2J7VA

Structure of pbp-a
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
TLPPERPLTNLQQQIQQLVSRQPNLTAGLYFFNLDSGASLNVGGDQVFPAASTIKFPILVAFFKAVDEGRVTLQERLTMRPDLIAPEAGTLQYQKPNSQYAALEVAELMITISDNTATNMIIDRLGGAAELNQQFQEWGLENTVINNPLPDMKGTNTTSPRDLATLMLKIGQGEILSPRSRDRLLDIMRRTVTNTLLPAGLGKGATIAHKTGDIGIVVGDAGMVDMPNGQRYVAAMMVKRPYNDPRGSELIRQVSRMVYQAFEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Pbp-A from Thermosynechococcus Elongatus, a Penicillin-Binding Protein Closely Related to Class a Beta-Lactamases.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Hydrolase
molecule keywords TLL2115 PROTEIN
total genus 99
structure length 265
sequence length 265
chains with identical sequence B, C, D
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2006-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2j7vA01
2IWBA 4BENA 1TEMA 2Y2PA 3I7JA 2H10A 3RJUA 2P9VB 3VSKA 3ZNYA 4S2LA 3OPRA 3IHBA 1FCOA 4JXGA 4DE1A 2EX6A 1S0WA 1BLHA 2Y91A 4DXBA 4X69A 3W4QA 4WEKA 3WS2A 4E3NA 3G30A 4EBPA 1XA7A 4EV4A 4K0XA 5DVAA 3PTEA 3NCKA 1BLSA 2H0TA 1GHPA 3SOIA 3ZFZA 1EROA 2V20A 5GHZA 3BFEA 2IWDA 2OSUA 4WZ5A 1FCMA 1K54C 2P74A 3S4XA 2Q9NA 1YLZA 3OC2A 3UPPA 2PU2A 5FQIA 1AXBA 4IBRA 5HW3A 1CI9A 3IWQA 4OPZA 3IXDA 2XEPA 5CXWA 3UE1A 4Y7PA 4LENA 1BZAA 3G32A 4FH2A 1G6AA 1SCWA 3LEZA 3UY6A 1H5XA 1GHMA 2WGIA 1NY0A 2DRWA 4X68A 2ZQ8A 5CGWA 5E2GA 4DE0A 1SDNA 3BYDA 4UA9A 2Z2LB 3IXGA 3IF6B 5A90A 3HBRA 5DTTA 1U60A 5A91A 2XFSA 3TSGA 5DTSA 4JKTA 4LV1A 3IWOA 3G35A 3IXHA 4OOYA 1PZPA 1JWPA 2XDMA 1JTDA 2ZC6B 4ZJ1A 1ONGA 4KENB 1XGJA 1JWVA 3HLWA 4JF5A 4BLMA 1KE3A 2PBYA 1K57A 3C5AA 3NBLA 3LO7A 3FZCA 1CK3A 5EOOA 1PI4A 2JC7A 3PBTA 1O07A 5L2FA 1DJAA 1FSYA 2FFFB 4WBGA 4XXRA 5FAPA 5KZHA 2P9VA 1HVBA 4DF6A 5U47A 5G18A 5D3OA 1KGEA 1ERQA 2QZ6A 4WMCA 5DF8A 3CZDA 4S2KA 1WYCA 2I72A 2ZC5B 2WAEA 4WMCD 3UPOA 3ZNTA 4C75A 2Y2IA 3Q82A 5DTKA 1BT5A 