3WS5A

N288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (condition-2b)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
357
structure length
357
Chain Sequence
QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGQGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTQGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 118
structure length 357
sequence length 357
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ws5A00
2DRWA 1FCNA 4OPYA 3VP2A 3MZEA 4WYYA 5CGXA 1FR1A 2PU2A 1H8ZA 1PWCA 1L0GA 5FQJA 1LHYA 3Q81A 1MKIA 2ZQAA 3QHYA 4GZBA 1BLCA 4BQMA 2BG1A 1ERMA 2Q9MA 4LCMA 4Y0OA 4DE1A 1IYOA 5JYOA 2ZC6B 3IQAA 5FQMA 1E3UD 2OLUA 2EFXA 3MKEA 4FD8A 4LV3A 3SH8A 1ESUA 3NCKA 1SKFA 2J9PA 3OPRA 2J8YA 5GLAA 4PMAA 1LI0A 4CJNA 3G34A 1CK3A 3O3VA 5F83A 4JF4A 2XLNA 2ZQ7A 2WAEA 4GKUA 4HEFA 5FI7A 1WE4A 3BFDA 5FQKA 4EBLA 3IXGA 4PM7A 4ZBEA 4IVKA 1XGJA 3IF5A 3LY4A 3G32A 4FH2A 4S2NC 4DE0A 4WMCD 4YINA 5DTTA 2P74A 4B88A 3SS4A 3I7JA 3HUOA 5FI6A 4OP8A 2P9VA 1Z6FA 4IBXA 3SS5A 2ZC5B 3TOIA 2G2UA 2C5WB 1BLSA 2Y91A 1LL9A 1L0EA 3WS1A 3A3IA 4C3QA 4Y0TA 3PBRA 1IYSA 5EVIC 1XA1A 3UE3A 4XXRA 2IWDA 2XDMA 5JYPA 4NK3A 4JXSA 3LCEA 4ZAMA 1VM1A 2EFUA 3S22A 3ZVTA 5HW3A 5EPHA 2XQZA 1Q2QA 2EXAA 2EX9A 1K55C 2HDQA 1NYYA 4BL2A 5CTNA 3MZDA 2Y2IA 1KGFA 4E6WA 4FSFA 4OH0A 5EOEA 5DF7A 3V3SA 1XA7A 1BLPA 2PBYA 3O86A 1QMEA 4S2LA 5CEDA 3LY3A 3N7WA 4MBHA 3FKVA 3BEBA 3WRTA 5CHJA 1EWZA 3DWKA 1KVMA 2ZC4B 3G35A 4MNRA 1YMXA 2ZD8A 3O87A 5HX9A 4GOGA 3GRJA 3FWLA 1LLBA 5HAPA 3HREA 4HESA 2WGIA 3IHBA 4KZBA 1TEMA 3VOYA 1JWPA 3IXDA 1K4FA 3LO7A 4KZ9A 4QY6A 3E2KA 2Z2MB 4JKTA 4N92A 3OCNA 3HL9A 2Z2LB 2P9VB 1ONGA 2FFFB 1PWDA 3CG5A 1DJBA 1TDLA 4IEDA 3A3EA 2WGWB 3IF6C 3O88A 2Y2QA 3PBOA 4PPRA 4H8RA 3GMWA 3G2YA 3ZG0A 1MWRA 3G2ZA 3WWXA 4KZ7A 1IKIA 1K6SA 2QPNA 5FDHA 3HLGA 2VGKA 1JWVA 1BT5A 3PTEA 1EROA 2CC1A 5TR7A 5HARA 2A49A 4OQIA 3IWIA 4GD6A 1BZAA 4B4XA 3MKFA 1FSYA 1KVLA 4E3MA 3WS4A 3IH8A 3ZGAB 2HPBA 1IELA 3WS0A 4N9LA 3C5AA 3CZDA 4X55A 4R1GA 4EUZA 5KMWA 3MZFA 1ERQA 1TVFA 3GV9A 4OOMA 3Q1FA 1LL5A 2WAFA 4UA9A 4WEJA 5AQ7A 4KQQA 3VSLA 1O7EA 3TSGA 3V5MA 2JCHA 4BD0A 4K0XA 5DTSA 3VP0A 1FCMA 1L2SA 1ALQA 4R0QA 4E3IA 2WGWA 4RX2A 1CEFA 3GQZA 1N9BA 4JLFA 2Y2MA 4E3NA 1W7FA 2EX6A 2ZC3B 3PBSA 3HLWA 3TG9A 4IBRA 4KZ6A 3BM6A 3UPOA 2Y2JA 5CRFA 1MPLA 2ZM0A 4LENA 5EECA 5FI2A 1IYQA 4HBTA 2A3UA 4E3JA 4N9KA 5E43A 4P87A 5CGSA 2ZQ9A 4JPMA 2ZM2A 1N4OA 3BLMA 2ZM8A 1L0FA 2XR0A 3RXXA 5TGFA 4Q8IA 3HVFA 4KQRA 4PM5A 2H5SA 5I94A 5AQAA 2X01A 2QZ6A 1HVBA 2WZXA 3SS3A 5U47A 4FH4A 5FQQA 3UE1A 4DF6A 3PAGA 3C4PA 1YLZA 2XGNA 3QNCA 4S2OA 3IF6A 4EV4A 2UWXA 4CPKA 4ID4A 3VFFA 3ISGA 3SH7A 1KGEA 3D4FA 4WBGA 1G68A 3A3JA 3EQUA 4Y0UA 4DXCA 4DE3A 3UPPA 1PZOA 1BULA 1M40A 2RCXA 4OLDA 5FA7A 3S4XA 4WZ5C 2Y2HA 2EX8A 3OZHA 4S2KA 2DNSA 2OV5A 3UE0A 1RGYA 2H0TA 5GLBA 4OVDA 1GA9A 4KG6A 4R3BA 1J9MA 1MY8A 4KZ5A 3OPHA 1JVJA 2V20A 3C7VA 5GLCA 3CJMA 4XUXA 5GHYA 1ES2A 4U3TA 4WZ5A 4S2PA 4S2JA 2XF3A 1BUEA 2JC7A 2WGVA 3ZG7B 3N4IA 5HAIA 1KE4A 1PYYA 4OLGA 1KDWA 3ZG9B 4EBNA 1ZG6A 1I2WA 1CI9A 3FYZA 1M6KA 1ES3A 1GHPA 3VMAA 2HP9A 5EOOA 4OQHA 5EVLA 1JWZA 3AGEA 4WMCA 1PZPA 1XX2A 1YMSA 3C7UA 3EQVA 3ITAA 4DDSA 3Q7ZA 4DXBA 5CTMA 5GHXA 1MXOA 1IYPA 1YLTA 3G30A 4JBFA 3P09A 3IF6B 4RX3A 4U0XA 5AQBA 1FCOA 1MWTA 3VP3A 1HD8A 4WEKA 1PW8A 1ONHA 4LV2A 4K0WA 5DVAA 2J9OA 2GDNA 4X6TA 4YFMA 1U60A 5HAQA 3Q7VB 4EWFA 4X53A 3G31A 2BLSA 3ITBA 3SH9A 3V39A 2RL3A 3MFDA 3PBNA 1BSGA 1FR6A 1I2SA 3Q07A 1TDGA 1YM1A 5DF9A 1AXBA 4E3OA 3NDEA 2V1ZA 4GD8A 2R9WA 1GCEA 1C3BA 3DW0A 3CMZA 1Q2PA 3HBRA 3VOZA 1FOFA 1H5XA 4ZTKA 1LI9A 1XXMA 3M2JA 3HLCA 4UA7A 2EX2A 1JTDA 2ZQDA 1ZC2A 2EXBA 5CXWA 2ZMAA 3M6BA 3ZVWA 1W8QA 4DKIA 5E2HA 4E3KA 5E2GA 1W79A 2XD1A 3BFCA 1K38A 2Y2KA 2HDSA 3HLBA 3IXBA 1BTLA 2PU4A 3NY4A 3BYDA 4QB8A 3ZNTA 2Y2GA 1XPBA 1W8YA 4BD1A 3N6IA 2ZLYA 5IHVA 3N8LA 1IKGA 4LCLA 4LV1A 3HLFA 1ES5A 4OPQA 1SCWA 1RCJA 4WELA 1KE3A 4OP5A 5L2FA 4PM6A 2WUQA 1CI8A 3OC2A 3UNWA 5DTKA 4OOYA 3AGDA 4KENB 3BFFA 1HTZA 4GN2A 4NETA 4EQIA 3IWQA 5FQIA 2Y2PA 1KE0A 1O07A 3PAEA 1K56D 1YQSA 1YLYA 5CHUA 4MBFA 1E3UA 2XD5A 3M2KA 5G18A 5CECA 4F94A 5HFOA 4S2MA 3UPNA 2Q9NA 4GB7A 2Y59A 4LV0A 4GDNA 4JF6A 4GDBA 4UAAA 2WZZA 4C75A 5FASA 4S2IA 1K25A 5CERA 3GR2A 4ZJ2A 1I5QA 3HUNA 2JE5A 3WS5A 4X56A 4PM8A 1K57C 3MBZA 4A5RA 4B4ZA 4EBPA 5FAPA 1OMEA 5GLDA 3W4QA 1XP4A 3IWOA 2XH9A 4JXVA 5FAQA 4N1XA 3FZCA 2R9XA 5A91A 3BFGA 2ZJ9A 1ESIA 1K57A 5A90A 3GSGA 4KZ4A 3RXWA 4D2OA 4R23A 2DCFA 4OPRA 1DJAA 1EI5A 4E6XA 3W4OA 3GTCA 1RGZA 3VP1A 3BLSA 2Y55A 2OLVA 3MXRA 4WM9A 4GNUA 4WZ4A 5FATA 2QMIA 4N1HA 3W4PA 1RP5A 2E8IA 5M19A 3IT9A 2ZQCA 3WRZA 4BL3A 1QMFA 1MBLA 2Y2OA 3HLDA 2ZC7A 2VGJA 3VP4A 3ZDJA 5CHMA 2X71A 5KSCA 1FSWA 5DF8A 4U0TA 1GA0A 1FQGA 3W8KA 1BLHA 5AQ9A 3A3FA 4JXWA 3ZFZA 4JF5A 2XFSA 5FAOA 4ZDXA 5KZHA 2V2FF 2Y2LA 3E2LA 5F1FA 2FFYA 1CEGA 3GVBA 4MBKA 1K6RA 3DWZA 3M6HA 4OQGA 4ZJ1A 1XGIA 3IHAA 3JYIA 2H0YA 4OONA 4OPZA 4P0MA 5EVID 2WKHA 5E2FA 4BLMA 4QU3A 1MWSA 1IEMA 4RVAA 4C6YA 1E25A 3UDXA 4KZ8A 1KGGA 4MEZA 3NBLA 1G6AA 3AGFA 4KG2A 3MXSA 1WYBA 4OQ0A 4QHCA 2HP5A 2G2WA 5D3OA 1NYMA 1PIOA 4R4RA 1S6RA 3IXHA 4Z9QA 4RYEA 3SOIA 5FSRA 1K4EA 1K54C 5GHZA 2HP6A 1H8YA 1K56A 1YLJA 4S2NA 4QY5A 5E2EA 2Y4AA 4R3JA 5EUAA 2OSUA 3ZG8B 5M18A 1DY6A 1MWUA 4L0LA 5F1GA 2WYXA 4Y7PA 4E3LA 3G4PA 4IVIA 3DTMA 3VSKA 5TFQA 1NJ4A 2WKEA 3Q82A 4DE2A 3NI9A 3UDIA 5J8XA 4RA7A 1NXYA 2XK1A 4KQOA 5EVIB 3RJUA 4P85A 2X02A 3V50A 1PI5A 3PBQA 1DJCA 2XFTA 3B3XA 5EE8A 1W5DA 1S0WA 1ZKJA 3A3DA 3QNBA 1E4DA 2ZQ8A 1XKZA 4O7DA 3BRMA 2WADA 5M1AA 1PWGA 3Q7VA 3ZNYA 1SDNA 5HL1A 1GHIA 1K54A 1YLWA 4ZJ3A 3WS2A 2WKIA 5FQ9A 3UN7A 1HZOA 1YT4A 4JXGA 3UO9A 5A92A 3P98A 4QJGA 2J7VA 5KSHA 3C4OA 4X68A 3LEZA 3NDGA 4DRTA 4OOLA 3OPPA 4FCFA 3BFEA 3N8RA 3NIAA 2H10A 1ZG4A 4KG5A 1SDEA 2B5RA 3OCLA 2I72A 5BOHA 1GHMA 3S1YA 1WYCA 4QD4A 3ZCZA 2HDUA 4BJPA 4HBUA 3N8SA 1L0DA 4MLLA 4X69A 5EVIA 1NZUA 1NY0A 3FKWA 3HLEA 2Y2NA 2JBFA 3ZHHA 3V3RA 3HUMA 3ZG5A 4OKPA 3NC8A 4KZAA 4DDYA 1K55A 1SHVA 1YLPA 5GL9A 1PW1A 4K91A 4UA6A 2IWCA 4R4SA 3IH9A 1NZOA 2XEPA 5A93A 4P6BA 5CEBA 3FV7A 3BECA 4XUZA 1JTGA 4M3KA 3VFHA 1ES4A 3UY6A 2IWBA 3PBTA 2C6WB 1NRFA 4KZ3A 5CGWA 2HDRA 1Y54A 5F82A 2WK0A 4BENA 1PI4A 1VQQA 3OPLA 3UDFA 4PM9A 1KDSA 4UHUA
chains in the Genus database with same CATH superfamily
