2J7VA

Structure of pbp-a
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
TLPPERPLTNLQQQIQQLVSRQPNLTAGLYFFNLDSGASLNVGGDQVFPAASTIKFPILVAFFKAVDEGRVTLQERLTMRPDLIAPEAGTLQYQKPNSQYAALEVAELMITISDNTATNMIIDRLGGAAELNQQFQEWGLENTVINNPLPDMKGTNTTSPRDLATLMLKIGQGEILSPRSRDRLLDIMRRTVTNTLLPAGLGKGATIAHKTGDIGIVVGDAGMVDMPNGQRYVAAMMVKRPYNDPRGSELIRQVSRMVYQAFEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TLL2115 PROTEIN
publication title Structure of Pbp-A from Thermosynechococcus Elongatus, a Penicillin-Binding Protein Closely Related to Class a Beta-Lactamases.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Hydrolase
total genus 99
structure length 265
sequence length 265
chains with identical sequence B, C, D
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2006-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2j7vA01
2ZM2A 4R3JA 5U47A 4KZ3A 1VQQA 3FKVA 2H5SA 4Y0TA 5A92A 4GOGA 4OH0A 3FZCA 3P09A 2G2UA 3NC8A 2IWCA 4E3MA 3HBRA 1YLWA 3IHBA 4PPRA 1MKIA 2WAEA 4WZ5A 4OONA 5BOHA 1KGFA 3AGDA 4MBHA 1PIOA 1NYYA 4OPZA 3UE0A 2H0TA 1GHMA 1JTDA 2Y55A 4LCLA 2JC7A 4UAAA 4BENA 1HZOA 1KDSA 3OC2A 1K55A 4OQHA 3OCLA 3NDEA 2XFTA 3GTCA 1J9MA 2XQZA 5HARA 4MLLA 3GQZA 1E3UA 2X01A 4P85A 4UA9A 3MBZA 4LV3A 5A91A 3PBQA 3RXWA 3BFDA 4QD4A 5A90A 4Y0OA 3UE1A 3DWZA 2ZQAA 1L0GA 4K91A 2UWXA 5DTTA 4CPKA 3VP4A 1K6SA 4FCFA 3UNWA 1E3UD 2WZZA 1ONGA 2HP6A 3GV9A 1XA7A 4X55A 3A3DA 1DJCA 1Y54A 4KZ8A 3UDXA 2ZC4B 4BD0A 1GA0A 4C75A 2QPNA 4RX2A 1ALQA 1JVJA 3PBNA 3FKWA 4QY5A 2V2FF 3TG9A 1IELA 2Z2MB 3ITAA 1RP5A 1SCWA 2WGWB 3FV7A 3QNBA 4GN2A 4OPQA 5FSRA 3FWLA 3FYZA 4S2OA 4NETA 2ZC7A 2Y2IA 1XX2A 2XR0A 3LO7A 2BG1A 2Z2LB 3OZHA 4KZAA 2B5RA 4OPRA 5AQ7A 5HAIA 3WS1A 3VP3A 4X68A 5KZHA 2QZ6A 1ZKJA 1KVLA 3MXSA 4R3BA 3AGFA 4LV0A 5EE8A 3MKFA 5GHZA 1PI5A 5CTNA 2WUQA 3OPPA 3BEBA 3E2KA 2J8YA 5L2FA 5FQKA 5D3OA 3A3EA 4PM6A 1ONHA 1KVMA 1SKFA 3BRMA 1O7EA 3ZVTA 3GR2A 3N6IA 5M1AA 1I2WA 1CEFA 2HPBA 4WYYA 4DDSA 1MPLA 2ZLYA 5F1GA 3W4QA 5M18A 2Y59A 3ZVWA 4E6WA 3SOIA 1K57A 3OPHA 3P98A 4EBLA 2WKIA 3C7VA 2ZM8A 2XF3A 2P74A 4N1XA 1NZUA 4KG6A 1PW1A 1NJ4A 2R9XA 3G32A 5CTMA 3UPPA 1ERMA 5DF8A 1XGJA 3IXHA 5E2HA 1XA1A 4EBPA 2J9PA 1EROA 2G2WA 4K0WA 4PMAA 5F1FA 4KG2A 3O88A 5IHVA 3IWOA 1PI4A 2A3UA 1LHYA 4OOMA 5FI2A 5E2FA 5FQIA 1PWDA 5HFOA 2WKEA 2WGWA 1SHVA 1FR6A 2EX9A 1MWTA 3BM6A 1QMFA 3OPLA 1YMSA 4R4SA 3V3RA 3VOYA 1K38A 2QMIA 1ESUA 1ESIA 2ZQ8A 3G34A 3IF6B 4EBNA 4GKUA 4XUXA 1L0FA 1N9BA 3PBTA 4WMCA 2PU4A 4JF6A 3G35A 1K4EA 4MNRA 4JF5A 1G6AA 1BULA 3HLGA 3V3SA 3W4OA 4P0MA 3WS2A 3Q7VB 1W79A 4KZBA 3ZG8B 3JYIA 3LY3A 1K54C 4S2NA 1E4DA 3WS0A 5EVIA 1N4OA 1FQGA 1TDGA 4OQIA 3N8LA 4DE2A 2XGNA 5EOEA 2JE5A 1FSWA 3HLEA 4PM5A 2R9WA 1BTLA 1HTZA 4QY6A 3ZG7B 4X56A 1L0EA 2A49A 2ZQCA 4RX3A 2WGVA 1LL5A 2IWDA 4KQOA 5HAPA 3C5AA 4LV2A 1YLYA 4DXCA 4PM8A 5FDHA 4ZDXA 2Y2HA 4OVDA 5FAPA 3SH8A 4OP8A 1MY8A 3NI9A 5EVID 1K56A 1XKZA 3DW0A 4JXSA 4X69A 5AQ9A 3LEZA 3M6BA 3N8RA 5CHUA 1PZPA 3HUOA 3ZHHA 4R4RA 3HUNA 4X53A 5TGFA 4GZBA 3LCEA 2ZC5B 5DF7A 5J8XA 2DNSA 5AQBA 1JWVA 4IVIA 4JXWA 1W8YA 3G4PA 2Y2JA 3C4PA 3IF6A 4BLMA 3EQUA 3PTEA 5FI6A 3EQVA 3MKEA 4OLDA 5HX9A 1YM1A 5CXWA 1K56D 5FQQA 4Y0UA 1ZG4A 1HVBA 3Q82A 3VP1A 4KG5A 5EOOA 5CECA 3G2ZA 3NIAA 3IH8A 3E2LA 3IXBA 4JBFA 4S2PA 1U60A 1M6KA 4C6YA 2Q9MA 4ZJ1A 3Q7VA 4ZAMA 4ZTKA 4KQRA 3HLFA 2ZM0A 4EWFA 1BSGA 5HAQA 3ZG5A 3UDFA 4RVAA 1IKIA 3SH9A 4OQ0A 3HL9A 1H8YA 4PM9A 4DKIA 1KE4A 1JWZA 1PYYA 1XP4A 4HESA 4LV1A 3VFHA 2EFXA 1XXMA 2Y2GA 3Q81A 4FD8A 4OQGA 4KZ4A 5CERA 1SDNA 2CC1A 3UN7A 2ZJ9A 2VGJA 3AGEA 2H10A 4JXGA 1FSYA 3IQAA 1Q2PA 3ZGAB 2EFUA 1MBLA 2WK0A 3QHYA 4WM9A 3ZDJA 4XUZA 1Z6FA 4WEKA 4JXVA 4KZ6A 3TSGA 1ES2A 3C7UA 5GLDA 5FI7A 1K4FA 2WZXA 1BLSA 2J7VA 2V20A 1AXBA 4N9KA 1C3BA 4Z9QA 3ZCZA 4Q8IA 3ZFZA 5FQJA 3G2YA 1YLJA 2XLNA 4DF6A 2PBYA 4B88A 5TR7A 3LY4A 3S4XA 4KQQA 3PBRA 1MWUA 3UPOA 4QB8A 5EVLA 1KE0A 5EVIB 4KZ9A 4LCMA 4JLFA 3A3IA 5DTSA 2ZC6B 5F83A 5CGSA 1FCNA 3VP2A 1BZAA 1TVFA 1WYBA 3HUMA 5HL1A 3W8KA 2OV5A 1QMEA 2H0YA 3B3XA 2X02A 3N7WA 1G68A 2WGIA 3WS4A 4M3KA 1H5XA 4WZ5C 3BLSA 1W5DA 2WAFA 1FR1A 4OPYA 4WELA 5FA7A 4A5RA 1DJAA 3RJUA 4OP5A 4L0LA 3GRJA 4BL2A 1K6RA 4R0QA 4RYEA 2HP9A 1KGGA 3D4FA 4P87A 1K55C 1GCEA 2Y2NA 2RL3A 1CEGA 3IF6C 5E2GA 1W7FA 1ES4A 3HLDA 5TFQA 1S6RA 2C6WB 1BLCA 2GDNA 3BFCA 5F82A 3ZG9B 1GHIA 1LLBA 3IT9A 2HDUA 4FSFA 4KZ5A 5FAOA 4GDBA 3CG5A 1IYPA 3MXRA 1JWPA 4JF4A 3V39A 3IHAA 1H8ZA 2Y2QA 2RCXA 2ZQDA 4MBFA 3O3VA 3GSGA 3QNCA 4B4ZA 1E25A 4P6BA 1BUEA 4BL3A 3S1YA 1NY0A 3IF5A 4WZ4A 3IXDA 3VP0A 1LL9A 3NBLA 5DF9A 3S22A 5E43A 1IYOA 1TDLA 4ZBEA 5CHMA 2XH9A 1IYSA 2X71A 4N1HA 1YLZA 5CHJA 3HVFA 1WYCA 4QJGA 4DDYA 4KENB 3CMZA 2WYXA 1RGZA 3PBSA 2HDQA 1FCOA 2Y2KA 2ZD8A 2Y2LA 1W8QA 3N8SA 4S2KA 2IWBA 3UPNA 4GDNA 1CI9A 3BLMA 5A93A 3Q7ZA 4N92A 1EI5A 5M19A 5G18A 5EUAA 1YQSA 1ZG6A 4S2LA 2EX8A 3UO9A 2ZC3B 1KDWA 3ISGA 5CEDA 5GLBA 4IVKA 4Y7PA 1JTGA 3UDIA 4U0XA 4WBGA 1NRFA 5GL9A 3VFFA 3BYDA 1PZOA 4EQIA 3GMWA 5DVAA 2WADA 3WWXA 1NXYA 5JYOA 4KZ7A 4U0TA 1PW8A 3MZFA 5FQ9A 4FH2A 4DXBA 3UY6A 2P9VB 3UE3A 2BLSA 2C5WB 3DWKA 5EPHA 3V5MA 2XD5A 4S2JA 3M6HA 1K57C 4DE1A 5FQMA 4WEJA 3IXGA 5E2EA 4DE0A 2XFSA 3Q07A 1XPBA 2HP5A 1BLHA 2EX2A 2XDMA 3N4IA 4QHCA 4E3JA 5FATA 1BLPA 1NYMA 3O86A 4HBTA 4OOYA 4UA6A 1MWRA 1I2SA 1YLPA 4GB7A 1DY6A 4LENA 1I5QA 1XGIA 3C4OA 2HDRA 4BQMA 1ES5A 1MXOA 1SDEA 3CZDA 3HLCA 4HEFA 4S2MA 1S0WA 1CI8A 5CRFA 1YLTA 4IBRA 1IEMA 3SS5A 5AQAA 1LI9A 2PU2A 3TOIA 4E3OA 3WS5A 3G31A 4K0XA 3ZNYA 4ZJ3A 2J9OA 3HLWA 1YT4A 2JCHA 4GD6A 4UHUA 1K54A 2XD1A 3IWQA 1M40A 3CJMA 4X6TA 4E3KA 3V50A 4BJPA 4GD8A 2EXBA 2I72A 4YINA 4S2NC 1TEMA 1RCJA 1K25A 4XXRA 5EVIC 1CK3A 2DRWA 5DTKA 3SS4A 3ZG0A 3DTMA 3VMAA 1RGYA 3G30A 1Q2QA 4E3IA 3NCKA 3SH7A 3A3JA 4B4XA 3VSKA 2P9VA 1L2SA 1DJBA 1FCMA 1FOFA 4NK3A 3ITBA 3GVBA 5GHYA 5GHXA 4S2IA 2XEPA 4JPMA 4O7DA 3Q1FA 2OLUA 2EX6A 2ZQ9A 1O07A 2JBFA 3W4PA 2OSUA 3SS3A 2HDSA 4E3NA 3MFDA 2WKHA 4MEZA 4JKTA 1GHPA 3BECA 2FFFB 3HLBA 1IYQA 4E6XA 5GLCA 4ID4A 2V1ZA 3BFGA 1OMEA 1VM1A 5CGXA 4F94A 3IWIA 1WE4A 4H8RA 1KE3A 4N9LA 5GLAA 3VSLA 5HW3A 5KSHA 2Y2PA 2ZMAA 5I94A 4DE3A 3PBOA 5CEBA 4PM7A 2VGKA 1KGEA 4IBXA 1NZOA 3M2KA 4U3TA 4YFMA 5FAQA 3O87A 3WRZA 3HREA 4ZJ2A 4MBKA 3VOZA 1MWSA 4RA7A 4OLGA 5KSCA 3BFEA 4CJNA 1EWZA 3OPRA 3WRTA 1ERQA 3MZDA 4EUZA 3RXXA 3BFFA 2Q9NA 4IEDA 4EV4A 2Y91A 1HD8A 3NY4A 5FASA 2Y2MA 1L0DA 3PAEA 3M2JA 2XK1A 3PAGA 2EXAA 2OLVA 5CGWA 2DCFA 4DRTA 3NDGA 2Y2OA 5JYPA 4D2OA 1BT5A 4OKPA 1GA9A 3IH9A 1PWCA 4R23A 3I7JA 5EECA 4BD1A 4E3LA 1ES3A 1PWGA 2ZQ7A 2E8IA 1ZC2A 1YMXA 4UA7A 1LI0A 1IKGA 4GNUA 2Y4AA 5KMWA 3OCNA 4FH4A 2FFYA 4C3QA 3MZEA 4WMCD 3ZNTA 4QU3A 4OOLA 3A3FA 4HBUA 4R1GA
chains in the Genus database with same CATH superfamily
