3WS5A

N288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (condition-2b)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
357
structure length
357
Chain Sequence
b'QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGQGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTQGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
molecule tags Hydrolase
total genus 118
structure length 357
sequence length 357
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ws5A00
3IHAA 3G31A 2H10A 3GMWA 4A5RA 3EQUA 1YLZA 4KZ8A 5DF7A 2VGKA 2XF3A 3C4PA 3ITAA 3TOIA 4LENA 3HL9A 1SDNA 3S4XA 1ALQA 3SH9A 4KG2A 1NYYA 4E3JA 2RCXA 1NXYA 3GSGA 4U0XA 3ZCZA 1K55C 4X55A 1LI0A 2Z2LB 1QMEA 3Q81A 3FV7A 4N9KA 4OPZA 4R3JA 3HREA 1VM1A 4DXCA 1BSGA 2X02A 4FH2A 4ZDXA 3FWLA 2WADA 4UA9A 1E3UD 1N9BA 2QPNA 3N4IA 3Q07A 3HLCA 3ZVTA 4FH4A 1KE3A 1BUEA 1ES5A 1OMEA 4XUZA 4DE0A 4EV4A 2VGJA 4PMAA 4PM5A 1PZOA 1IYOA 2Y2NA 1GHIA 4DE1A 1K4EA 2XEPA 3ZNYA 4MBFA 3S22A 1XA7A 3NY4A 1MXOA 3GV9A 5U47A 1FCNA 1N4OA 5HARA 4EUZA 3C7UA 1WYCA 1YLTA 5DF9A 4LCLA 4S2OA 5JYPA 4JXWA 4UAAA 3VFFA 1IYSA 3OPHA 1ZG4A 3O3VA 4X69A 2ZQDA 5EVID 1MWUA 5CTMA 3IF5A 5F82A 1K54A 4OONA 2WKHA 3Q7ZA 3WRTA 3C4OA 4QU3A 1YLWA 3UE0A 3VOYA 2HP6A 4CPKA 4WMCD 3IXDA 2J9PA 4JBFA 5CHUA 3BECA 5FI6A 5DTSA 1E25A 3CMZA 2Q9MA 3IWIA 2GDNA 3NBLA 1ES3A 3G2YA 2UWXA 4YFMA 1CEFA 3Q1FA 5TFQA 5JYOA 4OKPA 1LL5A 3PTEA 4RA7A 3PBNA 4P6BA 5GHXA 5HW3A 1YT4A 3HVFA 1TVFA 1FQGA 1PWCA 3ITBA 2A49A 3IXGA 4MBKA 5AQBA 3OCLA 3VFHA 4HESA 4WZ5C 2QMIA 2XDMA 3M2KA 3ZG9B 1PW8A 2Y2HA 3EQVA 3VSKA 4Q8IA 3O87A 4PM6A 4S2NA 3W4OA 3WS4A 4IEDA 2PBYA 3HUOA 1J9MA 1EWZA 4DKIA 4OQHA 3M2JA 1PI4A 2Q9NA 3GTCA 4JF6A 4E3NA 5FI7A 1MWRA 1NRFA 3GVBA 1MWTA 1S0WA 3LO7A 2G2WA 5FAQA 4S2NC 3ZVWA 2H0YA 3MBZA 2ZLYA 3V3SA 3C5AA 5EE8A 5GLDA 5KSHA 1PWDA 2HDSA 2P9VB 2Y2OA 1FOFA 3A3IA 2WGWA 2E8IA 3HUMA 4S2MA 1JWPA 5EOOA 3WS0A 1CI8A 1JTGA 3P98A 5HFOA 3UPOA 1ZC2A 4KG6A 2XQZA 3OZHA 4JXSA 5FQQA 3A3FA 3VP0A 3BFFA 5AQ7A 4Z9QA 1IEMA 1H8YA 1PWGA 1DJAA 5F1GA 2J8YA 1U60A 5FSRA 3OCNA 5HL1A 1JWZA 4MLLA 3IWOA 4LV0A 1K57A 2ZC5B 5KZHA 4ZBEA 1H8ZA 1AXBA 2H5SA 5DVAA 4JXVA 2BG1A 5BOHA 4QJGA 1FCOA 3SS3A 1LLBA 3CG5A 1KGEA 2XD5A 3BFGA 2Y91A 1WYBA 3PAGA 4FCFA 5D3OA 1CEGA 4QHCA 3GRJA 3TSGA 1K57C 3G4PA 3W4QA 5CHJA 3HLDA 4GB7A 2JCHA 4WEJA 1BT5A 3MXRA 3VP1A 3E2LA 1I2WA 2WGVA 4K0WA 3HLEA 5HAQA 1CI9A 2EX6A 3IXHA 4KQQA 1KGGA 1KE4A 4Y0OA 1QMFA 3WRZA 4X53A 2IWDA 4S2LA 1RGZA 4BQMA 2HP5A 3QNCA 3DWKA 3A3EA 2JE5A 3UO9A 2V20A 4OPYA 2JC7A 1YQSA 2FFFB 4R23A 4PM8A 1RGYA 3N7WA 5GLAA 5CGSA 1JWVA 2Y2GA 3P09A 3BFDA 2Y59A 1HTZA 5E2HA 4DF6A 3IXBA 4KZ7A 3MXSA 3GQZA 4QD4A 3DWZA 3IQAA 5FQMA 2Y2PA 4WELA 5EOEA 1W8QA 3BRMA 1YMXA 1Z6FA 2ZM8A 5CERA 2WKEA 3A3JA 2OLUA 2OV5A 2J7VA 2JBFA 2HPBA 3ZG5A 4KZ4A 1ERQA 5DF8A 4HBUA 2R9WA 1Y54A 3HLWA 4B4XA 1O07A 2ZC6B 5FAOA 1SHVA 1ERMA 4ID4A 1G68A 1W79A 1GHPA 3PBSA 4BLMA 1IKIA 4WZ5A 3HLFA 1Q2PA 4E3LA 5EUAA 4R3BA 3SOIA 1YLYA 1KDSA 5M18A 2ZQCA 1LI9A 3LCEA 2WKIA 3OPLA 4EBLA 4RVAA 4BJPA 2WK0A 3O86A 3N8SA 1L0EA 4KG5A 4OOMA 3ZG8B 1TEMA 4GD8A 4KQOA 4LV2A 1GCEA 1IELA 4LCMA 5FDHA 4JXGA 4BENA 2G2UA 2XLNA 5CHMA 4F94A 1DY6A 3AGEA 3G35A 3WS1A 4BL2A 4E3IA 4OVDA 2XK1A 3V50A 4Y0TA 3FKVA 4GN2A 2WAEA 2Y2IA 1SDEA 2H0TA 4C6YA 4E3OA 5CGXA 3IF6B 2ZMAA 2HDUA 2EFXA 3BFCA 3SS4A 4D2OA 4XUXA 1BZAA 1VQQA 2XR0A 3MFDA 3N6IA 2J9OA 4R1GA 1XKZA 2CC1A 1L0DA 1NJ4A 4OOLA 1W5DA 3IH9A 4BD1A 1PZPA 4P0MA 1HVBA 1XP4A 3VP3A 1JTDA 1GA0A 3OPPA 5TR7A 1G6AA 1M6KA 1XXMA 3D4FA 5GLCA 4E6WA 3Q82A 3W8KA 2Y2LA 4JF5A 5E2GA 1BTLA 3G30A 4FD8A 4O7DA 4KZ3A 5EVIB 4IBXA 3IT9A 3DTMA 5DTTA 1M40A 2Y2KA 4RX3A 2EFUA 3MZFA 3Q7VB 4KZ6A 4OQGA 3PAEA 4C75A 3VSLA 2WZZA 1I2SA 2OLVA 1ES4A 1TDGA 1KDWA 5A90A 3IF6C 1CK3A 2DRWA 2ZJ9A 3ZHHA 2P9VA 4X56A 3M6BA 4GDBA 3VP4A 3LY4A 3UDIA 1E4DA 2V1ZA 2WAFA 2WGIA 1FR6A 4EWFA 4MEZA 3V3RA 1KVLA 1JVJA 4BL3A 5FASA 2ZQ9A 5GHYA 5I94A 4UHUA 2XH9A 4UA7A 4X68A 4FSFA 2IWBA 2Y2JA 4WMCA 3HBRA 4S2KA 1H5XA 3NCKA 1TDLA 1Q2QA 3PBOA 3UDFA 1YM1A 1GA9A 4XXRA 2B5RA 1HZOA 5EVIC 4OOYA 3RJUA 1NY0A 1W8YA 5CXWA 4YINA 1XX2A 2RL3A 5EPHA 4OQ0A 5DTKA 1K6SA 4S2IA 4KZAA 4GKUA 3O88A 3MKEA 4JF4A 3G32A 1KE0A 2ZC3B 3WS5A 3HLGA 4IVIA 1NYMA 2Y4AA 3W4PA 1BLPA 2P74A 4MNRA 3PBRA 4GOGA 1BLSA 2WYXA 4NK3A 4LV3A 5E2EA 2EX9A 2ZC4B 5HAIA 5IHVA 5CTNA 1KGFA 1K4FA 2DCFA 3SS5A 4R4SA 3NI9A 5KSCA 1BLCA 5M1AA 4UA6A 5F1FA 4QY5A 4DE3A 1FSWA 3G2ZA 3PBTA 4DDSA 1KVMA 5FA7A 3NIAA 2XFSA 4OPRA 3BYDA 1I5QA 2HDRA 4CJNA 1PIOA 3HUNA 1K38A 4KZ5A 4N1HA 3IH8A 3ZDJA 3ZGAB 4ZTKA 5L2FA 2ZD8A 1ESUA 2WZXA 2Y2QA 4OH0A 3ZG7B 5M19A 4B4ZA 1WE4A 3JYIA 3OPRA 4DXBA 1L0FA 1PI5A 2WUQA 1EROA 1IYPA 1MPLA 3QHYA 3ISGA 1YLPA 2HP9A 1XGJA 4EBPA 2EXBA 3UPNA 3NDEA 4QY6A 3IWQA 1PYYA 1XGIA 5CGWA 5A91A 4DDYA 2BLSA 4NETA 1ZG6A 4KZBA 5J8XA 4JPMA 1XA1A 5E2FA 3WS2A 2DNSA 1EI5A 2ZM2A 3C7VA 3A3DA 4X6TA 5FQIA 4R4RA 5CEBA 5GLBA 5E43A 3MZDA 2ZQ7A 3SH7A 4HEFA 3N8LA 5FQJA 2XFTA 4BD0A 3MKFA 1K56A 2Y2MA 1MKIA 4N92A 4E3MA 5A92A 4LV1A 4WBGA 1ZKJA 5KMWA 1ONHA 3OC2A 1DJCA 1FR1A 4HBTA 4PM9A 2FFYA 2PU4A 2R9XA 2C5WB 3QNBA 4KZ9A 5G18A 5GHZA 3RXXA 3G34A 3M6HA 5TGFA 3UE3A 3BEBA 5FAPA 4KQRA 2EX8A 1MWSA 1ONGA 4H8RA 4GD6A 3UN7A 4R0QA 3VMAA 2OSUA 4E3KA 3ZNTA 2HDQA 3I7JA 4DE2A 4Y0UA 5AQAA 5A93A 3AGFA 4IBRA 2EX2A 1MY8A 5CRFA 1K54C 1L0GA 3NC8A 5GL9A 2IWCA 3HLBA 1FSYA 4ZJ3A 1IKGA 4OLGA 3UDXA 3NDGA 4GDNA 4JLFA 3CZDA 2ZM0A 1E3UA 2ZQAA 2C6WB 2Z2MB 5CEDA 1BLHA 3V39A 4GNUA 4K0XA 3IF6A 3WWXA 2ZC7A 2ZQ8A 4M3KA 4RX2A 4QB8A 1IYQA 2WGWB 3RXWA 3BLSA 4B88A 1RP5A 2XGNA 5EVLA 3CJMA 3V5MA 1K6RA 3LY3A 3IHBA 4OLDA 4EBNA 2Y55A 5FQKA 1PW1A 3PBQA 1SCWA 3N8RA 4K91A 1NZOA 4ZAMA 4N1XA 3GR2A 1C3BA 1W7FA 4C3QA 3SH8A 3ZG0A 4OQIA 3UPPA 1YLJA 4E6XA 3S1YA 5FATA 3BM6A 4WYYA 4P85A 5FQ9A 3BLMA 1SKFA 1ES2A 4S2PA 2XD1A 3FKWA 2EXAA 2I72A 2V2FF 4WZ4A 1K25A 1HD8A 5EVIA 1FCMA 1LL9A 4U0TA 1MBLA 3AGDA 4N9LA 4P87A 4WEKA 5F83A 4GZBA 3E2KA 5HAPA 2X01A 3B3XA 4S2JA 3Q7VA 2PU2A 3UE1A 3UNWA 4DRTA 4MBHA 4WM9A 4OP8A 4Y7PA 1LHYA 5EECA 4PM7A 1NZUA 1YMSA 5HX9A 4KENB 4L0LA 4RYEA 2A3UA 4EQIA 3BFEA 4PPRA 2QZ6A 1S6RA 1ESIA 3MZEA 4OP5A 3FZCA 4U3TA 4OPQA 4IVKA 1DJBA 3DW0A 5FI2A 3VP2A 4ZJ1A 1K56D 4ZJ2A 3UY6A 1XPBA 3TG9A 2X71A 1GHMA 1O7EA 3FYZA 3LEZA 1BULA 1L2SA 4JKTA 3VOZA 3ZFZA 1K55A 5AQ9A 1RCJA 5CECA
chains in the Genus database with same CATH superfamily
