3WS5A

N288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (condition-2b)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
357
structure length
357
Chain Sequence
QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGQGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTQGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
total genus 118
structure length 357
sequence length 357
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ws5A00
2UWXA 5FQMA 3SH7A 4X68A 4OQGA 5E43A 3GMWA 4WEKA 5FAPA 1Y54A 3N4IA 5AQ9A 3VP0A 5DTSA 1YLJA 4MNRA 5KMWA 3SH9A 3BFDA 4GDNA 2WAEA 1IELA 3Q82A 2JC7A 5A92A 4OPZA 4X53A 1KE0A 3IHAA 1NYYA 3SS5A 3VP2A 1FCMA 1MPLA 4OKPA 4EBPA 2J7VA 3MBZA 5EPHA 4X55A 4WYYA 1FSWA 1IYSA 4R4RA 1SCWA 4DDYA 2I72A 5FSRA 4HBUA 4PMAA 2WK0A 4E3NA 4UA7A 5M18A 4LV2A 3BLSA 3HUNA 1KGFA 4O7DA 1S6RA 3HLEA 4QU3A 4B4XA 3A3DA 3E2LA 5L2FA 2Y2LA 3HBRA 3IXHA 3GQZA 3OPRA 4MBHA 3IF6A 1PWCA 3C7UA 1YLYA 3GR2A 1KVMA 4GOGA 4Y0TA 3M6HA 5JYOA 4IBRA 1NZOA 3V3SA 3PBSA 3P09A 4Y0OA 3LCEA 4PPRA 4QD4A 1NRFA 2ZQAA 2H10A 5JYPA 4D2OA 1ESIA 4WMCA 1SDEA 4U0XA 4EWFA 2ZC7A 3EQUA 3HLDA 3FKVA 4JXSA 1JWZA 5E2EA 1EWZA 3N8RA 4JF6A 3P98A 5M1AA 2JE5A 4MBKA 3W8KA 3TOIA 3BLMA 1E3UA 2G2WA 5U47A 3VSLA 3NBLA 2Y2MA 3IT9A 4N9KA 4OPYA 1FCNA 2B5RA 2DRWA 2XR0A 3A3EA 4KENB 4C3QA 4DDSA 5CGWA 2P74A 3ZG0A 3ZVTA 5CTMA 1HVBA 1NZUA 2WUQA 3VMAA 3N8LA 1E4DA 3G35A 1TEMA 1K54A 4JXVA 3HVFA 4ZDXA 1SHVA 4P87A 4ZBEA 5FQKA 1CK3A 3N6IA 2PU2A 2IWDA 1ESUA 1KDWA 1M6KA 3GSGA 2V2FF 4MEZA 3M2KA 3FWLA 1PZPA 1CI9A 3MFDA 3C7VA 1Z6FA 5BOHA 1HZOA 3OPHA 3MZEA 1MWTA 5CTNA 5CHMA 4E3KA 3VOYA 1HTZA 4L0LA 2HDUA 4GZBA 5EVIA 3IHBA 2Y55A 4JBFA 1NJ4A 2ZLYA 1PWGA 1I2WA 3Q07A 4WEJA 4X69A 4CPKA 1BUEA 1ONHA 3FYZA 1ERQA 1SKFA 3VOZA 3NC8A 3Q7VB 2WKEA 1ERMA 2ZC5B 2XEPA 4FD8A 4WZ5C 4R3JA 2EFXA 3JYIA 1PIOA 3QHYA 2HDSA 4RA7A 2HP6A 4KG6A 2J9PA 4RX2A 1Q2PA 2HDQA 3ZFZA 3O88A 3G31A 4K0XA 3CZDA 2OSUA 1MWRA 4RX3A 3RXWA 1IKGA 3PAEA 3AGDA 1XX2A 3DW0A 5FQQA 1BLHA 5HARA 2PU4A 3VFFA 4S2JA 3QNCA 2IWCA 4UHUA 5GLDA 1BULA 1ONGA 4OLGA 4OOMA 4N1HA 1DY6A 3UY6A 3AGEA 4OVDA 1BTLA 1K56D 2JCHA 3GTCA 5A91A 4X6TA 3V5MA 5FA7A 4DE0A 4JF5A 4IVKA 4KZ9A 4KZ6A 2ZQDA 3OCNA 5EVIB 2WGVA 4QHCA 4MLLA 2PBYA 1YT4A 1L0DA 2EXAA 5FDHA 5A93A 5DTTA 2XK1A 3W4PA 1MKIA 2EFUA 2ZM2A 2C6WB 2ZD8A 4E3OA 1LI9A 1GCEA 1VQQA 1KDSA 3GV9A 1KE3A 4OP8A 4PM5A 3ZG7B 3UE1A 1J9MA 5IHVA 1PWDA 1L0EA 4ZAMA 3HUMA 2GDNA 3D4FA 2HP5A 4Y7PA 4BL3A 3O3VA 4R3BA 1H5XA 4RVAA 3G34A 3DTMA 4HEFA 3RXXA 5E2HA 2ZM8A 5F82A 5EECA 1EROA 2H0YA 2RL3A 3SS4A 3UNWA 2ZQCA 3ZG9B 4ZJ1A 2XD1A 4OPRA 1IYPA 3OZHA 3UO9A 2Y4AA 3G32A 3VP4A 3N7WA 2WKHA 2Y2GA 3IF6C 4KZ4A 2X01A 3V50A 5DF8A 1BZAA 1I5QA 4FH4A 4H8RA 4LV3A 4RYEA 5F1GA 3ZVWA 3BEBA 4KZAA 1IEMA 4XUXA 1W8QA 3ZCZA 1KVLA 3IQAA 4FSFA 1RGYA 4IVIA 5FI7A 2J8YA 1LHYA 2P9VB 3FZCA 3NIAA 3ZGAB 1EI5A 4BD1A 4OOYA 4QB8A 5GHYA 4EBLA 3RJUA 4ZTKA 2A49A 1ES3A 3C4OA 1MBLA 4DKIA 2BG1A 3O87A 2J9OA 3I7JA 1XA1A 4LENA 5CEDA 4P85A 3C4PA 1PYYA 1LL9A 3LEZA 2R9XA 2Y2QA 2WZXA 3UPOA 2H0TA 1FOFA 4S2IA 3HREA 3M2JA 4R4SA 4E3MA 3Q1FA 3PBTA 4BLMA 5CECA 4OLDA 3AGFA 3GRJA 5AQAA 1FR1A 2EX6A 3BM6A 3UE3A 3IXBA 3Q7VA 4GKUA 4DXCA 1K54C 5CEBA 1I2SA 1FQGA 4GD6A 4S2NA 1XGJA 3NDEA 4BENA 4BL2A 1LLBA 2ZJ9A 4N9LA 2E8IA 1TDGA 4NK3A 1DJBA 4KZBA 5EOOA 5FQJA 5TR7A 3OPLA 1Q2QA 5HAPA 4KG5A 5CGXA 1RCJA 3E2KA 3BECA 1N4OA 3WS2A 4C75A 1XP4A 2XF3A 1S0WA 3WWXA 3WRTA 1GA0A 4HBTA 3IWQA 1XGIA 5F83A 4S2MA 4JKTA 1MWUA 3BFFA 4UAAA 3SH8A 4QY6A 1MXOA 5GLAA 2EXBA 3NY4A 3HL9A 3WRZA 3Q7ZA 1MWSA 2V1ZA 2G2UA 3DWKA 4WMCD 3HLGA 5EVIC 3Q81A 5GL9A 3ITAA 3UDXA 3UDIA 1WE4A 3OC2A 5DVAA 2WZZA 2VGKA 1LL5A 1CEGA 3N8SA 2EX8A 2ZC6B 1E3UD 4PM6A 5CXWA 4LCMA 3VP1A 1K57A 2H5SA 3HLBA 3NDGA 1VM1A 1TVFA 4FH2A 3VFHA 1K38A 4KZ5A 2BLSA 1JTGA 2DCFA 3BRMA 2XH9A 4KZ7A 4IEDA 1K55A 4N92A 4OP5A 5TGFA 2Y91A 4OQIA 1NY0A 2C5WB 1RP5A 3S4XA 3UPNA 5TFQA 3V3RA 3A3IA 3MKEA 4LV1A 3IF5A 4U0TA 3WS0A 5HL1A 3G4PA 1BT5A 1KGEA 1H8ZA 4S2LA 2Y2JA 1U60A 4UA9A 5CHJA 4U3TA 3G2YA 1PI4A 1L2SA 3W4OA 4YFMA 1WYCA 5KSHA 2Z2LB 1K6SA 4EQIA 3UDFA 1W7FA 1K4EA 3BFGA 4LV0A 5EVLA 3CJMA 3LY3A 3UPPA 5HFOA 3V39A 2R9WA 1BLSA 5EE8A 5FAOA 5J8XA 4S2PA 2ZM0A 4QJGA 5CGSA 1DJCA 4Y0UA 5CHUA 2HPBA 2XD5A 1PZOA 2WGWB 3FKWA 3MXSA 1QMFA 3LY4A 2P9VA 4WELA 1MY8A 2QZ6A 3VSKA 3PBRA 4OQ0A 4B4ZA 4JLFA 4JXWA 4PM8A 4EBNA 1N9BA 4OPQA 5HW3A 4E6XA 1W5DA 2FFYA 2ZQ7A 5G18A 4DE2A 3PTEA 3WS1A 1SDNA 1ZG6A 3ITBA 1H8YA 3S22A 1ZG4A 2X71A 3UN7A 4BQMA 1BLPA 3VP3A 1W79A 1GHMA 1YM1A 1YLPA 2Y2OA 2HDRA 2Y2IA 1GA9A 4GDBA 3BFEA 5FATA 4UA6A 2Y2KA 3A3JA 3SOIA 5M19A 3LO7A 4ID4A 4E3JA 5FASA 1TDLA 4NETA 5E2GA 4KQOA 3HLWA 3MZDA 1DJAA 1WYBA 3MKFA 3WS4A 3IXDA 4K91A 1JVJA 3ZHHA 5DF7A 3G30A 3TG9A 1K25A 2OLUA 4E6WA 4JXGA 3O86A 1FR6A 1ES4A 3NI9A 4R1GA 1W8YA 2DNSA 1G68A 1YQSA 4PM9A 1FCOA 2XDMA 4Q8IA 2VGJA 3IH8A 4BD0A 1ES2A 4C6YA 3M6BA 1IYOA 1LI0A 3S1YA 4WBGA 2QPNA 3PBQA 4X56A 5KSCA 3SS3A 5DTKA 4GB7A 2IWBA 5AQBA 3NCKA 1G6AA 1ZC2A 2ZC3B 3CMZA 2WKIA 2FFFB 3IXGA 4S2NC 4KQQA 2Q9NA 4P6BA 1K6RA 2Y2HA 3B3XA 2XGNA 4KQRA 2WYXA 2WAFA 4PM7A 4QY5A 4R23A 5FI6A 1KE4A 4F94A 4OQHA 4E3LA 2ZQ8A 4YINA 1L0GA 4DXBA 1YLZA 4BJPA 5EUAA 1AXBA 3ZNYA 5A90A 3DWZA 3FV7A 4LCLA 2XQZA 4XUZA 3BYDA 3IH9A 3ZNTA 5HX9A 4KZ8A 4HESA 3WS5A 4E3IA 3A3FA 3HLFA 1JWVA 1YLWA 3IWIA 2OV5A 2ZC4B 4DF6A 5FAQA 4WM9A 3C5AA 4M3KA 4Z9QA 1XPBA 3QNBA 3IF6B 2RCXA 1KGGA 4DE1A 1CEFA 1PW8A 2EX9A 3BFCA 1C3BA 2Y2NA 1GHPA 5I94A 4K0WA 5CRFA 4KZ3A 5FQIA 3ZG5A 3G2ZA 2X02A 1K56A 1OMEA 1PI5A 1YLTA 4WZ4A 2WGIA 1YMSA 2WGWA 2HP9A 5F1FA 1K57C 3ZDJA 4EV4A 3W4QA 4DRTA 1O7EA 3CG5A 2Z2MB 5E2FA 3UE0A 1XKZA 1PW1A 1K55C 2V20A 2XFSA 4IBXA 3EQVA 1FSYA 1YMXA 1ES5A 4OH0A 3HLCA 4P0MA 1BLCA 4CJNA 3PBOA 1K4FA 4MBFA 2QMIA 4JPMA 1CI8A 5FI2A 1XA7A 1QMEA 1M40A 2Q9MA 3OCLA 3TSGA 4ZJ2A 1JWPA 4B88A 4JF4A 1E25A 3ZG8B 3HUOA 4OONA 1HD8A 4XXRA 3OPPA 5GHZA 2ZQ9A 3IWOA 5AQ7A 4GN2A 1XXMA 4WZ5A 1RGZA 5GLCA 3PAGA 5D3OA 1L0FA 3GVBA 4N1XA 2OLVA 2A3UA 1NXYA 2ZMAA 2Y59A 5HAIA 3PBNA 1IKIA 3MXRA 4S2KA 4EUZA 2XFTA 2XLNA 4KG2A 1O07A 2JBFA 5EVID 4R0QA 5GHXA 5GLBA 2WADA 1JTDA 4A5RA 2EX2A 2CC1A 5HAQA 5FQ9A 4GD8A 1IYQA 4ZJ3A 5KZHA 4FCFA 3MZFA 3ISGA 1BSGA 5DF9A 2Y2PA 4OOLA 1ZKJA 5EOEA 5CERA 4S2OA 4DE3A 1ALQA 1GHIA 4GNUA 1NYMA
chains in the Genus database with same CATH superfamily