2ZM2A 1T18A 4G3KA 4KZ3A 5L07A 4Y0TA 2KOIA 4OH0A 3FZCA 3NC8A 2IWCA 1PNEA 1CF0A 2HGVA 3HJIA 5BOHA 1KGFA 4MBHA 4OPZA 3UE0A 3K3CA 1KDSA 1K55A 4X1MA 5HARA 4LV3A 5A91A 3RXWA 3BFDA 4QD4A 5A90A 2M7VA 4Y0OA 3JPUA 2UWXA 5DTTA 1K6SA 3S7OA 1ONGA 3A3DA 1Y54A 4K08A 1GA0A 3UMDA 4M4XA 3DTEA 4NXBA 1SCWA 2PD7A 2ACGA 3FV7A 3QNBA 4OPQA 5FSRA 4S2OA 1TS0A 4NETA 3CITA 3NOTC 4LGWA 2XR0A 1VETA 2B5RA 4OPRA 5AQ7A 3DBAA 3WS1A 4X68A 3CHWP 3T4SA 3T4JA 3V67A 5EE8A 5CTNA 5DKLA 5L2FA 2E8JA 5FQKA 3A3EA 4ETZA 1D7EA 3ZVTA 3MF0A 4WYYA 4DDSA 1MPLA 2ZLYA 5F1GA 3ZVWA 3SOIA 2PYPA 2R9XA 2V9AA 4GLQA 3MMHA 1NRJA 4K0WA 5FI2A 1PWDA 2JN7A 3V3RA 1XJ2A 2QMIA 2ZQ8A 4GKUA 1VEUA 1N9BA 4HH3A 4WMCA 2PU4A 4JF6A 3B33A 4MN7A 3KYZA 1OTDA 3VE3A 2KDKA 3VOLA 3EEHA 4WL9A 4S2NA 3VV4A 5EVIA 1TDGA 4DE2A 2NUTC 5EOEA 1FSWA 4PM5A 4QY6A 4X56A 3LI8A 2A49A 2ZQCA 2WGVA 3C5AA 4LV2A 4GHIB 1KOUA 5FDHA 4OVDA 1G5UA 5EVID 1K56A 1XKZA 5LBRA 4X69A 3HUOA 3ZHHA 5J3WA 3T1RA 5TGFA 2FH5A 4G3WA 1JWVA 3LI9A 3OLOA 1VHMA 2QWSA 5HX9A 1K56D 2DMWA 1ZG4A 5EOOA 2JKRI 2W1TB 3IH8A 3E2LA 3LIDA 1M6KA 4P6ZM 3HLFA 5EVEA 3QP8A 3ZG5A 4H6JA 2G7UA 3QP6A 1XP4A 4LV1A 2PBDP 3Q81A 4JGOA 4MN6A 2H10A 2W3HA 3IQAA 4WM9A 3DAVA 4N9KA 2V20A 1AXBA 1C3BA 2ZBBA 1G6OA 2IA2A 2XLNA 4KQQA 3UPOA 4QB8A 5EVIB 5DTSA 1S4RA 4JLFA 4HHDA 1YSPA 3O5YA 2J3TD 1TVFA 3NHQA 2ZMFA 3N7WA 4M3KA 1F98A 2WAFA 4A5RA 5FA7A 3RJUA 4OP5A 3GRJA 4RYEA 1KGGA 4ME4A 4HIAA 2GX5A 5HSQA 3HCYA 2Y2NA 2V8FA 4HQAA 3IF6C 3T4OA 2C6WB 1BLCA 2GDNA 3BFCA 4YOFA 5F82A 2P08A 1N9OA 4KZ5A 2HDUA 5FAOA 1IYPA 5HWTA 4BL3A 3A0SA 3IXDA 2PYRA 1PFLA 2VEAA 4BWIA 4GJ4A 4ZBEA 5CHMA 4DDYA 3CMZA 2MJ6A 1RGZA 3PBSA 1FCOA 4S2KA 3N8SA 3BLMA 2LB5A 2BTFP 2EX8A 1P9WA 3P7NA 5GLBA 5I5LA 5G4YA 1N9NA 2ZMVA 4U0TA 4DN0A 3CAXA 3UY6A 3UE3A 2C5WB 5IS1A 2XD5A 4S2JA 1K57C 4WEJA 2OWHA 4DE0A 2HP5A 2XDMA 4P6ZS 3T12B 4HBTA 4MN5A 1DY6A 1GSWA 1XGIA 4BQMA 4G3VA 1SDEA 2OAP1 4HEFA 1S0WA 4IBRA 1IEMA 2PU2A 3G31A 4IUHA 3ZNYA 2JCHA 3IWQA 4X6TA 4BJPA 4IHQA 3NOPC 2EXBA 4YINA 3ZG0A 1K25A 4Q0JA 3DTMA 3CWFA 1LSXA 3VMAA 3IBJA 3A3JA 3VSKA 1FOFA 5GHXA 2P04A 3LICA 1GSVA 2ZQ9A 1O07A 3SS3A 4E3NA 4MEZA 3K3DA 4BMWA 2FFFB 4II7A 1MZUA 2VZWA 2WKQA 3HLBA 1IYQA 2V1ZA 1LL8A 3IWIA 4N9LA 5HW3A 4EUVA 2JKFA 3C38A 3BY9A 3D9YA 4PM7A 1KGEA 3C30A 4U3TA 3WRZA 4OLGA 5KSCA 1S1ZA 4EV4A 2Y91A 2M7UA 3PAEA 1OTEA 2EXAA 3T1SA 2DCFA 4MDZA 3F1OB 4R6LA 4BD1A 4E3LA 1ES3A 2E8IA 4X25A 1LI0A 2Y4AA 3KO6A 5EV0A 4HJ3A 4FH4A 5F6AA 1OJGA 4OOLA 4R1GA 1LT0A 4Y13A 5U47A 2H5SA 5L10A 5A92A 2OOLA 4GOGA 3P09A 1P9RA 2G2UA 2XA7M 3PHYA 1L3LA 3IHBA 1YLWA 2WAEA 5IT5A 3H82A 3AGDA 1NYYA 4Z1WA 4LCLA 2JC7A 4BENA 3OC2A 1S67L 3TRCA 4OQHA 2O9CA 3CUEC 3KSHA 3OCLA 1IOUA 3GTCA 2WKRA 3FC7A 1DP6A 3NOUC 4MLLA 1E3UA 4UA9A 3PBQA 2VV8A 5EM1A 4CPKA 3VP4A 4R38A 1H3QA 1E3UD 3JVVA 3GV9A 1XA7A 4X55A 5DFYA 4BD0A 2QPNA 4RX2A 1ALQA 4QY5A 3FKWA 2B02A 3PR6A 2Z2MB 1RP5A 2WGWB 4GN2A 3FYZA 2ZC7A 1K0KA 2Y2IA 3RFBA 2Z2LB 2UV0E 4NG2A 3UB6A 5HAIA 1W63M 4CLCE 3VP3A 1KVLA 3MXSA 5GHZA 3AGFA 2WUQA 3E2KA 4YNRA 3BW6A 1SKFA 3GR2A 5M1AA 1CEFA 4O8GA 3W4QA 2Y59A 2O9BA 1K57A 2WKIA 3C7VA 2ZM8A 2P74A 4N1XA 4R70A 5CTMA 1ERMA 4GW9A 5A8BA 4EBPA 1EROA 2A3UA 1LHYA 2AVXA 5FEFA 1QMFA 1K38A 3UMEA 1ESIA 3IF6B 2VKSA 4XUXA 2Q0OA 1L0FA 3G35A 5HD3A 3HLGA 4NXEA 3V3SA 3W4OA 5F69A 3LIEA 4KZBA 3ZG8B 3LY3A 1K54C 1E4DA 1FQGA 4L9FA 4OQIA 3MJQA 1HTZA 2L1MA 5HAPA 3U4LP 4PM8A 5F5YA 4ZDXA 5FAPA 3MS6A 3MQ0A 1MY8A 3NI9A 3T4QA 3DW0A 2D01A 4JXSA 5AQ9A 2QJ7A 3LEZA 3M6BA 3N8RA 4R4RA 3HUNA 3LCEA 2DNSA 3LIBA 3PTEA 3MKEA 1YM1A 5FQQA 3KYQA 1FILA 1T1BA 3IXBA 4JBFA 4S2PA 1HLUP 3LIAA 5HAQA 2R78A 4RVAA 4Q0IA 3LR3A 3SH9A 4PM9A 1PYYA 3D3OA 4HESA 2GJ3A 4GHIA 2EFXA 1XXMA 4FD8A 4OQGA 4KZ4A 2CC1A 2ZJ9A 2VGJA 3T1XA 3AGEA 3LGOA 1FSYA 3ZGAB 3D72A 3LUQA 2NUPC 2PD8A 5L8MA 4DF6A 3HJKA 4ETXA 5K5BA 2W1TA 3VP2A 3HUMA 4QWOA 1T1AA 3H9WA 4JGRA 2WGIA 2XSSA 4O01A 4WZ5C 4PKYA 3EWKA 3CUEA 3E4OA 2A24A 4R0QA 2HP9A 5MC7A 3D4FA 4FTXA 4P87A 3H7WA 1CEGA 3HLDA 5TFQA 1GHIA 4LRYC 1LLBA 5AVEA 2FZ0A 3LFVA 3MXRA 4NKPA 3IHAA 5AJGA 4P6BA 1SKOA 2V1BA 4ARZB 4HP4A 3LYXA 3T4KA 2O9AA 1TDLA 4IJGA 4PAUA 4Y5FA 1IYSA 4N1HA 4QJGA 4KENB 2WYXA 5G4ZA 1W8QA 3Q7ZA 5HDCA 4N92A 3NULA 1OPXA 1TS7A 5M19A 5EUAA 4S2LA 1OTBA 5CEDA 2OWJA 1JTGA 4WBGA 3BYDA 5DVAA 3WWXA 1NXYA 1PW8A 1XJ6A 2QHKA 2BLSA 5EPHA 3DWKA 4DE1A 3M6HA 5C5KA 3IXGA 4EW7A 1BLHA 5HDSA 4HJ4A 3N4IA 5TBMB 5FATA 1BLPA 1NYMA 3O86A 2XRNA 2YKFA 1I2SA 1YLPA 2A24B 4LENA 4WLAA 1ODVA 3C4OA 2HDRA 3H7WB 4O0PA 1YLTA 3SS5A 1LI9A 3TOIA 4E3OA 4EETB 3WS5A 2J9OA 1YT4A 4GCZA 1K54A 4I3IA 1M40A 2VGLM 4JGQA 1SKOB 1LSVA 1PRQA 1TEMA 3U2AA 1CK3A 2DRWA 2L4RA 5DTKA 5CX7A 3G30A 4HY8A 3W2ZA 3SH7A 1L2SA 1NWZA 3GVBA 2XEPA 3S7NA 2OLUA 2JBFA 2WKHA 4GS9B 1GHPA 5FDSA 4E6XA 5CGXA 4F94A 1KE3A 3VSLA 2OAQ1 4WF0A 5CEBA 4IBXA 4KQDA 4YFMA 3HREA 3VOZA 3BFEA 1EWZA 5HPFA 3RXXA 3RTYA 4KUOA 2ZL1B 4AFIA 2Y2MA 1L0DA 3M2JA 2W3EA 2Y2OA 5DJTA 3BQAA 1GA9A 4D60A 1D06A 3IH9A 5FL3A 1PWGA 1ZC2A 1MC0A 1YMXA 4GNUA 3L9KA 4CLCB 2PR6A 2V8CA 4RQ9A 2FFYA 4C3QA 1DP8A 3MZEA 2Z6CA 3ZNTA 3A3FA 4HBUA 1OTAA 3IX3A 4E3MA 3HBRA 4WZ5A 1MKIA 1MKMA 4OONA 1SZVA 1GHMA 1JTDA 4BBVA 1T19A 1HZOA 3NDEA 2XFTA 2XQZA 3PXPA 4HNBA 3GQZA 4P85A 3MBZA 3QP4A 3UE1A 3F1OA 2ZQAA 5HWVA 4HP9A 2HP6A 1P0ZA 3BJNA 3UDXA 4C75A 3PBNA 1IELA 2M1CA 3FWLA 1J3WA 1XX2A 3LO7A 3ZQ5A 2BG1A 3OZHA 2PDRA 5DJUA 3MXQA 5KZHA 4HI4A 2QZ6A 4R3BA 5EFWA 1PI5A 3OPPA 2W3DA 3BEBA 4Y2FA 4BBUA 4LRXC 5D3OA 4PM6A 5HPIA 1ONHA 1KVMA 1O7EA 1I2WA 2HPBA 1A0KA 5M18A 4E6WA 1XJ3A 4ESPA 1NZUA 1PW1A 3G32A 2VLGA 5DF8A 1XGJA 5E2HA 1XA1A 2B18A 2J9PA 4PMAA 5F1FA 2J80A 3O88A 3IWOA 1PI4A 3LR5A 2QYBA 4LPZA 5E2FA 2WKEA 2WGWA 1MWTA 3OPLA 3BM6A 1ESUA 3UB8A 4Y3IA 4EBNA 3R7WA 3F1PB 3PBTA 1K4EA 4MNRA 1BULA 3WS2A 1ACFA 3Q7VB 3JYIA 3N8LA 2JE5A 3HLEA 2R9WA 3MSHA 4RX3A 2GNXA 4KQOA 3E98A 1YLYA 2BASA 1S4SA 5DFXA 1TS6A 5CHUA 1PZPA 1OJ5A 1VB6A 3B47A 4GZBA 5J8XA 4I5SA 1W8YA 2Y2JA 3C4PA 3IF6A 4BLMA 5FI6A 3EQVA 4OLDA 5CXWA 5HWWA 1Y28A 1HVBA 3VP1A 3G2ZA 3NIAA 4C6YA 2Q9MA 4ZJ1A 4KQRA 2ZM0A 1BSGA 1UGUA 5FEGA 3HL9A 3K2NA 1JWZA 1TF1A 2JKTI 3VFHA 5EM0A 1XJ4A 1Z09A 3UN7A 2V0UA 1Q2PA 2XROA 3NJAA 4E04A 2W3FA 1Z6FA 4JXVA 3R7WB 1ES2A 5GLDA 1XFNA 3OBFA 4I38A 3ZYTA 2J7VA 2WZXA 4Z9QA 3ZCZA 2HF6A 4LLOB 5FQJA 3T4LA 3G2YA 1YLJA 2ZOHA 5TR7A 3LY4A 4B88A 1DP9A 1MWUA 4HJ6A 4KZ9A 2ZC6B 5F83A 1FCNA 1WYBA 3W8KA 1QMEA 2H0YA 3B3XA 2X02A 2QKPA 2JKGA 3MQQA 1FR1A 1DJAA 4BL2A 1F2KA 1TS8A 4I39A 3EEAA 1GCEA 3CI6A 2RL3A 5E2GA 1W7FA 1ES4A 3F1NA 3IT9A 4JF4A 1STZA 4WUJA 3TW8A 1H8ZA 2RCXA 3QNCA 4B4ZA 1E25A 1BUEA 4EEPA 3IF5A 4WZ4A 3VP0A 1NLZA 4JGPA 3SZTA 4CLCC 4ZRRA 2ZOIA 1YAXA 4XT2B 2XH9A 3CLOA 2X71A 5CHJA 1BYWA 3GECA 2ZD8A 4DKIA 2Y2LA 2JHEA 3UPNA 1CI9A 1H8MA 1EI5A 5G18A 3OOVA 1YQSA 1ZG6A 2XA7S 3UO9A 3ISGA 1X0OA 2L0WA 2B95A 1FIKA 4Y7PA 2Y79A 3UDIA 5GL9A 1PZOA 3GMWA 2WADA 5JYOA 3ULFA 4FH2A 4DXBA 4L9EA 2P9VB 4ARZA 1CQAA 2XFSA 1XPBA 2CMNA 4QHCA 4E3JA 4Y15A 4OOYA 2HJEA 1MWRA 4UA6A 2HZ5A 3SW1A 1WA9A 3UB9A 2VK3A 4HOIA 4B93A 4EERA 1D1JA 1YPRA 1CI8A 4NEED 5AQAA 3F1NB 3FPVA 5DKKA 3CPTB 4GD6A 2VX8A 2XD1A 4GD8A 3E4QA 2I9VA 1RCJA 