1G68A 3LCEA 3GR2A 1L0GA 4KZ4A 3DWKA 3D4FA 4HEFA 4S2MA 4PM7A 2OV5A 3HLCA 3AGFA 4R23A 4DXCA 4S2IA 3OCNA 2CC1A 1K4EA 4OPYA 3LY4A 4LV2A 4N9KA 2WADA 1RP5A 4B4XA 2HP6A 4EBNA 1FQGA 5M19A 3BM6A 4BL3A 1MWTA 1PWGA 2ZC3B 1K6RA 3G4PA 3PBOA 3WS0A 5JYOA 2EFXA 5FI7A 1FR6A 1W8YA 4K91A 4DDSA 3ZCZA 4JBFA 1KGFA 4R3JA 2XD5A 5AQ9A 1EI5A 3BRMA 3WS1A 2C6WB 1M40A 3JYIA 3V3RA 4KG6A 3OPLA 4LCMA 4PMAA 3QHYA 3WWXA 3N7WA 5EPHA 3ZG5A 4B88A 1MKIA 4FH4A 4N1XA 3VP0A 3TG9A 4HBUA 2UWXA 3RXXA 1YLYA 5HARA 2WZXA 5HFOA 3IF5A 4OPRA 1TVFA 4OQIA 2WUQA 5CTNA 4S2NA 1ZC2A 3ZHHA 1ALQA 3VOZA 1KVLA 1L0EA 1K55A 4KZ3A 3OPHA 3GTCA 1N9BA 3GMWA 4KZBA 4BD0A 3AGEA 1OMEA 3A3DA 3DTMA 3S22A 4D2OA 3IWIA 4HBTA 2WGWB 4FCFA 1FSWA 4ZBEA 2Y2OA 1RGZA 2ZQAA 1MBLA 2Y2MA 3IQAA 4MBKA 5FA7A 4ZTKA 3PBNA 1L0FA 4M3KA 4RX3A 4QHCA 3HL9A 2Y55A 1PIOA 4NETA 4C6YA 2XF3A 4ZJ3A 1BLPA 3HLGA 2WYXA 3UDXA 1NZUA 3MZFA 1Z6FA 2HDUA 2XH9A 4RYEA 5EE8A 4UA6A 3VOYA 4BJPA 1IKIA 1H8YA 4CJNA 4UA7A 3ZG0A 5EECA 3BLMA 4UHUA 1YT4A 4JXVA 3IF6C 1NJ4A 5TR7A 3ITBA 4E3OA 2R9XA 2R9WA 1W79A 1CEGA 1IYQA 4EUZA 3G31A 4K0WA 4IVKA 4PM5A 3W4OA 1LLBA 3A3JA 3VSLA 4LV0A 4BD1A 1ERMA 4OONA 2ZM8A 3EQVA 1K38A 1K54A 5HAIA 2RL3A 3C4PA 4KQOA 4X56A 3V39A 2WGVA 3MZEA 1C3BA 4X6TA 3G2YA 1E25A 1DY6A 5A92A 3GVBA 2XK1A 4ZDXA 1IYOA 2H5SA 3FKVA 3Q7VB 1Q2QA 1XX2A 5F82A 3SH9A 4GDBA 1SHVA 5EVIC 3G34A 4BQMA 3ZDJA 1XPBA 3Q7ZA 4KQRA 2OLUA 4PPRA 1HZOA 4ID4A 4OVDA 5EUAA 5F1FA 2HP9A 2DCFA 3P09A 4OPQA 1SDEA 4QY6A 5IHVA 3P98A 1L0DA 3MKEA 1YQSA 4KQQA 4O7DA 1M6KA 4IVIA 2XLNA 3W8KA 3BLSA 5GLBA 3M6HA 5I94A 2ZC4B 4DDYA 4RA7A 5FQQA 3SS3A 1NXYA 2HPBA 1KE0A 4E3MA 2ZLYA 4OOMA 5FSRA 2Y2HA 4XUXA 1VQQA 1E4DA 1KVMA 1DJCA 3HUMA 1JVJA 3NDGA 4KZAA 5CGXA 2Y2KA 4QY5A 3O87A 1YLTA 3FYZA 3N8RA 5E2HA 1IKGA 5EVLA 4E3KA 2GDNA 2V1ZA 3UPNA 4UAAA 2J9PA 1H8ZA 2HDQA 3A3IA 4F94A 1J9MA 4OH0A 2EFUA 3HLEA 1ES3A 1LI0A 4JF6A 4OP8A 1S6RA 1N4OA 