1YKDA 3IHAA 3G31A 2H10A 4MN6A 3GMWA 4A5RA 1NLZA 5DF7A 3T12B 2VGKA 2XF3A 3C4PA 3TOIA 4LENA 3HL9A 4LFUA 3NULA 1NYYA 4KUOA 1NXYA 3GSGA 3H82B 1K55C 4N9KA 1VETB 3Q81A 4R3JA 4Y2FA 1BSGA 2X02A 4ZDXA 4IJGA 3GDIA 3N4IA 3FPVA 1BUEA 1OMEA 4DE0A 2VGJA 1PZOA 1IYOA 1NWZA 5TBMB 1K4EA 1XA7A 5U47A 1FCNA 3L7HA 3MFXA 4ARZB 1XFQA 3C7UA 4S2OA 4UAAA 3P7NA 3VFFA 4B9OA 3B33A 5EVID 4FTXA 4NXBA 2O9AA 3WRTA 2WKHA 3Q7ZA 1V9YA 3KSGA 3UE0A 2HP6A 5HD5A 4WMCD 5CHUA 3BECA 3JVUA 1FILA 5FI6A 3CMZA 2Q9MA 3F1PB 1CEFA 4YFMA 5JYOA 3PBNA 4EQ1A 1S1YA 1FQGA 5J3WA 3TE8A 3OCLA 1G28A 4WZ5C 2XDMA 1PW8A 4PM6A 2A2LA 2PBYA 4HNBA 4HHDA 1J9MA 5K5BA 1PI4A 3DBAA 2PYPA 1J3WA 3GVBA 1NRJA 4MCWA 3ZVWA 5EE8A 1OT6A 5GLDA 2HDSA 1FOFA 3A3IA 2WGWA 4S2MA 1MKMA 1JTGA 5HFOA 1ZC2A 3C38A 3A3FA 4DJ3A 1H3QA 4RQ9A 3IX3A 2V8FA 3OCNA 4MLLA 3C30A 3IWOA 4H6JA 4LV0A 3LGOA 3CAXA 1AXBA 4JXVA 2BG1A 4QJGA 3O5YA 2QHKA 3SS3A 2VA0A 2P08A 1K57C 3W4QA 4QWOA 5CHJA 4Y3IA 1BT5A 3MXRA 2J3TC 1T1BA 1I2WA 4K0WA 1IOUA 4KQQA 3E4PA 1KGGA 4Y0OA 3T4TA 4NXFA 4WF0A 3T4KA 4JGRA 3DWKA 2Y8HA 2VEAA 4WN5A 3W2ZA 2V20A 2JC7A 1RGYA 3P09A 5HDCA 3IXBA 2VV8A 4QD4A 3IQAA 3ZYTA 5EOEA 2WKEA 3LR3A 3ZG5A 4KZ4A 1ERQA 4EETB 3LICA 1Y54A 3HLWA 2ZC6B 5FAOA 4O01A 1ERMA 4ID4A 1W79A 1IKIA 3GECA 4R3BA 4Q0HA 4EESA 2WKIA 2OWHA 5F68A 4BJPA 4GHIB 4KQOA 1GCEA 4MDZA 2G2UA 1OTBA 4BL2A 1XJ3A 3AGEA 1P0ZA 3BY8A 1SDEA 2H0TA 4C6YA 3IF6B 2HDUA 3IX4A 4I3IA 5IU1A 2J9OA 1XKZA 2CC1A 4BMWA 4P0MA 1GA0A 2W27A 1M6KA 3D4FA 5GLCA 4E6WA 1T1CA 5DFXA 1M40A 2Y2KA 4RX3A 3MZFA 1S4RA 4BBVA 3PAEA 1G5UA 3VSLA 1I2SA 3IBRA 5A90A 3IF6C 1CK3A 3KSIA 1OTEA 4X56A 3VP4A 3P01A 2W3DA 1DRMA 2V1ZA 5HWTA 3V3RA 2ZQ9A 5J7EA 2V1BA 4FSFA 2Y2JA 2IWBA 4L9GA 1TDLA 1Q2QA 1YM1A 4R70A 2JKTI 1HZOA 4OOYA 1W8YA 5CXWA 5EPHA 4OQ0A 1K6SA 4KZAA 3O88A 2PT7A 4NEED 3LI9A 1KE0A 2ZC3B 4IVIA 2B02A 3BJNA 1BLPA 2P74A 4HIAA 4MNRA 3PBRA 1BLSA 2HJEA 2ZC4B 2DCFA 3SS5A 4QY5A 4DE3A 3G2ZA 1XJ6A 4JGQA 1T19A 4P6ZM 4CJNA 1PIOA 4KZ5A 4N1HA 3IH8A 3KYZA 2XRNA 2Y2QA 5M19A 3JYIA 3OPRA 4DXBA 2PAVP 4I38A 1LT0A 4JPMA 3IX8A 2DNSA 2ZM2A 3A3DA 4UEYA 5CEBA 2ZQ7A 5HSQA 5FQJA 5HPFA 2XFTA 5L10A 5A92A 4LV1A 2ZOHA 1FR1A 2J3TD 2R9XA 4KZ9A 5GHZA 3RXXA 3QP8A 3UE3A 2K31A 3BEBA 5HDDA 2NUTC 4IBRA 1L0GA 3PR6A 2IWCA 4JGPA 3HLBA 1FSYA 3UDXA 2A24A 3NDGA 5L09A 5FL3A 4GDNA 1UWNX 2ZQAA 2J3WA 2P7JA 5CEDA 1OTIA 3K2NA 3WWXA 4WUJA 4RX2A 2WGWB 3RXWA 3BLSA 4B88A 4CLCA 2XGNA 4Q0JA 1K6RA 1W7FA 5HZHA 4WYYA 3BLMA 4S2PA 2ACGA 4H6JB 4U0TA 1LL9A 1MBLA 2YKHA 5AVFA 3UNWA 4DRTA 2L1MA 4WM9A 4Y7PA 4R3AA 1LHYA 2V0UA 1YMSA 4L0LA 3BFEA 3FZCA 4IVKA 4ETZA 3DW0A 3T1XA 1K56D 2O9BA 3UY6A 1EW0A 2X71A 1GHMA 2OWJA 5AQ9A 3UMEA 1OJGA 1YLZA 4KZ8A 3ITAA 1SDNA 4IUHA 4U0XA 4X55A 4HOIA 2Z2LB 2EA9A 2W3HA 3HREA 1VM1A 4DXCA 4WL9A 3MR0A 1E3UD 1N9BA 2QPNA 3KX0X 1KE3A 4PM5A 2XEPA 3IS2A 3GV9A 1N4OA 4EUZA 1WYCA 3DTKA 5JYPA 1LSVA 3R7WA 2O99A 1ZG4A 4X69A 1MWUA 3IF5A 5F82A 1K54A 1ZTUA 2V9AA 4OONA 1YLWA 3IXDA 2HGVA 3KSFA 1W63Q 1YPRA 5FDSA 3Q1FA 2V1AA 4OKPA 4RA7A 2VLGA 3KYQA 3S7OA 1PWCA 2A49A 3IXGA 5AQBA 3M2KA 2G7UA 3EQVA 3VSKA 5TJJA 2R78A 3LI8A 5LBRA 4S2NA 3W4OA 3WS4A 4OQHA 3M2JA 3GTCA 4JF6A 2OAQ1 3C2WA 1S0WA 2XA7M 4I3AA 1Y28A 2E8IA 3HUMA 5EOOA 3LIFA 2PD7A 3QP2A 5FQQA 1OJ5A 3VP0A 4L9EA 2K2NA 2JHEA 5HL1A 1JWZA 1UWPX 2ZC5B 1H8ZA 5DVAA 5BOHA 1S1ZA 3BFGA 1WYBA 4II7A 4FCFA 3NOPC 3S7QA 3JPUA 3VOLA 3HLDA 4GB7A 3VP1A 2HV1A 2O0YA 2WGVA 3HLEA 2EX6A 1RGZA 5HL6A 5AJGA 2JE5A 3LIDA 3UO9A 2JKRI 1YQSA 2FFFB 2VJWA 3N7WA 5CGSA 1JWVA 2E8JA 3BFDA 2Y59A 1HTZA 5EM1A 4DF6A 5HPIA 4K08A 3DWZA 3T4QA 3BRMA 1YMXA 1Z6FA 5HD3A 1LSWA 1SKOA 1T1AA 4NKPA 2OV5A 2JBFA 2HPBA 2HJ9C 4HY8A 4HBUA 3QP5A 2QKPA 4B4XA 1L3LA 1G68A 2JKGA 1GHPA 4BLMA 3HLFA 1Q2PA 3OPLA 4FOFA 1H0MA 4OOMA 3ZG8B 2QWSA 1IELA 4JXGA 2A24B 4BENA 4PKYG 5CHMA 4E3IA 4OVDA 2Z6CA 2XK1A 4BWIA 3FKVA 2WAEA 1YSQA 5CGXA 2ZMAA 3RFBA 3BFCA 3QP1A 3SS4A 1S4SA 4XUXA 3MFDA 4CLCB 2XR0A 3UB7A 3N6IA 4OOLA 5CX7A 1JTDA 2H28A 3OPPA 1XXMA 1S66L 1DP6A 3Q82A 4JF5A 2GNXA 1BTLA 4IBXA 3CHWP 2VK3A 3NOUC 2OLVA 1ES4A 1KDWA 3B42A 2ZJ9A 1YSPA 4GDBA 4CLCC 2WAFA 2WGIA 1FR6A 3K3CA 1KVLA 3PXPA 3FPWA 1JVJA 5FASA 4LRZE 4WMCA 3PBOA 4FUWA 3UDFA 4HJ4A 3RJUA 1NY0A 4S2IA 3MKEA 2XSSA 5FEGA 3RTYA 5HAIA 5IHVA 5MC7A 4R4SA 3ICYA 3NI9A 5G4ZA 5F1FA 3E4QA 2PR6A 5FA7A 2GJ3A 2GX5A 1PRQA 4O0PA 3BYDA 3NECA 1K38A 3ZDJA 3ZGAB 5L2FA 3IS2B 3LIEA 4IHQA 3EGDC 4EERA 1EROA 1IYPA 5F5YA 3V67A 3R7WB 1XGJA 3UPNA 2O9CA 1TF1A 4QY6A 4PKYA 4DDYA 2BLSA 1ZG6A 1A0KA 2W3FA 1XA1A 5DKLA 4Y15A 4EW7A 3MZDA 3SH7A 4BD0A 4E3MA 5DFYA 2WKQA 5KMWA 1ZKJA 3OC2A 4PM9A 2PU4A 3QNBA 1OTDA 4KQRA 1MWSA 4GD6A 2KOIA 2OSUA 4E3KA 4DE2A 3AGFA 2EX2A 1K54C 3CLOA 5F69A 3TJZC 4EU0A 4ZJ3A 2VKSA 1HLUP 5AVEA 2ZM0A 1UGUA 1BLHA 3V39A 4GNUA 2ZC7A 2ZQ8A 1IYQA 2MJ6A 3V5MA 3LY3A 4EBNA 2Y55A 4N1XA 4C3QA 3ZG0A 3VV4A 5FQ9A 2D01A 3H7WA 1SKFA 5L8MA 2Q0OA 3RH8B 1K25A 1FCMA 2HF6A 4DMZA 4WEKA 4GZBA 4HP4A 2X01A 3B3XA 3Q7VA 4OP8A 3VE4A 4PM7A 2DMWA 5HX9A 4KENB 2A3UA 1VHMA 4PPRA 4EQIA 3MZEA 4U3TA 1ESIA 1OPXA 4X1LA 4I3JA 4GJ4A 3EWKA 5FI2A 2JKFA 4ZJ2A 1XPBA 2Z6DA 4GS9A 3C8CA 1K55A 1RCJA 2HZ5A 5EM0A 5A8BA 3E98A 4AFIA 1ALQA 2RCXA 1LI0A 4OPZA 1QMEA 5F6AA 4FH2A 4KQDA 3FWLA 3K3DA 4IUKA 1SKOB 3Q07A 3HLCA 4FH4A 1ES5A 3T50A 4PMAA 1VB6A 1GHIA 3S22A 4G3KA 1MXOA 1DP8A 3MJQA 1YLTA 4HP9A 4LCLA 2D02A 4LRYC 2ZQDA 3SW1A 5CTMA 2YKFA 1TS6A 2M7UA 3C4OA 3VOYA 4CPKA 4JBFA 5DTSA 3IWIA 2GDNA 1ES3A 3G2YA 3R4KA 2UWXA 4MMNA 5TFQA 1LL5A 1S67L 4X25A 4P6BA 1YT4A 3HVFA 2QJ7A 1X0OA 3ZG9B 2WKPA 4Q8IA 4IEDA 3HUOA 1EWZA 3FC7A 4DKIA 4E3NA 4LRXC 3KSHA 3C5AA 5KSHA 3WS0A 1JWPA 1CI8A 4P6ZS 2XQZA 3NOTC 3BFFA 5AQ7A 4Z9QA 1IEMA 1PWGA 2J8YA 5FSRA 1K57A 3D9YA 5KZHA 4ZBEA 1FCOA 1SZVA 1LLBA 3CG5A 2XD5A 3BW6A 5D3OA 1CEGA 4QHCA 4HQAA 3GRJA 3TSGA 1OT9A 4BBTA 3LIBA 1D06A 4DN0A 1CI9A 2KDKA 3NJAA 3WRZA 3UB8A 4X53A 1F9IA 2IWDA 4S2LA 4O8GA 3QNCA 1STZA 2ZL1A 3UB9A 4R23A 4PM8A 5GLAA 2UV0E 2W3EA 3GQZA 2Y2PA 4WELA 5CERA 1PNEA 2OLUA 2J7VA 5DF8A 2R9WA 1ACFA 4ME4A 4WLAA 4CLCE 1TD5A 1VEUA 4XT2A 2PR5A 5EUAA 1YLYA 1KDSA 1LI9A 3LCEA 4EBLA 4RVAA 2WK0A 3O86A 3N8SA 1L0EA 4X1MA 3SZTA 1TEMA 4LV2A 1F2KA 4LCMA 1Y4OA 4F94A 1H8MA 2ZBBA 3G35A 3V50A 4Y0TA 3EOIA 3PYPA 2EFXA 1BZAA 1VQQA 4R1GA 1L0DA 1NJ4A 2FZ0A 3IH9A 2L0WA 1HVBA 1LSXA 5TR7A 3H7WB 2Y79A 3W8KA 1GSWA 2Y2LA 2ZMFA 3CUEA 1P9WA 3DTMA 5DTTA 3Q7VB 4KZ6A 4F3LA 4C75A 4EXOA 4B93A 2DRWA 2P9VA 2PBDP 3CPTA 4EWFA 3MQOA 2EWVA 5GHYA 3MMHA 4I5SA 2XH9A 4UA7A 4UHUA 4X68A 3UE6A 3HBRA 4BBUA 4S2KA 4QPRA 3S7PA 1H5XA 3NCKA 4GS9B 1GA9A 1N9OA 4JGOA 4GKUA 3WS5A 4ETXA 3HLGA 4GOGA 2EX9A 5CTNA 1KGFA 3QP6A 3A0RA 3T4JA 1BLCA 4UA6A 1KVMA 2XFSA 1I5QA 2HDRA 3EEHA 1ESUA 2KLIA 2WZXA 4OH0A 3BQ8A 1MC0A 3HJKA 2BTFP 1PI5A 2WUQA 1MPLA 3ISGA 1V9ZA 1YLPA 2HP9A 4EBPA 5CGWA 5A91A 3DTEA 2B95A 4KZBA 5C5KA 5J8XA 5E2FA 2XA7S 4UQIM 1EI5A 3MQ0A 5FQIA 3C7VA 1T18A 2AVXA 4NXGA 3H9WA 4R4RA 5GLBA 2PD8A 2M1CA 4HEFA 3S7NA 2Y2MA 1MKIA 4N92A 2PYRA 5IS1A 1ONHA 1DJCA 3CI6A 2C5WB 5I5LA 3G34A 4H8RA 1ONGA 3UN7A 3VMAA 3TRCA 4R38A 3ZNTA 2HDQA 3UMDA 5AQAA 5A93A 5CRFA 3NC8A 5GL9A 5DJUA 5EV0A 2IA2A 4OLGA 2K7SA 2PDRA 4JLFA 2LB5A 3B47A 3LR4A 5EVLA 3CJMA 4OLDA 5FQKA 1JNUA 3PBQA 3N8RA 5IT5A 3E0YA 3SH8A 4E6XA 3S1YA 5FATA 3BM6A 5HWWA 4P85A 2FH5A 2XD1A 4WZ4A 2I72A 1F5MA 1W63M 5EVIA 5EVEA 5F83A 3ULFA 3AGDA 4N9LA 1P9RA 5J4EA 4S2JA 4HI4A 2PU2A 2VGLM 4PHTA 3LIAA 5KIZA 5EECA 1NZUA 1S6RA 1BYWA 4OP5A 1DP9A 