5J7EA 2PT7A 4E3IA 3NCKA 2JKRM 1DJBA 1FCMA 4NK3A 3ITBA 4S2IA 4JPMA 2EX6A 1AWIA 5TBMA 3BY8A 1N9LA 3MFDA 4JKTA 5GLCA 4ID4A 1W63Q 3BFGA 1WE4A 4H8RA 5KSHA 2ZMAA 4NXGA 5I94A 3KX0X 2VGKA 1NZOA 3M2KA 3O87A 4ZJ2A 3OPRA 3MZDA 4EUZA 5F68A 1HD8A 1ZTUA 3NY4A 3ICYA 5HDDA 2XK1A 4I3AA 5HD5A 4DRTA 3E4PA 5JYPA 4D2OA 1BT5A 3VE4A 4OKPA 2QJ5A 4GS9A 1PWCA 4KUKA 3DTKA 3C8CA 1IKGA 1EW0A 3OCNA 1JNUA 1T1CA 4WMCD 4QU3A 5TJJA 4R3JA 4FOFA 1VQQA 3FKVA 3MFXA 3BQ8A 2YKHA 4PPRA 1PIOA 3FG8A 2H0TA 2Y55A 5J4EA 1VETB 4UAAA 2ZL1A 3E0YA 3IBRA 1J9MA 4EESA 2X01A 2INWA 3DWZA 1L0GA 3EGXC 4K91A 1OT9A 4FCFA 3UNWA 2WZZA 4CLCA 3QP2A 1DJCA 3IX4A 4KZ8A 1DRMA 1XFQA 2ZC4B 3LEQA 4HH2A 1JVJA 2V0WA 2V2FF 3TG9A 3S7QA 4DMZA 3ITAA 3KSGA 3UB5P 4CLCD 4KZAA 1VEUB 1ZKJA 4LV0A 3MKFA 2J8YA 3BRMA 3LIFA 1CJFA 3N6IA 3OPHA 3P98A 2VJWA 4EBLA 3T4TA 2XF3A 4KG6A 1NJ4A 3UPPA 1V9ZA 2HV1A 3IXHA 2G2WA 4KG2A 5IHVA 5HL6A 5HFOA 4OOMA 5FQIA 1SHVA 1FR6A 2EX9A 4R4SA 1YMSA 4B9OA 3VOYA 3G34A 4F3LA 2J3WA 4IUKA 2KLIA 4JF5A 1G6AA 4Q0HA 4P0MA 1W79A 3WS0A 1N4OA 2HJ9C 2VV6A 4H6JB 2XGNA 1S66L 1BTLA 3MQOA 3ZG7B 1L0EA 1OTIA 1LL5A 2O0YA 2IWDA 3IS2A 4DXCA 2Y2HA 3UB7A 3SH8A 4OP8A 3KYEA 4MCWA 2K7SA 2EA9A 1OT6A 4X53A 1NLYA 2ZC5B 5DF7A 5AQBA 2LB9A 4IVIA 2D02A 4JXWA 3G4PA 4EU0A 3A0RA 3EQUA 3F1PA 4Y0UA 3Q82A 4KG5A 5CECA 2A2LA 4FUWA 4MMNA 1U60A 3Q7VA 4ZAMA 4ZTKA 4EWFA 3UDFA 1IKIA 3R4KA 4OQ0A 4PHTA 2EWWA 4UQIM 1H8YA 1KE4A 2PR5A 2Y2GA 5CERA 1SDNA 2VGLS 2Z6DA 3RH8B 4JXGA 2EFUA 1MBLA 1S1YA 2WK0A 3QHYA 3IX8A 3ZDJA 4XUZA 4WEKA 4KZ6A 4F3LB 3TSGA 2H28A 3C7UA 5FI7A 1K4FA 2O99A 1BLSA 4EEUA 3A0VA 4Q8IA 3ZFZA 5HZHA 2PBYA 2W27A 3S4XA 3PBRA 5L09A 5EVLA 1KE0A 4LCMA 3A3IA 1UWPX 5CGSA 4LFUA 1BZAA 1F5MA 5HL1A 2OV5A 4CQHA 3IS2B 2P7JA 1G68A 3WS4A 3T1QB 1H5XA 3BLSA 1W5DA 4WELA 4OPYA 2VV7A 4L0LA 1K6RA 3BWLA 1K55C 2JKTM 5IU1A 1V9YA 1S6RA 4EQ1A 3ZG9B 4FSFA 2V1AA 4GDBA 3CG5A 1JWPA 3V39A 4YWZA 2Y2QA 2ZQDA 3QP5A 4MBFA 3O3VA 3GSGA 2PAVP 3S1YA 1NY0A 2PRFA 1LL9A 4EXOA 3NBLA 5DF9A 3NECA 3S22A 5E43A 1YKDA 1IYOA 3G6OA 3KSFA 1YLZA 3MR0A 3HVFA 1WYCA 3PYPA 2HDQA 4NXFA 2Y2KA 3T50A 1G28A 2WKPA 2IWBA 4GDNA 5A93A 2KX6A 3C2WA 2ZC3B 4PKYG 1KDWA 4QPRA 1IFQA 1F9IA 4IVKA 4U0XA 1NRFA 3VFFA 5KIZA 4EQIA 4KZ7A 1GSXA 3MZFA 5FQ9A 2W1RA 2PHYA 3V5MA 5FQMA 5E2EA 3TJZC 3Q07A 2EX2A 2Y8HA 5AVFA 4XT2A 1YSQA 3UE6A 4GB7A 3EGDC 1I5QA 1ES5A 1MXOA 4UQIS 3CZDA 3HLCA 4S2MA 4UEYA 2K2NA 5CRFA 3JVUA 1LSWA 2EWVA 4K0XA 3LR0A 4ZJ3A 3HLWA 3S7PA 4UHUA 4E3KA 3CJMA 3V50A 3L7HA 4BBTA 2I72A 4XXRA 4S2NC 3SS4A 5EVIC 2W0NA 1RGYA 3B42A 1Q2QA 4B4XA 2VA0A 2P9VA 2K31A 5GHYA 2W3GA 4O7DA 3Q1FA 3EOIA 3W4PA 2OSUA 2HDSA 3KSIA 3BECA 4WN5A 4X1LA 1OMEA 1VM1A 5GLAA 2Y2PA 1UWNX 2GZAA 4DE3A 3PBOA 3LR4A 4Y17A 3CPTA 3GDIA 5FAQA 4MBKA 4I3JA 1MWSA 4RA7A 1P97A 4DJ2A 3H82B 4CJNA 3WRTA 1ERQA 3QP1A 3BFFA 2Q9NA 4IEDA 4L9GA 5FASA 3PAGA 2OLVA 5CGWA 3NDGA 3P01A 1ZHHB 4R3AA 1Y4OA 4R23A 1TD5A 3I7JA 5EECA 2J3TC 2ZQ7A 4LRZE 4UA7A 3TE8A 5KMWA 3FPWA 1H0MA 4DJ3A 3DTIA
chains in the Genus database with same CATH topology
2ZM2A 4R3JA 5U47A 4KZ3A 1VQQA 3FKVA 2H5SA 4Y0TA 5A92A 4GOGA 4OH0A 3FZCA 3P09A 2G2UA 3NC8A 2IWCA 4E3MA 3HBRA 1YLWA 3IHBA 4PPRA 1MKIA 2WAEA 4WZ5A 4OONA 5BOHA 1KGFA 3AGDA 4MBHA 1PIOA 1NYYA 4OPZA 3UE0A 2H0TA 1GHMA 1JTDA 2Y55A 4LCLA 2JC7A 4UAAA 4BENA 1HZOA 1KDSA 3OC2A 1K55A 4OQHA 3OCLA 3NDEA 2XFTA 3GTCA 1J9MA 2XQZA 5HARA 4MLLA 3GQZA 1E3UA 2X01A 4P85A 4UA9A 3MBZA 4LV3A 5A91A 3PBQA 3RXWA 3BFDA 4QD4A 5A90A 4Y0OA 3UE1A 3DWZA 2ZQAA 1L0GA 4K91A 2UWXA 5DTTA 4CPKA 3VP4A 1K6SA 4FCFA 3UNWA 1E3UD 2WZZA 1ONGA 2HP6A 3GV9A 1XA7A 4X55A 3A3DA 1DJCA 1Y54A 4KZ8A 3UDXA 2ZC4B 4BD0A 1GA0A 4C75A 2QPNA 4RX2A 1ALQA 1JVJA 3PBNA 3FKWA 4QY5A 2V2FF 3TG9A 1IELA 2Z2MB 3ITAA 1RP5A 1SCWA 2WGWB 3FV7A 3QNBA 4GN2A 4OPQA 5FSRA 3FWLA 3FYZA 4S2OA 4NETA 2ZC7A 2Y2IA 1XX2A 2XR0A 3LO7A 2BG1A 2Z2LB 3OZHA 4KZAA 2B5RA 4OPRA 5AQ7A 5HAIA 3WS1A 3VP3A 4X68A 5KZHA 2QZ6A 1ZKJA 1KVLA 3MXSA 4R3BA 3AGFA 4LV0A 5EE8A 3MKFA 5GHZA 1PI5A 5CTNA 2WUQA 3OPPA 3BEBA 3E2KA 2J8YA 5L2FA 5FQKA 5D3OA 3A3EA 4PM6A 1ONHA 1KVMA 1SKFA 3BRMA 1O7EA 3ZVTA 3GR2A 3N6IA 5M1AA 1I2WA 1CEFA 2HPBA 4WYYA 4DDSA 1MPLA 2ZLYA 5F1GA 3W4QA 5M18A 2Y59A 3ZVWA 4E6WA 3SOIA 1K57A 3OPHA 3P98A 4EBLA 2WKIA 3C7VA 2ZM8A 2XF3A 2P74A 4N1XA 1NZUA 4KG6A 1PW1A 1NJ4A 2R9XA 3G32A 5CTMA 3UPPA 1ERMA 5DF8A 1XGJA 3IXHA 5E2HA 1XA1A 4EBPA 2J9PA 1EROA 2G2WA 4K0WA 4PMAA 5F1FA 4KG2A 3O88A 5IHVA 3IWOA 1PI4A 2A3UA 1LHYA 4OOMA 5FI2A 5E2FA 5FQIA 1PWDA 5HFOA 2WKEA 2WGWA 1SHVA 1FR6A 2EX9A 1MWTA 3BM6A 1QMFA 3OPLA 1YMSA 4R4SA 3V3RA 3VOYA 1K38A 2QMIA 1ESUA 1ESIA 2ZQ8A 3G34A 3IF6B 4EBNA 4GKUA 4XUXA 1L0FA 1N9BA 3PBTA 4WMCA 2PU4A 4JF6A 3G35A 1K4EA 4MNRA 4JF5A 1G6AA 1BULA 3HLGA 3V3SA 3W4OA 4P0MA 3WS2A 3Q7VB 1W79A 4KZBA 3ZG8B 3JYIA 3LY3A 1K54C 4S2NA 1E4DA 3WS0A 5EVIA 1N4OA 1FQGA 1TDGA 4OQIA 3N8LA 4DE2A 2XGNA 5EOEA 2JE5A 1FSWA 3HLEA 4PM5A 2R9WA 1BTLA 1HTZA 4QY6A 3ZG7B 4X56A 1L0EA 2A49A 2ZQCA 4RX3A 2WGVA 1LL5A 2IWDA 4KQOA 5HAPA 3C5AA 4LV2A 1YLYA 4DXCA 4PM8A 5FDHA 4ZDXA 2Y2HA 4OVDA 5FAPA 3SH8A 4OP8A 1MY8A 3NI9A 5EVID 1K56A 1XKZA 3DW0A 4JXSA 4X69A 5AQ9A 3LEZA 3M6BA 3N8RA 5CHUA 1PZPA 3HUOA 3ZHHA 4R4RA 3HUNA 4X53A 5TGFA 4GZBA 3LCEA 2ZC5B 5DF7A 5J8XA 2DNSA 5AQBA 1JWVA 4IVIA 4JXWA 1W8YA 3G4PA 2Y2JA 3C4PA 3IF6A 4BLMA 3EQUA 3PTEA 5FI6A 3EQVA 3MKEA 4OLDA 5HX9A 1YM1A 5CXWA 1K56D 5FQQA 4Y0UA 1ZG4A 1HVBA 3Q82A 3VP1A 4KG5A 5EOOA 5CECA 3G2ZA 3NIAA 3IH8A 3E2LA 3IXBA 4JBFA 4S2PA 1U60A 1M6KA 4C6YA 2Q9MA 4ZJ1A 3Q7VA 4ZAMA 4ZTKA 4KQRA 3HLFA 2ZM0A 4EWFA 1BSGA 5HAQA 3ZG5A 3UDFA 4RVAA 1IKIA 3SH9A 4OQ0A 3HL9A 1H8YA 4PM9A 4DKIA 1KE4A 1JWZA 1PYYA 1XP4A 4HESA 4LV1A 3VFHA 2EFXA 1XXMA 2Y2GA 3Q81A 4FD8A 4OQGA 4KZ4A 5CERA 1SDNA 2CC1A 3UN7A 2ZJ9A 2VGJA 3AGEA 2H10A 4JXGA 1FSYA 3IQAA 1Q2PA 3ZGAB 2EFUA 1MBLA 2WK0A 3QHYA 4WM9A 3ZDJA 4XUZA 1Z6FA 4WEKA 4JXVA 4KZ6A 3TSGA 1ES2A 3C7UA 5GLDA 5FI7A 1K4FA 2WZXA 1BLSA 2J7VA 2V20A 1AXBA 4N9KA 1C3BA 4Z9QA 3ZCZA 4Q8IA 3ZFZA 5FQJA 3G2YA 1YLJA 2XLNA 4DF6A 2PBYA 4B88A 5TR7A 3LY4A 3S4XA 4KQQA 3PBRA 1MWUA 3UPOA 4QB8A 5EVLA 1KE0A 5EVIB 4KZ9A 4LCMA 4JLFA 3A3IA 5DTSA 2ZC6B 5F83A 5CGSA 1FCNA 3VP2A 1BZAA 1TVFA 1WYBA 3HUMA 5HL1A 3W8KA 2OV5A 1QMEA 2H0YA 3B3XA 2X02A 3N7WA 1G68A 2WGIA 3WS4A 4M3KA 1H5XA 4WZ5C 3BLSA 1W5DA 2WAFA 1FR1A 4OPYA 4WELA 5FA7A 4A5RA 1DJAA 3RJUA 4OP5A 4L0LA 3GRJA 4BL2A 1K6RA 4R0QA 4RYEA 2HP9A 1KGGA 3D4FA 4P87A 1K55C 1GCEA 2Y2NA 2RL3A 1CEGA 3IF6C 5E2GA 1W7FA 1ES4A 3HLDA 5TFQA 1S6RA 2C6WB 1BLCA 2GDNA 3BFCA 5F82A 3ZG9B 1GHIA 1LLBA 3IT9A 2HDUA 4FSFA 4KZ5A 5FAOA 4GDBA 3CG5A 1IYPA 3MXRA 1JWPA 4JF4A 3V39A 3IHAA 1H8ZA 2Y2QA 2RCXA 2ZQDA 4MBFA 3O3VA 3GSGA 3QNCA 4B4ZA 1E25A 4P6BA 1BUEA 4BL3A 3S1YA 1NY0A 3IF5A 4WZ4A 3IXDA 3VP0A 1LL9A 3NBLA 5DF9A 3S22A 5E43A 1IYOA 1TDLA 4ZBEA 5CHMA 2XH9A 1IYSA 2X71A 4N1HA 1YLZA 5CHJA 3HVFA 1WYCA 4QJGA 4DDYA 4KENB 3CMZA 2WYXA 1RGZA 3PBSA 2HDQA 1FCOA 2Y2KA 2ZD8A 2Y2LA 1W8QA 3N8SA 4S2KA 2IWBA 3UPNA 4GDNA 