1CI8A 4E3IA 3UE0A 1JWZA 2XFTA 2Y4AA 3NDEA 2XQZA 3CMZA 3BFGA 3FKWA 3UO9A 3VFHA 3MZDA 3M6BA 4P87A 4DE3A 5CERA 2XR0A 2VGJA 3VP3A 2X71A 1E3UA 2Z2MB 4Y0UA 5GLAA 2Q9MA 5HAPA 1K25A 2VGKA 3FWLA 3CJMA 4PM6A 3UE3A 5GLCA 3DWZA 5FQJA 4R3BA 1XKZA 5AQ7A 1ONHA 1VM1A 3SH7A 3WS4A 4OKPA 2WZZA 1WE4A 5CHUA 1K6SA 2ZC7A 5GHXA 4OQHA 4B4ZA 5CEBA 2ZQ9A 3EQUA 3LY3A 3QNBA 3M2KA 4P6BA 4R4RA 4N1HA 3FV7A 5FQMA 4OLDA 2Y2NA 1XXMA 3M2JA 1PWDA 2OLVA 4OLGA 5BOHA 1TDGA 3SH8A 5DF7A 4OQ0A 3PAEA 1XGIA 1ZG6A 2J7VA 1EWZA 2JE5A 3IH9A 4KG2A 2HP5A 1MWRA 1HTZA 2XD1A 2QMIA 3VP1A 5TFQA 5KMWA 3MXRA 4FD8A 1I2SA 3O3VA 5DF9A 3ISGA 1YLWA 1YMXA 2EX2A 2EX8A 5CEDA 1IELA 4EQIA 3IF6A 3NI9A 2A49A 1PYYA 4WM9A 2Y2JA 5HX9A 4WZ5C 3HLDA 4GB7A 4NK3A 4OOLA 4R0QA 3UDIA 2J9OA 3SS4A 1YLJA 2ZM2A 5CHMA 1MY8A 2G2WA 4P85A 3C7UA 1PW1A 4S2OA 2ZQ7A 4QB8A 3O88A 4EWFA 1XP4A 3BFDA 1IYSA 3N4IA 3SS5A 4Y0OA 3RXWA 4KZ9A 3VMAA 3ZG9B 1W7FA 1E3UD 3Q07A 4MLLA 5FI2A 3ZG8B 4KZ8A 2X01A 1Q2PA 3HREA 3E2LA 2Y59A 4N92A 1K55C 1ZG4A 2JBFA 4U0XA 3VP4A 4KZ7A 2EXBA 1JTGA 4MBHA 1IEMA 2ZQDA 2WKHA 1GA9A 3E2KA 3PBQA 4E3JA 5FQKA 3VFFA 1HD8A 5CGSA 3IXBA 3HUNA 4XUZA 5EOEA 2ZMAA 5EVIA 4DRTA 2ZJ9A 5FATA 5A93A 1KGGA 1K4FA 3ZGAB 4GN2A 3NIAA 3UDFA 1Y54A 1BSGA 4JF4A 4GNUA 1LL5A 3GSGA 4RX2A 4KG5A 4IEDA 5E43A 4MNRA 4GDNA 1FR1A 1PW8A 1LHYA 2QPNA 4JXWA 4DE2A 3V5MA 3DW0A 3G2ZA 4N9LA 1DJBA 4U3TA 3HUOA 1ES5A 4DKIA 2Y2LA 1NZOA 4PM8A 3WRTA 3GRJA 2PU4A 1GHIA 3IH8A 2DNSA 4X53A 5GHYA 4MEZA 3PBSA 3Q81A 5FAOA 5HAQA 2V2FF 4C3QA 1I5QA 4Q8IA 3BFCA 3UN7A 2EXAA 2HDRA 3NC8A 4EBLA 2G2UA 2Y2QA 2A3UA 2IWCA 2J8YA 3ITAA 3MXSA 4OP5A 5FQ9A 3BEBA 4X55A 3AGDA 1NRFA 1FOFA 2EX9A 1YMSA 3BECA 5CECA 5FDHA 3N6IA 4HESA 5CRFA 2WAFA 5F1GA 3OPPA 1YLPA 1QMEA 1LI9A 4OQGA 1PWCA 2FFYA 1L2SA 4U0TA 1CEFA 1NYMA 4GD8A 2C5WB 3N8LA 4KZ5A 4QU3A 5CHJA 1K57C 5E2EA 5J8XA 2B5RA 3MBZA 1KDWA 5EVIB 3N8SA 1MWUA 4GZBA 3BFFA 4R4SA 3W4PA 