2J7VA

Structure of pbp-a
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
TLPPERPLTNLQQQIQQLVSRQPNLTAGLYFFNLDSGASLNVGGDQVFPAASTIKFPILVAFFKAVDEGRVTLQERLTMRPDLIAPEAGTLQYQKPNSQYAALEVAELMITISDNTATNMIIDRLGGAAELNQQFQEWGLENTVINNPLPDMKGTNTTSPRDLATLMLKIGQGEILSPRSRDRLLDIMRRTVTNTLLPAGLGKGATIAHKTGDIGIVVGDAGMVDMPNGQRYVAAMMVKRPYNDPRGSELIRQVSRMVYQAFEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Pbp-A from Thermosynechococcus Elongatus, a Penicillin-Binding Protein Closely Related to Class a Beta-Lactamases.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Hydrolase
molecule keywords TLL2115 PROTEIN
total genus 99
structure length 265
sequence length 265
chains with identical sequence B, C, D
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2006-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2j7vA01
3M2KA 1O7EA 3ITAA 3DWKA 5AQAA 1XXMA 3ISGA 3DW0A 3Q81A 3UO9A 2Y2OA 1PYYA 3P09A 3G31A 5KZHA 1PZPA 4KZ8A 2IWCA 2XFTA 5GLCA 4N9LA 3GRJA 4OPZA 1JTGA 1RCJA 4E3NA 3QNCA 5KMWA 4OP5A 1HD8A 1ESUA 4WMCD 2EFXA 2G2UA 2Z2MB 3HLDA 1GA0A 3BM6A 3ITBA 3HLBA 1GCEA 1Q2QA 2JCHA 3Q7VB 1YM1A 4KZ5A 5FQ9A 3UE1A 5CEDA 5HL1A 1JWVA 1IYOA 5F1FA 2OLUA 2QZ6A 1BTLA 4WZ5C 4QB8A 4JXGA 4M3KA 2V20A 3MXSA 1XA1A 2JC7A 4JF4A 4JPMA 4E3KA 5A93A 3OC2A 5A92A 3A3EA 1KVMA 3FYZA 4S2JA 3TG9A 5DTKA 2X71A 5HX9A 2HP9A 3UNWA 4DE1A 3VFFA 4R4RA 3IWQA 4JF6A 2VGJA 1KGEA 1SDEA 3AGEA 2PBYA 2B5RA 2ZLYA 2DRWA 3ZFZA 3A3DA 1CEGA 3EQVA 3AGFA 3PBOA 3ZNTA 3IWIA 1K6RA 3WRTA 4LV0A 3ZDJA 2G2WA 1HVBA 5FQQA 4E3LA 1ERMA 2XQZA 3G30A 3HL9A 4KENB 4MBHA 1PWCA 4GD8A 3ZHHA 5CGWA 5GHZA 5GLBA 4E6XA 1DY6A 1Q2PA 1ZKJA 4OOMA 1XX2A 1K6SA 1TDGA 4RYEA 2P9VB 3UE0A 2UWXA 2C6WB 2C5WB 4K91A 5CGXA 3UPPA 1MKIA 1NRFA 1E3UA 1K25A 3O87A 5FDHA 4EBPA 4NETA 3SH8A 1I2WA 4Y0UA 3W4OA 3NDGA 1PW1A 2FFFB 5EVID 4P6BA 4KZ6A 1ESIA 4XUZA 1I2SA 1ALQA 5CTMA 4KQRA 4OPRA 3N7WA 3GMWA 3WS0A 4O7DA 1BT5A 3WWXA 1MY8A 3G2YA 3MKEA 4GZBA 5DTSA 2WKIA 4N9KA 1S6RA 1HZOA 1K55C 3G35A 1HTZA 3HBRA 1J9MA 2R9XA 2HDQA 3OPRA 1WYCA 3LY3A 3ZG9B 4X69A 3DTMA 4PM7A 3VMAA 2FFYA 4S2NC 4HEFA 5FQIA 5FQKA 3SS4A 3WS2A 5EOOA 4A5RA 3GTCA 4DE3A 2Y2MA 3UN7A 1FR1A 2RL3A 2ZC6B 3UDFA 4WZ4A 3ZG7B 3VFHA 5FASA 5CHMA 3LEZA 2EXAA 5CHJA 2Z2LB 4L0LA 5IHVA 2QMIA 2ZC7A 1W7FA 1K54C 4BD1A 3PBNA 3BECA 4ZAMA 4LV3A 3VP4A 1BLSA 3VOZA 3WS4A 2IWBA 3OPLA 3PBSA 1C3BA 2R9WA 3IF5A 4FD8A 4WEJA 2ZQ7A 5GHXA 4FSFA 4QJGA 4FH2A 1JTDA 4MBKA 5HAPA 4GD6A 4DDYA 1BLHA 1N4OA 1YLPA 2Y91A 2J7VA 4KZ7A 5E2FA 3OCLA 5HAIA 4DRTA 1K54A 4QHCA 5JYOA 3UE3A 3GQZA 3VOYA 3Q7ZA 4P87A 4OQ0A 3ZCZA 3C7VA 3LO7A 3FKVA 5DF7A 3WS1A 4DE0A 4UA6A 4OOLA 4JF5A 1KDWA 3HUNA 3PAEA 2EX6A 5A91A 1SHVA 3N8RA 5FAPA 3V39A 5E2GA 3W4PA 3C4OA 2H5SA 1H8ZA 1IYQA 5FQMA 3ZG5A 3BFCA 5A90A 4KG6A 4E6WA 4S2NA 1EROA 2V2FF 3MZEA 1XKZA 2XK1A 4K0XA 4OQGA 2A49A 1XA7A 1W8QA 1FOFA 1M6KA 4WELA 4JXWA 4WZ5A 1EWZA 1ONGA 2Y4AA 1MWTA 3IHBA 4MBFA 2ZC3B 4FH4A 1IKIA 5CTNA 4EUZA 2ZM0A 3MZDA 3M2JA 1PZOA 4WYYA 4OKPA 4Q8IA 1K56A 2WKEA 4S2PA 5EVIC 3LY4A 2OSUA 2J9OA 4C3QA 1AXBA 4LCLA 5EUAA 5E2HA 4RA7A 4ZBEA 2OLVA 4OPQA 5FSRA 3P98A 1NXYA 3RJUA 2V1ZA 3IF6A 2JE5A 1CI8A 3D4FA 3N4IA 3FKWA 4HESA 2ZQAA 4C6YA 3N8LA 4R23A 5FI2A 3PBRA 1PI4A 1ZG6A 3VSKA 1SDNA 4R3JA 4PM6A 3HUMA 1IYSA 1YLTA 5D3OA 1K4EA 3RXXA 2Y2NA 2ZQ8A 4PPRA 4JXSA 1YLWA 1YT4A 4C75A 3A3IA 5EOEA 3G32A 1KGGA 2Y2GA 3UY6A 1W5DA 2WK0A 3QNBA 1PWGA 4RVAA 5FI6A 5I94A 3V3SA 3I7JA 4DXCA 4YFMA 3PBQA 4U0XA 2BLSA 4LV1A 5FAQA 2WGWA 4KZAA 3CG5A 5CHUA 3OZHA 1LL9A 3SH7A 4P0MA 4K0WA 3MFDA 1IEMA 4KZ3A 5GLAA 4GDBA 4WMCA 4RX3A 2EXBA 3IXHA 3DWZA 1RP5A 3S1YA 3IXGA 4GDNA 2H0TA 3O3VA 3BFEA 2P9VA 3ZVWA 3W8KA 3BLMA 1FCOA 1PI5A 1WYBA 3HLFA 5GLDA 2WUQA 4JLFA 3IXDA 3OPPA 5TR7A 3VSLA 1XGJA 3IF6C 3NI9A 2WZXA 4R1GA 3EQUA 4WEKA 1MBLA 3PAGA 5KSHA 2ZM2A 2I72A 3GSGA 1L0DA 4N92A 3SS5A 3N6IA 1N9BA 1KE0A 3HLEA 4JXVA 1GA9A 4D2OA 2IWDA 2Y2QA 3BFDA 5DTTA 4MLLA 4IEDA 1BSGA 1H5XA 4X56A 1DJCA 3VP1A 2HDSA 5DVAA 5HAQA 4IBRA 1LI0A 4PM5A 4OVDA 4E3OA 4X55A 4IBXA 2Y2KA 2WAFA 1KVLA 2EFUA 3IH9A 4S2IA 1S0WA 1CI9A 2Y2IA 2RCXA 4UA7A 1GHPA 4LV2A 4N1XA 2XD5A 3PBTA 3NBLA 1ERQA 1PWDA 4U3TA 3SS3A 1LL5A 2WGWB 3B3XA 2JBFA 4HBTA 1JVJA 2XDMA 1ONHA 2WKHA 3G4PA 3Q1FA 4KQQA 2ZQCA 3FWLA 4LCMA 4OPYA 5DF8A 4BD0A 2X02A 5M1AA 1DJBA 4X53A 2WADA 4GNUA 3GVBA 1SCWA 1ZG4A 4OLDA 5EVLA 1FCNA 1ZC2A 4KZ4A 4WM9A 3CJMA 4N1HA 1L0GA 1MXOA 1W79A 4BL3A 1RGYA 3AGDA 4ZJ3A 3V3RA 1H8YA 1NZOA 1K57C 3LCEA 4XXRA 4BLMA 4JKTA 4MNRA 4OQHA 3ZNYA 1LLBA 1FSYA 2XFSA 4OH0A 4ZJ1A 1ES3A 2XH9A 1FR6A 4NK3A 2XEPA 4B4XA 1KGFA 2Y55A 3A3JA 1Z6FA 4S2KA 4R0QA 1YMXA 3NY4A 1EI5A 5J8XA 3IH8A 4E3JA 2HPBA 4GOGA 4ZTKA 1FQGA 4RX2A 4ZJ2A 1NJ4A 5U47A 2J8YA 1KDSA 5L2FA 3UDXA 4PM8A 3S22A 3BEBA 5AQ7A 4DDSA 1VM1A 5FI7A 4BENA 2BG1A 2GDNA 3VP3A 3WRZA 1PW8A 1L0EA 4EBLA 3BYDA 3IWOA 3V5MA 1JWPA 2EX2A 3Q7VA 1GHIA 1IKGA 1GHMA 2Y2HA 4UHUA 4KG2A 4KZ9A 1LI9A 1I5QA 1NZUA 3SOIA 2ZC4B 3SH9A 1MWUA 3OCNA 5JYPA 2Y2PA 3S4XA 4ID4A 5EECA 4R4SA 3M6BA 3NC8A 2VGKA 2ZMAA 3O88A 2QPNA 3ZGAB 3ZG0A 5AQ9A 2XLNA 4WBGA 3VP2A 3BRMA 5FAOA 1L2SA 5F82A 1ES5A 2OV5A 3FZCA 3HUOA 1K57A 4OLGA 1BLCA 1LHYA 3NIAA 4PM9A 5CEBA 2A3UA 1BULA 5GHYA 3NCKA 3IXBA 1VQQA 4OP8A 4FCFA 2WGIA 4BQMA 2E8IA 4DF6A 4UA9A 2XD1A 2XF3A 3C5AA 1TEMA 5TGFA 3UPOA 2P74A 1O07A 1BUEA 4KQOA 1G68A 4QY5A 5FA7A 5CXWA 5F1GA 2ZJ9A 2ZC5B 1L0FA 1XP4A 2ZM8A 3Q07A 1KE3A 2EX8A 3G34A 5CERA 2X01A 4EV4A 1TVFA 4HBUA 4CPKA 1WE4A 5EE8A 5FATA 2Q9MA 1KE4A 5CECA 2H10A 3HVFA 4EBNA 4F94A 1QMFA 5E2EA 1CK3A 4H8RA 5CGSA 4B4ZA 3HLWA 1TDLA 3O86A 1PIOA 4QD4A 5G18A 3FV7A 1YLJA 4GB7A 3C4PA 3ZG8B 3G2ZA 1SKFA 2ZQ9A 3UPNA 1YMSA 4OOYA 4U0TA 4XUXA 3Q82A 4B88A 1XPBA 5M19A 3IQAA 3ZVTA 4P85A 1YQSA 3BFFA 3QHYA 1K38A 4Y7PA 2ZQDA 4ZDXA 3CMZA 3MKFA 4S2MA 1K55A 1K56D 2WAEA 3IT9A 2WYXA 4GKUA 1K4FA 1JWZA 1QMEA 4KG5A 4BL2A 3OPHA 4EWFA 1ES4A 4OONA 2H0YA 2HDUA 4IVKA 4JBFA 1CEFA 3TSGA 3V50A 4Y0TA 5EPHA 1E3UD 3JYIA 4EQIA 5EVIB 4X6TA 1W8YA 2Y2LA 1IELA 4PMAA 4DXBA 3MBZA 3GR2A 3N8SA 5EVIA 1E25A 4IVIA 1FSWA 5TFQA 4YINA 5E43A 5HW3A 3WS5A 4BJPA 1IYPA 3HLGA 5HARA 3IHAA 2DCFA 3TOIA 3MZFA 4R3BA 3E2KA 1DJAA 3HLCA 4DE2A 5F83A 2HDRA 3C7UA 2PU4A 1NYYA 2XR0A 5HFOA 1YLZA 2WGVA 4GN2A 2EX9A 4Y0OA 3MXRA 3BFGA 1MWRA 1ES2A 4KZBA 5AQBA 4S2LA 3W4QA 1YLYA 2HP5A 2CC1A 2PU2A 5CRFA 2J9PA 3PTEA 5DF9A 2ZD8A 2Y59A 4S2OA 4QU3A 4QY6A 1BLPA 3UDIA 3VP0A 1FCMA 1U60A 3HREA 4OQIA 5M18A 2HP6A 4CJNA 1Y54A 3GV9A 3IF6B 1NY0A 4E3IA 1E4DA 1G6AA 4LENA 3NDEA 2Y2JA 3CZDA 4MEZA 4Z9QA 4DKIA 2XGNA 1NYMA 2Q9NA 1MPLA 1RGZA 3BLSA 5BOHA 5KSCA 1OMEA 3RXWA 1XGIA 3A3FA 4E3MA 3M6HA 5FQJA 1BZAA 4X68A 3E2LA 1M40A 4UAAA 5GL9A 2DNSA 2WZZA 1MWSA
chains in the Genus database with same CATH superfamily
