2J7VA

Structure of pbp-a
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
TLPPERPLTNLQQQIQQLVSRQPNLTAGLYFFNLDSGASLNVGGDQVFPAASTIKFPILVAFFKAVDEGRVTLQERLTMRPDLIAPEAGTLQYQKPNSQYAALEVAELMITISDNTATNMIIDRLGGAAELNQQFQEWGLENTVINNPLPDMKGTNTTSPRDLATLMLKIGQGEILSPRSRDRLLDIMRRTVTNTLLPAGLGKGATIAHKTGDIGIVVGDAGMVDMPNGQRYVAAMMVKRPYNDPRGSELIRQVSRMVYQAFEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TLL2115 PROTEIN
publication title Structure of Pbp-A from Thermosynechococcus Elongatus, a Penicillin-Binding Protein Closely Related to Class a Beta-Lactamases.
pubmed doi rcsb
source organism Synechococcus elongatus
total genus 99
structure length 265
sequence length 265
chains with identical sequence B, C, D
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2006-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2j7vA01
1NRFA 2C5WB 3G2YA 1SKFA 3IF6B 2ZQDA 3AGFA 3WRZA 4KZ8A 1GHIA 1I2SA 4JXSA 1FQGA 3IWOA 1WYBA 4HBUA 1K4EA 3HLWA 1VQQA 1YMXA 1LI0A 2ZQ9A 1MWUA 3OZHA 4JXVA 3A3FA 2QMIA 4DE0A 4E3KA 1XGIA 1NXYA 4FSFA 2WGWB 1ES5A 2I72A 4JBFA 2ZM2A 1W8QA 1YLPA 1PWGA 4XUZA 3IHAA 1KDWA 1JTDA 1WE4A 1S0WA 5GLCA 3GR2A 4E6WA 2XDMA 4E3NA 3FKWA 2Y2HA 4GD6A 4N1XA 2ZLYA 1LLBA 5TR7A 3IWQA 3GSGA 4KENB 4S2LA 1LL5A 1RGZA 1YLJA 4JF6A 4RVAA 3UPPA 3ZFZA 3MBZA 5FASA 1MXOA 2Y4AA 2XR0A 3HREA 4KZBA 4ZJ2A 3TOIA 3VP0A 1FSWA 1K6SA 3Q1FA 4OPZA 3TSGA 5F83A 1IYQA 3FZCA 4QHCA 4E3JA 5CHMA 3PBOA 4ZJ1A 2VGJA 2BLSA 5HAIA 5L2FA 1ES2A 1ES3A 4KZ9A 1GCEA 5GHZA 3HBRA 1KGEA 1K38A 2XEPA 4OQ0A 3BRMA 2EFXA 3RXXA 3UE1A 3Q7VA 3UNWA 5HAQA 3IXHA 5EECA 4DE1A 3W4PA 1NYMA 5EVIC 1ZKJA 4ZAMA 4LCMA 4U0TA 3ZDJA 3W8KA 4EBLA 5FQ9A 3UO9A 3GV9A 1ONHA 1JWZA 3IQAA 5IHVA 2EXBA 2HDUA 3WS0A 1RP5A 3IH9A 1KE3A 2R9WA 4B4ZA 3MKFA 4JXWA 2WKIA 5GLDA 4NK3A 5GL9A 3A3EA 2ZM8A 5M18A 3G32A 2Y2PA 3PTEA 4GB7A 3V3RA 5CHUA 2XD5A 2PU2A 4EBNA 4EV4A 2Z2LB 1JWPA 5A92A 3IXDA 1MWSA 4PPRA 4Z9QA 5EVIB 5JYPA 3C4OA 5KSHA 1KGFA 4OONA 2R9XA 3BLMA 3C7VA 3I7JA 3IF6A 4P0MA 4Y7PA 3PAEA 1ERMA 2V2FF 4RYEA 3CMZA 4U3TA 5EPHA 3ZG0A 2EX9A 3OPRA 2X02A 3PBNA 3GVBA 1L0FA 4N1HA 2Y59A 1NZOA 1N4OA 1XXMA 3N8SA 4KG2A 3ZNYA 3ISGA 3E2KA 3PAGA 4LV3A 4OKPA 2WGWA 2XH9A 4BJPA 4JF5A 3UN7A 5FI6A 1NYYA 4WELA 5FI7A 3W4OA 4DE2A 2WZZA 1XKZA 3NBLA 3O88A 3Q7VB 1CEGA 2FFFB 3M6BA 4KG6A 4EWFA 1FSYA 3BEBA 1S6RA 5FQQA 3HLDA 3SS5A 2WGVA 1WYCA 5KMWA 3ZNTA 2FFYA 1JVJA 3BFFA 3RJUA 1H5XA 2IWCA 1W7FA 4MNRA 4DDSA 5CEDA 1IELA 3OPLA 4IVKA 4PM9A 1L2SA 5D3OA 4DDYA 4E3IA 1K56A 3UPNA 5E43A 2G2UA 1K57C 2OLUA 2WYXA 4OQIA 5DF7A 2RCXA 5CHJA 3LCEA 5DTTA 1N9BA 1BTLA 1MPLA 2JE5A 2Y2LA 3G31A 4WMCA 1E4DA 5F1GA 2H0YA 5E2HA 3TG9A 5BOHA 3LO7A 4OH0A 2HP5A 1K56D 4UA6A 4X55A 3IF5A 5DVAA 1QMEA 5CXWA 4KG5A 2A49A 2Y2JA 4PMAA 3VSLA 3S4XA 4WMCD 1BZAA 1AXBA 1MWTA 2HP6A 4R1GA 3SH8A 5A93A 4MBHA 2X01A 1E3UA 2HPBA 5F1FA 4GKUA 4DXCA 3GQZA 3LY3A 2XFSA 5EVIA 2EFUA 2JBFA 1PW8A 3W4QA 3NCKA 3VOZA 3G34A 1KGGA 2WK0A 3N7WA 2HP9A 3IT9A 1LL9A 3C7UA 1MBLA 5A91A 2H0TA 4OOYA 1PYYA 5AQAA 1JWVA 1M6KA 3E2LA 2PBYA 2J8YA 4OPYA 4BQMA 5EVID 2V1ZA 4MEZA 2XK1A 4X6TA 4OLDA 3S22A 2J9OA 1G6AA 4WBGA 4MBKA 1CI8A 1YLYA 4FD8A 3QNCA 4BL2A 3HLCA 3O86A 3CJMA 4S2MA 2WKHA 4UAAA 1YLTA 3VP1A 3WS2A 5G18A 4EQIA 5HAPA 1XA1A 1KE4A 4KQQA 2CC1A 2WKEA 3ZG7B 2XFTA 4P85A 3VP4A 1ESUA 2ZC3B 4EBPA 1PI4A 4JLFA 3PBSA 1HVBA 3MZEA 4N9KA 1XA7A 5E2GA 3BFEA 4S2NA 5GLAA 1IKIA 4Y0TA 4XXRA 4OOMA 3MZFA 4QJGA 3SS3A 4WYYA 4OVDA 4BL3A 4HBTA 4YINA 2Y2KA 3Q81A 4GNUA 1ERQA 3NI9A 1EROA 1ALQA 3HUMA 5CEBA 1DJBA 4KZ6A 3LEZA 3IH8A 4P6BA 4X56A 4OP8A 2Y2MA 3MKEA 5DTSA 1PW1A 1HTZA 1PZOA 4LV0A 3IWIA 4IBRA 2OLVA 3SH9A 2GDNA 4KZ7A 3VP3A 1IEMA 5E2FA 1RCJA 4KZAA 1K25A 4K91A 3HL9A 4JKTA 2DRWA 1YM1A 4Q8IA 4E6XA 1DY6A 4S2OA 1YQSA 4GZBA 1XP4A 1Z6FA 3QNBA 5F82A 3IXBA 2XLNA 4IBXA 1PIOA 1LI9A 2Y91A 4S2NC 5GHXA 4IVIA 2WUQA 2HDRA 4ZJ3A 4R4RA 5AQ7A 2ZD8A 4WZ4A 4O7DA 5A90A 1BLSA 1BSGA 5FATA 5FQMA 3N4IA 1OMEA 4OP5A 3B3XA 1TDGA 1O07A 1PWCA 1BLCA 1K57A 2ZQAA 3GMWA 5HARA 4OLGA 2WAEA 4DKIA 2ZM0A 2WADA 3HUOA 3VSKA 5KSCA 1I5QA 3WS1A 3PBQA 4FH4A 3FWLA 5FQJA 2E8IA 2BG1A 5DTKA 2ZQ7A 4NETA 5FQKA 3UPOA 2WAFA 2ZQ8A 3A3IA 4QU3A 4X69A 4PM6A 1GA0A 3A3JA 5CGXA 3HUNA 3ZG5A 1NJ4A 4U0XA 1YMSA 4LV2A 1KVMA 2QPNA 1ONGA 3ZVWA 2ZMAA 4X68A 2J7VA 2XD1A 3PBTA 3WS4A 5J8XA 3ZG8B 2UWXA 5EVLA 5EOEA 1TVFA 3IHBA 3Q07A 2X71A 2PU4A 4ZTKA 4LCLA 4B4XA 3G35A 3EQVA 3G2ZA 4C6YA 2IWDA 5CRFA 1KDSA 5FDHA 3UE0A 2Y2GA 5JYOA 1SCWA 4DF6A 2ZC7A 3O3VA 2Q9MA 3P98A 3Q7ZA 1Q2QA 1JTGA 5U47A 3BECA 4WZ5A 3HVFA 1E25A 2Y2IA 5GHYA 1VM1A 2XGNA 1K55A 3ITBA 3BFGA 3IXGA 1ZG4A 5HFOA 4BLMA 4N9LA 3UDFA 3DTMA 4RX3A 4GN2A 1W5DA 1GHPA 2DCFA 3BFDA 1MKIA 5M1AA 4QB8A 3ZHHA 5FAQA 3AGEA 3MXRA 3SOIA 1L0EA 1XPBA 4D2OA 3PBRA 4KZ4A 4LENA 3SH7A 4GDBA 2C6WB 3OCNA 3SS4A 2XQZA 1EI5A 1FR6A 4KQRA 1SDEA 3M2KA 2P74A 3UE3A 2IWBA 2JC7A 3N6IA 4WZ5C 2EX6A 3V3SA 3V39A 1E3UD 5EOOA 5FSRA 2Q9NA 2OV5A 1K55C 1BLPA 2A3UA 2J9PA 3AGDA 4YFMA 1RGYA 4DE3A 3DWKA 1CK3A 4F94A 4WEJA 2VGKA 4M3KA 2EX2A 4MLLA 1G68A 5DF9A 1IYSA 2OSUA 2EX8A 3BLSA 1ZG6A 3M6HA 4UA9A 4XUXA 2ZC6B 1PZPA 1GA9A 3GTCA 2EXAA 3OCLA 1PI5A 4R3BA 4S2IA 5CECA 1BLHA 5FI2A 1L0GA 4QD4A 3VMAA 2P9VB 3ZCZA 4C3QA 5TGFA 1BUEA 4KQOA 4PM7A 3UDXA 3A3DA 5HL1A 1HD8A 3HLEA 2Z2MB 4S2PA 5CERA 3NIAA 2ZC4B 2WZXA 2V20A 3FV7A 3N8RA 4L0LA 4P87A 3S1YA 5M19A 1DJCA 5HX9A 3CG5A 4WEKA 3V5MA 5KZHA 4OPRA 5CGSA 1C3BA 1XGJA 3RXWA 1DJAA 5FA7A 3BM6A 2Y2QA 1CEFA 1U60A 2QZ6A 2H10A 1BULA 1K6RA 1M40A 4UHUA 5CTNA 3DWZA 4ZDXA 4GOGA 4OOLA 1K54A 3D4FA 1I2WA 5HW3A 1FCMA 4LV1A 3LY4A 3P09A 4BD0A 4C75A 1GHMA 4B88A 4Y0UA 1NZUA 3EQUA 1ES4A 5EE8A 4KZ5A 5AQBA 4KZ3A 3VFFA 2Y55A 4OPQA 2ZJ9A 3G30A 4FH2A 1L0DA 3OPPA 3HLFA 2HDSA 4RA7A 2ZQCA 5GLBA 1FOFA 3CZDA 1SDNA 5EUAA 3V50A 1Y54A 4JF4A 2RL3A 3C4PA 4Y0OA 1BT5A 1K4FA 4PM8A 4WM9A 4R3JA 1W79A 3FKVA 1YLZA 1Q2PA 3OPHA 4E3LA 3QHYA 4JPMA 4OQHA 1HZOA 1TDLA 3O87A 4IEDA 3WRTA 1ZC2A 2Y2NA 1K54C 4S2JA 3UDIA 4ZBEA 4QY6A 4E3OA 3BFCA 3BYDA 3ZG9B 2XF3A 3ZGAB 4R23A 1H8YA 5I94A 3C5AA 1QMFA 4K0XA 4BENA 2JCHA 3VFHA 4RX2A 1W8YA 5DF8A 2B5RA 3N8LA 5TFQA 3M2JA 1XX2A 4HESA 4K0WA 4MBFA 4QY5A 3VOYA 2G2WA 4GD8A 4OQGA 1FCOA 4R4SA 5FAPA 3ITAA 3Q82A 3MFDA 5CTMA 4R0QA 1TEMA 4PM5A 3NDGA 1FCNA 2ZC5B 3NY4A 4DXBA 5FAOA 1IKGA 1NY0A 2DNSA 3MZDA 3WWXA 4FCFA 2WGIA 3WS5A 2P9VA 3MXSA 2HDQA 2H5SA 4GDNA 4CPKA 1MY8A 3UY6A 1H8ZA 3ZVTA 3DW0A 4H8RA 3IF6C 3JYIA 1YLWA 4E3MA 5FQIA 3HLBA 1J9MA 4CJNA 1EWZA 3G4PA 1IYPA 4HEFA 1KE0A 3FYZA 1O7EA 4X53A 1KVLA 4JXGA 3VP2A 4S2KA 1IYOA 4N92A 1LHYA 4EUZA 5CGWA 3NDEA 5E2EA 1MWRA 1ESIA 1SHVA 1YT4A 1CI9A 5AQ9A 1PWDA 3NC8A 4ID4A 4A5RA 3OC2A 4UA7A 4BD1A 4DRTA 2Y2OA 3HLGA 3GRJA 1FR1A
chains in the Genus database with same CATH superfamily