4E6XA 1FCNA 1SKFA 3ZVWA 3ZVTA 3V3SA 4S2PA 5EVID 1W8QA 3HLBA 4YINA 1O7EA 1RGYA 3PBRA 4P0MA 1MWSA 1ES4A 3Q1FA 4JXSA 3WRZA 4JLFA 4JPMA 4IBXA 2WGWA 4LV3A 4QJGA 1RCJA 5F83A 3CG5A 3TOIA 2BG1A 1GA0A 3ZG7B 4A5RA 1KE4A 4RVAA 3V50A 5KSCA 3OCLA 1IYPA 1LL9A 3HLFA 4L0LA 3B3XA 3GQZA 4GKUA 3WS5A 3QNCA 5M1AA 3S1YA 5GL9A 3A3FA 1BLCA 4H8RA 3IT9A 1YM1A 4GD6A 3O86A 1ESUA 2BLSA 2JCHA 3C4OA 1PZOA 3OZHA 2X02A 4Y0TA 4FSFA 2WK0A 3A3EA 4R1GA 5FASA 1W5DA 1WYBA 3NY4A 4PM9A 5FI6A 4YFMA 2ZQCA 5KSHA 1BTLA 2E8IA 1PI5A 4WELA 1BUEA 2H0YA 1ES2A 3C7VA 3HVFA 3MKFA 5CTMA 4GOGA 5M18A 1MPLA 3UNWA 2XGNA 4MBFA 4S2NC 4E6WA 3IHAA 4S2JA 4ZAMA 4QD4A 4E3LA 4Z9QA 1KDSA 2Y2GA 3Q7VA 1BULA 1XA1A 2WKIA 5JYPA 1NYYA 1ZKJA 3VP2A 1ESIA 4LCLA 4CPKA 3MFDA 4WZ4A 5HL1A 4KZ6A 2HDSA 5GLDA 4WYYA 5E2FA 1QMFA 1K56A 1MXOA 4BL2A 1TDLA 3GV9A 2WKEA 2ZM0A 5AQAA 4ZJ2A 1K56D 2ZD8A 5AQBA 1GCEA 5FAQA 1I2WA 3PAGA 4WEJA 2RCXA 5TGFA
chains in the Genus database with same CATH superfamily
2IWBA 2P04A 1TEMA 2Y2PA 3LR3A 2H10A 3RJUA 2P9VB 3ZNYA 4S2LA 2W3FA 3W4QA 3WS2A 4EBPA 4HQAA 1XA7A 4EV4A 4K0XA 1GHPA 3MJQA 3SOIA 3HJKA 1EROA 1K0KA 3BFEA 2V0WA 1N9LA 4HJ6A 1YLZA 2V9AA 3OC2A 4NEED 4IBRA 3IWQA 2XEPA 3UE1A 3LIBA 4Y7PA 4LENA 2J3WA 4IUHA 3LEZA 3UY6A 4X68A 2ZQ8A 1SDNA 3BYDA 5L10A 2Z2LB 3IF6B 3DBAA 5A90A 1OJGA 3S7NA 3CWFA 3ZYTA 2XDMA 1ONGA 1KE3A 2FH5A 3NBLA 1K57A 3C5AA 5L07A 3LO7A 5EOOA 3NHQA 5L2FA 1DJAA 5FAPA 3SW1A 5G18A 1ERQA 3EGDC 3CZDA 4AFIA 3QP1A 3ZNTA 3Q82A 2A24B 1BT5A 3IX8A 5HWWA 3MR0A 3D4FA 4ETZA 4S2IA 3LY4A 4LV2A 4EBNA 1MWTA 3PBOA 1ZHHB 1W8YA 4ARZA 2GNXA 4I3AA 5HWVA 4L9FA 2C6WB 4HOIA 4KG6A 4PMAA 4LCMA 1T1BA 2VA0A 3ZG5A 4B88A 2VJWA 2UWXA 3RXXA 5HARA 5HL6A 1TVFA 1F5MA 2WUQA 3UMEA 1ZC2A 3ZHHA 1KVLA 3MSHA 3VE4A 4O01A 1OMEA 1UWNX 3S22A 2WGWB 4FCFA 4NXEA 3IX3A 4X1MA 4ZTKA 3PBNA 1L0FA 3HL9A 4NETA 2XF3A 1BLPA 1UGUA 2WYXA 1Z6FA 3UMDA 4ME4A 5EE8A 2PAVP 2EWWA 