4NKPA 1XXMA 3TRCA 1ZTUA 3DW0A 2Y2OA 4OPZA 1JTGA 1RCJA 1A0KA 4QPRA 4YNRA 2EFXA 3BY9A 3ITBA 3HLBA 1GCEA 4KZ5A 3UE1A 1YM1A 2QKPA 1IYOA 2OLUA 1NWZA 4Y2FA 1BTLA 4JXGA 3MXSA 5A93A 3ICYA 4S2JA 2G7UA 1HLUP 5HX9A 4R70A 3T4TA 1VETA 3CLOA 3OLOA 2DRWA 1S4RA 3EQVA 3ZNTA 3FC7A 2XQZA 3ZHHA 1DY6A 3ULFA 4OOMA 4RYEA 5FEGA 4K91A 1LL8A 5FDHA 2PD7A 2HV1A 4Y0UA 3BY8A 5EVID 4KZ6A 1ESIA 4EQ1A 4Y13A 1ALQA 3GMWA 3WS0A 2XSSA 1S6RA 3LR5A 2R9XA 2HDQA 4HH2A 3ZG9B 4X69A 3A0VA 4ESPA 4CLCC 1H0MA 3K2NA 4DE3A 2M1CA 2EXAA 1DP9A 2ZC7A 4QJGA 2ZQ7A 4FSFA 5HAPA 4GD6A 1N4OA 2Y91A 4KZ7A 4DRTA 3OCLA 3GQZA 3EGXC 3JVUA 3ZCZA 3NJAA 3IX4A 3WS1A 4DE0A 4OOLA 4B93A 3LIAA 3TJZC 3W4PA 3BFCA 4E6WA 1MC0A 2A2LA 1EROA 2JKFA 4OQGA 1VHMA 4PKYA 3T4LA 3DTEA 4WZ5A 2GZAA 2VGLS 4EUZA 2ZM0A 5EVIC 3LY4A 1YKDA 3H82A 2OLVA 1D06A 4EUVA 3D4FA 1ZHHB 2YKHA 2W27A 3N8LA 3BQ8A 3PBRA 3VSKA 3IS2B 1IYSA 2V9AA 5DKKA 5C5KA 1K4EA 3RXXA 2ZQ8A 4PPRA 2D01A 1KGGA 2Y2GA 4NXFA 4GLQA 3V3SA 3E0YA 3I7JA 4U0XA 3CG5A 3C30A 3RTYA 3MFDA 4KZ3A 5GLAA 4GDBA 4RX3A 3IXHA 3O3VA 3BFEA 2XROA 4EESA 1PI5A 5TR7A 1WYBA 5GLDA 2WUQA 3OPPA 2WZXA 2VZWA 3EQUA 1S67L 3SS5A 3DTIA 3N6IA 1KE0A 4JXVA 1OTBA 1D7EA 1H5XA 4X56A 3VP1A 1LSWA 2BASA 1P9WA 2B95A 1KVLA 2EFUA 1CI9A 4LV2A 3CITA 3SS3A 1LL5A 2VEAA 1FIKA 2P04A 1JVJA 2WKHA 4OPYA 4EEUA 4BD0A 3OBFA 2W1RA 1SKOB 4X53A 2WADA 4HHDA 3SZTA 3GVBA 3AGDA 2ZMFA 4ZJ3A 1K57C 3T4OA 3EEAA 4OQHA 4I39A 4EETB 4OH0A 4Y15A 2XEPA 5KIZA 4R0QA 3S7OA 2E8JA 2HPBA 4GOGA 3D9YA 4FOFA 3S22A 4UQIS 5AQ7A 3WRZA 1L0EA 2JKTM 3BYDA 2NUPC 4UHUA 2VLGA 2EA9A 4KZ9A 1NZUA 4IHQA 4LRXC 5JYPA 4ID4A 3B47A 3MMHA 3UB7A 2VJWA 2QPNA 5AQ9A 4WBGA 3BRMA 2WKRA 1L2SA 2OV5A 3HUOA 1G5UA 3DTKA 3H7WB 4PM9A 2A3UA 2H28A 3NCKA 2QJ7A 5TGFA 3UPOA 2ZL1B 1CJFA 5TBMA 2PT7A 3T1XA 3Q07A 1N9OA 1XP4A 4EV4A 2X01A 4CPKA 1WE4A 3EEHA 5CECA 4EBNA 3KSHA 1YLJA 3C4PA 2XRNA 3ZG8B 2ZQ9A 1YMSA 4OOYA 2QHKA 1GSXA 3ZVTA 4EU0A 4P85A 4Y7PA 3QHYA 1K38A 3LICA 2ZQDA 4G3KA 4JGPA 1T1AA 4KG5A 4GKUA 4BL2A 2Y79A 3OPHA 4LPZA 1XJ4A 2V8CA 1IELA 1STZA 3GR2A 3N8SA 5EVIA 1BYWA 4IVIA 1FSWA 4YINA 5E43A 3WS5A 1VEUA 1IYPA 3HLGA 5J7EA 4R3BA 1G6OA 3E2KA 3HLCA 2HZ5A 4DE2A 3H82B 3F1OB 2I9VA 2EX9A 3MXRA 1T1CA 4KZBA 3W4QA 1YLYA 2HP5A 2CC1A 4M4XA 4Z1WA 2PU2A 5CRFA 2J9PA 3UDIA 3MQOA 3VP0A 3HREA 1NLZA 1OTIA 1XJ3A 1Y54A 3IF6B 4O8GA 1G6AA 3NDEA 3FG8A 1XJ6A 2K7SA 5DKLA 4Z9QA 3QP2A 2O9BA 2HJ9C 3BLSA 3NOPC 1LSVA 5KSCA 1OMEA 3RXWA 1XGIA 3A3FA 1CF0A 2MJ6A 5AQAA 2B02A 3QP8A 3ISGA 3Q81A 3UO9A 2ACGA 3P09A 3G31A 5HWWA 3GRJA 4E3NA 2GNXA 1HD8A 1ESUA 2G2UA 3HLDA 3T1SA 2A24A 1GA0A 5FL3A 5G4YA 4EXOA 3LR0A 2JCHA 5CEDA 4PHTA 4WN5A 2QZ6A 1V9YA 4WZ5C 4NEED 2INWA 4E3KA 2V20A 2JC7A 5HDDA 3OC2A 1KVMA 3UB9A 5AVEA 5DTKA 3VFFA 4R4RA 1DP6A 4X1MA 3IWQA 1KGEA 2B5RA 2ZLYA 4L9FA 3ZFZA 3PBOA 3WRTA 3R4KA 4MDZA 3ZDJA 2VV8A 2G2WA 1HVBA 1K0KA 3HL9A 5GLBA 4P6ZS 1Q2PA 2PYPA 5EVEA 5CGXA 1NRFA 1E3UA 1K25A 4EBPA 1I2WA 3RH8B 3W4OA 1I2SA 5CTMA 4KQRA 3N7WA 3B42A 3G2YA 3MKEA 1N9NA 2P08A 1HZOA 5HDSA 3LY3A 4NXBA 3DTMA 4IJGA 4HIAA 4PM7A 3SS4A 5EOOA 3IX3A 3UN7A 2RL3A 4L9EA 4WZ4A 3MFXA 3UDFA 3ZG7B 2KX6A 1JNUA 4ZRRA 5IHVA 5HD5A 3F1PB 1IOUA 1P97A 4ZAMA 4LV3A 3IS2A 4WEJA 1C3BA 3IF5A 5GHXA 4O01A 1LSXA 4DDYA 1YLPA 3LYXA 4QHCA 3UE3A 4UQIM 4P87A 1IFQA 4OQ0A 3LO7A 3FKVA 5DF7A 5MC7A 4UA6A 4JF5A 1KDWA 3HUNA 5EM1A 2ZBBA 3ZG5A 5A90A 4KG6A 5HSQA 3MZEA 2XK1A 1XA7A 2ZOHA 1YSPA 4WELA 5EM0A 3JPUA 1MWTA 1IKIA 5HPFA 4WYYA 5L07A 1OJGA 2WKEA 2O9CA 2OSUA 5EUAA 1X0OA 1YAXA 1PFLA 5FSRA 3PYPA 3IF6A 2M7UA 2ZQAA 3EOIA 1SDNA 1OTAA 3S7PA 4BBUA 4PM6A 2OAP1 5D3OA 2Y2NA 3HCYA 4PKYG 4KUOA 4JXSA 4C75A 4BWIA 4JGRA 5EOEA 3G32A 3E4QA 4IUHA 5FAQA 2B18A 3OZHA 3CUEA 3UB6A 1LL9A 1VB6A 3MSHA 5K5BA 4Q0HA 4LFUA 2CMNA 3LIBA 5DFYA 3T4SA 3CAXA 3QP1A 3W8KA 2Q0OA 4JLFA 3IF6C 4WEKA 3PAGA 3FPWA 3GSGA 2Y2QA 5DTTA 3BFDA 2LB9A 1BSGA 4E3OA 4X55A 4EERA 2Y2KA 2WAFA 2EWVA 1S0WA 4CLCE 3BWLA 1GHPA 4N1XA 3CUEC 1ERQA 3B3XA 2JBFA 2VV7A 2Y8HA 2XDMA 4KQQA 3Q1FA 5DF8A 2A24B 5M1AA 4GNUA 4Y3IA 1PRQA 1SCWA 3F1OA 4N1HA 3R7WA 4BL3A 3JVVA 2OOLA 3V3RA 4BLMA 4CLCB 4MNRA 4DJ3A 3CPTA 1FSYA 2J3TC 1FR6A 4B4XA 3U2AA 5J8XA 1EI5A 3IH8A 1KDSA 5L2FA 4PM8A 4DDSA 3C8CA 2BG1A 3P01A 3VP3A 3V5MA 2EX2A 1GHMA 2UV0E 4KG2A 3UMEA 2ZC4B 4DMZA 3PHYA 3SH9A 3S4XA 5LBRA 2V8FA 4GS9B 4R4SA 4B9OA 3CHWP 2VGKA 3O88A 1H3QA 3ZGAB 2XLNA 1WA9A 3FZCA 1K57A 1MKMA 1BLCA 1F9IA 5GHYA 1VQQA 4OP8A 4FCFA 2E8IA 2XF3A 3C5AA 3MXQA 1TEMA 4FTXA 3T4KA 5A8BA 2QJ5A 4KQOA 1G68A 5G4ZA 5CXWA 1L0FA 5CERA 1KE3A 4HBUA 2L4RA 3C38A 3KSFA 1UGUA 3LR4A 2W3HA 5EE8A 2L0WA 3GECA 1P0ZA 3NOTC 4BBTA 5CGSA 1PIOA 4QD4A 5G18A 5HZHA 3G2ZA 4X1LA 4U0TA 4B88A 1XPBA 4HQAA 5M19A 3BJNA 3LFVA 3NHQA 3MKFA 4LRZE 2WAEA 5L8MA 4E04A 4IVKA 2HDUA 3TSGA 2HJEA 4Y0TA 4UEYA 4X6TA 1W8YA 3MBZA 4F3LA 2FH5A 3TE8A 5HPIA 3RFBA 5HARA 2KDKA 2DCFA 5F83A 2HDRA 2W3EA 4MN5A 2PU4A 1NYYA 2XR0A 4I3IA 4Y0OA 4G3WA 1T18A 3U4LP 3PTEA 2Y59A 4Q0JA 4QU3A 2JN7A 1FCMA 2QYBA 2HP6A 1NY0A 4ETXA 2Y2JA 4DKIA 4R38A 2XGNA 2HF6A 1MPLA 1RGZA 4F3LB 3BW6A 4E3MA 5CX7A 2PHYA 3M6HA 1BZAA 4G3VA 3M2KA 1O7EA 3ITAA 1NRJA 3QP5A 3KX0X 5KZHA 1PZPA 2W3FA 4N9LA 4R3AA 3QNCA 5KMWA 4OP5A 2YKFA 2Z2MB 3ZQ5A 2GJ3A 1Q2QA 5FQ9A 1JWVA 5F1FA 3L7HA 4QB8A 4M3KA 2ZMVA 4JPMA 4JF4A 5A92A 3H7WA 3TG9A 4GHIB 3L9KA 3VE4A 2HP9A 4DE1A 1OPXA 1XFQA 2VGJA 1SDEA 3QP4A 3A3DA 3T50A 1CEGA 3AGFA 2VA0A 3E98A 4GJ4A 4MBHA 1XFNA 4GD8A 5CGWA 4E6XA 1ODVA 3T4QA 2GX5A 1XX2A 3UE0A 4HI4A 2P9VB 2UWXA 2C6WB 3CPTB 3O87A 4NETA 2D02A 3SH8A 2FFFB 3T12B 4P6BA 4XUZA 4OPRA 1MY8A 3NOUC 2WKIA 4N9KA 5F5YA 1J9MA 4JGOA 3OPRA 3SW1A 3VMAA 3C2WA 4S2NC 4HEFA 5FQIA 3WS2A 2OAQ1 3UE6A 4H6JA 5FASA 5CHMA 3F1NB 3IBJA 5CHJA 1OTEA 3DBAA 1W7FA 3WS4A 3OPLA 2R9WA 4FH2A 1JTDA 4MBKA 5E2FA 1Y4OA 3C7VA 3PAEA 2EX6A 5A91A 5FAPA 3EGDC 4MN6A 2H5SA 1H8ZA 3P7NA 5FQMA 2W1TB 4S2NA 4JXWA 1EWZA 4CQHA 1ONGA 3A0RA 4MBFA 2ZC3B 5CTNA 1PZOA 4Q8IA 4OKPA 4S2PA 2O9AA 2J9OA 4C3QA 4LCLA 4WUJA 5E2HA 4RA7A 3P98A 3G6OA 4HJ6A 3MS6A 4HESA 4C6YA 2PDRA 4R23A 5DFXA 1PI4A 1ZG6A 2WKPA 3VE3A 3HUMA 1YLTA 1YLWA 1F5MA 3UY6A 1W5DA 2WK0A 2DMWA 1PWGA 4RVAA 5FI6A 5I94A 4DXCA 2NUTC 2XA7S 2Z6DA 4H6JB 3OOVA 2BLSA 4HY8A 2WGWA 5CHUA 2HGVA 1S1YA 4P0MA 5F6AA 4WMCA 5DJUA 3DWZA 1RP5A 3S1YA 3IXGA 3K3CA 4GDNA 2H0TA 4AFIA 5J3WA 5F69A 2WKQA 3VSLA 3NI9A 3A0SA 1MBLA 3UB5P 5KSHA 4N92A 4EW7A 1W63Q 2V1BA 3HLEA 2AVXA 2IWDA 1DP8A 3MQ0A 1DJCA 5HAQA 4IBRA 2V1AA 2QWSA 4IBXA 3BQAA 2J80A 2Y2IA 1EW0A 2RCXA 4UA7A 4DJ2A 3PBTA 1J3WA 3NBLA 1FILA 1PWDA 4U3TA 3W2ZA 1ONHA 3G4PA 4LCMA 2ZQCA 3FWLA 4ETZA 2X02A 1DJBA 2O99A 5EVLA 1ZC2A 1F98A 1W79A 5AJGA 1H8YA 3IBRA 3LCEA 4XXRA 4GCZA 4JKTA 1NLYA 1LLBA 4L9GA 4R6LA 4MMNA 2XFSA 2Y55A 2W3DA 1YMXA 3NY4A 4MN7A 4E3JA 4ZTKA 3TW8A 1FQGA 4RX2A 5U47A 2J8YA 3UDXA 2VGLM 1VM1A 4BENA 2GDNA 3LIEA 4LLOB 4EBLA 3IWOA 1TS0A 5F68A 4LRYC 3Q7VA 1GHIA 1IKGA 2Y2HA 2W1TA 1LI9A 1I5QA 1Z09A 2Y2PA 5EECA 3M6BA 3NC8A 3D3OA 2J3TD 1D1JA 1MZUA 3VP2A 5HD3A 2PR5A 5F82A 2W3GA 4YWZA 5L09A 1LHYA 2KOIA 4BQMA 2PRFA 4UA9A 4P6ZM 2XD1A 4NG2A 3NULA 1O07A 1VETB 4HP9A 3F1NA 4QY5A 5FA7A 2EWWA 4ME4A 3EWKA 1AWIA 1TVFA 2V0UA 4EEPA 1YPRA 1TF1A 2H10A 1QMFA 5E2EA 