5FQMA 4X25A 4X68A 3GMWA 4GJ4A 3TJZC 4UQIS 3Q82A 5L10A 4X53A 1KE0A 3SS5A 2H28A 2J7VA 3MBZA 3F1OB 1FSWA 1IYSA 1SCWA 3LIEA 3P7NA 4HBUA 4PMAA 4UA7A 3BLSA 4O7DA 3E2LA 3GQZA 3GR2A 1KVMA 3LEQA 4Y0OA 4QD4A 5FDSA 2ZQAA 1ESIA 1SDEA 1YSQA 3HLDA 5E2EA 1EWZA 3N8RA 2GZAA 3CWFA 4FTXA 3TOIA 3BLMA 2G2WA 1K0KA 3UMDA 3VSLA 3UE6A 2Y2MA 2KDKA 2B5RA 2DRWA 3A3EA 2PRFA 4K08A 4NXBA 3UMEA 3VMAA 3G35A 4FUWA 3P01A 1K54A 3T1RA 2VGLS 3HVFA 3LICA 5FQKA 5F68A 2IWDA 3TRCA 4R6LA 1M6KA 4HI4A 1J3WA 2VV8A 3C7VA 3LGOA 1MWTA 1DRMA 3DBAA 2HDUA 1PFLA 4GZBA 3IHBA 4JBFA 4WEJA 4X69A 2R78A 4I3AA 1UGUA 3VOZA 3H82B 3NC8A 1G5UA 4P6ZM 5EM1A 1ZHHB 4R3JA 2EFXA 3HJKA 3JYIA 1PIOA 5TBMA 2HDSA 4X1LA 4KG6A 3D3OA 2J9PA 3DTEA 3ZFZA 3CZDA 1MWRA 4RX3A 3RXWA 1IKGA 3ZQ5A 1XJ4A 5EVEA 4OLGA 4GCZA 3LR5A 3UY6A 2PD8A 1K56D 2JCHA 3V5MA 4DJ3A 4JF5A 4KZ9A 4QHCA 4MLLA 4CLCE 4F3LA 1YT4A 3S7NA 5A93A 5DTTA 3W4PA 1GSXA 2C6WB 2ZD8A 1KDSA 4OP8A 1J9MA 1OT9A 2GDNA 2VLGA 3G34A 3PHYA 5J7EA 3CPTB 2ZM8A 3IBRA 2INWA 5F82A 3UNWA 3LIBA 2VZWA 3UO9A 1PRQA 3NJAA 2Y2GA 3IF6C 3IS2B 1T19A 4F3LB 4LV3A 3BEBA 1VETA 3ZCZA 4EESA 4HIAA 1LHYA 3KSHA 4EBLA 1HLUP 3O87A 5CEDA 3C4PA 3LIFA 2Y2QA 3M2JA 5CECA 5AQAA 3BM6A 3UE3A 2LB9A 3Q7VA 4GKUA 4H6JA 1I2SA 3KYQA 1MKMA 4GD6A 3NDEA 1YSPA 2ZJ9A 4N9LA 1VETB 3S7QA 5FQJA 5HAPA 3A0RA 4KG5A 3BECA 5HDSA 4C75A 3WWXA 1GA0A 4HBTA 1V9ZA 5F83A 4DMZA 4JKTA 1MWUA 4JGPA 4UAAA 1MXOA 2L0WA 3DAVA 3HL9A 3WRZA 2V1ZA 4PKYA 3L7HA 1A0KA 1WE4A 3OC2A 2VGKA 2JHEA 2QWSA 4FH2A 2XH9A 4IEDA 4N92A 2Y91A 4OQIA 5TFQA 3A3IA 4LV1A 4EEUA 4CQHA 2Y2JA 4GW9A 4U3TA 4YFMA 2KOIA 4O8GA 1WYCA 1K6SA 4ETZA 4EQIA 3UPPA 3V39A 5EVLA 1BLSA 5EM0A 1XJ3A 4EEPA 5CGSA 1FILA 2HPBA 2XD5A 2P04A 4DN0A 4EXOA 2PBDP 4JGRA 1H0MA 3T4QA 3T4LA 4OQ0A 4II7A 4JXWA 2QYBA 4PM8A 4OPQA 3NULA 4LGWA 5HW3A 2FFYA 4DE2A 4EUVA 3S22A 1YAXA 3KX0X 4BQMA 2BASA 2OAP1 3VP3A 1YM1A 2WKQA 3MQOA 2Y2OA 2HDRA 1N9OA 3A3JA 3OLOA 4E3JA 1TDLA 4NETA 5E2GA 1SKOB 1H8MA 3WS4A 5IS1A 3ZHHA 3G30A 2OLUA 4JXGA 3ZYTA 3C30A 2A24A 2DNSA 1G68A 1YQSA 2LB5A 2XDMA 4Y13A 1S4RA 3IH8A 3W2ZA 4BD0A 1ES2A 3S1YA 4WBGA 4HP9A 3NCKA 3CMZA 1YKDA 1G6OA 1NLZA 2WAFA 4R23A 4QY5A 3BJNA 4E3LA 4YINA 3FV7A 3ZNTA 3BYDA 2OOLA 3F1PA 3WS5A 2ZC4B 2W3EA 4Z9QA 3QNBA 3IF6B 2RCXA 5EFWA 2EX9A 3BQ8A 4K0WA 2YKFA 3G2ZA 1PI5A 1YLTA 2WGIA 3MR0A 1K57C 2Z2MB 5E2FA 4LRXC 4IBXA 3EQVA 4CLCA 1ES5A 4P0MA 3PBOA 2CMNA 2O9BA 1CI8A 5FI2A 1QMEA 3CLOA 1M40A 4ZJ2A 1JWPA 3F1PB 4LPZA 3ZG8B 2E8JA 1W63M 2NUPC 3QP5A 5GLCA 3MS6A 5D3OA 3GVBA 4N1XA 1ODVA 2XLNA 4KG2A 3MF0A 1O07A 4O01A 4R3AA 3O5YA 4R0QA 2CC1A 4YOFA 4FCFA 1BSGA 4OOLA 5CERA 1GHIA 2UWXA 3SH7A 5FAPA 1Y54A 3N4IA 4MNRA 3SH9A 2W1TA 4G3WA 3BFDA 3IHAA 1OTIA 2JKGA 3TE8A 3MSHA 4WYYA 4WLAA 4DDYA 2I72A 2WK0A 4E3NA 5M18A 4LV2A 5CX7A 4LLOB 1S6RA 5J3WA 1IFQA 3C7UA 4GOGA 4Y0TA 5JYOA 4JGOA 4GHIB 4PPRA 4D2OA 1S66L 3QP1A 4WMCA 3S7OA 2ZC7A 3EQUA 5HDCA 3FKVA 5HD5A 4JF6A 2EA9A 2JE5A 1NLYA 2ZMFA 3CI6A 5U47A 1GSWA 4KUKA 3IT9A 3JPUA 1FCNA 5AVFA 5CTMA 2GJ3A 3R7WB 1NZUA 1P97A 3N8LA 1E4DA 1TEMA 4JXVA 4ZDXA 4EETB 2PR5A 3N6IA 2PU2A 1KDWA 5TJJA 1P0ZA 2V2FF 1CI9A 1Z6FA 2JKRM 3OPHA 3VOYA 4L0LA 2HV1A 2B18A 3LIAA 4CPKA 1ONHA 3FYZA 1ERQA 4Z1WA 2WKEA 2XEPA 2Z6DA 4NG2A 2WKPA 4Y5FA 1Q2PA 3K3CA 3T1XA 3G31A 4K0XA 4ARZB 3AGDA 1XX2A 5FQQA 5HARA 2PU4A 3VFFA 3F1OA 3IBJA 1ONGA 4N1HA 1DY6A 5F69A 3AGEA 1BTLA 5A91A 3PXPA 2BTFP 2ZQDA 2WGVA 4MCWA 2K31A 2PBYA 1L0DA 2M1CA 5FL3A 4E3OA 4XT2B 3CUEA 1VQQA 3GV9A 4NXGA 3ZG7B 5IHVA 2FZ0A 4PKYG 4ZAMA 3BQAA 4X1MA 2O9AA 4BL3A 3O3VA 3RXXA 1EROA 2H0YA 2KX6A 2RL3A 3ZG9B 3NOUC 3FPVA 3CITA 4BBUA 3N7WA 2V9AA 2WKHA 1CJFA 3KYEA 1BZAA 2VK3A 3IQAA 4IVIA 3FZCA 3ZGAB 1EI5A 2JKTI 5GHYA 4ZTKA 4GS9B 3MJQA 3C2WA 4G3VA 4P85A 3VE3A 5HD3A 1LL9A 3LEZA 2WZXA 2H0TA 1FOFA 3HREA 3Q1FA 2EX6A 3H82A 1VB6A 4FOFA 3ULFA 5CEBA 2HZ5A 4HH2A 1LLBA 5KIZA 4NK3A 2M7VA 1VEUB 1Q2QA 5CGXA 3T50A 1F98A 1S0WA 5DJUA 3WRTA 4EERA 2XA7M 2IA2A 3SH8A 4QY6A 3Q7ZA 2G2UA 5EVIC 3Q81A 4NXFA 3UDXA 5DVAA 1CEGA 3N8SA 2ZC6B 4WN5A 2J3TD 4LCMA 3VP1A 4MMNA 3VFHA 4KZ5A 2PAVP 1JTGA 2DCFA 2PT7A 4KZ7A 1K55A 5TGFA 1NY0A 1RP5A 4HJ6A 3V3RA 4U0TA 3WS0A 1D7EA 3G4PA 3CPTA 4UA9A 5CHJA 2A2LA 1PI4A 1L2SA 5KSHA 3UDFA 4IHQA 1W7FA 2V0UA 3LY3A 1YPRA 3IS2A 5EE8A 5FAOA 1Y4OA 4S2PA 4QJGA 1DJCA 4Y0UA 1PZOA 1ZTUA 5G4YA 5HWVA 3MXSA 2D01A 4WELA 3QP8A 3T12B 1MY8A 2PYRA 4B4ZA 3BWLA 2O99A 4JLFA 5AJGA 4I5SA 4EBNA 1T1CA 2HGVA 2ZQ7A 3PTEA 1SDNA 3LR4A 1ZG6A 3ITBA 5HPIA 3JVVA 3EGXC 2J80A 1BLPA 4NKPA 1GHMA 1OT6A 1DP8A 3BFEA 3HJIA 2Y2KA 3B33A 5M19A 3LO7A 5FASA 4P6ZS 4KQOA 1WYBA 3IXDA 5DF7A 3TG9A 5HL6A 3O86A 4R1GA 2P08A 4NEED 2OWHA 2VGJA 1LI0A 3KYZA 3NECA 5KSCA 5DTKA 2ZC3B 2WKIA 2FFFB 4S2NC 4KQQA 3B47A 3B3XA 2XGNA 4WL9A 1LSVA 5F5YA 4F94A 5EUAA 4LCLA 4XUZA 3IH9A 4LRYC 4KZ8A 4E3IA 3HLFA 1JWVA 1YLWA 1P9RA 4WM9A 2W3GA 4DE1A 1PW8A 5I94A 5CRFA 4KZ3A 2X02A 4WZ4A 3SZTA 5F1FA 2HF6A 4EU0A 4EV4A 1TS6A 3W4QA 4DRTA 2V20A 2XFSA 1FSYA 1YMXA 2VV7A 1BLCA 3QP2A 3NHQA 3KSGA 4DJ2A 1K4FA 4MBFA 2QMIA 1XA7A 2Q9MA 4JF4A 3HUOA 4OONA 4XXRA 1XXMA 1CQAA 3PAGA 1L0FA 3PR6A 4HQAA 2AVXA 2A3UA 1SKOA 3E4PA 5EVID 5GLBA 3T4SA 2WADA 5HAQA 1V9YA 1VHMA 4R70A 5KZHA 3KSFA 2Y2PA 1S67L 5EOEA 1F2KA 3HCYA 4GNUA 4ZRRA 4Y2FA 4OQGA 3DTKA 4WEKA 5AQ9A 3VP0A 1YLJA 5KMWA 5HSQA 2WAEA 5A92A 4OPZA 3R4KA 4I3JA 1MPLA 1OTEA 2VA0A 5EPHA 3LI9A 5FSRA 4B93A 3HUNA 1KGFA 1X0OA 3HLEA 2M7UA 4QU3A 5L2FA 2Y2LA 3HBRA 3IF6A 1GSVA 1TF1A 3EEHA 3M6HA 5A8BA 3P09A 2H10A 5JYPA 4B9OA 1JWZA 3OOVA 1E3UA 5DJTA 4L9GA 1OTBA 4N9KA 4OPYA 4KENB 3H7WA 2P74A 5CGWA 4EQ1A 1S1YA 1HVBA 3OBFA 2GNXA 5IU1A 2VKSA 1CK3A 3C38A 4BWIA 1N9NA 5MC7A 1LL8A 1ESUA 4BBVA 2QKPA 4MEZA 3MFDA 4HP4A 5HWTA 5F6AA 1HZOA 2I9VA 2W27A 4Q0JA 1ACFA 4MN5A 1HTZA 2Y55A 1NJ4A 1PWGA 1I2WA 3MQ0A 3H7WB 3Q07A 1BUEA 3KSIA 1ERMA 2ZC5B 4PHTA 4WZ5C 1CF0A 3QP4A 3QHYA 1DP9A 1BYWA 2HDQA 3O88A 4YNRA 3UB9A 2P7JA 1BLHA 5DFXA 1MZUA 4OVDA 5AVEA 5FA7A 4IVKA 1N9LA 4KZ6A 4LRZE 1JNUA 2EXAA 4GHIA 2XK1A 1W63Q 4CLCD 2EFUA 3CUEC 1LI9A 1GCEA 3IX3A 2O9CA 4HHDA 3HUMA 3U2AA 3H9WA 4R3BA 4RVAA 2PDRA 3DTMA 5DFYA 3MFXA 3SS4A 1XFNA 2ZQCA 4ZJ1A 2XD1A 4OPRA 1IYPA 3SW1A 3R7WA 2ZOHA 4E04A 3G32A 4KZ4A 2W0NA 2ACGA 4I39A 1I5QA 4RYEA 5F1GA 3ZVWA 4KZAA 1IEMA 3EGDC 4FSFA 5FI7A 4Y17A 2J8YA 2P9VB 3NIAA 4QB8A 5L07A 1ES3A 3C4OA 1MBLA 4M4XA 2W3HA 1NWZA 3U4LP 2VX8A 2J9OA 2J3TC 2J3WA 1PYYA 3UPOA 2R9XA 3VE4A 3T1SA 3K2NA 4R4SA 3BW6A 3PBTA 4OLDA 3AGFA 3GRJA 4HJ3A 2B95A 3GECA 4MN6A 3IXBA 1K54C 1FQGA 1XGJA 2E8IA 2B02A 4ARZA 1DJBA 5EOOA 5TR7A 3OPLA 4GLQA 1RCJA 3WS2A 2XF3A 3B42A 2PHYA 3EEAA 3T4TA 1XGIA 2ZBBA 4IJGA 1MWSA 4WMCD 3HLGA 3UDIA 5IT5A 4UQIM 1LL5A 2EX8A 3E4QA 5I5LA 2O0YA 4PM6A 4XT2A 4LFUA 1K57A 2H5SA 3HLBA 3UB6A 3BY9A 1VM1A 2NUTC 1K38A 1G28A 1AWIA 3S4XA 1UWNX 5HL1A 1BT5A 2PYPA 1KGEA 5HZHA 2JN7A 1U60A 2VEAA 2Z2LB 4LV0A 3CJMA 2R9WA 1OTAA 1L3LA 2ZM0A 5CHUA 2WGWB 1S1ZA 3LY4A 1MC0A 2Y8HA 3S7PA 2MJ6A 3C8CA 2QZ6A 3PBRA 2HJEA 3GDIA 1N9BA 4GS9A 3DTIA 4E6XA 1W5DA 4IUKA 5G18A 2V1BA 2ZL1A 2VGLM 3LI8A 3T1QB 3UN7A 4ETXA 1D1JA 1W79A 2Y2IA 1GA9A 4UA6A 5HPFA 4ID4A 3T4OA 2Q0OA 1DJAA 1VEUA 2V1AA 1STZA 1JVJA 2HJ9C 1NRJA 2KLIA 1FR6A 1ES4A 3NI9A 4YWZA 2XRNA 3M6BA 2V8FA 2ZL1B 3PBQA 4X56A 3SS3A 5AQBA 3QP6A 1G6AA 1ZC2A 5HWWA 3IXGA 3RTYA 2Q9NA 4P6BA 1K6RA 2XROA 1FIKA 4HNBA 1KOUA 4KQRA 2WYXA 2QHKA 4PM7A 4OQHA 2ZQ8A 1YLZA 4NXEA 3E4OA 1AXBA 3DWZA 2XQZA 3MXQA 4RQ9A 5HX9A 3A3FA 3IWIA 3FC7A 4G3KA 4DF6A 3LYXA 3C5AA 4M3KA 