4BJPA 3LR5A 2ZOIA 3T4LA 3BLMA 4GHIA 3IF6C 3ITBA 4E3OA 2R9XA 1W79A 2H28A 2XROA 3G31A 3E4OA 2Z6DA 1NLZA 1P97A 4OONA 2ZM8A 2LB5A 5HAIA 2WGVA 3G2YA 1DY6A 3GVBA 3SH9A 3UB5P 4Y13A 3LIAA 4JGPA 4G3KA 4QPRA 5EM0A 2OLUA 3D9YA 4ID4A 4OVDA 4PPRA 5F1FA 2DCFA 1SDEA 1OTDA 1L0DA 2JKRI 1YQSA 4KQQA 1V9ZA 4MN6A 3W8KA 3M6HA 5I94A 2ZC4B 4DDYA 5FQQA 1NXYA 3OOVA 1KE0A 4E3MA 3MF0A 2Y2HA 1DJCA 2JKRM 3O87A 1YLTA 2GDNA 3UPNA 3LFVA 3A3IA 1H0MA 2EFUA 1ES3A 1LI0A 3C2WA 4OP8A 3G6OA 4WL9A 3PXPA 4Q0JA 3VFHA 3CHWP 3FKWA 3NULA 3S7OA 1DP9A 1K25A 2B18A 2V1BA 2EA9A 5AQ7A 4OKPA 2INWA 5CEBA 3EQUA 2AVXA 3QNBA 4N1HA 3FV7A 3NOUC 4CQHA 4OQ0A 2VX8A 3BJNA 2J7VA 3U2AA 2HP5A 3LIFA 1MWRA 4GLQA 3KYQA 5TFQA 5DF9A 1S67L 2EX2A 4H6JA 2PRFA 4YNRA 3IX4A 5F5YA 4WF0A 3SS4A 3C7UA 2JHEA 4S2OA 2ZQ7A 4MCWA 4F3LA 2O9AA 1E3UD 4MLLA 4KZ8A 1H3QA 4EW7A 1K55C 3FPWA 3BY9A 2VV8A 4WUJA 2ZJ9A 4X1LA 5A93A 1K4FA 3T4OA 3UDFA 1XJ4A 4KG5A 4DE2A 4I38A 2J80A 1FIKA 1LT0A 3DW0A 3LGOA 4U3TA 3HUOA 5DFYA 4X53A 3Q81A 5HAQA 4C3QA 4Q8IA 4WLAA 3RFBA 3ITAA 5HDCA 2Y79A 5FQ9A 3JVVA 1ACFA 5FDHA 4HESA 4EU0A 4BMWA 4QWOA 1NYMA 5CHJA 4EEPA 5E2EA 5J8XA 2B5RA 3E4PA 3FPVA 3N8SA 4GZBA 3W4PA 1FCNA 2PDRA 4DJ2A 1OTIA 3ZVTA 3HLBA 4YINA 3Q1FA 4JLFA 4IBXA 2ZOHA 3SZTA 2XA7M 3CG5A 4BBUA 5J3WA 2WKPA 1KE4A 3V50A 3HLFA 3B3XA 3GQZA 4CLCB 2Y8HA 3R7WA 1BLCA 4B93A 3IT9A 4GD6A 2G7UA 1ESUA 1PZOA 4FSFA 3A3EA 2OAP1 4PM9A 5FI6A 5KSHA 1BTLA 1YKDA 4WELA 2H0YA 3C7VA 1MKMA 4GOGA 3UNWA 2XGNA 3UB6A 4QD4A 4NXGA 4Z9QA 1KDSA 3Q7VA 1XA1A 2WKIA 4LRZE 4F3LB 5G4YA 1TD5A 5GLDA 3EOIA 5E2FA 1MZUA 3EEHA 2ZM0A 5AQAA 4ZJ2A 5AQBA 5FAQA 3PAGA 5TGFA 3I7JA 4JXGA 1S0WA 1GSXA 4WEKA 3G30A 4CLCC 1DP8A 4PAUA 4X25A 2OSUA 4WZ5A 1FCMA 2P74A 2Q9NA 3UPPA 1LSWA 2B95A 3IXDA 5FEFA 5CXWA 5AVEA 4FH2A 1G6AA 1SCWA 3IS2A 1OTBA 2DRWA 4R70A 3KO6A 2OWHA 4UA9A 3HBRA 5A91A 2XFSA 3TE8A 1G6OA 5DTSA 4LV1A 3EWKA 2JKGA 1JWPA 2L1MA 2W1TB 4BLMA 