1CK3A 4B4ZA 3HLWA 1TDLA 3FV7A 4LGWA 1P9RA 5HL6A 4XUXA 3Q82A 3IQAA 1YQSA 3BFFA 4ZDXA 1V9ZA 3CMZA 1K56D 1W63M 1K4FA 1QMEA 4Q0IA 3V50A 3JYIA 4YOFA 2JKGA 4EQIA 3O5YA 4PMAA 4DXBA 5TFQA 4BJPA 2PBDP 2W0NA 3TOIA 3MZFA 4D60A 3C7UA 2K2NA 1YLZA 1OJ5A 4GN2A 4JGQA 1ACFA 1MWRA 4GHIA 1TS8A 5DF9A 2ZD8A 2VX8A 4QY6A 1BLPA 2PAVP 1U60A 3B33A 4OQIA 5M18A 4BMWA 1SZVA 1OT9A 1E4DA 1T19A 2Q9NA 4RQ9A 4HH3A 3S7NA 4QWOA 2KLIA 4X68A 3E2LA 1M40A 4UAAA 2DNSA 2WZZA 4PAUA 3DWKA 1TS6A 5TBMB 3LIDA 3T1QB 1PYYA 4KZ8A 2IWCA 2XFTA 5GLCA 3UB8A 5HWTA 4WMCD 3LIFA 5HWVA 3LEQA 3BM6A 1TS7A 3ZYTA 3Q7VB 5HL1A 1XA1A 3HJIA 3A3EA 3FYZA 2X71A 5FDSA 3UNWA 4JF6A 3AGEA 2PBYA 4Y5FA 1CQAA 3IWIA 1K6RA 4LV0A 1VEUB 5FQQA 4E3LA 1ERMA 4KENB 3G30A 1PWCA 5GHZA 1ZKJA 1K6SA 1TDGA 4XT2B 2C5WB 3KYQA 3UPPA 3V67A 1MKIA 3KYZA 3NDGA 1PW1A 5HDCA 4O7DA 1BT5A 3WWXA 4GZBA 5DTSA 3G35A 1K55C 3HBRA 1HTZA 4I3JA 3KSIA 1WYCA 3K3DA 2FFYA 4A5RA 5FQKA 3GTCA 1LT0A 2Y2MA 1FR1A 2ZC6B 3VFHA 3LEZA 3S7QA 2Z2LB 4L0LA 1DRMA 2QMIA 1K54C 4BD1A 3PBNA 3BECA 3VP4A 1BLSA 3VOZA 2IWBA 4FD8A 3PBSA 4X25A 1BLHA 1TD5A 5EFWA 2J7VA 5HAIA 5JYOA 1K54A 5TJJA 4I5SA 3VOYA 3Q7ZA 2JKRM 4O0PA 4I3AA 1SHVA 3N8RA 4GS9A 4HNBA 3V39A 5E2GA 3C4OA 1Y28A 1IYQA 4NXGA 2V2FF 1XKZA 4K0XA 2A49A 4K08A 1H8MA 1W8QA 1FOFA 1M6KA 3QP6A 2PR6A 2BTFP 2Y4AA 1S1ZA 3IHBA 3IX8A 4FH4A 3GDIA 1GSVA 3MZDA 3M2JA 4KQDA 1K56A 4HOIA 4XT2A 1AXBA 1S4SA 3LR3A 5IT5A 4ZBEA 4OPQA 1NXYA 3RJUA 2V1ZA 2JE5A 1CI8A 3N4IA 3FKWA 2PYRA 1G28A 5FI2A 4R3JA 3PXPA 1SKOA 1L3LA 1YT4A 4GW9A 2VK3A 3A3IA 1UWPX 3QNBA 4HJ3A 4YFMA 3PBQA 4LV1A 4KZAA 3SH7A 2V0WA 1KOUA 3HJKA 4K0WA 1IEMA 4I38A 1GSWA 2EXBA 1T1BA 2LB5A 2P9VA 3ZVWA 1N9LA 3BLMA 1FCOA 3HLFA 4II7A 2OWJA 3IXDA 1S66L 4ARZA 1XGJA 3CWFA 4R1GA 4CLCD 2ZM2A 2I72A 2M7VA 1L0DA 1N9BA 3FPVA 4D2OA 1GA9A 4MLLA 4IEDA 4HP4A 3R7WB 2PD8A 2HDSA 5DVAA 1LI0A 4PM5A 4OVDA 3IH9A 4S2IA 5J4EA 2K31A 2XD5A 3T4JA 3CI6A 4HJ4A 2WGWB 4HBTA 1OTDA 2JKRI 4WLAA 2ZL1A 3MR0A 3E4OA 3F1PA 1ZG4A 4OLDA 1OT6A 1FCNA 4KZ4A 4WM9A 3CJMA 5I5LA 2JKTI 2FZ0A 1L0GA 1MXOA 1RGYA 5L10A 1NZOA 3ZNYA 4ZJ1A 1ES3A 3MF0A 3LI9A 2XH9A 4NK3A 2VKSA 1KGFA 3A3JA 1Z6FA 4S2KA 5DJTA 2OWHA 4WL9A 5IS1A 4ZJ2A 1NJ4A 3BEBA 4MCWA 5FI7A 1PW8A 3H9WA 1JWPA 1XJ2A 3SOIA 4Y17A 1MWUA 3OCNA 3NECA 4CLCA 4DN0A 4ARZB 3MJQA 2ZMAA 3ZG0A 3MQQA 2O0YA 3E4PA 5FAOA 1ES5A 4IUKA 4OLGA 4BBVA 3NIAA 3LI8A 5CEBA 1BULA 1YSQA 2XA7M 3IXBA 2WGIA 4DF6A 1F2KA 2P74A 1BUEA 3PR6A 5F1GA 2ZJ9A 2ZC5B 4KUKA 2ZM8A 2EX8A 2VV6A 3G34A 5FATA 2Q9MA 5FEFA 1KE4A 3HVFA 4F94A 5AVFA 2R78A 4H8RA 3O86A 2J3WA 4GB7A 1UWNX 1SKFA 2L1MA 5IU1A 3UPNA 3LGOA 4WF0A 4S2MA 4NXEA 1K55A 3IT9A 4EWFA 2WYXA 1JWZA 1ES4A 4OONA 2H0YA 4JBFA 2ZOIA 1CEFA 5EPHA 3VV4A 1E3UD 5EVIB 2Y2LA 3DAVA 1E25A 4FUWA 5HW3A 3IHAA 1DJAA 2Z6CA 5HFOA 1PNEA 2WGVA 3KYEA 3BFGA 1ES2A 5AQBA 4S2LA 5EV0A 3KSGA 2IA2A 2JHEA 3LUQA 3UMDA 3T1RA 4S2OA 3KO6A 4CJNA 3GV9A 3VOLA 4E3IA 3D72A 4LENA 2P7JA 3CZDA 4MEZA 1NYMA 5BOHA 5FQJA 5GL9A 1MWSA
chains in the Genus database with same CATH topology
3M2KA 1O7EA 3ITAA 3DWKA 5AQAA 1XXMA 3ISGA 3DW0A 3Q81A 3UO9A 2Y2OA 1PYYA 3P09A 3G31A 5KZHA 1PZPA 4KZ8A 2IWCA 2XFTA 5GLCA 4N9LA 3GRJA 4OPZA 1JTGA 1RCJA 4E3NA 3QNCA 5KMWA 4OP5A 1HD8A 1ESUA 4WMCD 2EFXA 2G2UA 2Z2MB 3HLDA 1GA0A 3BM6A 3ITBA 3HLBA 1GCEA 1Q2QA 2JCHA 3Q7VB 1YM1A 4KZ5A 5FQ9A 3UE1A 5CEDA 5HL1A 1JWVA 1IYOA 5F1FA 2OLUA 2QZ6A 1BTLA 4WZ5C 4QB8A 4JXGA 4M3KA 2V20A 3MXSA 1XA1A 2JC7A 4JF4A 4JPMA 4E3KA 5A93A 3OC2A 5A92A 3A3EA 1KVMA 3FYZA 4S2JA 3TG9A 5DTKA 2X71A 5HX9A 2HP9A 3UNWA 4DE1A 3VFFA 4R4RA 3IWQA 4JF6A 2VGJA 1KGEA 1SDEA 3AGEA 2PBYA 2B5RA 2ZLYA 2DRWA 3ZFZA 3A3DA 1CEGA 3EQVA 3AGFA 3PBOA 3ZNTA 3IWIA 1K6RA 3WRTA 4LV0A 3ZDJA 2G2WA 1HVBA 5FQQA 4E3LA 1ERMA 2XQZA 3G30A 3HL9A 4KENB 4MBHA 1PWCA 4GD8A 3ZHHA 5CGWA 5GHZA 5GLBA 4E6XA 1DY6A 1Q2PA 1ZKJA 4OOMA 1XX2A 1K6SA 1TDGA 4RYEA 2P9VB 3UE0A 2UWXA 2C6WB 2C5WB 4K91A 5CGXA 3UPPA 1MKIA 1NRFA 1E3UA 1K25A 3O87A 5FDHA 4EBPA 4NETA 3SH8A 1I2WA 4Y0UA 3W4OA 3NDGA 1PW1A 2FFFB 5EVID 4P6BA 4KZ6A 1ESIA 4XUZA 1I2SA 1ALQA 5CTMA 4KQRA 4OPRA 3N7WA 3GMWA 3WS0A 4O7DA 1BT5A 3WWXA 1MY8A 3G2YA 3MKEA 4GZBA 5DTSA 2WKIA 4N9KA 1S6RA 1HZOA 1K55C 3G35A 1HTZA 3HBRA 1J9MA 2R9XA 2HDQA 3OPRA 1WYCA 3LY3A 3ZG9B 4X69A 3DTMA 4PM7A 3VMAA 2FFYA 4S2NC 4HEFA 5FQIA 5FQKA 3SS4A 3WS2A 5EOOA 4A5RA 3GTCA 4DE3A 2Y2MA 3UN7A 1FR1A 2RL3A 2ZC6B 3UDFA 4WZ4A 3ZG7B 3VFHA 5FASA 5CHMA 3LEZA 2EXAA 5CHJA 2Z2LB 4L0LA 5IHVA 2QMIA 2ZC7A 1W7FA 1K54C 4BD1A 3PBNA 3BECA 4ZAMA 4LV3A 3VP4A 1BLSA 3VOZA 3WS4A 2IWBA 3OPLA 3PBSA 1C3BA 2R9WA 3IF5A 4FD8A 4WEJA 2ZQ7A 5GHXA 4FSFA 4QJGA 4FH2A 1JTDA 4MBKA 5HAPA 4GD6A 4DDYA 1BLHA 1N4OA 1YLPA 2Y91A 2J7VA 4KZ7A 5E2FA 3OCLA 5HAIA 4DRTA 1K54A 4QHCA 5JYOA 3UE3A 3GQZA 3VOYA 3Q7ZA 4P87A 4OQ0A 3ZCZA 3C7VA 3LO7A 3FKVA 5DF7A 3WS1A 4DE0A 4UA6A 4OOLA 4JF5A 1KDWA 3HUNA 3PAEA 2EX6A 5A91A 1SHVA 3N8RA 5FAPA 3V39A 5E2GA 3W4PA 3C4OA 2H5SA 1H8ZA 1IYQA 5FQMA 3ZG5A 3BFCA 5A90A 4KG6A 4E6WA 4S2NA 1EROA 2V2FF 3MZEA 1XKZA 2XK1A 4K0XA 4OQGA 2A49A 1XA7A 1W8QA 1FOFA 1M6KA 4WELA 4JXWA 4WZ5A 1EWZA 1ONGA 2Y4AA 1MWTA 3IHBA 4MBFA 2ZC3B 4FH4A 1IKIA 5CTNA 4EUZA 2ZM0A 3MZDA 3M2JA 1PZOA 4WYYA 4OKPA 4Q8IA 1K56A 2WKEA 4S2PA 5EVIC 3LY4A 2OSUA 2J9OA 4C3QA 1AXBA 4LCLA 5EUAA 5E2HA 4RA7A 4ZBEA 2OLVA 4OPQA 5FSRA 3P98A 1NXYA 3RJUA 2V1ZA 3IF6A 2JE5A 1CI8A 3D4FA 3N4IA 3FKWA 4HESA 2ZQAA 4C6YA 3N8LA 4R23A 5FI2A 3PBRA 1PI4A 1ZG6A 3VSKA 1SDNA 4R3JA 4PM6A 3HUMA 1IYSA 1YLTA 5D3OA 1K4EA 3RXXA 2Y2NA 2ZQ8A 4PPRA 4JXSA 1YLWA 1YT4A 4C75A 3A3IA 5EOEA 3G32A 1KGGA 2Y2GA 3UY6A 1W5DA 2WK0A 3QNBA 1PWGA 4RVAA 5FI6A 5I94A 3V3SA 3I7JA 4DXCA 4YFMA 3PBQA 4U0XA 2BLSA 4LV1A 5FAQA 2WGWA 4KZAA 3CG5A 5CHUA 3OZHA 1LL9A 3SH7A 4P0MA 4K0WA 3MFDA 1IEMA 4KZ3A 5GLAA 4GDBA 4WMCA 4RX3A 2EXBA 3IXHA 3DWZA 1RP5A 3S1YA 3IXGA 4GDNA 2H0TA 3O3VA 3BFEA 2P9VA 3ZVWA 3W8KA 3BLMA 1FCOA 1PI5A 1WYBA 3HLFA 5GLDA 2WUQA 4JLFA 3IXDA 3OPPA 5TR7A 3VSLA 1XGJA 3IF6C 3NI9A 2WZXA 4R1GA 3EQUA 4WEKA 1MBLA 3PAGA 5KSHA 2ZM2A 2I72A 3GSGA 1L0DA 4N92A 3SS5A 3N6IA 1N9BA 1KE0A 3HLEA 4JXVA 1GA9A 4D2OA 2IWDA 2Y2QA 3BFDA 5DTTA 4MLLA 4IEDA 1BSGA 1H5XA 4X56A 1DJCA 3VP1A 2HDSA 5DVAA 5HAQA 4IBRA 1LI0A 4PM5A 4OVDA 4E3OA 4X55A 4IBXA 2Y2KA 2WAFA 1KVLA 2EFUA 3IH9A 4S2IA 1S0WA 1CI9A 2Y2IA 2RCXA 4UA7A 1GHPA 4LV2A 4N1XA 2XD5A 3PBTA 3NBLA 1ERQA 1PWDA 4U3TA 3SS3A 1LL5A 2WGWB 3B3XA 2JBFA 4HBTA 1JVJA 2XDMA 1ONHA 2WKHA 3G4PA 3Q1FA 4KQQA 2ZQCA 3FWLA 4LCMA 4OPYA 5DF8A 4BD0A 2X02A 5M1AA 1DJBA 4X53A 2WADA 4GNUA 3GVBA 1SCWA 1ZG4A 4OLDA 5EVLA 1FCNA 1ZC2A 4KZ4A 4WM9A 3CJMA 4N1HA 1L0GA 1MXOA 1W79A 4BL3A 1RGYA 3AGDA 4ZJ3A 3V3RA 1H8YA 1NZOA 1K57C 3LCEA 4XXRA 4BLMA 4JKTA 4MNRA 4OQHA 3ZNYA 1LLBA 1FSYA 2XFSA 4OH0A 4ZJ1A 1ES3A 2XH9A 1FR6A 4NK3A 2XEPA 4B4XA 1KGFA 2Y55A 3A3JA 1Z6FA 4S2KA 4R0QA 1YMXA 3NY4A 1EI5A 5J8XA 3IH8A 4E3JA 2HPBA 4GOGA 4ZTKA 1FQGA 4RX2A 4ZJ2A 1NJ4A 5U47A 2J8YA 1KDSA 5L2FA 3UDXA 4PM8A 3S22A 3BEBA 5AQ7A 4DDSA 1VM1A 5FI7A 