1NRFA 1YPRA 1TD5A 3AGFA 3EWKA 1I2SA 2O9AA 4HBUA 1K4EA 1T18A 1VQQA 1LI0A 3UMEA 1MWUA 4JXVA 3A3FA 4DE0A 4E3KA 4LRXC 1ES5A 2YKHA 3C2WA 1W8QA 2NUTC 1S0WA 3GR2A 5EV0A 2ZLYA 3KYEA 3UPPA 1MXOA 3HREA 4ZJ2A 3VP0A 1K6SA 5F83A 3BY8A 1X0OA 5CHMA 5HAIA 1GSWA 1K38A 4B93A 3RXXA 3IXHA 5EVIC 3OLOA 4LCMA 4L9FA 5FQ9A 1JWZA 1H0MA 3IQAA 1CF0A 3FPVA 2EXBA 2HDUA 1KE3A 2WKQA 3MKFA 2WKIA 3F1OB 5M18A 1D06A 3V3RA 3LIAA 3PR6A 4EV4A 2Z2LB 3IXDA 3VV4A 4Z9QA 1LT0A 2K31A 2W3HA 3BLMA 4ESPA 4P0MA 3GVBA 1L0FA 4N1HA 2Y59A 1NZOA 1AWIA 4RQ9A 3IX4A 2XH9A 1NYYA 2WZZA 1XKZA 4IJGA 1CEGA 2D02A 3ZNTA 3LR3A 4DDSA 5A8BA 4PM9A 1L2SA 4D60A 2PRFA 1S1ZA 4MN6A 3UPNA 3T4OA 1K57C 5DF7A 2JE5A 1MPLA 2Y2LA 3G31A 5L8MA 5BOHA 5E2HA 4HJ3A 3QP1A 4OH0A 4MN5A 4UA6A 4BBVA 3V67A 3IF5A 1BZAA 2VV7A 2HP6A 3P7NA 4GKUA 4M4XA 4PKYA 3W4QA 2JKFA 2PAVP 1KGGA 3IT9A 2JKTI 3C7UA 2H0TA 3E98A 1PYYA 4OOYA 5AQAA 3E2LA 4OPYA 3TW8A 2XK1A 2L1MA 2J9OA 1G6AA 4WBGA 2WKHA 3WS2A 4II7A 5HAPA 1TS6A 2GNXA 4KQQA 4NXFA 3ZG7B 4P85A 1ESUA 2ZC3B 3F1PA 4EBPA 5HDDA 3PBSA 3MZEA 4S2NA 1IKIA 4Y0TA 2VGLS 4OOMA 1UWNX 4QJGA 1SKOB 1EROA 4X56A 4MN7A 4P6BA 2Y2MA 1PZOA 4LV0A 3IWIA 2OLVA 3SH9A 5E2FA 2DRWA 3DBAA 1Z6FA 3IXBA 4S2NC 2GX5A 5F69A 2PD8A 2V1AA 4H6JB 3N4IA 1F2KA 1GSXA 1PFLA 2WAEA 5KSCA 1I5QA 5FQJA 2BG1A 2ZQ7A 4WUJA 2B02A 3S7PA 1VB6A 3A3IA 4QU3A 5EM0A 3UB6A 4LPZA 3T1RA 5HPIA 1OJ5A 5J8XA 3ZG8B 2UWXA 2X71A 2VK3A 4LCLA 1Q2QA 5U47A 1T1AA 4WZ5A 4EEPA 1E25A 1DRMA 2H28A 2XGNA 3IXGA 4WL9A 1ZG4A 3MXQA 1F98A 4N9LA 3MJQA 1OTIA 4D2OA 1XPBA 4GCZA 3SH7A 4KZ4A 3NULA 2P74A 4LRYC 3UE3A 4WZ5C 2EX6A 5DJTA 1E3UD 5EOOA 5TBMB 4EETB 4BBUA 2PDRA 1CK3A 4WEJA 3MSHA 4H6JA 3ULFA 1VHMA 4M3KA 5DF9A 5AJGA 1XJ4A 4UA9A 1ODVA 2J3TD 4R3BA 4S2IA 1OPXA 4C3QA 1L0GA 4QD4A 3VMAA 3BWLA 3CHWP 3EEHA 4S2PA 2WZXA 3CUEA 2V20A 1H8MA 5HZHA 1DJCA 1C3BA 4NEED 2Y2QA 3EGXC 1K54A 1GHMA 4Y0UA 1NRJA 3VFFA 2ZJ9A 4FH2A 3KYQA 4RA7A 3JVVA 3CUEC 3CZDA 1SDNA 2QHKA 4I3JA 1YLZA 4HH3A 3QHYA 4JPMA 1HZOA 3WRTA 1ZC2A 2Y2NA 1K54C 4ZBEA 4QY6A 5HDCA 3BYDA 3ZGAB 4KUOA 4BENA 3VFHA 1XJ6A 3M2JA 4K0WA 4MBFA 4QY5A 4GD8A 4OQGA 1TS7A 3ITAA 3MFDA 1TEMA 2P04A 3KSHA 4PM5A 2WKPA 1G28A 5FAOA 1YKDA 3WWXA 5HD5A 2HDQA 1G6OA 3DW0A 3U4LP 3JYIA 3NOUC 1YLWA 4BMWA 1OTDA 1KE0A 2KDKA 4HIAA 2PYPA 4EUZA 3D3OA 1SHVA 5IS1A 1PNEA 1PWDA 2PR5A 4ID4A 3OC2A 2YKFA 4LLOB 1SKFA 3IF6B 2ZQDA 1V9YA 1VETB 3OZHA 4EEUA 2QMIA 5DKLA 1NXYA 3TE8A 4JBFA 2ZM2A 2VV8A 1JTDA 2Z6DA 3LIDA 2OWHA 3FKWA 4GD6A 2EA9A 1LLBA 3GSGA 1RGZA 4JF6A 5FASA 4KZBA 3TSGA 1IYQA 2VGJA 4QWOA 4PHTA 4OQ0A 2ZOIA 2EFXA 3Q7VA 1G5UA 4DE1A 3W4PA 2A2LA 3B47A 3H82B 1ONHA 3GDIA 1RP5A 3WS0A 4B4ZA 1J3WA 5GLDA 3KSFA 1YSQA 2ZM8A 3G32A 4GB7A 5CHUA 2XD5A 4EBNA 3C8CA 4JGOA 4HP4A 1VEUB 1XFQA 5EVIB 3UB9A 2R9XA 3IF6A 3I7JA 1ERMA 4RYEA 4U3TA 1OTEA 1VETA 5EPHA 3ZG0A 2EX9A 3A0SA 3OPRA 3PBNA 5L10A 3FPWA 1N4OA 1XXMA 4KG2A 3PAGA 3CPTB 1SZVA 4BJPA 2VGLM 3MS6A 3T50A 1V9ZA 4DE2A 3NBLA 1NWZA 3M6BA 4EUVA 3SS5A 2WGVA 1JVJA 1H5XA 1W7FA 4L9GA 4MNRA 5CEDA 1IELA 4JGQA 3OPLA 4IVKA 5DJUA 4R38A 4DDYA 4E3IA 1K56A 4GW9A 2I9VA 2PR6A 2RCXA 3H82A 4PAUA 5FL3A 1N9BA 3LO7A 4HY8A 2HP5A 1K56D 4X55A 1QMEA 3RH8B 2Y2JA 3S4XA 3CI6A 5HWTA 1MWTA 4R1GA 5KIZA 2X01A 2QKPA 1XJ2A 2HPBA 5F1FA 3GQZA 1VEUA 5EVIA 2JBFA 4WN5A 3NCKA 2WK0A 2HP9A 3GECA 5A91A 1IOUA 3LICA 4O01A 1M6KA 2PBYA 5TJJA 4BQMA 4KUKA 5EVID 4ETXA 4OLDA 3S22A 3CPTA 2Z6CA 3E4PA 3HLCA 3O86A 4S2MA 4G3WA 3TJZC 5G18A 4EQIA 1KE4A 2CC1A 2WKEA 3VP4A 3BFEA 2JKRI 3UB5P 3LUQA 3SS3A 3LEQA 4OVDA 2V9AA 4HBTA 2Y2KA 4GNUA 2ZL1A 2VEAA 3A0VA 4I3AA 1N9LA 3HUMA 3T4TA 2M1CA 3IH8A 3MFXA 3MQOA 4OP8A 4CLCE 2HF6A 3CWFA 3T4QA 3VP3A 1IEMA 4KZAA 4DMZA 3BW6A 4FTXA 2VA0A 4E6XA 4O8GA 3RTYA 1XP4A 3LI9A 4IBXA 2WUQA 2O9CA 2W1TB 4O7DA 1BSGA 5FQMA 4OP5A 1O07A 2O9BA 1K57A 4DKIA 4OLGA 2W3DA 2WADA 3WS1A 3ICYA 2P08A 3FWLA 2E8IA 3UPOA 3F1PB 4LV2A 2QPNA 1LSWA 3K2NA 3ZVWA 2XD1A 5EVLA 5EOEA 3IHBA 2PU4A 4ZTKA 4B4XA 3G35A 3EQVA 5CRFA 1KDSA 3UE0A 3L9KA 5EFWA 1SCWA 2AVXA 4DF6A 2ZC7A 3O3VA 2Q9MA 3P98A 4HI4A 2FZ0A 2NUPC 2Y2IA 5HL6A 2J3WA 3IBJA 1K55A 3BFGA 3T1QB 2XROA 5HFOA 2VZWA 5K5BA 1F9IA 4BLMA 3UDFA 4MDZA 3ZHHA 3DTKA 4Y15A 3NJAA 1W63Q 4X1LA 1L0EA 3SOIA 3PBRA 2C6WB 1EI5A 1FR6A 4KQRA 2JC7A 3V39A 2K2NA 5FSRA 2OV5A 1K55C 2A3UA 4X1MA 3SZTA 1RGYA 2W1TA 2W3GA 2VGKA 4AFIA 2EX2A 4MLLA 2JKTM 1ZG6A 4XUXA 2ZC6B 1PZPA 1GA9A 1ACFA 1MC0A 1S66L 2P9VB 4P6ZM 1BUEA 4WF0A 5CERA 3TRCA 3F1NA 4HP9A 3N8RA 2V0WA 3S1YA 5M19A 5HX9A 4WEKA 1XGJA 3RXWA 1DJAA 5FA7A 1YSPA 1TS0A 2QZ6A 1BULA 1M40A 4I3IA 4GOGA 1I2WA 2ZBBA 1FCMA 5HW3A 3P09A 1NZUA 5EE8A 5AQBA 2Y55A 1OTBA 4OPQA 3E4QA 3G30A 1L0DA 2V8CA 2HDSA 3HLFA 3VE3A 4Y5FA 2PBDP 4NKPA 3DTIA 1WA9A 3FKVA 3OPHA 1TDLA 4IEDA 4S2JA 4R6LA 3BFCA 3ZG9B 2XF3A 5I94A 3C5AA 1QMFA 2JCHA 3MQQA 2B5RA 2R78A 2G2WA 1MZUA 1FCOA 1XFNA 5I5LA 3NY4A 2ZC5B 1IKGA 5AVEA 2P9VA 3WS5A 2VV6A 4E3MA 5FQIA 2O99A 3CLOA 1J9MA 3HLBA 4CJNA 1EWZA 5C5KA 4HEFA 4X53A 1DP8A 3VP2A 1FIKA 2A24A 5CGWA 1MWRA 1ESIA 3LR5A 3NC8A 4BD1A 4DRTA 3OOVA 4UQIS 5L07A 2M7VA 4KZ8A 1GHIA 2ZMVA 1FQGA 1WYBA 2CMNA 1OTAA 3HLWA 4CLCA 1YMXA 4FSFA 4R70A 2I72A 2ZMFA 3PYPA 2Q0OA 1YLPA 1PWGA 4XUZA 3IHAA 3LIBA 1WE4A 5GLCA 4E6WA 2Y2HA 4N1XA 1D1JA 2Y79A 5TR7A 3IWQA 4KENB 1YLJA 4O0PA 3MBZA 2Y4AA 2XR0A 4GS9B 4OPZA 4CLCC 4QHCA 4E3JA 3PBOA 5L2FA 1ES2A 4JGPA 2INWA 4WLAA 2XEPA 5EECA 1NYMA 4ZAMA 4U0TA 3UO9A 3GV9A 2K7SA 5IHVA 4LFUA 4JXWA 3FG8A 4MCWA 5GL9A 1TS8A 3A3EA 2Y2PA 3PTEA 3OBFA 4ZRRA 5A92A 2Y8HA 4PPRA 5JYPA 3C4OA 2G7UA 3JVUA 4OONA 1OT9A 3C7VA 4Y7PA 2V1BA 3CMZA 2W1RA 2X02A 3N8SA 1LSVA 3E2KA 4LV3A 2EWVA 4OKPA 4HJ4A 5MC7A 5FI6A 1A0KA 4GLQA 4WELA 5FI7A 4E04A 3Q7VB 4R3AA 2FFFB 4EWFA 1FSYA 1S6RA 5FQQA 4DN0A 3C30A 2FFYA 5L09A 3BFFA 3RJUA 5CX7A 4BBTA 4ETZA 2IWCA 2B18A 4G3KA 4GS9A 5FDSA 2W27A 1IFQA 2GZAA 4G3VA 5D3OA 4LGWA 4P6ZS 2PHYA 5E43A 2OLUA 3LR4A 3QP2A 4NXBA 3LCEA 5DTTA 3S7NA 1BTLA 3TG9A 4WMCA 2H0YA 2KOIA 5CXWA 4KG5A 4WMCD 4NXGA 3SH8A 5A93A 4MBHA 3IBRA 2W3EA 3K3CA 3BJNA 4DJ2A 2MJ6A 2XFSA 2EFUA 4K08A 1PW8A 3UB7A 2HGVA 3VOZA 1MBLA 1JWVA 4MEZA 1YAXA 3IX8A 3KO6A 4X6TA 1CI8A 4FD8A 3QNCA 4BL2A 3D72A 3T12B 3T1SA 1XA1A 2UV0E 2XFTA 2ACGA 4HNBA 1PI4A 4JLFA 5E2GA 3HJKA 1DP9A 1H3QA 4WYYA 4BL3A 3Q81A 5F5YA 4Z1WA 3LEZA 5DTSA 1PW1A 1HTZA 2P7JA 3T4KA 1RCJA 1K25A 4K91A 3HL9A 1YQSA 3QNBA 4EERA 1PIOA 2Y91A 2JN7A 4UEYA 2HDRA 5AQ7A 3RFBA 1OT6A 5FATA 1OMEA 1TDGA 1PWCA 3GMWA 3R4KA 2ZM0A 3HUOA 3VSKA 3KSIA 3QP6A 3PBQA 2ZQ8A 4X69A 5CGXA 3A3JA 1N9NA 3HCYA 3HUNA 3ZG5A 1NJ4A 1ONGA 4X68A 2J7VA 3PBTA 2PYRA 4IHQA 3UE6A 3Q07A 2ZL1B 3UMDA 2IWDA 5FDHA 5HDSA 2Y2GA 2B95A 5J7EA 3G6OA 1FILA 3QP5A 4F3LB 1T1CA 1VM1A 1N9OA 1MKMA 3MR0A 4GN2A 2DCFA 3BFDA 1MKIA 5LBRA 5HD3A 3AGEA 4LENA 4GDBA 3OCNA 2XQZA 3CITA 2IWBA 2QJ7A 3A0RA 2HJEA 3AGDA 4YFMA 4DE3A 2V8FA 1D7EA 2V0UA 1IYSA 3H7WB 2OSUA 2EX8A 3M6HA 5AVFA 4JGRA 3GTCA 2EXAA 3OCLA 1PI5A 3QP8A 5FI2A 3ZCZA 5TGFA 4KQOA 4NG2A 4PM7A 3UDXA 2Z2MB 4QPRA 2ZC4B 4UQIM 2L0WA 4L0LA 4P87A 3CG5A 3V5MA 5KZHA 2OAP1 4OPRA 5CGSA 5IT5A 3BM6A 2ZOHA 2H10A 2JKRM 5CTNA 3LGOA 2VKSA 1BYWA 4LV1A 3LY4A 4BD0A 3QP4A 4C75A 3NECA 1ES4A 4F3LA 4KZ5A 4HQAA 2ZQCA 