3WS5A

N288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (condition-2b)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
357
structure length
357
Chain Sequence
QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGQGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTQGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
molecule tags Hydrolase
total genus 118
structure length 357
sequence length 357
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ws5A00
1FCNA 3VSKA 1VQQA 3IQAA 2ZD8A 3GV9A 3GRJA 2J9PA 4DDSA 3UPOA 3IWIA 2BG1A 2EX9A 2HDRA 5E2FA 2XD1A 4BLMA 1JVJA 3SH9A 5KSCA 2PU2A 2WKIA 4GZBA 4S2JA 3WS1A 5L2FA 3W4OA 4OOLA 4UA7A 2XLNA 1BLHA 2J8YA 4NETA 3BRMA 4WZ5C 4P0MA 3MZDA 3OPHA 4KZ3A 4E6WA 1K4FA 1GA9A 3IXHA 5BOHA 1ALQA 1ESIA 3UE0A 1SCWA 3NI9A 4S2IA 5JYPA 2Z2LB 2WADA 3IWQA 4OP8A 3PBRA 2OV5A 2XFTA 2Y2NA 5FAQA 4BQMA 1PWCA 2J7VA 3WRZA 3O87A 1L2SA 1IYOA 1YT4A 1ES4A 4ZDXA 1CEGA 3IF6A 3IHAA 4YFMA 4X6TA 1KDSA 1WE4A 1LL5A 2IWBA 5EE8A 2WYXA 3V5MA 1K55A 4K0XA 3JYIA 4P85A 3MBZA 1PZOA 3MFDA 5EVID 1L0DA 5JYOA 1W8YA 3PAEA 1YLJA 2HDUA 1FR1A 2ZM8A 5FSRA 3TOIA 1E3UA 1XA7A 4U0TA 5DF8A 3UDFA 3W4QA 4DE0A 1H5XA 1SDNA 2VGKA 5AQAA 5CTMA 3M6HA 2EXBA 4N1HA 1KVMA 4NK3A 5E43A 5FAOA 4E3OA 5A90A 3N4IA 5EOOA 1BULA 5D3OA 3VOZA 3VOYA 1XX2A 4EV4A 2DNSA 4MEZA 4GOGA 3EQVA 1XXMA 2A49A 2HDSA 2JE5A 5CHJA 2ZQAA 5GHZA 3ZG5A 4JXGA 4QB8A 1K56D 5HFOA 3E2KA 3SS5A 5KSHA 5A93A 1L0EA 1XGIA 2HP9A 4QD4A 4PM6A 2ZMAA 5FATA 4WMCA 2A3UA 4ZTKA 5FQQA 3BFDA 1YLYA 3AGFA 1KE4A 4S2KA 3LCEA 3ZDJA 2P9VA 3VFHA 4OQ0A 2UWXA 2X71A 4D2OA 2H10A 1KE0A 4N9KA 3O88A 2IWCA 4JXWA 5CTNA 3IXBA 5HW3A 1IYQA 4RA7A 4WM9A 2Y2OA 3Q7ZA 5CXWA 3OZHA 5FQMA 4ZBEA 2ZQ8A 1YM1A 3PTEA 3WRTA 3FKWA 2ZQ9A 4M3KA 1C3BA 2G2WA 5GLDA 4Y0OA 4MLLA 2XK1A 5KMWA 2EFUA 4GD8A 1ERMA 3Q07A 4LV1A 3UE1A 4KQOA 2H0TA 3A3DA 4BD1A 1FSYA 4LV0A 4N92A 3PBTA 4S2NC 1PW8A 4KG2A 4DF6A 4OOYA 4OQHA 3E2LA 3A3JA 2Y2QA 1K54A 4C3QA 3PBOA 4Y7PA 3IH9A 4H8RA 1RGZA 4R3JA 4XUXA 4QHCA 3FWLA 1BTLA 3LY4A 4OPYA 5A91A 1CI8A 1I2SA 3VFFA 4OONA 4Q8IA 1LHYA 2ZC6B 3IF6B 4HESA 2V2FF 4KZ8A 1K6RA 1KDWA 1L0FA 4KENB 5HX9A 4OH0A 1KVLA 3GR2A 5DF7A 2ZC4B 3V39A 3IH8A 3UY6A 3IXDA 3BFFA 3ITBA 1G68A 4JLFA 4DXBA 1XKZA 3ZGAB 2Q9NA 4RYEA 4GD6A 4QJGA 1LL9A 2C5WB 3DTMA 4E3JA 3UE3A 1K57A 2ZLYA 4RVAA 3AGEA 4KZBA 4N1XA 4IBRA 5IHVA 4K91A 4FH2A 3ZHHA 5HAQA 3MXSA 5FDHA 1TEMA 5EVIA 4CPKA 4X55A 4EWFA 3BLMA 1PI4A 5EVLA 1DJAA 4HBUA 2Y4AA 4IVKA 4DRTA 4LV3A 4EBPA 3CZDA 5GLBA 1LLBA 1G6AA 4KZ7A 3V50A 3ZFZA 1IEMA 4DKIA 5TFQA 2ZC7A 3HLCA 3HREA 4WBGA 5CECA 4E6XA 1S6RA 3PBSA 5KZHA 3V3SA 1NJ4A 3C4PA 3HLGA 3ITAA 3PAGA 4OLDA 3GQZA 3NDEA 2Y59A 2OSUA 1MWTA 4UHUA 2P9VB 1MKIA 1BLSA 1BLPA 4EQIA 1QMFA 1XP4A 4LENA 3CJMA 3OCNA 4E3MA 2E8IA 3SS4A 1NXYA 3OC2A 3BYDA 4B4ZA 4MBKA 1K56A 1JWZA 4R4RA 5EOEA 4JF4A 3RXWA 5CHUA 1NRFA 2OLVA 1FSWA 2Z2MB 4R1GA 4S2MA 3ZNTA 3VSLA 3HUNA 5G18A 3NC8A 4HEFA 1ES5A 3G4PA 4HBTA 2ZQDA 2P74A 2XDMA 1NYMA 4P6BA 4RX2A 4FH4A 3CG5A 5TR7A 3CMZA 3GVBA 4PM9A 1WYCA 3VP4A 3DW0A 4OOMA 2CC1A 1ZC2A 2Y2GA 1JTDA 1HVBA 4X68A 5FAPA 4WELA 4ZJ2A 2Y2MA 4DXCA 3BFEA 5HL1A 1CK3A 3M2JA 2XF3A 3VP2A 4A5RA 5F1FA 3G2ZA 3MKFA 1GCEA 3C5AA 3LY3A 1PZPA 5FI7A 2Y2LA 3AGDA 2XFSA 3M6BA 1ZG4A 1YLPA 3IHBA 3WS4A 2C6WB 2G2UA 3Q81A 3BM6A 3MZFA 4B4XA 2R9WA 1LI0A 3EQUA 1KGFA 1JTGA 3NBLA 4Z9QA 1DJCA 5FQKA 3IF6C 1IYPA 2I72A 2WUQA 3G34A 3UN7A 3DWZA 4PPRA 5EUAA 3GSGA 4BL2A 1FR6A 1K55C 1EROA 4BJPA 1CEFA 1O7EA 1L0GA 4B88A 4S2OA 4FD8A 1Y54A 2WGWA 3O3VA 3ZVWA 4EUZA 1YMXA 2WK0A 3UNWA 4GKUA 4OP5A 3W8KA 3IT9A 5DTSA 2Q9MA 4WEJA 3SH8A 4UA9A 2RL3A 1RP5A 1MBLA 4OPQA 5CGWA 5TGFA 2PU4A 4U0XA 1SKFA 1TVFA 3UPPA 2X01A 2JBFA 4E3NA 3FV7A 1W7FA 5FI2A 1ES2A 3G31A 1BT5A 4QU3A 3UDXA 3NDGA 1KGEA 4OPZA 3UO9A 2IWDA 5GHYA 5HARA 1ONHA 2ZJ9A 1GA0A 2OLUA 3Q1FA 4MBHA 5FI6A 4WZ5A 1HD8A 2GDNA 2DCFA 4UAAA 3QNCA 5F1GA 5EVIB 1PIOA 2VGJA 1ERQA 2WZXA 1ZG6A 3TG9A 3HLWA 3ZG0A 5M18A 2WAFA 3V3RA 3QHYA 1YQSA 3HUMA 3HLDA 2XEPA 3Q7VA 3G2YA 4F94A 1S0WA 4ZJ1A 3FYZA 3OPRA 5CGSA 4JF5A 4FCFA 4KZ5A 4JXSA 1IKGA 3MXRA 2B5RA 1YLTA 5A92A 2H0YA 1GHMA 1W79A 4GN2A 5EECA 4JXVA 5FQ9A 3IXGA 4YINA 1MWSA 3C7UA 2FFFB 3MZEA 3N6IA 3OPLA 4IEDA 5F82A 5AQBA 1MWUA 2QZ6A 4C6YA 2V1ZA 3UPNA 3NCKA 1YLWA 5CERA 4KG6A 5F83A 2PBYA 3BECA 3HUOA 1HZOA 3N8SA 2QMIA 4BL3A 4DE1A 2ZQCA 1W5DA 4WZ4A 2EFXA 4KZAA 3G32A 3VP1A 1ONGA 2ZQ7A 5CEBA 1NYYA 4FSFA 1SDEA 5FQIA 4EBLA 5AQ7A 1AXBA 2XGNA 4EBNA 1EWZA 2WGVA 3HL9A 1Q2PA 2EX6A 2HP6A 3OCLA 4K0WA 4QY5A 1J9MA 2HP5A 1NZOA 4S2LA 4BENA 4MBFA 1RCJA 3B3XA 4OKPA 1N9BA 4P87A 5CHMA 3A3EA 2X02A 2H5SA 2QPNA 1K54C 5M19A 4MNRA 4JBFA 4L0LA 3PBNA 1PWGA 2WGIA 1XGJA 1ZKJA 4OVDA 3ZNYA 1LI9A 1N4OA 4JKTA 3P98A 1PWDA 1ESUA 2WZZA 5GHXA 1GHPA 1NZUA 4PMAA 3N7WA 4X69A 3BFGA 4UA6A 4WYYA 5J8XA 2DRWA 4C75A 2Y55A 5E2GA 1FCMA 1JWVA 2FFYA 1I2WA 3O86A 1MXOA 1NY0A 3HVFA 4RX3A 5DF9A 5FA7A 4OLGA 4PM5A 5CRFA 3ZG8B 2WGWB 4KZ9A 2Y2JA 1M6KA 1QMEA 1KGGA 3QNBA 1IYSA 4XUZA 5DVAA 3ZG9B 1K38A 1VM1A 3BLSA 5FASA 3GMWA 4KZ6A 2ZC3B 5EPHA 3RJUA 3DWKA 4GDBA 1H8YA 1IELA 3N8LA 1HTZA 2HPBA 1K57C 3HLFA 4WEKA 5AQ9A 3WS0A 2ZM0A 2BLSA 2Y2PA 3Q82A 5FQJA 4N9LA 4GDNA 2ZM2A 4X53A 5GLAA 1BUEA 1PYYA 2V20A 4S2NA 5EVIC 3D4FA 3ZG7B 3C7VA 4Y0UA 1E4DA 4OQGA 2JC7A 2EX2A 3FKVA 3BFCA 4ID4A 4KZ4A 4LCLA 3SOIA 1DY6A 3W4PA 1KE3A 1FCOA 1O07A 1E3UD 1GHIA 1Q2QA 2EX8A 1K25A 3LEZA 3TSGA 4E3LA 4KQQA 4QY6A 1PW1A 3ZVTA 1MWRA 3NIAA 2XD5A 3FZCA 3Q7VB 1H8ZA 1TDGA 3A3IA 3PBQA 3A3FA 3SH7A 3VP3A 4O7DA 4LV2A 5HAPA 1BLCA 3VP0A 1FQGA 1TDLA 3G30A 4KQRA 3RXXA 3UDIA 4E3KA 3S1YA 1MY8A 2RCXA 4CJNA 4R3BA 1SHVA 3WS5A 2J9OA 3OPPA 4DE2A 4KG5A 1IKIA 1U60A 4PM8A 3S4XA 2XQZA 4GNUA 1BSGA 5GLCA 3C4OA 1JWPA 4PM7A 1XPBA 2XR0A 1FOFA 3M2KA 2JCHA 1EI5A 3BEBA 2ZC5B 3HLEA 4WMCD 1K4EA 4XXRA 4Y0TA 5U47A 5E2HA 3HLBA 5DTTA 4JPMA 3P09A 2WKEA 4BD0A 1ES3A 3IWOA 3LO7A 1CI9A 1RGYA 2EXAA 1MPLA 3ISGA 4IBXA 1BZAA 3WWXA 1Z6FA 1I5QA 1OMEA 5DTKA 1E25A 4ZJ3A 3VMAA 2WKHA 2Y2KA 4R4SA 5CEDA 4JF6A 5GL9A 3NY4A 4U3TA 1K6SA 2Y2IA 2XH9A 1DJBA 5E2EA 3I7JA 1YMSA 3HBRA 4IVIA 1WYBA 5CGXA 2R9XA 5I94A 4R0QA 3ZCZA 3IF5A 4LCMA 3GTCA 4OQIA 1PI5A 1YLZA 4OPRA 2Y91A 4R23A 4DE3A 4X56A 4ZAMA 1M40A 4S2PA 3S22A 3WS2A 4DDYA 3N8RA 4E3IA 2WAEA 2HDQA 3SS3A 1XA1A 4GB7A 3MKEA 1W8QA 3G35A 2Y2HA 5M1AA 5HAIA
chains in the Genus database with same CATH superfamily