1CI9A 3BLMA 5A93A 3Q7ZA 4N92A 1EI5A 5M19A 5G18A 5EUAA 1YQSA 1ZG6A 4S2LA 2EX8A 3UO9A 2ZC3B 1KDWA 3ISGA 5CEDA 5GLBA 4IVKA 4Y7PA 1JTGA 3UDIA 4U0XA 4WBGA 1NRFA 5GL9A 3VFFA 3BYDA 1PZOA 4EQIA 3GMWA 5DVAA 2WADA 3WWXA 1NXYA 5JYOA 4KZ7A 4U0TA 1PW8A 3MZFA 5FQ9A 4FH2A 4DXBA 3UY6A 2P9VB 3UE3A 2BLSA 2C5WB 3DWKA 5EPHA 3V5MA 2XD5A 4S2JA 3M6HA 1K57C 4DE1A 5FQMA 4WEJA 3IXGA 5E2EA 4DE0A 2XFSA 3Q07A 1XPBA 2HP5A 1BLHA 2EX2A 2XDMA 3N4IA 4QHCA 4E3JA 5FATA 1BLPA 1NYMA 3O86A 4HBTA 4OOYA 4UA6A 1MWRA 1I2SA 1YLPA 4GB7A 1DY6A 4LENA 1I5QA 1XGIA 3C4OA 2HDRA 4BQMA 1ES5A 1MXOA 1SDEA 3CZDA 3HLCA 4HEFA 4S2MA 1S0WA 1CI8A 5CRFA 1YLTA 4IBRA 1IEMA 3SS5A 5AQAA 1LI9A 2PU2A 3TOIA 4E3OA 3WS5A 3G31A 4K0XA 3ZNYA 4ZJ3A 2J9OA 3HLWA 1YT4A 2JCHA 4GD6A 4UHUA 1K54A 2XD1A 3IWQA 1M40A 3CJMA 4X6TA 4E3KA 3V50A 4BJPA 4GD8A 2EXBA 2I72A 4YINA 4S2NC 1TEMA 1RCJA 1K25A 4XXRA 5EVIC 1CK3A 2DRWA 5DTKA 3SS4A 3ZG0A 3DTMA 3VMAA 1RGYA 3G30A 1Q2QA 4E3IA 3NCKA 3SH7A 3A3JA 4B4XA 3VSKA 2P9VA 1L2SA 1DJBA 1FCMA 1FOFA 4NK3A 3ITBA 3GVBA 5GHYA 5GHXA 4S2IA 2XEPA 4JPMA 4O7DA 3Q1FA 2OLUA 2EX6A 2ZQ9A 1O07A 2JBFA 3W4PA 2OSUA 3SS3A 2HDSA 4E3NA 3MFDA 2WKHA 4MEZA 4JKTA 1GHPA 3BECA 2FFFB 3HLBA 1IYQA 4E6XA 5GLCA 4ID4A 2V1ZA 3BFGA 1OMEA 1VM1A 5CGXA 4F94A 3IWIA 1WE4A 4H8RA 1KE3A 4N9LA 5GLAA 3VSLA 5HW3A 5KSHA 2Y2PA 2ZMAA 5I94A 4DE3A 3PBOA 5CEBA 4PM7A 2VGKA 1KGEA 4IBXA 1NZOA 3M2KA 4U3TA 4YFMA 5FAQA 3O87A 3WRZA 3HREA 4ZJ2A 4MBKA 3VOZA 1MWSA 4RA7A 4OLGA 5KSCA 3BFEA 4CJNA 1EWZA 3OPRA 3WRTA 1ERQA 3MZDA 4EUZA 3RXXA 3BFFA 2Q9NA 4IEDA 4EV4A 2Y91A 1HD8A 3NY4A 5FASA 2Y2MA 1L0DA 3PAEA 3M2JA 2XK1A 3PAGA 2EXAA 2OLVA 5CGWA 2DCFA 4DRTA 3NDGA 2Y2OA 5JYPA 4D2OA 1BT5A 4OKPA 1GA9A 3IH9A 1PWCA 4R23A 3I7JA 5EECA 4BD1A 4E3LA 1ES3A 1PWGA 2ZQ7A 2E8IA 1ZC2A 1YMXA 4UA7A 1LI0A 1IKGA 4GNUA 2Y4AA 5KMWA 3OCNA 4FH4A 2FFYA 4C3QA 3MZEA 4WMCD 3ZNTA 4QU3A 4OOLA 3A3FA 4HBUA 4R1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM2 A;  4R3J A;  5U47 A;  4KZ3 A;  1VQQ A;  3FKV A;  2H5S A;  4Y0T A;  5A92 A;  4GOG A;  4OH0 A;  3FZC A;  3P09 A;  2G2U A;  3NC8 A;  2IWC A;  4E3M A;  3HBR A;  1YLW A;  3IHB A;  4PPR A;  1MKI A;  2WAE A;  4WZ5 A;  4OON A;  5BOH A;  1KGF A;  3AGD A;  4MBH A;  1PIO A;  1NYY A;  4OPZ A;  3UE0 A;  2H0T A;  1GHM A;  1JTD A;  2Y55 A;  4LCL A;  2JC7 A;  4UAA A;  4BEN A;  1HZO A;  1KDS A;  3OC2 A;  1K55 A;  4OQH A;  3OCL A;  3NDE A;  2XFT A;  3GTC A;  1J9M A;  2XQZ A;  5HAR A;  4MLL A;  3GQZ A;  1E3U A;  2X01 A;  4P85 A;  4UA9 A;  3MBZ A;  4LV3 A;  5A91 A;  3PBQ A;  3RXW A;  3BFD A;  4QD4 A;  5A90 A;  4Y0O A;  3UE1 A;  3DWZ A;  2ZQA A;  1L0G A;  4K91 A;  2UWX A;  5DTT A;  4CPK A;  3VP4 A;  1K6S A;  4FCF A;  3UNW A;  1E3U D;  2WZZ A;  1ONG A;  2HP6 A;  3GV9 A;  1XA7 A;  4X55 A;  3A3D A;  1DJC A;  1Y54 A;  4KZ8 A;  3UDX A;  2ZC4 B;  4BD0 A;  1GA0 A;  4C75 A;  2QPN A;  4RX2 A;  1ALQ A;  1JVJ A;  3PBN A;  3FKW A;  4QY5 A;  2V2F F;  3TG9 A;  1IEL A;  2Z2M B;  3ITA A;  1RP5 A;  1SCW A;  2WGW B;  3FV7 A;  3QNB A;  4GN2 A;  4OPQ A;  5FSR A;  3FWL A;  3FYZ A;  4S2O A;  4NET A;  2ZC7 A;  2Y2I A;  1XX2 A;  2XR0 A;  3LO7 A;  2BG1 A;  2Z2L B;  3OZH A;  4KZA A;  2B5R A;  4OPR A;  5AQ7 A;  5HAI A;  3WS1 A;  3VP3 A;  4X68 A;  5KZH A;  2QZ6 A;  1ZKJ A;  1KVL A;  3MXS A;  4R3B A;  3AGF A;  4LV0 A;  5EE8 A;  3MKF A;  5GHZ A;  1PI5 A;  5CTN A;  2WUQ A;  3OPP A;  3BEB A;  3E2K A;  2J8Y A;  5L2F A;  5FQK A;  5D3O A;  3A3E A;  4PM6 A;  1ONH A;  1KVM A;  1SKF A;  3BRM A;  1O7E A;  3ZVT A;  3GR2 A;  3N6I A;  5M1A A;  1I2W A;  1CEF A;  2HPB A;  4WYY A;  4DDS A;  1MPL A;  2ZLY A;  5F1G A;  3W4Q A;  5M18 A;  2Y59 A;  3ZVW A;  4E6W A;  3SOI A;  1K57 A;  3OPH A;  3P98 A;  4EBL A;  2WKI A;  3C7V A;  2ZM8 A;  2XF3 A;  2P74 A;  4N1X A;  1NZU A;  4KG6 A;  1PW1 A;  1NJ4 A;  2R9X A;  3G32 A;  5CTM A;  3UPP A;  1ERM A;  5DF8 A;  1XGJ A;  3IXH A;  5E2H A;  1XA1 A;  4EBP A;  2J9P A;  1ERO A;  2G2W A;  4K0W A;  4PMA A;  5F1F A;  4KG2 A;  3O88 A;  5IHV A;  3IWO A;  1PI4 A;  2A3U A;  1LHY A;  4OOM A;  5FI2 A;  5E2F A;  5FQI A;  1PWD A;  5HFO A;  2WKE A;  2WGW A;  1SHV A;  1FR6 A;  2EX9 A;  1MWT A;  3BM6 A;  1QMF A;  3OPL A;  1YMS A;  4R4S A;  3V3R A;  3VOY A;  1K38 A;  2QMI A;  1ESU A;  1ESI A;  2ZQ8 A;  3G34 A;  3IF6 B;  4EBN A;  4GKU A;  4XUX A;  1L0F A;  1N9B A;  3PBT A;  4WMC A;  2PU4 A;  4JF6 A;  3G35 A;  1K4E A;  4MNR A;  4JF5 A;  1G6A A;  1BUL A;  3HLG A;  3V3S A;  3W4O A;  4P0M A;  3WS2 A;  3Q7V B;  1W79 A;  4KZB A;  3ZG8 B;  3JYI A;  3LY3 A;  1K54 C;  4S2N A;  1E4D A;  3WS0 A;  5EVI A;  1N4O A;  1FQG A;  1TDG A;  4OQI A;  3N8L A;  4DE2 A;  2XGN A;  5EOE A;  2JE5 A;  1FSW A;  3HLE A;  4PM5 A;  2R9W A;  1BTL A;  1HTZ A;  4QY6 A;  3ZG7 B;  4X56 A;  1L0E A;  2A49 A;  2ZQC A;  4RX3 A;  2WGV A;  1LL5 A;  2IWD A;  4KQO A;  5HAP A;  3C5A A;  4LV2 A;  1YLY A;  4DXC A;  4PM8 A;  5FDH A;  4ZDX A;  2Y2H A;  4OVD A;  5FAP A;  3SH8 A;  4OP8 A;  1MY8 A;  3NI9 A;  5EVI D;  1K56 A;  1XKZ A;  3DW0 A;  4JXS A;  4X69 A;  5AQ9 A;  3LEZ A;  3M6B A;  3N8R A;  5CHU A;  1PZP A;  3HUO A;  3ZHH A;  4R4R A;  3HUN A;  4X53 A;  5TGF A;  4GZB A;  3LCE A;  2ZC5 B;  5DF7 A;  5J8X A;  2DNS A;  5AQB A;  1JWV A;  4IVI A;  4JXW A;  1W8Y A;  3G4P A;  2Y2J A;  3C4P A;  3IF6 A;  4BLM A;  3EQU A;  3PTE A;  5FI6 A;  3EQV A;  3MKE A;  4OLD A;  5HX9 A;  1YM1 A;  5CXW A;  1K56 D;  5FQQ A;  4Y0U A;  1ZG4 A;  1HVB A;  3Q82 A;  3VP1 A;  4KG5 A;  5EOO A;  5CEC A;  3G2Z A;  3NIA A;  3IH8 A;  3E2L A;  3IXB A;  4JBF A;  4S2P A;  1U60 A;  1M6K A;  4C6Y A;  2Q9M A;  4ZJ1 A;  3Q7V A;  4ZAM A;  4ZTK A;  4KQR A;  3HLF A;  2ZM0 A;  4EWF A;  1BSG A;  5HAQ A;  3ZG5 A;  3UDF A;  4RVA A;  1IKI A;  3SH9 A;  4OQ0 A;  3HL9 A;  1H8Y A;  4PM9 A;  4DKI A;  1KE4 A;  1JWZ A;  1PYY A;  1XP4 A;  4HES A;  4LV1 A;  3VFH A;  2EFX A;  1XXM A;  2Y2G A;  3Q81 A;  4FD8 A;  4OQG A;  4KZ4 A;  5CER A;  1SDN A;  2CC1 A;  3UN7 A;  2ZJ9 A;  2VGJ A;  3AGE A;  2H10 A;  4JXG A;  1FSY A;  3IQA A;  1Q2P A;  3ZGA B;  2EFU A;  1MBL A;  2WK0 A;  3QHY A;  4WM9 A;  3ZDJ A;  4XUZ A;  1Z6F A;  4WEK A;  4JXV A;  4KZ6 A;  3TSG A;  1ES2 A;  3C7U A;  5GLD A;  5FI7 A;  1K4F A;  2WZX A;  1BLS A;  2J7V A;  2V20 A;  1AXB A;  4N9K A;  1C3B A;  4Z9Q A;  3ZCZ A;  4Q8I A;  3ZFZ A;  5FQJ A;  3G2Y A;  1YLJ A;  2XLN A;  4DF6 A;  2PBY A;  4B88 A;  5TR7 A;  3LY4 A;  3S4X A;  4KQQ A;  3PBR A;  1MWU A;  3UPO A;  4QB8 A;  5EVL A;  1KE0 A;  5EVI B;  4KZ9 A;  4LCM A;  4JLF A;  3A3I A;  5DTS A;  2ZC6 B;  5F83 A;  5CGS A;  1FCN A;  3VP2 A;  1BZA A;  1TVF A;  1WYB A;  3HUM A;  5HL1 A;  3W8K A;  2OV5 A;  1QME A;  2H0Y A;  3B3X A;  2X02 A;  3N7W A;  1G68 A;  2WGI A;  3WS4 A;  4M3K A;  1H5X A;  4WZ5 C;  3BLS A;  1W5D A;  2WAF A;  1FR1 A;  4OPY A;  4WEL A;  5FA7 A;  4A5R A;  1DJA A;  3RJU A;  4OP5 A;  4L0L A;  3GRJ A;  4BL2 A;  1K6R A;  4R0Q A;  4RYE A;  2HP9 A;  