1XPBA 1KGGA 1CEFA 2OAQ1 1T18A 1GHPA 1K56A 1OMEA 1Z09A 3FPWA 1YMSA 3D72A 4L9EA 3ZDJA 3JVUA 3CG5A 4OH0A 4CJNA 1XJ6A 1H3QA 3LR0A 3EOIA 3TSGA 5GHZA 2ZQ9A 3IWOA 4GN2A 1OJ5A 2ZOIA 2D02A 3UB7A 3A0VA 4JGQA 1NXYA 2K7SA 4EUZA 4HH3A 2XFTA 2JBFA 1XFQA 3LR3A 4WF0A 1LSXA 5HDDA 2EX2A 3D9YA 1DP6A 3NOTC 4GD8A 3MZFA 2GX5A 3ISGA 4KUOA 4S2OA 4DE3A 2XA7S 1NYMA 2L4RA 4QPRA 5E43A 5DTSA 4GDNA 1IELA 2JC7A 5TBMB 4EW7A 1T1BA 3F1NA 1NYYA 2WKRA 3VP2A 1FCMA 4OKPA 5L8MA 4EBPA 4X55A 4R4RA 4ESPA 3E0YA 3CHWP 1Y28A 4QWOA 4B4XA 3A3DA 3IXHA 2W1RA 3OPRA 4MBHA 1PWCA 1YLYA 4HY8A 4IBRA 1NZOA 3V3SA 3PBSA 3LCEA 1NRFA 4U0XA 4AFIA 4EWFA 4JXSA 3VOLA 3P98A 5M1AA 4MBKA 3W8KA 4Q0HA 3F1NB 2ZMVA 3RFBA 2VJWA 3NBLA 1EW0A 4R38A 1WA9A 5FEGA 2XR0A 4C3QA 4DDSA 3ZG0A 3A0SA 3ZVTA 2WUQA 3CAXA 2JKRI 1SHVA 4P87A 3NOPC 4ZBEA 2OWJA 3GSGA 3M2KA 3FWLA 1PZPA 4CLCC 4O0PA 5BOHA 2YKHA 3MZEA 5CTNA 5CHMA 4E3KA 5EVIA 2ZLYA 2W3FA 1SKFA 3Q7VB 4FD8A 4H6JB 1OPXA 4RA7A 2HP6A 4RX2A 2V0WA 1F9IA 4PAUA 1P9WA 2L1MA 2OSUA 3PAEA 4Y15A 1OJGA 3DW0A 4MDZA 4S2JA 3QNCA 2IWCA 4UHUA 5GLDA 3T4KA 1BULA 3K3DA 4OOMA 3ICYA 3E98A 4IUHA 3GTCA 4X6TA 4BBTA 4DE0A 3OCNA 5EVIB 4BMWA 5FDHA 1LT0A 1MKIA 2G7UA 2ZM2A 3MQQA 1KE3A 4PM5A 3UE1A 1S4SA 2QJ5A 1PWDA 1L0EA 3D4FA 2HP5A 4Y7PA 1H5XA 4HEFA 1TS0A 5E2HA 5EECA 1TD5A 3OZHA 2Y4AA 3VP4A 4L9FA 2X01A 3V50A 5DF8A 1F5MA 4FH4A 4H8RA 5C5KA 4XUXA 1W8QA 1KVLA 1RGYA 4BD1A 4OOYA 3RJUA 2A49A 4DKIA 2BG1A 3EWKA 3I7JA 3IX4A 1XA1A 4LENA 3LFVA 1D06A 5FEFA 4E3MA 4S2IA 4BLMA 1TS7A 2JKTM 2Y79A 1FR1A 4DXCA 2QJ7A 2FH5A 3BY8A 4I3IA 4S2NA 4BENA 4BL2A 1OTDA 1TDGA 4KZBA 1UWPX 3E2KA 1N4OA 1XP4A 3IWQA 2A24B 4S2MA 1SZVA 3BFFA 2K2NA 5GLAA 2EXBA 3NY4A 1TS8A 3DWKA 5GL9A 3ITAA 5EV0A 2EWVA 2WZZA 3UB8A 5L09A 1E3UD 3MMHA 5CXWA 3FG8A 4I38A 3NDGA 1TVFA 1XJ2A 2BLSA 3LIDA 3BRMA 4OP5A 2C5WB 3KO6A 3UPNA 3MKEA 3IF5A 1H8ZA 4S2LA 2VV6A 3G2YA 3W4OA 2XSSA 4UEYA 3BFGA 1K4EA 5HFOA 5J8XA 3FKWA 1QMFA 2P9VA 1IOUA 2V8CA 3VSKA 4CLCB 3UB5P 3T4JA 3WS1A 1H8YA 3TW8A 1ZG4A 2X71A 1LSWA 1YLPA 4GDBA 5FATA 3VV4A 3SOIA 3G6OA 2Z6CA 3HLWA 3MZDA 3MKFA 5J4EA 4K91A 4ME4A 1K25A 4E6WA 1W8YA 4PM9A 1FCOA 4Q8IA 4D60A 4C6YA 1IYOA 5LBRA 2QPNA 5G4ZA 4GB7A 2IWBA 5DKLA 2W1TB 2Y2HA 4WUJA 3PYPA 3V67A 4HJ4A 5FI6A 1KE4A 1L0GA 3RH8B 4DXBA 2JKFA 4BJPA 2EWWA 5A90A 3ZNYA 5K5BA 4HESA 2OV5A 5FAQA 1T1AA 3BFCA 1C3BA 2Y2NA 3ZG5A 5FQIA 4Y3IA 2WGWA 2HP9A 1O7EA 3UE0A 1XKZA 1PW1A 1K55C 2PD7A 2W3DA 3HLCA 3LUQA 2UV0E 4JPMA 2PR6A 3OCLA 4B88A 1E25A 1HD8A 3IX8A 3OPPA 1PNEA 2DMWA 5AQ7A 4Q0IA 4WZ5A 1RGZA 4HOIA 2OLVA 2ZMAA 5HAIA 2Y59A 3PBNA 1IKIA 3MXRA 4S2KA 5DKKA 3L9KA 5GHXA 1JTDA 4A5RA 5FQ9A 1IYQA 4KQDA 4ZJ3A 4MN7A 5DF9A 1ZKJA 1ALQA
chains in the Genus database with same CATH topology
2UWXA 5FQMA 3SH7A 4X68A 4OQGA 5E43A 3GMWA 4WEKA 5FAPA 1Y54A 3N4IA 5AQ9A 3VP0A 5DTSA 1YLJA 4MNRA 5KMWA 3SH9A 3BFDA 4GDNA 2WAEA 1IELA 3Q82A 2JC7A 5A92A 4OPZA 4X53A 1KE0A 3IHAA 1NYYA 3SS5A 3VP2A 1FCMA 1MPLA 4OKPA 4EBPA 2J7VA 3MBZA 5EPHA 4X55A 4WYYA 1FSWA 1IYSA 4R4RA 1SCWA 4DDYA 2I72A 5FSRA 4HBUA 4PMAA 2WK0A 4E3NA 4UA7A 5M18A 4LV2A 3BLSA 3HUNA 1KGFA 4O7DA 1S6RA 3HLEA 4QU3A 4B4XA 3A3DA 3E2LA 5L2FA 2Y2LA 3HBRA 3IXHA 3GQZA 3OPRA 4MBHA 3IF6A 1PWCA 3C7UA 1YLYA 3GR2A 1KVMA 4GOGA 4Y0TA 3M6HA 5JYOA 4IBRA 1NZOA 3V3SA 3PBSA 3P09A 4Y0OA 3LCEA 4PPRA 4QD4A 1NRFA 2ZQAA 2H10A 5JYPA 4D2OA 1ESIA 4WMCA 1SDEA 4U0XA 4EWFA 2ZC7A 3EQUA 3HLDA 3FKVA 4JXSA 1JWZA 5E2EA 1EWZA 3N8RA 4JF6A 3P98A 5M1AA 2JE5A 4MBKA 3W8KA 3TOIA 3BLMA 1E3UA 2G2WA 5U47A 3VSLA 3NBLA 2Y2MA 3IT9A 4N9KA 4OPYA 1FCNA 2B5RA 2DRWA 2XR0A 3A3EA 4KENB 4C3QA 4DDSA 5CGWA 2P74A 3ZG0A 3ZVTA 5CTMA 1HVBA 1NZUA 2WUQA 3VMAA 3N8LA 1E4DA 3G35A 1TEMA 1K54A 4JXVA 3HVFA 4ZDXA 1SHVA 4P87A 4ZBEA 5FQKA 1CK3A 3N6IA 2PU2A 2IWDA 1ESUA 1KDWA 1M6KA 3GSGA 2V2FF 4MEZA 3M2KA 3FWLA 1PZPA 1CI9A 3MFDA 3C7VA 1Z6FA 5BOHA 1HZOA 3OPHA 3MZEA 1MWTA 5CTNA 5CHMA 4E3KA 3VOYA 1HTZA 4L0LA 2HDUA 4GZBA 5EVIA 3IHBA 2Y55A 4JBFA 1NJ4A 2ZLYA 1PWGA 1I2WA 3Q07A 4WEJA 4X69A 4CPKA 1BUEA 1ONHA 3FYZA 1ERQA 1SKFA 3VOZA 3NC8A 3Q7VB 2WKEA 1ERMA 2ZC5B 2XEPA 4FD8A 4WZ5C 4R3JA 2EFXA 3JYIA 1PIOA 3QHYA 2HDSA 4RA7A 2HP6A 4KG6A 2J9PA 4RX2A 1Q2PA 2HDQA 3ZFZA 3O88A 3G31A 4K0XA 3CZDA 2OSUA 1MWRA 4RX3A 3RXWA 1IKGA 3PAEA 3AGDA 1XX2A 3DW0A 5FQQA 1BLHA 5HARA 2PU4A 3VFFA 4S2JA 3QNCA 2IWCA 4UHUA 5GLDA 1BULA 1ONGA 4OLGA 4OOMA 4N1HA 1DY6A 3UY6A 3AGEA 4OVDA 1BTLA 1K56D 2JCHA 3GTCA 5A91A 4X6TA 3V5MA 5FA7A 4DE0A 4JF5A 4IVKA 4KZ9A 4KZ6A 2ZQDA 3OCNA 5EVIB 2WGVA 4QHCA 4MLLA 2PBYA 1YT4A 1L0DA 2EXAA 5FDHA 5A93A 5DTTA 2XK1A 3W4PA 1MKIA 2EFUA 2ZM2A 2C6WB 2ZD8A 4E3OA 1LI9A 1GCEA 1VQQA 1KDSA 3GV9A 1KE3A 4OP8A 4PM5A 3ZG7B 3UE1A 1J9MA 5IHVA 1PWDA 1L0EA 4ZAMA 3HUMA 2GDNA 3D4FA 2HP5A 4Y7PA 4BL3A 3O3VA 4R3BA 1H5XA 4RVAA 3G34A 3DTMA 4HEFA 3RXXA 5E2HA 2ZM8A 5F82A 5EECA 1EROA 2H0YA 2RL3A 3SS4A 3UNWA 2ZQCA 3ZG9B 4ZJ1A 2XD1A 4OPRA 1IYPA 3OZHA 3UO9A 2Y4AA 3G32A 3VP4A 3N7WA 2WKHA 2Y2GA 3IF6C 4KZ4A 2X01A 3V50A 5DF8A 1BZAA 1I5QA 4FH4A 4H8RA 4LV3A 4RYEA 5F1GA 3ZVWA 3BEBA 4KZAA 1IEMA 4XUXA 1W8QA 3ZCZA 1KVLA 3IQAA 4FSFA 1RGYA 4IVIA 5FI7A 2J8YA 1LHYA 2P9VB 3FZCA 3NIAA 3ZGAB 1EI5A 4BD1A 4OOYA 4QB8A 5GHYA 4EBLA 3RJUA 4ZTKA 2A49A 1ES3A 3C4OA 1MBLA 4DKIA 2BG1A 3O87A 2J9OA 3I7JA 1XA1A 4LENA 5CEDA 4P85A 3C4PA 1PYYA 1LL9A 3LEZA 2R9XA 2Y2QA 2WZXA 3UPOA 2H0TA 1FOFA 4S2IA 3HREA 3M2JA 4R4SA 4E3MA 3Q1FA 3PBTA 4BLMA 5CECA 4OLDA 3AGFA 3GRJA 5AQAA 1FR1A 2EX6A 3BM6A 3UE3A 3IXBA 3Q7VA 4GKUA 4DXCA 1K54C 5CEBA 1I2SA 1FQGA 4GD6A 4S2NA 1XGJA 3NDEA 4BENA 4BL2A 1LLBA 2ZJ9A 4N9LA 2E8IA 1TDGA 4NK3A 1DJBA 4KZBA 5EOOA 5FQJA 5TR7A 3OPLA 1Q2QA 5HAPA 4KG5A 5CGXA 1RCJA 3E2KA 3BECA 1N4OA 3WS2A 4C75A 1XP4A 2XF3A 1S0WA 3WWXA 3WRTA 1GA0A 4HBTA 3IWQA 1XGIA 5F83A 4S2MA 4JKTA 1MWUA 3BFFA 4UAAA 3SH8A 4QY6A 1MXOA 5GLAA 2EXBA 3NY4A 3HL9A 3WRZA 3Q7ZA 1MWSA 2V1ZA 2G2UA 3DWKA 4WMCD 3HLGA 5EVIC 3Q81A 5GL9A 3ITAA 3UDXA 3UDIA 1WE4A 3OC2A 5DVAA 2WZZA 2VGKA 1LL5A 1CEGA 3N8SA 2EX8A 2ZC6B 1E3UD 4PM6A 5CXWA 4LCMA 3VP1A 1K57A 2H5SA 3HLBA 3NDGA 1VM1A 1TVFA 4FH2A 3VFHA 1K38A 4KZ5A 2BLSA 1JTGA 2DCFA 3BRMA 2XH9A 4KZ7A 4IEDA 1K55A 4N92A 4OP5A 5TGFA 2Y91A 4OQIA 1NY0A 2C5WB 1RP5A 3S4XA 3UPNA 5TFQA 3V3RA 3A3IA 3MKEA 4LV1A 3IF5A 4U0TA 3WS0A 5HL1A 3G4PA 1BT5A 1KGEA 1H8ZA 4S2LA 2Y2JA 1U60A 4UA9A 5CHJA 4U3TA 3G2YA 1PI4A 1L2SA 3W4OA 4YFMA 1WYCA 5KSHA 2Z2LB 1K6SA 4EQIA 3UDFA 1W7FA 1K4EA 3BFGA 4LV0A 5EVLA 3CJMA 3LY3A 3UPPA 5HFOA 3V39A 2R9WA 1BLSA 5EE8A 5FAOA 5J8XA 4S2PA 2ZM0A 4QJGA 5CGSA 1DJCA 4Y0UA 5CHUA 2HPBA 2XD5A 1PZOA 2WGWB 3FKWA 3MXSA 1QMFA 3LY4A 2P9VA 4WELA 1MY8A 2QZ6A 3VSKA 3PBRA 4OQ0A 4B4ZA 4JLFA 4JXWA 4PM8A 4EBNA 1N9BA 4OPQA 5HW3A 4E6XA 1W5DA 2FFYA 2ZQ7A 5G18A 4DE2A 3PTEA 3WS1A 1SDNA 1ZG6A 3ITBA 1H8YA 3S22A 1ZG4A 2X71A 3UN7A 4BQMA 1BLPA 3VP3A 1W79A 1GHMA 1YM1A 1YLPA 2Y2OA 2HDRA 2Y2IA 1GA9A 4GDBA 3BFEA 5FATA 4UA6A 2Y2KA 3A3JA 3SOIA 5M19A 3LO7A 4ID4A 4E3JA 