4BENA 2BG1A 2GDNA 3VP3A 3WRZA 1PW8A 1L0EA 4EBLA 3BYDA 3IWOA 3V5MA 1JWPA 2EX2A 3Q7VA 1GHIA 1IKGA 1GHMA 2Y2HA 4UHUA 4KG2A 4KZ9A 1LI9A 1I5QA 1NZUA 3SOIA 2ZC4B 3SH9A 1MWUA 3OCNA 5JYPA 2Y2PA 3S4XA 4ID4A 5EECA 4R4SA 3M6BA 3NC8A 2VGKA 2ZMAA 3O88A 2QPNA 3ZGAB 3ZG0A 5AQ9A 2XLNA 4WBGA 3VP2A 3BRMA 5FAOA 1L2SA 5F82A 1ES5A 2OV5A 3FZCA 3HUOA 1K57A 4OLGA 1BLCA 1LHYA 3NIAA 4PM9A 5CEBA 2A3UA 1BULA 5GHYA 3NCKA 3IXBA 1VQQA 4OP8A 4FCFA 2WGIA 4BQMA 2E8IA 4DF6A 4UA9A 2XD1A 2XF3A 3C5AA 1TEMA 5TGFA 3UPOA 2P74A 1O07A 1BUEA 4KQOA 1G68A 4QY5A 5FA7A 5CXWA 5F1GA 2ZJ9A 2ZC5B 1L0FA 1XP4A 2ZM8A 3Q07A 1KE3A 2EX8A 3G34A 5CERA 2X01A 4EV4A 1TVFA 4HBUA 4CPKA 1WE4A 5EE8A 5FATA 2Q9MA 1KE4A 5CECA 2H10A 3HVFA 4EBNA 4F94A 1QMFA 5E2EA 1CK3A 4H8RA 5CGSA 4B4ZA 3HLWA 1TDLA 3O86A 1PIOA 4QD4A 5G18A 3FV7A 1YLJA 4GB7A 3C4PA 3ZG8B 3G2ZA 1SKFA 2ZQ9A 3UPNA 1YMSA 4OOYA 4U0TA 4XUXA 3Q82A 4B88A 1XPBA 5M19A 3IQAA 3ZVTA 4P85A 1YQSA 3BFFA 3QHYA 1K38A 4Y7PA 2ZQDA 4ZDXA 3CMZA 3MKFA 4S2MA 1K55A 1K56D 2WAEA 3IT9A 2WYXA 4GKUA 1K4FA 1JWZA 1QMEA 4KG5A 4BL2A 3OPHA 4EWFA 1ES4A 4OONA 2H0YA 2HDUA 4IVKA 4JBFA 1CEFA 3TSGA 3V50A 4Y0TA 5EPHA 1E3UD 3JYIA 4EQIA 5EVIB 4X6TA 1W8YA 2Y2LA 1IELA 4PMAA 4DXBA 3MBZA 3GR2A 3N8SA 5EVIA 1E25A 4IVIA 1FSWA 5TFQA 4YINA 5E43A 5HW3A 3WS5A 4BJPA 1IYPA 3HLGA 5HARA 3IHAA 2DCFA 3TOIA 3MZFA 4R3BA 3E2KA 1DJAA 3HLCA 4DE2A 5F83A 2HDRA 3C7UA 2PU4A 1NYYA 2XR0A 5HFOA 1YLZA 2WGVA 4GN2A 2EX9A 4Y0OA 3MXRA 3BFGA 1MWRA 1ES2A 4KZBA 5AQBA 4S2LA 3W4QA 1YLYA 2HP5A 2CC1A 2PU2A 5CRFA 2J9PA 3PTEA 5DF9A 2ZD8A 2Y59A 4S2OA 4QU3A 4QY6A 1BLPA 3UDIA 3VP0A 1FCMA 1U60A 3HREA 4OQIA 5M18A 2HP6A 4CJNA 1Y54A 3GV9A 3IF6B 1NY0A 4E3IA 1E4DA 1G6AA 4LENA 3NDEA 2Y2JA 3CZDA 4MEZA 4Z9QA 4DKIA 2XGNA 1NYMA 2Q9NA 1MPLA 1RGZA 3BLSA 5BOHA 5KSCA 1OMEA 3RXWA 1XGIA 3A3FA 4E3MA 3M6HA 5FQJA 1BZAA 4X68A 3E2LA 1M40A 4UAAA 5GL9A 2DNSA 2WZZA 1MWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M2K A;  1O7E A;  3ITA A;  3DWK A;  5AQA A;  1XXM A;  3ISG A;  3DW0 A;  3Q81 A;  3UO9 A;  2Y2O A;  1PYY A;  3P09 A;  3G31 A;  5KZH A;  1PZP A;  4KZ8 A;  2IWC A;  2XFT A;  5GLC A;  4N9L A;  3GRJ A;  4OPZ A;  1JTG A;  1RCJ A;  4E3N A;  3QNC A;  5KMW A;  4OP5 A;  1HD8 A;  1ESU A;  4WMC D;  2EFX A;  2G2U A;  2Z2M B;  3HLD A;  1GA0 A;  3BM6 A;  3ITB A;  3HLB A;  1GCE A;  1Q2Q A;  2JCH A;  3Q7V B;  1YM1 A;  4KZ5 A;  5FQ9 A;  3UE1 A;  5CED A;  5HL1 A;  1JWV A;  1IYO A;  5F1F A;  2OLU A;  2QZ6 A;  1BTL A;  4WZ5 C;  4QB8 A;  4JXG A;  4M3K A;  2V20 A;  3MXS A;  1XA1 A;  2JC7 A;  4JF4 A;  4JPM A;  4E3K A;  5A93 A;  3OC2 A;  5A92 A;  3A3E A;  1KVM A;  3FYZ A;  4S2J A;  3TG9 A;  5DTK A;  2X71 A;  5HX9 A;  2HP9 A;  3UNW A;  4DE1 A;  3VFF A;  4R4R A;  3IWQ A;  4JF6 A;  2VGJ A;  1KGE A;  1SDE A;  3AGE A;  2PBY A;  2B5R A;  2ZLY A;  2DRW A;  3ZFZ A;  3A3D A;  1CEG A;  3EQV A;  3AGF A;  3PBO A;  3ZNT A;  3IWI A;  1K6R A;  3WRT A;  4LV0 A;  3ZDJ A;  2G2W A;  1HVB A;  5FQQ A;  4E3L A;  1ERM A;  2XQZ A;  3G30 A;  3HL9 A;  4KEN B;  4MBH A;  1PWC A;  4GD8 A;  3ZHH A;  5CGW A;  5GHZ A;  5GLB A;  4E6X A;  1DY6 A;  1Q2P A;  1ZKJ A;  4OOM A;  1XX2 A;  1K6S A;  1TDG A;  4RYE A;  2P9V B;  3UE0 A;  2UWX A;  2C6W B;  2C5W B;  4K91 A;  5CGX A;  3UPP A;  1MKI A;  1NRF A;  1E3U A;  1K25 A;  3O87 A;  5FDH A;  4EBP A;  4NET A;  3SH8 A;  1I2W A;  4Y0U A;  3W4O A;  3NDG A;  1PW1 A;  2FFF B;  5EVI D;  4P6B A;  4KZ6 A;  1ESI A;  4XUZ A;  1I2S A;  1ALQ A;  5CTM A;  4KQR A;  4OPR A;  3N7W A;  3GMW A;  3WS0 A;  4O7D A;  1BT5 A;  3WWX A;  1MY8 A;  3G2Y A;  3MKE A;  4GZB A;  5DTS A;  2WKI A;  4N9K A;  1S6R A;  1HZO A;  1K55 C;  3G35 A;  1HTZ A;  3HBR A;  1J9M A;  2R9X A;  2HDQ A;  3OPR A;  1WYC A;  3LY3 A;  3ZG9 B;  4X69 A;  3DTM A;  4PM7 A;  3VMA A;  2FFY A;  4S2N C;  4HEF A;  5FQI A;  5FQK A;  3SS4 A;  3WS2 A;  5EOO A;  4A5R A;  3GTC A;  4DE3 A;  2Y2M A;  3UN7 A;  1FR1 A;  2RL3 A;  2ZC6 B;  3UDF A;  4WZ4 A;  3ZG7 B;  3VFH A;  5FAS A;  5CHM A;  3LEZ A;  2EXA A;  5CHJ A;  2Z2L B;  4L0L A;  5IHV A;  2QMI A;  2ZC7 A;  1W7F A;  1K54 C;  4BD1 A;  3PBN A;  3BEC A;  4ZAM A;  4LV3 A;  3VP4 A;  1BLS A;  3VOZ A;  3WS4 A;  2IWB A;  3OPL A;  3PBS A;  1C3B A;  2R9W A;  3IF5 A;  4FD8 A;  4WEJ A;  2ZQ7 A;  5GHX A;  4FSF A;  4QJG A;  4FH2 A;  1JTD A;  4MBK A;  5HAP A;  4GD6 A;  4DDY A;  1BLH A;  1N4O A;  1YLP A;  2Y91 A;  2J7V A;  4KZ7 A;  5E2F A;  3OCL A;  5HAI A;  4DRT A;  1K54 A;  4QHC A;  5JYO A;  3UE3 A;  3GQZ A;  3VOY A;  3Q7Z A;  4P87 A;  4OQ0 A;  3ZCZ A;  3C7V A;  3LO7 A;  3FKV A;  5DF7 A;  3WS1 A;  4DE0 A;  4UA6 A;  4OOL A;  4JF5 A;  1KDW A;  3HUN A;  3PAE A;  2EX6 A;  5A91 A;  1SHV A;  3N8R A;  5FAP A;  3V39 A;  5E2G A;  3W4P A;  3C4O A;  2H5S A;  1H8Z A;  1IYQ A;  5FQM A;  3ZG5 A;  3BFC A;  5A90 A;  4KG6 A;  4E6W A;  4S2N A;  1ERO A;  2V2F F;  3MZE A;  1XKZ A;  2XK1 A;  4K0X A;  4OQG A;  2A49 A;  1XA7 A;  1W8Q A;  1FOF A;  1M6K A;  4WEL A;  4JXW A;  4WZ5 A;  1EWZ A;  1ONG A;  2Y4A A;  1MWT A;  3IHB A;  4MBF A;  2ZC3 B;  4FH4 A;  1IKI A;  5CTN A;  4EUZ A;  2ZM0 A;  3MZD A;  3M2J A;  1PZO A;  4WYY A;  4OKP A;  4Q8I A;  1K56 A;  2WKE A;  4S2P A;  5EVI C;  3LY4 A;  2OSU A;  2J9O A;  4C3Q A;  1AXB A;  4LCL A;  5EUA A;  5E2H A;  4RA7 A;  4ZBE A;  2OLV A;  4OPQ A;  5FSR A;  3P98 A;  1NXY A;  3RJU A;  2V1Z A;  3IF6 A;  2JE5 A;  1CI8 A;  3D4F A;  3N4I A;  3FKW A;  4HES A;  2ZQA A;  4C6Y A;  3N8L A;  4R23 A;  5FI2 A;  3PBR A;  1PI4 A;  1ZG6 A;  3VSK A;  1SDN A;  4R3J A;  4PM6 A;  3HUM A;  1IYS A;  1YLT A;  5D3O A;  1K4E A;  3RXX A;  2Y2N A;  2ZQ8 A;  4PPR A;  4JXS A;  1YLW A;  1YT4 A;  4C75 A;  3A3I A;  5EOE A;  3G32 A;  1KGG A;  2Y2G A;  3UY6 A;  1W5D A;  2WK0 A;  3QNB A;  1PWG A;  4RVA A;  5FI6 A;  5I94 A;  3V3S A;  3I7J A;  4DXC A;  4YFM A;  3PBQ A;  4U0X A;  2BLS A;  4LV1 A;  5FAQ A;  2WGW A;  4KZA A;  3CG5 A;  5CHU A;  3OZH A;  1LL9 A;  3SH7 A;  4P0M A;  4K0W A;  3MFD A;  1IEM A;  4KZ3 A;  5GLA A;  4GDB A;  4WMC A;  4RX3 A;  2EXB A;  3IXH A;  3DWZ A;  1RP5 A;  3S1Y A;  3IXG A;  4GDN A;  2H0T A;  3O3V A;  3BFE A;  2P9V A;  3ZVW A;  3W8K A;  3BLM A;  1FCO A;  1PI5 A;  1WYB A;  3HLF A;  5GLD A;  2WUQ A;  4JLF A;  3IXD A;  3OPP A;  5TR7 A;  3VSL A;  1XGJ A;  3IF6 C;  3NI9 A;  2WZX A;  4R1G A;  3EQU A;  4WEK A;  1MBL A;  3PAG A;  5KSH A;  2ZM2 A;  2I72 A;  3GSG A;  1L0D A;  4N92 A;  3SS5 A;  3N6I A;  1N9B A;  1KE0 A;  3HLE A;  4JXV A;  1GA9 A;  4D2O A;  2IWD A;  2Y2Q A;  3BFD A;  5DTT A;  4MLL A;  4IED A;  1BSG A;  1H5X A;  4X56 A;  1DJC A;  3VP1 A;  2HDS A;  5DVA A;  5HAQ A;  4IBR A;  1LI0 A;  4PM5 A;  4OVD A;  4E3O A;  4X55 A;  4IBX A;  2Y2K A;  2WAF A;  1KVL A;  2EFU A;  3IH9 A;  4S2I A;  1S0W A;  1CI9 A;  2Y2I A;  2RCX A;  4UA7 A;  1GHP A;  4LV2 A;  4N1X A;  2XD5 A;  3PBT A;  3NBL A;  1ERQ A;  1PWD A;  4U3T A;  3SS3 A;  1LL5 A;  2WGW B;  3B3X A;  2JBF A;  4HBT