1KGG A;  3D4F A;  4P87 A;  1K55 C;  1GCE A;  2Y2N A;  2RL3 A;  1CEG A;  3IF6 C;  5E2G A;  1W7F A;  1ES4 A;  3HLD A;  5TFQ A;  1S6R A;  2C6W B;  1BLC A;  2GDN A;  3BFC A;  5F82 A;  3ZG9 B;  1GHI A;  1LLB A;  3IT9 A;  2HDU A;  4FSF A;  4KZ5 A;  5FAO A;  4GDB A;  3CG5 A;  1IYP A;  3MXR A;  1JWP A;  4JF4 A;  3V39 A;  3IHA A;  1H8Z A;  2Y2Q A;  2RCX A;  2ZQD A;  4MBF A;  3O3V A;  3GSG A;  3QNC A;  4B4Z A;  1E25 A;  4P6B A;  1BUE A;  4BL3 A;  3S1Y A;  1NY0 A;  3IF5 A;  4WZ4 A;  3IXD A;  3VP0 A;  1LL9 A;  3NBL A;  5DF9 A;  3S22 A;  5E43 A;  1IYO A;  1TDL A;  4ZBE A;  5CHM A;  2XH9 A;  1IYS A;  2X71 A;  4N1H A;  1YLZ A;  5CHJ A;  3HVF A;  1WYC A;  4QJG A;  4DDY A;  4KEN B;  3CMZ A;  2WYX A;  1RGZ A;  3PBS A;  2HDQ A;  1FCO A;  2Y2K A;  2ZD8 A;  2Y2L A;  1W8Q A;  3N8S A;  4S2K A;  2IWB A;  3UPN A;  4GDN A;  1CI9 A;  3BLM A;  5A93 A;  3Q7Z A;  4N92 A;  1EI5 A;  5M19 A;  5G18 A;  5EUA A;  1YQS A;  1ZG6 A;  4S2L A;  2EX8 A;  3UO9 A;  2ZC3 B;  1KDW A;  3ISG A;  5CED A;  5GLB A;  4IVK A;  4Y7P A;  1JTG A;  3UDI A;  4U0X A;  4WBG A;  1NRF A;  5GL9 A;  3VFF A;  3BYD A;  1PZO A;  4EQI A;  3GMW A;  5DVA A;  2WAD A;  3WWX A;  1NXY A;  5JYO A;  4KZ7 A;  4U0T A;  1PW8 A;  3MZF A;  5FQ9 A;  4FH2 A;  4DXB A;  3UY6 A;  2P9V B;  3UE3 A;  2BLS A;  2C5W B;  3DWK A;  5EPH A;  3V5M A;  2XD5 A;  4S2J A;  3M6H A;  1K57 C;  4DE1 A;  5FQM A;  4WEJ A;  3IXG A;  5E2E A;  4DE0 A;  2XFS A;  3Q07 A;  1XPB A;  2HP5 A;  1BLH A;  2EX2 A;  2XDM A;  3N4I A;  4QHC A;  4E3J A;  5FAT A;  1BLP A;  1NYM A;  3O86 A;  4HBT A;  4OOY A;  4UA6 A;  1MWR A;  1I2S A;  1YLP A;  4GB7 A;  1DY6 A;  4LEN A;  1I5Q A;  1XGI A;  3C4O A;  2HDR A;  4BQM A;  1ES5 A;  1MXO A;  1SDE A;  3CZD A;  3HLC A;  4HEF A;  4S2M A;  1S0W A;  1CI8 A;  5CRF A;  1YLT A;  4IBR A;  1IEM A;  3SS5 A;  5AQA A;  1LI9 A;  2PU2 A;  3TOI A;  4E3O A;  3WS5 A;  3G31 A;  4K0X A;  3ZNY A;  4ZJ3 A;  2J9O A;  3HLW A;  1YT4 A;  2JCH A;  4GD6 A;  4UHU A;  1K54 A;  2XD1 A;  3IWQ A;  1M40 A;  3CJM A;  4X6T A;  4E3K A;  3V50 A;  4BJP A;  4GD8 A;  2EXB A;  2I72 A;  4YIN A;  4S2N C;  1TEM A;  1RCJ A;  1K25 A;  4XXR A;  5EVI C;  1CK3 A;  2DRW A;  5DTK A;  3SS4 A;  3ZG0 A;  3DTM A;  3VMA A;  1RGY A;  3G30 A;  1Q2Q A;  4E3I A;  3NCK A;  3SH7 A;  3A3J A;  4B4X A;  3VSK A;  2P9V A;  1L2S A;  1DJB A;  1FCM A;  1FOF A;  4NK3 A;  3ITB A;  3GVB A;  5GHY A;  5GHX A;  4S2I A;  2XEP A;  4JPM A;  4O7D A;  3Q1F A;  2OLU A;  2EX6 A;  2ZQ9 A;  1O07 A;  2JBF A;  3W4P A;  2OSU A;  3SS3 A;  2HDS A;  4E3N A;  3MFD A;  2WKH A;  4MEZ A;  4JKT A;  1GHP A;  3BEC A;  2FFF B;  3HLB A;  1IYQ A;  4E6X A;  5GLC A;  4ID4 A;  2V1Z A;  3BFG A;  1OME A;  1VM1 A;  5CGX A;  4F94 A;  3IWI A;  1WE4 A;  4H8R A;  1KE3 A;  4N9L A;  5GLA A;  3VSL A;  5HW3 A;  5KSH A;  2Y2P A;  2ZMA A;  5I94 A;  4DE3 A;  3PBO A;  5CEB A;  4PM7 A;  2VGK A;  1KGE A;  4IBX A;  1NZO A;  3M2K A;  4U3T A;  4YFM A;  5FAQ A;  3O87 A;  3WRZ A;  3HRE A;  4ZJ2 A;  4MBK A;  3VOZ A;  1MWS A;  4RA7 A;  4OLG A;  5KSC A;  3BFE A;  4CJN A;  1EWZ A;  3OPR A;  3WRT A;  1ERQ A;  3MZD A;  4EUZ A;  3RXX A;  3BFF A;  2Q9N A;  4IED A;  4EV4 A;  2Y91 A;  1HD8 A;  3NY4 A;  5FAS A;  2Y2M A;  1L0D A;  3PAE A;  3M2J A;  2XK1 A;  3PAG A;  2EXA A;  2OLV A;  5CGW A;  2DCF A;  4DRT A;  3NDG A;  2Y2O A;  5JYP A;  4D2O A;  1BT5 A;  4OKP A;  1GA9 A;  3IH9 A;  1PWC A;  4R23 A;  3I7J A;  5EEC A;  4BD1 A;  4E3L A;  1ES3 A;  1PWG A;  2ZQ7 A;  2E8I A;  1ZC2 A;  1YMX A;  4UA7 A;  1LI0 A;  1IKG A;  4GNU A;  2Y4A A;  5KMW A;  3OCN A;  4FH4 A;  2FFY A;  4C3Q A;  3MZE A;  4WMC D;  3ZNT A;  4QU3 A;  4OOL A;  3A3F A;  4HBU A;  4R1G A; 
#chains in the Genus database with same CATH topology
 2ZM2 A;  1T18 A;  4G3K A;  4KZ3 A;  5L07 A;  4Y0T A;  2KOI A;  4OH0 A;  3FZC A;  3NC8 A;  2IWC A;  1PNE A;  1CF0 A;  2HGV A;  3HJI A;  5BOH A;  1KGF A;  4MBH A;  4OPZ A;  3UE0 A;  3K3C A;  1KDS A;  1K55 A;  4X1M A;  5HAR A;  4LV3 A;  5A91 A;  3RXW A;  3BFD A;  4QD4 A;  5A90 A;  2M7V A;  4Y0O A;  3JPU A;  2UWX A;  5DTT A;  1K6S A;  3S7O A;  1ONG A;  3A3D A;  1Y54 A;  4K08 A;  1GA0 A;  3UMD A;  4M4X A;  3DTE A;  4NXB A;  1SCW A;  2PD7 A;  2ACG A;  3FV7 A;  3QNB A;  4OPQ A;  5FSR A;  4S2O A;  1TS0 A;  4NET A;  3CIT A;  3NOT C;  4LGW A;  2XR0 A;  1VET A;  2B5R A;  4OPR A;  5AQ7 A;  3DBA A;  3WS1 A;  4X68 A;  3CHW P;  3T4S A;  3T4J A;  3V67 A;  5EE8 A;  5CTN A;  5DKL A;  5L2F A;  2E8J A;  5FQK A;  3A3E A;  4ETZ A;  1D7E A;  3ZVT A;  3MF0 A;  4WYY A;  4DDS A;  1MPL A;  2ZLY A;  5F1G A;  3ZVW A;  3SOI A;  2PYP A;  2R9X A;  2V9A A;  4GLQ A;  3MMH A;  1NRJ A;  4K0W A;  5FI2 A;  1PWD A;  2JN7 A;  3V3R A;  1XJ2 A;  2QMI A;  2ZQ8 A;  4GKU A;  1VEU A;  1N9B A;  4HH3 A;  4WMC A;  2PU4 A;  4JF6 A;  3B33 A;  4MN7 A;  3KYZ A;  1OTD A;  3VE3 A;  2KDK A;  3VOL A;  3EEH A;  4WL9 A;  4S2N A;  3VV4 A;  5EVI A;  1TDG A;  4DE2 A;  2NUT C;  5EOE A;  1FSW A;  4PM5 A;  4QY6 A;  4X56 A;  3LI8 A;  2A49 A;  2ZQC A;  2WGV A;  3C5A A;  4LV2 A;  4GHI B;  1KOU A;  5FDH A;  4OVD A;  1G5U A;  5EVI D;  1K56 A;  1XKZ A;  5LBR A;  4X69 A;  3HUO A;  3ZHH A;  5J3W A;  3T1R A;  5TGF A;  2FH5 A;  4G3W A;  1JWV A;  3LI9 A;  3OLO A;  1VHM A;  2QWS A;  5HX9 A;  1K56 D;  2DMW A;  1ZG4 A;  5EOO A;  2JKR I;  2W1T B;  3IH8 A;  3E2L A;  3LID A;  1M6K A;  4P6Z M;  3HLF A;  5EVE A;  3QP8 A;  3ZG5 A;  4H6J A;  2G7U A;  3QP6 A;  1XP4 A;  4LV1 A;  2PBD P;  3Q81 A;  4JGO A;  4MN6 A;  2H10 A;  2W3H A;  3IQA A;  4WM9 A;  3DAV A;  4N9K A;  2V20 A;  1AXB A;  1C3B A;  2ZBB A;  1G6O A;  2IA2 A;  2XLN A;  4KQQ A;  3UPO A;  4QB8 A;  5EVI B;  5DTS A;  1S4R A;  4JLF A;  4HHD A;  1YSP A;  3O5Y A;  2J3T D;  1TVF A;  3NHQ A;  2ZMF A;  3N7W A;  4M3K A;  1F98 A;  2WAF A;  4A5R A;  5FA7 A;  3RJU A;  4OP5 A;  3GRJ A;  4RYE A;  1KGG A;  4ME4 A;  4HIA A;  2GX5 A;  5HSQ A;  3HCY A;  2Y2N A;  2V8F A;  4HQA A;  3IF6 C;  3T4O A;  2C6W B;  1BLC A;  2GDN A;  3BFC A;  4YOF A;  5F82 A;  2P08 A;  1N9O A;  4KZ5 A;  2HDU A;  5FAO A;  1IYP A;  5HWT A;  4BL3 A;  3A0S A;  3IXD A;  2PYR A;  1PFL A;  2VEA A;  4BWI A;  4GJ4 A;  4ZBE A;  5CHM A;  4DDY A;  3CMZ A;  2MJ6 A;  1RGZ A;  3PBS A;  1FCO A;  4S2K A;  3N8S A;  3BLM A;  2LB5 A;  2BTF P;  2EX8 A;  1P9W A;  3P7N A;  5GLB A;  5I5L A;  5G4Y A;  1N9N A;  2ZMV A;  4U0T A;  4DN0 A;  3CAX A;  3UY6 A;  3UE3 A;  2C5W B;  5IS1 A;  2XD5 A;  4S2J A;  1K57 C;  4WEJ A;  2OWH A;  4DE0 A;  2HP5 A;  2XDM A;  4P6Z S;  3T12 B;  4HBT A;  4MN5 A;  1DY6 A;  1GSW A;  1XGI A;  4BQM A;  4G3V A;  1SDE A;  2OAP 1;  4HEF A;  1S0W A;  4IBR A;  1IEM A;  2PU2 A;  3G31 A;  4IUH A;  3ZNY A;  2JCH A;  3IWQ A;  4X6T A;  4BJP A;  4IHQ A;  3NOP C;  2EXB A;  4YIN A;  3ZG0 A;  1K25 A;  4Q0J A;  3DTM A;  3CWF A;  1LSX A;  3VMA A;  3IBJ A;  3A3J A;  3VSK A;  1FOF A;  5GHX A;  2P04 A;  3LIC A;  1GSV A;  