1FOFA 1Y54A 2JKGA 4JF4A 2RL3A 3CAXA 1BT5A 1K4FA 4PM8A 3BQAA 1HLUP 1Q2PA 4OQHA 5HWWA 3IS2A 3O87A 4PKYG 2HV1A 3IX3A 3VE4A 1F5MA 1GSVA 4K0XA 1Y28A 4RX2A 1W8YA 5DF8A 2M7UA 3F1NB 1XJ3A 5TFQA 3ZYTA 3E4OA 3H7WA 3Q82A 5CTMA 4HOIA 3NDGA 2DNSA 3MZDA 4FCFA 2WGIA 4CPKA 2H5SA 1MY8A 2O0YA 4HHDA 3UY6A 3S7QA 4H8RA 1W63M 1IYPA 1S4RA 3FYZA 4HJ6A 1O7EA 3LFVA 4JXGA 1S67L 4S2KA 3NDEA 1YT4A 4Y17A 1JNUA 3DAVA 3HLGA 3PXPA 3R7WB 2C5WB 3G2YA 3WRZA 4JXSA 3IWOA 4EQ1A 2ZQ9A 3F1OA 3KX0X 1XGIA 2WGWB 5G4YA 3L7HA 5J3WA 3MQ0A 1KDWA 3BY9A 2XDMA 4E3NA 5HSQA 4MMNA 2QWSA 3S7OA 4S2LA 1LL5A 4RVAA 3ZFZA 4GJ4A 4I39A 5DFYA 3TOIA 1FSWA 3Q1FA 1KOUA 5EVEA 3FZCA 4ZJ1A 2BLSA 1ES3A 4KZ9A 1GCEA 5GHZA 2A24B 3HBRA 1KGEA 3BRMA 5HAQA 3UE1A 3UNWA 1S4SA 1ZKJA 3ZDJA 3W8KA 3BQ8A 4EBLA 2BTFP 2QJ5A 5DFXA 2E8JA 3MF0A 3IH9A 2R9WA 4LRZE 4CLCB 4NK3A 1T19A 2PU2A 1Y4OA 4Q0IA 4CQHA 1JWPA 1MWSA 1ZHHB 3C38A 3H9WA 3W2ZA 5KSHA 1KGFA 3R7WA 1P9WA 3PAEA 2V2FF 3T1XA 3LIFA 2OOLA 4DJ3A 5G4ZA 3ZNYA 3ISGA 5FEFA 2WGWA 4JF5A 3UN7A 3W4OA 4L9EA 3O88A 5IU1A 3O5YA 5HWVA 4KG6A 3BEBA 2HZ5A 3HLDA 2XA7M 1WYCA 5KMWA 1LSXA 4Q0HA 2LB5A 3U2AA 3D9YA 5F6AA 3PHYA 2IA2A 2G2UA 2WYXA 4OQIA 4Y2FA 5CHJA 5F1GA 1E4DA 2XSSA 2D01A 5DVAA 4YOFA 1SKOA 2A49A 1T1BA 2LB9A 4PMAA 3VSLA 1AXBA 2DMWA 1STZA 4FOFA 1E3UA 4DXCA 3LY3A 4CLCD 3EOIA 5HPFA 3G34A 3N7WA 1LL9A 4EW7A 2J8YA 2KX6A 2V1ZA 1DP6A 4IUKA 4HH2A 2KLIA 2PT7A 4MBKA 1YLYA 3CJMA 3EEAA 4UAAA 1YLTA 3VP1A 2HJ9C 1TF1A 2OWJA 3UB8A 1NLYA 1UGUA 1HVBA 4N9KA 4GHIB 1XA7A 5GLAA 4XXRA 3NOTC 5DKKA 3MZFA 2J3TC 4XT2B 4YINA 1ERQA 3NI9A 4KQDA 1ALQA 1P0ZA 1OJGA 5CEBA 3KYZA 1DJBA 4KZ6A 1Z09A 3JPUA 3MKEA 4IBRA 3B33A 2GDNA 4KZ7A 2VX8A 2FH5A 4JKTA 1YM1A 4Q8IA 1DY6A 4S2OA 4GZBA 5F82A 1UWPX 5GHXA 2XLNA 1LI9A 4IVIA 4ZJ3A 2OAQ1 4I5SA 4R4RA 2ZD8A 4WZ4A 5A90A 1BLSA 1NLZA 4Y13A 3T4LA 3B3XA 3NHQA 1BLCA 2ZQAA 5HARA 3K3DA 4FH4A 5DTKA 4NETA 5FQKA 2WAFA 2JHEA 5TBMA 4PM6A 1GA0A 3P01A 4U0XA 1YMSA 1KVMA 5FEGA 2ZMAA 3WS4A 2VJWA 4ARZB 1TVFA 3G2ZA 4C6YA 4FUWA 1K0KA 1EW0A 3E0YA 5JYOA 3NOPC 2W3FA 3Q7ZA 1JTGA 1L3LA 3BECA 2L4RA 3HVFA 3HJIA 4GHIA 4EXOA 5GHYA 3ITBA 3B42A 3MMHA 4XT2A 4Q0JA 3DTMA 4RX3A 1W5DA 1GHPA 5M1AA 4QB8A 5FAQA 3LI8A 1PRQA 2QYBA 3MXRA 3SS4A 3LYXA 2J80A 1CQAA 1SDEA 3M2KA 3N6IA 4I38A 3SW1A 3V3SA 2Q9NA 1BLPA 2J9PA 4YWZA 3DWKA 4F94A 3LR0A 1G68A 3BLSA 2BASA 3ZQ5A 1CJFA 4ME4A 4BWIA 5CECA 1BLHA 1LL8A 3A3DA 5HL1A 1HD8A 3HLEA 3NIAA 3T4JA 1P9RA 3FV7A 2PD7A 1P97A 5F68A 4ARZA 4Y3IA 1CEFA 1U60A 1K6RA 2XA7S 4UHUA 3DWZA 4ZDXA 4OOLA 3D4FA 2WKRA 4B88A 3LIEA 3EQUA 4KZ3A 3T4SA 3OPPA 5GLBA 5EUAA 3V50A 3C4PA 4Y0OA 4WM9A 4R3JA 1W79A 4E3LA 4X25A 3UDIA 4E3OA 1S1YA 4R23A 4EESA 1H8YA 2EWWA 3N8LA 1XX2A 4HESA 3VOYA 4EU0A 4R4SA 3EGDC 5FAPA 4R0QA 5EM1A 1FCNA 4DXBA 1NY0A 3DTEA 3MXSA 3VOLA 4GDNA 5J4EA 1H8ZA 3ZVTA 3IF6C 4YNRA 4IUHA 3FC7A 3G4PA 3KSGA 1KVLA 4NXEA 2W0NA 1IYOA 4N92A 1LHYA 1ZTUA 5E2EA 2XRNA 1CI9A 5AQ9A 2VLGA 2GJ3A 4A5RA 4UA7A 2Y2OA 3IS2B 3GRJA 1FR1A 4B9OA
chains in the Genus database with same CATH topology
1NRFA 2C5WB 3G2YA 1SKFA 3IF6B 2ZQDA 3AGFA 3WRZA 4KZ8A 1GHIA 1I2SA 4JXSA 1FQGA 3IWOA 1WYBA 4HBUA 1K4EA 3HLWA 1VQQA 1YMXA 1LI0A 2ZQ9A 1MWUA 3OZHA 4JXVA 3A3FA 2QMIA 4DE0A 4E3KA 1XGIA 1NXYA 4FSFA 2WGWB 1ES5A 2I72A 4JBFA 2ZM2A 1W8QA 1YLPA 1PWGA 4XUZA 3IHAA 1KDWA 1JTDA 1WE4A 1S0WA 5GLCA 3GR2A 4E6WA 2XDMA 4E3NA 3FKWA 2Y2HA 4GD6A 4N1XA 2ZLYA 1LLBA 5TR7A 3IWQA 3GSGA 4KENB 4S2LA 1LL5A 1RGZA 1YLJA 4JF6A 4RVAA 3UPPA 3ZFZA 3MBZA 5FASA 1MXOA 2Y4AA 2XR0A 3HREA 4KZBA 4ZJ2A 3TOIA 3VP0A 1FSWA 1K6SA 3Q1FA 4OPZA 3TSGA 5F83A 1IYQA 3FZCA 4QHCA 4E3JA 5CHMA 3PBOA 4ZJ1A 2VGJA 2BLSA 5HAIA 5L2FA 1ES2A 1ES3A 4KZ9A 1GCEA 5GHZA 3HBRA 1KGEA 1K38A 2XEPA 4OQ0A 3BRMA 2EFXA 3RXXA 3UE1A 3Q7VA 3UNWA 5HAQA 3IXHA 5EECA 4DE1A 3W4PA 1NYMA 5EVIC 1ZKJA 4ZAMA 4LCMA 4U0TA 3ZDJA 3W8KA 4EBLA 5FQ9A 3UO9A 3GV9A 1ONHA 1JWZA 3IQAA 5IHVA 2EXBA 2HDUA 3WS0A 1RP5A 3IH9A 1KE3A 2R9WA 4B4ZA 3MKFA 4JXWA 2WKIA 5GLDA 4NK3A 5GL9A 3A3EA 2ZM8A 5M18A 3G32A 2Y2PA 3PTEA 4GB7A 3V3RA 5CHUA 2XD5A 2PU2A 4EBNA 4EV4A 2Z2LB 1JWPA 5A92A 3IXDA 1MWSA 4PPRA 4Z9QA 5EVIB 5JYPA 3C4OA 5KSHA 1KGFA 4OONA 2R9XA 3BLMA 3C7VA 3I7JA 3IF6A 4P0MA 4Y7PA 3PAEA 1ERMA 2V2FF 4RYEA 3CMZA 4U3TA 5EPHA 3ZG0A 2EX9A 3OPRA 2X02A 3PBNA 3GVBA 1L0FA 4N1HA 2Y59A 1NZOA 1N4OA 1XXMA 3N8SA 4KG2A 3ZNYA 3ISGA 3E2KA 3PAGA 4LV3A 4OKPA 2WGWA 2XH9A 4BJPA 4JF5A 3UN7A 5FI6A 1NYYA 4WELA 5FI7A 3W4OA 4DE2A 2WZZA 1XKZA 3NBLA 3O88A 3Q7VB 1CEGA 2FFFB 3M6BA 4KG6A 4EWFA 1FSYA 3BEBA 1S6RA 5FQQA 3HLDA 3SS5A 2WGVA 1WYCA 5KMWA 3ZNTA 2FFYA 1JVJA 3BFFA 3RJUA 1H5XA 2IWCA 1W7FA 4MNRA 4DDSA 5CEDA 1IELA 3OPLA 4IVKA 4PM9A 1L2SA 5D3OA 4DDYA 4E3IA 1K56A 3UPNA 5E43A 2G2UA 1K57C 2OLUA 2WYXA 4OQIA 5DF7A 2RCXA 5CHJA 3LCEA 5DTTA 1N9BA 1BTLA 1MPLA 2JE5A 2Y2LA 3G31A 4WMCA 1E4DA 5F1GA 2H0YA 5E2HA 3TG9A 5BOHA 3LO7A 4OH0A 2HP5A 1K56D 4UA6A 4X55A 3IF5A 5DVAA 1QMEA 5CXWA 4KG5A 2A49A 2Y2JA 4PMAA 3VSLA 3S4XA 4WMCD 1BZAA 1AXBA 1MWTA 2HP6A 4R1GA 3SH8A 5A93A 4MBHA 2X01A 1E3UA 2HPBA 5F1FA 4GKUA 4DXCA 3GQZA 3LY3A 2XFSA 5EVIA 2EFUA 2JBFA 1PW8A 3W4QA 3NCKA 3VOZA 3G34A 1KGGA 2WK0A 3N7WA 2HP9A 3IT9A 1LL9A 3C7UA 1MBLA 5A91A 2H0TA 4OOYA 1PYYA 5AQAA 1JWVA 1M6KA 3E2LA 2PBYA 2J8YA 4OPYA 4BQMA 5EVID 2V1ZA 4MEZA 2XK1A 4X6TA 4OLDA 3S22A 2J9OA 1G6AA 4WBGA 4MBKA 1CI8A 1YLYA 4FD8A 3QNCA 4BL2A 3HLCA 3O86A 3CJMA 4S2MA 2WKHA 4UAAA 1YLTA 3VP1A 3WS2A 5G18A 4EQIA 5HAPA 1XA1A 1KE4A 4KQQA 2CC1A 2WKEA 3ZG7B 2XFTA 4P85A 3VP4A 1ESUA 2ZC3B 4EBPA 1PI4A 4JLFA 3PBSA 1HVBA 3MZEA 4N9KA 1XA7A 5E2GA 3BFEA 4S2NA 5GLAA 1IKIA 4Y0TA 4XXRA 4OOMA 3MZFA 4QJGA 3SS3A 4WYYA 4OVDA 4BL3A 4HBTA 4YINA 2Y2KA 3Q81A 4GNUA 1ERQA 3NI9A 1EROA 1ALQA 3HUMA 5CEBA 1DJBA 4KZ6A 3LEZA 3IH8A 4P6BA 4X56A 4OP8A 2Y2MA 3MKEA 5DTSA 1PW1A 1HTZA 1PZOA 4LV0A 3IWIA 4IBRA 2OLVA 3SH9A 2GDNA 4KZ7A 3VP3A 1IEMA 5E2FA 1RCJA 4KZAA 1K25A 4K91A 3HL9A 4JKTA 2DRWA 1YM1A 4Q8IA 4E6XA 1DY6A 4S2OA 1YQSA 4GZBA 1XP4A 1Z6FA 3QNBA 5F82A 3IXBA 2XLNA 4IBXA 1PIOA 1LI9A 2Y91A 4S2NC 5GHXA 4IVIA 2WUQA 2HDRA 4ZJ3A 4R4RA 5AQ7A 2ZD8A 4WZ4A 4O7DA 5A90A 1BLSA 1BSGA 5FATA 5FQMA 3N4IA 1OMEA 4OP5A 3B3XA 1TDGA 1O07A 1PWCA 1BLCA 1K57A 2ZQAA 3GMWA 5HARA 4OLGA 2WAEA 4DKIA 2ZM0A 2WADA 3HUOA 3VSKA 5KSCA 1I5QA 3WS1A 3PBQA 4FH4A 3FWLA 5FQJA 2E8IA 2BG1A 5DTKA 2ZQ7A 4NETA 5FQKA 3UPOA 2WAFA 2ZQ8A 3A3IA 4QU3A 4X69A 4PM6A 1GA0A 3A3JA 5CGXA 3HUNA 3ZG5A 1NJ4A 4U0XA 1YMSA 4LV2A 1KVMA 2QPNA 1ONGA 3ZVWA 2ZMAA 4X68A 2J7VA 2XD1A 3PBTA 3WS4A 5J8XA 3ZG8B 2UWXA 5EVLA 5EOEA 1TVFA 3IHBA 3Q07A 2X71A 2PU4A 4ZTKA 4LCLA 4B4XA 3G35A 3EQVA 3G2ZA 4C6YA 2IWDA 5CRFA 1KDSA 5FDHA 3UE0A 2Y2GA 5JYOA 1SCWA 4DF6A 2ZC7A 3O3VA 2Q9MA 3P98A 3Q7ZA 1Q2QA 1JTGA 5U47A 3BECA 4WZ5A 3HVFA 1E25A 2Y2IA 5GHYA 1VM1A 2XGNA 1K55A 3ITBA 3BFGA 3IXGA 1ZG4A 5HFOA 4BLMA 4N9LA 3UDFA 3DTMA 4RX3A 4GN2A 1W5DA 1GHPA 2DCFA 3BFDA 1MKIA 5M1AA 4QB8A 3ZHHA 5FAQA 3AGEA 3MXRA 3SOIA 1L0EA 1XPBA 4D2OA 3PBRA 4KZ4A 4LENA 3SH7A 4GDBA 2C6WB 