4GLQA 2W1RA 4UQIS 3T1QB 3TG9A 4JKTA 3FYZA 3LEZA 1BULA 1L2SA 3VOZA 1P97A 3MS6A 5CECA 2ZL1B 5L07A 3EQUA 4Y17A 4HH3A 3MXQA 2XROA 4G3WA 3S4XA 3SH9A 4KG2A 4E3JA 2PRFA 3ZCZA 1ZHHB 3F1OA 3UB6A 3FV7A 5DJTA 3OOVA 2WADA 4UA9A 2M7VA 3ZVTA 4XUZA 4EV4A 3NHQA 3VE3A 4HJ3A 2Y2NA 4DE1A 1ODVA 3ZNYA 4MBFA 4LLOB 2GZAA 3NY4A 1FIKA 1NLYA 2WKRA 5HARA 1VEUB 4XT2B 5DF9A 2PHYA 4JXWA 1IYSA 3OPHA 3O3VA 4YNRA 2INWA 4QU3A 3MF0A 4I39A 3T1RA 2J9PA 1E25A 3NBLA 2ZMVA 2VGLS 1G6OA 3PTEA 2V0WA 2W1TA 5GHXA 3LUQA 3D72A 5HW3A 1TVFA 3LYXA 2J80A 3ITBA 1XFNA 4MBKA 3VFHA 4YWZA 4HESA 4D60A 2QMIA 4EUVA 2Y2HA 3O87A 3OLOA 2Q9NA 4PAUA 1CQAA 5FI7A 2JKRM 1MWRA 1NRFA 4HJ6A 1MWTA 1TS0A 3LO7A 2G2WA 5FAQA 4S2NC 4F3LB 2H0YA 3MBZA 2ZLYA 3V3SA 3EEAA 1PWDA 2P9VB 2Y2OA 3PHYA 3F1NA 2ZOIA 3CPTB 3P98A 3UPOA 4KG6A 3OZHA 3LR5A 4JXSA 1H8YA 1DJAA 5F1GA 1U60A 3CUEC 4Z1WA 4M4XA 2H5SA 3PAGA 1KGEA 2Y91A 4E04A 3A0VA 3G4PA 2QJ5A 3L9KA 2JCHA 4WEJA 3U2AA 3E2LA 5HAQA 4Q0IA 3CITA 3IXHA 1KE4A 1QMFA 3QP4A 2W0NA 1IFQA 3UB5P 4BQMA 2HP5A 2I9VA 3FG8A 3A3EA 4OPYA 4MN5A 5FEFA 3BY9A 1TS8A 2Y2GA 3TW8A 3E4OA 3H82A 5E2HA 1VETA 4KZ7A 3MXSA 4CLCD 3IBJA 1AWIA 5FQMA 1W8QA 1XJ4A 2ZM8A 5EFWA 2W3GA 3A3JA 1N9NA 1MZUA 5TBMA 5HDSA 1O07A 1SHVA 4ARZA 3PBSA 1PFLA 4WZ5A 4E3LA 3SOIA 5M18A 2ZQCA 2VX8A 4EEUA 5HWVA 5DKKA 2EWWA 4KG5A 4GD8A 5FDHA 3OBFA 2XLNA 1DY6A 2CMNA 3WS1A 3F1PA 4GN2A 3BWLA 2Y2IA 3EGXC 4E3OA 4D2OA 1W5DA 4BD1A 1PZPA 3LEQA 4GCZA 1XP4A 3VP3A 1G6AA 3HCYA 2VZWA 1WA9A 5E2GA 3T1SA 3G30A 1LL8A 4FD8A 4O7DA 4KZ3A 5EVIB 3IT9A 2EFUA 4OQGA 2WZZA 1TDGA 4EEPA 4MN7A 3ZHHA 3M6BA 3MQQA 1CJFA 3LY4A 3UDIA 1E4DA 1TS7A 1YAXA 4MEZA 2OAP1 3U4LP 4BL3A 5I94A 1XJ2A 4R6LA 4XXRA 2B5RA 5EVIC 4YINA 1XX2A 2RL3A 1D1JA 3BQAA 5DTKA 4JF4A 3G32A 3DTIA 1NYMA 2Y4AA 3W4PA 3F1OB 2WYXA 2BASA 4NK3A 4Y5FA 4LV3A 5E2EA 4KUKA 3LR0A 4NXEA 1K4FA 3KO6A 5KSCA 5M1AA 1FSWA 3PBTA 4DDSA 1Z09A 3NIAA 4OPRA 5G4YA 1N9LA 3HUNA 4LPZA 4ZTKA 2ZD8A 3ZG7B 4HH2A 4B4ZA 1WE4A 1L0FA 3QHYA 2EXBA 3MSHA 1F98A 3NDEA 3IWQA 1PYYA 1XGIA 2L4RA 4NETA 3DAVA 3T4LA 4NG2A 2NUPC 3WS2A 4X6TA 2B18A 5E43A 2VV6A 3N8LA 3MKFA 1K56A 4WBGA 2W1TB 4HBTA 2FFYA 2JKTM 5G18A 3A0SA 3M6HA 5TGFA 5FAPA 3JVVA 2EX8A 3G6OA 3ZQ5A 4R0QA 1K0KA 3CWFA 4DJ2A 3I7JA 4Y0UA 1D7EA 4GHIA 1MY8A 1IKGA 1CF0A 2KX6A 1GSXA 1OTAA 3CZDA 1E3UA 2C6WB 2Z2MB 3LFVA 4K0XA 3IF6A 4M3KA 4GW9A 4QB8A 3F1NB 1RP5A 2V8CA 3IHBA 1PW1A 1SCWA 4K91A 1NZOA 4ZAMA 3GR2A 1C3BA 4ESPA 4OQIA 3UPPA 1YLJA 3T4SA 1ES2A 4Y13A 3FKWA 2EXAA 2V2FF 1HD8A 2VV7A 3HJIA 4P87A 4LGWA 2P04A 3E2KA 5HAPA 4CQHA 3T4OA 3UE1A 4MBHA 4YOFA 2JN7A 4ZRRA 4RYEA 2QZ6A 4OPQA 3D3OA 4L9FA 1KOUA 1DJBA 3KYEA 2QYBA 1GSVA 3VP2A 4ZJ1A 4G3VA 1O7EA 2OOLA 3ZFZA 2LB9A
chains in the Genus database with same CATH topology
3IHAA 3G31A 2H10A 3GMWA 4A5RA 3EQUA 1YLZA 4KZ8A 5DF7A 2VGKA 2XF3A 3C4PA 3ITAA 3TOIA 4LENA 3HL9A 1SDNA 3S4XA 1ALQA 3SH9A 4KG2A 1NYYA 4E3JA 2RCXA 1NXYA 3GSGA 4U0XA 3ZCZA 1K55C 4X55A 1LI0A 2Z2LB 1QMEA 3Q81A 3FV7A 4N9KA 4OPZA 4R3JA 3HREA 1VM1A 4DXCA 1BSGA 2X02A 4FH2A 4ZDXA 3FWLA 2WADA 4UA9A 1E3UD 1N9BA 2QPNA 3N4IA 3Q07A 3HLCA 3ZVTA 4FH4A 1KE3A 1BUEA 1ES5A 1OMEA 4XUZA 4DE0A 4EV4A 2VGJA 4PMAA 4PM5A 1PZOA 1IYOA 2Y2NA 1GHIA 4DE1A 1K4EA 2XEPA 3ZNYA 4MBFA 3S22A 1XA7A 3NY4A 1MXOA 3GV9A 5U47A 1FCNA 1N4OA 5HARA 4EUZA 3C7UA 1WYCA 1YLTA 5DF9A 4LCLA 4S2OA 5JYPA 4JXWA 4UAAA 3VFFA 1IYSA 3OPHA 1ZG4A 3O3VA 4X69A 2ZQDA 5EVID 1MWUA 5CTMA 3IF5A 5F82A 1K54A 4OONA 2WKHA 3Q7ZA 3WRTA 3C4OA 4QU3A 1YLWA 3UE0A 3VOYA 2HP6A 4CPKA 4WMCD 3IXDA 2J9PA 4JBFA 5CHUA 3BECA 5FI6A 5DTSA 1E25A 3CMZA 2Q9MA 3IWIA 2GDNA 3NBLA 1ES3A 3G2YA 2UWXA 4YFMA 1CEFA 3Q1FA 5TFQA 5JYOA 4OKPA 1LL5A 3PTEA 4RA7A 3PBNA 4P6BA 5GHXA 5HW3A 1YT4A 3HVFA 1TVFA 1FQGA 1PWCA 3ITBA 2A49A 3IXGA 4MBKA 5AQBA 3OCLA 3VFHA 4HESA 4WZ5C 2QMIA 2XDMA 3M2KA 3ZG9B 1PW8A 2Y2HA 3EQVA 3VSKA 4Q8IA 3O87A 4PM6A 4S2NA 3W4OA 3WS4A 4IEDA 2PBYA 3HUOA 1J9MA 1EWZA 4DKIA 4OQHA 3M2JA 1PI4A 2Q9NA 3GTCA 4JF6A 4E3NA 5FI7A 1MWRA 1NRFA 3GVBA 1MWTA 1S0WA 3LO7A 2G2WA 5FAQA 4S2NC 3ZVWA 2H0YA 3MBZA 2ZLYA 3V3SA 3C5AA 5EE8A 5GLDA 5KSHA 1PWDA 2HDSA 2P9VB 2Y2OA 1FOFA 3A3IA 2WGWA 2E8IA 3HUMA 4S2MA 1JWPA 5EOOA 3WS0A 1CI8A 1JTGA 3P98A 5HFOA 3UPOA 1ZC2A 4KG6A 2XQZA 3OZHA 4JXSA 5FQQA 3A3FA 3VP0A 3BFFA 5AQ7A 4Z9QA 1IEMA 1H8YA 1PWGA 1DJAA 5F1GA 2J8YA 1U60A 5FSRA 3OCNA 5HL1A 1JWZA 4MLLA 3IWOA 4LV0A 1K57A 2ZC5B 5KZHA 4ZBEA 1H8ZA 1AXBA 2H5SA 5DVAA 4JXVA 2BG1A 5BOHA 4QJGA 1FCOA 3SS3A 1LLBA 3CG5A 1KGEA 2XD5A 3BFGA 2Y91A 1WYBA 3PAGA 4FCFA 5D3OA 1CEGA 4QHCA 3GRJA 3TSGA 1K57C 3G4PA 3W4QA 5CHJA 3HLDA 4GB7A 2JCHA 4WEJA 1BT5A 3MXRA 3VP1A 3E2LA 1I2WA 2WGVA 4K0WA 3HLEA 5HAQA 1CI9A 2EX6A 3IXHA 4KQQA 1KGGA 1KE4A 4Y0OA 1QMFA 3WRZA 4X53A 2IWDA 4S2LA 1RGZA 4BQMA 2HP5A 3QNCA 3DWKA 3A3EA 2JE5A 3UO9A 2V20A 4OPYA 2JC7A 1YQSA 2FFFB 4R23A 4PM8A 1RGYA 3N7WA 5GLAA 5CGSA 1JWVA 2Y2GA 3P09A 3BFDA 2Y59A 1HTZA 5E2HA 4DF6A 3IXBA 4KZ7A 3MXSA 3GQZA 4QD4A 3DWZA 3IQAA 5FQMA 2Y2PA 4WELA 5EOEA 1W8QA 3BRMA 1YMXA 1Z6FA 2ZM8A 5CERA 2WKEA 3A3JA 2OLUA 2OV5A 2J7VA 2JBFA 2HPBA 3ZG5A 4KZ4A 1ERQA 5DF8A 4HBUA 2R9WA 1Y54A 3HLWA 4B4XA 1O07A 2ZC6B 5FAOA 1SHVA 1ERMA 4ID4A 1G68A 1W79A 1GHPA 3PBSA 4BLMA 1IKIA 4WZ5A 3HLFA 1Q2PA 4E3LA 5EUAA 4R3BA 3SOIA 1YLYA 1KDSA 5M18A 2ZQCA 1LI9A 3LCEA 2WKIA 3OPLA 4EBLA 4RVAA 4BJPA 2WK0A 3O86A 3N8SA 1L0EA 4KG5A 4OOMA 3ZG8B 1TEMA 4GD8A 4KQOA 4LV2A 1GCEA 1IELA 4LCMA 5FDHA 4JXGA 4BENA 2G2UA 2XLNA 5CHMA 4F94A 1DY6A 3AGEA 3G35A 3WS1A 4BL2A 4E3IA 4OVDA 2XK1A 3V50A 4Y0TA 3FKVA 4GN2A 2WAEA 2Y2IA 1SDEA 2H0TA 4C6YA 4E3OA 5CGXA 3IF6B 2ZMAA 2HDUA 2EFXA 3BFCA 3SS4A 4D2OA 4XUXA 1BZAA 1VQQA 2XR0A 3MFDA 3N6IA 2J9OA 4R1GA 1XKZA 2CC1A 1L0DA 1NJ4A 4OOLA 1W5DA 3IH9A 4BD1A 1PZPA 4P0MA 1HVBA 1XP4A 3VP3A 1JTDA 1GA0A 3OPPA 5TR7A 1G6AA 1M6KA 1XXMA 3D4FA 5GLCA 4E6WA 3Q82A 3W8KA 2Y2LA 4JF5A 5E2GA 1BTLA 3G30A 4FD8A 4O7DA 4KZ3A 5EVIB 4IBXA 3IT9A 3DTMA 5DTTA 1M40A 2Y2KA 4RX3A 2EFUA 3MZFA 3Q7VB 4KZ6A 4OQGA 3PAEA 4C75A 3VSLA 2WZZA 1I2SA 2OLVA 1ES4A 1TDGA 1KDWA 5A90A 3IF6C 1CK3A 2DRWA 2ZJ9A 3ZHHA 2P9VA 4X56A 3M6BA 4GDBA 3VP4A 3LY4A 3UDIA 1E4DA 2V1ZA 2WAFA 2WGIA 1FR6A 4EWFA 4MEZA 3V3RA 1KVLA 1JVJA 4BL3A 5FASA 2ZQ9A 5GHYA 5I94A 4UHUA 2XH9A 4UA7A 4X68A 4FSFA 2IWBA 2Y2JA 4WMCA 3HBRA 4S2KA 1H5XA 3NCKA 1TDLA 1Q2QA 3PBOA 3UDFA 1YM1A 1GA9A 4XXRA 2B5RA 1HZOA 5EVIC 4OOYA 3RJUA 1NY0A 1W8YA 5CXWA 4YINA 1XX2A 2RL3A 5EPHA 4OQ0A 5DTKA 1K6SA 4S2IA 4KZAA 4GKUA 3O88A 3MKEA 4JF4A 3G32A 1KE0A 2ZC3B 3WS5A 3HLGA 4IVIA 1NYMA 2Y4AA 3W4PA 1BLPA 2P74A 4MNRA 3PBRA 4GOGA 1BLSA 2WYXA 4NK3A 4LV3A 5E2EA 2EX9A 2ZC4B 5HAIA 5IHVA 5CTNA 1KGFA 1K4FA 2DCFA 3SS5A 4R4SA 3NI9A 5KSCA 1BLCA 5M1AA 4UA6A 5F1FA 4QY5A 4DE3A 1FSWA 3G2ZA 3PBTA 4DDSA 1KVMA 5FA7A 3NIAA 2XFSA 4OPRA 3BYDA 1I5QA 2HDRA 4CJNA 1PIOA 3HUNA 1K38A 4KZ5A 4N1HA 3IH8A 3ZDJA 3ZGAB 4ZTKA 5L2FA 2ZD8A 1ESUA 2WZXA 2Y2QA 4OH0A 3ZG7B 5M19A 4B4ZA 1WE4A 3JYIA 3OPRA 4DXBA 