2ZQ9 A;  1O07 A;  3SS3 A;  4E3N A;  4MEZ A;  3K3D A;  4BMW A;  2FFF B;  4II7 A;  1MZU A;  2VZW A;  2WKQ A;  3HLB A;  1IYQ A;  2V1Z A;  1LL8 A;  3IWI A;  4N9L A;  5HW3 A;  4EUV A;  2JKF A;  3C38 A;  3BY9 A;  3D9Y A;  4PM7 A;  1KGE A;  3C30 A;  4U3T A;  3WRZ A;  4OLG A;  5KSC A;  1S1Z A;  4EV4 A;  2Y91 A;  2M7U A;  3PAE A;  1OTE A;  2EXA A;  3T1S A;  2DCF A;  4MDZ A;  3F1O B;  4R6L A;  4BD1 A;  4E3L A;  1ES3 A;  2E8I A;  4X25 A;  1LI0 A;  2Y4A A;  3KO6 A;  5EV0 A;  4HJ3 A;  4FH4 A;  5F6A A;  1OJG A;  4OOL A;  4R1G A;  1LT0 A;  4Y13 A;  5U47 A;  2H5S A;  5L10 A;  5A92 A;  2OOL A;  4GOG A;  3P09 A;  1P9R A;  2G2U A;  2XA7 M;  3PHY A;  1L3L A;  3IHB A;  1YLW A;  2WAE A;  5IT5 A;  3H82 A;  3AGD A;  1NYY A;  4Z1W A;  4LCL A;  2JC7 A;  4BEN A;  3OC2 A;  1S67 L;  3TRC A;  4OQH A;  2O9C A;  3CUE C;  3KSH A;  3OCL A;  1IOU A;  3GTC A;  2WKR A;  3FC7 A;  1DP6 A;  3NOU C;  4MLL A;  1E3U A;  4UA9 A;  3PBQ A;  2VV8 A;  5EM1 A;  4CPK A;  3VP4 A;  4R38 A;  1H3Q A;  1E3U D;  3JVV A;  3GV9 A;  1XA7 A;  4X55 A;  5DFY A;  4BD0 A;  2QPN A;  4RX2 A;  1ALQ A;  4QY5 A;  3FKW A;  2B02 A;  3PR6 A;  2Z2M B;  1RP5 A;  2WGW B;  4GN2 A;  3FYZ A;  2ZC7 A;  1K0K A;  2Y2I A;  3RFB A;  2Z2L B;  2UV0 E;  4NG2 A;  3UB6 A;  5HAI A;  1W63 M;  4CLC E;  3VP3 A;  1KVL A;  3MXS A;  5GHZ A;  3AGF A;  2WUQ A;  3E2K A;  4YNR A;  3BW6 A;  1SKF A;  3GR2 A;  5M1A A;  1CEF A;  4O8G A;  3W4Q A;  2Y59 A;  2O9B A;  1K57 A;  2WKI A;  3C7V A;  2ZM8 A;  2P74 A;  4N1X A;  4R70 A;  5CTM A;  1ERM A;  4GW9 A;  5A8B A;  4EBP A;  1ERO A;  2A3U A;  1LHY A;  2AVX A;  5FEF A;  1QMF A;  1K38 A;  3UME A;  1ESI A;  3IF6 B;  2VKS A;  4XUX A;  2Q0O A;  1L0F A;  3G35 A;  5HD3 A;  3HLG A;  4NXE A;  3V3S A;  3W4O A;  5F69 A;  3LIE A;  4KZB A;  3ZG8 B;  3LY3 A;  1K54 C;  1E4D A;  1FQG A;  4L9F A;  4OQI A;  3MJQ A;  1HTZ A;  2L1M A;  5HAP A;  3U4L P;  4PM8 A;  5F5Y A;  4ZDX A;  5FAP A;  3MS6 A;  3MQ0 A;  1MY8 A;  3NI9 A;  3T4Q A;  3DW0 A;  2D01 A;  4JXS A;  5AQ9 A;  2QJ7 A;  3LEZ A;  3M6B A;  3N8R A;  4R4R A;  3HUN A;  3LCE A;  2DNS A;  3LIB A;  3PTE A;  3MKE A;  1YM1 A;  5FQQ A;  3KYQ A;  1FIL A;  1T1B A;  3IXB A;  4JBF A;  4S2P A;  1HLU P;  3LIA A;  5HAQ A;  2R78 A;  4RVA A;  4Q0I A;  3LR3 A;  3SH9 A;  4PM9 A;  1PYY A;  3D3O A;  4HES A;  2GJ3 A;  4GHI A;  2EFX A;  1XXM A;  4FD8 A;  4OQG A;  4KZ4 A;  2CC1 A;  2ZJ9 A;  2VGJ A;  3T1X A;  3AGE A;  3LGO A;  1FSY A;  3ZGA B;  3D72 A;  3LUQ A;  2NUP C;  2PD8 A;  5L8M A;  4DF6 A;  3HJK A;  4ETX A;  5K5B A;  2W1T A;  3VP2 A;  3HUM A;  4QWO A;  1T1A A;  3H9W A;  4JGR A;  2WGI A;  2XSS A;  4O01 A;  4WZ5 C;  4PKY A;  3EWK A;  3CUE A;  3E4O A;  2A24 A;  4R0Q A;  2HP9 A;  5MC7 A;  3D4F A;  4FTX A;  4P87 A;  3H7W A;  1CEG A;  3HLD A;  5TFQ A;  1GHI A;  4LRY C;  1LLB A;  5AVE A;  2FZ0 A;  3LFV A;  3MXR A;  4NKP A;  3IHA A;  5AJG A;  4P6B A;  1SKO A;  2V1B A;  4ARZ B;  4HP4 A;  3LYX A;  3T4K A;  2O9A A;  1TDL A;  4IJG A;  4PAU A;  4Y5F A;  1IYS A;  4N1H A;  4QJG A;  4KEN B;  2WYX A;  5G4Z A;  1W8Q A;  3Q7Z A;  5HDC A;  4N92 A;  3NUL A;  1OPX A;  1TS7 A;  5M19 A;  5EUA A;  4S2L A;  1OTB A;  5CED A;  2OWJ A;  1JTG A;  4WBG A;  3BYD A;  5DVA A;  3WWX A;  1NXY A;  1PW8 A;  1XJ6 A;  2QHK A;  2BLS A;  5EPH A;  3DWK A;  4DE1 A;  3M6H A;  5C5K A;  3IXG A;  4EW7 A;  1BLH A;  5HDS A;  4HJ4 A;  3N4I A;  5TBM B;  5FAT A;  1BLP A;  1NYM A;  3O86 A;  2XRN A;  2YKF A;  1I2S A;  1YLP A;  2A24 B;  4LEN A;  4WLA A;  1ODV A;  3C4O A;  2HDR A;  3H7W B;  4O0P A;  1YLT A;  3SS5 A;  1LI9 A;  3TOI A;  4E3O A;  4EET B;  3WS5 A;  2J9O A;  1YT4 A;  4GCZ A;  1K54 A;  4I3I A;  1M40 A;  2VGL M;  4JGQ A;  1SKO B;  1LSV A;  1PRQ A;  1TEM A;  3U2A A;  1CK3 A;  2DRW A;  2L4R A;  5DTK A;  5CX7 A;  3G30 A;  4HY8 A;  3W2Z A;  3SH7 A;  1L2S A;  1NWZ A;  3GVB A;  2XEP A;  3S7N A;  2OLU A;  2JBF A;  2WKH A;  4GS9 B;  1GHP A;  5FDS A;  4E6X A;  5CGX A;  4F94 A;  1KE3 A;  3VSL A;  2OAQ 1;  4WF0 A;  5CEB A;  4IBX A;  4KQD A;  4YFM A;  3HRE A;  3VOZ A;  3BFE A;  1EWZ A;  5HPF A;  3RXX A;  3RTY A;  4KUO A;  2ZL1 B;  4AFI A;  2Y2M A;  1L0D A;  3M2J A;  2W3E A;  2Y2O A;  5DJT A;  3BQA A;  1GA9 A;  4D60 A;  1D06 A;  3IH9 A;  5FL3 A;  1PWG A;  1ZC2 A;  1MC0 A;  1YMX A;  4GNU A;  3L9K A;  4CLC B;  2PR6 A;  2V8C A;  4RQ9 A;  2FFY A;  4C3Q A;  1DP8 A;  3MZE A;  2Z6C A;  3ZNT A;  3A3F A;  4HBU A;  1OTA A;  3IX3 A;  4E3M A;  3HBR A;  4WZ5 A;  1MKI A;  1MKM A;  4OON A;  1SZV A;  1GHM A;  1JTD A;  4BBV A;  1T19 A;  1HZO A;  3NDE A;  2XFT A;  2XQZ A;  3PXP A;  4HNB A;  3GQZ A;  4P85 A;  3MBZ A;  3QP4 A;  3UE1 A;  3F1O A;  2ZQA A;  5HWV A;  4HP9 A;  2HP6 A;  1P0Z A;  3BJN A;  3UDX A;  4C75 A;  3PBN A;  1IEL A;  2M1C A;  3FWL A;  1J3W A;  1XX2 A;  3LO7 A;  3ZQ5 A;  2BG1 A;  3OZH A;  2PDR A;  5DJU A;  3MXQ A;  5KZH A;  4HI4 A;  2QZ6 A;  4R3B A;  5EFW A;  1PI5 A;  3OPP A;  2W3D A;  3BEB A;  4Y2F A;  4BBU A;  4LRX C;  5D3O A;  4PM6 A;  5HPI A;  1ONH A;  1KVM A;  1O7E A;  1I2W A;  2HPB A;  1A0K A;  5M18 A;  4E6W A;  1XJ3 A;  4ESP A;  1NZU A;  1PW1 A;  3G32 A;  2VLG A;  5DF8 A;  1XGJ A;  5E2H A;  1XA1 A;  2B18 A;  2J9P A;  4PMA A;  5F1F A;  2J80 A;  3O88 A;  3IWO A;  1PI4 A;  3LR5 A;  2QYB A;  4LPZ A;  5E2F A;  2WKE A;  2WGW A;  1MWT A;  3OPL A;  3BM6 A;  1ESU A;  3UB8 A;  4Y3I A;  4EBN A;  3R7W A;  3F1P B;  3PBT A;  1K4E A;  4MNR A;  1BUL A;  3WS2 A;  1ACF A;  3Q7V B;  3JYI A;  3N8L A;  2JE5 A;  3HLE A;  2R9W A;  3MSH A;  4RX3 A;  2GNX A;  4KQO A;  3E98 A;  1YLY A;  2BAS A;  1S4S A;  5DFX A;  1TS6 A;  5CHU A;  1PZP A;  1OJ5 A;  1VB6 A;  3B47 A;  4GZB A;  5J8X A;  4I5S A;  1W8Y A;  2Y2J A;  3C4P A;  3IF6 A;  4BLM A;  5FI6 A;  3EQV A;  4OLD A;  5CXW A;  5HWW A;  1Y28 A;  1HVB A;  3VP1 A;  3G2Z A;  3NIA A;  4C6Y A;  2Q9M A;  4ZJ1 A;  4KQR A;  2ZM0 A;  1BSG A;  1UGU A;  5FEG A;  3HL9 A;  3K2N A;  1JWZ A;  1TF1 A;  2JKT I;  3VFH A;  5EM0 A;  1XJ4 A;  1Z09 A;  3UN7 A;  2V0U A;  1Q2P A;  2XRO A;  3NJA A;  4E04 A;  2W3F A;  1Z6F A;  4JXV A;  3R7W B;  1ES2 A;  5GLD A;  1XFN A;  3OBF A;  4I38 A;  3ZYT A;  2J7V A;  2WZX A;  4Z9Q A;  3ZCZ A;  2HF6 A;  4LLO B;  5FQJ A;  3T4L A;  3G2Y A;  1YLJ A;  2ZOH A;  5TR7 A;  3LY4 A;  4B88 A;  1DP9 A;  1MWU A;  4HJ6 A;  4KZ9 A;  2ZC6 B;  5F83 A;  1FCN A;  1WYB A;  3W8K A;  1QME A;  2H0Y A;  3B3X A;  2X02 A;  2QKP A;  2JKG A;  3MQQ A;  1FR1 A;  1DJA A;  4BL2 A;  1F2K A;  1TS8 A;  4I39 A;  3EEA A;  1GCE A;  3CI6 A;  2RL3 A;  5E2G A;  1W7F A;  1ES4 A;  3F1N A;  3IT9 A;  4JF4 A;  1STZ A;  4WUJ A;  3TW8 A;  1H8Z A;  2RCX A;  3QNC A;  4B4Z A;  1E25 A;  1BUE A;  4EEP A;  3IF5 A;  4WZ4 A;  3VP0 A;  1NLZ A;  4JGP A;  3SZT A;  4CLC C;  4ZRR A;  2ZOI A;  1YAX A;  4XT2 B;  2XH9 A;  3CLO A;  2X71 A;  5CHJ A;  1BYW A;  3GEC A;  2ZD8 A;  4DKI A;  2Y2L A;  2JHE A;  3UPN A;  1CI9 A;  1H8M