5FASA 1TDLA 4NETA 5E2GA 4KQOA 3HLWA 3MZDA 1DJAA 1WYBA 3MKFA 3WS4A 3IXDA 4K91A 1JVJA 3ZHHA 5DF7A 3G30A 3TG9A 1K25A 2OLUA 4E6WA 4JXGA 3O86A 1FR6A 1ES4A 3NI9A 4R1GA 1W8YA 2DNSA 1G68A 1YQSA 4PM9A 1FCOA 2XDMA 4Q8IA 2VGJA 3IH8A 4BD0A 1ES2A 4C6YA 3M6BA 1IYOA 1LI0A 3S1YA 4WBGA 2QPNA 3PBQA 4X56A 5KSCA 3SS3A 5DTKA 4GB7A 2IWBA 5AQBA 3NCKA 1G6AA 1ZC2A 2ZC3B 3CMZA 2WKIA 2FFFB 3IXGA 4S2NC 4KQQA 2Q9NA 4P6BA 1K6RA 2Y2HA 3B3XA 2XGNA 4KQRA 2WYXA 2WAFA 4PM7A 4QY5A 4R23A 5FI6A 1KE4A 4F94A 4OQHA 4E3LA 2ZQ8A 4YINA 1L0GA 4DXBA 1YLZA 4BJPA 5EUAA 1AXBA 3ZNYA 5A90A 3DWZA 3FV7A 4LCLA 2XQZA 4XUZA 3BYDA 3IH9A 3ZNTA 5HX9A 4KZ8A 4HESA 3WS5A 4E3IA 3A3FA 3HLFA 1JWVA 1YLWA 3IWIA 2OV5A 2ZC4B 4DF6A 5FAQA 4WM9A 3C5AA 4M3KA 4Z9QA 1XPBA 3QNBA 3IF6B 2RCXA 1KGGA 4DE1A 1CEFA 1PW8A 2EX9A 3BFCA 1C3BA 2Y2NA 1GHPA 5I94A 4K0WA 5CRFA 4KZ3A 5FQIA 3ZG5A 3G2ZA 2X02A 1K56A 1OMEA 1PI5A 1YLTA 4WZ4A 2WGIA 1YMSA 2WGWA 2HP9A 5F1FA 1K57C 3ZDJA 4EV4A 3W4QA 4DRTA 1O7EA 3CG5A 2Z2MB 5E2FA 3UE0A 1XKZA 1PW1A 1K55C 2V20A 2XFSA 4IBXA 3EQVA 1FSYA 1YMXA 1ES5A 4OH0A 3HLCA 4P0MA 1BLCA 4CJNA 3PBOA 1K4FA 4MBFA 2QMIA 4JPMA 1CI8A 5FI2A 1XA7A 1QMEA 1M40A 2Q9MA 3OCLA 3TSGA 4ZJ2A 1JWPA 4B88A 4JF4A 1E25A 3ZG8B 3HUOA 4OONA 1HD8A 4XXRA 3OPPA 5GHZA 2ZQ9A 3IWOA 5AQ7A 4GN2A 1XXMA 4WZ5A 1RGZA 5GLCA 3PAGA 5D3OA 1L0FA 3GVBA 4N1XA 2OLVA 2A3UA 1NXYA 2ZMAA 2Y59A 5HAIA 3PBNA 1IKIA 3MXRA 4S2KA 4EUZA 2XFTA 2XLNA 4KG2A 1O07A 2JBFA 5EVID 4R0QA 5GHXA 5GLBA 2WADA 1JTDA 4A5RA 2EX2A 2CC1A 5HAQA 5FQ9A 4GD8A 1IYQA 4ZJ3A 5KZHA 4FCFA 3MZFA 3ISGA 1BSGA 5DF9A 2Y2PA 4OOLA 1ZKJA 5EOEA 5CERA 4S2OA 4DE3A 1ALQA 1GHIA 4GNUA 1NYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UWX A;  5FQM A;  3SH7 A;  4X68 A;  4OQG A;  5E43 A;  3GMW A;  4WEK A;  5FAP A;  1Y54 A;  3N4I A;  5AQ9 A;  3VP0 A;  5DTS A;  1YLJ A;  4MNR A;  5KMW A;  3SH9 A;  3BFD A;  4GDN A;  2WAE A;  1IEL A;  3Q82 A;  2JC7 A;  5A92 A;  4OPZ A;  4X53 A;  1KE0 A;  3IHA A;  1NYY A;  3SS5 A;  3VP2 A;  1FCM A;  1MPL A;  4OKP A;  4EBP A;  2J7V A;  3MBZ A;  5EPH A;  4X55 A;  4WYY A;  1FSW A;  1IYS A;  4R4R A;  1SCW A;  4DDY A;  2I72 A;  5FSR A;  4HBU A;  4PMA A;  2WK0 A;  4E3N A;  4UA7 A;  5M18 A;  4LV2 A;  3BLS A;  3HUN A;  1KGF A;  4O7D A;  1S6R A;  3HLE A;  4QU3 A;  4B4X A;  3A3D A;  3E2L A;  5L2F A;  2Y2L A;  3HBR A;  3IXH A;  3GQZ A;  3OPR A;  4MBH A;  3IF6 A;  1PWC A;  3C7U A;  1YLY A;  3GR2 A;  1KVM A;  4GOG A;  4Y0T A;  3M6H A;  5JYO A;  4IBR A;  1NZO A;  3V3S A;  3PBS A;  3P09 A;  4Y0O A;  3LCE A;  4PPR A;  4QD4 A;  1NRF A;  2ZQA A;  2H10 A;  5JYP A;  4D2O A;  1ESI A;  4WMC A;  1SDE A;  4U0X A;  4EWF A;  2ZC7 A;  3EQU A;  3HLD A;  3FKV A;  4JXS A;  1JWZ A;  5E2E A;  1EWZ A;  3N8R A;  4JF6 A;  3P98 A;  5M1A A;  2JE5 A;  4MBK A;  3W8K A;  3TOI A;  3BLM A;  1E3U A;  2G2W A;  5U47 A;  3VSL A;  3NBL A;  2Y2M A;  3IT9 A;  4N9K A;  4OPY A;  1FCN A;  2B5R A;  2DRW A;  2XR0 A;  3A3E A;  4KEN B;  4C3Q A;  4DDS A;  5CGW A;  2P74 A;  3ZG0 A;  3ZVT A;  5CTM A;  1HVB A;  1NZU A;  2WUQ A;  3VMA A;  3N8L A;  1E4D A;  3G35 A;  1TEM A;  1K54 A;  4JXV A;  3HVF A;  4ZDX A;  1SHV A;  4P87 A;  4ZBE A;  5FQK A;  1CK3 A;  3N6I A;  2PU2 A;  2IWD A;  1ESU A;  1KDW A;  1M6K A;  3GSG A;  2V2F F;  4MEZ A;  3M2K A;  3FWL A;  1PZP A;  1CI9 A;  3MFD A;  3C7V A;  1Z6F A;  5BOH A;  1HZO A;  3OPH A;  3MZE A;  1MWT A;  5CTN A;  5CHM A;  4E3K A;  3VOY A;  1HTZ A;  4L0L A;  2HDU A;  4GZB A;  5EVI A;  3IHB A;  2Y55 A;  4JBF A;  1NJ4 A;  2ZLY A;  1PWG A;  1I2W A;  3Q07 A;  4WEJ A;  4X69 A;  4CPK A;  1BUE A;  1ONH A;  3FYZ A;  1ERQ A;  1SKF A;  3VOZ A;  3NC8 A;  3Q7V B;  2WKE A;  1ERM A;  2ZC5 B;  2XEP A;  4FD8 A;  4WZ5 C;  4R3J A;  2EFX A;  3JYI A;  1PIO A;  3QHY A;  2HDS A;  4RA7 A;  2HP6 A;  4KG6 A;  2J9P A;  4RX2 A;  1Q2P A;  2HDQ A;  3ZFZ A;  3O88 A;  3G31 A;  4K0X A;  3CZD A;  2OSU A;  1MWR A;  4RX3 A;  3RXW A;  1IKG A;  3PAE A;  3AGD A;  1XX2 A;  3DW0 A;  5FQQ A;  1BLH A;  5HAR A;  2PU4 A;  3VFF A;  4S2J A;  3QNC A;  2IWC A;  4UHU A;  5GLD A;  1BUL A;  1ONG A;  4OLG A;  4OOM A;  4N1H A;  1DY6 A;  3UY6 A;  3AGE A;  4OVD A;  1BTL A;  1K56 D;  2JCH A;  3GTC A;  5A91 A;  4X6T A;  3V5M A;  5FA7 A;  4DE0 A;  4JF5 A;  4IVK A;  4KZ9 A;  4KZ6 A;  2ZQD A;  3OCN A;  5EVI B;  2WGV A;  4QHC A;  4MLL A;  2PBY A;  1YT4 A;  1L0D A;  2EXA A;  5FDH A;  5A93 A;  5DTT A;  2XK1 A;  3W4P A;  1MKI A;  2EFU A;  2ZM2 A;  2C6W B;  2ZD8 A;  4E3O A;  1LI9 A;  1GCE A;  1VQQ A;  1KDS A;  3GV9 A;  1KE3 A;  4OP8 A;  4PM5 A;  3ZG7 B;  3UE1 A;  1J9M A;  5IHV A;  1PWD A;  1L0E A;  4ZAM A;  3HUM A;  2GDN A;  3D4F A;  2HP5 A;  4Y7P A;  4BL3 A;  3O3V A;  4R3B A;  1H5X A;  4RVA A;  3G34 A;  3DTM A;  4HEF A;  3RXX A;  5E2H A;  2ZM8 A;  5F82 A;  5EEC A;  1ERO A;  2H0Y A;  2RL3 A;  3SS4 A;  3UNW A;  2ZQC A;  3ZG9 B;  4ZJ1 A;  2XD1 A;  4OPR A;  1IYP A;  3OZH A;  3UO9 A;  2Y4A A;  3G32 A;  3VP4 A;  3N7W A;  2WKH A;  2Y2G A;  3IF6 C;  4KZ4 A;  2X01 A;  3V50 A;  5DF8 A;  1BZA A;  1I5Q A;  4FH4 A;  4H8R A;  4LV3 A;  4RYE A;  5F1G A;  3ZVW A;  3BEB A;  4KZA A;  1IEM A;  4XUX A;  1W8Q A;  3ZCZ A;  1KVL A;  3IQA A;  4FSF A;  1RGY A;  4IVI A;  5FI7 A;  2J8Y A;  1LHY A;  2P9V B;  3FZC A;  3NIA A;  3ZGA B;  1EI5 A;  4BD1 A;  4OOY A;  4QB8 A;  5GHY A;  4EBL A;  3RJU A;  4ZTK A;  2A49 A;  1ES3 A;  3C4O A;  1MBL A;  4DKI A;  2BG1 A;  3O87 A;  2J9O A;  3I7J A;  1XA1 A;  4LEN A;  5CED A;  4P85 A;  3C4P A;  1PYY A;  1LL9 A;  3LEZ A;  2R9X A;  2Y2Q A;  2WZX A;  3UPO A;  2H0T A;  1FOF A;  4S2I A;  3HRE A;  3M2J A;  4R4S A;  4E3M A;  3Q1F A;  3PBT A;  4BLM A;  5CEC A;  4OLD A;  3AGF A;  3GRJ A;  5AQA A;  1FR1 A;  2EX6 A;  3BM6 A;  3UE3 A;  3IXB A;  3Q7V A;  4GKU A;  4DXC A;  1K54 C;  5CEB A;  1I2S A;  1FQG A;  4GD6 A;  4S2N A;  1XGJ A;  3NDE A;  4BEN A;  4BL2 A;  1LLB A;  2ZJ9 A;  4N9L A;  2E8I A;  1TDG A;  4NK3 A;  1DJB A;  4KZB A;  5EOO A;  5FQJ A;  5TR7 A;  3OPL A;  1Q2Q A;  5HAP A;  4KG5 A;  5CGX A;  1RCJ A;  3E2K A;  3BEC A;  1N4O A;  3WS2 A;  4C75 A;  1XP4 A;  2XF3 A;  1S0W A;  3WWX A;  3WRT A;  1GA0 A;  4HBT A;  3IWQ A;  1XGI A;  5F83 A;  4S2M A;  4JKT A;  1MWU A;  3BFF A;  4UAA A;  3SH8 A;  4QY6 A;  1MXO A;  5GLA A;  2EXB A;  3NY4 A;  3HL9 A;  3WRZ A;  3Q7Z A;  1MWS A;  2V1Z A;  2G2U A;  3DWK A;  4WMC D;  3HLG A;  5EVI C;  3Q81 A;  5GL9 A;  3ITA A;  3UDX A;  3UDI A;  1WE4 A;  3OC2 A;  5DVA A;  2WZZ A;  2VGK A;  1LL5 A;  1CEG A;  3N8S A;  2EX8 A;  2ZC6 B;  1E3U D;  4PM6 A;  5CXW A;  4LCM A;  3VP1 A;  1K57 A;  2H5S A;  3HLB A;  3NDG A;  1VM1 A;  1TVF A;  4FH2 A;  3VFH A;  1K38 A;  4KZ5 A;  2BLS A;  1JTG A;  2DCF A;  3BRM A;  2XH9 A;  4KZ7 A;  4IED A;  1K55 A;  4N92 A;  4OP5 A;  5TGF A;  2Y91 A;  4OQI A;  1NY0 A;  2C5W B;  1RP5 A;  3S4X A;  3UPN A;  5TFQ A;  3V3R A;  3A3I A;  3MKE A;  