1L0FA 1PI5A 2WUQA 1EROA 1IYPA 1MPLA 3QHYA 3ISGA 1YLPA 2HP9A 1XGJA 4EBPA 2EXBA 3UPNA 3NDEA 4QY6A 3IWQA 1PYYA 1XGIA 5CGWA 5A91A 4DDYA 2BLSA 4NETA 1ZG6A 4KZBA 5J8XA 4JPMA 1XA1A 5E2FA 3WS2A 2DNSA 1EI5A 2ZM2A 3C7VA 3A3DA 4X6TA 5FQIA 4R4RA 5CEBA 5GLBA 5E43A 3MZDA 2ZQ7A 3SH7A 4HEFA 3N8LA 5FQJA 2XFTA 4BD0A 3MKFA 1K56A 2Y2MA 1MKIA 4N92A 4E3MA 5A92A 4LV1A 4WBGA 1ZKJA 5KMWA 1ONHA 3OC2A 1DJCA 1FR1A 4HBTA 4PM9A 2FFYA 2PU4A 2R9XA 2C5WB 3QNBA 4KZ9A 5G18A 5GHZA 3RXXA 3G34A 3M6HA 5TGFA 3UE3A 3BEBA 5FAPA 4KQRA 2EX8A 1MWSA 1ONGA 4H8RA 4GD6A 3UN7A 4R0QA 3VMAA 2OSUA 4E3KA 3ZNTA 2HDQA 3I7JA 4DE2A 4Y0UA 5AQAA 5A93A 3AGFA 4IBRA 2EX2A 1MY8A 5CRFA 1K54C 1L0GA 3NC8A 5GL9A 2IWCA 3HLBA 1FSYA 4ZJ3A 1IKGA 4OLGA 3UDXA 3NDGA 4GDNA 4JLFA 3CZDA 2ZM0A 1E3UA 2ZQAA 2C6WB 2Z2MB 5CEDA 1BLHA 3V39A 4GNUA 4K0XA 3IF6A 3WWXA 2ZC7A 2ZQ8A 4M3KA 4RX2A 4QB8A 1IYQA 2WGWB 3RXWA 3BLSA 4B88A 1RP5A 2XGNA 5EVLA 3CJMA 3V5MA 1K6RA 3LY3A 3IHBA 4OLDA 4EBNA 2Y55A 5FQKA 1PW1A 3PBQA 1SCWA 3N8RA 4K91A 1NZOA 4ZAMA 4N1XA 3GR2A 1C3BA 1W7FA 4C3QA 3SH8A 3ZG0A 4OQIA 3UPPA 1YLJA 4E6XA 3S1YA 5FATA 3BM6A 4WYYA 4P85A 5FQ9A 3BLMA 1SKFA 1ES2A 4S2PA 2XD1A 3FKWA 2EXAA 2I72A 2V2FF 4WZ4A 1K25A 1HD8A 5EVIA 1FCMA 1LL9A 4U0TA 1MBLA 3AGDA 4N9LA 4P87A 4WEKA 5F83A 4GZBA 3E2KA 5HAPA 2X01A 3B3XA 4S2JA 3Q7VA 2PU2A 3UE1A 3UNWA 4DRTA 4MBHA 4WM9A 4OP8A 4Y7PA 1LHYA 5EECA 4PM7A 1NZUA 1YMSA 5HX9A 4KENB 4L0LA 4RYEA 2A3UA 4EQIA 3BFEA 4PPRA 2QZ6A 1S6RA 1ESIA 3MZEA 4OP5A 3FZCA 4U3TA 4OPQA 4IVKA 1DJBA 3DW0A 5FI2A 3VP2A 4ZJ1A 1K56D 4ZJ2A 3UY6A 1XPBA 3TG9A 2X71A 1GHMA 1O7EA 3FYZA 3LEZA 1BULA 1L2SA 4JKTA 3VOZA 3ZFZA 1K55A 5AQ9A 1RCJA 5CECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHA A;  3G31 A;  2H10 A;  3GMW A;  4A5R A;  3EQU A;  1YLZ A;  4KZ8 A;  5DF7 A;  2VGK A;  2XF3 A;  3C4P A;  3ITA A;  3TOI A;  4LEN A;  3HL9 A;  1SDN A;  3S4X A;  1ALQ A;  3SH9 A;  4KG2 A;  1NYY A;  4E3J A;  2RCX A;  1NXY A;  3GSG A;  4U0X A;  3ZCZ A;  1K55 C;  4X55 A;  1LI0 A;  2Z2L B;  1QME A;  3Q81 A;  3FV7 A;  4N9K A;  4OPZ A;  4R3J A;  3HRE A;  1VM1 A;  4DXC A;  1BSG A;  2X02 A;  4FH2 A;  4ZDX A;  3FWL A;  2WAD A;  4UA9 A;  1E3U D;  1N9B A;  2QPN A;  3N4I A;  3Q07 A;  3HLC A;  3ZVT A;  4FH4 A;  1KE3 A;  1BUE A;  1ES5 A;  1OME A;  4XUZ A;  4DE0 A;  4EV4 A;  2VGJ A;  4PMA A;  4PM5 A;  1PZO A;  1IYO A;  2Y2N A;  1GHI A;  4DE1 A;  1K4E A;  2XEP A;  3ZNY A;  4MBF A;  3S22 A;  1XA7 A;  3NY4 A;  1MXO A;  3GV9 A;  5U47 A;  1FCN A;  1N4O A;  5HAR A;  4EUZ A;  3C7U A;  1WYC A;  1YLT A;  5DF9 A;  4LCL A;  4S2O A;  5JYP A;  4JXW A;  4UAA A;  3VFF A;  1IYS A;  3OPH A;  1ZG4 A;  3O3V A;  4X69 A;  2ZQD A;  5EVI D;  1MWU A;  5CTM A;  3IF5 A;  5F82 A;  1K54 A;  4OON A;  2WKH A;  3Q7Z A;  3WRT A;  3C4O A;  4QU3 A;  1YLW A;  3UE0 A;  3VOY A;  2HP6 A;  4CPK A;  4WMC D;  3IXD A;  2J9P A;  4JBF A;  5CHU A;  3BEC A;  5FI6 A;  5DTS A;  1E25 A;  3CMZ A;  2Q9M A;  3IWI A;  2GDN A;  3NBL A;  1ES3 A;  3G2Y A;  2UWX A;  4YFM A;  1CEF A;  3Q1F A;  5TFQ A;  5JYO A;  4OKP A;  1LL5 A;  3PTE A;  4RA7 A;  3PBN A;  4P6B A;  5GHX A;  5HW3 A;  1YT4 A;  3HVF A;  1TVF A;  1FQG A;  1PWC A;  3ITB A;  2A49 A;  3IXG A;  4MBK A;  5AQB A;  3OCL A;  3VFH A;  4HES A;  4WZ5 C;  2QMI A;  2XDM A;  3M2K A;  3ZG9 B;  1PW8 A;  2Y2H A;  3EQV A;  3VSK A;  4Q8I A;  3O87 A;  4PM6 A;  4S2N A;  3W4O A;  3WS4 A;  4IED A;  2PBY A;  3HUO A;  1J9M A;  1EWZ A;  4DKI A;  4OQH A;  3M2J A;  1PI4 A;  2Q9N A;  3GTC A;  4JF6 A;  4E3N A;  5FI7 A;  1MWR A;  1NRF A;  3GVB A;  1MWT A;  1S0W A;  3LO7 A;  2G2W A;  5FAQ A;  4S2N C;  3ZVW A;  2H0Y A;  3MBZ A;  2ZLY A;  3V3S A;  3C5A A;  5EE8 A;  5GLD A;  5KSH A;  1PWD A;  2HDS A;  2P9V B;  2Y2O A;  1FOF A;  3A3I A;  2WGW A;  2E8I A;  3HUM A;  4S2M A;  1JWP A;  5EOO A;  3WS0 A;  1CI8 A;  1JTG A;  3P98 A;  5HFO A;  3UPO A;  1ZC2 A;  4KG6 A;  2XQZ A;  3OZH A;  4JXS A;  5FQQ A;  3A3F A;  3VP0 A;  3BFF A;  5AQ7 A;  4Z9Q A;  1IEM A;  1H8Y A;  1PWG A;  1DJA A;  5F1G A;  2J8Y A;  1U60 A;  5FSR A;  3OCN A;  5HL1 A;  1JWZ A;  4MLL A;  3IWO A;  4LV0 A;  1K57 A;  2ZC5 B;  5KZH A;  4ZBE A;  1H8Z A;  1AXB A;  2H5S A;  5DVA A;  4JXV A;  2BG1 A;  5BOH A;  4QJG A;  1FCO A;  3SS3 A;  1LLB A;  3CG5 A;  1KGE A;  2XD5 A;  3BFG A;  2Y91 A;  1WYB A;  3PAG A;  4FCF A;  5D3O A;  1CEG A;  4QHC A;  3GRJ A;  3TSG A;  1K57 C;  3G4P A;  3W4Q A;  5CHJ A;  3HLD A;  4GB7 A;  2JCH A;  4WEJ A;  1BT5 A;  3MXR A;  3VP1 A;  3E2L A;  1I2W A;  2WGV A;  4K0W A;  3HLE A;  5HAQ A;  1CI9 A;  2EX6 A;  3IXH A;  4KQQ A;  1KGG A;  1KE4 A;  4Y0O A;  1QMF A;  3WRZ A;  4X53 A;  2IWD A;  4S2L A;  1RGZ A;  4BQM A;  2HP5 A;  3QNC A;  3DWK A;  3A3E A;  2JE5 A;  3UO9 A;  2V20 A;  4OPY A;  2JC7 A;  1YQS A;  2FFF B;  4R23 A;  4PM8 A;  1RGY A;  3N7W A;  5GLA A;  5CGS A;  1JWV A;  2Y2G A;  3P09 A;  3BFD A;  2Y59 A;  1HTZ A;  5E2H A;  4DF6 A;  3IXB A;  4KZ7 A;  3MXS A;  3GQZ A;  4QD4 A;  3DWZ A;  3IQA A;  5FQM A;  2Y2P A;  4WEL A;  5EOE A;  1W8Q A;  3BRM A;  1YMX A;  1Z6F A;  2ZM8 A;  5CER A;  2WKE A;  3A3J A;  2OLU A;  2OV5 A;  2J7V A;  2JBF A;  2HPB A;  3ZG5 A;  4KZ4 A;  1ERQ A;  5DF8 A;  4HBU A;  2R9W A;  1Y54 A;  3HLW A;  4B4X A;  1O07 A;  2ZC6 B;  5FAO A;  1SHV A;  1ERM A;  4ID4 A;  1G68 A;  1W79 A;  1GHP A;  3PBS A;  4BLM A;  1IKI A;  4WZ5 A;  3HLF A;  1Q2P A;  4E3L A;  5EUA A;  4R3B A;  3SOI A;  1YLY A;  1KDS A;  5M18 A;  2ZQC A;  1LI9 A;  3LCE A;  2WKI A;  3OPL A;  4EBL A;  4RVA A;  4BJP A;  2WK0 A;  3O86 A;  3N8S A;  1L0E A;  4KG5 A;  4OOM A;  3ZG8 B;  1TEM A;  4GD8 A;  4KQO A;  4LV2 A;  1GCE A;  1IEL A;  4LCM A;  5FDH A;  4JXG A;  4BEN A;  2G2U A;  2XLN A;  5CHM A;  4F94 A;  1DY6 A;  3AGE A;  3G35 A;  3WS1 A;  4BL2 A;  4E3I A;  4OVD A;  2XK1 A;  3V50 A;  4Y0T A;  3FKV A;  4GN2 A;  2WAE A;  2Y2I A;  1SDE A;  2H0T A;  4C6Y A;  4E3O A;  5CGX A;  3IF6 B;  2ZMA A;  2HDU A;  2EFX A;  3BFC A;  3SS4 A;  4D2O A;  4XUX A;  1BZA A;  1VQQ A;  2XR0 A;  3MFD A;  3N6I A;  2J9O A;  4R1G A;  1XKZ A;  2CC1 A;  1L0D A;  1NJ4 A;  4OOL A;  1W5D A;  3IH9 A;  4BD1 A;  1PZP A;  4P0M A;  1HVB A;  1XP4 A;  3VP3 A;  1JTD A;  1GA0 A;  3OPP A;  5TR7 A;  1G6A A;  1M6K A;  1XXM A;  3D4F A;  5GLC A;  4E6W A;  3Q82 A;  3W8K A;  2Y2L A;  4JF5 A;  5E2G A;  1BTL A;  3G30 A;  4FD8 A;  4O7D A;  4KZ3 A;  5EVI B;  4IBX A;  3IT9 A;  3DTM A;  5DTT A;  1M40 A;  2Y2K A;  4RX3 A;  2EFU A;  3MZF A;  3Q7V B;  4KZ6 A;  4OQG A;  3PAE A;  4C75 A;  3VSL A;  2WZZ A;  1I2S A;  2OLV A;  1ES4 A;  1TDG A;  1KDW A;  5A90 A;  3IF6 C;  1CK3 A;  2DRW A;  2ZJ9 A;  3ZHH A;  2P9V A;  4X56 A;  3M6B A;  4GDB A;  3VP4 A;  3LY4 A;  3UDI A;  1E4D A;  2V1Z A;  2WAF A;  2WGI A;  1FR6 A;  4EWF A;  4MEZ A;  3V3R A;  1KVL A;  1JVJ A;  4BL3 A;  5FAS A;  2ZQ9 A;  5GHY A;  5I94 A;  4UHU A;  2XH9 A;  4UA7 A;  4X68 A;  4FSF