3VSKA 1VQQA 1S1YA 4NXGA 3GV9A 2WKIA 5L2FA 2LB5A 1OPXA 5HZHA 3CPTB 4CLCB 2OWHA 5JYPA 2Z2LB 2WADA 2VX8A 2OV5A 1UGUA 2K31A 1PWCA 2PHYA 3WRZA 2YKFA 4YFMA 4I3AA 1WE4A 1D1JA 5EE8A 1XFNA 3V5MA 4P85A 3MBZA 1PZOA 5EVID 3TOIA 4DE0A 1E3UA 3UDFA 4HHDA 3W4QA 1VEUB 5AQAA 4QWOA 3M6HA 3NJAA 2EXBA 5G4YA 4N1HA 4E3OA 5FAOA 4WL9A 3N4IA 4HH3A 4HNBA 5DKKA 2GX5A 3BW6A 5AVEA 5D3OA 3VOZA 2QJ5A 4EV4A 2NUTC 3EQVA 2JE5A 5GHZA 3LI9A 4JXGA 3KYEA 4WLAA 5HFOA 2HP9A 2A3UA 5FQQA 4NG2A 2W27A 4BWIA 2H10A 4N9KA 1OT6A 5CTNA 1F5MA 5FEGA 2AVXA 5HD5A 3CI6A 4EEUA 1T1CA 1C3BA 4Y0OA 2XK1A 2PT7A 3TW8A 1ERMA 2OAP1 4LV1A 4R3AA 3LIAA 2DMWA 3BWLA 1UWNX 4ETXA 4DF6A 3A3JA 1K54A 5HDCA 4H8RA 4R3JA 4XUXA 3DAVA 2JKTM 3S7PA 4LLOB 1CI8A 3VFFA 4Q8IA 3UB9A 4LRXC 4HESA 4KZ8A 2R78A 4KENB 4OH0A 2ZC4B 1TS7A 3UY6A 1Y4OA 4DXBA 3C2WA 1GSXA 2Q9NA 1LL9A 3DTMA 5C5KA 3OOVA 4FH2A 3ZHHA 2I9VA 1IFQA 5FDHA 1TEMA 5EVIA 3BLMA 1PI4A 5EVLA 1DJAA 2Y4AA 4IVKA 5J3WA 1S67L 2VKSA 5DJUA 5FDSA 2ZC7A 3HREA 5KZHA 4HI4A 3ITAA 4P6ZM 4OLDA 2Y59A 3L7HA 1MWTA 2W1RA 3MFXA 1MKIA 4EQIA 1QMFA 4LENA 3CJMA 3DTKA 3SS4A 4R4RA 1T1BA 2BTFP 3RXWA 2OLVA 2Z2MB 3ZYTA 3ZNTA 4HEFA 3T4SA 1VHMA 2P74A 3T1SA 3UB5P 4PM9A 3VP4A 2CC1A 2Y2GA 5FAPA 4ZJ2A 2M7VA 2Y2MA 5HL1A 1CK3A 2ZOHA 2XF3A 3VP2A 4DMZA 1W63Q 5F1FA 3C5AA 3UE6A 3LR5A 3LY3A 2Y2LA 1YPRA 3WS4A 2G2UA 3Q81A 3BM6A 2H28A 1DJCA 2I72A 3DTEA 3G34A 4X1MA 5EUAA 1K55C 1EROA 4B88A 1TS8A 4LRYC 4EUZA 3UNWA 4GKUA 5DTSA 2Q9MA 5CX7A 4JGRA 2RL3A 1MBLA 4WF0A 3EGDC 4QU3A 3B33A 2IWDA 2XROA 4Y15A 1ONHA 3LIDA 4JGPA 4WZ5A 5EVIB 1PIOA 1ERQA 1Z09A 1ZG6A 4II7A 3HLWA 3DTIA 4F94A 4KUOA 5CGSA 4JF5A 4FCFA 1G6OA 2B5RA 4P6ZS 1N9LA 2KX6A 3IXGA 4YINA 2FFFB 4C6YA 2OAQ1 5F83A 3N8SA 4BL3A 2ZQCA 2ZQ7A 4R38A 4FSFA 4G3VA 1LSVA 2XGNA 4K0WA 3EGXC 1OT9A 2INWA 4BENA 1N9BA 4P87A 5CHMA 3PBNA 2WGIA 2L4RA 1XGJA 2P04A 3NHQA 3P98A 5GHXA 1NZUA 2HJEA 5HDSA 5J8XA 1FCMA 2J3TC 1I2WA 4RX3A 5DF9A 5FA7A 4OLGA 1KGGA 3QNBA 3SW1A 3EOIA 1P9RA 1S4RA 1XJ4A 2ZC3B 2HPBA 1K57C 4WEKA 3WS0A 2HGVA 4HIAA 2ZM0A 5FQJA 2Y2PA 3Q82A 1NLZA 5GLAA 3C7VA 2PRFA 2O0YA 4KZ4A 4LCLA 4NXFA 2O9AA 1Q2QA 1K25A 2ZBBA 4QY6A 1P97A 1MWRA 2Y79A 4HP4A 1TDGA 3A3IA 3VE3A 3DBAA 5HAPA 3RXXA 4E3KA 2RCXA 4R3BA 4KG5A 4PM8A 2XQZA 1IOUA 1BSGA 4I38A 3H9WA 5HPFA 1ZHHB 4XXRA 3HLEA 4WMCD 2D02A 2EXAA 1MPLA 1E25A 1J3WA 3NY4A 1OTBA 1K6SA 2Y2IA 3PXPA 1DJBA 3I7JA 5CGXA 2BASA 2NUPC 4R0QA 1S66L 1KOUA 4OPRA 1OJGA 4FOFA 4ZAMA 1M40A 4DDYA 1GSWA 1XA1A 4GB7A 2Y2HA 4DE2A 5HAIA 3D3OA 3IQAA 2ZD8A 3E4OA 2M1CA 3BY8A 5E2FA 2XD1A 4HP9A 4GZBA 1T19A 3WS1A 4B9OA 2XLNA 1K4FA 4YWZA 3IXHA 5BOHA 3UE0A 3NI9A 4HJ3A 5F68A 3LR0A 1GSVA 2XFTA 5FAQA 4BQMA 3SZTA 1YAXA 1V9ZA 3O87A 1L2SA 1IYOA 3IHAA 3IF6A 3PYPA 1N9OA 4FTXA 3QP1A 2HDUA 1FR1A 5HWWA 5KIZA 5CTMA 5E43A 4I5SA 1V9YA 4O8GA 4Q0HA 5EOOA 1BULA 2J3WA 2DNSA 2L1MA 4MEZA 3B47A 2HDSA 1P9WA 3ZG5A 4IUHA 3SS5A 3UB8A 1XGIA 4WMCA 4ZTKA 3BFDA 1ZTUA 3AGFA 3LCEA 2PD7A 3VFHA 4OQ0A 2UWXA 2X71A 1KE0A 3LR4A 2ZL1A 3QP8A 4L9FA 3CAXA 4RA7A 2MJ6A 3KSFA 3Q7ZA 3OZHA 3PTEA 3WRTA 2ZQ9A 5GLDA 2G2WA 5K5BA 5KMWA 4GW9A 4GD8A 3Q07A 4KQOA 4Q0IA 4LV0A 2P08A 4N92A 3PBTA 4S2NC 4C3QA 3PBOA 4Y7PA 1OTDA 4QHCA 4XT2A 4OPYA 1G5UA 5LBRA 2ZMVA 4OONA 1LHYA 2ZC6B 3IF6B 1K6RA 1L0FA 1TD5A 5HX9A 5DF7A 3E4PA 3C30A 4JLFA 2VV6A 2LB9A 4QJGA 4GD6A 4F3LA 3IX4A 2C5WB 1YKDA 3UE3A 3ULFA 2JN7A 4EW7A 3CUEC 4E04A 2VZWA 4CQHA 4CPKA 4X55A 4HBUA 4LV3A 3CZDA 5GLBA 3VV4A 2B95A 1IEMA 3T4KA 4DKIA 4LGWA 2W1TA 3BQAA 1S6RA 3GQZA 2PR5A 5MC7A 1BLPA 1XP4A 4HJ4A 2ZL1B 4LPZA 1NXYA 1NRFA 4MN6A 3VSLA 3R4KA 4FH4A 5TR7A 5G4ZA 4OOMA 2W3HA 1ZC2A 1HVBA 2VK3A 4WELA 5HPIA 4A5RA 3G2ZA 1GCEA 2XFSA 3IHBA 2C6WB 2JKFA 1PFLA 3MZFA 4I3JA 4B4XA 4XT2B 1LI0A 3K3CA 4Z9QA 5IT5A 2WUQA 3UN7A 1FR6A 1L0GA 1O7EA 4MN7A 3KSHA 4H6JA 4LFUA 4S2OA 2V1AA 2WGWA 4OP5A 3IT9A 2JKRI 5CGWA 5TGFA 4U0XA 4E3NA 4F3LB 2JBFA 5FI2A 1ES2A 3G31A 1BT5A 3UDXA 3NDGA 2VJWA 2OLUA 4MBHA 4UAAA 2DCFA 1CF0A 5A8BA 4O0PA 4HQAA 5F1GA 2VGJA 1NWZA 2CMNA 2V1BA 3ZG0A 2WAFA 3QHYA 2XEPA 3RFBA 1VETA 2W1TB 4KZ5A 1P0ZA 1IKGA 1YLTA 2YKHA 5A92A 1GHMA 3C38A 3MZEA 2GZAA 4IEDA 1MWUA 1YLWA 3HUOA 2QMIA 4DE1A 4MMNA 3VP1A 2W3GA 5CEBA 1NYYA 1UWPX 1SDEA 4EBLA 5AQ7A 3HL9A 1Q2PA 3OCLA 1J9MA 3CITA 4MCWA 4MBFA 2VV8A 3UMDA 1DP8A 2H5SA 4RQ9A 4OVDA 1N4OA 3LUQA 1PWDA 3W2ZA 1ESUA 5EV0A 5DJTA 3N7WA 3BFGA 2V8CA 3D9YA 2UV0E 1JWVA 1F2KA 1MXOA 4H6JB 5CRFA 3ZG8B 2WGWB 4KZ9A 2Y2JA 4XUZA 3ZG9B 3BLSA 5FASA 1IELA 3N8LA 1DP6A 4N9LA 4X53A 3T1RA 1BUEA 2V20A 4GS9A 4Y0UA 2JC7A 1XJ3A 3SOIA 3MJQA 3W4PA 2A2LA 1O07A 1GHIA 2EX8A 4G3WA 4KQQA 1TF1A 2XD5A 3TE8A 1VETB 4O7DA 4LV2A 3BQ8A 2XA7M 4HJ6A 4CJNA 5F69A 3WS5A 3OPPA 1IKIA 3F1PA 1Y28A 2JCHA 1EI5A 3BEBA 4HH2A 4JPMA 3P09A 2WKEA 3S7OA 4EEPA 1LSWA 3IWOA 1RGYA 4IBXA 2O99A 1Z6FA 1I5QA 3VMAA 2WKHA 2Y2KA 4JF6A 3CHWP 5E2EA 4GHIA 1YMSA 2PBDP 2V9AA 4CLCE 5I94A 3T4TA 4LCMA 4OQIA 4R23A 2O9BA 3TRCA 3KSGA 2V0WA 3LIBA 3N8RA 2WAEA 1FILA 3A0VA 3MKEA 2KDKA 5HDDA 1W8QA 5M1AA 1FCNA 1H3QA 4YNRA 4BMWA 2HZ5A 2Z6DA 2J9PA 1X0OA 3IWIA 2EX9A 2HDRA 1JVJA 3SH9A 5KSCA 4PKYA 3JPUA 4UA7A 3T4JA 1BLHA 2J8YA 4NETA 3FPVA 3BRMA 3MZDA 4KZ3A 4E6WA 1GA9A 4GS9B 2J3TD 1ESIA 4S2IA 3PBRA 4ME4A 2Y2NA 2J7VA 4ZDXA 1N9NA 1ES4A 2PYPA 4X6TA 1KDSA 1LL5A 2IWBA 2WYXA 3B42A 3L9KA 1K55A 2V8FA 1L0DA 5JYOA 1W8YA 1D06A 2W0NA 3PAEA 5AJGA 2XA7S 4U0TA 1A0KA 3F1PB 3LI8A 4BBUA 3LIEA 3FC7A 1XX2A 4DJ2A 2A49A 3QP2A 4MN5A 5CHJA 2B02A 4QB8A 1K56D 3TJZC 5A93A 3T1XA 4QD4A 4PM6A 1TS6A 2QJ7A 4GHIB 4S2KA 1FIKA 2ZMFA 4D2OA 1PNEA 3O88A 4WUJA 2OWJA 1MKMA 4WM9A 3MXQA 2Y2OA 5FQMA 2Q0OA 3BJNA 4MLLA 3UE1A 2PDRA 4BD1A 1YSPA 4M4XA 3LR3A 4KG2A 4OOYA 4OQHA 4CLCC 2Y2QA 3MF0A 5HWTA 3IH9A 1RGZA 3LFVA 3FWLA 3KX0X 4PKYG 1BTLA 3LY4A 4K08A 1I2SA 4I39A 1KDWA 4UQIM 3V39A 2GJ3A 3IXDA 3BFFA 3BY9A 3ITBA 1G68A 1NRJA 1H0MA 1XKZA 3ZGAB 1MZUA 2K2NA 3LEQA 1K57A 3JVUA 5EM0A 3NULA 5HAQA 4EWFA 3KYZA 3MMHA 1LLBA 1G6AA 2ZOIA 4KZ7A 3V50A 3ZFZA 3KYQA 3HLCA 3F1NA 4WBGA 4EUVA 3NOPC 1NJ4A 3C4PA 3HLGA 2A24A 3NDEA 2OSUA 3UMEA 4R6LA 3OCNA 3D72A 1SKOA 4MBKA 1K56A 1T1AA 5DFXA 4JF4A 5CHUA 3VE4A 1ES5A 3G4PA 3S7NA 2XDMA 1NYMA 4RX2A 4NXBA 3GVBA 5L07A 3EWKA 4DXCA 3IBJA 2Y8HA 3MKFA 4BBVA 2EWWA 1PZPA 5FI7A 3M6BA 1WA9A 3GECA 3EQUA 3LICA 4FUWA 5FQKA 3FG8A 1IYPA 4L9EA 3DWZA 4PPRA 4BL2A 4BJPA 1CEFA 3MQQA 2EA9A 5DFYA 1Y54A 3O3VA 3ZVWA 1YMXA 2WK0A 3W8KA 3MQ0A 4UQIS 4WEJA 3SH8A 3HJKA 3UPPA 2X01A 3MQOA 3FV7A 2W3FA 1D7EA 5GHYA 5CECA 2ZJ9A 1GA0A 3Q1FA 5FI6A 1HD8A 2GDNA 5IU1A 3QNCA 4IJGA 4JGOA 2WZXA 3TG9A 5M18A 1YQSA 3HLDA 1G28A 3NOTC 3T12B 3Q7VA 1S0WA 3F1NB 1F9IA 3OPRA 2A24B 2H0YA 5EECA 4GN2A 5FQ9A 2HV1A 5AQBA 2QZ6A 3QP5A 4WN5A 5CERA 1SKOB 2PBYA 3BECA 1HZOA 4WZ4A 4ARZA 5FQIA 3ICYA 1EWZA 2EX6A 2M7UA 4DJ3A 4S2LA 2XRNA 2QYBA 3A3EA 4NEED 1K54C 4JBFA 4ESPA 4KQDA 5F6AA 5L09A 4PAUA 2WZZA 1GHPA 4UA6A 3LGOA 1OJ5A 2Y55A 5E2GA 4C75A 1CQAA 2FFYA 3O86A 1NY0A 3HVFA 3V67A 4PM5A 2JKRM 1M6KA 1QMEA 2P7JA 1VM1A 4KZ6A 3T4QA 3DWKA 4GDBA 1H8YA 1HTZA 1XJ2A 3G6OA 4GDNA 2ZM2A 1PYYA 5EVIC 4S2NA 4EESA 3D4FA 1E4DA 4OQGA 4IHQA 2EX2A 2JKGA 3FKVA 4ID4A 4E3LA 1H8MA 3LEZA 3TSGA 1PW1A 3U4LP 3ZVTA 2ACGA 3FZCA 1HLUP 3Q7VB 4Y17A 1H8ZA 3PBQA 3SH7A 3A3FA 3VP3A 5FEFA 3UB7A 2QKPA 5F5YA 1F98A 1TDLA 3G30A 4KQRA 3K3DA 3S1YA 1MY8A 3GDIA 2J9OA 3T4OA 1JWPA 2WKQA 4NKPA 4X68A 4PM7A 1XPBA 2XR0A 4ARZB 1K4EA 1ACFA 3CUEA 5U47A 5DTTA 1LT0A 4ZRRA 3P7NA 1CI9A 3ISGA 2B18A 3H7WA 3WWXA 4ZJ3A 2Z6CA 