3OCNA 3SS4A 2XQZA 1EI5A 1FR6A 4KQRA 1SDEA 3M2KA 2P74A 3UE3A 2IWBA 2JC7A 3N6IA 4WZ5C 2EX6A 3V3SA 3V39A 1E3UD 5EOOA 5FSRA 2Q9NA 2OV5A 1K55C 1BLPA 2A3UA 2J9PA 3AGDA 4YFMA 1RGYA 4DE3A 3DWKA 1CK3A 4F94A 4WEJA 2VGKA 4M3KA 2EX2A 4MLLA 1G68A 5DF9A 1IYSA 2OSUA 2EX8A 3BLSA 1ZG6A 3M6HA 4UA9A 4XUXA 2ZC6B 1PZPA 1GA9A 3GTCA 2EXAA 3OCLA 1PI5A 4R3BA 4S2IA 5CECA 1BLHA 5FI2A 1L0GA 4QD4A 3VMAA 2P9VB 3ZCZA 4C3QA 5TGFA 1BUEA 4KQOA 4PM7A 3UDXA 3A3DA 5HL1A 1HD8A 3HLEA 2Z2MB 4S2PA 5CERA 3NIAA 2ZC4B 2WZXA 2V20A 3FV7A 3N8RA 4L0LA 4P87A 3S1YA 5M19A 1DJCA 5HX9A 3CG5A 4WEKA 3V5MA 5KZHA 4OPRA 5CGSA 1C3BA 1XGJA 3RXWA 1DJAA 5FA7A 3BM6A 2Y2QA 1CEFA 1U60A 2QZ6A 2H10A 1BULA 1K6RA 1M40A 4UHUA 5CTNA 3DWZA 4ZDXA 4GOGA 4OOLA 1K54A 3D4FA 1I2WA 5HW3A 1FCMA 4LV1A 3LY4A 3P09A 4BD0A 4C75A 1GHMA 4B88A 4Y0UA 1NZUA 3EQUA 1ES4A 5EE8A 4KZ5A 5AQBA 4KZ3A 3VFFA 2Y55A 4OPQA 2ZJ9A 3G30A 4FH2A 1L0DA 3OPPA 3HLFA 2HDSA 4RA7A 2ZQCA 5GLBA 1FOFA 3CZDA 1SDNA 5EUAA 3V50A 1Y54A 4JF4A 2RL3A 3C4PA 4Y0OA 1BT5A 1K4FA 4PM8A 4WM9A 4R3JA 1W79A 3FKVA 1YLZA 1Q2PA 3OPHA 4E3LA 3QHYA 4JPMA 4OQHA 1HZOA 1TDLA 3O87A 4IEDA 3WRTA 1ZC2A 2Y2NA 1K54C 4S2JA 3UDIA 4ZBEA 4QY6A 4E3OA 3BFCA 3BYDA 3ZG9B 2XF3A 3ZGAB 4R23A 1H8YA 5I94A 3C5AA 1QMFA 4K0XA 4BENA 2JCHA 3VFHA 4RX2A 1W8YA 5DF8A 2B5RA 3N8LA 5TFQA 3M2JA 1XX2A 4HESA 4K0WA 4MBFA 4QY5A 3VOYA 2G2WA 4GD8A 4OQGA 1FCOA 4R4SA 5FAPA 3ITAA 3Q82A 3MFDA 5CTMA 4R0QA 1TEMA 4PM5A 3NDGA 1FCNA 2ZC5B 3NY4A 4DXBA 5FAOA 1IKGA 1NY0A 2DNSA 3MZDA 3WWXA 4FCFA 2WGIA 3WS5A 2P9VA 3MXSA 2HDQA 2H5SA 4GDNA 4CPKA 1MY8A 3UY6A 1H8ZA 3ZVTA 3DW0A 4H8RA 3IF6C 3JYIA 1YLWA 4E3MA 5FQIA 3HLBA 1J9MA 4CJNA 1EWZA 3G4PA 1IYPA 4HEFA 1KE0A 3FYZA 1O7EA 4X53A 1KVLA 4JXGA 3VP2A 4S2KA 1IYOA 4N92A 1LHYA 4EUZA 5CGWA 3NDEA 5E2EA 1MWRA 1ESIA 1SHVA 1YT4A 1CI9A 5AQ9A 1PWDA 3NC8A 4ID4A 4A5RA 3OC2A 4UA7A 4BD1A 4DRTA 2Y2OA 3HLGA 3GRJA 1FR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NRF A;  2C5W B;  3G2Y A;  1SKF A;  3IF6 B;  2ZQD A;  3AGF A;  3WRZ A;  4KZ8 A;  1GHI A;  1I2S A;  4JXS A;  1FQG A;  3IWO A;  1WYB A;  4HBU A;  1K4E A;  3HLW A;  1VQQ A;  1YMX A;  1LI0 A;  2ZQ9 A;  1MWU A;  3OZH A;  4JXV A;  3A3F A;  2QMI A;  4DE0 A;  4E3K A;  1XGI A;  1NXY A;  4FSF A;  2WGW B;  1ES5 A;  2I72 A;  4JBF A;  2ZM2 A;  1W8Q A;  1YLP A;  1PWG A;  4XUZ A;  3IHA A;  1KDW A;  1JTD A;  1WE4 A;  1S0W A;  5GLC A;  3GR2 A;  4E6W A;  2XDM A;  4E3N A;  3FKW A;  2Y2H A;  4GD6 A;  4N1X A;  2ZLY A;  1LLB A;  5TR7 A;  3IWQ A;  3GSG A;  4KEN B;  4S2L A;  1LL5 A;  1RGZ A;  1YLJ A;  4JF6 A;  4RVA A;  3UPP A;  3ZFZ A;  3MBZ A;  5FAS A;  1MXO A;  2Y4A A;  2XR0 A;  3HRE A;  4KZB A;  4ZJ2 A;  3TOI A;  3VP0 A;  1FSW A;  1K6S A;  3Q1F A;  4OPZ A;  3TSG A;  5F83 A;  1IYQ A;  3FZC A;  4QHC A;  4E3J A;  5CHM A;  3PBO A;  4ZJ1 A;  2VGJ A;  2BLS A;  5HAI A;  5L2F A;  1ES2 A;  1ES3 A;  4KZ9 A;  1GCE A;  5GHZ A;  3HBR A;  1KGE A;  1K38 A;  2XEP A;  4OQ0 A;  3BRM A;  2EFX A;  3RXX A;  3UE1 A;  3Q7V A;  3UNW A;  5HAQ A;  3IXH A;  5EEC A;  4DE1 A;  3W4P A;  1NYM A;  5EVI C;  1ZKJ A;  4ZAM A;  4LCM A;  4U0T A;  3ZDJ A;  3W8K A;  4EBL A;  5FQ9 A;  3UO9 A;  3GV9 A;  1ONH A;  1JWZ A;  3IQA A;  5IHV A;  2EXB A;  2HDU A;  3WS0 A;  1RP5 A;  3IH9 A;  1KE3 A;  2R9W A;  4B4Z A;  3MKF A;  4JXW A;  2WKI A;  5GLD A;  4NK3 A;  5GL9 A;  3A3E A;  2ZM8 A;  5M18 A;  3G32 A;  2Y2P A;  3PTE A;  4GB7 A;  3V3R A;  5CHU A;  2XD5 A;  2PU2 A;  4EBN A;  4EV4 A;  2Z2L B;  1JWP A;  5A92 A;  3IXD A;  1MWS A;  4PPR A;  4Z9Q A;  5EVI B;  5JYP A;  3C4O A;  5KSH A;  1KGF A;  4OON A;  2R9X A;  3BLM A;  3C7V A;  3I7J A;  3IF6 A;  4P0M A;  4Y7P A;  3PAE A;  1ERM A;  2V2F F;  4RYE A;  3CMZ A;  4U3T A;  5EPH A;  3ZG0 A;  2EX9 A;  3OPR A;  2X02 A;  3PBN A;  3GVB A;  1L0F A;  4N1H A;  2Y59 A;  1NZO A;  1N4O A;  1XXM A;  3N8S A;  4KG2 A;  3ZNY A;  3ISG A;  3E2K A;  3PAG A;  4LV3 A;  4OKP A;  2WGW A;  2XH9 A;  4BJP A;  4JF5 A;  3UN7 A;  5FI6 A;  1NYY A;  4WEL A;  5FI7 A;  3W4O A;  4DE2 A;  2WZZ A;  1XKZ A;  3NBL A;  3O88 A;  3Q7V B;  1CEG A;  2FFF B;  3M6B A;  4KG6 A;  4EWF A;  1FSY A;  3BEB A;  1S6R A;  5FQQ A;  3HLD A;  3SS5 A;  2WGV A;  1WYC A;  5KMW A;  3ZNT A;  2FFY A;  1JVJ A;  3BFF A;  3RJU A;  1H5X A;  2IWC A;  1W7F A;  4MNR A;  4DDS A;  5CED A;  1IEL A;  3OPL A;  4IVK A;  4PM9 A;  1L2S A;  5D3O A;  4DDY A;  4E3I A;  1K56 A;  3UPN A;  5E43 A;  2G2U A;  1K57 C;  2OLU A;  2WYX A;  4OQI A;  5DF7 A;  2RCX A;  5CHJ A;  3LCE A;  5DTT A;  1N9B A;  1BTL A;  1MPL A;  2JE5 A;  2Y2L A;  3G31 A;  4WMC A;  1E4D A;  5F1G A;  2H0Y A;  5E2H A;  3TG9 A;  5BOH A;  3LO7 A;  4OH0 A;  2HP5 A;  1K56 D;  4UA6 A;  4X55 A;  3IF5 A;  5DVA A;  1QME A;  5CXW A;  4KG5 A;  2A49 A;  2Y2J A;  4PMA A;  3VSL A;  3S4X A;  4WMC D;  1BZA A;  1AXB A;  1MWT A;  2HP6 A;  4R1G A;  3SH8 A;  5A93 A;  4MBH A;  2X01 A;  1E3U A;  2HPB A;  5F1F A;  4GKU A;  4DXC A;  3GQZ A;  3LY3 A;  2XFS A;  5EVI A;  2EFU A;  2JBF A;  1PW8 A;  3W4Q A;  3NCK A;  3VOZ A;  3G34 A;  1KGG A;  2WK0 A;  3N7W A;  2HP9 A;  3IT9 A;  1LL9 A;  3C7U A;  1MBL A;  5A91 A;  2H0T A;  4OOY A;  1PYY A;  5AQA A;  1JWV A;  1M6K A;  3E2L A;  2PBY A;  2J8Y A;  4OPY A;  4BQM A;  5EVI D;  2V1Z A;  4MEZ A;  2XK1 A;  4X6T A;  4OLD A;  3S22 A;  2J9O A;  1G6A A;  4WBG A;  4MBK A;  1CI8 A;  1YLY A;  4FD8 A;  3QNC A;  4BL2 A;  3HLC A;  3O86 A;  3CJM A;  4S2M A;  2WKH A;  4UAA A;  1YLT A;  3VP1 A;  3WS2 A;  5G18 A;  4EQI A;  5HAP A;  1XA1 A;  1KE4 A;  4KQQ A;  2CC1 A;  2WKE A;  3ZG7 B;  2XFT A;  4P85 A;  3VP4 A;  1ESU A;  2ZC3 B;  4EBP A;  1PI4 A;  4JLF A;  3PBS A;  1HVB A;  3MZE A;  4N9K A;  1XA7 A;  5E2G A;  3BFE A;  4S2N A;  5GLA A;  1IKI A;  4Y0T A;  4XXR A;  4OOM A;  3MZF A;  4QJG A;  3SS3 A;  4WYY A;  4OVD A;  4BL3 A;  4HBT A;  4YIN A;  2Y2K A;  3Q81 A;  4GNU A;  1ERQ A;  3NI9 A;  1ERO A;  1ALQ A;  3HUM A;  5CEB A;  1DJB A;  4KZ6 A;  3LEZ A;  3IH8 A;  4P6B A;  4X56 A;  4OP8 A;  2Y2M A;  3MKE A;  5DTS A;  1PW1 A;  1HTZ A;  1PZO A;  4LV0 A;  3IWI A;  4IBR A;  2OLV A;  3SH9 A;  2GDN A;  4KZ7 A;  3VP3 A;  1IEM A;  5E2F A;  1RCJ A;  4KZA A;  1K25 A;  4K91 A;  3HL9 A;  4JKT A;  2DRW A;  1YM1 A;  4Q8I A;  4E6X A;  1DY6 A;  4S2O A;  1YQS A;  4GZB A;  1XP4 A;  1Z6F A;  3QNB A;  5F82 A;  3IXB A;  2XLN A;  4IBX A;  1PIO A;  1LI9 A;  2Y91 A;  4S2N C;  5GHX A;  4IVI A;  2WUQ A;  2HDR A;  4ZJ3 A;  4R4R A;  5AQ7 A;  2ZD8 A;  4WZ4 A;  4O7D A;  5A90 A;  1BLS A;  1BSG A;  5FAT A;  5FQM A;  3N4I A;  1OME A;  4OP5 A;  3B3X A;  1TDG A;  1O07 A;  1PWC A;  1BLC A;  1K57 A;  2ZQA A;  3GMW A;  5HAR A;  4OLG A;  2WAE A;  4DKI A;  2ZM0 A;  2WAD A;  3HUO A;  3VSK A;  5KSC A;  1I5Q A;  3WS1 A;  3PBQ A;  4FH4 A;  3FWL A;  5FQJ A;  2E8I A;  2BG1 A;  5DTK A;  2ZQ7 A;  4NET A;  5FQK A;  3UPO A;  2WAF A;  2ZQ8 A;  3A3I A;  4QU3 A;  4X69 A;  4PM6 A;  1GA0 A;  3A3J A;  5CGX A;  