A;  1EI5 A;  5G18 A;  3OOV A;  1YQS A;  1ZG6 A;  2XA7 S;  3UO9 A;  3ISG A;  1X0O A;  2L0W A;  2B95 A;  1FIK A;  4Y7P A;  2Y79 A;  3UDI A;  5GL9 A;  1PZO A;  3GMW A;  2WAD A;  5JYO A;  3ULF A;  4FH2 A;  4DXB A;  4L9E A;  2P9V B;  4ARZ A;  1CQA A;  2XFS A;  1XPB A;  2CMN A;  4QHC A;  4E3J A;  4Y15 A;  4OOY A;  2HJE A;  1MWR A;  4UA6 A;  2HZ5 A;  3SW1 A;  1WA9 A;  3UB9 A;  2VK3 A;  4HOI A;  4B93 A;  4EER A;  1D1J A;  1YPR A;  1CI8 A;  4NEE D;  5AQA A;  3F1N B;  3FPV A;  5DKK A;  3CPT B;  4GD6 A;  2VX8 A;  2XD1 A;  4GD8 A;  3E4Q A;  2I9V A;  1RCJ A;  5J7E A;  2PT7 A;  4E3I A;  3NCK A;  2JKR M;  1DJB A;  1FCM A;  4NK3 A;  3ITB A;  4S2I A;  4JPM A;  2EX6 A;  1AWI A;  5TBM A;  3BY8 A;  1N9L A;  3MFD A;  4JKT A;  5GLC A;  4ID4 A;  1W63 Q;  3BFG A;  1WE4 A;  4H8R A;  5KSH A;  2ZMA A;  4NXG A;  5I94 A;  3KX0 X;  2VGK A;  1NZO A;  3M2K A;  3O87 A;  4ZJ2 A;  3OPR A;  3MZD A;  4EUZ A;  5F68 A;  1HD8 A;  1ZTU A;  3NY4 A;  3ICY A;  5HDD A;  2XK1 A;  4I3A A;  5HD5 A;  4DRT A;  3E4P A;  5JYP A;  4D2O A;  1BT5 A;  3VE4 A;  4OKP A;  2QJ5 A;  4GS9 A;  1PWC A;  4KUK A;  3DTK A;  3C8C A;  1IKG A;  1EW0 A;  3OCN A;  1JNU A;  1T1C A;  4WMC D;  4QU3 A;  5TJJ A;  4R3J A;  4FOF A;  1VQQ A;  3FKV A;  3MFX A;  3BQ8 A;  2YKH A;  4PPR A;  1PIO A;  3FG8 A;  2H0T A;  2Y55 A;  5J4E A;  1VET B;  4UAA A;  2ZL1 A;  3E0Y A;  3IBR A;  1J9M A;  4EES A;  2X01 A;  2INW A;  3DWZ A;  1L0G A;  3EGX C;  4K91 A;  1OT9 A;  4FCF A;  3UNW A;  2WZZ A;  4CLC A;  3QP2 A;  1DJC A;  3IX4 A;  4KZ8 A;  1DRM A;  1XFQ A;  2ZC4 B;  3LEQ A;  4HH2 A;  1JVJ A;  2V0W A;  2V2F F;  3TG9 A;  3S7Q A;  4DMZ A;  3ITA A;  3KSG A;  3UB5 P;  4CLC D;  4KZA A;  1VEU B;  1ZKJ A;  4LV0 A;  3MKF A;  2J8Y A;  3BRM A;  3LIF A;  1CJF A;  3N6I A;  3OPH A;  3P98 A;  2VJW A;  4EBL A;  3T4T A;  2XF3 A;  4KG6 A;  1NJ4 A;  3UPP A;  1V9Z A;  2HV1 A;  3IXH A;  2G2W A;  4KG2 A;  5IHV A;  5HL6 A;  5HFO A;  4OOM A;  5FQI A;  1SHV A;  1FR6 A;  2EX9 A;  4R4S A;  1YMS A;  4B9O A;  3VOY A;  3G34 A;  4F3L A;  2J3W A;  4IUK A;  2KLI A;  4JF5 A;  1G6A A;  4Q0H A;  4P0M A;  1W79 A;  3WS0 A;  1N4O A;  2HJ9 C;  2VV6 A;  4H6J B;  2XGN A;  1S66 L;  1BTL A;  3MQO A;  3ZG7 B;  1L0E A;  1OTI A;  1LL5 A;  2O0Y A;  2IWD A;  3IS2 A;  4DXC A;  2Y2H A;  3UB7 A;  3SH8 A;  4OP8 A;  3KYE A;  4MCW A;  2K7S A;  2EA9 A;  1OT6 A;  4X53 A;  1NLY A;  2ZC5 B;  5DF7 A;  5AQB A;  2LB9 A;  4IVI A;  2D02 A;  4JXW A;  3G4P A;  4EU0 A;  3A0R A;  3EQU A;  3F1P A;  4Y0U A;  3Q82 A;  4KG5 A;  5CEC A;  2A2L A;  4FUW A;  4MMN A;  1U60 A;  3Q7V A;  4ZAM A;  4ZTK A;  4EWF A;  3UDF A;  1IKI A;  3R4K A;  4OQ0 A;  4PHT A;  2EWW A;  4UQI M;  1H8Y A;  1KE4 A;  2PR5 A;  2Y2G A;  5CER A;  1SDN A;  2VGL S;  2Z6D A;  3RH8 B;  4JXG A;  2EFU A;  1MBL A;  1S1Y A;  2WK0 A;  3QHY A;  3IX8 A;  3ZDJ A;  4XUZ A;  4WEK A;  4KZ6 A;  4F3L B;  3TSG A;  2H28 A;  3C7U A;  5FI7 A;  1K4F A;  2O99 A;  1BLS A;  4EEU A;  3A0V A;  4Q8I A;  3ZFZ A;  5HZH A;  2PBY A;  2W27 A;  3S4X A;  3PBR A;  5L09 A;  5EVL A;  1KE0 A;  4LCM A;  3A3I A;  1UWP X;  5CGS A;  4LFU A;  1BZA A;  1F5M A;  5HL1 A;  2OV5 A;  4CQH A;  3IS2 B;  2P7J A;  1G68 A;  3WS4 A;  3T1Q B;  1H5X A;  3BLS A;  1W5D A;  4WEL A;  4OPY A;  2VV7 A;  4L0L A;  1K6R A;  3BWL A;  1K55 C;  2JKT M;  5IU1 A;  1V9Y A;  1S6R A;  4EQ1 A;  3ZG9 B;  4FSF A;  2V1A A;  4GDB A;  3CG5 A;  1JWP A;  3V39 A;  4YWZ A;  2Y2Q A;  2ZQD A;  3QP5 A;  4MBF A;  3O3V A;  3GSG A;  2PAV P;  3S1Y A;  1NY0 A;  2PRF A;  1LL9 A;  4EXO A;  3NBL A;  5DF9 A;  3NEC A;  3S22 A;  5E43 A;  1YKD A;  1IYO A;  3G6O A;  3KSF A;  1YLZ A;  3MR0 A;  3HVF A;  1WYC A;  3PYP A;  2HDQ A;  4NXF A;  2Y2K A;  3T50 A;  1G28 A;  2WKP A;  2IWB A;  4GDN A;  5A93 A;  2KX6 A;  3C2W A;  2ZC3 B;  4PKY G;  1KDW A;  4QPR A;  1IFQ A;  1F9I A;  4IVK A;  4U0X A;  1NRF A;  3VFF A;  5KIZ A;  4EQI A;  4KZ7 A;  1GSX A;  3MZF A;  5FQ9 A;  2W1R A;  2PHY A;  3V5M A;  5FQM A;  5E2E A;  3TJZ C;  3Q07 A;  2EX2 A;  2Y8H A;  5AVF A;  4XT2 A;  1YSQ A;  3UE6 A;  4GB7 A;  3EGD C;  1I5Q A;  1ES5 A;  1MXO A;  4UQI S;  3CZD A;  3HLC A;  4S2M A;  4UEY A;  2K2N A;  5CRF A;  3JVU A;  1LSW A;  2EWV A;  4K0X A;  3LR0 A;  4ZJ3 A;  3HLW A;  3S7P A;  4UHU A;  4E3K A;  3CJM A;  3V50 A;  3L7H A;  4BBT A;  2I72 A;  4XXR A;  4S2N C;  3SS4 A;  5EVI C;  2W0N A;  1RGY A;  3B42 A;  1Q2Q A;  4B4X A;  2VA0 A;  2P9V A;  2K31 A;  5GHY A;  2W3G A;  4O7D A;  3Q1F A;  3EOI A;  3W4P A;  2OSU A;  2HDS A;  3KSI A;  3BEC A;  4WN5 A;  4X1L A;  1OME A;  1VM1 A;  5GLA A;  2Y2P A;  1UWN X;  2GZA A;  4DE3 A;  3PBO A;  3LR4 A;  4Y17 A;  3CPT A;  3GDI A;  5FAQ A;  4MBK A;  4I3J A;  1MWS A;  4RA7 A;  1P97 A;  4DJ2 A;  3H82 B;  4CJN A;  3WRT A;  1ERQ A;  3QP1 A;  3BFF A;  2Q9N A;  4IED A;  4L9G A;  5FAS A;  3PAG A;  2OLV A;  5CGW A;  3NDG A;  3P01 A;  1ZHH B;  4R3A A;  1Y4O A;  4R23 A;  1TD5 A;  3I7J A;  5EEC A;  2J3T C;  2ZQ7 A;  4LRZ E;  4UA7 A;  3TE8 A;  5KMW A;  3FPW A;  1H0M A;  4DJ3 A;  3DTI A; 
#chains in the Genus database with same CATH homology
 2ZM2 A;  4R3J A;  5U47 A;  4KZ3 A;  1VQQ A;  3FKV A;  2H5S A;  4Y0T A;  5A92 A;  4GOG A;  4OH0 A;  3FZC A;  3P09 A;  2G2U A;  3NC8 A;  2IWC A;  4E3M A;  3HBR A;  1YLW A;  3IHB A;  4PPR A;  1MKI A;  2WAE A;  4WZ5 A;  4OON A;  5BOH A;  1KGF A;  3AGD A;  4MBH A;  1PIO A;  1NYY A;  4OPZ A;  3UE0 A;  2H0T A;  1GHM A;  1JTD A;  2Y55 A;  4LCL A;  2JC7 A;  4UAA A;  4BEN A;  1HZO A;  1KDS A;  3OC2 A;  1K55 A;  4OQH A;  3OCL A;  3NDE A;  2XFT A;  3GTC A;  1J9M A;  2XQZ A;  5HAR A;  4MLL A;  3GQZ A;  1E3U A;  2X01 A;  4P85 A;  4UA9 A;  3MBZ A;  4LV3 A;  5A91 A;  3PBQ A;  3RXW A;  3BFD A;  4QD4 A;  5A90 A;  4Y0O A;  3UE1 A;  3DWZ A;  2ZQA A;  1L0G A;  4K91 A;  2UWX A;  5DTT A;  4CPK A;  3VP4 A;  1K6S A;  4FCF A;  3UNW A;  1E3U D;  2WZZ A;  1ONG A;  2HP6 A;  3GV9 A;  1XA7 A;  4X55 A;  3A3D A;  1DJC A;  1Y54 A;  4KZ8 A;  3UDX A;  2ZC4 B;  4BD0 A;  1GA0 A;  4C75 A;  2QPN A;  4RX2 A;  1ALQ A;  1JVJ A;  3PBN A;  3FKW A;  4QY5 A;  2V2F F;  3TG9 A;  1IEL A;  2Z2M B;  3ITA A;  1RP5 A;  1SCW A;  2WGW B;  3FV7 A;  3QNB A;  4GN2 A;  4OPQ A;  5FSR A;  3FWL A;  3FYZ A;  4S2O A;  4NET A;  2ZC7 A;  2Y2I A;  1XX2 A;  2XR0 A;  3LO7 A;  2BG1 A;  2Z2L B;  3OZH A;  4KZA A;  2B5R A;  4OPR A;  5AQ7 A;  5HAI A;  3WS1 A;  3VP3 A;  4X68 A;  5KZH A;  2QZ6 A;  1ZKJ A;  1KVL A;  3MXS A;  4R3B A;  3AGF A;  4LV0 A;  5EE8 A;  3MKF A;  5GHZ A;  1PI5 A;  5CTN A;  2WUQ A;  3OPP A;  3BEB A;  3E2K A;  2J8Y A;  5L2F A;  5FQK A;  5D3O A;  3A3E A;  4PM6 A;  1ONH A;  1KVM A;  1SKF A;  3BRM A;  1O7E A;  3ZVT A;  3GR2 A;  3N6I A;  5M1A A;  1I2W A;  1CEF A;  2HPB A;  4WYY A;  4DDS A;  1MPL A;  2ZLY A;  5F1G A;  3W4Q A;  5M18 A;  2Y59 A;  3ZVW A;  4E6W A;  3SOI A;  1K57 A;  3OPH A;  3P98 A;  4EBL A;  2WKI A;  3C7V A;  2ZM8 A;  2XF3 