5GL9A 3HBRA 3RTYA 4IVIA 1WYBA 3IF5A 1PI5A 1YLZA 3A0SA 1OTAA 4DE3A 4EQ1A 4S2PA 3WS2A 4E3IA 3SS3A 3KO6A 1PRQA 4Q0JA 4R70A 3UPOA 3GRJA 3OLOA 5TBMA 4DDSA 2BG1A 2JHEA 4BLMA 3PR6A 4DN0A 1S1ZA 2PU2A 4S2JA 3W4OA 4OOLA 4WZ5C 2FH5A 4P0MA 3OPHA 2IA2A 1ALQA 1SCWA 2VA0A 3IWQA 4OP8A 4GLQA 2JKTI 1DRMA 3EEHA 1YT4A 1CEGA 5HD3A 4B93A 3EEAA 4K0XA 3JYIA 2VGLM 1TS0A 2XSSA 3MFDA 1YLJA 2ZM8A 2K7SA 5FSRA 5L10A 1XA7A 5DF8A 5L8MA 1H5XA 1SDNA 2VGKA 4IUKA 3IX3A 1KVMA 4NK3A 5A90A 2O9CA 4Y3IA 3VOYA 4X25A 4GOGA 1LSXA 4X1LA 1XXMA 5EFWA 3H7WB 2ZQAA 3E2KA 5KSHA 1OTEA 1L0EA 5FATA 2ZMAA 3R7WA 4Y2FA 1YLYA 4KUKA 4Y13A 1KE4A 3E4QA 3ZDJA 2P9VA 2GNXA 1JNUA 4Y5FA 4G3KA 5IS1A 4NXEA 2IWCA 4JXWA 3IXBA 5HW3A 1IYQA 5CXWA 2J80A 2PD8A 4ZBEA 2VV7A 2ZQ8A 1YM1A 1ODVA 4GJ4A 3FKWA 5TBMB 4M3KA 2EFUA 5HL6A 3QP6A 2H0TA 3A3DA 1FSYA 3O5YA 1OTIA 1PW8A 3E2LA 1W63M 5A91A 2HF6A 4MDZA 2VEAA 1EW0A 4QPRA 4PHTA 2V2FF 2D01A 1KVLA 3GR2A 5FL3A 3IH8A 5J7EA 2VGLS 3OBFA 4RYEA 1AWIA 2VLGA 4E3JA 2G7UA 2PAVP 1S4SA 2ZLYA 4RVAA 3AGEA 4KZBA 4N1XA 4IBRA 5IHVA 4K91A 2L0WA 3FPWA 3MXSA 2PR6A 3HJIA 4EBPA 3NOUC 4DRTA 3P01A 4Z1WA 4HOIA 5TFQA 4E6XA 3PBSA 3R7WB 3V3SA 3PAGA 4D60A 3ZQ5A 4UHUA 2P9VB 1BLSA 4E3MA 2E8IA 4B4ZA 3OC2A 3BYDA 1JWZA 5EOEA 3H82A 3T4LA 4R1GA 4S2MA 1FSWA 3CWFA 3HUNA 5G18A 3NC8A 2QWSA 3K2NA 4HBTA 2ZQDA 4P6BA 1T18A 3CG5A 3UB6A 3CMZA 1WYCA 1YSQA 3DW0A 1JTDA 1VB6A 3BFEA 3M2JA 1DP9A 3MSHA 3AGDA 1ZG4A 1YLPA 2W3EA 2R9WA 1KGFA 1JTGA 3NBLA 2WKPA 3IF6C 3A0RA 2E8JA 3GSGA 2OOLA 3HCYA 3LIFA 4FD8A 3T50A 4CLCD 4UA9A 1RP5A 4OPQA 5HSQA 2PU4A 1SKFA 5EM1A 1TVFA 1W7FA 3UO9A 1KGEA 4OPZA 5J4EA 5HARA 3QP4A 1BYWA 5EVEA 2PYRA 3T1QB 4UEYA 1XFQA 3V3RA 3HUMA 2WKRA 3G2YA 4EERA 3E98A 4ZJ1A 3FYZA 2EWVA 4JXSA 3MXRA 1W79A 4JXVA 1MWSA 3C7UA 3N6IA 5F82A 3OPLA 4LRZE 1MC0A 3S7QA 4GCZA 2V1ZA 3UPNA 3NCKA 4KG6A 3RH8B 3H82B 1W5DA 2EFXA 4KZAA 3G32A 1ONGA 1CJFA 1AXBA 4EBNA 2WGVA 2HP6A 4QY5A 2HP5A 1NZOA 1STZA 1RCJA 3B3XA 4OKPA 4O01A 2X02A 2QPNA 5M19A 4MNRA 3F1OA 4L0LA 1PWGA 1ZKJA 3ZNYA 1LI9A 3IS2A 4JKTA 4I3IA 2FZ0A 3LYXA 3JVVA 4PMAA 1SZVA 5HWVA 1K0KA 4YOFA 4JGQA 4X69A 4WYYA 2DRWA 4HY8A 5DVAA 1IYSA 1K38A 3GMWA 5EPHA 3RJUA 5AVFA 3KSIA 3HLFA 1XJ6A 5AQ9A 3NECA 2KLIA 3CLOA 4EXOA 2BLSA 2HJ9C 1L3LA 2KOIA 3IX8A 3ZG7B 3CPTA 2QHKA 4CLCA 1LL8A 3BFCA 1DY6A 1KE3A 1FCOA 1E3UD 3VOLA 3NIAA 3MR0A 1BLCA 3VP0A 1FQGA 3UDIA 2V0UA 3E0YA 5I5LA 1SHVA 1U60A 3S4XA 1VEUA 4GNUA 5GLCA 3C4OA 3M2KA 1FOFA 2ZC5B 4Y0TA 3U2AA 4EU0A 3PHYA 5E2HA 3HLBA 4BBTA 1NLYA 4BD0A 1ES3A 3LO7A 1BZAA 1OMEA 3C8CA 5DTKA 4R4SA 5CEDA 4ETZA 4U3TA 2XH9A 3F1OB 2R9XA 3ZCZA 5DKLA 3GTCA 3IS2B 3MS6A 2W3DA 4EETB 2Y91A 4X56A 4L9GA 3S22A 5TJJA 2HDQA 4AFIA 3IBRA 3G35A
chains in the Genus database with same CATH topology
1FCNA 3VSKA 1VQQA 3IQAA 2ZD8A 3GV9A 3GRJA 2J9PA 4DDSA 3UPOA 3IWIA 2BG1A 2EX9A 2HDRA 5E2FA 2XD1A 4BLMA 1JVJA 3SH9A 5KSCA 2PU2A 2WKIA 4GZBA 4S2JA 3WS1A 5L2FA 3W4OA 4OOLA 4UA7A 2XLNA 1BLHA 2J8YA 4NETA 3BRMA 4WZ5C 4P0MA 3MZDA 3OPHA 4KZ3A 4E6WA 1K4FA 1GA9A 3IXHA 5BOHA 1ALQA 1ESIA 3UE0A 1SCWA 3NI9A 4S2IA 5JYPA 2Z2LB 2WADA 3IWQA 4OP8A 3PBRA 2OV5A 2XFTA 2Y2NA 5FAQA 4BQMA 1PWCA 2J7VA 3WRZA 3O87A 1L2SA 1IYOA 1YT4A 1ES4A 4ZDXA 1CEGA 3IF6A 3IHAA 4YFMA 4X6TA 1KDSA 1WE4A 1LL5A 2IWBA 5EE8A 2WYXA 3V5MA 1K55A 4K0XA 3JYIA 4P85A 3MBZA 1PZOA 3MFDA 5EVID 1L0DA 5JYOA 1W8YA 3PAEA 1YLJA 2HDUA 1FR1A 2ZM8A 5FSRA 3TOIA 1E3UA 1XA7A 4U0TA 5DF8A 3UDFA 3W4QA 4DE0A 1H5XA 1SDNA 2VGKA 5AQAA 5CTMA 3M6HA 2EXBA 4N1HA 1KVMA 4NK3A 5E43A 5FAOA 4E3OA 5A90A 3N4IA 5EOOA 1BULA 5D3OA 3VOZA 3VOYA 1XX2A 4EV4A 2DNSA 4MEZA 4GOGA 3EQVA 1XXMA 2A49A 2HDSA 2JE5A 5CHJA 2ZQAA 5GHZA 3ZG5A 4JXGA 4QB8A 1K56D 5HFOA 3E2KA 3SS5A 5KSHA 5A93A 1L0EA 1XGIA 2HP9A 4QD4A 4PM6A 2ZMAA 5FATA 4WMCA 2A3UA 4ZTKA 5FQQA 3BFDA 1YLYA 3AGFA 1KE4A 4S2KA 3LCEA 3ZDJA 2P9VA 3VFHA 4OQ0A 2UWXA 2X71A 4D2OA 2H10A 1KE0A 4N9KA 3O88A 2IWCA 4JXWA 5CTNA 3IXBA 5HW3A 1IYQA 4RA7A 4WM9A 2Y2OA 3Q7ZA 5CXWA 3OZHA 5FQMA 4ZBEA 2ZQ8A 1YM1A 3PTEA 3WRTA 3FKWA 2ZQ9A 4M3KA 1C3BA 2G2WA 5GLDA 4Y0OA 4MLLA 2XK1A 5KMWA 2EFUA 4GD8A 1ERMA 3Q07A 4LV1A 3UE1A 4KQOA 2H0TA 3A3DA 4BD1A 1FSYA 4LV0A 4N92A 3PBTA 4S2NC 1PW8A 4KG2A 4DF6A 4OOYA 4OQHA 3E2LA 3A3JA 2Y2QA 1K54A 4C3QA 3PBOA 4Y7PA 3IH9A 4H8RA 1RGZA 4R3JA 4XUXA 4QHCA 3FWLA 1BTLA 3LY4A 4OPYA 5A91A 1CI8A 1I2SA 3VFFA 4OONA 4Q8IA 1LHYA 2ZC6B 3IF6B 4HESA 2V2FF 4KZ8A 1K6RA 1KDWA 1L0FA 4KENB 5HX9A 4OH0A 1KVLA 3GR2A 5DF7A 2ZC4B 3V39A 3IH8A 3UY6A 3IXDA 3BFFA 3ITBA 1G68A 4JLFA 4DXBA 1XKZA 3ZGAB 2Q9NA 4RYEA 4GD6A 4QJGA 1LL9A 2C5WB 3DTMA 4E3JA 3UE3A 1K57A 2ZLYA 4RVAA 3AGEA 4KZBA 4N1XA 4IBRA 5IHVA 4K91A 4FH2A 3ZHHA 5HAQA 3MXSA 5FDHA 1TEMA 5EVIA 4CPKA 4X55A 4EWFA 3BLMA 1PI4A 5EVLA 1DJAA 4HBUA 2Y4AA 4IVKA 4DRTA 4LV3A 4EBPA 3CZDA 5GLBA 1LLBA 1G6AA 4KZ7A 3V50A 3ZFZA 1IEMA 4DKIA 5TFQA 2ZC7A 3HLCA 3HREA 4WBGA 5CECA 4E6XA 1S6RA 3PBSA 5KZHA 3V3SA 1NJ4A 3C4PA 3HLGA 3ITAA 3PAGA 4OLDA 3GQZA 3NDEA 2Y59A 2OSUA 1MWTA 4UHUA 2P9VB 1MKIA 1BLSA 1BLPA 4EQIA 1QMFA 1XP4A 4LENA 3CJMA 3OCNA 4E3MA 2E8IA 3SS4A 1NXYA 3OC2A 3BYDA 4B4ZA 4MBKA 1K56A 1JWZA 4R4RA 5EOEA 4JF4A 3RXWA 5CHUA 1NRFA 2OLVA 1FSWA 2Z2MB 4R1GA 4S2MA 3ZNTA 3VSLA 3HUNA 5G18A 3NC8A 4HEFA 1ES5A 3G4PA 4HBTA 2ZQDA 2P74A 2XDMA 1NYMA 4P6BA 4RX2A 4FH4A 3CG5A 5TR7A 3CMZA 3GVBA 4PM9A 1WYCA 3VP4A 3DW0A 4OOMA 2CC1A 1ZC2A 2Y2GA 1JTDA 1HVBA 4X68A 5FAPA 4WELA 4ZJ2A 2Y2MA 4DXCA 3BFEA 5HL1A 1CK3A 3M2JA 2XF3A 3VP2A 4A5RA 5F1FA 3G2ZA 3MKFA 1GCEA 3C5AA 3LY3A 1PZPA 5FI7A 2Y2LA 3AGDA 2XFSA 3M6BA 1ZG4A 1YLPA 3IHBA 3WS4A 2C6WB 2G2UA 3Q81A 3BM6A 3MZFA 4B4XA 2R9WA 1LI0A 3EQUA 1KGFA 1JTGA 3NBLA 4Z9QA 1DJCA 5FQKA 3IF6C 1IYPA 2I72A 2WUQA 3G34A 3UN7A 3DWZA 4PPRA 5EUAA 3GSGA 4BL2A 1FR6A 1K55C 1EROA 4BJPA 1CEFA 1O7EA 1L0GA 4B88A 4S2OA 4FD8A 1Y54A 2WGWA 3O3VA 3ZVWA 4EUZA 1YMXA 2WK0A 3UNWA 4GKUA 4OP5A 3W8KA 3IT9A 5DTSA 2Q9MA 4WEJA 3SH8A 4UA9A 2RL3A 1RP5A 1MBLA 4OPQA 5CGWA 5TGFA 2PU4A 4U0XA 1SKFA 1TVFA 3UPPA 2X01A 2JBFA 4E3NA 3FV7A 1W7FA 5FI2A 1ES2A 3G31A 1BT5A 4QU3A 3UDXA 3NDGA 1KGEA 4OPZA 3UO9A 2IWDA 5GHYA 5HARA 1ONHA 2ZJ9A 1GA0A 2OLUA 3Q1FA 4MBHA 5FI6A 4WZ5A 1HD8A 2GDNA 2DCFA 4UAAA 3QNCA 5F1GA 5EVIB 1PIOA 2VGJA 1ERQA 2WZXA 1ZG6A 3TG9A 3HLWA 3ZG0A 5M18A 2WAFA 3V3RA 3QHYA 1YQSA 3HUMA 3HLDA 2XEPA 3Q7VA 3G2YA 4F94A 1S0WA 4ZJ1A 3FYZA 3OPRA 5CGSA 4JF5A 4FCFA 4KZ5A 4JXSA 1IKGA 3MXRA 2B5RA 1YLTA 5A92A 2H0YA 1GHMA 1W79A 4GN2A 5EECA 4JXVA 5FQ9A 3IXGA 4YINA 1MWSA 3C7UA 2FFFB 3MZEA 3N6IA 3OPLA 4IEDA 5F82A 5AQBA 1MWUA 2QZ6A 4C6YA 2V1ZA 3UPNA 3NCKA 1YLWA 5CERA 4KG6A 5F83A 2PBYA 3BECA 3HUOA 1HZOA 3N8SA 2QMIA 4BL3A 4DE1A 2ZQCA 1W5DA 4WZ4A 2EFXA 4KZAA 3G32A 3VP1A 1ONGA 2ZQ7A 5CEBA 1NYYA 4FSFA 1SDEA 5FQIA 4EBLA 5AQ7A 1AXBA 2XGNA 4EBNA 1EWZA 2WGVA 3HL9A 1Q2PA 2EX6A 2HP6A 3OCLA 4K0WA 4QY5A 1J9MA 2HP5A 1NZOA 4S2LA 4BENA 4MBFA 1RCJA 3B3XA 4OKPA 1N9BA 4P87A 5CHMA 3A3EA 2X02A 2H5SA 2QPNA 1K54C 5M19A 4MNRA 