4CLCB 3MZEA 4EEUA 1FR1A 2INWA 1PWCA 2PYPA 3Q81A 1BLCA 3FPWA 2BG1A 2Q9MA 5IS1A 3MKEA 2J9PA 5GLAA 4EU0A 1LSXA 2XLNA 2ZQ7A 2WAEA 4PM7A 1VB6A 4S2NC 4Y17A 3T4TA 1MKMA 4YINA 3I7JA 1VETA 5FI6A 4OP8A 2P9VA 1G5UA 1BLSA 4Y0TA 4C3QA 3EWKA 2EFUA 5EPHA 3LR3A 4Y13A 2EXAA 2W3DA 4BL2A 5DKKA 3LI9A 2EWVA 4OH0A 3CPTB 2A2LA 4S2LA 1MC0A 5C5KA 3KO6A 3DWKA 4EEPA 2B95A 2ZD8A 3LUQA 5HX9A 3GRJA 2B18A 1JWPA 3IXDA 3LO7A 4KZ9A 2GNXA 4GCZA 2FFFB 4IEDA 3MS6A 5DKLA 3O88A 2Y2QA 4PPRA 2EWWA 2VV7A 3KYEA 4KZ7A 1IKIA 2QPNA 2JKRM 2VGKA 1BT5A 4KQDA 1TF1A 2GX5A 4E3MA 3WS4A 5KMWA 4Z1WA 3C5AA 3CZDA 4WEJA 4UA9A 3UB8A 2JCHA 4BD0A 2O0YA 2WKQA 3EOIA 3VP0A 1SKOB 4R0QA 4E3IA 1CEFA 4JLFA 3T4QA 3PBSA 4KZ6A 3LR0A 2V8CA 3NOUC 3UPOA 4HBTA 1N9LA 4E3JA 4N9KA 5E43A 4P87A 3O5YA 2LB5A 5EV0A 5HL6A 4BBVA 3TJZC 3BLMA 2XR0A 5AQAA 4H6JB 2PHYA 2X01A 4G3KA 2QZ6A 2WZXA 2W27A 5MC7A 3E4OA 3PAGA 4HH3A 3S7QA 4WUJA 2QKPA 1KGEA 3D4FA 4WBGA 3A3JA 3BQ8A 3DTEA 3EQUA 1BULA 4WZ5C 1NLYA 1RGYA 1XJ3A 4OVDA 2V20A 3C7VA 4KUKA 1TD5A 2A24B 4O01A 3F1OA 4U3TA 2WGVA 3FYZA 1CI9A 3HJIA 5EM0A 5EVLA 3AGEA 1JNUA 2V9AA 4DDSA 1YLTA 3R7WA 1G6OA 4RX3A 1FCOA 1HD8A 5DVAA 5HDSA 2QHKA 3Q7VB 2BLSA 3PBNA 5F69A 3Q07A 1TDGA 3IX8A 2QJ5A 4E3OA 2V1ZA 1S1YA 2R9WA 4GD8A 2KOIA 1N9OA 3H7WB 3UB6A 3CMZA 3VOZA 1FOFA 1H5XA 3NHQA 1G28A 1H3QA 4UA7A 4MMNA 1JTDA 2ZQDA 1ZC2A 2EXBA 5CXWA 4L9GA 5IU1A 1XJ2A 4E3KA 3HLBA 2QWSA 3TE8A 4BD1A 3N6IA 5AVFA 2W1TB 4LV1A 3VE4A 4I5SA 1RCJA 5DJTA 1OT6A 4NETA 4EQIA 3PAEA 4GLQA 1YQSA 3MMHA 4F94A 5HFOA 5L8MA 4LV0A 4JF6A 4GDBA 5FASA 3HUNA 1YPRA 3WS5A 3ZQ5A 4PM8A 1K57C 4A5RA 5GLDA 1ZHHB 5A91A 3MJQA 1XFQA 1F98A 4GS9B 4HH2A 4D2OA 1SZVA 4OPRA 4E6XA 3GTCA 2Y55A 2OLVA 2VGLS 2Q0OA 1SKOA 4N1HA 5IT5A 3WRZA 1QMFA 3VP4A 1WA9A 5CHMA 2M7VA 1FSWA 5FEFA 3E4PA 1ZTUA 5FAOA 4ZDXA 2V2FF 3E2LA 5TJJA 3GVBA 2VGLM 5EFWA 4MBKA 4H6JA 1K6RA 1PRQA 1XGIA 3D72A 3IHAA 2H0YA 2O9AA 4OONA 4G3WA 5EVID 2WKHA 4BLMA 1MWSA 1IEMA 5J3WA 3T4LA 3L9KA 3CUEC 4R6LA 5J4EA 2O99A 5F5YA 3MXSA 2W3GA 4ETZA 1K4EA 2HP6A 1K56A 4Y2FA 2OSUA 5M18A 1MWUA 2WYXA 4WL9A 5FEGA 3PHYA 3QP5A 2GJ3A 1K0KA 3PBQA 5EE8A 3S7PA 1PWGA 4HHDA 5HL1A 1GHIA 1YSQA 5KSHA 4ARZA 4DRTA 2H10A 5HSQA 3S1YA 1WYCA 3F1OB 3ICYA 4QD4A 1TS7A 3N8SA 4X69A 2VV8A 3DTKA 5HWTA 1ODVA 3ZYTA 1OJ5A 2LB9A 3FV7A 1DRMA 1JTGA 1ES4A 2IWBA 3PBTA 1T1CA 2WK0A 2YKHA 1KDSA 1FCNA 3VP2A 2VK3A 1S4RA 1N9NA 4EXOA 1L0GA 5FQJA 1LSWA 2BASA 3QHYA 1MKIA 4BQMA 4E04A 1T18A 4Y0OA 1IYOA 2ZMFA 5JYOA 2ZC6B 1E3UD 2OLUA 4FD8A 1ESUA 1SKFA 3OPRA 1T19A 2J8YA 3G34A 4GKUA 5FI7A 3IXGA 4IVKA 3IF5A 4DE0A 2P74A 3SS4A 3HUOA 2W1RA 2Y91A 3WS1A 5AJGA 1IYSA 1PNEA 1VM1A 5HW3A 2VX8A 2EX9A 1K55C 2HDQA 5AVEA 3MZDA 2V1AA 5EOEA 4KUOA 5DF7A 2QYBA 1BLPA 2PBYA 5CEDA 3LY3A 3T1QB 5CHJA 1EWZA 1VEUB 3G35A 4GHIB 4M4XA 3O87A 3FWLA 2OAP1 4HESA 3CWFA 2WGIA 3LI8A 3E2KA 2IA2A 2Z2MB 4N92A 3HL9A 2Z2LB 1DJBA 4X1MA 1P9RA 3C8CA 3MF0A 3B47A 4HI4A 4PHTA 3TRCA 2VKSA 1K6SA 3PTEA 1EROA 5TR7A 2A49A 4LRXC 4MN5A 2ZMVA 3BJNA 4LGWA 4JGQA 1TVFA 3GV9A 4Q0JA 5HD5A 5AQ7A 3V5MA 3T4SA 5DTSA 1FCMA 1L2SA 4RX2A 1UGUA 3GQZA 2ZC3B 2WKRA 4LENA 5FI2A 1IYQA 5CGSA 4L9EA 2ZQ9A 1N4OA 5TGFA 4Q8IA 3HVFA 5I94A 3CHWP 4D60A 1HVBA 3OOVA 4FH4A 4DF6A 2XGNA 3QNCA 2UWXA 4CPKA 3VFFA 3UPPA 1M40A 3HJKA 3S4XA 2Y2HA 2EX8A 3OZHA 4S2KA 2OV5A 2H0TA 5HDCA 4KG6A 3E0YA 2V0WA 3OPHA 3CJMA 5GHYA 1ES2A 3CITA 4S2JA 1HLUP 3ZG7B 5HAIA 1KE4A 3ZG9B 1ZG6A 4Y3IA 3BWLA 5EOOA 1XX2A 2HV1A 4NKPA 1D1JA 5GHXA 1MXOA 3MR0A 3P09A 4HJ4A 3KSGA 3A0RA 4U0XA 5AQBA 1MWTA 4WEKA 3G6OA 4LV2A 4K0WA 3NOTC 1U60A 5HAQA 2D02A 4EWFA 3G31A 3ITBA 3MFDA 3QP8A 2HF6A 3NDEA 4BMWA 1X0OA 3MXQA 1LSVA 1Q2PA 3F1PB 1XXMA 3M2JA 3HLCA 2EX2A 2VLGA 4PKYA 5E2HA 5EVEA 4DJ2A 5E2GA 2XD1A 2Y2KA 4CLCD 2CMNA 4QB8A 2Y2GA 2ZLYA 4NXBA 5IHVA 1IKGA 4LCLA 1ES5A 3K3CA 4GS9A 5L2FA 2W3FA 2WUQA 4F3LB 4OOYA 3UB9A 4GN2A 5FQIA 4Q0HA 3E98A 1O07A 5DJUA 2KX6A 3M2KA 1V9YA 5G18A 5CECA 3UPNA 5TBMB 2KLIA 4GDNA 1IOUA 1K25A 3GR2A 1I5QA 2M7UA 5K5BA 4EBPA 2JKGA 5FAPA 1XP4A 2W0NA 1MZUA 2L1MA 1ESIA 1K57A 4XT2B 5A90A 1EI5A 2J80A 1RGZA 1LL8A 3BLSA 3L7HA 4WM9A 3MQOA 5M19A 2E8IA 2ZQCA 3DTIA 4BL3A 3A0VA 2YKFA 3HLDA 2VGJA 3U4LP 5L09A 1DP9A 4HY8A 4U0TA 3W8KA 4WF0A 3A3FA 1GSVA 2XFSA 5KZHA 1OTIA 2Y2LA 1P97A 3DWZA 4ZJ1A 4RQ9A 4L9FA 4OPZA 2PAVP 5E2FA 3LIFA 3D3OA 1S67L 4ZRRA 3UDXA 1KGGA 3A0SA 3AGFA 4KG2A 1W63Q 4QHCA 1WYBA 4OQ0A 2HP5A 5DFYA 1W63M 4Z9QA 5FSRA 3KYZA 1K54C 5GHZA 1H8YA 2O9BA 4YOFA 4QY5A 4R3JA 5EUAA 1GSXA 5HD3A 5F1GA 4L0LA 3BY9A 4IVIA 2WKEA 2OOLA 3Q82A 4DE2A 1FILA 2X02A 4Y15A 3QP1A 3SW1A 1PI5A 1S0WA 3QNBA 1E4DA 2R78A 3ULFA 3BRMA 5M1AA 3ZNYA 1YLWA 3NJAA 1OT9A 5FQ9A 3UN7A 3UO9A 3P98A 3C4OA 1V9ZA 4HP4A 3OPPA 2BTFP 1ZG4A 2D01A 3OCLA 1P9WA 1L3LA 3ZCZA 4MLLA 1A0KA 1NY0A 3HLEA 2JBFA 3V3RA 3ZG5A 4OKPA 4DDYA 1K55A 1SHVA 1YLPA 1PW1A 4K91A 1TS8A 4UA6A 2IWCA 2XROA 3IH9A 5A93A 5CEBA 1XFNA 4XUZA 3VFHA 3UY6A 4IUHA 4NXGA 1VQQA 5FDSA 4UHUA 2HZ5A 3LIEA 3GECA 2PU2A 1H8ZA 1H0MA 2ZQAA 4GZBA 3RH8B 1ERMA 2VZWA 4DE1A 5FQMA 3HCYA 4LV3A 2EFXA 3SH8A 3RTYA 1OJGA 4CJNA 1CK3A 3O3VA 5F83A 4JF4A 4HEFA 5FQKA 3B33A 2JHEA 4FH2A 5DTTA 4B88A 5HDDA 1J3WA 3QP6A 5EM1A 3F1NB 4DMZA 1Z6FA 3E4QA 3NECA 2KDKA 3A3IA 3PBRA 4Q0IA 3UE3A 4XXRA 2IWDA 4GW9A 2HGVA 3LCEA 3S22A 3KSFA 1FIKA 2A24A 1NYYA 3D9YA 4FSFA 1XA7A 3O86A 1QMEA 4MBHA 3FKVA 3WRTA 2XA7S 2ZC4B 1Z09A 1YMXA 4NXEA 2W1TA 4EETB 4GOGA 5HAPA 1STZA 4UQIS 1TEMA 5G4YA 1K4FA 4QY6A 4LRZE 3OCNA 3BQAA 3T1RA 1ONGA 3LIDA 1TDLA 2WGWB 3IF6C 1T1AA 3PBOA 3T12B 1LT0A 3P7NA 1MWRA 2J3TC 2NUTC 5FDHA 3HLGA 1JWVA 1KOUA 3RFBA 4OQIA 3IWIA 1F9IA 3MKFA 3IH8A 4ME4A 3ZGAB 2HPBA 1IELA 3W2ZA 3WS0A 4EUZA 3MZFA 4OOMA 4KQQA 4UEYA 4P6ZM 3VSLA 3TSGA 4K0XA 2PR5A 1D7EA 3S7NA 5L10A 1N9BA 4E3NA 1XJ4A 1W7FA 2EX6A 2PD7A 1DP8A 2ZOHA 4IBRA 4YNRA 2Y2JA 5EECA 3LIBA 4FTXA 2NUPC 4EW7A 2L0WA 1NLZA 4IUKA 4BBUA 4JPMA 2ZM2A 1L0FA 4CLCE 4KQRA 3OBFA 3UE1A 4S2OA 4UQIM 3LIAA 4EV4A 4EERA 4ID4A 2J3WA 1G68A 4DXCA 4DE3A 2RCXA 1XJ6A 2DNSA 4YWZA 5GLBA 1Y4OA 1GA9A 4R3BA 1J9MA 1MY8A 3NULA 4KZ5A 2M1CA 5GLCA 3T50A 2WKPA 2HJEA 1S66L 2PYRA 1UWNX 1PYYA 1KDWA 4EBNA 2HP9A 2PT7A 3BY8A 2Z6CA 3ITAA 1YMSA 3C7UA 1OTEA 4DXBA 2V1BA 1IYPA 3IF6B 3C2WA 2OWJA 4I3JA 4NEED 1PW8A 3LR5A 1ONHA 4MDZA 3MQ0A 4PAUA 4YFMA 4EESA 3V39A 1BSGA 1I2SA 3T1XA 1S1ZA 1GCEA 2GZAA 3HBRA 4ZTKA 3IX3A 4HQAA 3K2NA 3ZVWA 2P08A 1W79A 3VOLA 3KX0X 2PU4A 3NY4A 3ZNTA 4BBTA 4QPRA 3HLFA 3UE6A 1SCWA 4WELA 4PM6A 1CI8A 3K3DA 3OC2A 1IFQA 3V67A 3UMDA 3IWQA 2Y2PA 1KE0A 1K56D 5CHUA 1YLYA 2XD5A 3F1NA 1GSWA 2Q9NA 1PFLA 2Y59A 4UAAA 2WZZA 4C75A 4DN0A 1VEUA 3B42A 3MBZA 2B02A 2VEAA 5TBMA 3CAXA 3W4QA 2XH9A 4JXVA 5FAQA 3CPTA 3FZCA 4B93A 3BFGA 3LFVA 2ZJ9A 2XA7M 2DCFA 3T4KA 1DJAA 4FOFA 4O0PA 3W4OA 4I39A 3VP1A 3MXRA 5FATA 3W4PA 1AWIA 2Y2OA 3ZDJA 5DF8A 5HPFA 1GA0A 1FQGA 2PDRA 1BLHA 4LRYC 3DBAA 4I3AA 3ZFZA 2W3EA 2FFYA 4X25A 1CEGA 4XT2A 3T4JA 2Y8HA 3KYQA 4QU3A 3JVVA 1NWZA 4C6YA 2PBDP 1E25A 4KZ8A 4MEZA 3NBLA 1VETB 3OLOA 5D3OA 1NYMA 4ARZB 4R4RA 1S6RA 3NOPC 3IXHA 4RYEA 1YLJA 5E2EA 2Y4AA 5I5LA 3ZG8B 1DY6A 4NG2A 4E3LA 3G4PA 3VSKA 5TFQA 1NJ4A 3NI9A 5J8XA 4RA7A 5EVIB 2XK1A 3RJUA 3V50A 2XFTA 3B3XA 2ZQ8A 2ZBBA 4O7DA 2WADA 3Q7VA 1SDNA 3WS2A 2WKIA 1HZOA 1YT4A 4JXGA 4NXFA 5A92A 4X68A 3LEZA 3NDGA 4FCFA 3N8RA 3NIAA 5F6AA 1SDEA 4JGOA 3CLOA 2I72A 3LICA 2FZ0A 4HBUA 1L0DA 3UMEA 3FKWA 2Y2NA 1CF0A 3ZHHA 3HUMA 4KZAA 5GL9A 5F68A 2XEPA 2I9VA 4M3KA 5CGWA 2C6WB 1NRFA 2HDRA 3LR4A 4PM9A 3QP4A 2DRWA 