3U4LP

Cryocooled bovine profilin:actin crystal structure to 2.4 a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
139
structure length
139
Chain Sequence
b'AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVHGGMINKKCYEMASHLRRSQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin, cytoplasmic 1
publication title Structural basis for profilin-mediated actin nucleotide exchange.
pubmed doi rcsb
molecule tags Structural protein
total genus 38
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2011-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3u4lP00
3T1RA 3KYEA 1Z09A 1FILA 4X25A 1A0KA 3MS6A 1PFLA 1K0KA 2ZL1A 4X1MA 2BTFP 3U4LP 5FEGA 5FEFA 1VETB 2VK3A 1F2KA 3L7HA 1HLUP 2JKGA 3L9KA 4FUWA 3LEQA 3CPTB 2PRFA 1VEUB 1G5UA 2E8JA 2V8FA 1SZVA 5FDSA 1SKOB 1VETA 1AWIA 3D9YA 4ESPA 3NULA 4D60A 1D1JA 3MSHA 3T1XA 3CPTA 1PNEA 1PRQA 1VEUA 2HZ5A 3UB5P 5EV0A 2PAVP 1J3WA 1SKOA 1CF0A 1CQAA 5EM0A 5EM1A 4X1LA 1ACFA 4FTXA 1CJFA 5EVEA 3T12B 3NECA 3CHWP 2JKFA 2PBDP 3DAVA 2V8CA 1FIKA 2ACGA 1Y4OA 4QWOA 3LGOA 1YPRA 3T1QB 2ZL1B 3T1SA 2B95A
chains in the Genus database with same CATH superfamily
1PIOA 3ZYTA 4MN6A 3OC2A 4R23A 4BQMA 3LICA 4JXWA 3MFDA 2P9VB 2X71A 4Y17A 5IT5A 1IYQA 4DRTA 2ZQ7A 1KVMA 3BLMA 2L1MA 3PHYA 3IXGA 2BTFP 3VV4A 3U4LP 4GZBA 1SDEA 1IFQA 3KSGA 1KE0A 3GV9A 3MXRA 4PHTA 3LEQA 3IX3A 4LLOB 2J9OA 4PPRA 2QJ5A 5F82A 4KG6A 2ZM0A 4HP9A 3MZEA 1JWZA 1O07A 3UPNA 3CPTA 1XP4A 2NUTC 1YT4A 2PD7A 4ZBEA 4NXBA 1N9BA 4BBUA 2OWHA 1LL5A 3IHAA 3ITAA 3IT9A 3I7JA 2DMWA 1H3QA 4R0QA 1NRJA 2Y79A 1KVLA 1ERMA 2GX5A 4IBRA 2XDMA 4DJ2A 1LSVA 1OTDA 3BFDA 2K7SA 3HLEA 2J8YA 4MN5A 1KOUA 3C2WA 4P0MA 2M7UA 5HX9A 2ZL1B 2EFXA 1XA7A 5D3OA 1L0FA 1C3BA 3HLWA 5FQMA 2VJWA 3MFXA 4HNBA 4FCFA 3SS3A 3HLGA 4S2IA 2UV0E 5FATA 3A3DA 1YLJA 3ZG9B 4GD8A 4X6TA 1P9RA 1K0KA 1IOUA 1BTLA 1ONHA 3S4XA 5HAPA 1IKIA 5HWWA 3HVFA 1L0DA 4OLDA 1DJCA 4EQIA 5EVLA 3L7HA 2M7VA 4GHIA 3BRMA 2EA9A 4Y3IA 4X55A 5EUAA 3VOLA 5AQBA 4JXVA 1DY6A 4WZ5C 1LHYA 4P85A 3BFCA 2PHYA 1FR6A 1RP5A 2HDRA 4E3KA 4N9LA 2YKFA 2WKEA 5DTTA 1EW0A 3CAXA 1L3LA 1DJBA 5LBRA 5G4ZA 4QB8A 2XQZA 1TD5A 4BENA 5CGSA 1ZC2A 3FG8A 3EGDC 4GOGA 1W63M 3NHQA 3RXWA 2OV5A 1DJAA 5M18A 2WGIA 5DJUA 3VP2A 3VSKA 1QMEA 2EWVA 5FDHA 4B9OA 1H8ZA 3P09A 3FPVA 2V8CA 3QP5A 3G2ZA 1YKDA 5TJJA 1TF1A 4UQIM 5EPHA 2BLSA 4ID4A 4II7A 1TS6A 1M40A 1MXOA 2QMIA 4BD0A 1PWDA 4RQ9A 1KE3A 2Q9NA 3OOVA 2W1TB 4LFUA 4M4XA 3MXSA 1S0WA 4P87A 5KSHA 4S2PA 4R1GA 3M6BA 1ODVA 3H9WA 1KDSA 5E43A 5EECA 5FI2A 3TG9A 1HLUP 3HBRA 1CK3A 3NDEA 1VB6A 3LY3A 2L4RA 2ZC7A 2ZQ8A 3LIFA 4OQIA 3LIDA 4EBNA 1MWSA 4OVDA 1GA9A 3ZG8B 4ARZB 5F5YA 3G35A 3MSHA 4XXRA 5AVFA 2GDNA 2KDKA 1PW8A 3BQ8A 4K91A 4PM9A 3W4OA 4DXCA 1JWVA 3GSGA 4DXBA 3RJUA 3HREA 2V1BA 1XJ6A 3ZDJA 4Q8IA 3E4QA 2HJEA 1FOFA 4K08A 3LR0A 3CHWP 1VQQA 1HVBA 1IEMA 1WE4A 3K2NA 4FH2A 2JCHA 4KZ7A 2ZC3B 2V1AA 1FIKA 1I5QA 3D72A 1BLPA 4WL9A 3N7WA 5CHMA 1BZAA 3T1QB 1I2WA 3CJMA 3LO7A 4DDYA 2B95A 2PDRA 3UB7A 4UA7A 1KGGA 1VHMA 3PBNA 4PM8A 4I3IA 3SW1A 2ZJ9A 2I72A 3HLBA 2WAEA 5U47A 3MS6A 1PFLA 1MPLA 4Y13A 2EFUA 3NIAA 4MDZA 1H5XA 1PWCA 4N9KA 4HP4A 4BWIA 5CEBA 1JWPA 4R4RA 1JTDA 3WS0A 3WS2A 3VP4A 4C6YA 1HTZA 4L9GA 1T19A 3Q7VA 3FC7A 1E25A 4PKYG 1NRFA 1RGZA 3IF6C 1Y28A 5CHJA 3ZFZA 4WMCD 4E3OA 3H7WA 4WBGA 3M2KA 4E3IA 1W7FA 3NOTC 2C5WB 3G32A 3QNBA 4HEFA 4PM6A 4Z9QA 1KGFA 4I3JA 2OAP1 1NYYA 3IXDA 3NJAA 3ZG7B 4KZBA 2A24B 2B18A 1G6OA 4GKUA 2IWBA 4JF4A 3NECA 3M2JA 1PYYA 3KSHA 1GHPA 3VP1A 4EEPA 5TBMA 4OQ0A 4RX2A 3EEHA 4KG2A 2ZMVA 1P97A 3H82A 3V67A 5HL1A 3OPRA 4LCLA 