A;  2IWB A;  2Y2J A;  4WMC A;  3HBR A;  4S2K A;  1H5X A;  3NCK A;  1TDL A;  1Q2Q A;  3PBO A;  3UDF A;  1YM1 A;  1GA9 A;  4XXR A;  2B5R A;  1HZO A;  5EVI C;  4OOY A;  3RJU A;  1NY0 A;  1W8Y A;  5CXW A;  4YIN A;  1XX2 A;  2RL3 A;  5EPH A;  4OQ0 A;  5DTK A;  1K6S A;  4S2I A;  4KZA A;  4GKU A;  3O88 A;  3MKE A;  4JF4 A;  3G32 A;  1KE0 A;  2ZC3 B;  3WS5 A;  3HLG A;  4IVI A;  1NYM A;  2Y4A A;  3W4P A;  1BLP A;  2P74 A;  4MNR A;  3PBR A;  4GOG A;  1BLS A;  2WYX A;  4NK3 A;  4LV3 A;  5E2E A;  2EX9 A;  2ZC4 B;  5HAI A;  5IHV A;  5CTN A;  1KGF A;  1K4F A;  2DCF A;  3SS5 A;  4R4S A;  3NI9 A;  5KSC A;  1BLC A;  5M1A A;  4UA6 A;  5F1F A;  4QY5 A;  4DE3 A;  1FSW A;  3G2Z A;  3PBT A;  4DDS A;  1KVM A;  5FA7 A;  3NIA A;  2XFS A;  4OPR A;  3BYD A;  1I5Q A;  2HDR A;  4CJN A;  1PIO A;  3HUN A;  1K38 A;  4KZ5 A;  4N1H A;  3IH8 A;  3ZDJ A;  3ZGA B;  4ZTK A;  5L2F A;  2ZD8 A;  1ESU A;  2WZX A;  2Y2Q A;  4OH0 A;  3ZG7 B;  5M19 A;  4B4Z A;  1WE4 A;  3JYI A;  3OPR A;  4DXB A;  1L0F A;  1PI5 A;  2WUQ A;  1ERO A;  1IYP A;  1MPL A;  3QHY A;  3ISG A;  1YLP A;  2HP9 A;  1XGJ A;  4EBP A;  2EXB A;  3UPN A;  3NDE A;  4QY6 A;  3IWQ A;  1PYY A;  1XGI A;  5CGW A;  5A91 A;  4DDY A;  2BLS A;  4NET A;  1ZG6 A;  4KZB A;  5J8X A;  4JPM A;  1XA1 A;  5E2F A;  3WS2 A;  2DNS A;  1EI5 A;  2ZM2 A;  3C7V A;  3A3D A;  4X6T A;  5FQI A;  4R4R A;  5CEB A;  5GLB A;  5E43 A;  3MZD A;  2ZQ7 A;  3SH7 A;  4HEF A;  3N8L A;  5FQJ A;  2XFT A;  4BD0 A;  3MKF A;  1K56 A;  2Y2M A;  1MKI A;  4N92 A;  4E3M A;  5A92 A;  4LV1 A;  4WBG A;  1ZKJ A;  5KMW A;  1ONH A;  3OC2 A;  1DJC A;  1FR1 A;  4HBT A;  4PM9 A;  2FFY A;  2PU4 A;  2R9X A;  2C5W B;  3QNB A;  4KZ9 A;  5G18 A;  5GHZ A;  3RXX A;  3G34 A;  3M6H A;  5TGF A;  3UE3 A;  3BEB A;  5FAP A;  4KQR A;  2EX8 A;  1MWS A;  1ONG A;  4H8R A;  4GD6 A;  3UN7 A;  4R0Q A;  3VMA A;  2OSU A;  4E3K A;  3ZNT A;  2HDQ A;  3I7J A;  4DE2 A;  4Y0U A;  5AQA A;  5A93 A;  3AGF A;  4IBR A;  2EX2 A;  1MY8 A;  5CRF A;  1K54 C;  1L0G A;  3NC8 A;  5GL9 A;  2IWC A;  3HLB A;  1FSY A;  4ZJ3 A;  1IKG A;  4OLG A;  3UDX A;  3NDG A;  4GDN A;  4JLF A;  3CZD A;  2ZM0 A;  1E3U A;  2ZQA A;  2C6W B;  2Z2M B;  5CED A;  1BLH A;  3V39 A;  4GNU A;  4K0X A;  3IF6 A;  3WWX A;  2ZC7 A;  2ZQ8 A;  4M3K A;  4RX2 A;  4QB8 A;  1IYQ A;  2WGW B;  3RXW A;  3BLS A;  4B88 A;  1RP5 A;  2XGN A;  5EVL A;  3CJM A;  3V5M A;  1K6R A;  3LY3 A;  3IHB A;  4OLD A;  4EBN A;  2Y55 A;  5FQK A;  1PW1 A;  3PBQ A;  1SCW A;  3N8R A;  4K91 A;  1NZO A;  4ZAM A;  4N1X A;  3GR2 A;  1C3B A;  1W7F A;  4C3Q A;  3SH8 A;  3ZG0 A;  4OQI A;  3UPP A;  1YLJ A;  4E6X A;  3S1Y A;  5FAT A;  3BM6 A;  4WYY A;  4P85 A;  5FQ9 A;  3BLM A;  1SKF A;  1ES2 A;  4S2P A;  2XD1 A;  3FKW A;  2EXA A;  2I72 A;  2V2F F;  4WZ4 A;  1K25 A;  1HD8 A;  5EVI A;  1FCM A;  1LL9 A;  4U0T A;  1MBL A;  3AGD A;  4N9L A;  4P87 A;  4WEK A;  5F83 A;  4GZB A;  3E2K A;  5HAP A;  2X01 A;  3B3X A;  4S2J A;  3Q7V A;  2PU2 A;  3UE1 A;  3UNW A;  4DRT A;  4MBH A;  4WM9 A;  4OP8 A;  4Y7P A;  1LHY A;  5EEC A;  4PM7 A;  1NZU A;  1YMS A;  5HX9 A;  4KEN B;  4L0L A;  4RYE A;  2A3U A;  4EQI A;  3BFE A;  4PPR A;  2QZ6 A;  1S6R A;  1ESI A;  3MZE A;  4OP5 A;  3FZC A;  4U3T A;  4OPQ A;  4IVK A;  1DJB A;  3DW0 A;  5FI2 A;  3VP2 A;  4ZJ1 A;  1K56 D;  4ZJ2 A;  3UY6 A;  1XPB A;  3TG9 A;  2X71 A;  1GHM A;  1O7E A;  3FYZ A;  3LEZ A;  1BUL A;  1L2S A;  4JKT A;  3VOZ A;  3ZFZ A;  1K55 A;  5AQ9 A;  1RCJ A;  5CEC A; 
#chains in the Genus database with same CATH topology
 1YKD A;  3IHA A;  3G31 A;  2H10 A;  4MN6 A;  3GMW A;  4A5R A;  1NLZ A;  5DF7 A;  3T12 B;  2VGK A;  2XF3 A;  3C4P A;  3TOI A;  4LEN A;  3HL9 A;  4LFU A;  3NUL A;  1NYY A;  4KUO A;  1NXY A;  3GSG A;  3H82 B;  1K55 C;  4N9K A;  1VET B;  3Q81 A;  4R3J A;  4Y2F A;  1BSG A;  2X02 A;  4ZDX A;  4IJG A;  3GDI A;  3N4I A;  3FPV A;  1BUE A;  1OME A;  4DE0 A;  2VGJ A;  1PZO A;  1IYO A;  1NWZ A;  5TBM B;  1K4E A;  1XA7 A;  5U47 A;  1FCN A;  3L7H A;  3MFX A;  4ARZ B;  1XFQ A;  3C7U A;  4S2O A;  4UAA A;  3P7N A;  3VFF A;  4B9O A;  3B33 A;  5EVI D;  4FTX A;  4NXB A;  2O9A A;  3WRT A;  2WKH A;  3Q7Z A;  1V9Y A;  3KSG A;  3UE0 A;  2HP6 A;  5HD5 A;  4WMC D;  5CHU A;  3BEC A;  3JVU A;  1FIL A;  5FI6 A;  3CMZ A;  2Q9M A;  3F1P B;  1CEF A;  4YFM A;  5JYO A;  3PBN A;  4EQ1 A;  1S1Y A;  1FQG A;  5J3W A;  3TE8 A;  3OCL A;  1G28 A;  4WZ5 C;  2XDM A;  1PW8 A;  4PM6 A;  2A2L A;  2PBY A;  4HNB A;  4HHD A;  1J9M A;  5K5B A;  1PI4 A;  3DBA A;  2PYP A;  1J3W A;  3GVB A;  1NRJ A;  4MCW A;  3ZVW A;  5EE8 A;  1OT6 A;  5GLD A;  2HDS A;  1FOF A;  3A3I A;  2WGW A;  4S2M A;  1MKM A;  1JTG A;  5HFO A;  1ZC2 A;  3C38 A;  3A3F A;  4DJ3 A;  1H3Q A;  4RQ9 A;  3IX3 A;  2V8F A;  3OCN A;  4MLL A;  3C30 A;  3IWO A;  4H6J A;  4LV0 A;  3LGO A;  3CAX A;  1AXB A;  4JXV A;  2BG1 A;  4QJG A;  3O5Y A;  2QHK A;  3SS3 A;  2VA0 A;  2P08 A;  1K57 C;  3W4Q A;  4QWO A;  5CHJ A;  4Y3I A;  1BT5 A;  3MXR A;  2J3T C;  1T1B A;  1I2W A;  4K0W A;  1IOU A;  4KQQ A;  3E4P A;  1KGG A;  4Y0O A;  3T4T A;  4NXF A;  4WF0 A;  3T4K A;  4JGR A;  3DWK A;  2Y8H A;  2VEA A;  4WN5 A;  3W2Z A;  2V20 A;  2JC7 A;  1RGY A;  3P09 A;  5HDC A;  3IXB A;  2VV8 A;  4QD4 A;  3IQA A;  3ZYT A;  5EOE A;  2WKE A;  3LR3 A;  3ZG5 A;  4KZ4 A;  1ERQ A;  4EET B;  3LIC A;  1Y54 A;  3HLW A;  2ZC6 B;  5FAO A;  4O01 A;  1ERM A;  4ID4 A;  1W79 A;  1IKI A;  3GEC A;  4R3B A;  4Q0H A;  4EES A;  2WKI A;  2OWH A;  5F68 A;  4BJP A;  4GHI B;  4KQO A;  1GCE A;  4MDZ A;  2G2U A;  1OTB A;  4BL2 A;  1XJ3 A;  3AGE A;  1P0Z A;  3BY8 A;  1SDE A;  2H0T A;  4C6Y A;  3IF6 B;  2HDU A;  3IX4 A;  4I3I A;  5IU1 A;  2J9O A;  1XKZ A;  2CC1 A;  4BMW A;  4P0M A;  1GA0 A;  2W27 A;  1M6K A;  3D4F A;  5GLC A;  4E6W A;  1T1C A;  5DFX A;  1M40 A;  2Y2K A;  4RX3 A;  3MZF A;  1S4R A;  4BBV A;  3PAE A;  1G5U A;  3VSL A;  1I2S A;  3IBR A;  5A90 A;  3IF6 C;  1CK3 A;  3KSI A;  1OTE A;  4X56 A;  3VP4 A;  3P01 A;  2W3D A;  1DRM A;  2V1Z A;  5HWT A;  3V3R A;  2ZQ9 A;  5J7E A;  2V1B A;  4FSF A;  2Y2J A;  2IWB A;  4L9G A;  1TDL A;  1Q2Q A;  1YM1 A;  4R70 A;  2JKT I;  1HZO A;  4OOY A;  1W8Y A;  5CXW A;  5EPH A;  4OQ0 A;  1K6S A;  4KZA A;  3O88 A;  2PT7 A;  4NEE D;  3LI9 A;  1KE0 A;  2ZC3 B;  4IVI A;  2B02 A;  3BJN A;  1BLP A;  2P74 A;  4HIA A;  4MNR A;  3PBR A;  1BLS A;  2HJE A;  2ZC4 B;  2DCF A;  3SS5 A;  4QY5 A;  4DE3 A;  3G2Z A;  1XJ6 A;  4JGQ A;  1T19 A;  4P6Z M;  4CJN A;  1PIO A;  4KZ5 A;  4N1H A;  3IH8 A;  3KYZ A;  2XRN A;  2Y2Q A;  5M19 A;  3JYI A;  3OPR A;  4DXB A;  2PAV P;  4I38 A;  1LT0 A;  4JPM A;  3IX8 A;  2DNS A;  2ZM2 A;  3A3D A;  4UEY A;  5CEB A;  2ZQ7 A;  5HSQ A;  5FQJ A;  5HPF A;  2XFT A;  5L10 A;  5A92 A;  4LV1 A;  2ZOH A;  1FR1 A;  2J3T D;  2R9X A;  4KZ9 A;  5GHZ A;  3RXX A;  3QP8 