4JBFA 4L0LA 3PBNA 1PWGA 2WGIA 1XGJA 1ZKJA 4OVDA 3ZNYA 1LI9A 1N4OA 4JKTA 3P98A 1PWDA 1ESUA 2WZZA 5GHXA 1GHPA 1NZUA 4PMAA 3N7WA 4X69A 3BFGA 4UA6A 4WYYA 5J8XA 2DRWA 4C75A 2Y55A 5E2GA 1FCMA 1JWVA 2FFYA 1I2WA 3O86A 1MXOA 1NY0A 3HVFA 4RX3A 5DF9A 5FA7A 4OLGA 4PM5A 5CRFA 3ZG8B 2WGWB 4KZ9A 2Y2JA 1M6KA 1QMEA 1KGGA 3QNBA 1IYSA 4XUZA 5DVAA 3ZG9B 1K38A 1VM1A 3BLSA 5FASA 3GMWA 4KZ6A 2ZC3B 5EPHA 3RJUA 3DWKA 4GDBA 1H8YA 1IELA 3N8LA 1HTZA 2HPBA 1K57C 3HLFA 4WEKA 5AQ9A 3WS0A 2ZM0A 2BLSA 2Y2PA 3Q82A 5FQJA 4N9LA 4GDNA 2ZM2A 4X53A 5GLAA 1BUEA 1PYYA 2V20A 4S2NA 5EVIC 3D4FA 3ZG7B 3C7VA 4Y0UA 1E4DA 4OQGA 2JC7A 2EX2A 3FKVA 3BFCA 4ID4A 4KZ4A 4LCLA 3SOIA 1DY6A 3W4PA 1KE3A 1FCOA 1O07A 1E3UD 1GHIA 1Q2QA 2EX8A 1K25A 3LEZA 3TSGA 4E3LA 4KQQA 4QY6A 1PW1A 3ZVTA 1MWRA 3NIAA 2XD5A 3FZCA 3Q7VB 1H8ZA 1TDGA 3A3IA 3PBQA 3A3FA 3SH7A 3VP3A 4O7DA 4LV2A 5HAPA 1BLCA 3VP0A 1FQGA 1TDLA 3G30A 4KQRA 3RXXA 3UDIA 4E3KA 3S1YA 1MY8A 2RCXA 4CJNA 4R3BA 1SHVA 3WS5A 2J9OA 3OPPA 4DE2A 4KG5A 1IKIA 1U60A 4PM8A 3S4XA 2XQZA 4GNUA 1BSGA 5GLCA 3C4OA 1JWPA 4PM7A 1XPBA 2XR0A 1FOFA 3M2KA 2JCHA 1EI5A 3BEBA 2ZC5B 3HLEA 4WMCD 1K4EA 4XXRA 4Y0TA 5U47A 5E2HA 3HLBA 5DTTA 4JPMA 3P09A 2WKEA 4BD0A 1ES3A 3IWOA 3LO7A 1CI9A 1RGYA 2EXAA 1MPLA 3ISGA 4IBXA 1BZAA 3WWXA 1Z6FA 1I5QA 1OMEA 5DTKA 1E25A 4ZJ3A 3VMAA 2WKHA 2Y2KA 4R4SA 5CEDA 4JF6A 5GL9A 3NY4A 4U3TA 1K6SA 2Y2IA 2XH9A 1DJBA 5E2EA 3I7JA 1YMSA 3HBRA 4IVIA 1WYBA 5CGXA 2R9XA 5I94A 4R0QA 3ZCZA 3IF5A 4LCMA 3GTCA 4OQIA 1PI5A 1YLZA 4OPRA 2Y91A 4R23A 4DE3A 4X56A 4ZAMA 1M40A 4S2PA 3S22A 3WS2A 4DDYA 3N8RA 4E3IA 2WAEA 2HDQA 3SS3A 1XA1A 4GB7A 3MKEA 1W8QA 3G35A 2Y2HA 5M1AA 5HAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FCN A;  3VSK A;  1VQQ A;  3IQA A;  2ZD8 A;  3GV9 A;  3GRJ A;  2J9P A;  4DDS A;  3UPO A;  3IWI A;  2BG1 A;  2EX9 A;  2HDR A;  5E2F A;  2XD1 A;  4BLM A;  1JVJ A;  3SH9 A;  5KSC A;  2PU2 A;  2WKI A;  4GZB A;  4S2J A;  3WS1 A;  5L2F A;  3W4O A;  4OOL A;  4UA7 A;  2XLN A;  1BLH A;  2J8Y A;  4NET A;  3BRM A;  4WZ5 C;  4P0M A;  3MZD A;  3OPH A;  4KZ3 A;  4E6W A;  1K4F A;  1GA9 A;  3IXH A;  5BOH A;  1ALQ A;  1ESI A;  3UE0 A;  1SCW A;  3NI9 A;  4S2I A;  5JYP A;  2Z2L B;  2WAD A;  3IWQ A;  4OP8 A;  3PBR A;  2OV5 A;  2XFT A;  2Y2N A;  5FAQ A;  4BQM A;  1PWC A;  2J7V A;  3WRZ A;  3O87 A;  1L2S A;  1IYO A;  1YT4 A;  1ES4 A;  4ZDX A;  1CEG A;  3IF6 A;  3IHA A;  4YFM A;  4X6T A;  1KDS A;  1WE4 A;  1LL5 A;  2IWB A;  5EE8 A;  2WYX A;  3V5M A;  1K55 A;  4K0X A;  3JYI A;  4P85 A;  3MBZ A;  1PZO A;  3MFD A;  5EVI D;  1L0D A;  5JYO A;  1W8Y A;  3PAE A;  1YLJ A;  2HDU A;  1FR1 A;  2ZM8 A;  5FSR A;  3TOI A;  1E3U A;  1XA7 A;  4U0T A;  5DF8 A;  3UDF A;  3W4Q A;  4DE0 A;  1H5X A;  1SDN A;  2VGK A;  5AQA A;  5CTM A;  3M6H A;  2EXB A;  4N1H A;  1KVM A;  4NK3 A;  5E43 A;  5FAO A;  4E3O A;  5A90 A;  3N4I A;  5EOO A;  1BUL A;  5D3O A;  3VOZ A;  3VOY A;  1XX2 A;  4EV4 A;  2DNS A;  4MEZ A;  4GOG A;  3EQV A;  1XXM A;  2A49 A;  2HDS A;  2JE5 A;  5CHJ A;  2ZQA A;  5GHZ A;  3ZG5 A;  4JXG A;  4QB8 A;  1K56 D;  5HFO A;  3E2K A;  3SS5 A;  5KSH A;  5A93 A;  1L0E A;  1XGI A;  2HP9 A;  4QD4 A;  4PM6 A;  2ZMA A;  5FAT A;  4WMC A;  2A3U A;  4ZTK A;  5FQQ A;  3BFD A;  1YLY A;  3AGF A;  1KE4 A;  4S2K A;  3LCE A;  3ZDJ A;  2P9V A;  3VFH A;  4OQ0 A;  2UWX A;  2X71 A;  4D2O A;  2H10 A;  1KE0 A;  4N9K A;  3O88 A;  2IWC A;  4JXW A;  5CTN A;  3IXB A;  5HW3 A;  1IYQ A;  4RA7 A;  4WM9 A;  2Y2O A;  3Q7Z A;  5CXW A;  3OZH A;  5FQM A;  4ZBE A;  2ZQ8 A;  1YM1 A;  3PTE A;  3WRT A;  3FKW A;  2ZQ9 A;  4M3K A;  1C3B A;  2G2W A;  5GLD A;  4Y0O A;  4MLL A;  2XK1 A;  5KMW A;  2EFU A;  4GD8 A;  1ERM A;  3Q07 A;  4LV1 A;  3UE1 A;  4KQO A;  2H0T A;  3A3D A;  4BD1 A;  1FSY A;  4LV0 A;  4N92 A;  3PBT A;  4S2N C;  1PW8 A;  4KG2 A;  4DF6 A;  4OOY A;  4OQH A;  3E2L A;  3A3J A;  2Y2Q A;  1K54 A;  4C3Q A;  3PBO A;  4Y7P A;  3IH9 A;  4H8R A;  1RGZ A;  4R3J A;  4XUX A;  4QHC A;  3FWL A;  1BTL A;  3LY4 A;  4OPY A;  5A91 A;  1CI8 A;  1I2S A;  3VFF A;  4OON A;  4Q8I A;  1LHY A;  2ZC6 B;  3IF6 B;  4HES A;  2V2F F;  4KZ8 A;  1K6R A;  1KDW A;  1L0F A;  4KEN B;  5HX9 A;  4OH0 A;  1KVL A;  3GR2 A;  5DF7 A;  2ZC4 B;  3V39 A;  3IH8 A;  3UY6 A;  3IXD A;  3BFF A;  3ITB A;  1G68 A;  4JLF A;  4DXB A;  1XKZ A;  3ZGA B;  2Q9N A;  4RYE A;  4GD6 A;  4QJG A;  1LL9 A;  2C5W B;  3DTM A;  4E3J A;  3UE3 A;  1K57 A;  2ZLY A;  4RVA A;  3AGE A;  4KZB A;  4N1X A;  4IBR A;  5IHV A;  4K91 A;  4FH2 A;  3ZHH A;  5HAQ A;  3MXS A;  5FDH A;  1TEM A;  5EVI A;  4CPK A;  4X55 A;  4EWF A;  3BLM A;  1PI4 A;  5EVL A;  1DJA A;  4HBU A;  2Y4A A;  4IVK A;  4DRT A;  4LV3 A;  4EBP A;  3CZD A;  5GLB A;  1LLB A;  1G6A A;  4KZ7 A;  3V50 A;  3ZFZ A;  1IEM A;  4DKI A;  5TFQ A;  2ZC7 A;  3HLC A;  3HRE A;  4WBG A;  5CEC A;  4E6X A;  1S6R A;  3PBS A;  5KZH A;  3V3S A;  1NJ4 A;  3C4P A;  3HLG A;  3ITA A;  3PAG A;  4OLD A;  3GQZ A;  3NDE A;  2Y59 A;  2OSU A;  1MWT A;  4UHU A;  2P9V B;  1MKI A;  1BLS A;  1BLP A;  4EQI A;  1QMF A;  1XP4 A;  4LEN A;  3CJM A;  3OCN A;  4E3M A;  2E8I A;  3SS4 A;  1NXY A;  3OC2 A;  3BYD A;  4B4Z A;  4MBK A;  1K56 A;  1JWZ A;  4R4R A;  5EOE A;  4JF4 A;  3RXW A;  5CHU A;  1NRF A;  2OLV A;  1FSW A;  2Z2M B;  4R1G A;  4S2M A;  3ZNT A;  3VSL A;  3HUN A;  5G18 A;  3NC8 A;  4HEF A;  1ES5 A;  3G4P A;  4HBT A;  2ZQD A;  2P74 A;  2XDM A;  1NYM A;  4P6B A;  4RX2 A;  4FH4 A;  3CG5 A;  5TR7 A;  3CMZ A;  3GVB A;  4PM9 A;  1WYC A;  3VP4 A;  3DW0 A;  4OOM A;  2CC1 A;  1ZC2 A;  2Y2G A;  1JTD A;  1HVB A;  4X68 A;  5FAP A;  4WEL A;  4ZJ2 A;  2Y2M A;  4DXC A;  3BFE A;  5HL1 A;  1CK3 A;  3M2J A;  2XF3 A;  3VP2 A;  4A5R A;  5F1F A;  3G2Z A;  3MKF A;  1GCE A;  3C5A A;  3LY3 A;  1PZP A;  5FI7 A;  2Y2L A;  3AGD A;  2XFS A;  3M6B A;  1ZG4 A;  1YLP A;  3IHB A;  3WS4 A;  2C6W B;  2G2U A;  3Q81 A;  3BM6 A;  3MZF A;  4B4X A;  2R9W A;  1LI0 A;  3EQU A;  1KGF A;  1JTG A;  3NBL A;  4Z9Q A;  1DJC A;  5FQK A;  3IF6 C;  1IYP A;  2I72 A;  2WUQ A;  3G34 A;  3UN7 A;  3DWZ A;  4PPR A;  5EUA A;  3GSG A;  4BL2 A;  1FR6 A;  1K55 C;  1ERO A;  4BJP A;  1CEF A;  1O7E A;  1L0G A;  4B88 A;  4S2O A;  4FD8 A;  1Y54 A;  2WGW A;  3O3V A;  3ZVW A;  4EUZ A;  1YMX A;  2WK0 A;  3UNW A;  4GKU A;  4OP5 A;  3W8K A;  3IT9 A;  5DTS A;  2Q9M A;  4WEJ A;  3SH8 A;  4UA9 A;  2RL3 A;  1RP5 A;  1MBL A;  4OPQ A;  5CGW A;  5TGF A;  2PU4 A;  4U0X A;  1SKF A;  1TVF A;  3UPP A;  2X01 A;  2JBF A;  4E3N A;  3FV7 A;  1W7F A;  5FI2 A;  1ES2 A;  3G31 A;  1BT5 A;  4QU3 A;  3UDX A;  3NDG A;  1KGE A;  4OPZ A;  3UO9 A;  2IWD A;  5GHY A;  5HAR A;  1ONH A;  2ZJ9 A;  1GA0 A;  2OLU A;  3Q1F A;  4MBH A;  5FI6 A;  4WZ5 A;  1HD8 A;  2GDN A;  2DCF A;  4UAA A;  3QNC A;  5F1G A;  5EVI B;  1PIO A;  2VGJ A;  1ERQ A;  2WZX A;  1ZG6 A;  3TG9 A;  3HLW A;  3ZG0 A;  5M18 