4K0XA 1XGIA 2ZMAA 3IF6B 2G2UA 2OSUA 4NEED 4WZ4A 3MMHA 4G3VA 2G2WA 4B93A 2Y55A 1K6SA 2I9VA 3QHYA 2J3TC 4Q0JA 3IBJA 5IU1A 3QNCA 4QY5A 4E3LA 3ITBA 2EXAA 3SZTA 4F3LB 3Q7ZA 2W3EA 4BMWA 2B5RA 2DCFA 1W8QA 3MZDA 1MKIA 4MBFA 2K2NA 5GLDA 5FQIA 3V39A 1DP8A 4Y7PA 3PBRA 1DRMA 3QP4A 4JLFA 5DJTA 3IH9A 4BLMA 3WS4A 1WYBA 3DTIA 4GD6A 3ICYA 4ESPA 3NULA 2O9AA 5BOHA 1MWUA 4JF5A 4FH4A 5HDSA 3TW8A 3WRZA 4NK3A 1VEUA 4KQOA 3S7NA 1F98A 1TEMA 3S7QA 3CZDA 1CQAA 2CMNA 3BWLA 1OJGA 3BFFA 3N6IA 3IS2B 1YSPA 5HWVA 2VZWA 3O5YA 3PXPA 5TGFA 3OBFA 1K54C 3ZNYA 4GHIB 4S2NA 3DAVA 4ZAMA 1LL8A 1N4OA 2Z6CA 1YPRA 5I5LA 2JN7A 3G4PA 3RH8B 4HIAA 4MBHA 5L07A 2KX6A 5J3WA 1F5MA 3W2ZA 2ZQDA 1T1CA 3T4TA 1TS8A 5J8XA 1LSXA 5CTNA 3K3DA 1LT0A 2XA7M 4UA9A 4LV2A 3HLFA 2JKGA 3AGDA 3L9KA 4KZ8A 3UB9A 3VP3A 3GMWA 1BLHA 4DJ3A 5DKLA 3N4IA 5AQ7A 2A3UA 2PRFA 5L8MA 5IHVA 4GS9A 5FDSA 3B3XA 1VETA 3PTEA 1ALQA 2ZC4B 5EVIB 2P04A 4H6JB 5FQ9A 1PNEA 3UPPA 4XT2B 1PRQA 4QHCA 2PAVP 1E3UD 2WKHA 1FQGA 4JXGA 3P01A 5HDCA 1RCJA 3KSIA 2XA7S 4YINA 2ZQAA 2C6WB 4OOYA 5JYOA 5A92A 3HL9A 1GHMA 3LIEA 2EX6A 3TJZC 4FTXA 2MJ6A 2CC1A 3TRCA 3UDFA 5CX7A 1O7EA 4CJNA 5F6AA 1S67L 3R7WB 2HDUA 3C8CA 4MLLA 1IELA 4JGPA 4ZJ1A 1SCWA 2L0WA 1K57A 5GHYA 2XF3A 5DF9A 5DVAA 3C5AA 3OCLA 2PT7A 2XFTA 4EBPA 1UGUA 3C30A 2WADA 4O0PA 5GLBA 1HD8A 2EXBA 5GHXA 1K4EA 4WMCA 1MWTA 3UMDA 2VGJA 5FEGA 4LGWA 3IBRA 4OOMA 3FKWA 5DFYA 4GCZA 1OJ5A 2GZAA 2OOLA 1XJ3A 4PKYA 2PBYA 3VP0A 4HI4A 2VV7A 3VFFA 3BY8A 1D06A 3SH9A 2JE5A 1K38A 4RVAA 4WEJA 2QHKA 3LIBA 2YKHA 2K31A 5DKKA 4LV0A 5HDDA 4BBVA 3F1OA 3F1PB 1TVFA 1Q2QA 2O0YA 4NXFA 5HPFA 5HZHA 5MC7A 5DTKA 3UB5P 4EUVA 4IVIA 4HBTA 4UA6A 1J3WA 3BLSA 3W8KA 3DTKA 1ERQA 4RX3A 4OPYA 3C7UA 3VE4A 4C3QA 1G68A 1WA9A 3TSGA 2G7UA 1YMSA 3O88A 2WGVA 3Q82A 4JGQA 4DMZA 4O7DA 2FFFB 2DRWA 3UDIA 1XPBA 4O01A 2V0UA 2Y59A 3MQQA 1NLYA 3P98A 1CEGA 3FWLA 3Q1FA 4LENA 3DTEA 3A3IA 3O87A 4CLCC 3OPPA 1OTBA 4QU3A 4GJ4A 1EI5A 4S2LA 3IF5A 1RGYA 1V9ZA 4WELA 3GTCA 3B33A 2A49A 3ISGA 5FA7A 1W8YA 1N9LA 3KX0X 4I39A 5J4EA 3S22A 1F9IA 4HJ3A 1FCMA 3PBQA 3WS5A 4DE2A 2VGLS 5FI6A 3EEAA 2P9VA 2VKSA 2PD8A 5FL3A 3IWIA 4BD1A 2OLVA 1BLSA 4X53A 2HDQA 3OPLA 3CITA 4CLCB 4LRYC 2Y2MA 4QPRA 2XRNA 3GR2A 5E2EA 2UWXA 4XUXA 1OT9A 3FPWA 3CUEA 3HUNA 2R9XA 4GDBA 2XFSA 2QKPA 2WGWB 2BASA 4A5RA 4YFMA 1ACFA 3MQ0A 5KZHA 3PYPA 3IX4A 3LR3A 2Z2MB 2X02A 2J3WA 5FASA 5M1AA 2OAQ1 3LI8A 3Q07A 3ZVTA 1U60A 4Y15A 2NUPC 4HHDA 1XX2A 4EERA 5EOEA 2DNSA 1QMFA 1K55A 4KQQA 1GSWA 5DFXA 4NG2A 3AGFA 3GDIA 3LEZA 3GRJA 1FILA 1TS7A 2HF6A 2ZL1A 4YOFA 3A3FA 5A93A 1KDWA 4S2MA 4WEKA 1K25A 1E3UA 4P6ZM 3T4SA 4E6WA 1TDGA 1FCNA 2FZ0A 3MXQA 3E98A 2KLIA 3LCEA 4ETZA 1W79A 1ESUA 2GNXA 4WYYA 4MCWA 2WKRA 3S7OA 3O3VA 4L9FA 4R3JA 3GVBA 1SKFA 3WWXA 2E8JA 2RL3A 2WZXA 1SKOB 4R70A 1KGEA 2QWSA 4ZTKA 3D9YA 4EESA 4KG5A 1D1JA 4LPZA 2H0TA 2WK0A 4NXEA 3A0SA 2IA2A 3T1XA 5AVEA 3ZG5A 4B4ZA 1JTGA 1XA1A 4EBLA 4KQDA 4JXSA 5EV0A 2QJ7A 3LYXA 3O86A 1UWNX 4P6ZS 5EM1A 3N8RA 1LI0A 2Y4AA 4FSFA 4DE1A 3EWKA 2HP5A 4ZDXA 3BW6A 4GB7A 3UB8A 4NETA 2R9WA 1N9OA 3OCNA 1G28A 4P6BA 4EV4A 4JBFA 2O9CA 3JYIA 2W3HA 1H0MA 1ESIA 4MMNA 2PU4A 3LY4A 3G30A 4H8RA 3T50A 2V20A 1H8MA 5A8BA 4WLAA 3WRTA 3T1RA 3S7PA 4WZ5A 5AJGA 3NI9A 2Y2HA 2Y2LA 2XLNA 1OPXA 2HJ9C 1YM1A 1S6RA 3FYZA 3EGXC 3V3SA 1ZG6A 5L10A 3ZHHA 1YQSA 2J3TD 2KOIA 3BECA 1Q2PA 2Z6DA 5FEFA 3MBZA 1J9MA 4Y0UA 3ZG0A 4Q0HA 4OKPA 4GLQA 3F1NA 2W1TA 3UE0A 2HP6A 3CPTB 3OPHA 4WM9A 3VMAA 4C75A 4PM7A 5CGXA 2ZM2A 4WUJA 4PAUA 1SZVA 5G4YA 4D60A 2ZOIA 1MY8A 2H28A 4QY6A 3KYQA 2JC7A 2V2FF 2ZM8A 1XJ2A 4KZ3A 1S4RA 