A;  3UE3 A;  2K31 A;  3BEB A;  5HDD A;  2NUT C;  4IBR A;  1L0G A;  3PR6 A;  2IWC A;  4JGP A;  3HLB A;  1FSY A;  3UDX A;  2A24 A;  3NDG A;  5L09 A;  5FL3 A;  4GDN A;  1UWN X;  2ZQA A;  2J3W A;  2P7J A;  5CED A;  1OTI A;  3K2N A;  3WWX A;  4WUJ A;  4RX2 A;  2WGW B;  3RXW A;  3BLS A;  4B88 A;  4CLC A;  2XGN A;  4Q0J A;  1K6R A;  1W7F A;  5HZH A;  4WYY A;  3BLM A;  4S2P A;  2ACG A;  4H6J B;  4U0T A;  1LL9 A;  1MBL A;  2YKH A;  5AVF A;  3UNW A;  4DRT A;  2L1M A;  4WM9 A;  4Y7P A;  4R3A A;  1LHY A;  2V0U A;  1YMS A;  4L0L A;  3BFE A;  3FZC A;  4IVK A;  4ETZ A;  3DW0 A;  3T1X A;  1K56 D;  2O9B A;  3UY6 A;  1EW0 A;  2X71 A;  1GHM A;  2OWJ A;  5AQ9 A;  3UME A;  1OJG A;  1YLZ A;  4KZ8 A;  3ITA A;  1SDN A;  4IUH A;  4U0X A;  4X55 A;  4HOI A;  2Z2L B;  2EA9 A;  2W3H A;  3HRE A;  1VM1 A;  4DXC A;  4WL9 A;  3MR0 A;  1E3U D;  1N9B A;  2QPN A;  3KX0 X;  1KE3 A;  4PM5 A;  2XEP A;  3IS2 A;  3GV9 A;  1N4O A;  4EUZ A;  1WYC A;  3DTK A;  5JYP A;  1LSV A;  3R7W A;  2O99 A;  1ZG4 A;  4X69 A;  1MWU A;  3IF5 A;  5F82 A;  1K54 A;  1ZTU A;  2V9A A;  4OON A;  1YLW A;  3IXD A;  2HGV A;  3KSF A;  1W63 Q;  1YPR A;  5FDS A;  3Q1F A;  2V1A A;  4OKP A;  4RA7 A;  2VLG A;  3KYQ A;  3S7O A;  1PWC A;  2A49 A;  3IXG A;  5AQB A;  3M2K A;  2G7U A;  3EQV A;  3VSK A;  5TJJ A;  2R78 A;  3LI8 A;  5LBR A;  4S2N A;  3W4O A;  3WS4 A;  4OQH A;  3M2J A;  3GTC A;  4JF6 A;  2OAQ 1;  3C2W A;  1S0W A;  2XA7 M;  4I3A A;  1Y28 A;  2E8I A;  3HUM A;  5EOO A;  3LIF A;  2PD7 A;  3QP2 A;  5FQQ A;  1OJ5 A;  3VP0 A;  4L9E A;  2K2N A;  2JHE A;  5HL1 A;  1JWZ A;  1UWP X;  2ZC5 B;  1H8Z A;  5DVA A;  5BOH A;  1S1Z A;  3BFG A;  1WYB A;  4II7 A;  4FCF A;  3NOP C;  3S7Q A;  3JPU A;  3VOL A;  3HLD A;  4GB7 A;  3VP1 A;  2HV1 A;  2O0Y A;  2WGV A;  3HLE A;  2EX6 A;  1RGZ A;  5HL6 A;  5AJG A;  2JE5 A;  3LID A;  3UO9 A;  2JKR I;  1YQS A;  2FFF B;  2VJW A;  3N7W A;  5CGS A;  1JWV A;  2E8J A;  3BFD A;  2Y59 A;  1HTZ A;  5EM1 A;  4DF6 A;  5HPI A;  4K08 A;  3DWZ A;  3T4Q A;  3BRM A;  1YMX A;  1Z6F A;  5HD3 A;  1LSW A;  1SKO A;  1T1A A;  4NKP A;  2OV5 A;  2JBF A;  2HPB A;  2HJ9 C;  4HY8 A;  4HBU A;  3QP5 A;  2QKP A;  4B4X A;  1L3L A;  1G68 A;  2JKG A;  1GHP A;  4BLM A;  3HLF A;  1Q2P A;  3OPL A;  4FOF A;  1H0M A;  4OOM A;  3ZG8 B;  2QWS A;  1IEL A;  4JXG A;  2A24 B;  4BEN A;  4PKY G;  5CHM A;  4E3I A;  4OVD A;  2Z6C A;  2XK1 A;  4BWI A;  3FKV A;  2WAE A;  1YSQ A;  5CGX A;  2ZMA A;  3RFB A;  3BFC A;  3QP1 A;  3SS4 A;  1S4S A;  4XUX A;  3MFD A;  4CLC B;  2XR0 A;  3UB7 A;  3N6I A;  4OOL A;  5CX7 A;  1JTD A;  2H28 A;  3OPP A;  1XXM A;  1S66 L;  1DP6 A;  3Q82 A;  4JF5 A;  2GNX A;  1BTL A;  4IBX A;  3CHW P;  2VK3 A;  3NOU C;  2OLV A;  1ES4 A;  1KDW A;  3B42 A;  2ZJ9 A;  1YSP A;  4GDB A;  4CLC C;  2WAF A;  2WGI A;  1FR6 A;  3K3C A;  1KVL A;  3PXP A;  3FPW A;  1JVJ A;  5FAS A;  4LRZ E;  4WMC A;  3PBO A;  4FUW A;  3UDF A;  4HJ4 A;  3RJU A;  1NY0 A;  4S2I A;  3MKE A;  2XSS A;  5FEG A;  3RTY A;  5HAI A;  5IHV A;  5MC7 A;  4R4S A;  3ICY A;  3NI9 A;  5G4Z A;  5F1F A;  3E4Q A;  2PR6 A;  5FA7 A;  2GJ3 A;  2GX5 A;  1PRQ A;  4O0P A;  3BYD A;  3NEC A;  1K38 A;  3ZDJ A;  3ZGA B;  5L2F A;  3IS2 B;  3LIE A;  4IHQ A;  3EGD C;  4EER A;  1ERO A;  1IYP A;  5F5Y A;  3V67 A;  3R7W B;  1XGJ A;  3UPN A;  2O9C A;  1TF1 A;  4QY6 A;  4PKY A;  4DDY A;  2BLS A;  1ZG6 A;  1A0K A;  2W3F A;  1XA1 A;  5DKL A;  4Y15 A;  4EW7 A;  3MZD A;  3SH7 A;  4BD0 A;  4E3M A;  5DFY A;  2WKQ A;  5KMW A;  1ZKJ A;  3OC2 A;  4PM9 A;  2PU4 A;  3QNB A;  1OTD A;  4KQR A;  1MWS A;  4GD6 A;  2KOI A;  2OSU A;  4E3K A;  4DE2 A;  3AGF A;  2EX2 A;  1K54 C;  3CLO A;  5F69 A;  3TJZ C;  4EU0 A;  4ZJ3 A;  2VKS A;  1HLU P;  5AVE A;  2ZM0 A;  1UGU A;  1BLH A;  3V39 A;  4GNU A;  2ZC7 A;  2ZQ8 A;  1IYQ A;  2MJ6 A;  3V5M A;  3LY3 A;  4EBN A;  2Y55 A;  4N1X A;  4C3Q A;  3ZG0 A;  3VV4 A;  5FQ9 A;  2D01 A;  3H7W A;  1SKF A;  5L8M A;  2Q0O A;  3RH8 B;  1K25 A;  1FCM A;  2HF6 A;  4DMZ A;  4WEK A;  4GZB A;  4HP4 A;  2X01 A;  3B3X A;  3Q7V A;  4OP8 A;  3VE4 A;  4PM7 A;  2DMW A;  5HX9 A;  4KEN B;  2A3U A;  1VHM A;  4PPR A;  4EQI A;  3MZE A;  4U3T A;  1ESI A;  1OPX A;  4X1L A;  4I3J A;  4GJ4 A;  3EWK A;  5FI2 A;  2JKF A;  4ZJ2 A;  1XPB A;  2Z6D A;  4GS9 A;  3C8C A;  1K55 A;  1RCJ A;  2HZ5 A;  5EM0 A;  5A8B A;  3E98 A;  4AFI A;  1ALQ A;  2RCX A;  1LI0 A;  4OPZ A;  1QME A;  5F6A A;  4FH2 A;  4KQD A;  3FWL A;  3K3D A;  4IUK A;  1SKO B;  3Q07 A;  3HLC A;  4FH4 A;  1ES5 A;  3T50 A;  4PMA A;  1VB6 A;  1GHI A;  3S22 A;  4G3K A;  1MXO A;  1DP8 A;  3MJQ A;  1YLT A;  4HP9 A;  4LCL A;  2D02 A;  4LRY C;  2ZQD A;  3SW1 A;  5CTM A;  2YKF A;  1TS6 A;  2M7U A;  3C4O A;  3VOY A;  4CPK A;  4JBF A;  5DTS A;  3IWI A;  2GDN A;  1ES3 A;  3G2Y A;  3R4K A;  2UWX A;  4MMN A;  5TFQ A;  1LL5 A;  1S67 L;  4X25 A;  4P6B A;  1YT4 A;  3HVF A;  2QJ7 A;  1X0O A;  3ZG9 B;  2WKP A;  4Q8I A;  4IED A;  3HUO A;  1EWZ A;  3FC7 A;  4DKI A;  4E3N A;  4LRX C;  3KSH A;  3C5A A;  5KSH A;  3WS0 A;  1JWP A;  1CI8 A;  4P6Z S;  2XQZ A;  3NOT C;  3BFF A;  5AQ7 A;  4Z9Q A;  1IEM A;  1PWG A;  2J8Y A;  5FSR A;  1K57 A;  3D9Y A;  5KZH A;  4ZBE A;  1FCO A;  1SZV A;  1LLB A;  3CG5 A;  2XD5 A;  3BW6 A;  5D3O A;  1CEG A;  4QHC A;  4HQA A;  3GRJ A;  3TSG A;  1OT9 A;  4BBT A;  3LIB A;  1D06 A;  4DN0 A;  1CI9 A;  2KDK A;  3NJA A;  3WRZ A;  3UB8 A;  4X53 A;  1F9I A;  2IWD A;  4S2L A;  4O8G A;  3QNC A;  1STZ A;  2ZL1 A;  3UB9 A;  4R23 A;  4PM8 A;  5GLA A;  2UV0 E;  2W3E A;  3GQZ A;  2Y2P A;  4WEL A;  5CER A;  1PNE A;  2OLU A;  2J7V A;  5DF8 A;  2R9W A;  1ACF A;  4ME4 A;  4WLA A;  4CLC E;  1TD5 A;  1VEU A;  4XT2 A;  2PR5 A;  5EUA A;  1YLY A;  1KDS A;  1LI9 A;  3LCE A;  4EBL A;  4RVA A;  2WK0 A;  3O86 A;  3N8S A;  1L0E A;  4X1M A;  3SZT A;  1TEM A;  4LV2 A;  1F2K A;  4LCM A;  1Y4O A;  4F94 A;  1H8M A;  2ZBB A;  3G35 A;  3V50 A;  4Y0T A;  3EOI A;  3PYP A;  2EFX A;  1BZA A;  1VQQ A;  4R1G A;  1L0D A;  1NJ4 A;  2FZ0 A;  3IH9 A;  2L0W A;  1HVB A;  1LSX A;  5TR7 A;  3H7W B;  2Y79 A;  3W8K A;  1GSW A;  2Y2L A;  2ZMF A;  3CUE A;  1P9W A;  3DTM A;  5DTT A;  3Q7V B;  4KZ6 A;  4F3L A;  4C75 A;  4EXO A;  4B93 A;  2DRW A;  2P9V A;  2PBD P;  3CPT A;  4EWF A;  3MQO A;  2EWV A;  5GHY A;  3MMH A;  4I5S A;  2XH9 A;  4UA7 A;  4UHU A;  4X68 A;  3UE6 A;  3HBR A;  4BBU A;  4S2K A;  4QPR A;  3S7P A;  1H5X A;  3NCK A;  4GS9 B;  1GA9 A;  1N9O A;  4JGO A;  4GKU A;  3WS5 A;  4ETX A;  3HLG A;  4GOG A;  2EX9 A;  5CTN A;  1KGF A;  3QP6 A;  3A0R A;  3T4J A;  1BLC A;  4UA6 A;  1KVM A;  2XFS A;  1I5Q A;  2HDR A;  3EEH A;  1ESU A;  2KLI A;  2WZX A;  4OH0 A;  3BQ8 A;  1MC0 A;  3HJK A;  2BTF P;  1PI5 A;  2WUQ A;  1MPL A;  3ISG A;  1V9Z A;  1YLP A;  2HP9 A;  4EBP A;  5CGW A;  5A91 A;  3DTE A;  2B95 A;  4KZB A;  5C5K