3HUN A;  3ZG5 A;  1NJ4 A;  4U0X A;  1YMS A;  4LV2 A;  1KVM A;  2QPN A;  1ONG A;  3ZVW A;  2ZMA A;  4X68 A;  2J7V A;  2XD1 A;  3PBT A;  3WS4 A;  5J8X A;  3ZG8 B;  2UWX A;  5EVL A;  5EOE A;  1TVF A;  3IHB A;  3Q07 A;  2X71 A;  2PU4 A;  4ZTK A;  4LCL A;  4B4X A;  3G35 A;  3EQV A;  3G2Z A;  4C6Y A;  2IWD A;  5CRF A;  1KDS A;  5FDH A;  3UE0 A;  2Y2G A;  5JYO A;  1SCW A;  4DF6 A;  2ZC7 A;  3O3V A;  2Q9M A;  3P98 A;  3Q7Z A;  1Q2Q A;  1JTG A;  5U47 A;  3BEC A;  4WZ5 A;  3HVF A;  1E25 A;  2Y2I A;  5GHY A;  1VM1 A;  2XGN A;  1K55 A;  3ITB A;  3BFG A;  3IXG A;  1ZG4 A;  5HFO A;  4BLM A;  4N9L A;  3UDF A;  3DTM A;  4RX3 A;  4GN2 A;  1W5D A;  1GHP A;  2DCF A;  3BFD A;  1MKI A;  5M1A A;  4QB8 A;  3ZHH A;  5FAQ A;  3AGE A;  3MXR A;  3SOI A;  1L0E A;  1XPB A;  4D2O A;  3PBR A;  4KZ4 A;  4LEN A;  3SH7 A;  4GDB A;  2C6W B;  3OCN A;  3SS4 A;  2XQZ A;  1EI5 A;  1FR6 A;  4KQR A;  1SDE A;  3M2K A;  2P74 A;  3UE3 A;  2IWB A;  2JC7 A;  3N6I A;  4WZ5 C;  2EX6 A;  3V3S A;  3V39 A;  1E3U D;  5EOO A;  5FSR A;  2Q9N A;  2OV5 A;  1K55 C;  1BLP A;  2A3U A;  2J9P A;  3AGD A;  4YFM A;  1RGY A;  4DE3 A;  3DWK A;  1CK3 A;  4F94 A;  4WEJ A;  2VGK A;  4M3K A;  2EX2 A;  4MLL A;  1G68 A;  5DF9 A;  1IYS A;  2OSU A;  2EX8 A;  3BLS A;  1ZG6 A;  3M6H A;  4UA9 A;  4XUX A;  2ZC6 B;  1PZP A;  1GA9 A;  3GTC A;  2EXA A;  3OCL A;  1PI5 A;  4R3B A;  4S2I A;  5CEC A;  1BLH A;  5FI2 A;  1L0G A;  4QD4 A;  3VMA A;  2P9V B;  3ZCZ A;  4C3Q A;  5TGF A;  1BUE A;  4KQO A;  4PM7 A;  3UDX A;  3A3D A;  5HL1 A;  1HD8 A;  3HLE A;  2Z2M B;  4S2P A;  5CER A;  3NIA A;  2ZC4 B;  2WZX A;  2V20 A;  3FV7 A;  3N8R A;  4L0L A;  4P87 A;  3S1Y A;  5M19 A;  1DJC A;  5HX9 A;  3CG5 A;  4WEK A;  3V5M A;  5KZH A;  4OPR A;  5CGS A;  1C3B A;  1XGJ A;  3RXW A;  1DJA A;  5FA7 A;  3BM6 A;  2Y2Q A;  1CEF A;  1U60 A;  2QZ6 A;  2H10 A;  1BUL A;  1K6R A;  1M40 A;  4UHU A;  5CTN A;  3DWZ A;  4ZDX A;  4GOG A;  4OOL A;  1K54 A;  3D4F A;  1I2W A;  5HW3 A;  1FCM A;  4LV1 A;  3LY4 A;  3P09 A;  4BD0 A;  4C75 A;  1GHM A;  4B88 A;  4Y0U A;  1NZU A;  3EQU A;  1ES4 A;  5EE8 A;  4KZ5 A;  5AQB A;  4KZ3 A;  3VFF A;  2Y55 A;  4OPQ A;  2ZJ9 A;  3G30 A;  4FH2 A;  1L0D A;  3OPP A;  3HLF A;  2HDS A;  4RA7 A;  2ZQC A;  5GLB A;  1FOF A;  3CZD A;  1SDN A;  5EUA A;  3V50 A;  1Y54 A;  4JF4 A;  2RL3 A;  3C4P A;  4Y0O A;  1BT5 A;  1K4F A;  4PM8 A;  4WM9 A;  4R3J A;  1W79 A;  3FKV A;  1YLZ A;  1Q2P A;  3OPH A;  4E3L A;  3QHY A;  4JPM A;  4OQH A;  1HZO A;  1TDL A;  3O87 A;  4IED A;  3WRT A;  1ZC2 A;  2Y2N A;  1K54 C;  4S2J A;  3UDI A;  4ZBE A;  4QY6 A;  4E3O A;  3BFC A;  3BYD A;  3ZG9 B;  2XF3 A;  3ZGA B;  4R23 A;  1H8Y A;  5I94 A;  3C5A A;  1QMF A;  4K0X A;  4BEN A;  2JCH A;  3VFH A;  4RX2 A;  1W8Y A;  5DF8 A;  2B5R A;  3N8L A;  5TFQ A;  3M2J A;  1XX2 A;  4HES A;  4K0W A;  4MBF A;  4QY5 A;  3VOY A;  2G2W A;  4GD8 A;  4OQG A;  1FCO A;  4R4S A;  5FAP A;  3ITA A;  3Q82 A;  3MFD A;  5CTM A;  4R0Q A;  1TEM A;  4PM5 A;  3NDG A;  1FCN A;  2ZC5 B;  3NY4 A;  4DXB A;  5FAO A;  1IKG A;  1NY0 A;  2DNS A;  3MZD A;  3WWX A;  4FCF A;  2WGI A;  3WS5 A;  2P9V A;  3MXS A;  2HDQ A;  2H5S A;  4GDN A;  4CPK A;  1MY8 A;  3UY6 A;  1H8Z A;  3ZVT A;  3DW0 A;  4H8R A;  3IF6 C;  3JYI A;  1YLW A;  4E3M A;  5FQI A;  3HLB A;  1J9M A;  4CJN A;  1EWZ A;  3G4P A;  1IYP A;  4HEF A;  1KE0 A;  3FYZ A;  1O7E A;  4X53 A;  1KVL A;  4JXG A;  3VP2 A;  4S2K A;  1IYO A;  4N92 A;  1LHY A;  4EUZ A;  5CGW A;  3NDE A;  5E2E A;  1MWR A;  1ESI A;  1SHV A;  1YT4 A;  1CI9 A;  5AQ9 A;  1PWD A;  3NC8 A;  4ID4 A;  4A5R A;  3OC2 A;  4UA7 A;  4BD1 A;  4DRT A;  2Y2O A;  3HLG A;  3GRJ A;  1FR1 A; 
#chains in the Genus database with same CATH topology
 1NRF A;  1YPR A;  1TD5 A;  3AGF A;  3EWK A;  1I2S A;  2O9A A;  4HBU A;  1K4E A;  1T18 A;  1VQQ A;  1LI0 A;  3UME A;  1MWU A;  4JXV A;  3A3F A;  4DE0 A;  4E3K A;  4LRX C;  1ES5 A;  2YKH A;  3C2W A;  1W8Q A;  2NUT C;  1S0W A;  3GR2 A;  5EV0 A;  2ZLY A;  3KYE A;  3UPP A;  1MXO A;  3HRE A;  4ZJ2 A;  3VP0 A;  1K6S A;  5F83 A;  3BY8 A;  1X0O A;  5CHM A;  5HAI A;  1GSW A;  1K38 A;  4B93 A;  3RXX A;  3IXH A;  5EVI C;  3OLO A;  4LCM A;  4L9F A;  5FQ9 A;  1JWZ A;  1H0M A;  3IQA A;  1CF0 A;  3FPV A;  2EXB A;  2HDU A;  1KE3 A;  2WKQ A;  3MKF A;  2WKI A;  3F1O B;  5M18 A;  1D06 A;  3V3R A;  3LIA A;  3PR6 A;  4EV4 A;  2Z2L B;  3IXD A;  3VV4 A;  4Z9Q A;  1LT0 A;  2K31 A;  2W3H A;  3BLM A;  4ESP A;  4P0M A;  3GVB A;  1L0F A;  4N1H A;  2Y59 A;  1NZO A;  1AWI A;  4RQ9 A;  3IX4 A;  2XH9 A;  1NYY A;  2WZZ A;  1XKZ A;  4IJG A;  1CEG A;  2D02 A;  3ZNT A;  3LR3 A;  4DDS A;  5A8B A;  4PM9 A;  1L2S A;  4D60 A;  2PRF A;  1S1Z A;  4MN6 A;  3UPN A;  3T4O A;  1K57 C;  5DF7 A;  2JE5 A;  1MPL A;  2Y2L A;  3G31 A;  5L8M A;  5BOH A;  5E2H A;  4HJ3 A;  3QP1 A;  4OH0 A;  4MN5 A;  4UA6 A;  4BBV A;  3V67 A;  3IF5 A;  1BZA A;  2VV7 A;  2HP6 A;  3P7N A;  4GKU A;  4M4X A;  4PKY A;  3W4Q A;  2JKF A;  2PAV P;  1KGG A;  3IT9 A;  2JKT I;  3C7U A;  2H0T A;  3E98 A;  1PYY A;  4OOY A;  5AQA A;  3E2L A;  4OPY A;  3TW8 A;  2XK1 A;  2L1M A;  2J9O A;  1G6A A;  4WBG A;  2WKH A;  3WS2 A;  4II7 A;  5HAP A;  1TS6 A;  2GNX A;  4KQQ A;  4NXF A;  3ZG7 B;  4P85 A;  1ESU A;  2ZC3 B;  3F1P A;  4EBP A;  5HDD A;  3PBS A;  3MZE A;  4S2N A;  1IKI A;  4Y0T A;  2VGL S;  4OOM A;  1UWN X;  4QJG A;  1SKO B;  1ERO A;  4X56 A;  4MN7 A;  4P6B A;  2Y2M A;  1PZO A;  4LV0 A;  3IWI A;  2OLV A;  3SH9 A;  5E2F A;  2DRW A;  3DBA A;  1Z6F A;  3IXB A;  4S2N C;  2GX5 A;  5F69 A;  2PD8 A;  2V1A A;  4H6J B;  3N4I A;  1F2K A;  1GSX A;  1PFL A;  2WAE A;  5KSC A;  1I5Q A;  5FQJ A;  2BG1 A;  2ZQ7 A;  4WUJ A;  2B02 A;  3S7P A;  1VB6 A;  3A3I A;  4QU3 A;  5EM0 A;  3UB6 A;  4LPZ A;  3T1R A;  5HPI A;  1OJ5 A;  5J8X A;  3ZG8 B;  2UWX A;  2X71 A;  2VK3 A;  4LCL A;  1Q2Q A;  5U47 A;  1T1A A;  4WZ5 A;  4EEP A;  1E25 A;  1DRM A;  2H28 A;  2XGN A;  3IXG A;  4WL9 A;  1ZG4 A;  3MXQ A;  1F98 A;  4N9L A;  3MJQ A;  1OTI A;  4D2O A;  1XPB A;  4GCZ A;  3SH7 A;  4KZ4 A;  3NUL A;  2P74 A;  4LRY C;  3UE3 A;  4WZ5 C;  2EX6 A;  5DJT A;  1E3U D;  5EOO A;  5TBM B;  4EET B;  4BBU A;  2PDR A;  1CK3 A;  4WEJ A;  3MSH A;  4H6J A;  3ULF A;  1VHM A;  4M3K A;  5DF9 A;  5AJG A;  1XJ4 A;  4UA9 A;  1ODV A;  2J3T D;  4R3B A;  4S2I A;  1OPX A;  4C3Q A;  1L0G A;  4QD4 A;  3VMA A;  3BWL A;  3CHW P;  3EEH A;  4S2P A;  2WZX A;  3CUE A;  2V20 A;  1H8M A;  5HZH A;  1DJC A;  1C3B A;  4NEE D;  2Y2Q A;  3EGX C;  1K54 A;  1GHM A;  4Y0U A;  1NRJ A;  3VFF A;  2ZJ9 A;  4FH2 A;  3KYQ A;  4RA7 A;  3JVV A;  3CUE C;  3CZD A;  1SDN A;  2QHK A;  4I3J A;  1YLZ A;  4HH3 A;  3QHY A;  4JPM A;  1HZO A;  3WRT A;  1ZC2 A;  2Y2N A;  1K54 C;  4ZBE A;  4QY6 A;  5HDC A;  3BYD A;  3ZGA B;  4KUO A;  4BEN A;  3VFH A;  1XJ6 A;  3M2J A;  4K0W A;  4MBF A;  4QY5 A;  4GD8 A;  4OQG A;  