3UMEA 1CF0A 4ARZA 5J7EA 1XFQA 1GSXA 3JPUA 4MEZA 2V0WA 4I3AA 5C5KA 5AQ9A 5L09A 3VE3A 2JKFA 4KQRA 3A0RA 4RA7A 4PMAA 3JVUA 1BLCA 4QWOA 4ZJ3A 1AXBA 1PZPA 4GDNA 1GA0A 2E8IA 4IHQA 5CECA 3UNWA 3NCKA 3RFBA 5GHZA 2ZLYA 4L0LA 5EVID 2Y2PA 3LUQA 4R6LA 5FQJA 2XH9A 4B88A 3MKEA 2Y8HA 1L0GA 2B02A 3EQVA 1ES2A 2H5SA 2W3FA 2J9PA 4R4SA 2W0NA 4OLGA 1E4DA 5KIZA 4DN0A 1FSWA 1FSYA 2VA0A 1G5UA 5FQQA 2ZMFA 1AWIA 1YAXA 2D02A 1MZUA 5CEDA 2ZBBA 3UE3A 2RCXA 4IJGA 4YWZA 1NJ4A 4OQHA 4JPMA 4E3MA 3NOPC 1UWPX 5CXWA 3MKFA 3IWQA 3U2AA 4Y0OA 2LB9A 4QJGA 2Y2NA 4DDSA 1T1BA 4R38A 1BULA 2XROA 3BYDA 3C7VA 2XK1A 5AQAA 3LR4A 1DP6A 1CI9A 2JHEA 3SS5A 4Y5FA 3QP6A 3P7NA 4R3AA 2FFYA 4PM5A 3SS4A 2A24A 1FCOA 3JVVA 1YLYA 1STZA 2QZ6A 4G3WA 2XD5A 1PI5A 5HARA 1K55C 3ULFA 2WUQA 1A0KA 4DKIA 1V9YA 4OPRA 3IF6A 3MR0A 2J7VA 2Y2JA 3BJNA 3KSFA 4OQGA 1MKMA 4OPZA 2HGVA 1JNUA 2QPNA 4KZ6A 4OH0A 3V5MA 4ZRRA 3V3RA 5KSCA 2ZC5B 2EX8A 3TOIA 3ZVWA 2J80A 3DWZA 3QP8A 1IYPA 3PR6A 5HAQA 4R3BA 1ES5A 3MZFA 4GNUA 4MN7A 4F3LA 2D01A 3HLCA 1IKGA 4JKTA 5GL9A 3T4QA 4FOFA 2WKPA 3B42A 4KENB 3PAEA 3DWKA 3Q81A 1X0OA 3WS1A 3UPOA 2ZD8A 4L9EA 3KO6A 3CI6A 3C38A 2VV6A 1YSQA 4CQHA 3FV7A 3VOZA 3SOIA 5GLCA 5HWTA 2PR5A 4LCMA 4EEUA 4X1LA 3T12B 2XGNA 3UO9A 2H0YA 3PBOA 2Y2KA 1PZOA 1ES3A 3IS2A 3IHBA 1CI8A 1YMXA 1EWZA 3GQZA 4E6XA 1K56D 1PI4A 1PW1A 3BFGA 1Z09A 4AFIA 2ZC6B 2W3DA 5FSRA 4HQAA 2VGLM 4OPQA 1T1AA 4WN5A 5FAOA 3C4OA 5HSQA 1LLBA 4CLCD 3QP1A 1KE4A 3IX8A 3NY4A 1ZG4A 4X1MA 2INWA 5FQKA 5HW3A 5M19A 2Y2QA 3Q7VB 2VK3A 3NBLA 1IYSA 1MWRA 1IYOA 4GW9A 5IS1A 1K4FA 1S1YA 3MJQA 3AGEA 3MF0A 3DTMA 4QD4A 1NWZA 4BJPA 3UY6A 3LFVA 5DF8A 2IWCA 1XFNA 1D7EA 3UE6A 3H7WB 4B4XA 1GHIA 3CG5A 5CERA 2W27A 1OTEA 3VOYA 3B47A 1K54A 3E4OA 5F1FA 4KUOA 3KYZA 1LSWA 4D2OA 1S4SA 1OTIA 4N92A 1T18A 2HZ5A 3V50A 4DF6A 5F69A 2PYPA 3BEBA 1P0ZA 5TBMB 4JGOA 1L2SA 5EVIA 2HDSA 3UN7A 1SDNA 2Z2LB 3H82B 4LRXC 3W4PA 4H6JA 3CLOA 3BY9A 4XT2A 4HY8A 4E3NA 4HESA 4HJ6A 5E2HA 4F94A 4EUZA 3IH8A 3F1NB 4LRZE 5A90A 4EWFA 5HAIA 4KZAA 5CRFA 3T1SA 1OTAA 2AVXA 3TE8A 4JGRA 1ES4A 4MBKA 4Q0IA 3D4FA 2HP9A 3R7WA 3G31A 4IVKA 2ZQ9A 1W5DA 2ZOHA 4X25A 4EU0A 4UAAA 2JKTI 4RYEA 4UQIS 2PYRA 3HJKA 3OZHA 4ETXA 4E04A 5F68A 4S2NC 4LV1A 2JKRI 3HUMA 1LL9A 3NOUC 4DE3A 1XKZA 3HLDA 3OLOA 3EOIA 2R78A 2V1ZA 4NXGA 5DF7A 4BL2A 3MQOA 2M1CA 2EX9A 3E4PA 4BL3A 5F83A 3VSLA 2BG1A 1VEUB 2JBFA 3A3EA 3N8SA 1OMEA 2GJ3A 4M3KA 3BQAA 4O8GA 3HCYA 4I38A 2QYBA 2VX8A 4G3KA 3T4LA 1ONGA 1P9WA 1LI9A 1W63Q 4OONA 3LR5A 5HD3A 4NKPA 4U0XA 3F1PA 2P74A 1ZTUA 4EQ1A 4KZ4A 3ZGAB 1CJFA 4IBXA 2XEPA 4Y2FA 5EVEA 4JF6A 5EOOA 4CLCE 2HV1A 5E2GA 3IXHA 1NZUA 4IUKA 3HJIA 4N1HA 5A91A 4EXOA 4K0WA 1NZOA 1Y4OA 3E2LA 4LV3A 1PWGA 5F1GA 2O99A 5DTSA 5HL6A 3KYEA 3T4JA 2IWDA 3ZNTA 1MC0A 4FD8A 1HZOA 1G6AA 1BUEA 1YLZA 4X56A 1WYCA 5CTMA 1ZKJA 1GSVA 5EFWA 1XJ4A 2FH5A 5JYPA 3SH8A 2PR6A 1FR1A 4HH3A 3E0YA 3DBAA 1YLTA 1NYMA 3G6OA 5GLAA 4DE0A 3IXBA 4XUZA 1CEFA 1Z6FA 4GN2A 3S1YA 4GS9B 2LB5A 5L2FA 1VETB 5TR7A 1NLZA 1NY0A 1L0EA 3T4OA 4FUWA 1K57C 4U0TA 4WF0A 5TFQA 2Q9MA 5CHUA 2VEAA 2Y2OA 4S2KA 3UDXA 3E2KA 3PBSA 3A0VA 2PU2A 1TS0A 1XGJA 4YNRA 3BFEA 1GCEA 5KMWA 3M6HA 1YLPA 1K56A 3CMZA 4OP8A 4UHUA 3G34A 2WAFA 3NC8A 2W1RA 3UE1A 4ME4A 2Y2IA 3RXXA 5HFOA 3DW0A 3HUOA 5CGWA 4MNRA 1XXMA 3BM6A 5EM0A 4CLCA 1DP9A 5HPIA 4EETB 3QP2A 2A2LA 3UB6A 4IUHA 2WZZA 1M6KA 2Q0OA 3IQAA 3IWOA 1H8YA 2WKQA 3SH7A 2P7JA 1YLWA 1EROA 1MBLA 4KZ5A 4ZJ2A 2ZQCA 1BT5A 4Z1WA 3FZCA 2WGWA 4EW7A 2JKTM 2EX2A 1OT6A 2XD1A 3VFHA 1TDLA 2JKRM 1SHVA 3LIAA 4Y0TA 2EWWA 5E2FA 2Y91A 3GECA 1S1ZA 3G2YA 2W3GA 3N8LA 2WKIA 1N9NA 4BBTA 3R4KA 2HPBA 3PAGA 5G18A 1ZHHB 1F2KA 3W4QA 3F1OB 1K6RA 1VM1A 3A3JA 3FKVA 2OWJA 4OOLA 3T4KA 4U3TA 3EQUA 2XR0A 2P08A 5EE8A 4UEYA 3RTYA 2OLUA 2V8FA 4OP5A 5FAQA 3CWFA 4KZ9A 3PBTA 2VGKA 2VLGA 3ZQ5A 2V9AA 1JVJA 4X68A 1Y54A 2XSSA 4S2JA 1BSGA 4E3JA 4HBUA 1I2SA 2WYXA 4KUKA 4HOIA 1S66L 4IEDA 5I94A 3ZCZA 1SKOA 3D3OA 1NXYA 5HD5A 3NDGA 4S2OA 4I5SA 4CPKA 2O9BA 5EVIC 5K5BA 3C4PA 4HJ4A 2PBDP 3K3CA 1BYWA 3LI9A 2X01A 2ACGA 4N1XA 4X69A 2Y2GA 2VV8A 5FAPA 3LGOA 2H10A 5FI7A 4HH2A 3CUEC