4LV1 A;  3IF5 A;  4U0T A;  3WS0 A;  5HL1 A;  3G4P A;  1BT5 A;  1KGE A;  1H8Z A;  4S2L A;  2Y2J A;  1U60 A;  4UA9 A;  5CHJ A;  4U3T A;  3G2Y A;  1PI4 A;  1L2S A;  3W4O A;  4YFM A;  1WYC A;  5KSH A;  2Z2L B;  1K6S A;  4EQI A;  3UDF A;  1W7F A;  1K4E A;  3BFG A;  4LV0 A;  5EVL A;  3CJM A;  3LY3 A;  3UPP A;  5HFO A;  3V39 A;  2R9W A;  1BLS A;  5EE8 A;  5FAO A;  5J8X A;  4S2P A;  2ZM0 A;  4QJG A;  5CGS A;  1DJC A;  4Y0U A;  5CHU A;  2HPB A;  2XD5 A;  1PZO A;  2WGW B;  3FKW A;  3MXS A;  1QMF A;  3LY4 A;  2P9V A;  4WEL A;  1MY8 A;  2QZ6 A;  3VSK A;  3PBR A;  4OQ0 A;  4B4Z A;  4JLF A;  4JXW A;  4PM8 A;  4EBN A;  1N9B A;  4OPQ A;  5HW3 A;  4E6X A;  1W5D A;  2FFY A;  2ZQ7 A;  5G18 A;  4DE2 A;  3PTE A;  3WS1 A;  1SDN A;  1ZG6 A;  3ITB A;  1H8Y A;  3S22 A;  1ZG4 A;  2X71 A;  3UN7 A;  4BQM A;  1BLP A;  3VP3 A;  1W79 A;  1GHM A;  1YM1 A;  1YLP A;  2Y2O A;  2HDR A;  2Y2I A;  1GA9 A;  4GDB A;  3BFE A;  5FAT A;  4UA6 A;  2Y2K A;  3A3J A;  3SOI A;  5M19 A;  3LO7 A;  4ID4 A;  4E3J A;  5FAS A;  1TDL A;  4NET A;  5E2G A;  4KQO A;  3HLW A;  3MZD A;  1DJA A;  1WYB A;  3MKF A;  3WS4 A;  3IXD A;  4K91 A;  1JVJ A;  3ZHH A;  5DF7 A;  3G30 A;  3TG9 A;  1K25 A;  2OLU A;  4E6W A;  4JXG A;  3O86 A;  1FR6 A;  1ES4 A;  3NI9 A;  4R1G A;  1W8Y A;  2DNS A;  1G68 A;  1YQS A;  4PM9 A;  1FCO A;  2XDM A;  4Q8I A;  2VGJ A;  3IH8 A;  4BD0 A;  1ES2 A;  4C6Y A;  3M6B A;  1IYO A;  1LI0 A;  3S1Y A;  4WBG A;  2QPN A;  3PBQ A;  4X56 A;  5KSC A;  3SS3 A;  5DTK A;  4GB7 A;  2IWB A;  5AQB A;  3NCK A;  1G6A A;  1ZC2 A;  2ZC3 B;  3CMZ A;  2WKI A;  2FFF B;  3IXG A;  4S2N C;  4KQQ A;  2Q9N A;  4P6B A;  1K6R A;  2Y2H A;  3B3X A;  2XGN A;  4KQR A;  2WYX A;  2WAF A;  4PM7 A;  4QY5 A;  4R23 A;  5FI6 A;  1KE4 A;  4F94 A;  4OQH A;  4E3L A;  2ZQ8 A;  4YIN A;  1L0G A;  4DXB A;  1YLZ A;  4BJP A;  5EUA A;  1AXB A;  3ZNY A;  5A90 A;  3DWZ A;  3FV7 A;  4LCL A;  2XQZ A;  4XUZ A;  3BYD A;  3IH9 A;  3ZNT A;  5HX9 A;  4KZ8 A;  4HES A;  3WS5 A;  4E3I A;  3A3F A;  3HLF A;  1JWV A;  1YLW A;  3IWI A;  2OV5 A;  2ZC4 B;  4DF6 A;  5FAQ A;  4WM9 A;  3C5A A;  4M3K A;  4Z9Q A;  1XPB A;  3QNB A;  3IF6 B;  2RCX A;  1KGG A;  4DE1 A;  1CEF A;  1PW8 A;  2EX9 A;  3BFC A;  1C3B A;  2Y2N A;  1GHP A;  5I94 A;  4K0W A;  5CRF A;  4KZ3 A;  5FQI A;  3ZG5 A;  3G2Z A;  2X02 A;  1K56 A;  1OME A;  1PI5 A;  1YLT A;  4WZ4 A;  2WGI A;  1YMS A;  2WGW A;  2HP9 A;  5F1F A;  1K57 C;  3ZDJ A;  4EV4 A;  3W4Q A;  4DRT A;  1O7E A;  3CG5 A;  2Z2M B;  5E2F A;  3UE0 A;  1XKZ A;  1PW1 A;  1K55 C;  2V20 A;  2XFS A;  4IBX A;  3EQV A;  1FSY A;  1YMX A;  1ES5 A;  4OH0 A;  3HLC A;  4P0M A;  1BLC A;  4CJN A;  3PBO A;  1K4F A;  4MBF A;  2QMI A;  4JPM A;  1CI8 A;  5FI2 A;  1XA7 A;  1QME A;  1M40 A;  2Q9M A;  3OCL A;  3TSG A;  4ZJ2 A;  1JWP A;  4B88 A;  4JF4 A;  1E25 A;  3ZG8 B;  3HUO A;  4OON A;  1HD8 A;  4XXR A;  3OPP A;  5GHZ A;  2ZQ9 A;  3IWO A;  5AQ7 A;  4GN2 A;  1XXM A;  4WZ5 A;  1RGZ A;  5GLC A;  3PAG A;  5D3O A;  1L0F A;  3GVB A;  4N1X A;  2OLV A;  2A3U A;  1NXY A;  2ZMA A;  2Y59 A;  5HAI A;  3PBN A;  1IKI A;  3MXR A;  4S2K A;  4EUZ A;  2XFT A;  2XLN A;  4KG2 A;  1O07 A;  2JBF A;  5EVI D;  4R0Q A;  5GHX A;  5GLB A;  2WAD A;  1JTD A;  4A5R A;  2EX2 A;  2CC1 A;  5HAQ A;  5FQ9 A;  4GD8 A;  1IYQ A;  4ZJ3 A;  5KZH A;  4FCF A;  3MZF A;  3ISG A;  1BSG A;  5DF9 A;  2Y2P A;  4OOL A;  1ZKJ A;  5EOE A;  5CER A;  4S2O A;  4DE3 A;  1ALQ A;  1GHI A;  4GNU A;  1NYM A; 
#chains in the Genus database with same CATH topology
 5FQM A;  4X25 A;  4X68 A;  3GMW A;  4GJ4 A;  3TJZ C;  4UQI S;  3Q82 A;  5L10 A;  4X53 A;  1KE0 A;  3SS5 A;  2H28 A;  2J7V A;  3MBZ A;  3F1O B;  1FSW A;  1IYS A;  1SCW A;  3LIE A;  3P7N A;  4HBU A;  4PMA A;  4UA7 A;  3BLS A;  4O7D A;  3E2L A;  3GQZ A;  3GR2 A;  1KVM A;  3LEQ A;  4Y0O A;  4QD4 A;  5FDS A;  2ZQA A;  1ESI A;  1SDE A;  1YSQ A;  3HLD A;  5E2E A;  1EWZ A;  3N8R A;  2GZA A;  3CWF A;  4FTX A;  3TOI A;  3BLM A;  2G2W A;  1K0K A;  3UMD A;  3VSL A;  3UE6 A;  2Y2M A;  2KDK A;  2B5R A;  2DRW A;  3A3E A;  2PRF A;  4K08 A;  4NXB A;  3UME A;  3VMA A;  3G35 A;  4FUW A;  3P01 A;  1K54 A;  3T1R A;  2VGL S;  3HVF A;  3LIC A;  5FQK A;  5F68 A;  2IWD A;  3TRC A;  4R6L A;  1M6K A;  4HI4 A;  1J3W A;  2VV8 A;  3C7V A;  3LGO A;  1MWT A;  1DRM A;  3DBA A;  2HDU A;  1PFL A;  4GZB A;  3IHB A;  4JBF A;  4WEJ A;  4X69 A;  2R78 A;  4I3A A;  1UGU A;  3VOZ A;  3H82 B;  3NC8 A;  1G5U A;  4P6Z M;  5EM1 A;  1ZHH B;  4R3J A;  2EFX A;  3HJK A;  3JYI A;  1PIO A;  5TBM A;  2HDS A;  4X1L A;  4KG6 A;  3D3O A;  2J9P A;  3DTE A;  3ZFZ A;  3CZD A;  1MWR A;  4RX3 A;  3RXW A;  1IKG A;  3ZQ5 A;  1XJ4 A;  5EVE A;  4OLG A;  4GCZ A;  3LR5 A;  3UY6 A;  2PD8 A;  1K56 D;  2JCH A;  3V5M A;  4DJ3 A;  4JF5 A;  4KZ9 A;  4QHC A;  4MLL A;  4CLC E;  4F3L A;  1YT4 A;  3S7N A;  5A93 A;  5DTT A;  3W4P A;  1GSX A;  2C6W B;  2ZD8 A;  1KDS A;  4OP8 A;  1J9M A;  1OT9 A;  2GDN A;  2VLG A;  3G34 A;  3PHY A;  5J7E A;  3CPT B;  2ZM8 A;  3IBR A;  2INW A;  5F82 A;  3UNW A;  3LIB A;  2VZW A;  3UO9 A;  1PRQ A;  3NJA A;  2Y2G A;  3IF6 C;  3IS2 B;  1T19 A;  4F3L B;  4LV3 A;  3BEB A;  1VET A;  3ZCZ A;  4EES A;  4HIA A;  1LHY A;  3KSH A;  4EBL A;  1HLU P;  3O87 A;  5CED A;  3C4P A;  3LIF A;  2Y2Q A;  3M2J A;  5CEC A;  5AQA A;  3BM6 A;  3UE3 A;  2LB9 A;  3Q7V A;  4GKU A;  4H6J A;  1I2S A;  3KYQ A;  1MKM A;  4GD6 A;  3NDE A;  1YSP A;  2ZJ9 A;  4N9L A;  1VET B;  3S7Q A;  5FQJ A;  5HAP A;  3A0R A;  4KG5 A;  3BEC A;  5HDS A;  4C75 A;  3WWX A;  1GA0 A;  4HBT A;  1V9Z A;  5F83 A;  4DMZ A;  4JKT A;  1MWU A;  4JGP A;  4UAA A;  1MXO A;  2L0W A;  3DAV A;  3HL9 A;  3WRZ A;  2V1Z A;  4PKY A;  3L7H A;  1A0K A;  1WE4 A;  3OC2 A;  2VGK A;  2JHE A;  2QWS A;  4FH2 A;  2XH9 A;  4IED A;  4N92 A;  2Y91 A;  4OQI A;  5TFQ A;  3A3I A;  4LV1 A;  4EEU A;  4CQH A;  2Y2J A;  4GW9 A;  4U3T A;  4YFM A;  2KOI A;  4O8G A;  1WYC A;  1K6S A;  4ETZ A;  4EQI A;  3UPP A;  3V39 A;  5EVL A;  1BLS A;  5EM0 A;  1XJ3 A;  4EEP A;  5CGS A;  1FIL A;  2HPB A;  2XD5 A;  2P04 A;  4DN0 A;  4EXO A;  2PBD P;  4JGR A;  1H0M A;  3T4Q A;  3T4L A;  4OQ0 A;  4II7 A;  4JXW A;  2QYB A;  4PM8 A;  4OPQ A;  3NUL A;  4LGW A;  5HW3 A;  2FFY A;  4DE2 A;  4EUV A;  3S22 A;  1YAX A;  3KX0 X;  4BQM A;  2BAS A;  2OAP 1;  3VP3 A;  1YM1 A;  2WKQ A;  3MQO A;  2Y2O A;  2HDR A;  1N9O A;  3A3J A;  3OLO A;  4E3J A;  1TDL A;  4NET A;  5E2G A;  1SKO B;  1H8M A;  3WS4 A;  5IS1 A;  3ZHH A;  3G30 A;  2OLU A;  4JXG A;  3ZYT A;  3C30 A;  2A24 A;  2DNS A;  1G68 A;  1YQS A;  2LB5 A;  2XDM A;  4Y13 A;  1S4R A;  3IH8 A;  3W2Z A;  4BD0 A;  1ES2 A;  3S1Y A;  4WBG A;  4HP9 A;  3NCK A;  3CMZ A;  1YKD A;  1G6O A;  1NLZ A;  2WAF A;  4R23 A;  4QY5 A;  3BJN A;  4E3L A;  4YIN A;  3FV7 A;  3ZNT A;  3BYD A;  2OOL A;  3F1P