5EVE A;  3U4L P;  4X25 A;  3LEQ A;  3DAV A;  1AWI A;  2JKF A;  5FEF A;  1J3W A;  5EM1 A;  1FIL A;  3KYE A;  3UB5 P;  3LGO A;  1F2K A;  4D60 A;  1CJF A;  5FEG A;  3L9K A;  2PBD P;  1VET B;  3T1S A;  2PAV P;  5EV0 A;  1SKO A;  2ZL1 A;  1VEU B;  1G5U A;  2ACG A;  4X1L A;  3CPT A;  3T1R A;  2E8J A;  1ACF A;  3MSH A;  2PRF A;  3T12 B;  1A0K A;  1CF0 A;  1Z09 A;  2VK3 A;  4ESP A;  2V8F A;  2ZL1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...