A;  1JVJ A;  2XDM A;  1ONH A;  2WKH A;  3G4P A;  3Q1F A;  4KQQ A;  2ZQC A;  3FWL A;  4LCM A;  4OPY A;  5DF8 A;  4BD0 A;  2X02 A;  5M1A A;  1DJB A;  4X53 A;  2WAD A;  4GNU A;  3GVB A;  1SCW A;  1ZG4 A;  4OLD A;  5EVL A;  1FCN A;  1ZC2 A;  4KZ4 A;  4WM9 A;  3CJM A;  4N1H A;  1L0G A;  1MXO A;  1W79 A;  4BL3 A;  1RGY A;  3AGD A;  4ZJ3 A;  3V3R A;  1H8Y A;  1NZO A;  1K57 C;  3LCE A;  4XXR A;  4BLM A;  4JKT A;  4MNR A;  4OQH A;  3ZNY A;  1LLB A;  1FSY A;  2XFS A;  4OH0 A;  4ZJ1 A;  1ES3 A;  2XH9 A;  1FR6 A;  4NK3 A;  2XEP A;  4B4X A;  1KGF A;  2Y55 A;  3A3J A;  1Z6F A;  4S2K A;  4R0Q A;  1YMX A;  3NY4 A;  1EI5 A;  5J8X A;  3IH8 A;  4E3J A;  2HPB A;  4GOG A;  4ZTK A;  1FQG A;  4RX2 A;  4ZJ2 A;  1NJ4 A;  5U47 A;  2J8Y A;  1KDS A;  5L2F A;  3UDX A;  4PM8 A;  3S22 A;  3BEB A;  5AQ7 A;  4DDS A;  1VM1 A;  5FI7 A;  4BEN A;  2BG1 A;  2GDN A;  3VP3 A;  3WRZ A;  1PW8 A;  1L0E A;  4EBL A;  3BYD A;  3IWO A;  3V5M A;  1JWP A;  2EX2 A;  3Q7V A;  1GHI A;  1IKG A;  1GHM A;  2Y2H A;  4UHU A;  4KG2 A;  4KZ9 A;  1LI9 A;  1I5Q A;  1NZU A;  3SOI A;  2ZC4 B;  3SH9 A;  1MWU A;  3OCN A;  5JYP A;  2Y2P A;  3S4X A;  4ID4 A;  5EEC A;  4R4S A;  3M6B A;  3NC8 A;  2VGK A;  2ZMA A;  3O88 A;  2QPN A;  3ZGA B;  3ZG0 A;  5AQ9 A;  2XLN A;  4WBG A;  3VP2 A;  3BRM A;  5FAO A;  1L2S A;  5F82 A;  1ES5 A;  2OV5 A;  3FZC A;  3HUO A;  1K57 A;  4OLG A;  1BLC A;  1LHY A;  3NIA A;  4PM9 A;  5CEB A;  2A3U A;  1BUL A;  5GHY A;  3NCK A;  3IXB A;  1VQQ A;  4OP8 A;  4FCF A;  2WGI A;  4BQM A;  2E8I A;  4DF6 A;  4UA9 A;  2XD1 A;  2XF3 A;  3C5A A;  1TEM A;  5TGF A;  3UPO A;  2P74 A;  1O07 A;  1BUE A;  4KQO A;  1G68 A;  4QY5 A;  5FA7 A;  5CXW A;  5F1G A;  2ZJ9 A;  2ZC5 B;  1L0F A;  1XP4 A;  2ZM8 A;  3Q07 A;  1KE3 A;  2EX8 A;  3G34 A;  5CER A;  2X01 A;  4EV4 A;  1TVF A;  4HBU A;  4CPK A;  1WE4 A;  5EE8 A;  5FAT A;  2Q9M A;  1KE4 A;  5CEC A;  2H10 A;  3HVF A;  4EBN A;  4F94 A;  1QMF A;  5E2E A;  1CK3 A;  4H8R A;  5CGS A;  4B4Z A;  3HLW A;  1TDL A;  3O86 A;  1PIO A;  4QD4 A;  5G18 A;  3FV7 A;  1YLJ A;  4GB7 A;  3C4P A;  3ZG8 B;  3G2Z A;  1SKF A;  2ZQ9 A;  3UPN A;  1YMS A;  4OOY A;  4U0T A;  4XUX A;  3Q82 A;  4B88 A;  1XPB A;  5M19 A;  3IQA A;  3ZVT A;  4P85 A;  1YQS A;  3BFF A;  3QHY A;  1K38 A;  4Y7P A;  2ZQD A;  4ZDX A;  3CMZ A;  3MKF A;  4S2M A;  1K55 A;  1K56 D;  2WAE A;  3IT9 A;  2WYX A;  4GKU A;  1K4F A;  1JWZ A;  1QME A;  4KG5 A;  4BL2 A;  3OPH A;  4EWF A;  1ES4 A;  4OON A;  2H0Y A;  2HDU A;  4IVK A;  4JBF A;  1CEF A;  3TSG A;  3V50 A;  4Y0T A;  5EPH A;  1E3U D;  3JYI A;  4EQI A;  5EVI B;  4X6T A;  1W8Y A;  2Y2L A;  1IEL A;  4PMA A;  4DXB A;  3MBZ A;  3GR2 A;  3N8S A;  5EVI A;  1E25 A;  4IVI A;  1FSW A;  5TFQ A;  4YIN A;  5E43 A;  5HW3 A;  3WS5 A;  4BJP A;  1IYP A;  3HLG A;  5HAR A;  3IHA A;  2DCF A;  3TOI A;  3MZF A;  4R3B A;  3E2K A;  1DJA A;  3HLC A;  4DE2 A;  5F83 A;  2HDR A;  3C7U A;  2PU4 A;  1NYY A;  2XR0 A;  5HFO A;  1YLZ A;  2WGV A;  4GN2 A;  2EX9 A;  4Y0O A;  3MXR A;  3BFG A;  1MWR A;  1ES2 A;  4KZB A;  5AQB A;  4S2L A;  3W4Q A;  1YLY A;  2HP5 A;  2CC1 A;  2PU2 A;  5CRF A;  2J9P A;  3PTE A;  5DF9 A;  2ZD8 A;  2Y59 A;  4S2O A;  4QU3 A;  4QY6 A;  1BLP A;  3UDI A;  3VP0 A;  1FCM A;  1U60 A;  3HRE A;  4OQI A;  5M18 A;  2HP6 A;  4CJN A;  1Y54 A;  3GV9 A;  3IF6 B;  1NY0 A;  4E3I A;  1E4D A;  1G6A A;  4LEN A;  3NDE A;  2Y2J A;  3CZD A;  4MEZ A;  4Z9Q A;  4DKI A;  2XGN A;  1NYM A;  2Q9N A;  1MPL A;  1RGZ A;  3BLS A;  5BOH A;  5KSC A;  1OME A;  3RXW A;  1XGI A;  3A3F A;  4E3M A;  3M6H A;  5FQJ A;  1BZA A;  4X68 A;  3E2L A;  1M40 A;  4UAA A;  5GL9 A;  2DNS A;  2WZZ A;  1MWS A; 
#chains in the Genus database with same CATH topology
 4NKP A;  1XXM A;  3TRC A;  1ZTU A;  3DW0 A;  2Y2O A;  4OPZ A;  1JTG A;  1RCJ A;  1A0K A;  4QPR A;  4YNR A;  2EFX A;  3BY9 A;  3ITB A;  3HLB A;  1GCE A;  4KZ5 A;  3UE1 A;  1YM1 A;  2QKP A;  1IYO A;  2OLU A;  1NWZ A;  4Y2F A;  1BTL A;  4JXG A;  3MXS A;  5A93 A;  3ICY A;  4S2J A;  2G7U A;  1HLU P;  5HX9 A;  4R70 A;  3T4T A;  1VET A;  3CLO A;  3OLO A;  2DRW A;  1S4R A;  3EQV A;  3ZNT A;  3FC7 A;  2XQZ A;  3ZHH A;  1DY6 A;  3ULF A;  4OOM A;  4RYE A;  5FEG A;  4K91 A;  1LL8 A;  5FDH A;  2PD7 A;  2HV1 A;  4Y0U A;  3BY8 A;  5EVI D;  4KZ6 A;  1ESI A;  4EQ1 A;  4Y13 A;  1ALQ A;  3GMW A;  3WS0 A;  2XSS A;  1S6R A;  3LR5 A;  2R9X A;  2HDQ A;  4HH2 A;  3ZG9 B;  4X69 A;  3A0V A;  4ESP A;  4CLC C;  1H0M A;  3K2N A;  4DE3 A;  2M1C A;  2EXA A;  1DP9 A;  2ZC7 A;  4QJG A;  2ZQ7 A;  4FSF A;  5HAP A;  4GD6 A;  1N4O A;  2Y91 A;  4KZ7 A;  4DRT A;  3OCL A;  3GQZ A;  3EGX C;  3JVU A;  3ZCZ A;  3NJA A;  3IX4 A;  3WS1 A;  4DE0 A;  4OOL A;  4B93 A;  3LIA A;  3TJZ C;  3W4P A;  3BFC A;  4E6W A;  1MC0 A;  2A2L A;  1ERO A;  2JKF A;  4OQG A;  1VHM A;  4PKY A;  3T4L A;  3DTE A;  4WZ5 A;  2GZA A;  2VGL S;  4EUZ A;  2ZM0 A;  5EVI C;  3LY4 A;  1YKD A;  3H82 A;  2OLV A;  1D06 A;  4EUV A;  3D4F A;  1ZHH B;  2YKH A;  2W27 A;  3N8L A;  3BQ8 A;  3PBR A;  3VSK A;  3IS2 B;  1IYS A;  2V9A A;  5DKK A;  5C5K A;  1K4E A;  3RXX A;  2ZQ8 A;  4PPR A;  2D01 A;  1KGG A;  2Y2G A;  4NXF A;  4GLQ A;  3V3S A;  3E0Y A;  3I7J A;  4U0X A;  3CG5 A;  3C30 A;  3RTY A;  3MFD A;  4KZ3 A;  5GLA A;  4GDB A;  4RX3 A;  3IXH A;  3O3V A;  3BFE A;  2XRO A;  4EES A;  1PI5 A;  5TR7 A;  1WYB A;  5GLD A;  2WUQ A;  3OPP A;  2WZX A;  2VZW A;  3EQU A;  1S67 L;  3SS5 A;  3DTI A;  3N6I A;  1KE0 A;  4JXV A;  1OTB A;  1D7E A;  1H5X A;  4X56 A;  3VP1 A;  1LSW A;  2BAS A;  1P9W A;  2B95 A;  1KVL A;  2EFU A;  1CI9 A;  4LV2 A;  3CIT A;  3SS3 A;  1LL5 A;  2VEA A;  1FIK A;  2P04 A;  1JVJ A;  2WKH A;  4OPY A;  4EEU A;  4BD0 A;  3OBF A;  2W1R A;  1SKO B;  4X53 A;  2WAD A;  4HHD A;  3SZT A;  3GVB A;  3AGD A;  2ZMF A;  4ZJ3 A;  1K57 C;  3T4O A;  3EEA A;  4OQH A;  4I39 A;  4EET B;  4OH0 A;  4Y15 A;  2XEP A;  5KIZ A;  4R0Q A;  3S7O A;  2E8J A;  2HPB A;  4GOG A;  3D9Y A;  4FOF A;  3S22 A;  4UQI S;  5AQ7 A;  3WRZ A;  1L0E A;  2JKT M;  3BYD A;  2NUP C;  4UHU A;  2VLG A;  2EA9 A;  4KZ9 A;  1NZU A;  4IHQ A;  4LRX C;  5JYP A;  4ID4 A;  3B47 A;  3MMH A;  3UB7 A;  2VJW A;  2QPN A;  5AQ9 A;  4WBG A;  3BRM A;  2WKR A;  1L2S A;  2OV5 A;  3HUO A;  1G5U A;  3DTK A;  3H7W B;  4PM9 A;  2A3U A;  2H28 A;  3NCK A;  2QJ7 A;  5TGF A;  3UPO A;  2ZL1 B;  1CJF A;  5TBM A;  2PT7 A;  3T1X A;  3Q07 A;  1N9O A;  1XP4 A;  4EV4 A;  2X01 A;  4CPK A;  1WE4 A;  3EEH A;  5CEC A;  4EBN A;  3KSH A;  1YLJ A;  3C4P A;  2XRN A;  3ZG8 B;  2ZQ9 A;  1YMS A;  4OOY A;  2QHK A;  1GSX A;  3ZVT A;  4EU0 A;  4P85 A;  4Y7P A;  3QHY A;  1K38 A;  3LIC A;  2ZQD A;  4G3K A;  4JGP A;  1T1A A;  4KG5 A;  4GKU A;  4BL2 A;  2Y79 A;  3OPH A;  4LPZ A;  1XJ4 A;  2V8C A;  1IEL A;  1STZ A;  3GR2 A;  3N8S A;  5EVI A;  1BYW A;  4IVI A;  1FSW A;  4YIN A;  5E43 A;  3WS5 A;  1VEU A;  1IYP