A;  2WAF A;  3V3R A;  3QHY A;  1YQS A;  3HUM A;  3HLD A;  2XEP A;  3Q7V A;  3G2Y A;  4F94 A;  1S0W A;  4ZJ1 A;  3FYZ A;  3OPR A;  5CGS A;  4JF5 A;  4FCF A;  4KZ5 A;  4JXS A;  1IKG A;  3MXR A;  2B5R A;  1YLT A;  5A92 A;  2H0Y A;  1GHM A;  1W79 A;  4GN2 A;  5EEC A;  4JXV A;  5FQ9 A;  3IXG A;  4YIN A;  1MWS A;  3C7U A;  2FFF B;  3MZE A;  3N6I A;  3OPL A;  4IED A;  5F82 A;  5AQB A;  1MWU A;  2QZ6 A;  4C6Y A;  2V1Z A;  3UPN A;  3NCK A;  1YLW A;  5CER A;  4KG6 A;  5F83 A;  2PBY A;  3BEC A;  3HUO A;  1HZO A;  3N8S A;  2QMI A;  4BL3 A;  4DE1 A;  2ZQC A;  1W5D A;  4WZ4 A;  2EFX A;  4KZA A;  3G32 A;  3VP1 A;  1ONG A;  2ZQ7 A;  5CEB A;  1NYY A;  4FSF A;  1SDE A;  5FQI A;  4EBL A;  5AQ7 A;  1AXB A;  2XGN A;  4EBN A;  1EWZ A;  2WGV A;  3HL9 A;  1Q2P A;  2EX6 A;  2HP6 A;  3OCL A;  4K0W A;  4QY5 A;  1J9M A;  2HP5 A;  1NZO A;  4S2L A;  4BEN A;  4MBF A;  1RCJ A;  3B3X A;  4OKP A;  1N9B A;  4P87 A;  5CHM A;  3A3E A;  2X02 A;  2H5S A;  2QPN A;  1K54 C;  5M19 A;  4MNR A;  4JBF A;  4L0L A;  3PBN A;  1PWG A;  2WGI A;  1XGJ A;  1ZKJ A;  4OVD A;  3ZNY A;  1LI9 A;  1N4O A;  4JKT A;  3P98 A;  1PWD A;  1ESU A;  2WZZ A;  5GHX A;  1GHP A;  1NZU A;  4PMA A;  3N7W A;  4X69 A;  3BFG A;  4UA6 A;  4WYY A;  5J8X A;  2DRW A;  4C75 A;  2Y55 A;  5E2G A;  1FCM A;  1JWV A;  2FFY A;  1I2W A;  3O86 A;  1MXO A;  1NY0 A;  3HVF A;  4RX3 A;  5DF9 A;  5FA7 A;  4OLG A;  4PM5 A;  5CRF A;  3ZG8 B;  2WGW B;  4KZ9 A;  2Y2J A;  1M6K A;  1QME A;  1KGG A;  3QNB A;  1IYS A;  4XUZ A;  5DVA A;  3ZG9 B;  1K38 A;  1VM1 A;  3BLS A;  5FAS A;  3GMW A;  4KZ6 A;  2ZC3 B;  5EPH A;  3RJU A;  3DWK A;  4GDB A;  1H8Y A;  1IEL A;  3N8L A;  1HTZ A;  2HPB A;  1K57 C;  3HLF A;  4WEK A;  5AQ9 A;  3WS0 A;  2ZM0 A;  2BLS A;  2Y2P A;  3Q82 A;  5FQJ A;  4N9L A;  4GDN A;  2ZM2 A;  4X53 A;  5GLA A;  1BUE A;  1PYY A;  2V20 A;  4S2N A;  5EVI C;  3D4F A;  3ZG7 B;  3C7V A;  4Y0U A;  1E4D A;  4OQG A;  2JC7 A;  2EX2 A;  3FKV A;  3BFC A;  4ID4 A;  4KZ4 A;  4LCL A;  3SOI A;  1DY6 A;  3W4P A;  1KE3 A;  1FCO A;  1O07 A;  1E3U D;  1GHI A;  1Q2Q A;  2EX8 A;  1K25 A;  3LEZ A;  3TSG A;  4E3L A;  4KQQ A;  4QY6 A;  1PW1 A;  3ZVT A;  1MWR A;  3NIA A;  2XD5 A;  3FZC A;  3Q7V B;  1H8Z A;  1TDG A;  3A3I A;  3PBQ A;  3A3F A;  3SH7 A;  3VP3 A;  4O7D A;  4LV2 A;  5HAP A;  1BLC A;  3VP0 A;  1FQG A;  1TDL A;  3G30 A;  4KQR A;  3RXX A;  3UDI A;  4E3K A;  3S1Y A;  1MY8 A;  2RCX A;  4CJN A;  4R3B A;  1SHV A;  3WS5 A;  2J9O A;  3OPP A;  4DE2 A;  4KG5 A;  1IKI A;  1U60 A;  4PM8 A;  3S4X A;  2XQZ A;  4GNU A;  1BSG A;  5GLC A;  3C4O A;  1JWP A;  4PM7 A;  1XPB A;  2XR0 A;  1FOF A;  3M2K A;  2JCH A;  1EI5 A;  3BEB A;  2ZC5 B;  3HLE A;  4WMC D;  1K4E A;  4XXR A;  4Y0T A;  5U47 A;  5E2H A;  3HLB A;  5DTT A;  4JPM A;  3P09 A;  2WKE A;  4BD0 A;  1ES3 A;  3IWO A;  3LO7 A;  1CI9 A;  1RGY A;  2EXA A;  1MPL A;  3ISG A;  4IBX A;  1BZA A;  3WWX A;  1Z6F A;  1I5Q A;  1OME A;  5DTK A;  1E25 A;  4ZJ3 A;  3VMA A;  2WKH A;  2Y2K A;  4R4S A;  5CED A;  4JF6 A;  5GL9 A;  3NY4 A;  4U3T A;  1K6S A;  2Y2I A;  2XH9 A;  1DJB A;  5E2E A;  3I7J A;  1YMS A;  3HBR A;  4IVI A;  1WYB A;  5CGX A;  2R9X A;  5I94 A;  4R0Q A;  3ZCZ A;  3IF5 A;  4LCM A;  3GTC A;  4OQI A;  1PI5 A;  1YLZ A;  4OPR A;  2Y91 A;  4R23 A;  4DE3 A;  4X56 A;  4ZAM A;  1M40 A;  4S2P A;  3S22 A;  3WS2 A;  4DDY A;  3N8R A;  4E3I A;  2WAE A;  2HDQ A;  3SS3 A;  1XA1 A;  4GB7 A;  3MKE A;  1W8Q A;  3G35 A;  2Y2H A;  5M1A A;  5HAI A; 
#chains in the Genus database with same CATH topology
 3VSK A;  1VQQ A;  1S1Y A;  4NXG A;  3GV9 A;  2WKI A;  5L2F A;  2LB5 A;  1OPX A;  5HZH A;  3CPT B;  4CLC B;  2OWH A;  5JYP A;  2Z2L B;  2WAD A;  2VX8 A;  2OV5 A;  1UGU A;  2K31 A;  1PWC A;  2PHY A;  3WRZ A;  2YKF A;  4YFM A;  4I3A A;  1WE4 A;  1D1J A;  5EE8 A;  1XFN A;  3V5M A;  4P85 A;  3MBZ A;  1PZO A;  5EVI D;  3TOI A;  4DE0 A;  1E3U A;  3UDF A;  4HHD A;  3W4Q A;  1VEU B;  5AQA A;  4QWO A;  3M6H A;  3NJA A;  2EXB A;  5G4Y A;  4N1H A;  4E3O A;  5FAO A;  4WL9 A;  3N4I A;  4HH3 A;  4HNB A;  5DKK A;  2GX5 A;  3BW6 A;  5AVE A;  5D3O A;  3VOZ A;  2QJ5 A;  4EV4 A;  2NUT C;  3EQV A;  2JE5 A;  5GHZ A;  3LI9 A;  4JXG A;  3KYE A;  4WLA A;  5HFO A;  2HP9 A;  2A3U A;  5FQQ A;  4NG2 A;  2W27 A;  4BWI A;  2H10 A;  4N9K A;  1OT6 A;  5CTN A;  1F5M A;  5FEG A;  2AVX A;  5HD5 A;  3CI6 A;  4EEU A;  1T1C A;  1C3B A;  4Y0O A;  2XK1 A;  2PT7 A;  3TW8 A;  1ERM A;  2OAP 1;  4LV1 A;  4R3A A;  3LIA A;  2DMW A;  3BWL A;  1UWN X;  4ETX A;  4DF6 A;  3A3J A;  1K54 A;  5HDC A;  4H8R A;  4R3J A;  4XUX A;  3DAV A;  2JKT M;  3S7P A;  4LLO B;  1CI8 A;  3VFF A;  4Q8I A;  3UB9 A;  4LRX C;  4HES A;  4KZ8 A;  2R78 A;  4KEN B;  4OH0 A;  2ZC4 B;  1TS7 A;  3UY6 A;  1Y4O A;  4DXB A;  3C2W A;  1GSX A;  2Q9N A;  1LL9 A;  3DTM A;  5C5K A;  3OOV A;  4FH2 A;  3ZHH A;  2I9V A;  1IFQ A;  5FDH A;  1TEM A;  5EVI A;  3BLM A;  1PI4 A;  5EVL A;  1DJA A;  2Y4A A;  4IVK A;  5J3W A;  1S67 L;  2VKS A;  5DJU A;  5FDS A;  2ZC7 A;  3HRE A;  5KZH A;  4HI4 A;  3ITA A;  4P6Z M;  4OLD A;  2Y59 A;  3L7H A;  1MWT A;  2W1R A;  3MFX A;  1MKI A;  4EQI A;  1QMF A;  4LEN A;  3CJM A;  3DTK A;  3SS4 A;  4R4R A;  1T1B A;  2BTF P;  3RXW A;  2OLV A;  2Z2M B;  3ZYT A;  3ZNT A;  4HEF A;  3T4S A;  1VHM A;  2P74 A;  3T1S A;  3UB5 P;  4PM9 A;  3VP4 A;  2CC1 A;  2Y2G A;  5FAP A;  4ZJ2 A;  2M7V A;  2Y2M A;  5HL1 A;  1CK3 A;  2ZOH A;  2XF3 A;  3VP2 A;  4DMZ A;  1W63 Q;  5F1F A;  3C5A A;  3UE6 A;  3LR5 A;  3LY3 A;  2Y2L A;  1YPR A;  3WS4 A;  2G2U A;  3Q81 A;  3BM6 A;  2H28 A;  1DJC A;  2I72 A;  3DTE A;  3G34 A;  4X1M A;  5EUA A;  1K55 C;  1ERO A;  4B88 A;  1TS8 A;  4LRY C;  4EUZ A;  3UNW A;  4GKU A;  5DTS A;  2Q9M A;  5CX7 A;  4JGR A;  2RL3 A;  1MBL A;  4WF0 A;  3EGD C;  4QU3 A;  3B33 A;  2IWD A;  2XRO A;  4Y15 A;  1ONH A;  3LID A;  4JGP A;  4WZ5 A;  5EVI B;  1PIO A;  1ERQ A;  1Z09 A;  1ZG6 A;  4II7 A;  3HLW A;  3DTI A;  4F94 A;  4KUO A;  5CGS A;  4JF5 A;  4FCF A;  1G6O A;  2B5R A;  4P6Z S;  1N9L A;  2KX6 A;  3IXG A;  4YIN A;  2FFF B;  4C6Y A;  2OAQ 1;  5F83 A;  3N8S A;  4BL3 A;  2ZQC A;  2ZQ7 A;  4R38 A;  4FSF A;  4G3V A;  1LSV A;  2XGN A;  4K0W A;  3EGX C;  1OT9 A;  2INW A;  4BEN A;  1N9B A;  4P87 A;  5CHM A;  3PBN A;  2WGI A;  2L4R A;  1XGJ A;  2P04 A;  3NHQ A;  3P98 A;  5GHX A;  1NZU A;  2HJE A;  5HDS A;  5J8X A;  1FCM A;  2J3T C;  1I2W A;  4RX3 A;  5DF9 A;  5FA7 A;  4OLG A;  1KGG A;  3QNB A;  3SW1 A;  3EOI A;  1P9R A;  1S4R A;  1XJ4 A;  2ZC3 B;  2HPB A;  1K57 C;  4WEK A;  3WS0 A;  2HGV A;  4HIA A;  2ZM0 A;  5FQJ A;  2Y2P A;  3Q82 A;  1NLZ A;  5GLA A;  3C7V A;  2PRF A;  2O0Y A;  4KZ4 A;  4LCL A;  4NXF A;  2O9A A;  1Q2Q A;  1K25 A;  2ZBB A;  4QY6 A;  1P97 A;  1MWR A;  2Y79 A;  4HP4 A;  1TDG A;  3A3I A;  3VE3 A;  3DBA A;  5HAP A;  3RXX