chains in the Genus database with same CATH topology
3T1RA 3KYEA 1Z09A 1FILA 4X25A 1A0KA 3MS6A 1PFLA 1K0KA 2ZL1A 4X1MA 2BTFP 3U4LP 5FEGA 5FEFA 1VETB 2VK3A 1F2KA 3L7HA 1HLUP 2JKGA 3L9KA 4FUWA 3LEQA 3CPTB 2PRFA 1VEUB 1G5UA 2E8JA 2V8FA 1SZVA 5FDSA 1SKOB 1VETA 1AWIA 3D9YA 4ESPA 3NULA 4D60A 1D1JA 3MSHA 3T1XA 3CPTA 1PNEA 1PRQA 1VEUA 2HZ5A 3UB5P 5EV0A 2PAVP 1J3WA 1SKOA 1CF0A 1CQAA 5EM0A 5EM1A 4X1LA 1ACFA 4FTXA 1CJFA 5EVEA 3T12B 3NECA 3CHWP 2JKFA 2PBDP 3DAVA 2V8CA 1FIKA 2ACGA 1Y4OA 4QWOA 3LGOA 1YPRA 3T1QB 2ZL1B 3T1SA 2B95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1R A;  3KYE A;  1Z09 A;  1FIL A;  4X25 A;  1A0K A;  3MS6 A;  1PFL A;  1K0K A;  2ZL1 A;  4X1M A;  2BTF P;  3U4L P;  5FEG A;  5FEF A;  1VET B;  2VK3 A;  1F2K A;  3L7H A;  1HLU P;  2JKG A;  3L9K A;  4FUW A;  3LEQ A;  3CPT B;  2PRF A;  1VEU B;  1G5U A;  2E8J A;  2V8F A;  1SZV A;  5FDS A;  1SKO B;  1VET A;  1AWI A;  3D9Y A;  4ESP A;  3NUL A;  4D60 A;  1D1J A;  3MSH A;  3T1X A;  3CPT A;  1PNE A;  1PRQ A;  1VEU A;  2HZ5 A;  3UB5 P;  5EV0 A;  2PAV P;  1J3W A;  1SKO A;  1CF0 A;  1CQA A;  5EM0 A;  5EM1 A;  4X1L A;  1ACF A;  4FTX A;  1CJF A;  5EVE A;  3T12 B;  3NEC A;  3CHW P;  2JKF A;  2PBD P;  3DAV A;  2V8C A;  1FIK A;  2ACG A;  1Y4O A;  4QWO A;  3LGO A;  1YPR A;  3T1Q B;  2ZL1 B;  3T1S A;  2B95 A; 
#chains in the Genus database with same CATH topology
 1PIO A;  3ZYT A;  4MN6 A;  3OC2 A;  4R23 A;  4BQM A;  3LIC A;  4JXW A;  3MFD A;  2P9V B;  2X71 A;  4Y17 A;  5IT5 A;  1IYQ A;  4DRT A;  2ZQ7 A;  1KVM A;  3BLM A;  2L1M A;  3PHY A;  3IXG A;  2BTF P;  3VV4 A;  3U4L P;  4GZB A;  1SDE A;  1IFQ A;  3KSG A;  1KE0 A;  3GV9 A;  3MXR A;  4PHT A;  3LEQ A;  3IX3 A;  4LLO B;  2J9O A;  4PPR A;  2QJ5 A;  5F82 A;  4KG6 A;  2ZM0 A;  4HP9 A;  3MZE A;  1JWZ A;  1O07 A;  3UPN A;  3CPT A;  1XP4 A;  2NUT C;  1YT4 A;  2PD7 A;  4ZBE A;  4NXB A;  1N9B A;  4BBU A;  2OWH A;  1LL5 A;  3IHA A;  3ITA A;  3IT9 A;  3I7J A;  2DMW A;  1H3Q A;  4R0Q A;  1NRJ A;  2Y79 A;  1KVL A;  1ERM A;  2GX5 A;  4IBR A;  2XDM A;  4DJ2 A;  1LSV A;  1OTD A;  3BFD A;  2K7S A;  3HLE A;  2J8Y A;  4MN5 A;  1KOU A;  3C2W A;  4P0M A;  2M7U A;  5HX9 A;  2ZL1 B;  2EFX A;  1XA7 A;  5D3O A;  1L0F A;  1C3B A;  3HLW A;  5FQM A;  2VJW A;  3MFX A;  4HNB A;  4FCF A;  3SS3 A;  3HLG A;  4S2I A;  2UV0 E;  5FAT A;  3A3D A;  1YLJ A;  3ZG9 B;  4GD8 A;  4X6T A;  1P9R A;  1K0K A;  1IOU A;  1BTL A;  1ONH A;  3S4X A;  5HAP A;  1IKI A;  5HWW A;  3HVF A;  1L0D A;  4OLD A;  1DJC A;  4EQI A;  5EVL A;  3L7H A;  2M7V A;  4GHI A;  3BRM A;  2EA9 A;  4Y3I A;  4X55 A;  5EUA A;  3VOL A;  5AQB A;  4JXV A;  1DY6 A;  4WZ5 C;  1LHY A;  4P85 A;  3BFC A;  2PHY A;  1FR6 A;  1RP5 A;  2HDR A;  4E3K A;  4N9L A;  2YKF A;  2WKE A;  5DTT A;  1EW0 A;  3CAX A;  1L3L A;  1DJB A;  5LBR A;  5G4Z A;  4QB8 A;  2XQZ A;  1TD5 A;  4BEN A;  5CGS A;  1ZC2 A;  3FG8 A;  3EGD C;  4GOG A;  1W63 M;  3NHQ A;  3RXW A;  2OV5 A;  1DJA A;  5M18 A;  2WGI A;  5DJU A;  3VP2 A;  3VSK A;  1QME A;  2EWV A;  5FDH A;  