A;  3WS5 A;  2ZC4 B;  2W3E A;  4Z9Q A;  3QNB A;  3IF6 B;  2RCX A;  5EFW A;  2EX9 A;  3BQ8 A;  4K0W A;  2YKF A;  3G2Z A;  1PI5 A;  1YLT A;  2WGI A;  3MR0 A;  1K57 C;  2Z2M B;  5E2F A;  4LRX C;  4IBX A;  3EQV A;  4CLC A;  1ES5 A;  4P0M A;  3PBO A;  2CMN A;  2O9B A;  1CI8 A;  5FI2 A;  1QME A;  3CLO A;  1M40 A;  4ZJ2 A;  1JWP A;  3F1P B;  4LPZ A;  3ZG8 B;  2E8J A;  1W63 M;  2NUP C;  3QP5 A;  5GLC A;  3MS6 A;  5D3O A;  3GVB A;  4N1X A;  1ODV A;  2XLN A;  4KG2 A;  3MF0 A;  1O07 A;  4O01 A;  4R3A A;  3O5Y A;  4R0Q A;  2CC1 A;  4YOF A;  4FCF A;  1BSG A;  4OOL A;  5CER A;  1GHI A;  2UWX A;  3SH7 A;  5FAP A;  1Y54 A;  3N4I A;  4MNR A;  3SH9 A;  2W1T A;  4G3W A;  3BFD A;  3IHA A;  1OTI A;  2JKG A;  3TE8 A;  3MSH A;  4WYY A;  4WLA A;  4DDY A;  2I72 A;  2WK0 A;  4E3N A;  5M18 A;  4LV2 A;  5CX7 A;  4LLO B;  1S6R A;  5J3W A;  1IFQ A;  3C7U A;  4GOG A;  4Y0T A;  5JYO A;  4JGO A;  4GHI B;  4PPR A;  4D2O A;  1S66 L;  3QP1 A;  4WMC A;  3S7O A;  2ZC7 A;  3EQU A;  5HDC A;  3FKV A;  5HD5 A;  4JF6 A;  2EA9 A;  2JE5 A;  1NLY A;  2ZMF A;  3CI6 A;  5U47 A;  1GSW A;  4KUK A;  3IT9 A;  3JPU A;  1FCN A;  5AVF A;  5CTM A;  2GJ3 A;  3R7W B;  1NZU A;  1P97 A;  3N8L A;  1E4D A;  1TEM A;  4JXV A;  4ZDX A;  4EET B;  2PR5 A;  3N6I A;  2PU2 A;  1KDW A;  5TJJ A;  1P0Z A;  2V2F F;  1CI9 A;  1Z6F A;  2JKR M;  3OPH A;  3VOY A;  4L0L A;  2HV1 A;  2B18 A;  3LIA A;  4CPK A;  1ONH A;  3FYZ A;  1ERQ A;  4Z1W A;  2WKE A;  2XEP A;  2Z6D A;  4NG2 A;  2WKP A;  4Y5F A;  1Q2P A;  3K3C A;  3T1X A;  3G31 A;  4K0X A;  4ARZ B;  3AGD A;  1XX2 A;  5FQQ A;  5HAR A;  2PU4 A;  3VFF A;  3F1O A;  3IBJ A;  1ONG A;  4N1H A;  1DY6 A;  5F69 A;  3AGE A;  1BTL A;  5A91 A;  3PXP A;  2BTF P;  2ZQD A;  2WGV A;  4MCW A;  2K31 A;  2PBY A;  1L0D A;  2M1C A;  5FL3 A;  4E3O A;  4XT2 B;  3CUE A;  1VQQ A;  3GV9 A;  4NXG A;  3ZG7 B;  5IHV A;  2FZ0 A;  4PKY G;  4ZAM A;  3BQA A;  4X1M A;  2O9A A;  4BL3 A;  3O3V A;  3RXX A;  1ERO A;  2H0Y A;  2KX6 A;  2RL3 A;  3ZG9 B;  3NOU C;  3FPV A;  3CIT A;  4BBU A;  3N7W A;  2V9A A;  2WKH A;  1CJF A;  3KYE A;  1BZA A;  2VK3 A;  3IQA A;  4IVI A;  3FZC A;  3ZGA B;  1EI5 A;  2JKT I;  5GHY A;  4ZTK A;  4GS9 B;  3MJQ A;  3C2W A;  4G3V A;  4P85 A;  3VE3 A;  5HD3 A;  1LL9 A;  3LEZ A;  2WZX A;  2H0T A;  1FOF A;  3HRE A;  3Q1F A;  2EX6 A;  3H82 A;  1VB6 A;  4FOF A;  3ULF A;  5CEB A;  2HZ5 A;  4HH2 A;  1LLB A;  5KIZ A;  4NK3 A;  2M7V A;  1VEU B;  1Q2Q A;  5CGX A;  3T50 A;  1F98 A;  1S0W A;  5DJU A;  3WRT A;  4EER A;  2XA7 M;  2IA2 A;  3SH8 A;  4QY6 A;  3Q7Z A;  2G2U A;  5EVI C;  3Q81 A;  4NXF A;  3UDX A;  5DVA A;  1CEG A;  3N8S A;  2ZC6 B;  4WN5 A;  2J3T D;  4LCM A;  3VP1 A;  4MMN A;  3VFH A;  4KZ5 A;  2PAV P;  1JTG A;  2DCF A;  2PT7 A;  4KZ7 A;  1K55 A;  5TGF A;  1NY0 A;  1RP5 A;  4HJ6 A;  3V3R A;  4U0T A;  3WS0 A;  1D7E A;  3G4P A;  3CPT A;  4UA9 A;  5CHJ A;  2A2L A;  1PI4 A;  1L2S A;  5KSH A;  3UDF A;  4IHQ A;  1W7F A;  2V0U A;  3LY3 A;  1YPR A;  3IS2 A;  5EE8 A;  5FAO A;  1Y4O A;  4S2P A;  4QJG A;  1DJC A;  4Y0U A;  1PZO A;  1ZTU A;  5G4Y A;  5HWV A;  3MXS A;  2D01 A;  4WEL A;  3QP8 A;  3T12 B;  1MY8 A;  2PYR A;  4B4Z A;  3BWL A;  2O99 A;  4JLF A;  5AJG A;  4I5S A;  4EBN A;  1T1C A;  2HGV A;  2ZQ7 A;  3PTE A;  1SDN A;  3LR4 A;  1ZG6 A;  3ITB A;  5HPI A;  3JVV A;  3EGX C;  2J80 A;  1BLP A;  4NKP A;  1GHM A;  1OT6 A;  1DP8 A;  3BFE A;  3HJI A;  2Y2K A;  3B33 A;  5M19 A;  3LO7 A;  5FAS A;  4P6Z S;  4KQO A;  1WYB A;  3IXD A;  5DF7 A;  3TG9 A;  5HL6 A;  3O86 A;  4R1G A;  2P08 A;  4NEE D;  2OWH A;  2VGJ A;  1LI0 A;  3KYZ A;  3NEC A;  5KSC A;  5DTK A;  2ZC3 B;  2WKI A;  2FFF B;  4S2N C;  4KQQ A;  3B47 A;  3B3X A;  2XGN A;  4WL9 A;  1LSV A;  5F5Y A;  4F94 A;  5EUA A;  4LCL A;  4XUZ A;  3IH9 A;  4LRY C;  4KZ8 A;  4E3I A;  3HLF A;  1JWV A;  1YLW A;  1P9R A;  4WM9 A;  2W3G A;  4DE1 A;  1PW8 A;  5I94 A;  5CRF A;  4KZ3 A;  2X02 A;  4WZ4 A;  3SZT A;  5F1F A;  2HF6 A;  4EU0 A;  4EV4 A;  1TS6 A;  3W4Q A;  4DRT A;  2V20 A;  2XFS A;  1FSY A;  1YMX A;  2VV7 A;  1BLC A;  3QP2 A;  3NHQ A;  3KSG A;  4DJ2 A;  1K4F A;  4MBF A;  2QMI A;  1XA7 A;  2Q9M A;  4JF4 A;  3HUO A;  4OON A;  4XXR A;  1XXM A;  1CQA A;  3PAG A;  1L0F A;  3PR6 A;  4HQA A;  2AVX A;  2A3U A;  1SKO A;  3E4P A;  5EVI D;  5GLB A;  3T4S A;  2WAD A;  5HAQ A;  1V9Y A;  1VHM A;  4R70 A;  5KZH A;  3KSF A;  2Y2P A;  1S67 L;  5EOE A;  1F2K A;  3HCY A;  4GNU A;  4ZRR A;  4Y2F A;  4OQG A;  3DTK A;  4WEK A;  5AQ9 A;  3VP0 A;  1YLJ A;  5KMW A;  5HSQ A;  2WAE A;  5A92 A;  4OPZ A;  3R4K A;  4I3J A;  1MPL A;  1OTE A;  2VA0 A;  5EPH A;  3LI9 A;  5FSR A;  4B93 A;  3HUN A;  1KGF A;  1X0O A;  3HLE A;  2M7U A;  4QU3 A;  5L2F A;  2Y2L A;  3HBR A;  3IF6 A;  1GSV A;  1TF1 A;  3EEH A;  3M6H A;  5A8B A;  3P09 A;  2H10 A;  5JYP A;  4B9O A;  1JWZ A;  3OOV A;  1E3U A;  5DJT A;  4L9G A;  1OTB A;  4N9K A;  4OPY A;  4KEN B;  3H7W A;  2P74 A;  5CGW A;  4EQ1 A;  1S1Y A;  1HVB A;  3OBF A;  2GNX A;  5IU1 A;  2VKS A;  1CK3 A;  3C38 A;  4BWI A;  1N9N A;  5MC7 A;  1LL8 A;  1ESU A;  4BBV A;  2QKP A;  4MEZ A;  3MFD A;  4HP4 A;  5HWT A;  5F6A A;  1HZO A;  2I9V A;  2W27 A;  4Q0J A;  1ACF A;  4MN5 A;  1HTZ A;  2Y55 A;  1NJ4 A;  1PWG A;  1I2W A;  3MQ0 A;  3H7W B;  3Q07 A;  1BUE A;  3KSI A;  1ERM A;  2ZC5 B;  4PHT A;  4WZ5 C;  1CF0 A;  3QP4 A;  3QHY A;  1DP9 A;  1BYW A;  2HDQ A;  3O88 A;  4YNR A;  3UB9 A;  2P7J A;  1BLH A;  5DFX A;  1MZU A;  4OVD A;  5AVE A;  5FA7 A;  4IVK A;  1N9L A;  4KZ6 A;  4LRZ E;  1JNU A;  2EXA A;  4GHI A;  2XK1 A;  1W63 Q;  4CLC D;  2EFU A;  3CUE C;  1LI9 A;  1GCE A;  3IX3 A;  2O9C A;  4HHD A;  3HUM A;  3U2A A;  3H9W A;  4R3B A;  4RVA A;  2PDR A;  3DTM A;  5DFY A;  3MFX A;  3SS4 A;  1XFN A;  2ZQC A;  4ZJ1 A;  2XD1 A;  4OPR A;  1IYP A;  3SW1 A;  3R7W A;  2ZOH A;  4E04 A;  3G32 A;  4KZ4 A;  2W0N A;  2ACG A;  4I39 A;  1I5Q A;  4RYE A;  5F1G A;  3ZVW A;  4KZA A;  1IEM A;  3EGD C;  4FSF A;  5FI7 A;  4Y17 A;  2J8Y A;  2P9V B;  3NIA A;  4QB8 A;  5L07 A;  1ES3 A;  3C4O A;  1MBL A;  4M4X A;  2W3H A;  1NWZ A;  3U4L P;  2VX8 A;  2J9O A;  2J3T C;  2J3W A;  1PYY A;  3UPO A;  2R9X A;  3VE4 A;  3T1S A;  3K2N A;  4R4S A;  3BW6 A;  3PBT A;  4OLD A;  3AGF A;  3GRJ A;  4HJ3 A;  2B95 A;  3GEC A;  4MN6 A;  3IXB A;  1K54 C;  1FQG A;  1XGJ A;  2E8I A;  2B02 A;  4ARZ A;  1DJB A;  5EOO A;  5TR7 A;  3OPL A;  4GLQ A;  1RCJ A;  3WS2 A;  2XF3 A;  3B42 A;  2PHY A;  3EEA A;  3T4T A;  1XGI A;  2ZBB A;  4IJG A;  1MWS A;  4WMC D;  3HLG A;  3UDI A;  5IT5 A;  4UQI M;  1LL5 A;  2EX8 A;  3E4Q A;  5I5L A;  2O0Y A;  4PM6 A;  4XT2 A;  4LFU A;  1K57 A;  2H5S A;  3HLB A;  3UB6 A;  3BY9 A;  1VM1 A;  2NUT C;  1K38 A;  1G28 A;  1AWI A;  3S4X A;  1UWN X;  5HL1 A;  1BT5 A;  2PYP A;  1KGE A;  5HZH A;  2JN7 A;  1U60 A;  2VEA A;  