A;  4E3K A;  2RCX A;  4R3B A;  4KG5 A;  4PM8 A;  2XQZ A;  1IOU A;  1BSG A;  4I38 A;  3H9W A;  5HPF A;  1ZHH B;  4XXR A;  3HLE A;  4WMC D;  2D02 A;  2EXA A;  1MPL A;  1E25 A;  1J3W A;  3NY4 A;  1OTB A;  1K6S A;  2Y2I A;  3PXP A;  1DJB A;  3I7J A;  5CGX A;  2BAS A;  2NUP C;  4R0Q A;  1S66 L;  1KOU A;  4OPR A;  1OJG A;  4FOF A;  4ZAM A;  1M40 A;  4DDY A;  1GSW A;  1XA1 A;  4GB7 A;  2Y2H A;  4DE2 A;  5HAI A;  3D3O A;  3IQA A;  2ZD8 A;  3E4O A;  2M1C A;  3BY8 A;  5E2F A;  2XD1 A;  4HP9 A;  4GZB A;  1T19 A;  3WS1 A;  4B9O A;  2XLN A;  1K4F A;  4YWZ A;  3IXH A;  5BOH A;  3UE0 A;  3NI9 A;  4HJ3 A;  5F68 A;  3LR0 A;  1GSV A;  2XFT A;  5FAQ A;  4BQM A;  3SZT A;  1YAX A;  1V9Z A;  3O87 A;  1L2S A;  1IYO A;  3IHA A;  3IF6 A;  3PYP A;  1N9O A;  4FTX A;  3QP1 A;  2HDU A;  1FR1 A;  5HWW A;  5KIZ A;  5CTM A;  5E43 A;  4I5S A;  1V9Y A;  4O8G A;  4Q0H A;  5EOO A;  1BUL A;  2J3W A;  2DNS A;  2L1M A;  4MEZ A;  3B47 A;  2HDS A;  1P9W A;  3ZG5 A;  4IUH A;  3SS5 A;  3UB8 A;  1XGI A;  4WMC A;  4ZTK A;  3BFD A;  1ZTU A;  3AGF A;  3LCE A;  2PD7 A;  3VFH A;  4OQ0 A;  2UWX A;  2X71 A;  1KE0 A;  3LR4 A;  2ZL1 A;  3QP8 A;  4L9F A;  3CAX A;  4RA7 A;  2MJ6 A;  3KSF A;  3Q7Z A;  3OZH A;  3PTE A;  3WRT A;  2ZQ9 A;  5GLD A;  2G2W A;  5K5B A;  5KMW A;  4GW9 A;  4GD8 A;  3Q07 A;  4KQO A;  4Q0I A;  4LV0 A;  2P08 A;  4N92 A;  3PBT A;  4S2N C;  4C3Q A;  3PBO A;  4Y7P A;  1OTD A;  4QHC A;  4XT2 A;  4OPY A;  1G5U A;  5LBR A;  2ZMV A;  4OON A;  1LHY A;  2ZC6 B;  3IF6 B;  1K6R A;  1L0F A;  1TD5 A;  5HX9 A;  5DF7 A;  3E4P A;  3C30 A;  4JLF A;  2VV6 A;  2LB9 A;  4QJG A;  4GD6 A;  4F3L A;  3IX4 A;  2C5W B;  1YKD A;  3UE3 A;  3ULF A;  2JN7 A;  4EW7 A;  3CUE C;  4E04 A;  2VZW A;  4CQH A;  4CPK A;  4X55 A;  4HBU A;  4LV3 A;  3CZD A;  5GLB A;  3VV4 A;  2B95 A;  1IEM A;  3T4K A;  4DKI A;  4LGW A;  2W1T A;  3BQA A;  1S6R A;  3GQZ A;  2PR5 A;  5MC7 A;  1BLP A;  1XP4 A;  4HJ4 A;  2ZL1 B;  4LPZ A;  1NXY A;  1NRF A;  4MN6 A;  3VSL A;  3R4K A;  4FH4 A;  5TR7 A;  5G4Z A;  4OOM A;  2W3H A;  1ZC2 A;  1HVB A;  2VK3 A;  4WEL A;  5HPI A;  4A5R A;  3G2Z A;  1GCE A;  2XFS A;  3IHB A;  2C6W B;  2JKF A;  1PFL A;  3MZF A;  4I3J A;  4B4X A;  4XT2 B;  1LI0 A;  3K3C A;  4Z9Q A;  5IT5 A;  2WUQ A;  3UN7 A;  1FR6 A;  1L0G A;  1O7E A;  4MN7 A;  3KSH A;  4H6J A;  4LFU A;  4S2O A;  2V1A A;  2WGW A;  4OP5 A;  3IT9 A;  2JKR I;  5CGW A;  5TGF A;  4U0X A;  4E3N A;  4F3L B;  2JBF A;  5FI2 A;  1ES2 A;  3G31 A;  1BT5 A;  3UDX A;  3NDG A;  2VJW A;  2OLU A;  4MBH A;  4UAA A;  2DCF A;  1CF0 A;  5A8B A;  4O0P A;  4HQA A;  5F1G A;  2VGJ A;  1NWZ A;  2CMN A;  2V1B A;  3ZG0 A;  2WAF A;  3QHY A;  2XEP A;  3RFB A;  1VET A;  2W1T B;  4KZ5 A;  1P0Z A;  1IKG A;  1YLT A;  2YKH A;  5A92 A;  1GHM A;  3C38 A;  3MZE A;  2GZA A;  4IED A;  1MWU A;  1YLW A;  3HUO A;  2QMI A;  4DE1 A;  4MMN A;  3VP1 A;  2W3G A;  5CEB A;  1NYY A;  1UWP X;  1SDE A;  4EBL A;  5AQ7 A;  3HL9 A;  1Q2P A;  3OCL A;  1J9M A;  3CIT A;  4MCW A;  4MBF A;  2VV8 A;  3UMD A;  1DP8 A;  2H5S A;  4RQ9 A;  4OVD A;  1N4O A;  3LUQ A;  1PWD A;  3W2Z A;  1ESU A;  5EV0 A;  5DJT A;  3N7W A;  3BFG A;  2V8C A;  3D9Y A;  2UV0 E;  1JWV A;  1F2K A;  1MXO A;  4H6J B;  5CRF A;  3ZG8 B;  2WGW B;  4KZ9 A;  2Y2J A;  4XUZ A;  3ZG9 B;  3BLS A;  5FAS A;  1IEL A;  3N8L A;  1DP6 A;  4N9L A;  4X53 A;  3T1R A;  1BUE A;  2V20 A;  4GS9 A;  4Y0U A;  2JC7 A;  1XJ3 A;  3SOI A;  3MJQ A;  3W4P A;  2A2L A;  1O07 A;  1GHI A;  2EX8 A;  4G3W A;  4KQQ A;  1TF1 A;  2XD5 A;  3TE8 A;  1VET B;  4O7D A;  4LV2 A;  3BQ8 A;  2XA7 M;  4HJ6 A;  4CJN A;  5F69 A;  3WS5 A;  3OPP A;  1IKI A;  3F1P A;  1Y28 A;  2JCH A;  1EI5 A;  3BEB A;  4HH2 A;  4JPM A;  3P09 A;  2WKE A;  3S7O A;  4EEP A;  1LSW A;  3IWO A;  1RGY A;  4IBX A;  2O99 A;  1Z6F A;  1I5Q A;  3VMA A;  2WKH A;  2Y2K A;  4JF6 A;  3CHW P;  5E2E A;  4GHI A;  1YMS A;  2PBD P;  2V9A A;  4CLC E;  5I94 A;  3T4T A;  4LCM A;  4OQI A;  4R23 A;  2O9B A;  3TRC A;  3KSG A;  2V0W A;  3LIB A;  3N8R A;  2WAE A;  1FIL A;  3A0V A;  3MKE A;  2KDK A;  5HDD A;  1W8Q A;  5M1A A;  1FCN A;  1H3Q A;  4YNR A;  4BMW A;  2HZ5 A;  2Z6D A;  2J9P A;  1X0O A;  3IWI A;  2EX9 A;  2HDR A;  1JVJ A;  3SH9 A;  5KSC A;  4PKY A;  3JPU A;  4UA7 A;  3T4J A;  1BLH A;  2J8Y A;  4NET A;  3FPV A;  3BRM A;  3MZD A;  4KZ3 A;  4E6W A;  1GA9 A;  4GS9 B;  2J3T D;  1ESI A;  4S2I A;  3PBR A;  4ME4 A;  2Y2N A;  2J7V A;  4ZDX A;  1N9N A;  1ES4 A;  2PYP A;  4X6T A;  1KDS A;  1LL5 A;  2IWB A;  2WYX A;  3B42 A;  3L9K A;  1K55 A;  2V8F A;  1L0D A;  5JYO A;  1W8Y A;  1D06 A;  2W0N A;  3PAE A;  5AJG A;  2XA7 S;  4U0T A;  1A0K A;  3F1P B;  3LI8 A;  4BBU A;  3LIE A;  3FC7 A;  1XX2 A;  4DJ2 A;  2A49 A;  3QP2 A;  4MN5 A;  5CHJ A;  2B02 A;  4QB8 A;  1K56 D;  3TJZ C;  5A93 A;  3T1X A;  4QD4 A;  4PM6 A;  1TS6 A;  2QJ7 A;  4GHI B;  4S2K A;  1FIK A;  2ZMF A;  4D2O A;  1PNE A;  3O88 A;  4WUJ A;  2OWJ A;  1MKM A;  4WM9 A;  3MXQ A;  2Y2O A;  5FQM A;  2Q0O A;  3BJN A;  4MLL A;  3UE1 A;  2PDR A;  4BD1 A;  1YSP A;  4M4X A;  3LR3 A;  4KG2 A;  4OOY A;  4OQH A;  4CLC C;  2Y2Q A;  3MF0 A;  5HWT A;  3IH9 A;  1RGZ A;  3LFV A;  3FWL A;  3KX0 X;  4PKY G;  1BTL A;  3LY4 A;  4K08 A;  1I2S A;  4I39 A;  1KDW A;  4UQI M;  3V39 A;  2GJ3 A;  3IXD A;  3BFF A;  3BY9 A;  3ITB A;  1G68 A;  1NRJ A;  1H0M A;  1XKZ A;  3ZGA B;  1MZU A;  2K2N A;  3LEQ A;  1K57 A;  3JVU A;  5EM0 A;  3NUL A;  5HAQ A;  4EWF A;  3KYZ A;  3MMH A;  1LLB A;  1G6A A;  2ZOI A;  4KZ7 A;  3V50 A;  3ZFZ A;  3KYQ A;  3HLC A;  3F1N A;  4WBG A;  4EUV A;  3NOP C;  1NJ4 A;  3C4P A;  3HLG A;  2A24 A;  3NDE A;  2OSU A;  3UME A;  4R6L A;  3OCN A;  3D72 A;  1SKO A;  4MBK A;  1K56 A;  1T1A A;  5DFX A;  4JF4 A;  5CHU A;  3VE4 A;  1ES5 A;  3G4P A;  3S7N A;  2XDM A;  1NYM A;  4RX2 A;  4NXB A;  3GVB A;  5L07 A;  3EWK A;  4DXC A;  3IBJ A;  2Y8H A;  3MKF A;  4BBV A;  2EWW A;  1PZP A;  5FI7 A;  3M6B A;  1WA9 A;  3GEC A;  3EQU A;  3LIC A;  4FUW A;  5FQK A;  3FG8 A;  1IYP A;  4L9E A;  3DWZ A;  4PPR A;  4BL2 A;  4BJP A;  1CEF A;  3MQQ A;  2EA9 A;  5DFY A;  1Y54 A;  3O3V A;  3ZVW A;  1YMX A;  2WK0 A;  3W8K A;  3MQ0 A;  4UQI S;  4WEJ A;  3SH8 A;  3HJK A;  3UPP A;  2X01 A;  3MQO A;  3FV7 A;  2W3F A;  1D7E A;  5GHY A;  5CEC A;  2ZJ9 A;  1GA0 A;  3Q1F A;  5FI6 A;  1HD8 A;  2GDN A;  5IU1 A;  3QNC A;  4IJG A;  4JGO A;  2WZX A;  3TG9 A;  5M18 A;  1YQS A;  3HLD A;  1G28 A;  3NOT C;  3T12 B;  3Q7V A;  1S0W A;  3F1N B;  1F9I A;  3OPR A;  2A24 B;  2H0Y A;  5EEC A;  4GN2 A;  5FQ9 A;  2HV1 A;  5AQB A;  2QZ6 A;  3QP5 A;  4WN5 A;  5CER A;  1SKO B;  2PBY A;  3BEC A;  1HZO A;  4WZ4 A;  4ARZ A;  5FQI A;  3ICY A;  1EWZ A;  2EX6 A;  2M7U A;  4DJ3 A;  4S2L A;  2XRN A;  2QYB A;  3A3E A;  4NEE D;  1K54 C;  4JBF A;  4ESP A;  4KQD A;  5F6A A;  5L09 A;  4PAU