A;  2P74 A;  4N1X A;  1NZU A;  4KG6 A;  1PW1 A;  1NJ4 A;  2R9X A;  3G32 A;  5CTM A;  3UPP A;  1ERM A;  5DF8 A;  1XGJ A;  3IXH A;  5E2H A;  1XA1 A;  4EBP A;  2J9P A;  1ERO A;  2G2W A;  4K0W A;  4PMA A;  5F1F A;  4KG2 A;  3O88 A;  5IHV A;  3IWO A;  1PI4 A;  2A3U A;  1LHY A;  4OOM A;  5FI2 A;  5E2F A;  5FQI A;  1PWD A;  5HFO A;  2WKE A;  2WGW A;  1SHV A;  1FR6 A;  2EX9 A;  1MWT A;  3BM6 A;  1QMF A;  3OPL A;  1YMS A;  4R4S A;  3V3R A;  3VOY A;  1K38 A;  2QMI A;  1ESU A;  1ESI A;  2ZQ8 A;  3G34 A;  3IF6 B;  4EBN A;  4GKU A;  4XUX A;  1L0F A;  1N9B A;  3PBT A;  4WMC A;  2PU4 A;  4JF6 A;  3G35 A;  1K4E A;  4MNR A;  4JF5 A;  1G6A A;  1BUL A;  3HLG A;  3V3S A;  3W4O A;  4P0M A;  3WS2 A;  3Q7V B;  1W79 A;  4KZB A;  3ZG8 B;  3JYI A;  3LY3 A;  1K54 C;  4S2N A;  1E4D A;  3WS0 A;  5EVI A;  1N4O A;  1FQG A;  1TDG A;  4OQI A;  3N8L A;  4DE2 A;  2XGN A;  5EOE A;  2JE5 A;  1FSW A;  3HLE A;  4PM5 A;  2R9W A;  1BTL A;  1HTZ A;  4QY6 A;  3ZG7 B;  4X56 A;  1L0E A;  2A49 A;  2ZQC A;  4RX3 A;  2WGV A;  1LL5 A;  2IWD A;  4KQO A;  5HAP A;  3C5A A;  4LV2 A;  1YLY A;  4DXC A;  4PM8 A;  5FDH A;  4ZDX A;  2Y2H A;  4OVD A;  5FAP A;  3SH8 A;  4OP8 A;  1MY8 A;  3NI9 A;  5EVI D;  1K56 A;  1XKZ A;  3DW0 A;  4JXS A;  4X69 A;  5AQ9 A;  3LEZ A;  3M6B A;  3N8R A;  5CHU A;  1PZP A;  3HUO A;  3ZHH A;  4R4R A;  3HUN A;  4X53 A;  5TGF A;  4GZB A;  3LCE A;  2ZC5 B;  5DF7 A;  5J8X A;  2DNS A;  5AQB A;  1JWV A;  4IVI A;  4JXW A;  1W8Y A;  3G4P A;  2Y2J A;  3C4P A;  3IF6 A;  4BLM A;  3EQU A;  3PTE A;  5FI6 A;  3EQV A;  3MKE A;  4OLD A;  5HX9 A;  1YM1 A;  5CXW A;  1K56 D;  5FQQ A;  4Y0U A;  1ZG4 A;  1HVB A;  3Q82 A;  3VP1 A;  4KG5 A;  5EOO A;  5CEC A;  3G2Z A;  3NIA A;  3IH8 A;  3E2L A;  3IXB A;  4JBF A;  4S2P A;  1U60 A;  1M6K A;  4C6Y A;  2Q9M A;  4ZJ1 A;  3Q7V A;  4ZAM A;  4ZTK A;  4KQR A;  3HLF A;  2ZM0 A;  4EWF A;  1BSG A;  5HAQ A;  3ZG5 A;  3UDF A;  4RVA A;  1IKI A;  3SH9 A;  4OQ0 A;  3HL9 A;  1H8Y A;  4PM9 A;  4DKI A;  1KE4 A;  1JWZ A;  1PYY A;  1XP4 A;  4HES A;  4LV1 A;  3VFH A;  2EFX A;  1XXM A;  2Y2G A;  3Q81 A;  4FD8 A;  4OQG A;  4KZ4 A;  5CER A;  1SDN A;  2CC1 A;  3UN7 A;  2ZJ9 A;  2VGJ A;  3AGE A;  2H10 A;  4JXG A;  1FSY A;  3IQA A;  1Q2P A;  3ZGA B;  2EFU A;  1MBL A;  2WK0 A;  3QHY A;  4WM9 A;  3ZDJ A;  4XUZ A;  1Z6F A;  4WEK A;  4JXV A;  4KZ6 A;  3TSG A;  1ES2 A;  3C7U A;  5GLD A;  5FI7 A;  1K4F A;  2WZX A;  1BLS A;  2J7V A;  2V20 A;  1AXB A;  4N9K A;  1C3B A;  4Z9Q A;  3ZCZ A;  4Q8I A;  3ZFZ A;  5FQJ A;  3G2Y A;  1YLJ A;  2XLN A;  4DF6 A;  2PBY A;  4B88 A;  5TR7 A;  3LY4 A;  3S4X A;  4KQQ A;  3PBR A;  1MWU A;  3UPO A;  4QB8 A;  5EVL A;  1KE0 A;  5EVI B;  4KZ9 A;  4LCM A;  4JLF A;  3A3I A;  5DTS A;  2ZC6 B;  5F83 A;  5CGS A;  1FCN A;  3VP2 A;  1BZA A;  1TVF A;  1WYB A;  3HUM A;  5HL1 A;  3W8K A;  2OV5 A;  1QME A;  2H0Y A;  3B3X A;  2X02 A;  3N7W A;  1G68 A;  2WGI A;  3WS4 A;  4M3K A;  1H5X A;  4WZ5 C;  3BLS A;  1W5D A;  2WAF A;  1FR1 A;  4OPY A;  4WEL A;  5FA7 A;  4A5R A;  1DJA A;  3RJU A;  4OP5 A;  4L0L A;  3GRJ A;  4BL2 A;  1K6R A;  4R0Q A;  4RYE A;  2HP9 A;  1KGG A;  3D4F A;  4P87 A;  1K55 C;  1GCE A;  2Y2N A;  2RL3 A;  1CEG A;  3IF6 C;  5E2G A;  1W7F A;  1ES4 A;  3HLD A;  5TFQ A;  1S6R A;  2C6W B;  1BLC A;  2GDN A;  3BFC A;  5F82 A;  3ZG9 B;  1GHI A;  1LLB A;  3IT9 A;  2HDU A;  4FSF A;  4KZ5 A;  5FAO A;  4GDB A;  3CG5 A;  1IYP A;  3MXR A;  1JWP A;  4JF4 A;  3V39 A;  3IHA A;  1H8Z A;  2Y2Q A;  2RCX A;  2ZQD A;  4MBF A;  3O3V A;  3GSG A;  3QNC A;  4B4Z A;  1E25 A;  4P6B A;  1BUE A;  4BL3 A;  3S1Y A;  1NY0 A;  3IF5 A;  4WZ4 A;  3IXD A;  3VP0 A;  1LL9 A;  3NBL A;  5DF9 A;  3S22 A;  5E43 A;  1IYO A;  1TDL A;  4ZBE A;  5CHM A;  2XH9 A;  1IYS A;  2X71 A;  4N1H A;  1YLZ A;  5CHJ A;  3HVF A;  1WYC A;  4QJG A;  4DDY A;  4KEN B;  3CMZ A;  2WYX A;  1RGZ A;  3PBS A;  2HDQ A;  1FCO A;  2Y2K A;  2ZD8 A;  2Y2L A;  1W8Q A;  3N8S A;  4S2K A;  2IWB A;  3UPN A;  4GDN A;  1CI9 A;  3BLM A;  5A93 A;  3Q7Z A;  4N92 A;  1EI5 A;  5M19 A;  5G18 A;  5EUA A;  1YQS A;  1ZG6 A;  4S2L A;  2EX8 A;  3UO9 A;  2ZC3 B;  1KDW A;  3ISG A;  5CED A;  5GLB A;  4IVK A;  4Y7P A;  1JTG A;  3UDI A;  4U0X A;  4WBG A;  1NRF A;  5GL9 A;  3VFF A;  3BYD A;  1PZO A;  4EQI A;  3GMW A;  5DVA A;  2WAD A;  3WWX A;  1NXY A;  5JYO A;  4KZ7 A;  4U0T A;  1PW8 A;  3MZF A;  5FQ9 A;  4FH2 A;  4DXB A;  3UY6 A;  2P9V B;  3UE3 A;  2BLS A;  2C5W B;  3DWK A;  5EPH A;  3V5M A;  2XD5 A;  4S2J A;  3M6H A;  1K57 C;  4DE1 A;  5FQM A;  4WEJ A;  3IXG A;  5E2E A;  4DE0 A;  2XFS A;  3Q07 A;  1XPB A;  2HP5 A;  1BLH A;  2EX2 A;  2XDM A;  3N4I A;  4QHC A;  4E3J A;  5FAT A;  1BLP A;  1NYM A;  3O86 A;  4HBT A;  4OOY A;  4UA6 A;  1MWR A;  1I2S A;  1YLP A;  4GB7 A;  1DY6 A;  4LEN A;  1I5Q A;  1XGI A;  3C4O A;  2HDR A;  4BQM A;  1ES5 A;  1MXO A;  1SDE A;  3CZD A;  3HLC A;  4HEF A;  4S2M A;  1S0W A;  1CI8 A;  5CRF A;  1YLT A;  4IBR A;  1IEM A;  3SS5 A;  5AQA A;  1LI9 A;  2PU2 A;  3TOI A;  4E3O A;  3WS5 A;  3G31 A;  4K0X A;  3ZNY A;  4ZJ3 A;  2J9O A;  3HLW A;  1YT4 A;  2JCH A;  4GD6 A;  4UHU A;  1K54 A;  2XD1 A;  3IWQ A;  1M40 A;  3CJM A;  4X6T A;  4E3K A;  3V50 A;  4BJP A;  4GD8 A;  2EXB A;  2I72 A;  4YIN A;  4S2N C;  1TEM A;  1RCJ A;  1K25 A;  4XXR A;  5EVI C;  1CK3 A;  2DRW A;  5DTK A;  3SS4 A;  3ZG0 A;  3DTM A;  3VMA A;  1RGY A;  3G30 A;  1Q2Q A;  4E3I A;  3NCK A;  3SH7 A;  3A3J A;  4B4X A;  3VSK A;  2P9V A;  1L2S A;  1DJB A;  1FCM A;  1FOF A;  4NK3 A;  3ITB A;  3GVB A;  5GHY A;  5GHX A;  4S2I A;  2XEP A;  4JPM A;  4O7D A;  3Q1F A;  2OLU A;  2EX6 A;  2ZQ9 A;  1O07 A;  2JBF A;  3W4P A;  2OSU A;  3SS3 A;  2HDS A;  4E3N A;  3MFD A;  2WKH A;  4MEZ A;  4JKT A;  1GHP A;  3BEC A;  2FFF B;  3HLB A;  1IYQ A;  4E6X A;  5GLC A;  4ID4 A;  2V1Z A;  3BFG A;  1OME A;  1VM1 A;  5CGX A;  4F94 A;  3IWI A;  1WE4 A;  4H8R A;  1KE3 A;  4N9L A;  5GLA A;  3VSL A;  5HW3 A;  5KSH A;  2Y2P A;  2ZMA A;  5I94 A;  4DE3 A;  3PBO A;  5CEB A;  4PM7 A;  2VGK A;  1KGE A;  4IBX A;  1NZO A;  3M2K A;  4U3T A;  4YFM A;  5FAQ A;  3O87 A;  3WRZ A;  3HRE A;  4ZJ2 A;  4MBK A;  3VOZ A;  1MWS A;  4RA7 A;  4OLG A;  5KSC A;  3BFE A;  4CJN A;  1EWZ A;  3OPR A;  3WRT A;  1ERQ A;  3MZD A;  4EUZ A;  3RXX A;  3BFF A;  2Q9N A;  4IED A;  4EV4 A;  2Y91 A;  1HD8 A;  3NY4 A;  5FAS A;  2Y2M A;  1L0D A;  3PAE A;  3M2J A;  2XK1 A;  3PAG A;  2EXA A;  2OLV A;  5CGW A;  2DCF A;  4DRT A;  3NDG A;  2Y2O A;  5JYP A;  4D2O A;  1BT5 A;  4OKP A;  1GA9 A;  3IH9 A;  1PWC A;  4R23 A;  3I7J A;  5EEC A;  4BD1 A;  4E3L A;  1ES3 A;  1PWG A;  2ZQ7 A;  2E8I A;  1ZC2 A;  1YMX A;  4UA7 A;  1LI0 A;  1IKG A;  4GNU A;  2Y4A A;  5KMW A;  3OCN A;  4FH4 A;  2FFY A;  4C3Q A;  3MZE A;  4WMC D;  3ZNT A;  4QU3 A;  4OOL A;  3A3F A;  4HBU A;  4R1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...