2Z2L B;  4LV0 A;  3CJM A;  2R9W A;  1OTA A;  1L3L A;  2ZM0 A;  5CHU A;  2WGW B;  1S1Z A;  3LY4 A;  1MC0 A;  2Y8H A;  3S7P A;  2MJ6 A;  3C8C A;  2QZ6 A;  3PBR A;  2HJE A;  3GDI A;  1N9B A;  4GS9 A;  3DTI A;  4E6X A;  1W5D A;  4IUK A;  5G18 A;  2V1B A;  2ZL1 A;  2VGL M;  3LI8 A;  3T1Q B;  3UN7 A;  4ETX A;  1D1J A;  1W79 A;  2Y2I A;  1GA9 A;  4UA6 A;  5HPF A;  4ID4 A;  3T4O A;  2Q0O A;  1DJA A;  1VEU A;  2V1A A;  1STZ A;  1JVJ A;  2HJ9 C;  1NRJ A;  2KLI A;  1FR6 A;  1ES4 A;  3NI9 A;  4YWZ A;  2XRN A;  3M6B A;  2V8F A;  2ZL1 B;  3PBQ A;  4X56 A;  3SS3 A;  5AQB A;  3QP6 A;  1G6A A;  1ZC2 A;  5HWW A;  3IXG A;  3RTY A;  2Q9N A;  4P6B A;  1K6R A;  2XRO A;  1FIK A;  4HNB A;  1KOU A;  4KQR A;  2WYX A;  2QHK A;  4PM7 A;  4OQH A;  2ZQ8 A;  1YLZ A;  4NXE A;  3E4O A;  1AXB A;  3DWZ A;  2XQZ A;  3MXQ A;  4RQ9 A;  5HX9 A;  3A3F A;  3IWI A;  3FC7 A;  4G3K A;  4DF6 A;  3LYX A;  3C5A A;  4M3K A;  1XPB A;  1KGG A;  1CEF A;  2OAQ 1;  1T18 A;  1GHP A;  1K56 A;  1OME A;  1Z09 A;  3FPW A;  1YMS A;  3D72 A;  4L9E A;  3ZDJ A;  3JVU A;  3CG5 A;  4OH0 A;  4CJN A;  1XJ6 A;  1H3Q A;  3LR0 A;  3EOI A;  3TSG A;  5GHZ A;  2ZQ9 A;  3IWO A;  4GN2 A;  1OJ5 A;  2ZOI A;  2D02 A;  3UB7 A;  3A0V A;  4JGQ A;  1NXY A;  2K7S A;  4EUZ A;  4HH3 A;  2XFT A;  2JBF A;  1XFQ A;  3LR3 A;  4WF0 A;  1LSX A;  5HDD A;  2EX2 A;  3D9Y A;  1DP6 A;  3NOT C;  4GD8 A;  3MZF A;  2GX5 A;  3ISG A;  4KUO A;  4S2O A;  4DE3 A;  2XA7 S;  1NYM A;  2L4R A;  4QPR A;  5E43 A;  5DTS A;  4GDN A;  1IEL A;  2JC7 A;  5TBM B;  4EW7 A;  1T1B A;  3F1N A;  1NYY A;  2WKR A;  3VP2 A;  1FCM A;  4OKP A;  5L8M A;  4EBP A;  4X55 A;  4R4R A;  4ESP A;  3E0Y A;  3CHW P;  1Y28 A;  4QWO A;  4B4X A;  3A3D A;  3IXH A;  2W1R A;  3OPR A;  4MBH A;  1PWC A;  1YLY A;  4HY8 A;  4IBR A;  1NZO A;  3V3S A;  3PBS A;  3LCE A;  1NRF A;  4U0X A;  4AFI A;  4EWF A;  4JXS A;  3VOL A;  3P98 A;  5M1A A;  4MBK A;  3W8K A;  4Q0H A;  3F1N B;  2ZMV A;  3RFB A;  2VJW A;  3NBL A;  1EW0 A;  4R38 A;  1WA9 A;  5FEG A;  2XR0 A;  4C3Q A;  4DDS A;  3ZG0 A;  3A0S A;  3ZVT A;  2WUQ A;  3CAX A;  2JKR I;  1SHV A;  4P87 A;  3NOP C;  4ZBE A;  2OWJ A;  3GSG A;  3M2K A;  3FWL A;  1PZP A;  4CLC C;  4O0P A;  5BOH A;  2YKH A;  3MZE A;  5CTN A;  5CHM A;  4E3K A;  5EVI A;  2ZLY A;  2W3F A;  1SKF A;  3Q7V B;  4FD8 A;  4H6J B;  1OPX A;  4RA7 A;  2HP6 A;  4RX2 A;  2V0W A;  1F9I A;  4PAU A;  1P9W A;  2L1M A;  2OSU A;  3PAE A;  4Y15 A;  1OJG A;  3DW0 A;  4MDZ A;  4S2J A;  3QNC A;  2IWC A;  4UHU A;  5GLD A;  3T4K A;  1BUL A;  3K3D A;  4OOM A;  3ICY A;  3E98 A;  4IUH A;  3GTC A;  4X6T A;  4BBT A;  4DE0 A;  3OCN A;  5EVI B;  4BMW A;  5FDH A;  1LT0 A;  1MKI A;  2G7U A;  2ZM2 A;  3MQQ A;  1KE3 A;  4PM5 A;  3UE1 A;  1S4S A;  2QJ5 A;  1PWD A;  1L0E A;  3D4F A;  2HP5 A;  4Y7P A;  1H5X A;  4HEF A;  1TS0 A;  5E2H A;  5EEC A;  1TD5 A;  3OZH A;  2Y4A A;  3VP4 A;  4L9F A;  2X01 A;  3V50 A;  5DF8 A;  1F5M A;  4FH4 A;  4H8R A;  5C5K A;  4XUX A;  1W8Q A;  1KVL A;  1RGY A;  4BD1 A;  4OOY A;  3RJU A;  2A49 A;  4DKI A;  2BG1 A;  3EWK A;  3I7J A;  3IX4 A;  1XA1 A;  4LEN A;  3LFV A;  1D06 A;  5FEF A;  4E3M A;  4S2I A;  4BLM A;  1TS7 A;  2JKT M;  2Y79 A;  1FR1 A;  4DXC A;  2QJ7 A;  2FH5 A;  3BY8 A;  4I3I A;  4S2N A;  4BEN A;  4BL2 A;  1OTD A;  1TDG A;  4KZB A;  1UWP X;  3E2K A;  1N4O A;  1XP4 A;  3IWQ A;  2A24 B;  4S2M A;  1SZV A;  3BFF A;  2K2N A;  5GLA A;  2EXB A;  3NY4 A;  1TS8 A;  3DWK A;  5GL9 A;  3ITA A;  5EV0 A;  2EWV A;  2WZZ A;  3UB8 A;  5L09 A;  1E3U D;  3MMH A;  5CXW A;  3FG8 A;  4I38 A;  3NDG A;  1TVF A;  1XJ2 A;  2BLS A;  3LID A;  3BRM A;  4OP5 A;  2C5W B;  3KO6 A;  3UPN A;  3MKE A;  3IF5 A;  1H8Z A;  4S2L A;  2VV6 A;  3G2Y A;  3W4O A;  2XSS A;  4UEY A;  3BFG A;  1K4E A;  5HFO A;  5J8X A;  3FKW A;  1QMF A;  2P9V A;  1IOU A;  2V8C A;  3VSK A;  4CLC B;  3UB5 P;  3T4J A;  3WS1 A;  1H8Y A;  3TW8 A;  1ZG4 A;  2X71 A;  1LSW A;  1YLP A;  4GDB A;  5FAT A;  3VV4 A;  3SOI A;  3G6O A;  2Z6C A;  3HLW A;  3MZD A;  3MKF A;  5J4E A;  4K91 A;  4ME4 A;  1K25 A;  4E6W A;  1W8Y A;  4PM9 A;  1FCO A;  4Q8I A;  4D60 A;  4C6Y A;  1IYO A;  5LBR A;  2QPN A;  5G4Z A;  4GB7 A;  2IWB A;  5DKL A;  2W1T B;  2Y2H A;  4WUJ A;  3PYP A;  3V67 A;  4HJ4 A;  5FI6 A;  1KE4 A;  1L0G A;  3RH8 B;  4DXB A;  2JKF A;  4BJP A;  2EWW A;  5A90 A;  3ZNY A;  5K5B A;  4HES A;  2OV5 A;  5FAQ A;  1T1A A;  3BFC A;  1C3B A;  2Y2N A;  3ZG5 A;  5FQI A;  4Y3I A;  2WGW A;  2HP9 A;  1O7E A;  3UE0 A;  1XKZ A;  1PW1 A;  1K55 C;  2PD7 A;  2W3D A;  3HLC A;  3LUQ A;  2UV0 E;  4JPM A;  2PR6 A;  3OCL A;  4B88 A;  1E25 A;  1HD8 A;  3IX8 A;  3OPP A;  1PNE A;  2DMW A;  5AQ7 A;  4Q0I A;  4WZ5 A;  1RGZ A;  4HOI A;  2OLV A;  2ZMA A;  5HAI A;  2Y59 A;  3PBN A;  1IKI A;  3MXR A;  4S2K A;  5DKK A;  3L9K A;  5GHX A;  1JTD A;  4A5R A;  5FQ9 A;  1IYQ A;  4KQD A;  4ZJ3 A;  4MN7 A;  5DF9 A;  1ZKJ A;  1ALQ A; 
#chains in the Genus database with same CATH homology
 2UWX A;  5FQM A;  3SH7 A;  4X68 A;  4OQG A;  5E43 A;  3GMW A;  4WEK A;  5FAP A;  1Y54 A;  3N4I A;  5AQ9 A;  3VP0 A;  5DTS A;  1YLJ A;  4MNR A;  5KMW A;  3SH9 A;  3BFD A;  4GDN A;  2WAE A;  1IEL A;  3Q82 A;  2JC7 A;  5A92 A;  4OPZ A;  4X53 A;  1KE0 A;  3IHA A;  1NYY A;  3SS5 A;  3VP2 A;  1FCM A;  1MPL A;  4OKP A;  4EBP A;  2J7V A;  3MBZ A;  5EPH A;  4X55 A;  4WYY A;  1FSW A;  1IYS A;  4R4R A;  1SCW A;  4DDY A;  2I72 A;  5FSR A;  4HBU A;  4PMA A;  2WK0 A;  4E3N A;  4UA7 A;  5M18 A;  4LV2 A;  3BLS A;  3HUN A;  1KGF A;  4O7D A;  1S6R A;  3HLE A;  4QU3 A;  4B4X A;  3A3D A;  3E2L A;  5L2F A;  2Y2L A;  3HBR A;  3IXH A;  3GQZ A;  3OPR A;  4MBH A;  3IF6 A;  1PWC A;  3C7U A;  1YLY A;  3GR2 A;  1KVM A;  4GOG A;  4Y0T A;  3M6H A;  5JYO A;  4IBR A;  1NZO A;  3V3S A;  3PBS A;  3P09 A;  4Y0O A;  3LCE A;  4PPR A;  4QD4 A;  1NRF A;  2ZQA A;  2H10 A;  5JYP A;  4D2O A;  1ESI A;  4WMC A;  1SDE A;  4U0X A;  4EWF A;  2ZC7 A;  3EQU A;  3HLD A;  3FKV A;  4JXS A;  1JWZ A;  5E2E A;  1EWZ A;  3N8R A;  4JF6 A;  3P98 A;  5M1A A;  2JE5 A;  4MBK A;  3W8K A;  3TOI A;  3BLM A;  1E3U A;  2G2W A;  5U47 A;  3VSL A;  3NBL A;  2Y2M A;  3IT9 A;  4N9K A;  4OPY A;  1FCN A;  2B5R A;  2DRW A;  2XR0 A;  3A3E A;  4KEN B;  4C3Q A;  4DDS A;  5CGW A;  2P74 A;  3ZG0 A;  3ZVT A;  5CTM A;  1HVB A;  1NZU A;  2WUQ A;  3VMA A;  3N8L A;  1E4D A;  3G35 A;  1TEM A;  1K54 A;  4JXV A;  3HVF A;  4ZDX A;  1SHV A;  4P87 A;  4ZBE A;  5FQK A;  1CK3 A;  3N6I A;  2PU2 A;  2IWD A;  1ESU A;  1KDW A;  1M6K A;  3GSG A;  2V2F F;  4MEZ A;  3M2K A;  3FWL A;  1PZP A;  1CI9 A;  3MFD A;  3C7V A;  1Z6F A;  5BOH A;  1HZO A;  3OPH A;  3MZE A;  1MWT A;  5CTN A;  5CHM A;  4E3K A;  3VOY A;  1HTZ A;  4L0L A;  2HDU A;  4GZB A;  5EVI A;  3IHB A;  2Y55 A;  4JBF A;  1NJ4 A;  2ZLY A;  1PWG A;  1I2W A;  3Q07 A;  