A;  2WZZ A;  1GHP A;  4UA6 A;  3LGO A;  1OJ5 A;  2Y55 A;  5E2G A;  4C75 A;  1CQA A;  2FFY A;  3O86 A;  1NY0 A;  3HVF A;  3V67 A;  4PM5 A;  2JKR M;  1M6K A;  1QME A;  2P7J A;  1VM1 A;  4KZ6 A;  3T4Q A;  3DWK A;  4GDB A;  1H8Y A;  1HTZ A;  1XJ2 A;  3G6O A;  4GDN A;  2ZM2 A;  1PYY A;  5EVI C;  4S2N A;  4EES A;  3D4F A;  1E4D A;  4OQG A;  4IHQ A;  2EX2 A;  2JKG A;  3FKV A;  4ID4 A;  4E3L A;  1H8M A;  3LEZ A;  3TSG A;  1PW1 A;  3U4L P;  3ZVT A;  2ACG A;  3FZC A;  1HLU P;  3Q7V B;  4Y17 A;  1H8Z A;  3PBQ A;  3SH7 A;  3A3F A;  3VP3 A;  5FEF A;  3UB7 A;  2QKP A;  5F5Y A;  1F98 A;  1TDL A;  3G30 A;  4KQR A;  3K3D A;  3S1Y A;  1MY8 A;  3GDI A;  2J9O A;  3T4O A;  1JWP A;  2WKQ A;  4NKP A;  4X68 A;  4PM7 A;  1XPB A;  2XR0 A;  4ARZ B;  1K4E A;  1ACF A;  3CUE A;  5U47 A;  5DTT A;  1LT0 A;  4ZRR A;  3P7N A;  1CI9 A;  3ISG A;  2B18 A;  3H7W A;  3WWX A;  4ZJ3 A;  2Z6C A;  5GL9 A;  3HBR A;  3RTY A;  4IVI A;  1WYB A;  3IF5 A;  1PI5 A;  1YLZ A;  3A0S A;  1OTA A;  4DE3 A;  4EQ1 A;  4S2P A;  3WS2 A;  4E3I A;  3SS3 A;  3KO6 A;  1PRQ A;  4Q0J A;  4R70 A;  3UPO A;  3GRJ A;  3OLO A;  5TBM A;  4DDS A;  2BG1 A;  2JHE A;  4BLM A;  3PR6 A;  4DN0 A;  1S1Z A;  2PU2 A;  4S2J A;  3W4O A;  4OOL A;  4WZ5 C;  2FH5 A;  4P0M A;  3OPH A;  2IA2 A;  1ALQ A;  1SCW A;  2VA0 A;  3IWQ A;  4OP8 A;  4GLQ A;  2JKT I;  1DRM A;  3EEH A;  1YT4 A;  1CEG A;  5HD3 A;  4B93 A;  3EEA A;  4K0X A;  3JYI A;  2VGL M;  1TS0 A;  2XSS A;  3MFD A;  1YLJ A;  2ZM8 A;  2K7S A;  5FSR A;  5L10 A;  1XA7 A;  5DF8 A;  5L8M A;  1H5X A;  1SDN A;  2VGK A;  4IUK A;  3IX3 A;  1KVM A;  4NK3 A;  5A90 A;  2O9C A;  4Y3I A;  3VOY A;  4X25 A;  4GOG A;  1LSX A;  4X1L A;  1XXM A;  5EFW A;  3H7W B;  2ZQA A;  3E2K A;  5KSH A;  1OTE A;  1L0E A;  5FAT A;  2ZMA A;  3R7W A;  4Y2F A;  1YLY A;  4KUK A;  4Y13 A;  1KE4 A;  3E4Q A;  3ZDJ A;  2P9V A;  2GNX A;  1JNU A;  4Y5F A;  4G3K A;  5IS1 A;  4NXE A;  2IWC A;  4JXW A;  3IXB A;  5HW3 A;  1IYQ A;  5CXW A;  2J80 A;  2PD8 A;  4ZBE A;  2VV7 A;  2ZQ8 A;  1YM1 A;  1ODV A;  4GJ4 A;  3FKW A;  5TBM B;  4M3K A;  2EFU A;  5HL6 A;  3QP6 A;  2H0T A;  3A3D A;  1FSY A;  3O5Y A;  1OTI A;  1PW8 A;  3E2L A;  1W63 M;  5A91 A;  2HF6 A;  4MDZ A;  2VEA A;  1EW0 A;  4QPR A;  4PHT A;  2V2F F;  2D01 A;  1KVL A;  3GR2 A;  5FL3 A;  3IH8 A;  5J7E A;  2VGL S;  3OBF A;  4RYE A;  1AWI A;  2VLG A;  4E3J A;  2G7U A;  2PAV P;  1S4S A;  2ZLY A;  4RVA A;  3AGE A;  4KZB A;  4N1X A;  4IBR A;  5IHV A;  4K91 A;  2L0W A;  3FPW A;  3MXS A;  2PR6 A;  3HJI A;  4EBP A;  3NOU C;  4DRT A;  3P01 A;  4Z1W A;  4HOI A;  5TFQ A;  4E6X A;  3PBS A;  3R7W B;  3V3S A;  3PAG A;  4D60 A;  3ZQ5 A;  4UHU A;  2P9V B;  1BLS A;  4E3M A;  2E8I A;  4B4Z A;  3OC2 A;  3BYD A;  1JWZ A;  5EOE A;  3H82 A;  3T4L A;  4R1G A;  4S2M A;  1FSW A;  3CWF A;  3HUN A;  5G18 A;  3NC8 A;  2QWS A;  3K2N A;  4HBT A;  2ZQD A;  4P6B A;  1T18 A;  3CG5 A;  3UB6 A;  3CMZ A;  1WYC A;  1YSQ A;  3DW0 A;  1JTD A;  1VB6 A;  3BFE A;  3M2J A;  1DP9 A;  3MSH A;  3AGD A;  1ZG4 A;  1YLP A;  2W3E A;  2R9W A;  1KGF A;  1JTG A;  3NBL A;  2WKP A;  3IF6 C;  3A0R A;  2E8J A;  3GSG A;  2OOL A;  3HCY A;  3LIF A;  4FD8 A;  3T50 A;  4CLC D;  4UA9 A;  1RP5 A;  4OPQ A;  5HSQ A;  2PU4 A;  1SKF A;  5EM1 A;  1TVF A;  1W7F A;  3UO9 A;  1KGE A;  4OPZ A;  5J4E A;  5HAR A;  3QP4 A;  1BYW A;  5EVE A;  2PYR A;  3T1Q B;  4UEY A;  1XFQ A;  3V3R A;  3HUM A;  2WKR A;  3G2Y A;  4EER A;  3E98 A;  4ZJ1 A;  3FYZ A;  2EWV A;  4JXS A;  3MXR A;  1W79 A;  4JXV A;  1MWS A;  3C7U A;  3N6I A;  5F82 A;  3OPL A;  4LRZ E;  1MC0 A;  3S7Q A;  4GCZ A;  2V1Z A;  3UPN A;  3NCK A;  4KG6 A;  3RH8 B;  3H82 B;  1W5D A;  2EFX A;  4KZA A;  3G32 A;  1ONG A;  1CJF A;  1AXB A;  4EBN A;  2WGV A;  2HP6 A;  4QY5 A;  2HP5 A;  1NZO A;  1STZ A;  1RCJ A;  3B3X A;  4OKP A;  4O01 A;  2X02 A;  2QPN A;  5M19 A;  4MNR A;  3F1O A;  4L0L A;  1PWG A;  1ZKJ A;  3ZNY A;  1LI9 A;  3IS2 A;  4JKT A;  4I3I A;  2FZ0 A;  3LYX A;  3JVV A;  4PMA A;  1SZV A;  5HWV A;  1K0K A;  4YOF A;  4JGQ A;  4X69 A;  4WYY A;  2DRW A;  4HY8 A;  5DVA A;  1IYS A;  1K38 A;  3GMW A;  5EPH A;  3RJU A;  5AVF A;  3KSI A;  3HLF A;  1XJ6 A;  5AQ9 A;  3NEC A;  2KLI A;  3CLO A;  4EXO A;  2BLS A;  2HJ9 C;  1L3L A;  2KOI A;  3IX8 A;  3ZG7 B;  3CPT A;  2QHK A;  4CLC A;  1LL8 A;  3BFC A;  1DY6 A;  1KE3 A;  1FCO A;  1E3U D;  3VOL A;  3NIA A;  3MR0 A;  1BLC A;  3VP0 A;  1FQG A;  3UDI A;  2V0U A;  3E0Y A;  5I5L A;  1SHV A;  1U60 A;  3S4X A;  1VEU A;  4GNU A;  5GLC A;  3C4O A;  3M2K A;  1FOF A;  2ZC5 B;  4Y0T A;  3U2A A;  4EU0 A;  3PHY A;  5E2H A;  3HLB A;  4BBT A;  1NLY A;  4BD0 A;  1ES3 A;  3LO7 A;  1BZA A;  1OME A;  3C8C A;  5DTK A;  4R4S A;  5CED A;  4ETZ A;  4U3T A;  2XH9 A;  3F1O B;  2R9X A;  3ZCZ A;  5DKL A;  3GTC A;  3IS2 B;  3MS6 A;  2W3D A;  4EET B;  2Y91 A;  4X56 A;  4L9G A;  3S22 A;  5TJJ A;  2HDQ A;  4AFI A;  3IBR A;  3G35 A; 
#chains in the Genus database with same CATH homology
 1FCN A;  3VSK A;  1VQQ A;  3IQA A;  2ZD8 A;  3GV9 A;  3GRJ A;  2J9P A;  4DDS A;  3UPO A;  3IWI A;  2BG1 A;  2EX9 A;  2HDR A;  5E2F A;  2XD1 A;  4BLM A;  1JVJ A;  3SH9 A;  5KSC A;  2PU2 A;  2WKI A;  4GZB A;  4S2J A;  3WS1 A;  5L2F A;  3W4O A;  4OOL A;  4UA7 A;  2XLN A;  1BLH A;  2J8Y A;  4NET A;  3BRM A;  4WZ5 C;  4P0M A;  3MZD A;  3OPH A;  4KZ3 A;  4E6W A;  1K4F A;  1GA9 A;  3IXH A;  5BOH A;  1ALQ A;  1ESI A;  3UE0 A;  1SCW A;  3NI9 A;  4S2I A;  5JYP A;  2Z2L B;  2WAD A;  3IWQ A;  4OP8 A;  3PBR A;  2OV5 A;  2XFT A;  2Y2N A;  5FAQ A;  4BQM A;  1PWC A;  2J7V A;  3WRZ A;  3O87 A;  1L2S A;  1IYO A;  1YT4 A;  1ES4 A;  4ZDX A;  1CEG A;  3IF6 A;  3IHA A;  4YFM A;  4X6T A;  1KDS A;  1WE4 A;  1LL5 A;  2IWB A;  5EE8 A;  2WYX A;  3V5M A;  1K55 A;  4K0X A;  3JYI A;  4P85 A;  3MBZ A;  1PZO A;  3MFD A;  5EVI D;  1L0D A;  5JYO A;  1W8Y A;  3PAE A;  1YLJ A;  2HDU A;  1FR1 A;  2ZM8 A;  5FSR A;  3TOI A;  1E3U A;  1XA7 A;  4U0T A;  5DF8 A;  3UDF A;  3W4Q A;  4DE0 A;  1H5X A;  1SDN A;  2VGK A;  5AQA A;  5CTM A;  3M6H A;  2EXB A;  4N1H A;  1KVM A;  4NK3 A;  5E43 A;  5FAO A;  4E3O A;  5A90 A;  3N4I A;  5EOO A;  1BUL A;  5D3O A;  3VOZ A;  3VOY A;  1XX2 A;  4EV4 A;  2DNS A;  4MEZ A;  4GOG A;  3EQV A;  1XXM A;  2A49 A;  2HDS A;  2JE5 A;  5CHJ A;  2ZQA A;  5GHZ A;  3ZG5 A;  4JXG A;  4QB8 A;  1K56 D;  5HFO A;  3E2K A;  3SS5 A;  5KSH A;  5A93 A;  1L0E A;  1XGI A;  2HP9 A;  4QD4 A;  4PM6 A;  2ZMA A;  5FAT A;  4WMC A;  2A3U A;  4ZTK A;  5FQQ A;  3BFD A;  1YLY A;  3AGF A;  1KE4 A;  4S2K A;  3LCE A;  3ZDJ A;  2P9V A;  3VFH A;  4OQ0 A;  2UWX A;  2X71 A;  4D2O A;  2H10 A;  1KE0 A;  4N9K A;  3O88 A;  2IWC A;  4JXW A;  5CTN A;  3IXB A;  5HW3 A;  1IYQ A;  4RA7 A;  4WM9 A;  2Y2O A;  3Q7Z A;  5CXW A;  3OZH A;  5FQM A;  4ZBE A;  2ZQ8 A;  1YM1 A;  3PTE A;  3WRT