1TS7 A;  3ITA A;  3MFD A;  1TEM A;  2P04 A;  3KSH A;  4PM5 A;  2WKP A;  1G28 A;  5FAO A;  1YKD A;  3WWX A;  5HD5 A;  2HDQ A;  1G6O A;  3DW0 A;  3U4L P;  3JYI A;  3NOU C;  1YLW A;  4BMW A;  1OTD A;  1KE0 A;  2KDK A;  4HIA A;  2PYP A;  4EUZ A;  3D3O A;  1SHV A;  5IS1 A;  1PNE A;  1PWD A;  2PR5 A;  4ID4 A;  3OC2 A;  2YKF A;  4LLO B;  1SKF A;  3IF6 B;  2ZQD A;  1V9Y A;  1VET B;  3OZH A;  4EEU A;  2QMI A;  5DKL A;  1NXY A;  3TE8 A;  4JBF A;  2ZM2 A;  2VV8 A;  1JTD A;  2Z6D A;  3LID A;  2OWH A;  3FKW A;  4GD6 A;  2EA9 A;  1LLB A;  3GSG A;  1RGZ A;  4JF6 A;  5FAS A;  4KZB A;  3TSG A;  1IYQ A;  2VGJ A;  4QWO A;  4PHT A;  4OQ0 A;  2ZOI A;  2EFX A;  3Q7V A;  1G5U A;  4DE1 A;  3W4P A;  2A2L A;  3B47 A;  3H82 B;  1ONH A;  3GDI A;  1RP5 A;  3WS0 A;  4B4Z A;  1J3W A;  5GLD A;  3KSF A;  1YSQ A;  2ZM8 A;  3G32 A;  4GB7 A;  5CHU A;  2XD5 A;  4EBN A;  3C8C A;  4JGO A;  4HP4 A;  1VEU B;  1XFQ A;  5EVI B;  3UB9 A;  2R9X A;  3IF6 A;  3I7J A;  1ERM A;  4RYE A;  4U3T A;  1OTE A;  1VET A;  5EPH A;  3ZG0 A;  2EX9 A;  3A0S A;  3OPR A;  3PBN A;  5L10 A;  3FPW A;  1N4O A;  1XXM A;  4KG2 A;  3PAG A;  3CPT B;  1SZV A;  4BJP A;  2VGL M;  3MS6 A;  3T50 A;  1V9Z A;  4DE2 A;  3NBL A;  1NWZ A;  3M6B A;  4EUV A;  3SS5 A;  2WGV A;  1JVJ A;  1H5X A;  1W7F A;  4L9G A;  4MNR A;  5CED A;  1IEL A;  4JGQ A;  3OPL A;  4IVK A;  5DJU A;  4R38 A;  4DDY A;  4E3I A;  1K56 A;  4GW9 A;  2I9V A;  2PR6 A;  2RCX A;  3H82 A;  4PAU A;  5FL3 A;  1N9B A;  3LO7 A;  4HY8 A;  2HP5 A;  1K56 D;  4X55 A;  1QME A;  3RH8 B;  2Y2J A;  3S4X A;  3CI6 A;  5HWT A;  1MWT A;  4R1G A;  5KIZ A;  2X01 A;  2QKP A;  1XJ2 A;  2HPB A;  5F1F A;  3GQZ A;  1VEU A;  5EVI A;  2JBF A;  4WN5 A;  3NCK A;  2WK0 A;  2HP9 A;  3GEC A;  5A91 A;  1IOU A;  3LIC A;  4O01 A;  1M6K A;  2PBY A;  5TJJ A;  4BQM A;  4KUK A;  5EVI D;  4ETX A;  4OLD A;  3S22 A;  3CPT A;  2Z6C A;  3E4P A;  3HLC A;  3O86 A;  4S2M A;  4G3W A;  3TJZ C;  5G18 A;  4EQI A;  1KE4 A;  2CC1 A;  2WKE A;  3VP4 A;  3BFE A;  2JKR I;  3UB5 P;  3LUQ A;  3SS3 A;  3LEQ A;  4OVD A;  2V9A A;  4HBT A;  2Y2K A;  4GNU A;  2ZL1 A;  2VEA A;  3A0V A;  4I3A A;  1N9L A;  3HUM A;  3T4T A;  2M1C A;  3IH8 A;  3MFX A;  3MQO A;  4OP8 A;  4CLC E;  2HF6 A;  3CWF A;  3T4Q A;  3VP3 A;  1IEM A;  4KZA A;  4DMZ A;  3BW6 A;  4FTX A;  2VA0 A;  4E6X A;  4O8G A;  3RTY A;  1XP4 A;  3LI9 A;  4IBX A;  2WUQ A;  2O9C A;  2W1T B;  4O7D A;  1BSG A;  5FQM A;  4OP5 A;  1O07 A;  2O9B A;  1K57 A;  4DKI A;  4OLG A;  2W3D A;  2WAD A;  3WS1 A;  3ICY A;  2P08 A;  3FWL A;  2E8I A;  3UPO A;  3F1P B;  4LV2 A;  2QPN A;  1LSW A;  3K2N A;  3ZVW A;  2XD1 A;  5EVL A;  5EOE A;  3IHB A;  2PU4 A;  4ZTK A;  4B4X A;  3G35 A;  3EQV A;  5CRF A;  1KDS A;  3UE0 A;  3L9K A;  5EFW A;  1SCW A;  2AVX A;  4DF6 A;  2ZC7 A;  3O3V A;  2Q9M A;  3P98 A;  4HI4 A;  2FZ0 A;  2NUP C;  2Y2I A;  5HL6 A;  2J3W A;  3IBJ A;  1K55 A;  3BFG A;  3T1Q B;  2XRO A;  5HFO A;  2VZW A;  5K5B A;  1F9I A;  4BLM A;  3UDF A;  4MDZ A;  3ZHH A;  3DTK A;  4Y15 A;  3NJA A;  1W63 Q;  4X1L A;  1L0E A;  3SOI A;  3PBR A;  2C6W B;  1EI5 A;  1FR6 A;  4KQR A;  2JC7 A;  3V39 A;  2K2N A;  5FSR A;  2OV5 A;  1K55 C;  2A3U A;  4X1M A;  3SZT A;  1RGY A;  2W1T A;  2W3G A;  2VGK A;  4AFI A;  2EX2 A;  4MLL A;  2JKT M;  1ZG6 A;  4XUX A;  2ZC6 B;  1PZP A;  1GA9 A;  1ACF A;  1MC0 A;  1S66 L;  2P9V B;  4P6Z M;  1BUE A;  4WF0 A;  5CER A;  3TRC A;  3F1N A;  4HP9 A;  3N8R A;  2V0W A;  3S1Y A;  5M19 A;  5HX9 A;  4WEK A;  1XGJ A;  3RXW A;  1DJA A;  5FA7 A;  1YSP A;  1TS0 A;  2QZ6 A;  1BUL A;  1M40 A;  4I3I A;  4GOG A;  1I2W A;  2ZBB A;  1FCM A;  5HW3 A;  3P09 A;  1NZU A;  5EE8 A;  5AQB A;  2Y55 A;  1OTB A;  4OPQ A;  3E4Q A;  3G30 A;  1L0D A;  2V8C A;  2HDS A;  3HLF A;  3VE3 A;  4Y5F A;  2PBD P;  4NKP A;  3DTI A;  1WA9 A;  3FKV A;  3OPH A;  1TDL A;  4IED A;  4S2J A;  4R6L A;  3BFC A;  3ZG9 B;  2XF3 A;  5I94 A;  3C5A A;  1QMF A;  2JCH A;  3MQQ A;  2B5R A;  2R78 A;  2G2W A;  1MZU A;  1FCO A;  1XFN A;  5I5L A;  3NY4 A;  2ZC5 B;  1IKG A;  5AVE A;  2P9V A;  3WS5 A;  2VV6 A;  4E3M A;  5FQI A;  2O99 A;  3CLO A;  1J9M A;  3HLB A;  4CJN A;  1EWZ A;  5C5K A;  4HEF A;  4X53 A;  1DP8 A;  3VP2 A;  1FIK A;  2A24 A;  5CGW A;  1MWR A;  1ESI A;  3LR5 A;  3NC8 A;  4BD1 A;  4DRT A;  3OOV A;  4UQI S;  5L07 A;  2M7V A;  4KZ8 A;  1GHI A;  2ZMV A;  1FQG A;  1WYB A;  2CMN A;  1OTA A;  3HLW A;  4CLC A;  1YMX A;  4FSF A;  4R70 A;  2I72 A;  2ZMF A;  3PYP A;  2Q0O A;  1YLP A;  1PWG A;  4XUZ A;  3IHA A;  3LIB A;  1WE4 A;  5GLC A;  4E6W A;  2Y2H A;  4N1X A;  1D1J A;  2Y79 A;  5TR7 A;  3IWQ A;  4KEN B;  1YLJ A;  4O0P A;  3MBZ A;  2Y4A A;  2XR0 A;  4GS9 B;  4OPZ A;  4CLC C;  4QHC A;  4E3J A;  3PBO A;  5L2F A;  1ES2 A;  4JGP A;  2INW A;  4WLA A;  2XEP A;  5EEC A;  1NYM A;  4ZAM A;  4U0T A;  3UO9 A;  3GV9 A;  2K7S A;  5IHV A;  4LFU A;  4JXW A;  3FG8 A;  4MCW A;  5GL9 A;  1TS8 A;  3A3E A;  2Y2P A;  3PTE A;  3OBF A;  4ZRR A;  5A92 A;  2Y8H A;  4PPR A;  5JYP A;  3C4O A;  2G7U A;  3JVU A;  4OON A;  1OT9 A;  3C7V A;  4Y7P A;  2V1B A;  3CMZ A;  2W1R A;  2X02 A;  3N8S A;  1LSV A;  3E2K A;  4LV3 A;  2EWV A;  4OKP A;  4HJ4 A;  5MC7 A;  5FI6 A;  1A0K A;  4GLQ A;  4WEL A;  5FI7 A;  4E04 A;  3Q7V B;  4R3A A;  2FFF B;  4EWF A;  1FSY A;  1S6R A;  5FQQ A;  4DN0 A;  3C30 A;  2FFY A;  5L09 A;  3BFF A;  3RJU A;  5CX7 A;  4BBT A;  4ETZ A;  2IWC A;  2B18 A;  4G3K A;  4GS9 A;  5FDS A;  2W27 A;  1IFQ A;  2GZA A;  4G3V A;  5D3O A;  4LGW A;  4P6Z S;  2PHY A;  5E43 A;  2OLU A;  3LR4 A;  3QP2 A;  4NXB A;  3LCE A;  5DTT A;  3S7N A;  1BTL A;  3TG9 A;  4WMC A;  2H0Y A;  2KOI A;  5CXW A;  4KG5 A;  4WMC D;  4NXG A;  3SH8 A;  5A93 A;  4MBH A;  3IBR A;  2W3E A;  3K3C A;  3BJN A;  4DJ2 A;  2MJ6 A;  2XFS A;  2EFU A;  4K08 A;  1PW8 A;  3UB7 A;  2HGV A;  3VOZ A;  1MBL A;  1JWV A;  4MEZ A;  1YAX A;  3IX8 A;  3KO6 A;  4X6T A;  1CI8 A;  4FD8 A;  3QNC A;  4BL2 A;  3D72 A;  3T12 B;  3T1S A;  1XA1 A;  2UV0 E;  2XFT A;  2ACG A;  4HNB A;  1PI4 A;  4JLF A;  5E2G A;  3HJK A;  1DP9 A;  1H3Q A;  4WYY A;  4BL3 A;  3Q81 A;  5F5Y A;  4Z1W A;  3LEZ A;  5DTS A;  1PW1 A;  1HTZ A;  2P7J A;  3T4K A;  1RCJ A;  1K25 A;  4K91 A;  3HL9 A;  1YQS A;  3QNB A;  4EER A;  1PIO A;  2Y91 A;  2JN7 A;  4UEY A;  2HDR A;  5AQ7 A;  3RFB A;  1OT6 A;  5FAT A;  1OME A;  1TDG A;  1PWC A;  3GMW A;  3R4K A;  2ZM0 A;  3HUO A;  3VSK A;  3KSI A;  3QP6 A;  3PBQ A;  2ZQ8 A;  4X69 A;  5CGX A;  3A3J A;  1N9N A;  3HCY A;  3HUN A;  3ZG5 A;  1NJ4 A;  1ONG A;  4X68 A;  2J7V A;  3PBT A;  2PYR A;  4IHQ A;  3UE6 A;  3Q07 A;  2ZL1 B;  3UMD A;  2IWD A;  5FDH A;  5HDS A;  2Y2G A;  2B95 A;  5J7E A;  3G6O A;  1FIL A;  3QP5 A;  4F3L B;  1T1C A;  1VM1 A;  1N9O A;  1MKM A;  3MR0 A;  4GN2 A;  2DCF A;  3BFD A;  1MKI A;  5LBR A;  5HD3 A;  3AGE A;  4LEN A;  4GDB A;  3OCN A;  2XQZ A;  3CIT A;  