A;  5J8X A;  5E2F A;  2XA7 S;  4UQI M;  1EI5 A;  3MQ0 A;  5FQI A;  3C7V A;  1T18 A;  2AVX A;  4NXG A;  3H9W A;  4R4R A;  5GLB A;  2PD8 A;  2M1C A;  4HEF A;  3S7N A;  2Y2M A;  1MKI A;  4N92 A;  2PYR A;  5IS1 A;  1ONH A;  1DJC A;  3CI6 A;  2C5W B;  5I5L A;  3G34 A;  4H8R A;  1ONG A;  3UN7 A;  3VMA A;  3TRC A;  4R38 A;  3ZNT A;  2HDQ A;  3UMD A;  5AQA A;  5A93 A;  5CRF A;  3NC8 A;  5GL9 A;  5DJU A;  5EV0 A;  2IA2 A;  4OLG A;  2K7S A;  2PDR A;  4JLF A;  2LB5 A;  3B47 A;  3LR4 A;  5EVL A;  3CJM A;  4OLD A;  5FQK A;  1JNU A;  3PBQ A;  3N8R A;  5IT5 A;  3E0Y A;  3SH8 A;  4E6X A;  3S1Y A;  5FAT A;  3BM6 A;  5HWW A;  4P85 A;  2FH5 A;  2XD1 A;  4WZ4 A;  2I72 A;  1F5M A;  1W63 M;  5EVI A;  5EVE A;  5F83 A;  3ULF A;  3AGD A;  4N9L A;  1P9R A;  5J4E A;  4S2J A;  4HI4 A;  2PU2 A;  2VGL M;  4PHT A;  3LIA A;  5KIZ A;  5EEC A;  1NZU A;  1S6R A;  1BYW A;  4OP5 A;  1DP9 A;  4GLQ A;  2W1R A;  4UQI S;  3T1Q B;  3TG9 A;  4JKT A;  3FYZ A;  3LEZ A;  1BUL A;  1L2S A;  3VOZ A;  1P97 A;  3MS6 A;  5CEC A;  2ZL1 B;  5L07 A;  3EQU A;  4Y17 A;  4HH3 A;  3MXQ A;  2XRO A;  4G3W A;  3S4X A;  3SH9 A;  4KG2 A;  4E3J A;  2PRF A;  3ZCZ A;  1ZHH B;  3F1O A;  3UB6 A;  3FV7 A;  5DJT A;  3OOV A;  2WAD A;  4UA9 A;  2M7V A;  3ZVT A;  4XUZ A;  4EV4 A;  3NHQ A;  3VE3 A;  4HJ3 A;  2Y2N A;  4DE1 A;  1ODV A;  3ZNY A;  4MBF A;  4LLO B;  2GZA A;  3NY4 A;  1FIK A;  1NLY A;  2WKR A;  5HAR A;  1VEU B;  4XT2 B;  5DF9 A;  2PHY A;  4JXW A;  1IYS A;  3OPH A;  3O3V A;  4YNR A;  2INW A;  4QU3 A;  3MF0 A;  4I39 A;  3T1R A;  2J9P A;  1E25 A;  3NBL A;  2ZMV A;  2VGL S;  1G6O A;  3PTE A;  2V0W A;  2W1T A;  5GHX A;  3LUQ A;  3D72 A;  5HW3 A;  1TVF A;  3LYX A;  2J80 A;  3ITB A;  1XFN A;  4MBK A;  3VFH A;  4YWZ A;  4HES A;  4D60 A;  2QMI A;  4EUV A;  2Y2H A;  3O87 A;  3OLO A;  2Q9N A;  4PAU A;  1CQA A;  5FI7 A;  2JKR M;  1MWR A;  1NRF A;  4HJ6 A;  1MWT A;  1TS0 A;  3LO7 A;  2G2W A;  5FAQ A;  4S2N C;  4F3L B;  2H0Y A;  3MBZ A;  2ZLY A;  3V3S A;  3EEA A;  1PWD A;  2P9V B;  2Y2O A;  3PHY A;  3F1N A;  2ZOI A;  3CPT B;  3P98 A;  3UPO A;  4KG6 A;  3OZH A;  3LR5 A;  4JXS A;  1H8Y A;  1DJA A;  5F1G A;  1U60 A;  3CUE C;  4Z1W A;  4M4X A;  2H5S A;  3PAG A;  1KGE A;  2Y91 A;  4E04 A;  3A0V A;  3G4P A;  2QJ5 A;  3L9K A;  2JCH A;  4WEJ A;  3U2A A;  3E2L A;  5HAQ A;  4Q0I A;  3CIT A;  3IXH A;  1KE4 A;  1QMF A;  3QP4 A;  2W0N A;  1IFQ A;  3UB5 P;  4BQM A;  2HP5 A;  2I9V A;  3FG8 A;  3A3E A;  4OPY A;  4MN5 A;  5FEF A;  3BY9 A;  1TS8 A;  2Y2G A;  3TW8 A;  3E4O A;  3H82 A;  5E2H A;  1VET A;  4KZ7 A;  3MXS A;  4CLC D;  3IBJ A;  1AWI A;  5FQM A;  1W8Q A;  1XJ4 A;  2ZM8 A;  5EFW A;  2W3G A;  3A3J A;  1N9N A;  1MZU A;  5TBM A;  5HDS A;  1O07 A;  1SHV A;  4ARZ A;  3PBS A;  1PFL A;  4WZ5 A;  4E3L A;  3SOI A;  5M18 A;  2ZQC A;  2VX8 A;  4EEU A;  5HWV A;  5DKK A;  2EWW A;  4KG5 A;  4GD8 A;  5FDH A;  3OBF A;  2XLN A;  1DY6 A;  2CMN A;  3WS1 A;  3F1P A;  4GN2 A;  3BWL A;  2Y2I A;  3EGX C;  4E3O A;  4D2O A;  1W5D A;  4BD1 A;  1PZP A;  3LEQ A;  4GCZ A;  1XP4 A;  3VP3 A;  1G6A A;  3HCY A;  2VZW A;  1WA9 A;  5E2G A;  3T1S A;  3G30 A;  1LL8 A;  4FD8 A;  4O7D A;  4KZ3 A;  5EVI B;  3IT9 A;  2EFU A;  4OQG A;  2WZZ A;  1TDG A;  4EEP A;  4MN7 A;  3ZHH A;  3M6B A;  3MQQ A;  1CJF A;  3LY4 A;  3UDI A;  1E4D A;  1TS7 A;  1YAX A;  4MEZ A;  2OAP 1;  3U4L P;  4BL3 A;  5I94 A;  1XJ2 A;  4R6L A;  4XXR A;  2B5R A;  5EVI C;  4YIN A;  1XX2 A;  2RL3 A;  1D1J A;  3BQA A;  5DTK A;  4JF4 A;  3G32 A;  3DTI A;  1NYM A;  2Y4A A;  3W4P A;  3F1O B;  2WYX A;  2BAS A;  4NK3 A;  4Y5F A;  4LV3 A;  5E2E A;  4KUK A;  3LR0 A;  4NXE A;  1K4F A;  3KO6 A;  5KSC A;  5M1A A;  1FSW A;  3PBT A;  4DDS A;  1Z09 A;  3NIA A;  4OPR A;  5G4Y A;  1N9L A;  3HUN A;  4LPZ A;  4ZTK A;  2ZD8 A;  3ZG7 B;  4HH2 A;  4B4Z A;  1WE4 A;  1L0F A;  3QHY A;  2EXB A;  3MSH A;  1F98 A;  3NDE A;  3IWQ A;  1PYY A;  1XGI A;  2L4R A;  4NET A;  3DAV A;  3T4L A;  4NG2 A;  2NUP C;  3WS2 A;  4X6T A;  2B18 A;  5E43 A;  2VV6 A;  3N8L A;  3MKF A;  1K56 A;  4WBG A;  2W1T B;  4HBT A;  2FFY A;  2JKT M;  5G18 A;  3A0S A;  3M6H A;  5TGF A;  5FAP A;  3JVV A;  2EX8 A;  3G6O A;  3ZQ5 A;  4R0Q A;  1K0K A;  3CWF A;  4DJ2 A;  3I7J A;  4Y0U A;  1D7E A;  4GHI A;  1MY8 A;  1IKG A;  1CF0 A;  2KX6 A;  1GSX A;  1OTA A;  3CZD A;  1E3U A;  2C6W B;  2Z2M B;  3LFV A;  4K0X A;  3IF6 A;  4M3K A;  4GW9 A;  4QB8 A;  3F1N B;  1RP5 A;  2V8C A;  3IHB A;  1PW1 A;  1SCW A;  4K91 A;  1NZO A;  4ZAM A;  3GR2 A;  1C3B A;  4ESP A;  4OQI A;  3UPP A;  1YLJ A;  3T4S A;  1ES2 A;  4Y13 A;  3FKW A;  2EXA A;  2V2F F;  1HD8 A;  2VV7 A;  3HJI A;  4P87 A;  4LGW A;  2P04 A;  3E2K A;  5HAP A;  4CQH A;  3T4O A;  3UE1 A;  4MBH A;  4YOF A;  2JN7 A;  4ZRR A;  4RYE A;  2QZ6 A;  4OPQ A;  3D3O A;  4L9F A;  1KOU A;  1DJB A;  3KYE A;  2QYB A;  1GSV A;  3VP2 A;  4ZJ1 A;  4G3V A;  1O7E A;  2OOL A;  3ZFZ A;  2LB9 A; 
#chains in the Genus database with same CATH homology
 3IHA A;  3G31 A;  2H10 A;  3GMW A;  4A5R A;  3EQU A;  1YLZ A;  4KZ8 A;  5DF7 A;  2VGK A;  2XF3 A;  3C4P A;  3ITA A;  3TOI A;  4LEN A;  3HL9 A;  1SDN A;  3S4X A;  1ALQ A;  3SH9 A;  4KG2 A;  1NYY A;  4E3J A;  2RCX A;  1NXY A;  3GSG A;  4U0X A;  3ZCZ A;  1K55 C;  4X55 A;  1LI0 A;  2Z2L B;  1QME A;  3Q81 A;  3FV7 A;  4N9K A;  4OPZ A;  4R3J A;  3HRE A;  1VM1 A;  4DXC A;  1BSG A;  2X02 A;  4FH2 A;  4ZDX A;  3FWL A;  2WAD A;  4UA9 A;  1E3U D;  1N9B A;  2QPN A;  3N4I A;  3Q07 A;  3HLC A;  3ZVT A;  4FH4 A;  1KE3 A;  1BUE A;  1ES5 A;  1OME A;  4XUZ A;  4DE0 A;  4EV4 A;  2VGJ A;  4PMA A;  4PM5 A;  1PZO A;  1IYO A;  2Y2N A;  1GHI A;  4DE1 A;  1K4E A;  2XEP A;  3ZNY A;  4MBF A;  3S22 A;  1XA7 A;  3NY4 A;  1MXO A;  3GV9 A;  5U47 A;  1FCN A;  1N4O A;  5HAR A;  4EUZ A;  3C7U A;  1WYC A;  1YLT A;  5DF9 A;  4LCL A;  4S2O A;  5JYP A;  4JXW A;  4UAA A;  3VFF A;  1IYS A;  3OPH A;  1ZG4 A;  3O3V A;  4X69 A;  2ZQD A;  5EVI D;  1MWU A;  5CTM A;  3IF5 A;  5F82 A;  1K54 A;  4OON A;  2WKH A;  3Q7Z A;  3WRT A;  3C4O A;  4QU3 A;  1YLW A;  3UE0 A;  3VOY A;  2HP6 A;  4CPK A;  4WMC D;  3IXD A;  2J9P A;  4JBF A;  5CHU A;  3BEC A;  5FI6 A;  5DTS A;  1E25 A;  3CMZ A;  2Q9M A;  3IWI A;  2GDN A;  3NBL A;  1ES3 A;  3G2Y A;  2UWX A;  4YFM A;  1CEF A;  3Q1F A;  5TFQ A;  5JYO A;  4OKP A;  1LL5 A;  3PTE A;  4RA7 A;  3PBN A;  4P6B A;  5GHX A;  5HW3 A;  1YT4 A;  3HVF A;  1TVF A;  1FQG A;  1PWC A;  3ITB A;  2A49 A;  3IXG A;  4MBK A;  5AQB A;  3OCL A;  3VFH A;  4HES A;  4WZ5 C;  2QMI A;  2XDM A;  3M2K A;  3ZG9 B;  1PW8 A;  2Y2H A;  3EQV A;  3VSK A;  4Q8I A;  3O87 A;  4PM6 A;  4S2N A;  3W4O A;  3WS4 A;  4IED A;  2PBY A;  3HUO A;  1J9M A;  1EWZ A;  4DKI A;  4OQH A;  3M2J A;  1PI4 A;  2Q9N A;  3GTC A;  4JF6 A;  4E3N A;  5FI7 A;  1MWR A;  1NRF A;  3GVB A;  1MWT A;  1S0W