A;  3FKW A;  2ZQ9 A;  4M3K A;  1C3B A;  2G2W A;  5GLD A;  4Y0O A;  4MLL A;  2XK1 A;  5KMW A;  2EFU A;  4GD8 A;  1ERM A;  3Q07 A;  4LV1 A;  3UE1 A;  4KQO A;  2H0T A;  3A3D A;  4BD1 A;  1FSY A;  4LV0 A;  4N92 A;  3PBT A;  4S2N C;  1PW8 A;  4KG2 A;  4DF6 A;  4OOY A;  4OQH A;  3E2L A;  3A3J A;  2Y2Q A;  1K54 A;  4C3Q A;  3PBO A;  4Y7P A;  3IH9 A;  4H8R A;  1RGZ A;  4R3J A;  4XUX A;  4QHC A;  3FWL A;  1BTL A;  3LY4 A;  4OPY A;  5A91 A;  1CI8 A;  1I2S A;  3VFF A;  4OON A;  4Q8I A;  1LHY A;  2ZC6 B;  3IF6 B;  4HES A;  2V2F F;  4KZ8 A;  1K6R A;  1KDW A;  1L0F A;  4KEN B;  5HX9 A;  4OH0 A;  1KVL A;  3GR2 A;  5DF7 A;  2ZC4 B;  3V39 A;  3IH8 A;  3UY6 A;  3IXD A;  3BFF A;  3ITB A;  1G68 A;  4JLF A;  4DXB A;  1XKZ A;  3ZGA B;  2Q9N A;  4RYE A;  4GD6 A;  4QJG A;  1LL9 A;  2C5W B;  3DTM A;  4E3J A;  3UE3 A;  1K57 A;  2ZLY A;  4RVA A;  3AGE A;  4KZB A;  4N1X A;  4IBR A;  5IHV A;  4K91 A;  4FH2 A;  3ZHH A;  5HAQ A;  3MXS A;  5FDH A;  1TEM A;  5EVI A;  4CPK A;  4X55 A;  4EWF A;  3BLM A;  1PI4 A;  5EVL A;  1DJA A;  4HBU A;  2Y4A A;  4IVK A;  4DRT A;  4LV3 A;  4EBP A;  3CZD A;  5GLB A;  1LLB A;  1G6A A;  4KZ7 A;  3V50 A;  3ZFZ A;  1IEM A;  4DKI A;  5TFQ A;  2ZC7 A;  3HLC A;  3HRE A;  4WBG A;  5CEC A;  4E6X A;  1S6R A;  3PBS A;  5KZH A;  3V3S A;  1NJ4 A;  3C4P A;  3HLG A;  3ITA A;  3PAG A;  4OLD A;  3GQZ A;  3NDE A;  2Y59 A;  2OSU A;  1MWT A;  4UHU A;  2P9V B;  1MKI A;  1BLS A;  1BLP A;  4EQI A;  1QMF A;  1XP4 A;  4LEN A;  3CJM A;  3OCN A;  4E3M A;  2E8I A;  3SS4 A;  1NXY A;  3OC2 A;  3BYD A;  4B4Z A;  4MBK A;  1K56 A;  1JWZ A;  4R4R A;  5EOE A;  4JF4 A;  3RXW A;  5CHU A;  1NRF A;  2OLV A;  1FSW A;  2Z2M B;  4R1G A;  4S2M A;  3ZNT A;  3VSL A;  3HUN A;  5G18 A;  3NC8 A;  4HEF A;  1ES5 A;  3G4P A;  4HBT A;  2ZQD A;  2P74 A;  2XDM A;  1NYM A;  4P6B A;  4RX2 A;  4FH4 A;  3CG5 A;  5TR7 A;  3CMZ A;  3GVB A;  4PM9 A;  1WYC A;  3VP4 A;  3DW0 A;  4OOM A;  2CC1 A;  1ZC2 A;  2Y2G A;  1JTD A;  1HVB A;  4X68 A;  5FAP A;  4WEL A;  4ZJ2 A;  2Y2M A;  4DXC A;  3BFE A;  5HL1 A;  1CK3 A;  3M2J A;  2XF3 A;  3VP2 A;  4A5R A;  5F1F A;  3G2Z A;  3MKF A;  1GCE A;  3C5A A;  3LY3 A;  1PZP A;  5FI7 A;  2Y2L A;  3AGD A;  2XFS A;  3M6B A;  1ZG4 A;  1YLP A;  3IHB A;  3WS4 A;  2C6W B;  2G2U A;  3Q81 A;  3BM6 A;  3MZF A;  4B4X A;  2R9W A;  1LI0 A;  3EQU A;  1KGF A;  1JTG A;  3NBL A;  4Z9Q A;  1DJC A;  5FQK A;  3IF6 C;  1IYP A;  2I72 A;  2WUQ A;  3G34 A;  3UN7 A;  3DWZ A;  4PPR A;  5EUA A;  3GSG A;  4BL2 A;  1FR6 A;  1K55 C;  1ERO A;  4BJP A;  1CEF A;  1O7E A;  1L0G A;  4B88 A;  4S2O A;  4FD8 A;  1Y54 A;  2WGW A;  3O3V A;  3ZVW A;  4EUZ A;  1YMX A;  2WK0 A;  3UNW A;  4GKU A;  4OP5 A;  3W8K A;  3IT9 A;  5DTS A;  2Q9M A;  4WEJ A;  3SH8 A;  4UA9 A;  2RL3 A;  1RP5 A;  1MBL A;  4OPQ A;  5CGW A;  5TGF A;  2PU4 A;  4U0X A;  1SKF A;  1TVF A;  3UPP A;  2X01 A;  2JBF A;  4E3N A;  3FV7 A;  1W7F A;  5FI2 A;  1ES2 A;  3G31 A;  1BT5 A;  4QU3 A;  3UDX A;  3NDG A;  1KGE A;  4OPZ A;  3UO9 A;  2IWD A;  5GHY A;  5HAR A;  1ONH A;  2ZJ9 A;  1GA0 A;  2OLU A;  3Q1F A;  4MBH A;  5FI6 A;  4WZ5 A;  1HD8 A;  2GDN A;  2DCF A;  4UAA A;  3QNC A;  5F1G A;  5EVI B;  1PIO A;  2VGJ A;  1ERQ A;  2WZX A;  1ZG6 A;  3TG9 A;  3HLW A;  3ZG0 A;  5M18 A;  2WAF A;  3V3R A;  3QHY A;  1YQS A;  3HUM A;  3HLD A;  2XEP A;  3Q7V A;  3G2Y A;  4F94 A;  1S0W A;  4ZJ1 A;  3FYZ A;  3OPR A;  5CGS A;  4JF5 A;  4FCF A;  4KZ5 A;  4JXS A;  1IKG A;  3MXR A;  2B5R A;  1YLT A;  5A92 A;  2H0Y A;  1GHM A;  1W79 A;  4GN2 A;  5EEC A;  4JXV A;  5FQ9 A;  3IXG A;  4YIN A;  1MWS A;  3C7U A;  2FFF B;  3MZE A;  3N6I A;  3OPL A;  4IED A;  5F82 A;  5AQB A;  1MWU A;  2QZ6 A;  4C6Y A;  2V1Z A;  3UPN A;  3NCK A;  1YLW A;  5CER A;  4KG6 A;  5F83 A;  2PBY A;  3BEC A;  3HUO A;  1HZO A;  3N8S A;  2QMI A;  4BL3 A;  4DE1 A;  2ZQC A;  1W5D A;  4WZ4 A;  2EFX A;  4KZA A;  3G32 A;  3VP1 A;  1ONG A;  2ZQ7 A;  5CEB A;  1NYY A;  4FSF A;  1SDE A;  5FQI A;  4EBL A;  5AQ7 A;  1AXB A;  2XGN A;  4EBN A;  1EWZ A;  2WGV A;  3HL9 A;  1Q2P A;  2EX6 A;  2HP6 A;  3OCL A;  4K0W A;  4QY5 A;  1J9M A;  2HP5 A;  1NZO A;  4S2L A;  4BEN A;  4MBF A;  1RCJ A;  3B3X A;  4OKP A;  1N9B A;  4P87 A;  5CHM A;  3A3E A;  2X02 A;  2H5S A;  2QPN A;  1K54 C;  5M19 A;  4MNR A;  4JBF A;  4L0L A;  3PBN A;  1PWG A;  2WGI A;  1XGJ A;  1ZKJ A;  4OVD A;  3ZNY A;  1LI9 A;  1N4O A;  4JKT A;  3P98 A;  1PWD A;  1ESU A;  2WZZ A;  5GHX A;  1GHP A;  1NZU A;  4PMA A;  3N7W A;  4X69 A;  3BFG A;  4UA6 A;  4WYY A;  5J8X A;  2DRW A;  4C75 A;  2Y55 A;  5E2G A;  1FCM A;  1JWV A;  2FFY A;  1I2W A;  3O86 A;  1MXO A;  1NY0 A;  3HVF A;  4RX3 A;  5DF9 A;  5FA7 A;  4OLG A;  4PM5 A;  5CRF A;  3ZG8 B;  2WGW B;  4KZ9 A;  2Y2J A;  1M6K A;  1QME A;  1KGG A;  3QNB A;  1IYS A;  4XUZ A;  5DVA A;  3ZG9 B;  1K38 A;  1VM1 A;  3BLS A;  5FAS A;  3GMW A;  4KZ6 A;  2ZC3 B;  5EPH A;  3RJU A;  3DWK A;  4GDB A;  1H8Y A;  1IEL A;  3N8L A;  1HTZ A;  2HPB A;  1K57 C;  3HLF A;  4WEK A;  5AQ9 A;  3WS0 A;  2ZM0 A;  2BLS A;  2Y2P A;  3Q82 A;  5FQJ A;  4N9L A;  4GDN A;  2ZM2 A;  4X53 A;  5GLA A;  1BUE A;  1PYY A;  2V20 A;  4S2N A;  5EVI C;  3D4F A;  3ZG7 B;  3C7V A;  4Y0U A;  1E4D A;  4OQG A;  2JC7 A;  2EX2 A;  3FKV A;  3BFC A;  4ID4 A;  4KZ4 A;  4LCL A;  3SOI A;  1DY6 A;  3W4P A;  1KE3 A;  1FCO A;  1O07 A;  1E3U D;  1GHI A;  1Q2Q A;  2EX8 A;  1K25 A;  3LEZ A;  3TSG A;  4E3L A;  4KQQ A;  4QY6 A;  1PW1 A;  3ZVT A;  1MWR A;  3NIA A;  2XD5 A;  3FZC A;  3Q7V B;  1H8Z A;  1TDG A;  3A3I A;  3PBQ A;  3A3F A;  3SH7 A;  3VP3 A;  4O7D A;  4LV2 A;  5HAP A;  1BLC A;  3VP0 A;  1FQG A;  1TDL A;  3G30 A;  4KQR A;  3RXX A;  3UDI A;  4E3K A;  3S1Y A;  1MY8 A;  2RCX A;  4CJN A;  4R3B A;  1SHV A;  3WS5 A;  2J9O A;  3OPP A;  4DE2 A;  4KG5 A;  1IKI A;  1U60 A;  4PM8 A;  3S4X A;  2XQZ A;  4GNU A;  1BSG A;  5GLC A;  3C4O A;  1JWP A;  4PM7 A;  1XPB A;  2XR0 A;  1FOF A;  3M2K A;  2JCH A;  1EI5 A;  3BEB A;  2ZC5 B;  3HLE A;  4WMC D;  1K4E A;  4XXR A;  4Y0T A;  5U47 A;  5E2H A;  3HLB A;  5DTT A;  4JPM A;  3P09 A;  2WKE A;  4BD0 A;  1ES3 A;  3IWO A;  3LO7 A;  1CI9 A;  1RGY A;  2EXA A;  1MPL A;  3ISG A;  4IBX A;  1BZA A;  3WWX A;  1Z6F A;  1I5Q A;  1OME A;  5DTK A;  1E25 A;  4ZJ3 A;  3VMA A;  2WKH A;  2Y2K A;  4R4S A;  5CED A;  4JF6 A;  5GL9 A;  3NY4 A;  4U3T A;  1K6S A;  2Y2I A;  2XH9 A;  1DJB A;  5E2E A;  3I7J A;  1YMS A;  3HBR A;  4IVI A;  1WYB A;  5CGX A;  2R9X A;  5I94 A;  4R0Q A;  3ZCZ A;  3IF5 A;  4LCM A;  3GTC A;  4OQI A;  1PI5 A;  1YLZ A;  4OPR A;  2Y91 A;  4R23 A;  4DE3 A;  4X56 A;  4ZAM A;  1M40 A;  4S2P A;  3S22 A;  3WS2 A;  4DDY A;  3N8R A;  4E3I A;  2WAE A;  2HDQ A;  3SS3 A;  1XA1 A;  4GB7 A;  3MKE A;  1W8Q A;  3G35 A;  2Y2H A;  5M1A A;  5HAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...