A;  3HLG A;  5J7E A;  4R3B A;  1G6O A;  3E2K A;  3HLC A;  2HZ5 A;  4DE2 A;  3H82 B;  3F1O B;  2I9V A;  2EX9 A;  3MXR A;  1T1C A;  4KZB A;  3W4Q A;  1YLY A;  2HP5 A;  2CC1 A;  4M4X A;  4Z1W A;  2PU2 A;  5CRF A;  2J9P A;  3UDI A;  3MQO A;  3VP0 A;  3HRE A;  1NLZ A;  1OTI A;  1XJ3 A;  1Y54 A;  3IF6 B;  4O8G A;  1G6A A;  3NDE A;  3FG8 A;  1XJ6 A;  2K7S A;  5DKL A;  4Z9Q A;  3QP2 A;  2O9B A;  2HJ9 C;  3BLS A;  3NOP C;  1LSV A;  5KSC A;  1OME A;  3RXW A;  1XGI A;  3A3F A;  1CF0 A;  2MJ6 A;  5AQA A;  2B02 A;  3QP8 A;  3ISG A;  3Q81 A;  3UO9 A;  2ACG A;  3P09 A;  3G31 A;  5HWW A;  3GRJ A;  4E3N A;  2GNX A;  1HD8 A;  1ESU A;  2G2U A;  3HLD A;  3T1S A;  2A24 A;  1GA0 A;  5FL3 A;  5G4Y A;  4EXO A;  3LR0 A;  2JCH A;  5CED A;  4PHT A;  4WN5 A;  2QZ6 A;  1V9Y A;  4WZ5 C;  4NEE D;  2INW A;  4E3K A;  2V20 A;  2JC7 A;  5HDD A;  3OC2 A;  1KVM A;  3UB9 A;  5AVE A;  5DTK A;  3VFF A;  4R4R A;  1DP6 A;  4X1M A;  3IWQ A;  1KGE A;  2B5R A;  2ZLY A;  4L9F A;  3ZFZ A;  3PBO A;  3WRT A;  3R4K A;  4MDZ A;  3ZDJ A;  2VV8 A;  2G2W A;  1HVB A;  1K0K A;  3HL9 A;  5GLB A;  4P6Z S;  1Q2P A;  2PYP A;  5EVE A;  5CGX A;  1NRF A;  1E3U A;  1K25 A;  4EBP A;  1I2W A;  3RH8 B;  3W4O A;  1I2S A;  5CTM A;  4KQR A;  3N7W A;  3B42 A;  3G2Y A;  3MKE A;  1N9N A;  2P08 A;  1HZO A;  5HDS A;  3LY3 A;  4NXB A;  3DTM A;  4IJG A;  4HIA A;  4PM7 A;  3SS4 A;  5EOO A;  3IX3 A;  3UN7 A;  2RL3 A;  4L9E A;  4WZ4 A;  3MFX A;  3UDF A;  3ZG7 B;  2KX6 A;  1JNU A;  4ZRR A;  5IHV A;  5HD5 A;  3F1P B;  1IOU A;  1P97 A;  4ZAM A;  4LV3 A;  3IS2 A;  4WEJ A;  1C3B A;  3IF5 A;  5GHX A;  4O01 A;  1LSX A;  4DDY A;  1YLP A;  3LYX A;  4QHC A;  3UE3 A;  4UQI M;  4P87 A;  1IFQ A;  4OQ0 A;  3LO7 A;  3FKV A;  5DF7 A;  5MC7 A;  4UA6 A;  4JF5 A;  1KDW A;  3HUN A;  5EM1 A;  2ZBB A;  3ZG5 A;  5A90 A;  4KG6 A;  5HSQ A;  3MZE A;  2XK1 A;  1XA7 A;  2ZOH A;  1YSP A;  4WEL A;  5EM0 A;  3JPU A;  1MWT A;  1IKI A;  5HPF A;  4WYY A;  5L07 A;  1OJG A;  2WKE A;  2O9C A;  2OSU A;  5EUA A;  1X0O A;  1YAX A;  1PFL A;  5FSR A;  3PYP A;  3IF6 A;  2M7U A;  2ZQA A;  3EOI A;  1SDN A;  1OTA A;  3S7P A;  4BBU A;  4PM6 A;  2OAP 1;  5D3O A;  2Y2N A;  3HCY A;  4PKY G;  4KUO A;  4JXS A;  4C75 A;  4BWI A;  4JGR A;  5EOE A;  3G32 A;  3E4Q A;  4IUH A;  5FAQ A;  2B18 A;  3OZH A;  3CUE A;  3UB6 A;  1LL9 A;  1VB6 A;  3MSH A;  5K5B A;  4Q0H A;  4LFU A;  2CMN A;  3LIB A;  5DFY A;  3T4S A;  3CAX A;  3QP1 A;  3W8K A;  2Q0O A;  4JLF A;  3IF6 C;  4WEK A;  3PAG A;  3FPW A;  3GSG A;  2Y2Q A;  5DTT A;  3BFD A;  2LB9 A;  1BSG A;  4E3O A;  4X55 A;  4EER A;  2Y2K A;  2WAF A;  2EWV A;  1S0W A;  4CLC E;  3BWL A;  1GHP A;  4N1X A;  3CUE C;  1ERQ A;  3B3X A;  2JBF A;  2VV7 A;  2Y8H A;  2XDM A;  4KQQ A;  3Q1F A;  5DF8 A;  2A24 B;  5M1A A;  4GNU A;  4Y3I A;  1PRQ A;  1SCW A;  3F1O A;  4N1H A;  3R7W A;  4BL3 A;  3JVV A;  2OOL A;  3V3R A;  4BLM A;  4CLC B;  4MNR A;  4DJ3 A;  3CPT A;  1FSY A;  2J3T C;  1FR6 A;  4B4X A;  3U2A A;  5J8X A;  1EI5 A;  3IH8 A;  1KDS A;  5L2F A;  4PM8 A;  4DDS A;  3C8C A;  2BG1 A;  3P01 A;  3VP3 A;  3V5M A;  2EX2 A;  1GHM A;  2UV0 E;  4KG2 A;  3UME A;  2ZC4 B;  4DMZ A;  3PHY A;  3SH9 A;  3S4X A;  5LBR A;  2V8F A;  4GS9 B;  4R4S A;  4B9O A;  3CHW P;  2VGK A;  3O88 A;  1H3Q A;  3ZGA B;  2XLN A;  1WA9 A;  3FZC A;  1K57 A;  1MKM A;  1BLC A;  1F9I A;  5GHY A;  1VQQ A;  4OP8 A;  4FCF A;  2E8I A;  2XF3 A;  3C5A A;  3MXQ A;  1TEM A;  4FTX A;  3T4K A;  5A8B A;  2QJ5 A;  4KQO A;  1G68 A;  5G4Z A;  5CXW A;  1L0F A;  5CER A;  1KE3 A;  4HBU A;  2L4R A;  3C38 A;  3KSF A;  1UGU A;  3LR4 A;  2W3H A;  5EE8 A;  2L0W A;  3GEC A;  1P0Z A;  3NOT C;  4BBT A;  5CGS A;  1PIO A;  4QD4 A;  5G18 A;  5HZH A;  3G2Z A;  4X1L A;  4U0T A;  4B88 A;  1XPB A;  4HQA A;  5M19 A;  3BJN A;  3LFV A;  3NHQ A;  3MKF A;  4LRZ E;  2WAE A;  5L8M A;  4E04 A;  4IVK A;  2HDU A;  3TSG A;  2HJE A;  4Y0T A;  4UEY A;  4X6T A;  1W8Y A;  3MBZ A;  4F3L A;  2FH5 A;  3TE8 A;  5HPI A;  3RFB A;  5HAR A;  2KDK A;  2DCF A;  5F83 A;  2HDR A;  2W3E A;  4MN5 A;  2PU4 A;  1NYY A;  2XR0 A;  4I3I A;  4Y0O A;  4G3W A;  1T18 A;  3U4L P;  3PTE A;  2Y59 A;  4Q0J A;  4QU3 A;  2JN7 A;  1FCM A;  2QYB A;  2HP6 A;  1NY0 A;  4ETX A;  2Y2J A;  4DKI A;  4R38 A;  2XGN A;  2HF6 A;  1MPL A;  1RGZ A;  4F3L B;  3BW6 A;  4E3M A;  5CX7 A;  2PHY A;  3M6H A;  1BZA A;  4G3V A;  3M2K A;  1O7E A;  3ITA A;  1NRJ A;  3QP5 A;  3KX0 X;  5KZH A;  1PZP A;  2W3F A;  4N9L A;  4R3A A;  3QNC A;  5KMW A;  4OP5 A;  2YKF A;  2Z2M B;  3ZQ5 A;  2GJ3 A;  1Q2Q A;  5FQ9 A;  1JWV A;  5F1F A;  3L7H A;  4QB8 A;  4M3K A;  2ZMV A;  4JPM A;  4JF4 A;  5A92 A;  3H7W A;  3TG9 A;  4GHI B;  3L9K A;  3VE4 A;  2HP9 A;  4DE1 A;  1OPX A;  1XFQ A;  2VGJ A;  1SDE A;  3QP4 A;  3A3D A;  3T50 A;  1CEG A;  3AGF A;  2VA0 A;  3E98 A;  4GJ4 A;  4MBH A;  1XFN A;  4GD8 A;  5CGW A;  4E6X A;  1ODV A;  3T4Q A;  2GX5 A;  1XX2 A;  3UE0 A;  4HI4 A;  2P9V B;  2UWX A;  2C6W B;  3CPT B;  3O87 A;  4NET A;  2D02 A;  3SH8 A;  2FFF B;  3T12 B;  4P6B A;  4XUZ A;  4OPR A;  1MY8 A;  3NOU C;  2WKI A;  4N9K A;  5F5Y A;  1J9M A;  4JGO A;  3OPR A;  3SW1 A;  3VMA A;  3C2W A;  4S2N C;  4HEF A;  5FQI A;  3WS2 A;  2OAQ 1;  3UE6 A;  4H6J A;  5FAS A;  5CHM A;  3F1N B;  3IBJ A;  5CHJ A;  1OTE A;  3DBA A;  1W7F A;  3WS4 A;  3OPL A;  2R9W A;  4FH2 A;  1JTD A;  4MBK A;  5E2F A;  1Y4O A;  3C7V A;  3PAE A;  2EX6 A;  5A91 A;  5FAP A;  3EGD C;  4MN6 A;  2H5S A;  1H8Z A;  3P7N A;  5FQM A;  2W1T B;  4S2N A;  4JXW A;  1EWZ A;  4CQH A;  1ONG A;  3A0R A;  4MBF A;  2ZC3 B;  5CTN A;  1PZO A;  4Q8I A;  4OKP A;  4S2P A;  2O9A A;  2J9O A;  4C3Q A;  4LCL A;  4WUJ A;  5E2H A;  4RA7 A;  3P98 A;  3G6O A;  4HJ6 A;  3MS6 A;  4HES A;  4C6Y A;  2PDR A;  4R23 A;  5DFX A;  1PI4 A;  1ZG6 A;  2WKP A;  3VE3 A;  3HUM A;  1YLT A;  1YLW A;  1F5M A;  3UY6 A;  1W5D A;  2WK0 A;  2DMW A;  1PWG A;  4RVA A;  5FI6 A;  5I94 A;  4DXC A;  2NUT C;  2XA7 S;  2Z6D A;  4H6J B;  3OOV A;  2BLS A;  4HY8 A;  2WGW A;  5CHU A;  2HGV A;  1S1Y A;  4P0M A;  5F6A A;  4WMC A;  5DJU A;  3DWZ A;  1RP5 A;  3S1Y A;  3IXG A;  3K3C A;  4GDN A;  2H0T A;  4AFI A;  5J3W A;  5F69 A;  2WKQ A;  3VSL A;  3NI9 A;  3A0S A;  1MBL A;  3UB5 P;  5KSH A;  4N92 A;  4EW7 A;  1W63 Q;  2V1B A;  3HLE A;  2AVX A;  2IWD A;  1DP8 A;  3MQ0 A;  1DJC A;  5HAQ A;  4IBR A;  2V1A A;  2QWS A;  4IBX A;  3BQA A;  2J80 A;  2Y2I A;  1EW0 A;  2RCX A;  4UA7 A;  4DJ2 A;  3PBT A;  1J3W A;  3NBL A;  1FIL A;  1PWD A;  4U3T A;  3W2Z A;  1ONH A;  3G4P A;  4LCM A;  2ZQC A;  3FWL A;  4ETZ A;  2X02 A;  1DJB A;  2O99 A;  5EVL A;  1ZC2 A;  1F98 A;  1W79 A;  5AJG A;  1H8Y A;  3IBR A;  3LCE A;  4XXR A;  4GCZ A;  4JKT A;  1NLY A;  1LLB A;  4L9G A;  4R6L A;  4MMN A;  2XFS A;  2Y55 A;  2W3D A;  1YMX A;  3NY4 A;  4MN7 A;  4E3J A;  4ZTK A;  3TW8 A;  1FQG A;  4RX2 A;  5U47 A;  