4DN0A 1G5UA 3UB7A 1CK3A 1PI4A 3PBTA 1FSYA 5F6AA 2FFFB 4DF6A 1KGEA 2QZ6A 1WYCA 2I72A 2WKQA 2ZC5B 3ZQ5A 3UPOA 3K3CA 2Y2IA 4NXBA 1L0GA 3DWKA 4YOFA 4PM7A 2OV5A 3AGFA 4R23A 4DXCA 2CC1A 5EV0A 2VLGA 3B42A 2ZC3B 4L9EA 1T1AA 4JBFA 1KGFA 2XD5A 1EI5A 3BRMA 3LR0A 3JYIA 2XSSA 3QHYA 3N7WA 4Z1WA 4FH4A 4HBUA 3IF5A 4OPRA 4LLOB 4OQIA 4R3AA 5CTNA 3H9WA 3E0YA 1ALQA 3IS2B 3A0VA 1K55A 1XJ3A 3GTCA 3GMWA 4KZBA 4D2OA 3IWIA 2Y2OA 2ZQAA 4MBKA 5FEGA 4M3KA 4QHCA 2Y55A 1PIOA 4ZJ3A 4DMZA 2OOLA 2HJ9C 4EERA 2Z6CA 4UA6A 1XJ2A 4UHUA 1NRJA 4JXVA 2R9WA 1IYQA 4K0WA 3W4OA 3A3JA 3VSLA 4EEUA 1K38A 2RL3A 3C4PA 3V39A 4X6TA 4ZDXA 2R78A 1IYOA 2H5SA 4Y2FA 5F82A 3E98A 5EVIC 4ETXA 4BQMA 3KSHA 3TW8A 1XPBA 2K31A 1FILA 2W1TA 3BQ8A 4OPQA 3P98A 1TS7A 4O7DA 1J3WA 1M6KA 4IVIA 1F9IA 5GLBA 1SKOA 4P6ZM 4MN7A 4Y5FA 2KDKA 2NUPC 5FSRA 4XUXA 4HNBA 1F2KA 5HPIA 3HUMA 4KZAA 3FYZA 4HI4A 5EVLA 1H8ZA 4HHDA 1J9MA 3ICYA 3CPTA 1N4OA 1CI8A 3UE0A 1JWZA 2XFTA 2Y4AA 3T50A 2XQZA 4PKYA 3MZDA 3LI9A 3VP3A 2X71A 1E3UA 4NKPA 5GLAA 5HAPA 4PM6A 2VGKA 3FWLA 3UE3A 3DWZA 3T12B 3LIDA 1VM1A 3VE3A 3SH7A 3LICA 1G28A 1WE4A 1BYWA 2ZQ9A 3M2KA 4R4RA 2Y2NA 3M2JA 1PWDA 2OLVA 2D01A 4OLGA 5BOHA 5L8MA 1TDGA 3SH8A 3IH9A 4KG2A 2ZL1A 1D7EA 3VP1A 5KMWA 4KUOA 1I2SA 3O3VA 3ISGA 1DP6A 1H8MA 2EX8A 3NI9A 1PYYA 4WM9A 3IBRA 3K2NA 1MY8A 1S66L 1PW1A 3T1RA 4EWFA 3BFDA 4P6ZS 3SS5A 3VMAA 1W7FA 3Q07A 5FI2A 3T4KA 5DFXA 3ZG8B 5C5KA 2WKRA 4KZ7A 1JTGA 4O0PA 2WKHA 1GA9A 2VK3A 5CGSA 4XUZA 2ZMAA 4ESPA 1KGGA 4GN2A 1Y54A 1BSGA 1LL5A 4RX2A 2IA2A 4IEDA 1TS6A 1PW8A 3LIEA 4IUKA 3V5MA 2O9BA 2ZL1B 1NZOA 3B47A 4PM8A 5HD3A 3GRJA 3VV4A 3HJIA 3PBSA 3A0RA 1WA9A 3BFCA 3UN7A 4EBLA 2PYRA 2J8YA 4OP5A 4X55A 3AGDA 5DKLA 4CLCD 1FOFA 1YMSA 2I9VA 3OPPA 1YLPA 2P08A 2PBDP 2VZWA 1L2SA 1N9NA 3N8LA 4QU3A 1K57C 3MBZA 5L09A 1KDWA 3NOPC 3PHYA 3T4JA 1MWUA 2OAQ1 2VGLM 3BFFA 4E6XA 1SKFA 3ZVWA 3CITA 3CLOA 5EVID 1ZTUA 1O7EA 