2IWB A;  2QJ7 A;  3A0R A;  2HJE A;  3AGD A;  4YFM A;  4DE3 A;  2V8F A;  1D7E A;  2V0U A;  1IYS A;  3H7W B;  2OSU A;  2EX8 A;  3M6H A;  5AVF A;  4JGR A;  3GTC A;  2EXA A;  3OCL A;  1PI5 A;  3QP8 A;  5FI2 A;  3ZCZ A;  5TGF A;  4KQO A;  4NG2 A;  4PM7 A;  3UDX A;  2Z2M B;  4QPR A;  2ZC4 B;  4UQI M;  2L0W A;  4L0L A;  4P87 A;  3CG5 A;  3V5M A;  5KZH A;  2OAP 1;  4OPR A;  5CGS A;  5IT5 A;  3BM6 A;  2ZOH A;  2H10 A;  2JKR M;  5CTN A;  3LGO A;  2VKS A;  1BYW A;  4LV1 A;  3LY4 A;  4BD0 A;  3QP4 A;  4C75 A;  3NEC A;  1ES4 A;  4F3L A;  4KZ5 A;  4HQA A;  2ZQC A;  1FOF A;  1Y54 A;  2JKG A;  4JF4 A;  2RL3 A;  3CAX A;  1BT5 A;  1K4F A;  4PM8 A;  3BQA A;  1HLU P;  1Q2P A;  4OQH A;  5HWW A;  3IS2 A;  3O87 A;  4PKY G;  2HV1 A;  3IX3 A;  3VE4 A;  1F5M A;  1GSV A;  4K0X A;  1Y28 A;  4RX2 A;  1W8Y A;  5DF8 A;  2M7U A;  3F1N B;  1XJ3 A;  5TFQ A;  3ZYT A;  3E4O A;  3H7W A;  3Q82 A;  5CTM A;  4HOI A;  3NDG A;  2DNS A;  3MZD A;  4FCF A;  2WGI A;  4CPK A;  2H5S A;  1MY8 A;  2O0Y A;  4HHD A;  3UY6 A;  3S7Q A;  4H8R A;  1W63 M;  1IYP A;  1S4R A;  3FYZ A;  4HJ6 A;  1O7E A;  3LFV A;  4JXG A;  1S67 L;  4S2K A;  3NDE A;  1YT4 A;  4Y17 A;  1JNU A;  3DAV A;  3HLG A;  3PXP A;  3R7W B;  2C5W B;  3G2Y A;  3WRZ A;  4JXS A;  3IWO A;  4EQ1 A;  2ZQ9 A;  3F1O A;  3KX0 X;  1XGI A;  2WGW B;  5G4Y A;  3L7H A;  5J3W A;  3MQ0 A;  1KDW A;  3BY9 A;  2XDM A;  4E3N A;  5HSQ A;  4MMN A;  2QWS A;  3S7O A;  4S2L A;  1LL5 A;  4RVA A;  3ZFZ A;  4GJ4 A;  4I39 A;  5DFY A;  3TOI A;  1FSW A;  3Q1F A;  1KOU A;  5EVE A;  3FZC A;  4ZJ1 A;  2BLS A;  1ES3 A;  4KZ9 A;  1GCE A;  5GHZ A;  2A24 B;  3HBR A;  1KGE A;  3BRM A;  5HAQ A;  3UE1 A;  3UNW A;  1S4S A;  1ZKJ A;  3ZDJ A;  3W8K A;  3BQ8 A;  4EBL A;  2BTF P;  2QJ5 A;  5DFX A;  2E8J A;  3MF0 A;  3IH9 A;  2R9W A;  4LRZ E;  4CLC B;  4NK3 A;  1T19 A;  2PU2 A;  1Y4O A;  4Q0I A;  4CQH A;  1JWP A;  1MWS A;  1ZHH B;  3C38 A;  3H9W A;  3W2Z A;  5KSH A;  1KGF A;  3R7W A;  1P9W A;  3PAE A;  2V2F F;  3T1X A;  3LIF A;  2OOL A;  4DJ3 A;  5G4Z A;  3ZNY A;  3ISG A;  5FEF A;  2WGW A;  4JF5 A;  3UN7 A;  3W4O A;  4L9E A;  3O88 A;  5IU1 A;  3O5Y A;  5HWV A;  4KG6 A;  3BEB A;  2HZ5 A;  3HLD A;  2XA7 M;  1WYC A;  5KMW A;  1LSX A;  4Q0H A;  2LB5 A;  3U2A A;  3D9Y A;  5F6A A;  3PHY A;  2IA2 A;  2G2U A;  2WYX A;  4OQI A;  4Y2F A;  5CHJ A;  5F1G A;  1E4D A;  2XSS A;  2D01 A;  5DVA A;  4YOF A;  1SKO A;  2A49 A;  1T1B A;  2LB9 A;  4PMA A;  3VSL A;  1AXB A;  2DMW A;  1STZ A;  4FOF A;  1E3U A;  4DXC A;  3LY3 A;  4CLC D;  3EOI A;  5HPF A;  3G34 A;  3N7W A;  1LL9 A;  4EW7 A;  2J8Y A;  2KX6 A;  2V1Z A;  1DP6 A;  4IUK A;  4HH2 A;  2KLI A;  2PT7 A;  4MBK A;  1YLY A;  3CJM A;  3EEA A;  4UAA A;  1YLT A;  3VP1 A;  2HJ9 C;  1TF1 A;  2OWJ A;  3UB8 A;  1NLY A;  1UGU A;  1HVB A;  4N9K A;  4GHI B;  1XA7 A;  5GLA A;  4XXR A;  3NOT C;  5DKK A;  3MZF A;  2J3T C;  4XT2 B;  4YIN A;  1ERQ A;  3NI9 A;  4KQD A;  1ALQ A;  1P0Z A;  1OJG A;  5CEB A;  3KYZ A;  1DJB A;  4KZ6 A;  1Z09 A;  3JPU A;  3MKE A;  4IBR A;  3B33 A;  2GDN A;  4KZ7 A;  2VX8 A;  2FH5 A;  4JKT A;  1YM1 A;  4Q8I A;  1DY6 A;  4S2O A;  4GZB A;  5F82 A;  1UWP X;  5GHX A;  2XLN A;  1LI9 A;  4IVI A;  4ZJ3 A;  2OAQ 1;  4I5S A;  4R4R A;  2ZD8 A;  4WZ4 A;  5A90 A;  1BLS A;  1NLZ A;  4Y13 A;  3T4L A;  3B3X A;  3NHQ A;  1BLC A;  2ZQA A;  5HAR A;  3K3D A;  4FH4 A;  5DTK A;  4NET A;  5FQK A;  2WAF A;  2JHE A;  5TBM A;  4PM6 A;  1GA0 A;  3P01 A;  4U0X A;  1YMS A;  1KVM A;  5FEG A;  2ZMA A;  3WS4 A;  2VJW A;  4ARZ B;  1TVF A;  3G2Z A;  4C6Y A;  4FUW A;  1K0K A;  1EW0 A;  3E0Y A;  5JYO A;  3NOP C;  2W3F A;  3Q7Z A;  1JTG A;  1L3L A;  3BEC A;  2L4R A;  3HVF A;  3HJI A;  4GHI A;  4EXO A;  5GHY A;  3ITB A;  3B42 A;  3MMH A;  4XT2 A;  4Q0J A;  3DTM A;  4RX3 A;  1W5D A;  1GHP A;  5M1A A;  4QB8 A;  5FAQ A;  3LI8 A;  1PRQ A;  2QYB A;  3MXR A;  3SS4 A;  3LYX A;  2J80 A;  1CQA A;  1SDE A;  3M2K A;  3N6I A;  4I38 A;  3SW1 A;  3V3S A;  2Q9N A;  1BLP A;  2J9P A;  4YWZ A;  3DWK A;  4F94 A;  3LR0 A;  1G68 A;  3BLS A;  2BAS A;  3ZQ5 A;  1CJF A;  4ME4 A;  4BWI A;  5CEC A;  1BLH A;  1LL8 A;  3A3D A;  5HL1 A;  1HD8 A;  3HLE A;  3NIA A;  3T4J A;  1P9R A;  3FV7 A;  2PD7 A;  1P97 A;  5F68 A;  4ARZ A;  4Y3I A;  1CEF A;  1U60 A;  1K6R A;  2XA7 S;  4UHU A;  3DWZ A;  4ZDX A;  4OOL A;  3D4F A;  2WKR A;  4B88 A;  3LIE A;  3EQU A;  4KZ3 A;  3T4S A;  3OPP A;  5GLB A;  5EUA A;  3V50 A;  3C4P A;  4Y0O A;  4WM9 A;  4R3J A;  1W79 A;  4E3L A;  4X25 A;  3UDI A;  4E3O A;  1S1Y A;  4R23 A;  4EES A;  1H8Y A;  2EWW A;  3N8L A;  1XX2 A;  4HES A;  3VOY A;  4EU0 A;  4R4S A;  3EGD C;  5FAP A;  4R0Q A;  5EM1 A;  1FCN A;  4DXB A;  1NY0 A;  3DTE A;  3MXS A;  3VOL A;  4GDN A;  5J4E A;  1H8Z A;  3ZVT A;  3IF6 C;  4YNR A;  4IUH A;  3FC7 A;  3G4P A;  3KSG A;  1KVL A;  4NXE A;  2W0N A;  1IYO A;  4N92 A;  1LHY A;  1ZTU A;  5E2E A;  2XRN A;  1CI9 A;  5AQ9 A;  2VLG A;  2GJ3 A;  4A5R A;  4UA7 A;  2Y2O A;  3IS2 B;  3GRJ A;  1FR1 A;  4B9O A; 
#chains in the Genus database with same CATH homology
 1NRF A;  2C5W B;  3G2Y A;  1SKF A;  3IF6 B;  2ZQD A;  3AGF A;  3WRZ A;  4KZ8 A;  1GHI A;  1I2S A;  4JXS A;  1FQG A;  3IWO A;  1WYB A;  4HBU A;  1K4E A;  3HLW A;  1VQQ A;  1YMX A;  1LI0 A;  2ZQ9 A;  1MWU A;  3OZH A;  4JXV A;  3A3F A;  2QMI A;  4DE0 A;  4E3K A;  1XGI A;  1NXY A;  4FSF A;  2WGW B;  1ES5 A;  2I72 A;  4JBF A;  2ZM2 A;  1W8Q A;  1YLP A;  1PWG A;  4XUZ A;  3IHA A;  1KDW A;  1JTD A;  1WE4 A;  1S0W A;  5GLC A;  3GR2 A;  4E6W A;  2XDM A;  4E3N A;  3FKW A;  2Y2H A;  4GD6 A;  4N1X A;  2ZLY A;  1LLB A;  5TR7 A;  3IWQ A;  3GSG A;  4KEN B;  4S2L A;  1LL5 A;  1RGZ A;  1YLJ A;  4JF6 A;  4RVA A;  3UPP A;  3ZFZ A;  3MBZ A;  5FAS A;  1MXO A;  2Y4A A;  2XR0 A;  3HRE A;  4KZB A;  4ZJ2 A;  3TOI A;  3VP0 A;  1FSW A;  1K6S A;  3Q1F A;  4OPZ A;  3TSG A;  5F83 A;  1IYQ A;  3FZC A;  4QHC A;  4E3J A;  5CHM A;  3PBO A;  4ZJ1 A;  2VGJ A;  2BLS A;  5HAI A;  5L2F A;  1ES2 A;  1ES3 A;  4KZ9 A;  1GCE A;  5GHZ A;  3HBR A;  1KGE A;  1K38 A;  2XEP A;  4OQ0 A;  3BRM A;  2EFX A;  3RXX A;  3UE1 A;  3Q7V A;  3UNW A;  5HAQ A;  3IXH A;  5EEC A;  4DE1 A;  3W4P A;  1NYM A;  5EVI C;  1ZKJ A;  4ZAM A;  4LCM A;  4U0T A;  3ZDJ A;  3W8K A;  4EBL A;  5FQ9 A;  3UO9 A;  3GV9 A;  1ONH A;  1JWZ A;  3IQA A;  5IHV A;  2EXB A;  2HDU A;  3WS0 A;  1RP5 A;  3IH9 A;  1KE3 A;  2R9W A;  4B4Z A;  3MKF A;  4JXW A;  2WKI A;  5GLD A;  4NK3 A;  5GL9 A;  3A3E A;  2ZM8 A;  5M18 A;  3G32 A;  2Y2P A;  3PTE A;  4GB7 A;  3V3R A;  5CHU A;  2XD5 A;  2PU2 A;  4EBN A;  4EV4 A;  2Z2L B;  1JWP A;  5A92 A;  3IXD A;  1MWS A;  4PPR A;  4Z9Q A;  5EVI B;  5JYP A;  3C4O A;  5KSH A;  1KGF A;  4OON A;  2R9X A;  3BLM A;  3C7V A;  3I7J A;  3IF6 A;  4P0M A;  4Y7P A;  3PAE A;  1ERM A;  2V2F F;  4RYE A;  3CMZ A;  4U3T A;  5EPH A;  3ZG0 A;  2EX9 A;  3OPR