4B9O A;  1H8Z A;  3P09 A;  3FPV A;  2V8C A;  3QP5 A;  3G2Z A;  1YKD A;  5TJJ A;  1TF1 A;  4UQI M;  5EPH A;  2BLS A;  4ID4 A;  4II7 A;  1TS6 A;  1M40 A;  1MXO A;  2QMI A;  4BD0 A;  1PWD A;  4RQ9 A;  1KE3 A;  2Q9N A;  3OOV A;  2W1T B;  4LFU A;  4M4X A;  3MXS A;  1S0W A;  4P87 A;  5KSH A;  4S2P A;  4R1G A;  3M6B A;  1ODV A;  3H9W A;  1KDS A;  5E43 A;  5EEC A;  5FI2 A;  3TG9 A;  1HLU P;  3HBR A;  1CK3 A;  3NDE A;  1VB6 A;  3LY3 A;  2L4R A;  2ZC7 A;  2ZQ8 A;  3LIF A;  4OQI A;  3LID A;  4EBN A;  1MWS A;  4OVD A;  1GA9 A;  3ZG8 B;  4ARZ B;  5F5Y A;  3G35 A;  3MSH A;  4XXR A;  5AVF A;  2GDN A;  2KDK A;  1PW8 A;  3BQ8 A;  4K91 A;  4PM9 A;  3W4O A;  4DXC A;  1JWV A;  3GSG A;  4DXB A;  3RJU A;  3HRE A;  2V1B A;  1XJ6 A;  3ZDJ A;  4Q8I A;  3E4Q A;  2HJE A;  1FOF A;  4K08 A;  3LR0 A;  3CHW P;  1VQQ A;  1HVB A;  1IEM A;  1WE4 A;  3K2N A;  4FH2 A;  2JCH A;  4KZ7 A;  2ZC3 B;  2V1A A;  1FIK A;  1I5Q A;  3D72 A;  1BLP A;  4WL9 A;  3N7W A;  5CHM A;  1BZA A;  3T1Q B;  1I2W A;  3CJM A;  3LO7 A;  4DDY A;  2B95 A;  2PDR A;  3UB7 A;  4UA7 A;  1KGG A;  1VHM A;  3PBN A;  4PM8 A;  4I3I A;  3SW1 A;  2ZJ9 A;  2I72 A;  3HLB A;  2WAE A;  5U47 A;  3MS6 A;  1PFL A;  1MPL A;  4Y13 A;  2EFU A;  3NIA A;  4MDZ A;  1H5X A;  1PWC A;  4N9K A;  4HP4 A;  4BWI A;  5CEB A;  1JWP A;  4R4R A;  1JTD A;  3WS0 A;  3WS2 A;  3VP4 A;  4C6Y A;  1HTZ A;  4L9G A;  1T19 A;  3Q7V A;  3FC7 A;  1E25 A;  4PKY G;  1NRF A;  1RGZ A;  3IF6 C;  1Y28 A;  5CHJ A;  3ZFZ A;  4WMC D;  4E3O A;  3H7W A;  4WBG A;  3M2K A;  4E3I A;  1W7F A;  3NOT C;  2C5W B;  3G32 A;  3QNB A;  4HEF A;  4PM6 A;  4Z9Q A;  1KGF A;  4I3J A;  2OAP 1;  1NYY A;  3IXD A;  3NJA A;  3ZG7 B;  4KZB A;  2A24 B;  2B18 A;  1G6O A;  4GKU A;  2IWB A;  4JF4 A;  3NEC A;  3M2J A;  1PYY A;  3KSH A;  1GHP A;  3VP1 A;  4EEP A;  5TBM A;  4OQ0 A;  4RX2 A;  3EEH A;  4KG2 A;  2ZMV A;  1P97 A;  3H82 A;  3V67 A;  5HL1 A;  3OPR A;  4LCL A;  4K0X A;  1XGI A;  2ZMA A;  3IF6 B;  2G2U A;  2OSU A;  4NEE D;  4WZ4 A;  3MMH A;  4G3V A;  2G2W A;  4B93 A;  2Y55 A;  1K6S A;  2I9V A;  3QHY A;  2J3T C;  4Q0J A;  3IBJ A;  5IU1 A;  3QNC A;  4QY5 A;  4E3L A;  3ITB A;  2EXA A;  3SZT A;  4F3L B;  3Q7Z A;  2W3E A;  4BMW A;  2B5R A;  2DCF A;  1W8Q A;  3MZD A;  1MKI A;  4MBF A;  2K2N A;  5GLD A;  5FQI A;  3V39 A;  1DP8 A;  4Y7P A;  3PBR A;  1DRM A;  3QP4 A;  4JLF A;  5DJT A;  3IH9 A;  4BLM A;  3WS4 A;  1WYB A;  3DTI A;  4GD6 A;  3ICY A;  4ESP A;  3NUL A;  2O9A A;  5BOH A;  1MWU A;  4JF5 A;  4FH4 A;  5HDS A;  3TW8 A;  3WRZ A;  4NK3 A;  1VEU A;  4KQO A;  3S7N A;  1F98 A;  1TEM A;  3S7Q A;  3CZD A;  1CQA A;  2CMN A;  3BWL A;  1OJG A;  3BFF A;  3N6I A;  3IS2 B;  1YSP A;  5HWV A;  2VZW A;  3O5Y A;  3PXP A;  5TGF A;  3OBF A;  1K54 C;  3ZNY A;  4GHI B;  4S2N A;  3DAV A;  4ZAM A;  1LL8 A;  1N4O A;  2Z6C A;  1YPR A;  5I5L A;  2JN7 A;  3G4P A;  3RH8 B;  4HIA A;  4MBH A;  5L07 A;  2KX6 A;  5J3W A;  1F5M A;  3W2Z A;  2ZQD A;  1T1C A;  3T4T A;  1TS8 A;  5J8X A;  1LSX A;  5CTN A;  3K3D A;  1LT0 A;  2XA7 M;  4UA9 A;  4LV2 A;  3HLF A;  2JKG A;  3AGD A;  3L9K A;  4KZ8 A;  3UB9 A;  3VP3 A;  3GMW A;  1BLH A;  4DJ3 A;  5DKL A;  3N4I A;  5AQ7 A;  2A3U A;  2PRF A;  5L8M A;  5IHV A;  4GS9 A;  5FDS A;  3B3X A;  1VET A;  3PTE A;  1ALQ A;  2ZC4 B;  5EVI B;  2P04 A;  4H6J B;  5FQ9 A;  1PNE A;  3UPP A;  4XT2 B;  1PRQ A;  4QHC A;  2PAV P;  1E3U D;  2WKH A;  1FQG A;  4JXG A;  3P01 A;  5HDC A;  1RCJ A;  3KSI A;  2XA7 S;  4YIN A;  2ZQA A;  2C6W B;  4OOY A;  5JYO A;  5A92 A;  3HL9 A;  1GHM