4OPYA 5HZHA 2G7UA 4WYYA 5CGXA 1LHYA 1OTDA 4LCMA 2L4RA 3CUEA 2MJ6A 3IQAA 4IJGA 4R3AA 1YAXA 3NCKA 3H9WA 4PMAA 1LI0A 3EGXC 4EBLA 1WE4A 3BFDA 4JGPA 4ZBEA 4BWIA 1XGJA 3LY4A 3G32A 4WMCD 4HNBA 2VV6A 4IBXA 3SS5A 2PD8A 2ZC5B 2G2UA 3TOIA 5A8BA 2C5WB 1LL9A 1L0EA 5EVIC 4HP9A 1XA1A 2XDMA 3IBJA 4CLCA 5JYPA 4NK3A 4X1LA 4JXSA 2VA0A 4ZAMA 2PR6A 3ZVTA 2XQZA 1Q2QA 4HJ6A 4I38A 5CTNA 2Y2IA 1KGFA 4E6WA 3V3SA 3MQQA 3N7WA 3BEBA 1BYWA 1KVMA 4MNRA 4P6ZS 1LLBA 3HREA 3FG8A 3IHBA 3VOYA 4KZBA 3UB7A 4QWOA 4JKTA 4JGRA 2P9VB 3CG5A 1PWDA 3PXPA 2O9CA 4EUVA 2QJ7A 1CQAA 3P01A 3A3EA 4LLOB 4H8RA 4ESPA 3GMWA 3G2YA 3DAVA 3ZG0A 4HOIA 2P04A 3G2ZA 3WWXA 4EQ1A 5FL3A 1T1BA 3PYPA 2CC1A 5HARA 3UB5P 3SZTA 4GD6A 1BZAA 2JKTM 4B4XA 1FSYA 1KVLA 2E8JA 4N9LA 4X55A 4R1GA 1ERQA 4I3IA 3JVUA 3Q1FA 1LL5A 2WAFA 4GJ4A 3IS2A 1O7EA 2EA9A 1YSPA 3FPVA 1ALQA 3H7WA 4MN7A 2WGWA 2Y2MA 3KSHA 3TG9A 3HLWA 4HJ3A 3BM6A 5CRFA 1MPLA 2ZM0A 2A3UA 1CJFA 5L07A 3FC7A 2ZM8A 2PRFA 2VJWA 3RXXA 5HPIA 4PM5A 2H5SA 3EEHA 3SS3A 5HWWA 5U47A 5FQQA 3C4PA 1YLZA 2V8FA 4WLAA 3IF6A 3BW6A 3MSHA 3C30A 3IS2B 3ISGA 3SH7A 3U2AA 4Y0UA 1PZOA 5FA7A 4OLDA 3IBRA 2AVXA 3UE0A 1JVJA 4XUXA 4WZ5A 4S2PA 2XF3A 1BUEA 2JC7A 3N4IA 4OLGA 1I2WA 1M6KA 1ES3A 1GHPA 3VMAA 2P7JA 4OQHA 1JWZA 4WMCA 1PZPA 3EQVA 3Q7ZA 1ACFA 2V0UA 5CTMA 2K31A 3G30A 4JBFA 4G3VA 3VP3A 3R4KA 1Y28A 2ACGA 2J9OA 2GDNA 4X6TA 1OTAA 1YKDA 4X53A 3SH9A 2RL3A 1FR6A 3LYXA 5DF9A 1YM1A 1AXBA 1C3BA 3DW0A 2JN7A 1LI9A 4MCWA 4LPZA 1TS0A 2HJ9C 2K7SA 2ZMAA 3M6BA 1W8QA 4DKIA 3BFCA 1K38A 2HDSA 2K2NA 3IXBA 1BTLA 3BYDA 3KSIA 1XPBA 5J7EA 1W8YA 2H28A 3EGDC 3N8LA 2OWHA 4OPQA 1KE3A 1F5MA 4OP5A 1DP6A 3UNWA 3GDIA 5DTKA 3AGDA 4KENB 3VV4A 3BFFA 1F2KA 1HTZA 5G4ZA 2JKRI 4MBFA 3T1SA 1E3UA 4LFUA 2Z6DA 4S2MA 3EEAA 4GB7A 3C38A 4S2IA 5CERA 4ZJ2A 2JE5A 4X56A 2J3TD 4WN5A 2Y79A 4B4ZA 1VHMA 4HIAA 3PR6A 1OMEA 4B9OA 3IWOA 4N1XA 2R9XA 4AFIA 4F3LA 3LGOA 3GSGA 1EW0A 4KZ4A 3RXWA 1UWPX 4R23A 5KIZA 3MFXA 3QP2A 2XRNA 4GNUA 4WZ4A 2QMIA 1RP5A 3IT9A 1MBLA 2ZC7A 2JKFA 3T4OA 1P0ZA 2X71A 4Y5FA 5KSCA 5AQ9A 1TS6A 3R7WB 4JXWA 4JF5A 5F1FA 4CQHA 4GHIA 3M6HA 4OQGA 2UV0E 3JYIA 2ZL1B 4P0MA 3JPUA 5LBRA 4RVAA 5CX7A 2ZL1A 1G6AA 2G2WA 4II7A 1PIOA 4O8GA 3SOIA 2ZOIA 2FH5A 4S2NA 2XSSA 4FUWA 1H8MA 2DMWA 4Y7PA 3DTMA 5DFXA 3UDIA 1NXYA 4KQOA 4P85A 5HWVA 1DJCA 1W5DA 1ZKJA 3A3DA 1OPXA 1XKZA 1K54A 4ZJ3A 3H82B 4QJGA 2J7VA 2OAQ1 4ETXA 4OOLA 3BFEA 3F1PA 4MN6A 1OTBA 3S7OA 3H82A 4PKYG 4KG5A 2B5RA 3IX4A 5BOHA 3LEQA 3VE3A 4R38A 1GHMA 4DJ3A 4IHQA 2HDUA 4BJPA 5EVIA 1NZUA 4CLCC 4R70A 3NC8A 4K08A 1D06A 4R4SA 2JKTI 1NZOA 4P6BA 3BECA 1NRJA 3CI6A 3TW8A 4KZ3A 5F82A 1Y54A 4BENA 1PI4A 1S4SA 3OPLA 3UDFA 2W3HA
chains in the Genus database with same CATH topology
2DRWA 1FCNA 4OPYA 3VP2A 3MZEA 4WYYA 5CGXA 1FR1A 2PU2A 1H8ZA 1PWCA 1L0GA 5FQJA 1LHYA 3Q81A 1MKIA 2ZQAA 3QHYA 4GZBA 1BLCA 4BQMA 2BG1A 1ERMA 2Q9MA 4LCMA 4Y0OA 4DE1A 1IYOA 5JYOA 2ZC6B 3IQAA 5FQMA 1E3UD 2OLUA 2EFXA 3MKEA 4FD8A 4LV3A 3SH8A 1ESUA 3NCKA 1SKFA 2J9PA 3OPRA 2J8YA 5GLAA 4PMAA 1LI0A 4CJNA 3G34A 1CK3A 3O3VA 5F83A 4JF4A 2XLNA 2ZQ7A 2WAEA 4GKUA 4HEFA 5FI7A 1WE4A 3BFDA 5FQKA 4EBLA 3IXGA 4PM7A 4ZBEA 4IVKA 1XGJA 3IF5A 3LY4A 3G32A 4FH2A 4S2NC 4DE0A 4WMCD 4YINA 5DTTA 2P74A 4B88A 3SS4A 3I7JA 3HUOA 5FI6A 4OP8A 2P9VA 1Z6FA 4IBXA 3SS5A 2ZC5B 3TOIA 2G2UA 2C5WB 1BLSA 2Y91A 1LL9A 1L0EA 3WS1A 3A3IA 4C3QA 4Y0TA 3PBRA 1IYSA 5EVIC 1XA1A 3UE3A 4XXRA 2IWDA 2XDMA 5JYPA 4NK3A 4JXSA 3LCEA 4ZAMA 1VM1A 2EFUA 3S22A 3ZVTA 5HW3A 5EPHA 2XQZA 1Q2QA 2EXAA 2EX9A 1K55C 2HDQA 1NYYA 4BL2A 5CTNA 3MZDA 2Y2IA 1KGFA 4E6WA 4FSFA 4OH0A 5EOEA 5DF7A 3V3SA 1XA7A 1BLPA 2PBYA 3O86A 1QMEA 4S2LA 5CEDA 3LY3A 3N7WA 4MBHA 3FKVA 3BEBA 3WRTA 5CHJA 1EWZA 3DWKA 1KVMA 2ZC4B 3G35A 4MNRA 1YMXA 2ZD8A 3O87A 5HX9A 4GOGA 3GRJA 3FWLA 1LLBA 5HAPA 3HREA 4HESA 2WGIA 3IHBA 4KZBA 1TEMA 3VOYA 1JWPA 3IXDA 1K4FA 3LO7A 4KZ9A 4QY6A 3E2KA 2Z2MB 4JKTA 4N92A 3OCNA 3HL9A 2Z2LB 2P9VB 1ONGA 2FFFB 1PWDA 3CG5A 1DJBA 1TDLA 4IEDA 3A3EA 2WGWB 3IF6C 3O88A 2Y2QA 3PBOA 4PPRA 4H8RA 3GMWA 3G2YA 3ZG0A 1MWRA 3G2ZA 3WWXA 4KZ7A 1IKIA 1K6SA 2QPNA 5FDHA 3HLGA 2VGKA 1JWVA 1BT5A 3PTEA 1EROA 2CC1A 5TR7A 5HARA 2A49A 4OQIA 3IWIA 4GD6A 1BZAA 4B4XA 3MKFA 1FSYA 1KVLA 4E3MA 3WS4A 3IH8A 3ZGAB 2HPBA 1IELA 3WS0A 4N9LA 3C5AA 3CZDA 4X55A 4R1GA 4EUZA 5KMWA 3MZFA 1ERQA 1TVFA 3GV9A 4OOMA 3Q1FA 1LL5A 2WAFA 4UA9A 4WEJA 5AQ7A 4KQQA 3VSLA 1O7EA 3TSGA 3V5MA 2JCHA 4BD0A 4K0XA 5DTSA 3VP0A 1FCMA 1L2SA 1ALQA 4R0QA 4E3IA 2WGWA 4RX2A 1CEFA 3GQZA 1N9BA 4JLFA 2Y2MA 4E3NA 1W7FA 2EX6A 2ZC3B 3PBSA 3HLWA 3TG9A 4IBRA 4KZ6A 3BM6A 3UPOA 2Y2JA 5CRFA 1MPLA 2ZM0A 4LENA 5EECA 5FI2A 1IYQA 4HBTA 2A3UA 4E3JA 4N9KA 5E43A 4P87A 5CGSA 2ZQ9A 4JPMA 2ZM2A 1N4OA 3BLMA 2ZM8A 1L0FA 2XR0A 3RXXA 5TGFA 4Q8IA 3HVFA 4KQRA 4PM5A 2H5SA 5I94A 5AQAA 2X01A 2QZ6A 1HVBA 2WZXA 3SS3A 5U47A 4FH4A 5FQQA 3UE1A 4DF6A 3PAGA 3C4PA 1YLZA 2XGNA 3QNCA 4S2OA 3IF6A 4EV4A 2UWXA 4CPKA 4ID4A 3VFFA 3ISGA 3SH7A 1KGEA 3D4FA 4WBGA 1G68A 3A3JA 3EQUA 4Y0UA 4DXCA 4DE3A 3UPPA 1PZOA 1BULA 1M40A 2RCXA 4OLDA 5FA7A 3S4XA 4WZ5C 2Y2HA 2EX8A 3OZHA 4S2KA 2DNSA 2OV5A 3UE0A 1RGYA 2H0TA 5GLBA 4OVDA 1GA9A 4KG6A 4R3BA 1J9MA 1MY8A 4KZ5A 3OPHA 1JVJA 2V20A 3C7VA 5GLCA 3CJMA 4XUXA 5GHYA 1ES2A 4U3TA 4WZ5A 4S2PA 4S2JA 2XF3A 1BUEA 2JC7A 2WGVA 3ZG7B 3N4IA 5HAIA 1KE4A 1PYYA 4OLGA 1KDWA 3ZG9B 4EBNA 1ZG6A 1I2WA 1CI9A 3FYZA 1M6KA 1ES3A 1GHPA 3VMAA 2HP9A 5EOOA 4OQHA 5EVLA 1JWZA 3AGEA 4WMCA 1PZPA 1XX2A 1YMSA 3C7UA 3EQVA 3ITAA 4DDSA 3Q7ZA 4DXBA 5CTMA 5GHXA 1MXOA 1IYPA 1YLTA 3G30A 4JBFA 3P09A 3IF6B 4RX3A 4U0XA 5AQBA 1FCOA 1MWTA 3VP3A 1HD8A 4WEKA 1PW8A 1ONHA 4LV2A 4K0WA 5DVAA 2J9OA 2GDNA 4X6TA 4YFMA 1U60A 5HAQA 3Q7VB 4EWFA 4X53A 3G31A 2BLSA 3ITBA 3SH9A 3V39A 2RL3A 3MFDA 3PBNA 1BSGA 1FR6A 1I2SA 3Q07A 1TDGA 1YM1A 5DF9A 1AXBA 4E3OA 3NDEA 2V1ZA 4GD8A 2R9WA 1GCEA 1C3BA 3DW0A 3CMZA 1Q2PA 3HBRA 3VOZA 1FOFA 1H5XA 4ZTKA 1LI9A 1XXMA 3M2JA 3HLCA 4UA7A 2EX2A 1JTDA 2ZQDA 1ZC2A 2EXBA 5CXWA 2ZMAA 3M6BA 3ZVWA 1W8QA 4DKIA 5E2HA 4E3KA 5E2GA 1W79A 2XD1A 3BFCA 1K38A 2Y2KA 2HDSA 3HLBA 3IXBA 1BTLA 2PU4A 3NY4A 3BYDA 4QB8A 3ZNTA 2Y2GA 1XPBA 1W8YA 4BD1A 3N6IA 2ZLYA 5IHVA 3N8LA 1IKGA 4LCLA 4LV1A 3HLFA 1ES5A 4OPQA 1SCWA 1RCJA 4WELA 1KE3A 4OP5A 5L2FA 4PM6A 2WUQA 1CI8A 3OC2A 3UNWA 5DTKA 4OOYA 3AGDA 4KENB 3BFFA 1HTZA 4GN2A 4NETA 4EQIA 3IWQA 5FQIA 2Y2PA 1KE0A 1O07A 3PAEA 1K56D 1YQSA 1YLYA 5CHUA 4MBFA 1E3UA 2XD5A 3M2KA 5G18A 5CECA 4F94A 5HFOA 4S2MA 3UPNA 2Q9NA 4GB7A 2Y59A 4LV0A 4GDNA 4JF6A 4GDBA 4UAAA 2WZZA 4C75A 5FASA 4S2IA 1K25A 5CERA 3GR2A 4ZJ2A 1I5QA 3HUNA 2JE5A 3WS5A 4X56A 4PM8A 1K57C 3MBZA 4A5RA 4B4ZA 4EBPA 5FAPA 1OMEA 5GLDA 3W4QA 1XP4A 3IWOA 2XH9A 4JXVA 5FAQA 4N1XA 3FZCA 2R9XA 5A91A 3BFGA 2ZJ9A 1ESIA 1K57A 5A90A 3GSGA 4KZ4A 3RXWA 4D2OA 4R23A 2DCFA 4OPRA 1DJAA 1EI5A 4E6XA 3W4OA 3GTCA 1RGZA 3VP1A 3BLSA 2Y55A 2OLVA 3MXRA 4WM9A 4GNUA 4WZ4A 5FATA 2QMIA 4N1HA 3W4PA 1RP5A 2E8IA 