A;  2X02 A;  3PBN A;  3GVB A;  1L0F A;  4N1H A;  2Y59 A;  1NZO A;  1N4O A;  1XXM A;  3N8S A;  4KG2 A;  3ZNY A;  3ISG A;  3E2K A;  3PAG A;  4LV3 A;  4OKP A;  2WGW A;  2XH9 A;  4BJP A;  4JF5 A;  3UN7 A;  5FI6 A;  1NYY A;  4WEL A;  5FI7 A;  3W4O A;  4DE2 A;  2WZZ A;  1XKZ A;  3NBL A;  3O88 A;  3Q7V B;  1CEG A;  2FFF B;  3M6B A;  4KG6 A;  4EWF A;  1FSY A;  3BEB A;  1S6R A;  5FQQ A;  3HLD A;  3SS5 A;  2WGV A;  1WYC A;  5KMW A;  3ZNT A;  2FFY A;  1JVJ A;  3BFF A;  3RJU A;  1H5X A;  2IWC A;  1W7F A;  4MNR A;  4DDS A;  5CED A;  1IEL A;  3OPL A;  4IVK A;  4PM9 A;  1L2S A;  5D3O A;  4DDY A;  4E3I A;  1K56 A;  3UPN A;  5E43 A;  2G2U A;  1K57 C;  2OLU A;  2WYX A;  4OQI A;  5DF7 A;  2RCX A;  5CHJ A;  3LCE A;  5DTT A;  1N9B A;  1BTL A;  1MPL A;  2JE5 A;  2Y2L A;  3G31 A;  4WMC A;  1E4D A;  5F1G A;  2H0Y A;  5E2H A;  3TG9 A;  5BOH A;  3LO7 A;  4OH0 A;  2HP5 A;  1K56 D;  4UA6 A;  4X55 A;  3IF5 A;  5DVA A;  1QME A;  5CXW A;  4KG5 A;  2A49 A;  2Y2J A;  4PMA A;  3VSL A;  3S4X A;  4WMC D;  1BZA A;  1AXB A;  1MWT A;  2HP6 A;  4R1G A;  3SH8 A;  5A93 A;  4MBH A;  2X01 A;  1E3U A;  2HPB A;  5F1F A;  4GKU A;  4DXC A;  3GQZ A;  3LY3 A;  2XFS A;  5EVI A;  2EFU A;  2JBF A;  1PW8 A;  3W4Q A;  3NCK A;  3VOZ A;  3G34 A;  1KGG A;  2WK0 A;  3N7W A;  2HP9 A;  3IT9 A;  1LL9 A;  3C7U A;  1MBL A;  5A91 A;  2H0T A;  4OOY A;  1PYY A;  5AQA A;  1JWV A;  1M6K A;  3E2L A;  2PBY A;  2J8Y A;  4OPY A;  4BQM A;  5EVI D;  2V1Z A;  4MEZ A;  2XK1 A;  4X6T A;  4OLD A;  3S22 A;  2J9O A;  1G6A A;  4WBG A;  4MBK A;  1CI8 A;  1YLY A;  4FD8 A;  3QNC A;  4BL2 A;  3HLC A;  3O86 A;  3CJM A;  4S2M A;  2WKH A;  4UAA A;  1YLT A;  3VP1 A;  3WS2 A;  5G18 A;  4EQI A;  5HAP A;  1XA1 A;  1KE4 A;  4KQQ A;  2CC1 A;  2WKE A;  3ZG7 B;  2XFT A;  4P85 A;  3VP4 A;  1ESU A;  2ZC3 B;  4EBP A;  1PI4 A;  4JLF A;  3PBS A;  1HVB A;  3MZE A;  4N9K A;  1XA7 A;  5E2G A;  3BFE A;  4S2N A;  5GLA A;  1IKI A;  4Y0T A;  4XXR A;  4OOM A;  3MZF A;  4QJG A;  3SS3 A;  4WYY A;  4OVD A;  4BL3 A;  4HBT A;  4YIN A;  2Y2K A;  3Q81 A;  4GNU A;  1ERQ A;  3NI9 A;  1ERO A;  1ALQ A;  3HUM A;  5CEB A;  1DJB A;  4KZ6 A;  3LEZ A;  3IH8 A;  4P6B A;  4X56 A;  4OP8 A;  2Y2M A;  3MKE A;  5DTS A;  1PW1 A;  1HTZ A;  1PZO A;  4LV0 A;  3IWI A;  4IBR A;  2OLV A;  3SH9 A;  2GDN A;  4KZ7 A;  3VP3 A;  1IEM A;  5E2F A;  1RCJ A;  4KZA A;  1K25 A;  4K91 A;  3HL9 A;  4JKT A;  2DRW A;  1YM1 A;  4Q8I A;  4E6X A;  1DY6 A;  4S2O A;  1YQS A;  4GZB A;  1XP4 A;  1Z6F A;  3QNB A;  5F82 A;  3IXB A;  2XLN A;  4IBX A;  1PIO A;  1LI9 A;  2Y91 A;  4S2N C;  5GHX A;  4IVI A;  2WUQ A;  2HDR A;  4ZJ3 A;  4R4R A;  5AQ7 A;  2ZD8 A;  4WZ4 A;  4O7D A;  5A90 A;  1BLS A;  1BSG A;  5FAT A;  5FQM A;  3N4I A;  1OME A;  4OP5 A;  3B3X A;  1TDG A;  1O07 A;  1PWC A;  1BLC A;  1K57 A;  2ZQA A;  3GMW A;  5HAR A;  4OLG A;  2WAE A;  4DKI A;  2ZM0 A;  2WAD A;  3HUO A;  3VSK A;  5KSC A;  1I5Q A;  3WS1 A;  3PBQ A;  4FH4 A;  3FWL A;  5FQJ A;  2E8I A;  2BG1 A;  5DTK A;  2ZQ7 A;  4NET A;  5FQK A;  3UPO A;  2WAF A;  2ZQ8 A;  3A3I A;  4QU3 A;  4X69 A;  4PM6 A;  1GA0 A;  3A3J A;  5CGX A;  3HUN A;  3ZG5 A;  1NJ4 A;  4U0X A;  1YMS A;  4LV2 A;  1KVM A;  2QPN A;  1ONG A;  3ZVW A;  2ZMA A;  4X68 A;  2J7V A;  2XD1 A;  3PBT A;  3WS4 A;  5J8X A;  3ZG8 B;  2UWX A;  5EVL A;  5EOE A;  1TVF A;  3IHB A;  3Q07 A;  2X71 A;  2PU4 A;  4ZTK A;  4LCL A;  4B4X A;  3G35 A;  3EQV A;  3G2Z A;  4C6Y A;  2IWD A;  5CRF A;  1KDS A;  5FDH A;  3UE0 A;  2Y2G A;  5JYO A;  1SCW A;  4DF6 A;  2ZC7 A;  3O3V A;  2Q9M A;  3P98 A;  3Q7Z A;  1Q2Q A;  1JTG A;  5U47 A;  3BEC A;  4WZ5 A;  3HVF A;  1E25 A;  2Y2I A;  5GHY A;  1VM1 A;  2XGN A;  1K55 A;  3ITB A;  3BFG A;  3IXG A;  1ZG4 A;  5HFO A;  4BLM A;  4N9L A;  3UDF A;  3DTM A;  4RX3 A;  4GN2 A;  1W5D A;  1GHP A;  2DCF A;  3BFD A;  1MKI A;  5M1A A;  4QB8 A;  3ZHH A;  5FAQ A;  3AGE A;  3MXR A;  3SOI A;  1L0E A;  1XPB A;  4D2O A;  3PBR A;  4KZ4 A;  4LEN A;  3SH7 A;  4GDB A;  2C6W B;  3OCN A;  3SS4 A;  2XQZ A;  1EI5 A;  1FR6 A;  4KQR A;  1SDE A;  3M2K A;  2P74 A;  3UE3 A;  2IWB A;  2JC7 A;  3N6I A;  4WZ5 C;  2EX6 A;  3V3S A;  3V39 A;  1E3U D;  5EOO A;  5FSR A;  2Q9N A;  2OV5 A;  1K55 C;  1BLP A;  2A3U A;  2J9P A;  3AGD A;  4YFM A;  1RGY A;  4DE3 A;  3DWK A;  1CK3 A;  4F94 A;  4WEJ A;  2VGK A;  4M3K A;  2EX2 A;  4MLL A;  1G68 A;  5DF9 A;  1IYS A;  2OSU A;  2EX8 A;  3BLS A;  1ZG6 A;  3M6H A;  4UA9 A;  4XUX A;  2ZC6 B;  1PZP A;  1GA9 A;  3GTC A;  2EXA A;  3OCL A;  1PI5 A;  4R3B A;  4S2I A;  5CEC A;  1BLH A;  5FI2 A;  1L0G A;  4QD4 A;  3VMA A;  2P9V B;  3ZCZ A;  4C3Q A;  5TGF A;  1BUE A;  4KQO A;  4PM7 A;  3UDX A;  3A3D A;  5HL1 A;  1HD8 A;  3HLE A;  2Z2M B;  4S2P A;  5CER A;  3NIA A;  2ZC4 B;  2WZX A;  2V20 A;  3FV7 A;  3N8R A;  4L0L A;  4P87 A;  3S1Y A;  5M19 A;  1DJC A;  5HX9 A;  3CG5 A;  4WEK A;  3V5M A;  5KZH A;  4OPR A;  5CGS A;  1C3B A;  1XGJ A;  3RXW A;  1DJA A;  5FA7 A;  3BM6 A;  2Y2Q A;  1CEF A;  1U60 A;  2QZ6 A;  2H10 A;  1BUL A;  1K6R A;  1M40 A;  4UHU A;  5CTN A;  3DWZ A;  4ZDX A;  4GOG A;  4OOL A;  1K54 A;  3D4F A;  1I2W A;  5HW3 A;  1FCM A;  4LV1 A;  3LY4 A;  3P09 A;  4BD0 A;  4C75 A;  1GHM A;  4B88 A;  4Y0U A;  1NZU A;  3EQU A;  1ES4 A;  5EE8 A;  4KZ5 A;  5AQB A;  4KZ3 A;  3VFF A;  2Y55 A;  4OPQ A;  2ZJ9 A;  3G30 A;  4FH2 A;  1L0D A;  3OPP A;  3HLF A;  2HDS A;  4RA7 A;  2ZQC A;  5GLB A;  1FOF A;  3CZD A;  1SDN A;  5EUA A;  3V50 A;  1Y54 A;  4JF4 A;  2RL3 A;  3C4P A;  4Y0O A;  1BT5 A;  1K4F A;  4PM8 A;  4WM9 A;  4R3J A;  1W79 A;  3FKV A;  1YLZ A;  1Q2P A;  3OPH A;  4E3L A;  3QHY A;  4JPM A;  4OQH A;  1HZO A;  1TDL A;  3O87 A;  4IED A;  3WRT A;  1ZC2 A;  2Y2N A;  1K54 C;  4S2J A;  3UDI A;  4ZBE A;  4QY6 A;  4E3O A;  3BFC A;  3BYD A;  3ZG9 B;  2XF3 A;  3ZGA B;  4R23 A;  1H8Y A;  5I94 A;  3C5A A;  1QMF A;  4K0X A;  4BEN A;  2JCH A;  3VFH A;  4RX2 A;  1W8Y A;  5DF8 A;  2B5R A;  3N8L A;  5TFQ A;  3M2J A;  1XX2 A;  4HES A;  4K0W A;  4MBF A;  4QY5 A;  3VOY A;  2G2W A;  4GD8 A;  4OQG A;  1FCO A;  4R4S A;  5FAP A;  3ITA A;  3Q82 A;  3MFD A;  5CTM A;  4R0Q A;  1TEM A;  4PM5 A;  3NDG A;  1FCN A;  2ZC5 B;  3NY4 A;  4DXB A;  5FAO A;  1IKG A;  1NY0 A;  2DNS A;  3MZD A;  3WWX A;  4FCF A;  2WGI A;  3WS5 A;  2P9V A;  3MXS A;  2HDQ A;  2H5S A;  4GDN A;  4CPK A;  1MY8 A;  3UY6 A;  1H8Z A;  3ZVT A;  3DW0 A;  4H8R A;  3IF6 C;  3JYI A;  1YLW A;  4E3M A;  5FQI A;  3HLB A;  1J9M A;  4CJN A;  1EWZ A;  3G4P A;  1IYP A;  4HEF A;  1KE0 A;  3FYZ A;  1O7E A;  4X53 A;  1KVL A;  4JXG A;  3VP2 A;  4S2K A;  1IYO A;  4N92 A;  1LHY A;  4EUZ A;  5CGW A;  3NDE A;  5E2E A;  1MWR A;  1ESI A;  1SHV A;  1YT4 A;  1CI9 A;  5AQ9 A;  1PWD A;  3NC8 A;  4ID4 A;  4A5R A;  3OC2 A;  4UA7 A;  4BD1 A;  4DRT A;  2Y2O A;  3HLG A;  3GRJ A;  1FR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...