A;  3LIE A;  2EX6 A;  3TJZ C;  4FTX A;  2MJ6 A;  2CC1 A;  3TRC A;  3UDF A;  5CX7 A;  1O7E A;  4CJN A;  5F6A A;  1S67 L;  3R7W B;  2HDU A;  3C8C A;  4MLL A;  1IEL A;  4JGP A;  4ZJ1 A;  1SCW A;  2L0W A;  1K57 A;  5GHY A;  2XF3 A;  5DF9 A;  5DVA A;  3C5A A;  3OCL A;  2PT7 A;  2XFT A;  4EBP A;  1UGU A;  3C30 A;  2WAD A;  4O0P A;  5GLB A;  1HD8 A;  2EXB A;  5GHX A;  1K4E A;  4WMC A;  1MWT A;  3UMD A;  2VGJ A;  5FEG A;  4LGW A;  3IBR A;  4OOM A;  3FKW A;  5DFY A;  4GCZ A;  1OJ5 A;  2GZA A;  2OOL A;  1XJ3 A;  4PKY A;  2PBY A;  3VP0 A;  4HI4 A;  2VV7 A;  3VFF A;  3BY8 A;  1D06 A;  3SH9 A;  2JE5 A;  1K38 A;  4RVA A;  4WEJ A;  2QHK A;  3LIB A;  2YKH A;  2K31 A;  5DKK A;  4LV0 A;  5HDD A;  4BBV A;  3F1O A;  3F1P B;  1TVF A;  1Q2Q A;  2O0Y A;  4NXF A;  5HPF A;  5HZH A;  5MC7 A;  5DTK A;  3UB5 P;  4EUV A;  4IVI A;  4HBT A;  4UA6 A;  1J3W A;  3BLS A;  3W8K A;  3DTK A;  1ERQ A;  4RX3 A;  4OPY A;  3C7U A;  3VE4 A;  4C3Q A;  1G68 A;  1WA9 A;  3TSG A;  2G7U A;  1YMS A;  3O88 A;  2WGV A;  3Q82 A;  4JGQ A;  4DMZ A;  4O7D A;  2FFF B;  2DRW A;  3UDI A;  1XPB A;  4O01 A;  2V0U A;  2Y59 A;  3MQQ A;  1NLY A;  3P98 A;  1CEG A;  3FWL A;  3Q1F A;  4LEN A;  3DTE A;  3A3I A;  3O87 A;  4CLC C;  3OPP A;  1OTB A;  4QU3 A;  4GJ4 A;  1EI5 A;  4S2L A;  3IF5 A;  1RGY A;  1V9Z A;  4WEL A;  3GTC A;  3B33 A;  2A49 A;  3ISG A;  5FA7 A;  1W8Y A;  1N9L A;  3KX0 X;  4I39 A;  5J4E A;  3S22 A;  1F9I A;  4HJ3 A;  1FCM A;  3PBQ A;  3WS5 A;  4DE2 A;  2VGL S;  5FI6 A;  3EEA A;  2P9V A;  2VKS A;  2PD8 A;  5FL3 A;  3IWI A;  4BD1 A;  2OLV A;  1BLS A;  4X53 A;  2HDQ A;  3OPL A;  3CIT A;  4CLC B;  4LRY C;  2Y2M A;  4QPR A;  2XRN A;  3GR2 A;  5E2E A;  2UWX A;  4XUX A;  1OT9 A;  3FPW A;  3CUE A;  3HUN A;  2R9X A;  4GDB A;  2XFS A;  2QKP A;  2WGW B;  2BAS A;  4A5R A;  4YFM A;  1ACF A;  3MQ0 A;  5KZH A;  3PYP A;  3IX4 A;  3LR3 A;  2Z2M B;  2X02 A;  2J3W A;  5FAS A;  5M1A A;  2OAQ 1;  3LI8 A;  3Q07 A;  3ZVT A;  1U60 A;  4Y15 A;  2NUP C;  4HHD A;  1XX2 A;  4EER A;  5EOE A;  2DNS A;  1QMF A;  1K55 A;  4KQQ A;  1GSW A;  5DFX A;  4NG2 A;  3AGF A;  3GDI A;  3LEZ A;  3GRJ A;  1FIL A;  1TS7 A;  2HF6 A;  2ZL1 A;  4YOF A;  3A3F A;  5A93 A;  1KDW A;  4S2M A;  4WEK A;  1K25 A;  1E3U A;  4P6Z M;  3T4S A;  4E6W A;  1TDG A;  1FCN A;  2FZ0 A;  3MXQ A;  3E98 A;  2KLI A;  3LCE A;  4ETZ A;  1W79 A;  1ESU A;  2GNX A;  4WYY A;  4MCW A;  2WKR A;  3S7O A;  3O3V A;  4L9F A;  4R3J A;  3GVB A;  1SKF A;  3WWX A;  2E8J A;  2RL3 A;  2WZX A;  1SKO B;  4R70 A;  1KGE A;  2QWS A;  4ZTK A;  3D9Y A;  4EES A;  4KG5 A;  1D1J A;  4LPZ A;  2H0T A;  2WK0 A;  4NXE A;  3A0S A;  2IA2 A;  3T1X A;  5AVE A;  3ZG5 A;  4B4Z A;  1JTG A;  1XA1 A;  4EBL A;  4KQD A;  4JXS A;  5EV0 A;  2QJ7 A;  3LYX A;  3O86 A;  1UWN X;  4P6Z S;  5EM1 A;  3N8R A;  1LI0 A;  2Y4A A;  4FSF A;  4DE1 A;  3EWK A;  2HP5 A;  4ZDX A;  3BW6 A;  4GB7 A;  3UB8 A;  4NET A;  2R9W A;  1N9O A;  3OCN A;  1G28 A;  4P6B A;  4EV4 A;  4JBF A;  2O9C A;  3JYI A;  2W3H A;  1H0M A;  1ESI A;  4MMN A;  2PU4 A;  3LY4 A;  3G30 A;  4H8R A;  3T50 A;  2V20 A;  1H8M A;  5A8B A;  4WLA A;  3WRT A;  3T1R A;  3S7P A;  4WZ5 A;  5AJG A;  3NI9 A;  2Y2H A;  2Y2L A;  2XLN A;  1OPX A;  2HJ9 C;  1YM1 A;  1S6R A;  3FYZ A;  3EGX C;  3V3S A;  1ZG6 A;  5L10 A;  3ZHH A;  1YQS A;  2J3T D;  2KOI A;  3BEC A;  1Q2P A;  2Z6D A;  5FEF A;  3MBZ A;  1J9M A;  4Y0U A;  3ZG0 A;  4Q0H A;  4OKP A;  4GLQ A;  3F1N A;  2W1T A;  3UE0 A;  2HP6 A;  3CPT B;  3OPH A;  4WM9 A;  3VMA A;  4C75 A;  4PM7 A;  5CGX