5M19A 3IT9A 2ZQCA 3WRZA 4BL3A 1QMFA 1MBLA 2Y2OA 3HLDA 2ZC7A 2VGJA 3VP4A 3ZDJA 5CHMA 2X71A 5KSCA 1FSWA 5DF8A 4U0TA 1GA0A 1FQGA 3W8KA 1BLHA 5AQ9A 3A3FA 4JXWA 3ZFZA 4JF5A 2XFSA 5FAOA 4ZDXA 5KZHA 2V2FF 2Y2LA 3E2LA 5F1FA 2FFYA 1CEGA 3GVBA 4MBKA 1K6RA 3DWZA 3M6HA 4OQGA 4ZJ1A 1XGIA 3IHAA 3JYIA 2H0YA 4OONA 4OPZA 4P0MA 5EVID 2WKHA 5E2FA 4BLMA 4QU3A 1MWSA 1IEMA 4RVAA 4C6YA 1E25A 3UDXA 4KZ8A 1KGGA 4MEZA 3NBLA 1G6AA 3AGFA 4KG2A 3MXSA 1WYBA 4OQ0A 4QHCA 2HP5A 2G2WA 5D3OA 1NYMA 1PIOA 4R4RA 1S6RA 3IXHA 4Z9QA 4RYEA 3SOIA 5FSRA 1K4EA 1K54C 5GHZA 2HP6A 1H8YA 1K56A 1YLJA 4S2NA 4QY5A 5E2EA 2Y4AA 4R3JA 5EUAA 2OSUA 3ZG8B 5M18A 1DY6A 1MWUA 4L0LA 5F1GA 2WYXA 4Y7PA 4E3LA 3G4PA 4IVIA 3DTMA 3VSKA 5TFQA 1NJ4A 2WKEA 3Q82A 4DE2A 3NI9A 3UDIA 5J8XA 4RA7A 1NXYA 2XK1A 4KQOA 5EVIB 3RJUA 4P85A 2X02A 3V50A 1PI5A 3PBQA 1DJCA 2XFTA 3B3XA 5EE8A 1W5DA 1S0WA 1ZKJA 3A3DA 3QNBA 1E4DA 2ZQ8A 1XKZA 4O7DA 3BRMA 2WADA 5M1AA 1PWGA 3Q7VA 3ZNYA 1SDNA 5HL1A 1GHIA 1K54A 1YLWA 4ZJ3A 3WS2A 2WKIA 5FQ9A 3UN7A 1HZOA 1YT4A 4JXGA 3UO9A 5A92A 3P98A 4QJGA 2J7VA 5KSHA 3C4OA 4X68A 3LEZA 3NDGA 4DRTA 4OOLA 3OPPA 4FCFA 3BFEA 3N8RA 3NIAA 2H10A 1ZG4A 4KG5A 1SDEA 2B5RA 3OCLA 2I72A 5BOHA 1GHMA 3S1YA 1WYCA 4QD4A 3ZCZA 2HDUA 4BJPA 4HBUA 3N8SA 1L0DA 4MLLA 4X69A 5EVIA 1NZUA 1NY0A 3FKWA 3HLEA 2Y2NA 2JBFA 3ZHHA 3V3RA 3HUMA 3ZG5A 4OKPA 3NC8A 4KZAA 4DDYA 1K55A 1SHVA 1YLPA 5GL9A 1PW1A 4K91A 4UA6A 2IWCA 4R4SA 3IH9A 1NZOA 2XEPA 5A93A 4P6BA 5CEBA 3FV7A 3BECA 4XUZA 1JTGA 4M3KA 3VFHA 1ES4A 3UY6A 2IWBA 3PBTA 2C6WB 1NRFA 4KZ3A 5CGWA 2HDRA 1Y54A 5F82A 2WK0A 4BENA 1PI4A 1VQQA 3OPLA 3UDFA 4PM9A 1KDSA 4UHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DRW A;  1FCN A;  4OPY A;  3VP2 A;  3MZE A;  4WYY A;  5CGX A;  1FR1 A;  2PU2 A;  1H8Z A;  1PWC A;  1L0G A;  5FQJ A;  1LHY A;  3Q81 A;  1MKI A;  2ZQA A;  3QHY A;  4GZB A;  1BLC A;  4BQM A;  2BG1 A;  1ERM A;  2Q9M A;  4LCM A;  4Y0O A;  4DE1 A;  1IYO A;  5JYO A;  2ZC6 B;  3IQA A;  5FQM A;  1E3U D;  2OLU A;  2EFX A;  3MKE A;  4FD8 A;  4LV3 A;  3SH8 A;  1ESU A;  3NCK A;  1SKF A;  2J9P A;  3OPR A;  2J8Y A;  5GLA A;  4PMA A;  1LI0 A;  4CJN A;  3G34 A;  1CK3 A;  3O3V A;  5F83 A;  4JF4 A;  2XLN A;  2ZQ7 A;  2WAE A;  4GKU A;  4HEF A;  5FI7 A;  1WE4 A;  3BFD A;  5FQK A;  4EBL A;  3IXG A;  4PM7 A;  4ZBE A;  4IVK A;  1XGJ A;  3IF5 A;  3LY4 A;  3G32 A;  4FH2 A;  4S2N C;  4DE0 A;  4WMC D;  4YIN A;  5DTT A;  2P74 A;  4B88 A;  3SS4 A;  3I7J A;  3HUO A;  5FI6 A;  4OP8 A;  2P9V A;  1Z6F A;  4IBX A;  3SS5 A;  2ZC5 B;  3TOI A;  2G2U A;  2C5W B;  1BLS A;  2Y91 A;  1LL9 A;  1L0E A;  3WS1 A;  3A3I A;  4C3Q A;  4Y0T A;  3PBR A;  1IYS A;  5EVI C;  1XA1 A;  3UE3 A;  4XXR A;  2IWD A;  2XDM A;  5JYP A;  4NK3 A;  4JXS A;  3LCE A;  4ZAM A;  1VM1 A;  2EFU A;  3S22 A;  3ZVT A;  5HW3 A;  5EPH A;  2XQZ A;  1Q2Q A;  2EXA A;  2EX9 A;  1K55 C;  2HDQ A;  1NYY A;  4BL2 A;  5CTN A;  3MZD A;  2Y2I A;  1KGF A;  4E6W A;  4FSF A;  4OH0 A;  5EOE A;  5DF7 A;  3V3S A;  1XA7 A;  1BLP A;  2PBY A;  3O86 A;  1QME A;  4S2L A;  5CED A;  3LY3 A;  3N7W A;  4MBH A;  3FKV A;  3BEB A;  3WRT A;  5CHJ A;  1EWZ A;  3DWK A;  1KVM A;  2ZC4 B;  3G35 A;  4MNR A;  1YMX A;  2ZD8 A;  3O87 A;  5HX9 A;  4GOG A;  3GRJ A;  3FWL A;  1LLB A;  5HAP A;  3HRE A;  4HES A;  2WGI A;  3IHB A;  4KZB A;  1TEM A;  3VOY A;  1JWP A;  3IXD A;  1K4F A;  3LO7 A;  4KZ9 A;  4QY6 A;  3E2K A;  2Z2M B;  4JKT A;  4N92 A;  3OCN A;  3HL9 A;  2Z2L B;  2P9V B;  1ONG A;  2FFF B;  1PWD A;  3CG5 A;  1DJB A;  1TDL A;  4IED A;  3A3E A;  2WGW B;  3IF6 C;  3O88 A;  2Y2Q A;  3PBO A;  4PPR A;  4H8R A;  3GMW A;  3G2Y A;  3ZG0 A;  1MWR A;  3G2Z A;  3WWX A;  4KZ7 A;  1IKI A;  1K6S A;  2QPN A;  5FDH A;  3HLG A;  2VGK A;  1JWV A;  1BT5 A;  3PTE A;  1ERO A;  2CC1 A;  5TR7 A;  5HAR A;  2A49 A;  4OQI A;  3IWI A;  4GD6 A;  1BZA A;  4B4X A;  3MKF A;  1FSY A;  1KVL A;  4E3M A;  3WS4 A;  3IH8 A;  3ZGA B;  2HPB A;  1IEL A;  3WS0 A;  4N9L A;  3C5A A;  3CZD A;  4X55 A;  4R1G A;  4EUZ A;  5KMW A;  3MZF A;  1ERQ A;  1TVF A;  3GV9 A;  4OOM A;  3Q1F A;  1LL5 A;  2WAF A;  4UA9 A;  4WEJ A;  5AQ7 A;  4KQQ A;  3VSL A;  1O7E A;  3TSG A;  3V5M A;  2JCH A;  4BD0 A;  4K0X A;  5DTS A;  3VP0 A;  1FCM A;  1L2S A;  1ALQ A;  4R0Q A;  4E3I A;  2WGW A;  4RX2 A;  1CEF A;  3GQZ A;  1N9B A;  4JLF A;  2Y2M A;  4E3N A;  1W7F A;  2EX6 A;  2ZC3 B;  3PBS A;  3HLW A;  3TG9 A;  4IBR A;  4KZ6 A;  3BM6 A;  3UPO A;  2Y2J A;  5CRF A;  1MPL A;  2ZM0 A;  4LEN A;  5EEC A;  5FI2 A;  1IYQ A;  4HBT A;  2A3U A;  4E3J A;  4N9K A;  5E43 A;  4P87 A;  5CGS A;  2ZQ9 A;  4JPM A;  2ZM2 A;  1N4O A;  3BLM A;  2ZM8 A;  1L0F A;  2XR0 A;  3RXX A;  5TGF A;  4Q8I A;  3HVF A;  4KQR A;  4PM5 A;  2H5S A;  5I94 A;  5AQA A;  2X01 A;  2QZ6 A;  1HVB A;  2WZX A;  3SS3 A;  5U47 A;  4FH4 A;  5FQQ A;  3UE1 A;  4DF6 A;  3PAG A;  3C4P A;  1YLZ A;  2XGN A;  3QNC A;  4S2O A;  3IF6 A;  4EV4 A;  2UWX A;  4CPK A;  4ID4 A;  3VFF A;  3ISG A;  3SH7 A;  1KGE A;  3D4F A;  4WBG A;  1G68 A;  3A3J A;  3EQU A;  4Y0U A;  4DXC A;  4DE3 A;  3UPP A;  1PZO A;  1BUL A;  1M40 A;  2RCX A;  4OLD A;  5FA7 A;  3S4X A;  4WZ5 C;  2Y2H A;  2EX8 A;  3OZH A;  4S2K A;  2DNS A;  2OV5 A;  3UE0 A;  1RGY A;  2H0T A;  5GLB A;  4OVD A;  1GA9 A;  4KG6 A;  4R3B A;  1J9M A;  1MY8 A;  4KZ5 A;  3OPH A;  1JVJ A;  2V20 A;  3C7V A;  5GLC A;  3CJM A;  4XUX A;  5GHY A;  1ES2 A;  4U3T A;  4WZ5 A;  4S2P A;  4S2J A;  2XF3 A;  1BUE A;  2JC7 A;  2WGV A;  3ZG7 B;  3N4I A;  5HAI A;  1KE4 A;  1PYY A;  4OLG A;  1KDW A;  3ZG9 B;  4EBN A;  1ZG6 A;  1I2W A;  1CI9 A;  3FYZ A;  1M6K A;  1ES3 A;  1GHP A;  3VMA A;  2HP9 A;  5EOO A;  4OQH A;  5EVL A;  1JWZ A;  3AGE A;  4WMC A;  1PZP A;  1XX2 A;  1YMS A;  3C7U A;  3EQV A;  3ITA A;  4DDS A;  3Q7Z A;  4DXB A;  5CTM A;  5GHX A;  1MXO A;  1IYP A;  1YLT A;  3G30 A;  4JBF A;  3P09 A;  3IF6 B;  4RX3 A;  4U0X A;  5AQB A;  1FCO A;  1MWT A;  3VP3 A;  1HD8 A;  4WEK A;  1PW8 A;  1ONH A;  4LV2 A;  4K0W A;  5DVA A;  2J9O A;  2GDN A;  4X6T A;  4YFM A;  1U60 A;  5HAQ A;  3Q7V B;  4EWF A;  4X53 A;  3G31 A;  2BLS A;  3ITB A;  3SH9 A;  3V39 A;  2RL3 A;  3MFD A;  3PBN A;  1BSG A;  1FR6 A;  1I2S A;  3Q07 A;  1TDG A;  1YM1 A;  5DF9 A;  1AXB A;  4E3O A;  3NDE A;  2V1Z A;  4GD8 A;  2R9W A;  1GCE A;  1C3B A;  3DW0 A;  3CMZ A;  1Q2P A;  3HBR A;  3VOZ A;  1FOF A;  1H5X A;  4ZTK A;  1LI9 A;  1XXM A;  3M2J A;  3HLC A;  4UA7 A;  2EX2 A;  1JTD A;  2ZQD A;  1ZC2 A;  2EXB A;  5CXW A;  2ZMA A;  3M6B A;  3ZVW A;  1W8Q A;  4DKI A;  5E2H A;  4E3K A;  5E2G A;  1W79 A;  2XD1 A;  3BFC A;  1K38 A;  2Y2K A;  2HDS A;  3HLB A;  3IXB A;  1BTL A;  2PU4 A;  3NY4 A;  3BYD A;  4QB8 A;  3ZNT A;  2Y2G A;  1XPB A;  1W8Y A;  4BD1 A;  3N6I A;  2ZLY A;  5IHV A;  3N8L A;  1IKG A;  4LCL A;  4LV1 A;  3HLF A;  1ES5 A;  4OPQ A;  1SCW A;  1RCJ A;  4WEL