3JVUA 1MWSA 4JXSA 3WRZA 4JPMA 2WGWA 5HPFA 4FTXA 1RCJA 3OLOA 5AVFA 4CLCA 2PT7A 2BG1A 3ZG7B 4A5RA 5KSCA 3H7WB 3OCLA 1LL9A 4L0LA 4GKUA 3WS5A 3T4TA 3S1YA 1YM1A 2JCHA 4RQ9A 1OTAA 3L9KA 4R1GA 4HJ3A 2E8IA 4PKYG 2CMNA 4KUKA 3HVFA 1ES2A 3MKFA 5M18A 1MPLA 4MBFA 3IHAA 1YSPA 1P9WA 3T4QA 5JYPA 1NYYA 1ZKJA 3VP2A 1JNUA 1ESIA 4LCLA 4CPKA 4WYYA 2YKHA 4BL2A 1TDLA 3GV9A 2WKEA 2ZD8A 1N9OA 1GCEA 4LRXC 4XT2B 5K5BA 4R38A 2ZMVA 5AJGA 2PYPA 1S4SA 3VSKA 1YPRA 1BLHA 2Y91A 4X69A 3H7WA 2BASA 4E3NA 5DVAA 3NCKA 2H0TA 4LFUA 4I39A 4EESA 3CI6A 2K2NA 4IJGA 5J4EA 2PU2A 2V8CA 5HW3A 1CI9A 1VB6A 1PFLA 1W63M 1VEUA 4R6LA 4HH3A 1DRMA 5J7EA 1GHMA 2WGIA 2HGVA 3D72A 4DE0A 3IXGA 4M4XA 3F1NA 5DTTA 3LYXA 3T1XA 3G35A 3IXHA 1ODVA 5IT5A 2ZC6B 2HZ5A 2JN7A 3T4SA 4ZJ1A 1JWVA 3EEAA 3FZCA 4HIAA 2LB9A 1O07A 1Z09A 1LL8A 4XXRA 3IBJA 4JGOA 1AWIA 1VETB 5U47A 5D3OA 1X0OA 4S2KA 3MS6A 4WMCD 5HZHA 1LSXA 3GR2A 4KZ4A 5EFWA 3MQOA 3H82A 2M1CA 3HLCA 4OPYA 1K4EA 4N9KA 2WADA 1FQGA 3QP2A 1K6RA 5JYOA 2EFXA 2HJEA 3E4QA 3OBFA 5AQ9A 1A0KA 2GZAA 1PRQA 1M40A 2L4RA 3OPLA 3JPUA 3R7WB 3P7NA 5EPHA 4N1XA 3TG9A 2P7JA 1YLYA 4S2NA 2NUTC 3VOZA 3UB9A 4HY8A 3UE6A 2QWSA 1N9BA 4BD0A 3AGEA 3DTMA 4HBTA 1FSWA 1RGZA 1MBLA 2Y2MA 5FA7A 3ULFA 5EM1A 4UEYA 1CF0A 3R4KA 2HDUA 3DTKA 2XH9A 4RYEA 2VEAA 5DJTA 5TBMB 1IKIA 4CJNA 3KYZA 4UA7A 5EECA 3MXQA 3C38A 1YT4A 3MQ0A 4Q0HA 1CEGA 1OPXA 3W2ZA 4EUZA 4PM5A 2PR6A 3NECA 1P9RA 4LV0A 1ERMA 3HCYA 5MC7A 1PNEA 4X56A 3MZEA 1C3BA 1E25A 3Q7VB 1Q2QA 1XX2A 4GDBA 3DTIA 2D02A 3G34A 3ZDJA 2VV7A 5EUAA 1HZOA 4BBVA 3P09A 4QY6A 3F1OA 3MKEA 4GHIB 1P0ZA 2PR5A 1TF1A 1UWPX 4RA7A 5HDSA 2ZLYA 2O9CA 1KVMA 1T1CA 5CGXA 4QY5A 5E2HA 3QP8A 4E3KA 4UAAA 1V9YA 2HDQA 2GJ3A 4GJ4A 4F94A 3HLEA 5IS1A 2E8JA 1S6RA 3NDEA 3UO9A 3CMZA 2K7SA 3BFGA 3M6BA 5CERA 2VGJA 4GS9A 4Y0UA 2Q9MA 3CJMA 5GLCA 5FQJA 4R3BA 1ONHA 3WS4A 1SKOB 2WZZA 2QHKA 3RH8B 1XFNA 4OLDA 1XXMA 3RTYA 2QJ5A 4HH2A 