A;  2ZM2 A;  4WUJ A;  4PAU A;  1SZV A;  5G4Y A;  4D60 A;  2ZOI A;  1MY8 A;  2H28 A;  4QY6 A;  3KYQ A;  2JC7 A;  2V2F F;  2ZM8 A;  1XJ2 A;  4KZ3 A;  1S4R A;  3UME A;  1CF0 A;  4ARZ A;  5J7E A;  1XFQ A;  1GSX A;  3JPU A;  4MEZ A;  2V0W A;  4I3A A;  5C5K A;  5AQ9 A;  5L09 A;  3VE3 A;  2JKF A;  4KQR A;  3A0R A;  4RA7 A;  4PMA A;  3JVU A;  1BLC A;  4QWO A;  4ZJ3 A;  1AXB A;  1PZP A;  4GDN A;  1GA0 A;  2E8I A;  4IHQ A;  5CEC A;  3UNW A;  3NCK A;  3RFB A;  5GHZ A;  2ZLY A;  4L0L A;  5EVI D;  2Y2P A;  3LUQ A;  4R6L A;  5FQJ A;  2XH9 A;  4B88 A;  3MKE A;  2Y8H A;  1L0G A;  2B02 A;  3EQV A;  1ES2 A;  2H5S A;  2W3F A;  2J9P A;  4R4S A;  2W0N A;  4OLG A;  1E4D A;  5KIZ A;  4DN0 A;  1FSW A;  1FSY A;  2VA0 A;  1G5U A;  5FQQ A;  2ZMF A;  1AWI A;  1YAX A;  2D02 A;  1MZU A;  5CED A;  2ZBB A;  3UE3 A;  2RCX A;  4IJG A;  4YWZ A;  1NJ4 A;  4OQH A;  4JPM A;  4E3M A;  3NOP C;  1UWP X;  5CXW A;  3MKF A;  3IWQ A;  3U2A A;  4Y0O A;  2LB9 A;  4QJG A;  2Y2N A;  4DDS A;  1T1B A;  4R38 A;  1BUL A;  2XRO A;  3BYD A;  3C7V A;  2XK1 A;  5AQA A;  3LR4 A;  1DP6 A;  1CI9 A;  2JHE A;  3SS5 A;  4Y5F A;  3QP6 A;  3P7N A;  4R3A A;  2FFY A;  4PM5 A;  3SS4 A;  2A24 A;  1FCO A;  3JVV A;  1YLY A;  1STZ A;  2QZ6 A;  4G3W A;  2XD5 A;  1PI5 A;  5HAR A;  1K55 C;  3ULF A;  2WUQ A;  1A0K A;  4DKI A;  1V9Y A;  4OPR A;  3IF6 A;  3MR0 A;  2J7V A;  2Y2J A;  3BJN A;  3KSF A;  4OQG A;  1MKM A;  4OPZ A;  2HGV A;  1JNU A;  2QPN A;  4KZ6 A;  4OH0 A;  3V5M A;  4ZRR A;  3V3R A;  5KSC A;  2ZC5 B;  2EX8 A;  3TOI A;  3ZVW A;  2J80 A;  3DWZ A;  3QP8 A;  1IYP A;  3PR6 A;  5HAQ A;  4R3B A;  1ES5 A;  3MZF A;  4GNU A;  4MN7 A;  4F3L A;  2D01 A;  3HLC A;  1IKG A;  4JKT A;  5GL9 A;  3T4Q A;  4FOF A;  2WKP A;  3B42 A;  4KEN B;  3PAE A;  3DWK A;  3Q81 A;  1X0O A;  3WS1 A;  3UPO A;  2ZD8 A;  4L9E A;  3KO6 A;  3CI6 A;  3C38 A;  2VV6 A;  1YSQ A;  4CQH A;  3FV7 A;  3VOZ A;  3SOI A;  5GLC A;  5HWT A;  2PR5 A;  4LCM A;  4EEU A;  4X1L A;  3T12 B;  2XGN A;  3UO9 A;  2H0Y A;  3PBO A;  2Y2K A;  1PZO A;  1ES3 A;  3IS2 A;  3IHB A;  1CI8 A;  1YMX A;  1EWZ A;  3GQZ A;  4E6X A;  1K56 D;  1PI4 A;  1PW1 A;  3BFG A;  1Z09 A;  4AFI A;  2ZC6 B;  2W3D A;  5FSR A;  4HQA A;  2VGL M;  4OPQ A;  1T1A A;  4WN5 A;  5FAO A;  3C4O A;  5HSQ A;  1LLB A;  4CLC D;  3QP1 A;  1KE4 A;  3IX8 A;  3NY4 A;  1ZG4 A;  4X1M A;  2INW A;  5FQK A;  5HW3 A;  5M19 A;  2Y2Q A;  3Q7V B;  2VK3 A;  3NBL A;  1IYS A;  1MWR A;  1IYO A;  4GW9 A;  5IS1 A;  1K4F A;  1S1Y A;  3MJQ A;  3AGE A;  3MF0 A;  3DTM A;  4QD4 A;  1NWZ A;  4BJP A;  3UY6 A;  3LFV A;  5DF8 A;  2IWC A;  1XFN A;  1D7E A;  3UE6 A;  3H7W B;  4B4X A;  1GHI A;  3CG5 A;  5CER A;  2W27 A;  1OTE A;  3VOY A;  3B47 A;  1K54 A;  3E4O A;  5F1F A;  4KUO A;  3KYZ A;  1LSW A;  4D2O A;  1S4S A;  1OTI A;  4N92 A;  1T18 A;  2HZ5 A;  3V50 A;  4DF6 A;  5F69 A;  2PYP A;  3BEB A;  1P0Z A;  5TBM B;  4JGO A;  1L2S A;  5EVI A;  2HDS A;  3UN7 A;  1SDN A;  2Z2L B;  3H82 B;  4LRX C;  3W4P A;  4H6J A;  3CLO A;  3BY9 A;  4XT2 A;  4HY8 A;  4E3N A;  4HES A;  4HJ6 A;  5E2H A;  4F94 A;  4EUZ A;  3IH8 A;  3F1N B;  4LRZ E;  5A90 A;  4EWF A;  5HAI A;  4KZA A;  5CRF A;  3T1S A;  1OTA A;  2AVX A;  3TE8 A;  4JGR A;  1ES4 A;  4MBK A;  4Q0I A;  3D4F A;  2HP9 A;  3R7W A;  3G31 A;  4IVK A;  2ZQ9 A;  1W5D A;  2ZOH A;  4X25 A;  4EU0 A;  4UAA A;  2JKT I;  4RYE A;  4UQI S;  2PYR A;  3HJK A;  3OZH A;  4ETX A;  4E04 A;  5F68 A;  4S2N C;  4LV1 A;  2JKR I;  3HUM A;  1LL9 A;  3NOU C;  4DE3 A;  1XKZ A;  3HLD A;  3OLO A;  3EOI