A;  1KE3 A;  4OP5 A;  5L2F A;  4PM6 A;  2WUQ A;  1CI8 A;  3OC2 A;  3UNW A;  5DTK A;  4OOY A;  3AGD A;  4KEN B;  3BFF A;  1HTZ A;  4GN2 A;  4NET A;  4EQI A;  3IWQ A;  5FQI A;  2Y2P A;  1KE0 A;  1O07 A;  3PAE A;  1K56 D;  1YQS A;  1YLY A;  5CHU A;  4MBF A;  1E3U A;  2XD5 A;  3M2K A;  5G18 A;  5CEC A;  4F94 A;  5HFO A;  4S2M A;  3UPN A;  2Q9N A;  4GB7 A;  2Y59 A;  4LV0 A;  4GDN A;  4JF6 A;  4GDB A;  4UAA A;  2WZZ A;  4C75 A;  5FAS A;  4S2I A;  1K25 A;  5CER A;  3GR2 A;  4ZJ2 A;  1I5Q A;  3HUN A;  2JE5 A;  3WS5 A;  4X56 A;  4PM8 A;  1K57 C;  3MBZ A;  4A5R A;  4B4Z A;  4EBP A;  5FAP A;  1OME A;  5GLD A;  3W4Q A;  1XP4 A;  3IWO A;  2XH9 A;  4JXV A;  5FAQ A;  4N1X A;  3FZC A;  2R9X A;  5A91 A;  3BFG A;  2ZJ9 A;  1ESI A;  1K57 A;  5A90 A;  3GSG A;  4KZ4 A;  3RXW A;  4D2O A;  4R23 A;  2DCF A;  4OPR A;  1DJA A;  1EI5 A;  4E6X A;  3W4O A;  3GTC A;  1RGZ A;  3VP1 A;  3BLS A;  2Y55 A;  2OLV A;  3MXR A;  4WM9 A;  4GNU A;  4WZ4 A;  5FAT A;  2QMI A;  4N1H A;  3W4P A;  1RP5 A;  2E8I A;  5M19 A;  3IT9 A;  2ZQC A;  3WRZ A;  4BL3 A;  1QMF A;  1MBL A;  2Y2O A;  3HLD A;  2ZC7 A;  2VGJ A;  3VP4 A;  3ZDJ A;  5CHM A;  2X71 A;  5KSC A;  1FSW A;  5DF8 A;  4U0T A;  1GA0 A;  1FQG A;  3W8K A;  1BLH A;  5AQ9 A;  3A3F A;  4JXW A;  3ZFZ A;  4JF5 A;  2XFS A;  5FAO A;  4ZDX A;  5KZH A;  2V2F F;  2Y2L A;  3E2L A;  5F1F A;  2FFY A;  1CEG A;  3GVB A;  4MBK A;  1K6R A;  3DWZ A;  3M6H A;  4OQG A;  4ZJ1 A;  1XGI A;  3IHA A;  3JYI A;  2H0Y A;  4OON A;  4OPZ A;  4P0M A;  5EVI D;  2WKH A;  5E2F A;  4BLM A;  4QU3 A;  1MWS A;  1IEM A;  4RVA A;  4C6Y A;  1E25 A;  3UDX A;  4KZ8 A;  1KGG A;  4MEZ A;  3NBL A;  1G6A A;  3AGF A;  4KG2 A;  3MXS A;  1WYB A;  4OQ0 A;  4QHC A;  2HP5 A;  2G2W A;  5D3O A;  1NYM A;  1PIO A;  4R4R A;  1S6R A;  3IXH A;  4Z9Q A;  4RYE A;  3SOI A;  5FSR A;  1K4E A;  1K54 C;  5GHZ A;  2HP6 A;  1H8Y A;  1K56 A;  1YLJ A;  4S2N A;  4QY5 A;  5E2E A;  2Y4A A;  4R3J A;  5EUA A;  2OSU A;  3ZG8 B;  5M18 A;  1DY6 A;  1MWU A;  4L0L A;  5F1G A;  2WYX A;  4Y7P A;  4E3L A;  3G4P A;  4IVI A;  3DTM A;  3VSK A;  5TFQ A;  1NJ4 A;  2WKE A;  3Q82 A;  4DE2 A;  3NI9 A;  3UDI A;  5J8X A;  4RA7 A;  1NXY A;  2XK1 A;  4KQO A;  5EVI B;  3RJU A;  4P85 A;  2X02 A;  3V50 A;  1PI5 A;  3PBQ A;  1DJC A;  2XFT A;  3B3X A;  5EE8 A;  1W5D A;  1S0W A;  1ZKJ A;  3A3D A;  3QNB A;  1E4D A;  2ZQ8 A;  1XKZ A;  4O7D A;  3BRM A;  2WAD A;  5M1A A;  1PWG A;  3Q7V A;  3ZNY A;  1SDN A;  5HL1 A;  1GHI A;  1K54 A;  1YLW A;  4ZJ3 A;  3WS2 A;  2WKI A;  5FQ9 A;  3UN7 A;  1HZO A;  1YT4 A;  4JXG A;  3UO9 A;  5A92 A;  3P98 A;  4QJG A;  2J7V A;  5KSH A;  3C4O A;  4X68 A;  3LEZ A;  3NDG A;  4DRT A;  4OOL A;  3OPP A;  4FCF A;  3BFE A;  3N8R A;  3NIA A;  2H10 A;  1ZG4 A;  4KG5 A;  1SDE A;  2B5R A;  3OCL A;  2I72 A;  5BOH A;  1GHM A;  3S1Y A;  1WYC A;  4QD4 A;  3ZCZ A;  2HDU A;  4BJP A;  4HBU A;  3N8S A;  1L0D A;  4MLL A;  4X69 A;  5EVI A;  1NZU A;  1NY0 A;  3FKW A;  3HLE A;  2Y2N A;  2JBF A;  3ZHH A;  3V3R A;  3HUM A;  3ZG5 A;  4OKP A;  3NC8 A;  4KZA A;  4DDY A;  1K55 A;  1SHV A;  1YLP A;  5GL9 A;  1PW1 A;  4K91 A;  4UA6 A;  2IWC A;  4R4S A;  3IH9 A;  1NZO A;  2XEP A;  5A93 A;  4P6B A;  5CEB A;  3FV7 A;  3BEC A;  4XUZ A;  1JTG A;  4M3K A;  3VFH A;  1ES4 A;  3UY6 A;  2IWB A;  3PBT A;  2C6W B;  1NRF A;  4KZ3 A;  5CGW A;  2HDR A;  1Y54 A;  5F82 A;  2WK0 A;  4BEN A;  1PI4 A;  1VQQ A;  3OPL A;  3UDF A;  4PM9 A;  1KDS A;  4UHU A; 
#chains in the Genus database with same CATH topology
 4CLC B;  3MZE A;  4EEU A;  1FR1 A;  2INW A;  1PWC A;  2PYP A;  3Q81 A;  1BLC A;  3FPW A;  2BG1 A;  2Q9M A;  5IS1 A;  3MKE A;  2J9P A;  5GLA A;  4EU0 A;  1LSX A;  2XLN A;  2ZQ7 A;  2WAE A;  4PM7 A;  1VB6 A;  4S2N C;  4Y17 A;  3T4T A;  1MKM A;  4YIN A;  3I7J A;  1VET A;  5FI6 A;  4OP8 A;  2P9V A;  1G5U A;  1BLS A;  4Y0T A;  4C3Q A;  3EWK A;  2EFU A;  5EPH A;  3LR3 A;  4Y13 A;  2EXA A;  2W3D A;  4BL2 A;  5DKK A;  3LI9 A;  2EWV A;  4OH0 A;  3CPT B;  2A2L A;  4S2L A;  1MC0 A;  5C5K A;  3KO6 A;  3DWK A;  4EEP A;  2B95 A;  2ZD8 A;  3LUQ A;  5HX9 A;  3GRJ A;  2B18 A;  1JWP A;  3IXD A;  3LO7 A;  4KZ9 A;  2GNX A;  4GCZ A;  2FFF B;  4IED A;  3MS6 A;  5DKL A;  3O88 A;  2Y2Q A;  4PPR A;  2EWW A;  2VV7 A;  3KYE A;  4KZ7 A;  1IKI A;  2QPN A;  2JKR M;  2VGK A;  1BT5 A;  4KQD A;  1TF1 A;  2GX5 A;  4E3M A;  3WS4 A;  5KMW A;  4Z1W A;  3C5A A;  3CZD A;  4WEJ A;  4UA9 A;  3UB8 A;  2JCH A;  4BD0 A;  2O0Y A;  2WKQ A;  3EOI A;  3VP0 A;  1SKO B;  4R0Q A;  4E3I A;  1CEF A;  4JLF A;  3T4Q A;  3PBS A;  4KZ6 A;  3LR0 A;  2V8C A;  3NOU C;  3UPO A;  4HBT A;  1N9L A;  4E3J A;  4N9K A;  5E43 A;  4P87 A;  3O5Y A;  2LB5 A;  5EV0 A;  5HL6 A;  4BBV A;  3TJZ C;  3BLM A;  2XR0 A;  5AQA A;  4H6J B;  2PHY A;  2X01 A;  4G3K A;  2QZ6 A;  2WZX A;  2W27 A;  5MC7 A;  3E4O A;  3PAG A;  4HH3 A;  3S7Q A;  4WUJ A;  2QKP A;  1KGE A;  3D4F A;  4WBG A;  3A3J A;  3BQ8 A;  3DTE A;  3EQU A;  1BUL A;  4WZ5 C;  1NLY A;  1RGY A;  1XJ3 A;  4OVD A;  2V20 A;  3C7V A;  4KUK A;  1TD5 A;  2A24 B;  4O01 A;  3F1O A;  4U3T A;  2WGV A;  3FYZ A;  1CI9 A;  3HJI A;  5EM0 A;  5EVL A;  3AGE A;  1JNU A;  2V9A A;  4DDS A;  1YLT A;  3R7W A;  1G6O A;  4RX3 A;  1FCO A;  1HD8 A;  5DVA A;  5HDS A;  2QHK A;  3Q7V B;  2BLS A;  3PBN A;  5F69 A;  3Q07 A;  1TDG A;  3IX8 A;  2QJ5 A;  4E3O A;  2V1Z A;  1S1Y A;  2R9W A;  4GD8 A;  2KOI A;  1N9O A;  3H7W B;  3UB6 A;  3CMZ A;  3VOZ A;  1FOF A;  1H5X A;  3NHQ A;  1G28 A;  1H3Q A;  4UA7 A;  4MMN A;  1JTD A;  2ZQD A;  1ZC2 A;  2EXB A;  5CXW A;  4L9G A;  5IU1 A;  1XJ2 A;  4E3K A;  3HLB A;  2QWS A;  3TE8 A;  4BD1 A;  3N6I A;  5AVF A;  2W1T B;  4LV1 A;  3VE4 A;  4I5S A;  1RCJ A;  5DJT A;  1OT6 A;  4NET A;  4EQI A;  3PAE A;  4GLQ A;  1YQS A;  3MMH A;  4F94 A;  5HFO A;  5L8M A;  4LV0 A;  4JF6 A;  4GDB A;  5FAS A;  3HUN A;  1YPR A;  3WS5 A;  3ZQ5 A;  4PM8 A;  1K57 C;  4A5R A;  5GLD A;  1ZHH B;  5A91 A;  3MJQ A;  1XFQ A;  1F98 A;  4GS9 B;  4HH2 A;  4D2O A;  1SZV A;  4OPR A;  4E6X A;  3GTC A;  2Y55 A;  2OLV A;  2VGL S;  2Q0O A;  1SKO A;  4N1H A;  5IT5 A;  3WRZ A;  1QMF A;  3VP4 A;  1WA9 A;  5CHM A;  2M7V A;  1FSW A;  5FEF A;  3E4P A;  1ZTU A;  5FAO A;  4ZDX A;  2V2F F;  3E2L A;  5TJJ A;  3GVB A;  2VGL M;  5EFW A;  4MBK A;  4H6J A;  1K6R A;  1PRQ A;  1XGI A;  3D72 A;  3IHA A;  2H0Y A;  2O9A A;  4OON A;  4G3W A;  5EVI D;  2WKH A;  4BLM A;  1MWS A;  1IEM A;  5J3W A;  3T4L A;  3L9K A;  3CUE C;  4R6L A;  5J4E A;  2O99 A;  5F5Y A;  3MXS A;  2W3G A;  4ETZ A;  1K4E A;  2HP6 A;  1K56 A;  4Y2F A;  2OSU A;  5M18 A;  1MWU A;  2WYX A;  4WL9 A;  5FEG A;  3PHY A;  3QP5 A;  2GJ3 A;  1K0K A;  3PBQ A;  5EE8 A;  3S7P A;  1PWG A;  4HHD A;  5HL1 A;  1GHI A;  1YSQ A;  5KSH A;  4ARZ A;  4DRT A;  2H10 A;  5HSQ A;  3S1Y A;  1WYC A;  3F1O B;  