2J8Y A;  3UDX A;  2VGL M;  1VM1 A;  4BEN A;  2GDN A;  3LIE A;  4LLO B;  4EBL A;  3IWO A;  1TS0 A;  5F68 A;  4LRY C;  3Q7V A;  1GHI A;  1IKG A;  2Y2H A;  2W1T A;  1LI9 A;  1I5Q A;  1Z09 A;  2Y2P A;  5EEC A;  3M6B A;  3NC8 A;  3D3O A;  2J3T D;  1D1J A;  1MZU A;  3VP2 A;  5HD3 A;  2PR5 A;  5F82 A;  2W3G A;  4YWZ A;  5L09 A;  1LHY A;  2KOI A;  4BQM A;  2PRF A;  4UA9 A;  4P6Z M;  2XD1 A;  4NG2 A;  3NUL A;  1O07 A;  1VET B;  4HP9 A;  3F1N A;  4QY5 A;  5FA7 A;  2EWW A;  4ME4 A;  3EWK A;  1AWI A;  1TVF A;  2V0U A;  4EEP A;  1YPR A;  1TF1 A;  2H10 A;  1QMF A;  5E2E A;  1CK3 A;  4B4Z A;  3HLW A;  1TDL A;  3FV7 A;  4LGW A;  1P9R A;  5HL6 A;  4XUX A;  3Q82 A;  3IQA A;  1YQS A;  3BFF A;  4ZDX A;  1V9Z A;  3CMZ A;  1K56 D;  1W63 M;  1K4F A;  1QME A;  4Q0I A;  3V50 A;  3JYI A;  4YOF A;  2JKG A;  4EQI A;  3O5Y A;  4PMA A;  4DXB A;  5TFQ A;  4BJP A;  2PBD P;  2W0N A;  3TOI A;  3MZF A;  4D60 A;  3C7U A;  2K2N A;  1YLZ A;  1OJ5 A;  4GN2 A;  4JGQ A;  1ACF A;  1MWR A;  4GHI A;  1TS8 A;  5DF9 A;  2ZD8 A;  2VX8 A;  4QY6 A;  1BLP A;  2PAV P;  1U60 A;  3B33 A;  4OQI A;  5M18 A;  4BMW A;  1SZV A;  1OT9 A;  1E4D A;  1T19 A;  2Q9N A;  4RQ9 A;  4HH3 A;  3S7N A;  4QWO A;  2KLI A;  4X68 A;  3E2L A;  1M40 A;  4UAA A;  2DNS A;  2WZZ A;  4PAU A;  3DWK A;  1TS6 A;  5TBM B;  3LID A;  3T1Q B;  1PYY A;  4KZ8 A;  2IWC A;  2XFT A;  5GLC A;  3UB8 A;  5HWT A;  4WMC D;  3LIF A;  5HWV A;  3LEQ A;  3BM6 A;  1TS7 A;  3ZYT A;  3Q7V B;  5HL1 A;  1XA1 A;  3HJI A;  3A3E A;  3FYZ A;  2X71 A;  5FDS A;  3UNW A;  4JF6 A;  3AGE A;  2PBY A;  4Y5F A;  1CQA A;  3IWI A;  1K6R A;  4LV0 A;  1VEU B;  5FQQ A;  4E3L A;  1ERM A;  4KEN B;  3G30 A;  1PWC A;  5GHZ A;  1ZKJ A;  1K6S A;  1TDG A;  4XT2 B;  2C5W B;  3KYQ A;  3UPP A;  3V67 A;  1MKI A;  3KYZ A;  3NDG A;  1PW1 A;  5HDC A;  4O7D A;  1BT5 A;  3WWX A;  4GZB A;  5DTS A;  3G35 A;  1K55 C;  3HBR A;  1HTZ A;  4I3J A;  3KSI A;  1WYC A;  3K3D A;  2FFY A;  4A5R A;  5FQK A;  3GTC A;  1LT0 A;  2Y2M A;  1FR1 A;  2ZC6 B;  3VFH A;  3LEZ A;  3S7Q A;  2Z2L B;  4L0L A;  1DRM A;  2QMI A;  1K54 C;  4BD1 A;  3PBN A;  3BEC A;  3VP4 A;  1BLS A;  3VOZ A;  2IWB A;  4FD8 A;  3PBS A;  4X25 A;  1BLH A;  1TD5 A;  5EFW A;  2J7V A;  5HAI A;  5JYO A;  1K54 A;  5TJJ A;  4I5S A;  3VOY A;  3Q7Z A;  2JKR M;  4O0P A;  4I3A A;  1SHV A;  3N8R A;  4GS9 A;  4HNB A;  3V39 A;  5E2G A;  3C4O A;  1Y28 A;  1IYQ A;  4NXG A;  2V2F F;  1XKZ A;  4K0X A;  2A49 A;  4K08 A;  1H8M A;  1W8Q A;  1FOF A;  1M6K A;  3QP6 A;  2PR6 A;  2BTF P;  2Y4A A;  1S1Z A;  3IHB A;  3IX8 A;  4FH4 A;  3GDI A;  1GSV A;  3MZD A;  3M2J A;  4KQD A;  1K56 A;  4HOI A;  4XT2 A;  1AXB A;  1S4S A;  3LR3 A;  5IT5 A;  4ZBE A;  4OPQ A;  1NXY A;  3RJU A;  2V1Z A;  2JE5 A;  1CI8 A;  3N4I A;  3FKW A;  2PYR A;  1G28 A;  5FI2 A;  4R3J A;  3PXP A;  1SKO A;  1L3L A;  1YT4 A;  4GW9 A;  2VK3 A;  3A3I A;  1UWP X;  3QNB A;  4HJ3 A;  4YFM A;  3PBQ A;  4LV1 A;  4KZA A;  3SH7 A;  2V0W A;  1KOU A;  3HJK A;  4K0W A;  1IEM A;  4I38 A;  1GSW A;  2EXB A;  1T1B A;  2LB5 A;  2P9V A;  3ZVW A;  1N9L A;  3BLM A;  1FCO A;  3HLF A;  4II7 A;  2OWJ A;  3IXD A;  1S66 L;  4ARZ A;  1XGJ A;  3CWF A;  4R1G A;  4CLC D;  2ZM2 A;  2I72 A;  2M7V A;  1L0D A;  1N9B A;  3FPV A;  4D2O A;  1GA9 A;  4MLL A;  4IED A;  4HP4 A;  3R7W B;  2PD8 A;  2HDS A;  5DVA A;  1LI0 A;  4PM5 A;  4OVD A;  3IH9 A;  4S2I A;  5J4E A;  2K31 A;  2XD5 A;  3T4J A;  3CI6 A;  4HJ4 A;  2WGW B;  4HBT A;  1OTD A;  2JKR I;  4WLA A;  2ZL1 A;  3MR0 A;  3E4O A;  3F1P A;  1ZG4 A;  4OLD A;  1OT6 A;  1FCN A;  4KZ4 A;  4WM9 A;  3CJM A;  5I5L A;  2JKT I;  2FZ0 A;  1L0G A;  1MXO A;  1RGY A;  5L10 A;  1NZO A;  3ZNY A;  4ZJ1 A;  1ES3 A;  3MF0 A;  3LI9 A;  2XH9 A;  4NK3 A;  2VKS A;  1KGF A;  3A3J A;  1Z6F A;  4S2K A;  5DJT A;  2OWH A;  4WL9 A;  5IS1 A;  4ZJ2 A;  1NJ4 A;  3BEB A;  4MCW A;  5FI7 A;  1PW8 A;  3H9W A;  1JWP A;  1XJ2 A;  3SOI A;  4Y17 A;  1MWU A;  3OCN A;  3NEC A;  4CLC A;  4DN0 A;  4ARZ B;  3MJQ A;  2ZMA A;  3ZG0 A;  3MQQ A;  2O0Y A;  3E4P A;  5FAO A;  1ES5 A;  4IUK A;  4OLG A;  4BBV A;  3NIA A;  3LI8 A;  5CEB A;  1BUL A;  1YSQ A;  2XA7 M;  3IXB A;  2WGI A;  4DF6 A;  1F2K A;  2P74 A;  1BUE A;  3PR6 A;  5F1G A;  2ZJ9 A;  2ZC5 B;  4KUK A;  2ZM8 A;  2EX8 A;  2VV6 A;  3G34 A;  5FAT A;  2Q9M A;  5FEF A;  1KE4 A;  3HVF A;  4F94 A;  5AVF A;  2R78 A;  4H8R A;  3O86 A;  2J3W A;  4GB7 A;  1UWN X;  1SKF A;  2L1M A;  5IU1 A;  3UPN A;  3LGO A;  4WF0 A;  4S2M A;  4NXE A;  1K55 A;  3IT9 A;  4EWF A;  2WYX A;  1JWZ A;  1ES4 A;  4OON A;  2H0Y A;  4JBF A;  2ZOI A;  1CEF A;  5EPH A;  3VV4 A;  1E3U D;  5EVI B;  2Y2L A;  3DAV A;  1E25 A;  4FUW A;  5HW3 A;  3IHA A;  1DJA A;  2Z6C A;  5HFO A;  1PNE A;  2WGV A;  3KYE A;  3BFG A;  1ES2 A;  5AQB A;  4S2L A;  5EV0 A;  3KSG A;  2IA2 A;  2JHE A;  3LUQ A;  3UMD A;  3T1R A;  4S2O A;  3KO6 A;  4CJN A;  3GV9 A;  3VOL A;  4E3I A;  3D72 A;  4LEN A;  2P7J A;  3CZD A;  4MEZ A;  1NYM A;  5BOH A;  5FQJ A;  5GL9 A;  1MWS A; 
#chains in the Genus database with same CATH homology
 3M2K A;  1O7E A;  3ITA A;  3DWK A;  5AQA A;  1XXM A;  3ISG A;  3DW0 A;  3Q81 A;  3UO9 A;  2Y2O A;  1PYY A;  3P09 A;  3G31 A;  5KZH A;  1PZP A;  4KZ8 A;  2IWC A;  2XFT A;  5GLC A;  4N9L A;  3GRJ A;  4OPZ A;  1JTG A;  1RCJ A;  4E3N A;  3QNC A;  5KMW A;  4OP5 A;  1HD8 A;  1ESU A;  4WMC D;  2EFX A;  2G2U A;  2Z2M B;  3HLD A;  1GA0 A;  3BM6 A;  3ITB A;  3HLB A;  1GCE A;  1Q2Q A;  2JCH A;  3Q7V B;  1YM1 A;  4KZ5 A;  5FQ9 A;  3UE1 A;  5CED A;  5HL1 A;  1JWV A;  1IYO A;  5F1F A;  2OLU A;  2QZ6 A;  1BTL A;  4WZ5 C;  4QB8 A;  4JXG A;  4M3K A;  2V20 A;  3MXS A;  1XA1 A;  2JC7 A;  4JF4 A;  4JPM A;  4E3K A;  5A93 A;  3OC2 A;  5A92 A;  3A3E A;  1KVM A;  3FYZ A;  4S2J A;  3TG9 A;  5DTK A;  2X71 A;  5HX9 A;  2HP9 A;  3UNW A;  4DE1 A;  3VFF A;  4R4R A;  3IWQ A;  4JF6 A;  2VGJ A;  1KGE A;  1SDE A;  3AGE A;  2PBY A;  2B5R A;  2ZLY A;  2DRW A;  3ZFZ A;  3A3D A;  1CEG A;  3EQV A;  3AGF A;  3PBO A;  3ZNT A;  3IWI A;  1K6R A;  3WRT A;  4LV0 A;  3ZDJ A;  2G2W A;  1HVB A;  5FQQ A;  4E3L A;  1ERM A;  2XQZ A;  3G30 A;  3HL9 A;  4KEN B;  4MBH A;  1PWC A;  4GD8 A;  3ZHH A;  5CGW A;  5GHZ A;  5GLB A;  4E6X A;  1DY6 A;  1Q2P A;  1ZKJ A;  4OOM A;  1XX2 A;  1K6S A;  1TDG A;  4RYE A;  2P9V B;  3UE0 A;  2UWX A;  2C6W B;  2C5W B;  4K91 A;  5CGX A;  3UPP A;  1MKI A;  1NRF A;  1E3U A;  1K25 A;  3O87 A;  5FDH A;  4EBP A;  4NET A;  3SH8 A;  1I2W A;  4Y0U A;  3W4O A;  3NDG A;  1PW1 A;  2FFF B;  5EVI D;  4P6B A;  4KZ6 A;  1ESI A;  4XUZ A;  1I2S A;  1ALQ A;  5CTM A;  4KQR A;  4OPR A;  3N7W A;  3GMW A;  3WS0 A;  4O7D A;  1BT5 A;  3WWX A;  1MY8 A;  3G2Y A;  3MKE A;  4GZB A;  5DTS A;  2WKI A;  4N9K A;  1S6R A;  1HZO A;  1K55 C;  3G35 A;  1HTZ A;  3HBR A;  1J9M A;  2R9X A;  2HDQ A;  3OPR A;  1WYC A;  3LY3 A;  3ZG9 B;  4X69 