A;  3LO7 A;  2G2W A;  5FAQ A;  4S2N C;  3ZVW A;  2H0Y A;  3MBZ A;  2ZLY A;  3V3S A;  3C5A A;  5EE8 A;  5GLD A;  5KSH A;  1PWD A;  2HDS A;  2P9V B;  2Y2O A;  1FOF A;  3A3I A;  2WGW A;  2E8I A;  3HUM A;  4S2M A;  1JWP A;  5EOO A;  3WS0 A;  1CI8 A;  1JTG A;  3P98 A;  5HFO A;  3UPO A;  1ZC2 A;  4KG6 A;  2XQZ A;  3OZH A;  4JXS A;  5FQQ A;  3A3F A;  3VP0 A;  3BFF A;  5AQ7 A;  4Z9Q A;  1IEM A;  1H8Y A;  1PWG A;  1DJA A;  5F1G A;  2J8Y A;  1U60 A;  5FSR A;  3OCN A;  5HL1 A;  1JWZ A;  4MLL A;  3IWO A;  4LV0 A;  1K57 A;  2ZC5 B;  5KZH A;  4ZBE A;  1H8Z A;  1AXB A;  2H5S A;  5DVA A;  4JXV A;  2BG1 A;  5BOH A;  4QJG A;  1FCO A;  3SS3 A;  1LLB A;  3CG5 A;  1KGE A;  2XD5 A;  3BFG A;  2Y91 A;  1WYB A;  3PAG A;  4FCF A;  5D3O A;  1CEG A;  4QHC A;  3GRJ A;  3TSG A;  1K57 C;  3G4P A;  3W4Q A;  5CHJ A;  3HLD A;  4GB7 A;  2JCH A;  4WEJ A;  1BT5 A;  3MXR A;  3VP1 A;  3E2L A;  1I2W A;  2WGV A;  4K0W A;  3HLE A;  5HAQ A;  1CI9 A;  2EX6 A;  3IXH A;  4KQQ A;  1KGG A;  1KE4 A;  4Y0O A;  1QMF A;  3WRZ A;  4X53 A;  2IWD A;  4S2L A;  1RGZ A;  4BQM A;  2HP5 A;  3QNC A;  3DWK A;  3A3E A;  2JE5 A;  3UO9 A;  2V20 A;  4OPY A;  2JC7 A;  1YQS A;  2FFF B;  4R23 A;  4PM8 A;  1RGY A;  3N7W A;  5GLA A;  5CGS A;  1JWV A;  2Y2G A;  3P09 A;  3BFD A;  2Y59 A;  1HTZ A;  5E2H A;  4DF6 A;  3IXB A;  4KZ7 A;  3MXS A;  3GQZ A;  4QD4 A;  3DWZ A;  3IQA A;  5FQM A;  2Y2P A;  4WEL A;  5EOE A;  1W8Q A;  3BRM A;  1YMX A;  1Z6F A;  2ZM8 A;  5CER A;  2WKE A;  3A3J A;  2OLU A;  2OV5 A;  2J7V A;  2JBF A;  2HPB A;  3ZG5 A;  4KZ4 A;  1ERQ A;  5DF8 A;  4HBU A;  2R9W A;  1Y54 A;  3HLW A;  4B4X A;  1O07 A;  2ZC6 B;  5FAO A;  1SHV A;  1ERM A;  4ID4 A;  1G68 A;  1W79 A;  1GHP A;  3PBS A;  4BLM A;  1IKI A;  4WZ5 A;  3HLF A;  1Q2P A;  4E3L A;  5EUA A;  4R3B A;  3SOI A;  1YLY A;  1KDS A;  5M18 A;  2ZQC A;  1LI9 A;  3LCE A;  2WKI A;  3OPL A;  4EBL A;  4RVA A;  4BJP A;  2WK0 A;  3O86 A;  3N8S A;  1L0E A;  4KG5 A;  4OOM A;  3ZG8 B;  1TEM A;  4GD8 A;  4KQO A;  4LV2 A;  1GCE A;  1IEL A;  4LCM A;  5FDH A;  4JXG A;  4BEN A;  2G2U A;  2XLN A;  5CHM A;  4F94 A;  1DY6 A;  3AGE A;  3G35 A;  3WS1 A;  4BL2 A;  4E3I A;  4OVD A;  2XK1 A;  3V50 A;  4Y0T A;  3FKV A;  4GN2 A;  2WAE A;  2Y2I A;  1SDE A;  2H0T A;  4C6Y A;  4E3O A;  5CGX A;  3IF6 B;  2ZMA A;  2HDU A;  2EFX A;  3BFC A;  3SS4 A;  4D2O A;  4XUX A;  1BZA A;  1VQQ A;  2XR0 A;  3MFD A;  3N6I A;  2J9O A;  4R1G A;  1XKZ A;  2CC1 A;  1L0D A;  1NJ4 A;  4OOL A;  1W5D A;  3IH9 A;  4BD1 A;  1PZP A;  4P0M A;  1HVB A;  1XP4 A;  3VP3 A;  1JTD A;  1GA0 A;  3OPP A;  5TR7 A;  1G6A A;  1M6K A;  1XXM A;  3D4F A;  5GLC A;  4E6W A;  3Q82 A;  3W8K A;  2Y2L A;  4JF5 A;  5E2G A;  1BTL A;  3G30 A;  4FD8 A;  4O7D A;  4KZ3 A;  5EVI B;  4IBX A;  3IT9 A;  3DTM A;  5DTT A;  1M40 A;  2Y2K A;  4RX3 A;  2EFU A;  3MZF A;  3Q7V B;  4KZ6 A;  4OQG A;  3PAE A;  4C75 A;  3VSL A;  2WZZ A;  1I2S A;  2OLV A;  1ES4 A;  1TDG A;  1KDW A;  5A90 A;  3IF6 C;  1CK3 A;  2DRW A;  2ZJ9 A;  3ZHH A;  2P9V A;  4X56 A;  3M6B A;  4GDB A;  3VP4 A;  3LY4 A;  3UDI A;  1E4D A;  2V1Z A;  2WAF A;  2WGI A;  1FR6 A;  4EWF A;  4MEZ A;  3V3R A;  1KVL A;  1JVJ A;  4BL3 A;  5FAS A;  2ZQ9 A;  5GHY A;  5I94 A;  4UHU A;  2XH9 A;  4UA7 A;  4X68 A;  4FSF A;  2IWB A;  2Y2J A;  4WMC A;  3HBR A;  4S2K A;  1H5X A;  3NCK A;  1TDL A;  1Q2Q A;  3PBO A;  3UDF A;  1YM1 A;  1GA9 A;  4XXR A;  2B5R A;  1HZO A;  5EVI C;  4OOY A;  3RJU A;  1NY0 A;  1W8Y A;  5CXW A;  4YIN A;  1XX2 A;  2RL3 A;  5EPH A;  4OQ0 A;  5DTK A;  1K6S A;  4S2I A;  4KZA A;  4GKU A;  3O88 A;  3MKE A;  4JF4 A;  3G32 A;  1KE0 A;  2ZC3 B;  3WS5 A;  3HLG A;  4IVI A;  1NYM A;  2Y4A A;  3W4P A;  1BLP A;  2P74 A;  4MNR A;  3PBR A;  4GOG A;  1BLS A;  2WYX A;  4NK3 A;  4LV3 A;  5E2E A;  2EX9 A;  2ZC4 B;  5HAI A;  5IHV A;  5CTN A;  1KGF A;  1K4F A;  2DCF A;  3SS5 A;  4R4S A;  3NI9 A;  5KSC A;  1BLC A;  5M1A A;  4UA6 A;  5F1F A;  4QY5 A;  4DE3 A;  1FSW A;  3G2Z A;  3PBT A;  4DDS A;  1KVM A;  5FA7 A;  3NIA A;  2XFS A;  4OPR A;  3BYD A;  1I5Q A;  2HDR A;  4CJN A;  1PIO A;  3HUN A;  1K38 A;  4KZ5 A;  4N1H A;  3IH8 A;  3ZDJ A;  3ZGA B;  4ZTK A;  5L2F A;  2ZD8 A;  1ESU A;  2WZX A;  2Y2Q A;  4OH0 A;  3ZG7 B;  5M19 A;  4B4Z A;  1WE4 A;  3JYI A;  3OPR A;  4DXB A;  1L0F A;  1PI5 A;  2WUQ A;  1ERO A;  1IYP A;  1MPL A;  3QHY A;  3ISG A;  1YLP A;  2HP9 A;  1XGJ A;  4EBP A;  2EXB A;  3UPN A;  3NDE A;  4QY6 A;  3IWQ A;  1PYY A;  1XGI A;  5CGW A;  5A91 A;  4DDY A;  2BLS A;  4NET A;  1ZG6 A;  4KZB A;  5J8X A;  4JPM A;  1XA1 A;  5E2F A;  3WS2 A;  2DNS A;  1EI5 A;  2ZM2 A;  3C7V A;  3A3D A;  4X6T A;  5FQI A;  4R4R A;  5CEB A;  5GLB A;  5E43 A;  3MZD A;  2ZQ7 A;  3SH7 A;  4HEF A;  3N8L A;  5FQJ A;  2XFT A;  4BD0 A;  3MKF A;  1K56 A;  2Y2M A;  1MKI A;  4N92 A;  4E3M A;  5A92 A;  4LV1 A;  4WBG A;  1ZKJ A;  5KMW A;  1ONH A;  3OC2 A;  1DJC A;  1FR1 A;  4HBT A;  4PM9 A;  2FFY A;  2PU4 A;  2R9X A;  2C5W B;  3QNB A;  4KZ9 A;  5G18 A;  5GHZ A;  3RXX A;  3G34 A;  3M6H A;  5TGF A;  3UE3 A;  3BEB A;  5FAP A;  4KQR A;  2EX8 A;  1MWS A;  1ONG A;  4H8R A;  4GD6 A;  3UN7 A;  4R0Q A;  3VMA A;  2OSU A;  4E3K A;  3ZNT A;  2HDQ A;  3I7J A;  4DE2 A;  4Y0U A;  5AQA A;  5A93 A;  3AGF A;  4IBR A;  2EX2 A;  1MY8 A;  5CRF A;  1K54 C;  1L0G A;  3NC8 A;  5GL9 A;  2IWC A;  3HLB A;  1FSY A;  4ZJ3 A;  1IKG A;  4OLG A;  3UDX A;  3NDG A;  4GDN A;  4JLF A;  3CZD A;  2ZM0 A;  1E3U A;  2ZQA A;  2C6W B;  2Z2M B;  5CED A;  1BLH A;  3V39 A;  4GNU A;  4K0X A;  3IF6 A;  3WWX A;  2ZC7 A;  2ZQ8 A;  4M3K A;  4RX2 A;  4QB8 A;  1IYQ A;  2WGW B;  3RXW A;  3BLS A;  4B88 A;  1RP5 A;  2XGN A;  5EVL A;  3CJM A;  3V5M A;  1K6R A;  3LY3 A;  3IHB A;  4OLD A;  4EBN A;  2Y55 A;  5FQK A;  1PW1 A;  3PBQ A;  1SCW A;  3N8R A;  4K91 A;  1NZO A;  4ZAM A;  4N1X A;  3GR2 A;  1C3B A;  1W7F A;  4C3Q A;  3SH8 A;  3ZG0 A;  4OQI A;  3UPP A;  1YLJ A;  4E6X A;  3S1Y A;  5FAT A;  3BM6 A;  4WYY A;  4P85 A;  5FQ9 A;  3BLM A;  1SKF A;  1ES2 A;  4S2P A;  2XD1 A;  3FKW A;  2EXA A;  2I72 A;  2V2F F;  4WZ4 A;  1K25 A;  1HD8 A;  5EVI A;  1FCM A;  1LL9 A;  4U0T A;  1MBL A;  3AGD A;  4N9L A;  4P87 A;  4WEK A;  5F83 A;  4GZB A;  3E2K A;  5HAP A;  2X01 A;  3B3X A;  4S2J A;  3Q7V A;  2PU2 A;  3UE1 A;  3UNW A;  4DRT A;  4MBH A;  4WM9 A;  4OP8 A;  4Y7P A;  1LHY A;  5EEC A;  4PM7 A;  1NZU A;  1YMS A;  5HX9 A;  4KEN B;  4L0L A;  4RYE A;  2A3U A;  4EQI A;  3BFE A;  4PPR A;  2QZ6 A;  1S6R A;  1ESI A;  3MZE A;  4OP5 A;  3FZC A;  4U3T A;  4OPQ A;  4IVK A;  1DJB A;  3DW0 A;  5FI2 A;  3VP2 A;  4ZJ1 A;  1K56 D;  4ZJ2 A;  3UY6 A;  1XPB A;  3TG9 A;  2X71 A;  1GHM A;  1O7E A;  3FYZ A;  3LEZ A;  1BUL A;  1L2S A;  4JKT A;  3VOZ A;  3ZFZ A;  1K55 A;  5AQ9 A;  1RCJ A;  5CEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...