3ICY A;  4QD4 A;  1TS7 A;  3N8S A;  4X69 A;  2VV8 A;  3DTK A;  5HWT A;  1ODV A;  3ZYT A;  1OJ5 A;  2LB9 A;  3FV7 A;  1DRM A;  1JTG A;  1ES4 A;  2IWB A;  3PBT A;  1T1C A;  2WK0 A;  2YKH A;  1KDS A;  1FCN A;  3VP2 A;  2VK3 A;  1S4R A;  1N9N A;  4EXO A;  1L0G A;  5FQJ A;  1LSW A;  2BAS A;  3QHY A;  1MKI A;  4BQM A;  4E04 A;  1T18 A;  4Y0O A;  1IYO A;  2ZMF A;  5JYO A;  2ZC6 B;  1E3U D;  2OLU A;  4FD8 A;  1ESU A;  1SKF A;  3OPR A;  1T19 A;  2J8Y A;  3G34 A;  4GKU A;  5FI7 A;  3IXG A;  4IVK A;  3IF5 A;  4DE0 A;  2P74 A;  3SS4 A;  3HUO A;  2W1R A;  2Y91 A;  3WS1 A;  5AJG A;  1IYS A;  1PNE A;  1VM1 A;  5HW3 A;  2VX8 A;  2EX9 A;  1K55 C;  2HDQ A;  5AVE A;  3MZD A;  2V1A A;  5EOE A;  4KUO A;  5DF7 A;  2QYB A;  1BLP A;  2PBY A;  5CED A;  3LY3 A;  3T1Q B;  5CHJ A;  1EWZ A;  1VEU B;  3G35 A;  4GHI B;  4M4X A;  3O87 A;  3FWL A;  2OAP 1;  4HES A;  3CWF A;  2WGI A;  3LI8 A;  3E2K A;  2IA2 A;  2Z2M B;  4N92 A;  3HL9 A;  2Z2L B;  1DJB A;  4X1M A;  1P9R A;  3C8C A;  3MF0 A;  3B47 A;  4HI4 A;  4PHT A;  3TRC A;  2VKS A;  1K6S A;  3PTE A;  1ERO A;  5TR7 A;  2A49 A;  4LRX C;  4MN5 A;  2ZMV A;  3BJN A;  4LGW A;  4JGQ A;  1TVF A;  3GV9 A;  4Q0J A;  5HD5 A;  5AQ7 A;  3V5M A;  3T4S A;  5DTS A;  1FCM A;  1L2S A;  4RX2 A;  1UGU A;  3GQZ A;  2ZC3 B;  2WKR A;  4LEN A;  5FI2 A;  1IYQ A;  5CGS A;  4L9E A;  2ZQ9 A;  1N4O A;  5TGF A;  4Q8I A;  3HVF A;  5I94 A;  3CHW P;  4D60 A;  1HVB A;  3OOV A;  4FH4 A;  4DF6 A;  2XGN A;  3QNC A;  2UWX A;  4CPK A;  3VFF A;  3UPP A;  1M40 A;  3HJK A;  3S4X A;  2Y2H A;  2EX8 A;  3OZH A;  4S2K A;  2OV5 A;  2H0T A;  5HDC A;  4KG6 A;  3E0Y A;  2V0W A;  3OPH A;  3CJM A;  5GHY A;  1ES2 A;  3CIT A;  4S2J A;  1HLU P;  3ZG7 B;  5HAI A;  1KE4 A;  3ZG9 B;  1ZG6 A;  4Y3I A;  3BWL A;  5EOO A;  1XX2 A;  2HV1 A;  4NKP A;  1D1J A;  5GHX A;  1MXO A;  3MR0 A;  3P09 A;  4HJ4 A;  3KSG A;  3A0R A;  4U0X A;  5AQB A;  1MWT A;  4WEK A;  3G6O A;  4LV2 A;  4K0W A;  3NOT C;  1U60 A;  5HAQ A;  2D02 A;  4EWF A;  3G31 A;  3ITB A;  3MFD A;  3QP8 A;  2HF6 A;  3NDE A;  4BMW A;  1X0O A;  3MXQ A;  1LSV A;  1Q2P A;  3F1P B;  1XXM A;  3M2J A;  3HLC A;  2EX2 A;  2VLG A;  4PKY A;  5E2H A;  5EVE A;  4DJ2 A;  5E2G A;  2XD1 A;  2Y2K A;  4CLC D;  2CMN A;  4QB8 A;  2Y2G A;  2ZLY A;  4NXB A;  5IHV A;  1IKG A;  4LCL A;  1ES5 A;  3K3C A;  4GS9 A;  5L2F A;  2W3F A;  2WUQ A;  4F3L B;  4OOY A;  3UB9 A;  4GN2 A;  5FQI A;  4Q0H A;  3E98 A;  1O07 A;  5DJU A;  2KX6 A;  3M2K A;  1V9Y A;  5G18 A;  5CEC A;  3UPN A;  5TBM B;  2KLI A;  4GDN A;  1IOU A;  1K25 A;  3GR2 A;  1I5Q A;  2M7U A;  5K5B A;  4EBP A;  2JKG A;  5FAP A;  1XP4 A;  2W0N A;  1MZU A;  2L1M A;  1ESI A;  1K57 A;  4XT2 B;  5A90 A;  1EI5 A;  2J80 A;  1RGZ A;  1LL8 A;  3BLS A;  3L7H A;  4WM9 A;  3MQO A;  5M19 A;  2E8I A;  2ZQC A;  3DTI A;  4BL3 A;  3A0V A;  2YKF A;  3HLD A;  2VGJ A;  3U4L P;  5L09 A;  1DP9 A;  4HY8 A;  4U0T A;  3W8K A;  4WF0 A;  3A3F A;  1GSV A;  2XFS A;  5KZH A;  1OTI A;  2Y2L A;  1P97 A;  3DWZ A;  4ZJ1 A;  4RQ9 A;  4L9F A;  4OPZ A;  2PAV P;  5E2F A;  3LIF A;  3D3O A;  1S67 L;  4ZRR A;  3UDX A;  1KGG A;  3A0S A;  3AGF A;  4KG2 A;  1W63 Q;  4QHC A;  1WYB A;  4OQ0 A;  2HP5 A;  5DFY A;  1W63 M;  4Z9Q A;  5FSR A;  3KYZ A;  1K54 C;  5GHZ A;  1H8Y A;  2O9B A;  4YOF A;  4QY5 A;  4R3J A;  5EUA A;  1GSX A;  5HD3 A;  5F1G A;  4L0L A;  3BY9 A;  4IVI A;  2WKE A;  2OOL A;  3Q82 A;  4DE2 A;  1FIL A;  2X02 A;  4Y15 A;  3QP1 A;  3SW1 A;  1PI5 A;  1S0W A;  3QNB A;  1E4D A;  2R78 A;  3ULF A;  3BRM A;  5M1A A;  3ZNY A;  1YLW A;  3NJA A;  1OT9 A;  5FQ9 A;  3UN7 A;  3UO9 A;  3P98 A;  3C4O A;  1V9Z A;  4HP4 A;  3OPP A;  2BTF P;  1ZG4 A;  2D01 A;  3OCL A;  1P9W A;  1L3L A;  3ZCZ A;  4MLL A;  1A0K A;  1NY0 A;  3HLE A;  2JBF A;  3V3R A;  3ZG5 A;  4OKP A;  4DDY A;  1K55 A;  1SHV A;  1YLP A;  1PW1 A;  4K91 A;  1TS8 A;  4UA6 A;  2IWC A;  2XRO A;  3IH9 A;  5A93 A;  5CEB A;  1XFN A;  4XUZ A;  3VFH A;  3UY6 A;  4IUH A;  4NXG A;  1VQQ A;  5FDS A;  4UHU A;  2HZ5 A;  3LIE A;  3GEC A;  2PU2 A;  1H8Z A;  1H0M A;  2ZQA A;  4GZB A;  3RH8 B;  1ERM A;  2VZW A;  4DE1 A;  5FQM A;  3HCY A;  4LV3 A;  2EFX A;  3SH8 A;  3RTY A;  1OJG A;  4CJN A;  1CK3 A;  3O3V A;  5F83 A;  4JF4 A;  4HEF A;  5FQK A;  3B33 A;  2JHE A;  4FH2 A;  5DTT A;  4B88 A;  5HDD A;  1J3W A;  3QP6 A;  5EM1 A;  3F1N B;  4DMZ A;  1Z6F A;  3E4Q A;  3NEC A;  2KDK A;  3A3I A;  3PBR A;  4Q0I A;  3UE3 A;  4XXR A;  2IWD A;  4GW9 A;  2HGV A;  3LCE A;  3S22 A;  3KSF A;  1FIK A;  2A24 A;  1NYY A;  3D9Y A;  4FSF A;  1XA7 A;  3O86 A;  1QME A;  4MBH A;  3FKV A;  3WRT A;  2XA7 S;  2ZC4 B;  1Z09 A;  1YMX A;  4NXE A;  2W1T A;  4EET B;  4GOG A;  5HAP A;  1STZ A;  4UQI S;  1TEM A;  5G4Y A;  1K4F A;  4QY6 A;  4LRZ E;  3OCN A;  3BQA A;  3T1R A;  1ONG A;  3LID A;  1TDL A;  2WGW B;  3IF6 C;  1T1A A;  3PBO A;  3T12 B;  1LT0 A;  3P7N A;  1MWR A;  2J3T C;  2NUT C;  5FDH A;  3HLG A;  1JWV A;  1KOU A;  3RFB A;  4OQI A;  3IWI A;  1F9I A;  3MKF A;  3IH8 A;  4ME4 A;  3ZGA B;  2HPB A;  1IEL A;  3W2Z A;  3WS0 A;  4EUZ A;  3MZF A;  4OOM A;  4KQQ A;  4UEY A;  4P6Z M;  3VSL A;  3TSG A;  4K0X A;  2PR5 A;  1D7E A;  3S7N A;  5L10 A;  1N9B A;  4E3N A;  1XJ4 A;  1W7F A;  2EX6 A;  2PD7 A;  1DP8 A;  2ZOH A;  4IBR A;  4YNR A;  2Y2J A;  5EEC A;  3LIB A;  4FTX A;  2NUP C;  4EW7 A;  2L0W A;  1NLZ A;  4IUK A;  4BBU A;  4JPM A;  2ZM2 A;  1L0F A;  4CLC E;  4KQR A;  3OBF A;  3UE1 A;  4S2O A;  4UQI M;  3LIA A;  4EV4 A;  4EER A;  4ID4 A;  2J3W A;  1G68 A;  4DXC A;  4DE3 A;  2RCX A;  1XJ6 A;  2DNS A;  4YWZ A;  5GLB A;  1Y4O A;  1GA9 A;  4R3B A;  1J9M A;  1MY8 A;  3NUL A;  4KZ5 A;  2M1C A;  5GLC A;  3T50 A;  2WKP A;  2HJE A;  1S66 L;  2PYR A;  1UWN X;  1PYY A;  1KDW A;  4EBN A;  2HP9 A;  2PT7 A;  3BY8 A;  2Z6C A;  3ITA A;  1YMS A;  3C7U A;  1OTE A;  4DXB A;  2V1B A;  1IYP A;  3IF6 B;  3C2W A;  2OWJ A;  4I3J A;  4NEE D;  1PW8 A;  3LR5 A;  1ONH A;  4MDZ A;  3MQ0 A;  4PAU A;  4YFM A;  4EES A;  3V39 A;  1BSG A;  1I2S A;  3T1X A;  1S1Z A;  1GCE A;  2GZA A;  3HBR A;  4ZTK A;  3IX3 A;  4HQA A;  3K2N A;  3ZVW A;  2P08 A;  1W79 A;  3VOL A;  3KX0 X;  2PU4 A;  3NY4 A;  3ZNT A;  4BBT A;  4QPR A;  3HLF A;  3UE6 A;  1SCW A;  4WEL A;  4PM6 A;  1CI8 A;  3K3D A;  3OC2 A;  1IFQ A;  3V67 A;  3UMD A;  3IWQ A;  2Y2P A;  1KE0 A;  1K56 D;  5CHU A;  1YLY A;  2XD5 A;  3F1N A;  1GSW A;  2Q9N A;  1PFL A;  2Y59 A;  4UAA A;  2WZZ A;  4C75 A;  4DN0 A;  1VEU A;  3B42 A;  3MBZ A;  2B02 A;  2VEA A;  5TBM A;  3CAX A;  3W4Q A;  2XH9 A;  4JXV A;  5FAQ A;  3CPT A;  3FZC A;  4B93 A;  3BFG A;  3LFV A;  2ZJ9 A;  2XA7 M;  2DCF A;  3T4K A;  1DJA A;  4FOF A;  4O0P A;  3W4O A;  4I39 A;  3VP1 A;  3MXR A;  5FAT A;  3W4P A;  1AWI A;  2Y2O A;  3ZDJ A;  5DF8 A;  5HPF A;  1GA0 A;  1FQG A;  2PDR A;  1BLH A;  4LRY