A;  2R78 A;  2V1Z A;  4NXG A;  5DF7 A;  4BL2 A;  3MQO A;  2M1C A;  2EX9 A;  3E4P A;  4BL3 A;  5F83 A;  3VSL A;  2BG1 A;  1VEU B;  2JBF A;  3A3E A;  3N8S A;  1OME A;  2GJ3 A;  4M3K A;  3BQA A;  4O8G A;  3HCY A;  4I38 A;  2QYB A;  2VX8 A;  4G3K A;  3T4L A;  1ONG A;  1P9W A;  1LI9 A;  1W63 Q;  4OON A;  3LR5 A;  5HD3 A;  4NKP A;  4U0X A;  3F1P A;  2P74 A;  1ZTU A;  4EQ1 A;  4KZ4 A;  3ZGA B;  1CJF A;  4IBX A;  2XEP A;  4Y2F A;  5EVE A;  4JF6 A;  5EOO A;  4CLC E;  2HV1 A;  5E2G A;  3IXH A;  1NZU A;  4IUK A;  3HJI A;  4N1H A;  5A91 A;  4EXO A;  4K0W A;  1NZO A;  1Y4O A;  3E2L A;  4LV3 A;  1PWG A;  5F1G A;  2O99 A;  5DTS A;  5HL6 A;  3KYE A;  3T4J A;  2IWD A;  3ZNT A;  1MC0 A;  4FD8 A;  1HZO A;  1G6A A;  1BUE A;  1YLZ A;  4X56 A;  1WYC A;  5CTM A;  1ZKJ A;  1GSV A;  5EFW A;  1XJ4 A;  2FH5 A;  5JYP A;  3SH8 A;  2PR6 A;  1FR1 A;  4HH3 A;  3E0Y A;  3DBA A;  1YLT A;  1NYM A;  3G6O A;  5GLA A;  4DE0 A;  3IXB A;  4XUZ A;  1CEF A;  1Z6F A;  4GN2 A;  3S1Y A;  4GS9 B;  2LB5 A;  5L2F A;  1VET B;  5TR7 A;  1NLZ A;  1NY0 A;  1L0E A;  3T4O A;  4FUW A;  1K57 C;  4U0T A;  4WF0 A;  5TFQ A;  2Q9M A;  5CHU A;  2VEA A;  2Y2O A;  4S2K A;  3UDX A;  3E2K A;  3PBS A;  3A0V A;  2PU2 A;  1TS0 A;  1XGJ A;  4YNR A;  3BFE A;  1GCE A;  5KMW A;  3M6H A;  1YLP A;  1K56 A;  3CMZ A;  4OP8 A;  4UHU A;  3G34 A;  2WAF A;  3NC8 A;  2W1R A;  3UE1 A;  4ME4 A;  2Y2I A;  3RXX A;  5HFO A;  3DW0 A;  3HUO A;  5CGW A;  4MNR A;  1XXM A;  3BM6 A;  5EM0 A;  4CLC A;  1DP9 A;  5HPI A;  4EET B;  3QP2 A;  2A2L A;  3UB6 A;  4IUH A;  2WZZ A;  1M6K A;  2Q0O A;  3IQA A;  3IWO A;  1H8Y A;  2WKQ A;  3SH7 A;  2P7J A;  1YLW A;  1ERO A;  1MBL A;  4KZ5 A;  4ZJ2 A;  2ZQC A;  1BT5 A;  4Z1W A;  3FZC A;  2WGW A;  4EW7 A;  2JKT M;  2EX2 A;  1OT6 A;  2XD1 A;  3VFH A;  1TDL A;  2JKR M;  1SHV A;  3LIA A;  4Y0T A;  2EWW A;  5E2F A;  2Y91 A;  3GEC A;  1S1Z A;  3G2Y A;  2W3G A;  3N8L A;  2WKI A;  1N9N A;  4BBT A;  3R4K A;  2HPB A;  3PAG A;  5G18 A;  1ZHH B;  1F2K A;  3W4Q A;  3F1O B;  1K6R A;  1VM1 A;  3A3J A;  3FKV A;  2OWJ A;  4OOL A;  3T4K A;  4U3T A;  3EQU A;  2XR0 A;  2P08 A;  5EE8 A;  4UEY A;  3RTY A;  2OLU A;  2V8F A;  4OP5 A;  5FAQ A;  3CWF A;  4KZ9 A;  3PBT A;  2VGK A;  2VLG A;  3ZQ5 A;  2V9A A;  1JVJ A;  4X68 A;  1Y54 A;  2XSS A;  4S2J A;  1BSG A;  4E3J A;  4HBU A;  1I2S A;  2WYX A;  4KUK A;  4HOI A;  1S66 L;  4IED A;  5I94 A;  3ZCZ A;  1SKO A;  3D3O A;  1NXY A;  5HD5 A;  3NDG A;  4S2O A;  4I5S A;  4CPK A;  2O9B A;  5EVI C;  5K5B A;  3C4P A;  4HJ4 A;  2PBD P;  3K3C A;  1BYW A;  3LI9 A;  2X01 A;  2ACG A;  4N1X A;  4X69 A;  2Y2G A;  2VV8 A;  5FAP A;  3LGO A;  2H10 A;  5FI7 A;  4HH2 A;  3CUE C; 
#chains in the Genus database with same CATH homology
 3T1R A;  3KYE A;  1Z09 A;  1FIL A;  4X25 A;  1A0K A;  3MS6 A;  1PFL A;  1K0K A;  2ZL1 A;  4X1M A;  2BTF P;  3U4L P;  5FEG A;  5FEF A;  1VET B;  2VK3 A;  1F2K A;  3L7H A;  1HLU P;  2JKG A;  3L9K A;  4FUW A;  3LEQ A;  3CPT B;  2PRF A;  1VEU B;  1G5U A;  2E8J A;  2V8F A;  1SZV A;  5FDS A;  1SKO B;  1VET A;  1AWI A;  3D9Y A;  4ESP A;  3NUL A;  4D60 A;  1D1J A;  3MSH A;  3T1X A;  3CPT A;  1PNE A;  1PRQ A;  1VEU A;  2HZ5 A;  3UB5 P;  5EV0 A;  2PAV P;  1J3W A;  1SKO A;  1CF0 A;  1CQA A;  5EM0 A;  5EM1 A;  4X1L A;  1ACF A;  4FTX A;  1CJF A;  5EVE A;  3T12 B;  3NEC A;  3CHW P;  2JKF A;  2PBD P;  3DAV A;  2V8C A;  1FIK A;  2ACG A;  1Y4O A;  4QWO A;  3LGO A;  1YPR A;  3T1Q B;  2ZL1 B;  3T1S A;  2B95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...