A;  3DTM A;  4PM7 A;  3VMA A;  2FFY A;  4S2N C;  4HEF A;  5FQI A;  5FQK A;  3SS4 A;  3WS2 A;  5EOO A;  4A5R A;  3GTC A;  4DE3 A;  2Y2M A;  3UN7 A;  1FR1 A;  2RL3 A;  2ZC6 B;  3UDF A;  4WZ4 A;  3ZG7 B;  3VFH A;  5FAS A;  5CHM A;  3LEZ A;  2EXA A;  5CHJ A;  2Z2L B;  4L0L A;  5IHV A;  2QMI A;  2ZC7 A;  1W7F A;  1K54 C;  4BD1 A;  3PBN A;  3BEC A;  4ZAM A;  4LV3 A;  3VP4 A;  1BLS A;  3VOZ A;  3WS4 A;  2IWB A;  3OPL A;  3PBS A;  1C3B A;  2R9W A;  3IF5 A;  4FD8 A;  4WEJ A;  2ZQ7 A;  5GHX A;  4FSF A;  4QJG A;  4FH2 A;  1JTD A;  4MBK A;  5HAP A;  4GD6 A;  4DDY A;  1BLH A;  1N4O A;  1YLP A;  2Y91 A;  2J7V A;  4KZ7 A;  5E2F A;  3OCL A;  5HAI A;  4DRT A;  1K54 A;  4QHC A;  5JYO A;  3UE3 A;  3GQZ A;  3VOY A;  3Q7Z A;  4P87 A;  4OQ0 A;  3ZCZ A;  3C7V A;  3LO7 A;  3FKV A;  5DF7 A;  3WS1 A;  4DE0 A;  4UA6 A;  4OOL A;  4JF5 A;  1KDW A;  3HUN A;  3PAE A;  2EX6 A;  5A91 A;  1SHV A;  3N8R A;  5FAP A;  3V39 A;  5E2G A;  3W4P A;  3C4O A;  2H5S A;  1H8Z A;  1IYQ A;  5FQM A;  3ZG5 A;  3BFC A;  5A90 A;  4KG6 A;  4E6W A;  4S2N A;  1ERO A;  2V2F F;  3MZE A;  1XKZ A;  2XK1 A;  4K0X A;  4OQG A;  2A49 A;  1XA7 A;  1W8Q A;  1FOF A;  1M6K A;  4WEL A;  4JXW A;  4WZ5 A;  1EWZ A;  1ONG A;  2Y4A A;  1MWT A;  3IHB A;  4MBF A;  2ZC3 B;  4FH4 A;  1IKI A;  5CTN A;  4EUZ A;  2ZM0 A;  3MZD A;  3M2J A;  1PZO A;  4WYY A;  4OKP A;  4Q8I A;  1K56 A;  2WKE A;  4S2P A;  5EVI C;  3LY4 A;  2OSU A;  2J9O A;  4C3Q A;  1AXB A;  4LCL A;  5EUA A;  5E2H A;  4RA7 A;  4ZBE A;  2OLV A;  4OPQ A;  5FSR A;  3P98 A;  1NXY A;  3RJU A;  2V1Z A;  3IF6 A;  2JE5 A;  1CI8 A;  3D4F A;  3N4I A;  3FKW A;  4HES A;  2ZQA A;  4C6Y A;  3N8L A;  4R23 A;  5FI2 A;  3PBR A;  1PI4 A;  1ZG6 A;  3VSK A;  1SDN A;  4R3J A;  4PM6 A;  3HUM A;  1IYS A;  1YLT A;  5D3O A;  1K4E A;  3RXX A;  2Y2N A;  2ZQ8 A;  4PPR A;  4JXS A;  1YLW A;  1YT4 A;  4C75 A;  3A3I A;  5EOE A;  3G32 A;  1KGG A;  2Y2G A;  3UY6 A;  1W5D A;  2WK0 A;  3QNB A;  1PWG A;  4RVA A;  5FI6 A;  5I94 A;  3V3S A;  3I7J A;  4DXC A;  4YFM A;  3PBQ A;  4U0X A;  2BLS A;  4LV1 A;  5FAQ A;  2WGW A;  4KZA A;  3CG5 A;  5CHU A;  3OZH A;  1LL9 A;  3SH7 A;  4P0M A;  4K0W A;  3MFD A;  1IEM A;  4KZ3 A;  5GLA A;  4GDB A;  4WMC A;  4RX3 A;  2EXB A;  3IXH A;  3DWZ A;  1RP5 A;  3S1Y A;  3IXG A;  4GDN A;  2H0T A;  3O3V A;  3BFE A;  2P9V A;  3ZVW A;  3W8K A;  3BLM A;  1FCO A;  1PI5 A;  1WYB A;  3HLF A;  5GLD A;  2WUQ A;  4JLF A;  3IXD A;  3OPP A;  5TR7 A;  3VSL A;  1XGJ A;  3IF6 C;  3NI9 A;  2WZX A;  4R1G A;  3EQU A;  4WEK A;  1MBL A;  3PAG A;  5KSH A;  2ZM2 A;  2I72 A;  3GSG A;  1L0D A;  4N92 A;  3SS5 A;  3N6I A;  1N9B A;  1KE0 A;  3HLE A;  4JXV A;  1GA9 A;  4D2O A;  2IWD A;  2Y2Q A;  3BFD A;  5DTT A;  4MLL A;  4IED A;  1BSG A;  1H5X A;  4X56 A;  1DJC A;  3VP1 A;  2HDS A;  5DVA A;  5HAQ A;  4IBR A;  1LI0 A;  4PM5 A;  4OVD A;  4E3O A;  4X55 A;  4IBX A;  2Y2K A;  2WAF A;  1KVL A;  2EFU A;  3IH9 A;  4S2I A;  1S0W A;  1CI9 A;  2Y2I A;  2RCX A;  4UA7 A;  1GHP A;  4LV2 A;  4N1X A;  2XD5 A;  3PBT A;  3NBL A;  1ERQ A;  1PWD A;  4U3T A;  3SS3 A;  1LL5 A;  2WGW B;  3B3X A;  2JBF A;  4HBT A;  1JVJ A;  2XDM A;  1ONH A;  2WKH A;  3G4P A;  3Q1F A;  4KQQ A;  2ZQC A;  3FWL A;  4LCM A;  4OPY A;  5DF8 A;  4BD0 A;  2X02 A;  5M1A A;  1DJB A;  4X53 A;  2WAD A;  4GNU A;  3GVB A;  1SCW A;  1ZG4 A;  4OLD A;  5EVL A;  1FCN A;  1ZC2 A;  4KZ4 A;  4WM9 A;  3CJM A;  4N1H A;  1L0G A;  1MXO A;  1W79 A;  4BL3 A;  1RGY A;  3AGD A;  4ZJ3 A;  3V3R A;  1H8Y A;  1NZO A;  1K57 C;  3LCE A;  4XXR A;  4BLM A;  4JKT A;  4MNR A;  4OQH A;  3ZNY A;  1LLB A;  1FSY A;  2XFS A;  4OH0 A;  4ZJ1 A;  1ES3 A;  2XH9 A;  1FR6 A;  4NK3 A;  2XEP A;  4B4X A;  1KGF A;  2Y55 A;  3A3J A;  1Z6F A;  4S2K A;  4R0Q A;  1YMX A;  3NY4 A;  1EI5 A;  5J8X A;  3IH8 A;  4E3J A;  2HPB A;  4GOG A;  4ZTK A;  1FQG A;  4RX2 A;  4ZJ2 A;  1NJ4 A;  5U47 A;  2J8Y A;  1KDS A;  5L2F A;  3UDX A;  4PM8 A;  3S22 A;  3BEB A;  5AQ7 A;  4DDS A;  1VM1 A;  5FI7 A;  4BEN A;  2BG1 A;  2GDN A;  3VP3 A;  3WRZ A;  1PW8 A;  1L0E A;  4EBL A;  3BYD A;  3IWO A;  3V5M A;  1JWP A;  2EX2 A;  3Q7V A;  1GHI A;  1IKG A;  1GHM A;  2Y2H A;  4UHU A;  4KG2 A;  4KZ9 A;  1LI9 A;  1I5Q A;  1NZU A;  3SOI A;  2ZC4 B;  3SH9 A;  1MWU A;  3OCN A;  5JYP A;  2Y2P A;  3S4X A;  4ID4 A;  5EEC A;  4R4S A;  3M6B A;  3NC8 A;  2VGK A;  2ZMA A;  3O88 A;  2QPN A;  3ZGA B;  3ZG0 A;  5AQ9 A;  2XLN A;  4WBG A;  3VP2 A;  3BRM A;  5FAO A;  1L2S A;  5F82 A;  1ES5 A;  2OV5 A;  3FZC A;  3HUO A;  1K57 A;  4OLG A;  1BLC A;  1LHY A;  3NIA A;  4PM9 A;  5CEB A;  2A3U A;  1BUL A;  5GHY A;  3NCK A;  3IXB A;  1VQQ A;  4OP8 A;  4FCF A;  2WGI A;  4BQM A;  2E8I A;  4DF6 A;  4UA9 A;  2XD1 A;  2XF3 A;  3C5A A;  1TEM A;  5TGF A;  3UPO A;  2P74 A;  1O07 A;  1BUE A;  4KQO A;  1G68 A;  4QY5 A;  5FA7 A;  5CXW A;  5F1G A;  2ZJ9 A;  2ZC5 B;  1L0F A;  1XP4 A;  2ZM8 A;  3Q07 A;  1KE3 A;  2EX8 A;  3G34 A;  5CER A;  2X01 A;  4EV4 A;  1TVF A;  4HBU A;  4CPK A;  1WE4 A;  5EE8 A;  5FAT A;  2Q9M A;  1KE4 A;  5CEC A;  2H10 A;  3HVF A;  4EBN A;  4F94 A;  1QMF A;  5E2E A;  1CK3 A;  4H8R A;  5CGS A;  4B4Z A;  3HLW A;  1TDL A;  3O86 A;  1PIO A;  4QD4 A;  5G18 A;  3FV7 A;  1YLJ A;  4GB7 A;  3C4P A;  3ZG8 B;  3G2Z A;  1SKF A;  2ZQ9 A;  3UPN A;  1YMS A;  4OOY A;  4U0T A;  4XUX A;  3Q82 A;  4B88 A;  1XPB A;  5M19 A;  3IQA A;  3ZVT A;  4P85 A;  1YQS A;  3BFF A;  3QHY A;  1K38 A;  4Y7P A;  2ZQD A;  4ZDX A;  3CMZ A;  3MKF A;  4S2M A;  1K55 A;  1K56 D;  2WAE A;  3IT9 A;  2WYX A;  4GKU A;  1K4F A;  1JWZ A;  1QME A;  4KG5 A;  4BL2 A;  3OPH A;  4EWF A;  1ES4 A;  4OON A;  2H0Y A;  2HDU A;  4IVK A;  4JBF A;  1CEF A;  3TSG A;  3V50 A;  4Y0T A;  5EPH A;  1E3U D;  3JYI A;  4EQI A;  5EVI B;  4X6T A;  1W8Y A;  2Y2L A;  1IEL A;  4PMA A;  4DXB A;  3MBZ A;  3GR2 A;  3N8S A;  5EVI A;  1E25 A;  4IVI A;  1FSW A;  5TFQ A;  4YIN A;  5E43 A;  5HW3 A;  3WS5 A;  4BJP A;  1IYP A;  3HLG A;  5HAR A;  3IHA A;  2DCF A;  3TOI A;  3MZF A;  4R3B A;  3E2K A;  1DJA A;  3HLC A;  4DE2 A;  5F83 A;  2HDR A;  3C7U A;  2PU4 A;  1NYY A;  2XR0 A;  5HFO A;  1YLZ A;  2WGV A;  4GN2 A;  2EX9 A;  4Y0O A;  3MXR A;  3BFG A;  1MWR A;  1ES2 A;  4KZB A;  5AQB A;  4S2L A;  3W4Q A;  1YLY A;  2HP5 A;  2CC1 A;  2PU2 A;  5CRF A;  2J9P A;  3PTE A;  5DF9 A;  2ZD8 A;  2Y59 A;  4S2O A;  4QU3 A;  4QY6 A;  1BLP A;  3UDI A;  3VP0 A;  1FCM A;  1U60 A;  3HRE A;  4OQI A;  5M18 A;  2HP6 A;  4CJN A;  1Y54 A;  3GV9 A;  3IF6 B;  1NY0 A;  4E3I A;  1E4D A;  1G6A A;  4LEN A;  3NDE A;  2Y2J A;  3CZD A;  4MEZ A;  4Z9Q A;  4DKI A;  2XGN A;  1NYM A;  2Q9N A;  1MPL A;  1RGZ A;  3BLS A;  5BOH A;  5KSC A;  1OME A;  3RXW A;  1XGI A;  3A3F A;  4E3M A;  3M6H A;  5FQJ A;  1BZA A;  4X68 A;  3E2L A;  1M40 A;  4UAA A;  5GL9 A;  2DNS A;  2WZZ A;  1MWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...