C;  3DBA A;  4I3A A;  3ZFZ A;  2W3E A;  2FFY A;  4X25 A;  1CEG A;  4XT2 A;  3T4J A;  2Y8H A;  3KYQ A;  4QU3 A;  3JVV A;  1NWZ A;  4C6Y A;  2PBD P;  1E25 A;  4KZ8 A;  4MEZ A;  3NBL A;  1VET B;  3OLO A;  5D3O A;  1NYM A;  4ARZ B;  4R4R A;  1S6R A;  3NOP C;  3IXH A;  4RYE A;  1YLJ A;  5E2E A;  2Y4A A;  5I5L A;  3ZG8 B;  1DY6 A;  4NG2 A;  4E3L A;  3G4P A;  3VSK A;  5TFQ A;  1NJ4 A;  3NI9 A;  5J8X A;  4RA7 A;  5EVI B;  2XK1 A;  3RJU A;  3V50 A;  2XFT A;  3B3X A;  2ZQ8 A;  2ZBB A;  4O7D A;  2WAD A;  3Q7V A;  1SDN A;  3WS2 A;  2WKI A;  1HZO A;  1YT4 A;  4JXG A;  4NXF A;  5A92 A;  4X68 A;  3LEZ A;  3NDG A;  4FCF A;  3N8R A;  3NIA A;  5F6A A;  1SDE A;  4JGO A;  3CLO A;  2I72 A;  3LIC A;  2FZ0 A;  4HBU A;  1L0D A;  3UME A;  3FKW A;  2Y2N A;  1CF0 A;  3ZHH A;  3HUM A;  4KZA A;  5GL9 A;  5F68 A;  2XEP A;  2I9V A;  4M3K A;  5CGW A;  2C6W B;  1NRF A;  2HDR A;  3LR4 A;  4PM9 A;  3QP4 A;  2DRW A;  4OPY A;  5HZH A;  2G7U A;  4WYY A;  5CGX A;  1LHY A;  1OTD A;  4LCM A;  2L4R A;  3CUE A;  2MJ6 A;  3IQA A;  4IJG A;  4R3A A;  1YAX A;  3NCK A;  3H9W A;  4PMA A;  1LI0 A;  3EGX C;  4EBL A;  1WE4 A;  3BFD A;  4JGP A;  4ZBE A;  4BWI A;  1XGJ A;  3LY4 A;  3G32 A;  4WMC D;  4HNB A;  2VV6 A;  4IBX A;  3SS5 A;  2PD8 A;  2ZC5 B;  2G2U A;  3TOI A;  5A8B A;  2C5W B;  1LL9 A;  1L0E A;  5EVI C;  4HP9 A;  1XA1 A;  2XDM A;  3IBJ A;  4CLC A;  5JYP A;  4NK3 A;  4X1L A;  4JXS A;  2VA0 A;  4ZAM A;  2PR6 A;  3ZVT A;  2XQZ A;  1Q2Q A;  4HJ6 A;  4I38 A;  5CTN A;  2Y2I A;  1KGF A;  4E6W A;  3V3S A;  3MQQ A;  3N7W A;  3BEB A;  1BYW A;  1KVM A;  4MNR A;  4P6Z S;  1LLB A;  3HRE A;  3FG8 A;  3IHB A;  3VOY A;  4KZB A;  3UB7 A;  4QWO A;  4JKT A;  4JGR A;  2P9V B;  3CG5 A;  1PWD A;  3PXP A;  2O9C A;  4EUV A;  2QJ7 A;  1CQA A;  3P01 A;  3A3E A;  4LLO B;  4H8R A;  4ESP A;  3GMW A;  3G2Y A;  3DAV A;  3ZG0 A;  4HOI A;  2P04 A;  3G2Z A;  3WWX A;  4EQ1 A;  5FL3 A;  1T1B A;  3PYP A;  2CC1 A;  5HAR A;  3UB5 P;  3SZT A;  4GD6 A;  1BZA A;  2JKT M;  4B4X A;  1FSY A;  1KVL A;  2E8J A;  4N9L A;  4X55 A;  4R1G A;  1ERQ A;  4I3I A;  3JVU A;  3Q1F A;  1LL5 A;  2WAF A;  4GJ4 A;  3IS2 A;  1O7E A;  2EA9 A;  1YSP A;  3FPV A;  1ALQ A;  3H7W A;  4MN7 A;  2WGW A;  2Y2M A;  3KSH A;  3TG9 A;  3HLW A;  4HJ3 A;  3BM6 A;  5CRF A;  1MPL A;  2ZM0 A;  2A3U A;  1CJF A;  5L07 A;  3FC7 A;  2ZM8 A;  2PRF A;  2VJW A;  3RXX A;  5HPI A;  4PM5 A;  2H5S A;  3EEH A;  3SS3 A;  5HWW A;  5U47 A;  5FQQ A;  3C4P A;  1YLZ A;  2V8F A;  4WLA A;  3IF6 A;  3BW6 A;  3MSH A;  3C30 A;  3IS2 B;  3ISG A;  3SH7 A;  3U2A A;  4Y0U A;  1PZO A;  5FA7 A;  4OLD A;  3IBR A;  2AVX A;  3UE0 A;  1JVJ A;  4XUX A;  4WZ5 A;  4S2P A;  2XF3 A;  1BUE A;  2JC7 A;  3N4I A;  4OLG A;  1I2W A;  1M6K A;  1ES3 A;  1GHP A;  3VMA A;  2P7J A;  4OQH A;  1JWZ A;  4WMC A;  1PZP A;  3EQV A;  3Q7Z A;  1ACF A;  2V0U A;  5CTM A;  2K31 A;  3G30 A;  4JBF A;  4G3V A;  3VP3 A;  3R4K A;  1Y28 A;  2ACG A;  2J9O A;  2GDN A;  4X6T A;  1OTA A;  1YKD A;  4X53 A;  3SH9 A;  2RL3 A;  1FR6 A;  3LYX A;  5DF9 A;  1YM1 A;  1AXB A;  1C3B A;  3DW0 A;  2JN7 A;  1LI9 A;  4MCW A;  4LPZ A;  1TS0 A;  2HJ9 C;  2K7S A;  2ZMA A;  3M6B A;  1W8Q A;  4DKI A;  3BFC A;  1K38 A;  2HDS A;  2K2N A;  3IXB A;  1BTL A;  3BYD A;  3KSI A;  1XPB A;  5J7E A;  1W8Y A;  2H28 A;  3EGD C;  3N8L A;  2OWH A;  4OPQ A;  1KE3 A;  1F5M A;  4OP5 A;  1DP6 A;  3UNW A;  3GDI A;  5DTK A;  3AGD A;  4KEN B;  3VV4 A;  3BFF A;  1F2K A;  1HTZ A;  5G4Z A;  2JKR I;  4MBF A;  3T1S A;  1E3U A;  4LFU A;  2Z6D A;  4S2M A;  3EEA A;  4GB7 A;  3C38 A;  4S2I A;  5CER A;  4ZJ2 A;  2JE5 A;  4X56 A;  2J3T D;  4WN5 A;  2Y79 A;  4B4Z A;  1VHM A;  4HIA A;  3PR6 A;  1OME A;  4B9O A;  3IWO A;  4N1X A;  2R9X A;  4AFI A;  4F3L A;  3LGO A;  3GSG A;  1EW0 A;  4KZ4 A;  3RXW A;  1UWP X;  4R23 A;  5KIZ A;  3MFX A;  3QP2 A;  2XRN A;  4GNU A;  4WZ4 A;  2QMI A;  1RP5 A;  3IT9 A;  1MBL A;  2ZC7 A;  2JKF A;  3T4O A;  1P0Z A;  2X71 A;  4Y5F A;  5KSC A;  5AQ9 A;  1TS6 A;  3R7W B;  4JXW A;  4JF5 A;  5F1F A;  4CQH A;  4GHI A;  3M6H A;  4OQG A;  2UV0 E;  3JYI A;  2ZL1 B;  4P0M A;  3JPU A;  5LBR A;  4RVA A;  5CX7 A;  2ZL1 A;  1G6A A;  2G2W A;  4II7 A;  1PIO A;  4O8G A;  3SOI A;  2ZOI A;  2FH5 A;  4S2N A;  2XSS A;  4FUW A;  1H8M A;  2DMW A;  4Y7P A;  3DTM A;  5DFX A;  3UDI A;  1NXY A;  4KQO A;  4P85 A;  5HWV A;  1DJC A;  1W5D A;  1ZKJ A;  3A3D A;  1OPX A;  1XKZ A;  1K54 A;  4ZJ3 A;  3H82 B;  4QJG A;  2J7V A;  2OAQ 1;  4ETX A;  4OOL A;  3BFE A;  3F1P A;  4MN6 A;  1OTB A;  3S7O A;  3H82 A;  4PKY G;  4KG5 A;  2B5R A;  3IX4 A;  5BOH A;  3LEQ A;  3VE3 A;  4R38 A;  1GHM A;  4DJ3 A;  4IHQ A;  2HDU A;  4BJP A;  5EVI A;  1NZU A;  4CLC C;  4R70 A;  3NC8 A;  4K08 A;  1D06 A;  4R4S A;  2JKT I;  1NZO A;  4P6B A;  3BEC A;  1NRJ A;  3CI6 A;  3TW8 A;  4KZ3 A;  5F82 A;  1Y54 A;  4BEN A;  1PI4 A;  1S4S A;  3OPL A;  3UDF A;  2W3H A; 
#chains in the Genus database with same CATH homology
 2DRW A;  1FCN A;  4OPY A;  3VP2 A;  3MZE A;  4WYY A;  5CGX A;  1FR1 A;  2PU2 A;  1H8Z A;  1PWC A;  1L0G A;  5FQJ A;  1LHY A;  3Q81 A;  1MKI A;  2ZQA A;  3QHY A;  4GZB A;  1BLC A;  4BQM A;  2BG1 A;  1ERM A;  2Q9M A;  4LCM A;  4Y0O A;  4DE1 A;  1IYO A;  5JYO A;  2ZC6 B;  3IQA A;  5FQM A;  1E3U D;  2OLU A;  2EFX A;  3MKE A;  4FD8 A;  4LV3 A;  3SH8 A;  1ESU A;  3NCK A;  1SKF A;  2J9P A;  3OPR A;  2J8Y A;  5GLA A;  4PMA A;  1LI0 A;  4CJN A;  3G34 A;  1CK3 A;  3O3V A;  5F83 A;  4JF4 A;  2XLN A;  2ZQ7 A;  2WAE A;  4GKU A;  4HEF A;  5FI7 A;  1WE4 A;  3BFD A;  5FQK A;  4EBL A;  3IXG A;  4PM7 A;  4ZBE A;  4IVK A;  1XGJ A;  3IF5 A;  3LY4 A;  3G32 A;  4FH2 A;  4S2N C;  4DE0 A;  4WMC D;  4YIN A;  5DTT A;  2P74 A;  4B88 A;  3SS4 A;  3I7J A;  3HUO A;  5FI6 A;  4OP8 A;  2P9V A;  1Z6F A;  4IBX A;  3SS5 A;  2ZC5 B;  3TOI A;  2G2U A;  2C5W B;  1BLS A;  2Y91 A;  1LL9 A;  1L0E A;  3WS1 A;  3A3I A;  4C3Q A;  4Y0T A;  3PBR A;  1IYS A;  5EVI C;  1XA1 A;  3UE3 A;  4XXR A;  2IWD A;  2XDM A;  5JYP A;  4NK3 A;  4JXS A;  3LCE A;  4ZAM A;  1VM1 A;  2EFU A;  3S22 A;  3ZVT A;  5HW3 A;  5EPH A;  2XQZ A;  1Q2Q A;  2EXA A;  2EX9 A;  1K55 C;  2HDQ A;  1NYY A;  4BL2 A;  5CTN A;  3MZD A;  2Y2I A;  1KGF A;  4E6W A;  4FSF A;  4OH0 A;  5EOE A;  5DF7 A;  3V3S A;  1XA7 A;  1BLP A;  2PBY A;  3O86 A;  1QME A;  4S2L A;  5CED A;  3LY3 A;  3N7W A;  4MBH A;  3FKV A;  3BEB A;  3WRT A;  5CHJ A;  1EWZ A;  3DWK A;  1KVM A;  2ZC4 B;  3G35 A;  4MNR A;  1YMX A;  2ZD8 A;  3O87 A;  5HX9 A;  4GOG A;  3GRJ A;  3FWL A;  1LLB A;  5HAP A;  3HRE A;  4HES A;  2WGI A;  3IHB A;  4KZB A;  1TEM A;  3VOY A;  1JWP A;  3IXD A;  1K4F A;  3LO7 A;  4KZ9 A;  4QY6 A;  3E2K A;  2Z2M B;  4JKT A;  4N92 A;  3OCN A;  3HL9 A;  2Z2L B;  2P9V B;  1ONG A;  2FFF B;  1PWD A;  3CG5 A;  1DJB A;  1TDL A;  4IED A;  