4WEJ A;  4X69 A;  4CPK A;  1BUE A;  1ONH A;  3FYZ A;  1ERQ A;  1SKF A;  3VOZ A;  3NC8 A;  3Q7V B;  2WKE A;  1ERM A;  2ZC5 B;  2XEP A;  4FD8 A;  4WZ5 C;  4R3J A;  2EFX A;  3JYI A;  1PIO A;  3QHY A;  2HDS A;  4RA7 A;  2HP6 A;  4KG6 A;  2J9P A;  4RX2 A;  1Q2P A;  2HDQ A;  3ZFZ A;  3O88 A;  3G31 A;  4K0X A;  3CZD A;  2OSU A;  1MWR A;  4RX3 A;  3RXW A;  1IKG A;  3PAE A;  3AGD A;  1XX2 A;  3DW0 A;  5FQQ A;  1BLH A;  5HAR A;  2PU4 A;  3VFF A;  4S2J A;  3QNC A;  2IWC A;  4UHU A;  5GLD A;  1BUL A;  1ONG A;  4OLG A;  4OOM A;  4N1H A;  1DY6 A;  3UY6 A;  3AGE A;  4OVD A;  1BTL A;  1K56 D;  2JCH A;  3GTC A;  5A91 A;  4X6T A;  3V5M A;  5FA7 A;  4DE0 A;  4JF5 A;  4IVK A;  4KZ9 A;  4KZ6 A;  2ZQD A;  3OCN A;  5EVI B;  2WGV A;  4QHC A;  4MLL A;  2PBY A;  1YT4 A;  1L0D A;  2EXA A;  5FDH A;  5A93 A;  5DTT A;  2XK1 A;  3W4P A;  1MKI A;  2EFU A;  2ZM2 A;  2C6W B;  2ZD8 A;  4E3O A;  1LI9 A;  1GCE A;  1VQQ A;  1KDS A;  3GV9 A;  1KE3 A;  4OP8 A;  4PM5 A;  3ZG7 B;  3UE1 A;  1J9M A;  5IHV A;  1PWD A;  1L0E A;  4ZAM A;  3HUM A;  2GDN A;  3D4F A;  2HP5 A;  4Y7P A;  4BL3 A;  3O3V A;  4R3B A;  1H5X A;  4RVA A;  3G34 A;  3DTM A;  4HEF A;  3RXX A;  5E2H A;  2ZM8 A;  5F82 A;  5EEC A;  1ERO A;  2H0Y A;  2RL3 A;  3SS4 A;  3UNW A;  2ZQC A;  3ZG9 B;  4ZJ1 A;  2XD1 A;  4OPR A;  1IYP A;  3OZH A;  3UO9 A;  2Y4A A;  3G32 A;  3VP4 A;  3N7W A;  2WKH A;  2Y2G A;  3IF6 C;  4KZ4 A;  2X01 A;  3V50 A;  5DF8 A;  1BZA A;  1I5Q A;  4FH4 A;  4H8R A;  4LV3 A;  4RYE A;  5F1G A;  3ZVW A;  3BEB A;  4KZA A;  1IEM A;  4XUX A;  1W8Q A;  3ZCZ A;  1KVL A;  3IQA A;  4FSF A;  1RGY A;  4IVI A;  5FI7 A;  2J8Y A;  1LHY A;  2P9V B;  3FZC A;  3NIA A;  3ZGA B;  1EI5 A;  4BD1 A;  4OOY A;  4QB8 A;  5GHY A;  4EBL A;  3RJU A;  4ZTK A;  2A49 A;  1ES3 A;  3C4O A;  1MBL A;  4DKI A;  2BG1 A;  3O87 A;  2J9O A;  3I7J A;  1XA1 A;  4LEN A;  5CED A;  4P85 A;  3C4P A;  1PYY A;  1LL9 A;  3LEZ A;  2R9X A;  2Y2Q A;  2WZX A;  3UPO A;  2H0T A;  1FOF A;  4S2I A;  3HRE A;  3M2J A;  4R4S A;  4E3M A;  3Q1F A;  3PBT A;  4BLM A;  5CEC A;  4OLD A;  3AGF A;  3GRJ A;  5AQA A;  1FR1 A;  2EX6 A;  3BM6 A;  3UE3 A;  3IXB A;  3Q7V A;  4GKU A;  4DXC A;  1K54 C;  5CEB A;  1I2S A;  1FQG A;  4GD6 A;  4S2N A;  1XGJ A;  3NDE A;  4BEN A;  4BL2 A;  1LLB A;  2ZJ9 A;  4N9L A;  2E8I A;  1TDG A;  4NK3 A;  1DJB A;  4KZB A;  5EOO A;  5FQJ A;  5TR7 A;  3OPL A;  1Q2Q A;  5HAP A;  4KG5 A;  5CGX A;  1RCJ A;  3E2K A;  3BEC A;  1N4O A;  3WS2 A;  4C75 A;  1XP4 A;  2XF3 A;  1S0W A;  3WWX A;  3WRT A;  1GA0 A;  4HBT A;  3IWQ A;  1XGI A;  5F83 A;  4S2M A;  4JKT A;  1MWU A;  3BFF A;  4UAA A;  3SH8 A;  4QY6 A;  1MXO A;  5GLA A;  2EXB A;  3NY4 A;  3HL9 A;  3WRZ A;  3Q7Z A;  1MWS A;  2V1Z A;  2G2U A;  3DWK A;  4WMC D;  3HLG A;  5EVI C;  3Q81 A;  5GL9 A;  3ITA A;  3UDX A;  3UDI A;  1WE4 A;  3OC2 A;  5DVA A;  2WZZ A;  2VGK A;  1LL5 A;  1CEG A;  3N8S A;  2EX8 A;  2ZC6 B;  1E3U D;  4PM6 A;  5CXW A;  4LCM A;  3VP1 A;  1K57 A;  2H5S A;  3HLB A;  3NDG A;  1VM1 A;  1TVF A;  4FH2 A;  3VFH A;  1K38 A;  4KZ5 A;  2BLS A;  1JTG A;  2DCF A;  3BRM A;  2XH9 A;  4KZ7 A;  4IED A;  1K55 A;  4N92 A;  4OP5 A;  5TGF A;  2Y91 A;  4OQI A;  1NY0 A;  2C5W B;  1RP5 A;  3S4X A;  3UPN A;  5TFQ A;  3V3R A;  3A3I A;  3MKE A;  4LV1 A;  3IF5 A;  4U0T A;  3WS0 A;  5HL1 A;  3G4P A;  1BT5 A;  1KGE A;  1H8Z A;  4S2L A;  2Y2J A;  1U60 A;  4UA9 A;  5CHJ A;  4U3T A;  3G2Y A;  1PI4 A;  1L2S A;  3W4O A;  4YFM A;  1WYC A;  5KSH A;  2Z2L B;  1K6S A;  4EQI A;  3UDF A;  1W7F A;  1K4E A;  3BFG A;  4LV0 A;  5EVL A;  3CJM A;  3LY3 A;  3UPP A;  5HFO A;  3V39 A;  2R9W A;  1BLS A;  5EE8 A;  5FAO A;  5J8X A;  4S2P A;  2ZM0 A;  4QJG A;  5CGS A;  1DJC A;  4Y0U A;  5CHU A;  2HPB A;  2XD5 A;  1PZO A;  2WGW B;  3FKW A;  3MXS A;  1QMF A;  3LY4 A;  2P9V A;  4WEL A;  1MY8 A;  2QZ6 A;  3VSK A;  3PBR A;  4OQ0 A;  4B4Z A;  4JLF A;  4JXW A;  4PM8 A;  4EBN A;  1N9B A;  4OPQ A;  5HW3 A;  4E6X A;  1W5D A;  2FFY A;  2ZQ7 A;  5G18 A;  4DE2 A;  3PTE A;  3WS1 A;  1SDN A;  1ZG6 A;  3ITB A;  1H8Y A;  3S22 A;  1ZG4 A;  2X71 A;  3UN7 A;  4BQM A;  1BLP A;  3VP3 A;  1W79 A;  1GHM A;  1YM1 A;  1YLP A;  2Y2O A;  2HDR A;  2Y2I A;  1GA9 A;  4GDB A;  3BFE A;  5FAT A;  4UA6 A;  2Y2K A;  3A3J A;  3SOI A;  5M19 A;  3LO7 A;  4ID4 A;  4E3J A;  5FAS A;  1TDL A;  4NET A;  5E2G A;  4KQO A;  3HLW A;  3MZD A;  1DJA A;  1WYB A;  3MKF A;  3WS4 A;  3IXD A;  4K91 A;  1JVJ A;  3ZHH A;  5DF7 A;  3G30 A;  3TG9 A;  1K25 A;  2OLU A;  4E6W A;  4JXG A;  3O86 A;  1FR6 A;  1ES4 A;  3NI9 A;  4R1G A;  1W8Y A;  2DNS A;  1G68 A;  1YQS A;  4PM9 A;  1FCO A;  2XDM A;  4Q8I A;  2VGJ A;  3IH8 A;  4BD0 A;  1ES2 A;  4C6Y A;  3M6B A;  1IYO A;  1LI0 A;  3S1Y A;  4WBG A;  2QPN A;  3PBQ A;  4X56 A;  5KSC A;  3SS3 A;  5DTK A;  4GB7 A;  2IWB A;  5AQB A;  3NCK A;  1G6A A;  1ZC2 A;  2ZC3 B;  3CMZ A;  2WKI A;  2FFF B;  3IXG A;  4S2N C;  4KQQ A;  2Q9N A;  4P6B A;  1K6R A;  2Y2H A;  3B3X A;  2XGN A;  4KQR A;  2WYX A;  2WAF A;  4PM7 A;  4QY5 A;  4R23 A;  5FI6 A;  1KE4 A;  4F94 A;  4OQH A;  4E3L A;  2ZQ8 A;  4YIN A;  1L0G A;  4DXB A;  1YLZ A;  4BJP A;  5EUA A;  1AXB A;  3ZNY A;  5A90 A;  3DWZ A;  3FV7 A;  4LCL A;  2XQZ A;  4XUZ A;  3BYD A;  3IH9 A;  3ZNT A;  5HX9 A;  4KZ8 A;  4HES A;  3WS5 A;  4E3I A;  3A3F A;  3HLF A;  1JWV A;  1YLW A;  3IWI A;  2OV5 A;  2ZC4 B;  4DF6 A;  5FAQ A;  4WM9 A;  3C5A A;  4M3K A;  4Z9Q A;  1XPB A;  3QNB A;  3IF6 B;  2RCX A;  1KGG A;  4DE1 A;  1CEF A;  1PW8 A;  2EX9 A;  3BFC A;  1C3B A;  2Y2N A;  1GHP A;  5I94 A;  4K0W A;  5CRF A;  4KZ3 A;  5FQI A;  3ZG5 A;  3G2Z A;  2X02 A;  1K56 A;  1OME A;  1PI5 A;  1YLT A;  4WZ4 A;  2WGI A;  1YMS A;  2WGW A;  2HP9 A;  5F1F A;  1K57 C;  3ZDJ A;  4EV4 A;  3W4Q A;  4DRT A;  1O7E A;  3CG5 A;  2Z2M B;  5E2F A;  3UE0 A;  1XKZ A;  1PW1 A;  1K55 C;  2V20 A;  2XFS A;  4IBX A;  3EQV A;  1FSY A;  1YMX A;  1ES5 A;  4OH0 A;  3HLC A;  4P0M A;  1BLC A;  4CJN A;  3PBO A;  1K4F A;  4MBF A;  2QMI A;  4JPM A;  1CI8 A;  5FI2 A;  1XA7 A;  1QME A;  1M40 A;  2Q9M A;  3OCL A;  3TSG A;  4ZJ2 A;  1JWP A;  4B88 A;  4JF4 A;  1E25 A;  3ZG8 B;  3HUO A;  4OON A;  1HD8 A;  4XXR A;  3OPP A;  5GHZ A;  2ZQ9 A;  3IWO A;  5AQ7 A;  4GN2 A;  1XXM A;  4WZ5 A;  1RGZ A;  5GLC A;  3PAG A;  5D3O A;  1L0F A;  3GVB A;  4N1X A;  2OLV A;  2A3U A;  1NXY A;  2ZMA A;  2Y59 A;  5HAI A;  3PBN A;  1IKI A;  3MXR A;  4S2K A;  4EUZ A;  2XFT A;  2XLN A;  4KG2 A;  1O07 A;  2JBF A;  5EVI D;  4R0Q A;  5GHX A;  5GLB A;  2WAD A;  1JTD A;  4A5R A;  2EX2 A;  2CC1 A;  5HAQ A;  5FQ9 A;  4GD8 A;  1IYQ A;  4ZJ3 A;  5KZH A;  4FCF A;  3MZF A;  3ISG A;  1BSG A;  5DF9 A;  2Y2P A;  4OOL A;  1ZKJ A;  5EOE A;  5CER A;  4S2O A;  4DE3 A;  1ALQ A;  1GHI A;  4GNU A;  1NYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...