3A3E A;  2WGW B;  3IF6 C;  3O88 A;  2Y2Q A;  3PBO A;  4PPR A;  4H8R A;  3GMW A;  3G2Y A;  3ZG0 A;  1MWR A;  3G2Z A;  3WWX A;  4KZ7 A;  1IKI A;  1K6S A;  2QPN A;  5FDH A;  3HLG A;  2VGK A;  1JWV A;  1BT5 A;  3PTE A;  1ERO A;  2CC1 A;  5TR7 A;  5HAR A;  2A49 A;  4OQI A;  3IWI A;  4GD6 A;  1BZA A;  4B4X A;  3MKF A;  1FSY A;  1KVL A;  4E3M A;  3WS4 A;  3IH8 A;  3ZGA B;  2HPB A;  1IEL A;  3WS0 A;  4N9L A;  3C5A A;  3CZD A;  4X55 A;  4R1G A;  4EUZ A;  5KMW A;  3MZF A;  1ERQ A;  1TVF A;  3GV9 A;  4OOM A;  3Q1F A;  1LL5 A;  2WAF A;  4UA9 A;  4WEJ A;  5AQ7 A;  4KQQ A;  3VSL A;  1O7E A;  3TSG A;  3V5M A;  2JCH A;  4BD0 A;  4K0X A;  5DTS A;  3VP0 A;  1FCM A;  1L2S A;  1ALQ A;  4R0Q A;  4E3I A;  2WGW A;  4RX2 A;  1CEF A;  3GQZ A;  1N9B A;  4JLF A;  2Y2M A;  4E3N A;  1W7F A;  2EX6 A;  2ZC3 B;  3PBS A;  3HLW A;  3TG9 A;  4IBR A;  4KZ6 A;  3BM6 A;  3UPO A;  2Y2J A;  5CRF A;  1MPL A;  2ZM0 A;  4LEN A;  5EEC A;  5FI2 A;  1IYQ A;  4HBT A;  2A3U A;  4E3J A;  4N9K A;  5E43 A;  4P87 A;  5CGS A;  2ZQ9 A;  4JPM A;  2ZM2 A;  1N4O A;  3BLM A;  2ZM8 A;  1L0F A;  2XR0 A;  3RXX A;  5TGF A;  4Q8I A;  3HVF A;  4KQR A;  4PM5 A;  2H5S A;  5I94 A;  5AQA A;  2X01 A;  2QZ6 A;  1HVB A;  2WZX A;  3SS3 A;  5U47 A;  4FH4 A;  5FQQ A;  3UE1 A;  4DF6 A;  3PAG A;  3C4P A;  1YLZ A;  2XGN A;  3QNC A;  4S2O A;  3IF6 A;  4EV4 A;  2UWX A;  4CPK A;  4ID4 A;  3VFF A;  3ISG A;  3SH7 A;  1KGE A;  3D4F A;  4WBG A;  1G68 A;  3A3J A;  3EQU A;  4Y0U A;  4DXC A;  4DE3 A;  3UPP A;  1PZO A;  1BUL A;  1M40 A;  2RCX A;  4OLD A;  5FA7 A;  3S4X A;  4WZ5 C;  2Y2H A;  2EX8 A;  3OZH A;  4S2K A;  2DNS A;  2OV5 A;  3UE0 A;  1RGY A;  2H0T A;  5GLB A;  4OVD A;  1GA9 A;  4KG6 A;  4R3B A;  1J9M A;  1MY8 A;  4KZ5 A;  3OPH A;  1JVJ A;  2V20 A;  3C7V A;  5GLC A;  3CJM A;  4XUX A;  5GHY A;  1ES2 A;  4U3T A;  4WZ5 A;  4S2P A;  4S2J A;  2XF3 A;  1BUE A;  2JC7 A;  2WGV A;  3ZG7 B;  3N4I A;  5HAI A;  1KE4 A;  1PYY A;  4OLG A;  1KDW A;  3ZG9 B;  4EBN A;  1ZG6 A;  1I2W A;  1CI9 A;  3FYZ A;  1M6K A;  1ES3 A;  1GHP A;  3VMA A;  2HP9 A;  5EOO A;  4OQH A;  5EVL A;  1JWZ A;  3AGE A;  4WMC A;  1PZP A;  1XX2 A;  1YMS A;  3C7U A;  3EQV A;  3ITA A;  4DDS A;  3Q7Z A;  4DXB A;  5CTM A;  5GHX A;  1MXO A;  1IYP A;  1YLT A;  3G30 A;  4JBF A;  3P09 A;  3IF6 B;  4RX3 A;  4U0X A;  5AQB A;  1FCO A;  1MWT A;  3VP3 A;  1HD8 A;  4WEK A;  1PW8 A;  1ONH A;  4LV2 A;  4K0W A;  5DVA A;  2J9O A;  2GDN A;  4X6T A;  4YFM A;  1U60 A;  5HAQ A;  3Q7V B;  4EWF A;  4X53 A;  3G31 A;  2BLS A;  3ITB A;  3SH9 A;  3V39 A;  2RL3 A;  3MFD A;  3PBN A;  1BSG A;  1FR6 A;  1I2S A;  3Q07 A;  1TDG A;  1YM1 A;  5DF9 A;  1AXB A;  4E3O A;  3NDE A;  2V1Z A;  4GD8 A;  2R9W A;  1GCE A;  1C3B A;  3DW0 A;  3CMZ A;  1Q2P A;  3HBR A;  3VOZ A;  1FOF A;  1H5X A;  4ZTK A;  1LI9 A;  1XXM A;  3M2J A;  3HLC A;  4UA7 A;  2EX2 A;  1JTD A;  2ZQD A;  1ZC2 A;  2EXB A;  5CXW A;  2ZMA A;  3M6B A;  3ZVW A;  1W8Q A;  4DKI A;  5E2H A;  4E3K A;  5E2G A;  1W79 A;  2XD1 A;  3BFC A;  1K38 A;  2Y2K A;  2HDS A;  3HLB A;  3IXB A;  1BTL A;  2PU4 A;  3NY4 A;  3BYD A;  4QB8 A;  3ZNT A;  2Y2G A;  1XPB A;  1W8Y A;  4BD1 A;  3N6I A;  2ZLY A;  5IHV A;  3N8L A;  1IKG A;  4LCL A;  4LV1 A;  3HLF A;  1ES5 A;  4OPQ A;  1SCW A;  1RCJ A;  4WEL A;  1KE3 A;  4OP5 A;  5L2F A;  4PM6 A;  2WUQ A;  1CI8 A;  3OC2 A;  3UNW A;  5DTK A;  4OOY A;  3AGD A;  4KEN B;  3BFF A;  1HTZ A;  4GN2 A;  4NET A;  4EQI A;  3IWQ A;  5FQI A;  2Y2P A;  1KE0 A;  1O07 A;  3PAE A;  1K56 D;  1YQS A;  1YLY A;  5CHU A;  4MBF A;  1E3U A;  2XD5 A;  3M2K A;  5G18 A;  5CEC A;  4F94 A;  5HFO A;  4S2M A;  3UPN A;  2Q9N A;  4GB7 A;  2Y59 A;  4LV0 A;  4GDN A;  4JF6 A;  4GDB A;  4UAA A;  2WZZ A;  4C75 A;  5FAS A;  4S2I A;  1K25 A;  5CER A;  3GR2 A;  4ZJ2 A;  1I5Q A;  3HUN A;  2JE5 A;  3WS5 A;  4X56 A;  4PM8 A;  1K57 C;  3MBZ A;  4A5R A;  4B4Z A;  4EBP A;  5FAP A;  1OME A;  5GLD A;  3W4Q A;  1XP4 A;  3IWO A;  2XH9 A;  4JXV A;  5FAQ A;  4N1X A;  3FZC A;  2R9X A;  5A91 A;  3BFG A;  2ZJ9 A;  1ESI A;  1K57 A;  5A90 A;  3GSG A;  4KZ4 A;  3RXW A;  4D2O A;  4R23 A;  2DCF A;  4OPR A;  1DJA A;  1EI5 A;  4E6X A;  3W4O A;  3GTC A;  1RGZ A;  3VP1 A;  3BLS A;  2Y55 A;  2OLV A;  3MXR A;  4WM9 A;  4GNU A;  4WZ4 A;  5FAT A;  2QMI A;  4N1H A;  3W4P A;  1RP5 A;  2E8I A;  5M19 A;  3IT9 A;  2ZQC A;  3WRZ A;  4BL3 A;  1QMF A;  1MBL A;  2Y2O A;  3HLD A;  2ZC7 A;  2VGJ A;  3VP4 A;  3ZDJ A;  5CHM A;  2X71 A;  5KSC A;  1FSW A;  5DF8 A;  4U0T A;  1GA0 A;  1FQG A;  3W8K A;  1BLH A;  5AQ9 A;  3A3F A;  4JXW A;  3ZFZ A;  4JF5 A;  2XFS A;  5FAO A;  4ZDX A;  5KZH A;  2V2F F;  2Y2L A;  3E2L A;  5F1F A;  2FFY A;  1CEG A;  3GVB A;  4MBK A;  1K6R A;  3DWZ A;  3M6H A;  4OQG A;  4ZJ1 A;  1XGI A;  3IHA A;  3JYI A;  2H0Y A;  4OON A;  4OPZ A;  4P0M A;  5EVI D;  2WKH A;  5E2F A;  4BLM A;  4QU3 A;  1MWS A;  1IEM A;  4RVA A;  4C6Y A;  1E25 A;  3UDX A;  4KZ8 A;  1KGG A;  4MEZ A;  3NBL A;  1G6A A;  3AGF A;  4KG2 A;  3MXS A;  1WYB A;  4OQ0 A;  4QHC A;  2HP5 A;  2G2W A;  5D3O A;  1NYM A;  1PIO A;  4R4R A;  1S6R A;  3IXH A;  4Z9Q A;  4RYE A;  3SOI A;  5FSR A;  1K4E A;  1K54 C;  5GHZ A;  2HP6 A;  1H8Y A;  1K56 A;  1YLJ A;  4S2N A;  4QY5 A;  5E2E A;  2Y4A A;  4R3J A;  5EUA A;  2OSU A;  3ZG8 B;  5M18 A;  1DY6 A;  1MWU A;  4L0L A;  5F1G A;  2WYX A;  4Y7P A;  4E3L A;  3G4P A;  4IVI A;  3DTM A;  3VSK A;  5TFQ A;  1NJ4 A;  2WKE A;  3Q82 A;  4DE2 A;  3NI9 A;  3UDI A;  5J8X A;  4RA7 A;  1NXY A;  2XK1 A;  4KQO A;  5EVI B;  3RJU A;  4P85 A;  2X02 A;  3V50 A;  1PI5 A;  3PBQ A;  1DJC A;  2XFT A;  3B3X A;  5EE8 A;  1W5D A;  1S0W A;  1ZKJ A;  3A3D A;  3QNB A;  1E4D A;  2ZQ8 A;  1XKZ A;  4O7D A;  3BRM A;  2WAD A;  5M1A A;  1PWG A;  3Q7V A;  3ZNY A;  1SDN A;  5HL1 A;  1GHI A;  1K54 A;  1YLW A;  4ZJ3 A;  3WS2 A;  2WKI A;  5FQ9 A;  3UN7 A;  1HZO A;  1YT4 A;  4JXG A;  3UO9 A;  5A92 A;  3P98 A;  4QJG A;  2J7V A;  5KSH A;  3C4O A;  4X68 A;  3LEZ A;  3NDG A;  4DRT A;  4OOL A;  3OPP A;  4FCF A;  3BFE A;  3N8R A;  3NIA A;  2H10 A;  1ZG4 A;  4KG5 A;  1SDE A;  2B5R A;  3OCL A;  2I72 A;  5BOH A;  1GHM A;  3S1Y A;  1WYC A;  4QD4 A;  3ZCZ A;  2HDU A;  4BJP A;  4HBU A;  3N8S A;  1L0D A;  4MLL A;  4X69 A;  5EVI A;  1NZU A;  1NY0 A;  3FKW A;  3HLE A;  2Y2N A;  2JBF A;  3ZHH A;  3V3R A;  3HUM A;  3ZG5 A;  4OKP A;  3NC8 A;  4KZA A;  4DDY A;  1K55 A;  1SHV A;  1YLP A;  5GL9 A;  1PW1 A;  4K91 A;  4UA6 A;  2IWC A;  4R4S A;  3IH9 A;  1NZO A;  2XEP A;  5A93 A;  4P6B A;  5CEB A;  3FV7 A;  3BEC A;  4XUZ A;  1JTG A;  4M3K A;  3VFH A;  1ES4 A;  3UY6 A;  2IWB A;  3PBT A;  2C6W B;  1NRF A;  4KZ3 A;  5CGW A;  2HDR A;  1Y54 A;  5F82 A;  2WK0 A;  4BEN A;  1PI4 A;  1VQQ A;  3OPL A;  3UDF A;  4PM9 A;  1KDS A;  4UHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...