3PAEA 1EWZA 2QMIA 2ZMFA 3TJZC 4FD8A 3CPTB 1S4RA 1YLWA 4JGRA 2JKTI 5CEDA 5HX9A 2Y2JA 4WZ5C 3HLDA 3V67A 4GB7A 4OOLA 3UDIA 2J9OA 2ZM2A 5CHMA 4P85A 3BWLA 3PYPA 4QB8A 3O88A 4LRYC 1KOUA 1XP4A 1GSWA 4NG2A 1IYSA 3N4IA 1CJFA 4Y0OA 1MC0A 3ZG9B 1T18A 2X01A 3MFXA 4JGQA 4N92A 1ZG4A 2JBFA 4U0XA 2EXBA 4I3IA 4MBHA 4ZRRA 2V0UA 3D3OA 3LR4A 1GSVA 2A2LA 4E3JA 5FQKA 3IXBA 3T1QB 5EOEA 5EVIA 5FATA 2ACGA 4JF4A 4GNUA 3GSGA 1FR1A 1LHYA 2QPNA 5LBRA 4N9LA 1XJ6A 1DJBA 5HWTA 4DKIA 1CQAA 2PU4A 3BW6A 2DNSA 4MEZA 3C8CA 2V2FF 2XRNA 2EXAA 3MMHA 2VV6A 2Y2QA 2IWCA 3BEBA 1LSVA 4WN5A 3GECA 3N6IA 1W63Q 5DJUA 2QJ7A 2WAFA 2QYBA 2W0NA 4OQGA 1PWCA 1CEFA 4GD8A 2C5WB 4Y3IA 5KIZA 4L9GA 2BTFP 5IU1A 1W8QA 4NXFA 4P0MA 1ES4A 1YSQA 3S7QA 5A8BA 1HLUP 4MMNA 4QJGA 5F83A 2KLIA 1GA0A 4RVAA 5M1AA 5GL9A 4YWZA 5TJJA 3O86A 2BLSA 5I5LA 3C4OA 3OZHA 2GX5A 4EQ1A 5F68A 5FASA 1W5DA 1WYBA 4CLCE 4MN5A 4ARZB 1PI5A 1BUEA 4E6WA 4S2NC 4ZAMA 1SZVA 5DKKA 4I5SA 4UQIM 5FDSA 1STZA 3L7HA 3MFDA 5HL1A 2HDSA 1MXOA 2A24A 3F1PA 1K56D 1YAXA 3F1OB 3PR6A 2W3EA 4BENA 3OPRA 3IHBA 1FCOA 4DE1A 2EX6A 4DXBA 3PTEA 3GDIA 1BLSA 3ZFZA 3H82B 4DJ3A 2V20A 2JKTM 5GHZA 2IWDA 1K54C 3S4XA 2B02A 5FQIA 1AXBA 4OPZA 2JKFA 3CUEA 4E04A 1BZAA 3G32A 3TRCA 1EW0A 2YKFA 4HJ4A 1H5XA 1NY0A 4BBTA 5CGWA 5E2GA 4LGWA 1U60A 1S1YA 3TSGA 3QP6A 4JKTA 2DMWA 3IWOA 4OOYA 1PZPA 1JTDA 4KENB 1XGJA 3HLWA 4JF5A 3F1NB 5CX7A 3QP4A 2PBYA 2JC7A 4WBGA 5KZHA 2P9VA 4FUWA 1HVBA 2W27A 4WMCA 5DF8A 2WAEA 4C75A 4BWIA 5DTKA 1G68A 3LCEA 3T1SA 1F98A 3F1PB 4HEFA 4S2MA 5HD5A 3OCNA 1RP5A 4B4XA 2HP6A 4EXOA 2O0YA 5M19A 3BM6A 4BL3A 1PWGA 3G4PA 3WS0A 5FI7A 1FR6A 4PHTA 3A0SA 4K91A 4DDSA 3ZCZA 2M7UA 1XFQA 4R3JA 3WS1A 3V3RA 2V1AA 3WWXA 2EWVA 4Y15A 1MKIA 1OT9A 4Y17A 3VP0A 1L3LA 3KX0X 2WZXA 5HFOA 4B9OA 5TBMA 1VEUB 3KSFA 3NJAA 1L0EA 4KZ3A 3OPHA 2W1RA 3A3DA 3BY8A 1S1ZA 4ZBEA 3IQAA 4RX3A 4C6YA 3HLGA 3UDXA 1NZUA 3MZFA 3KSGA 2W3HA 2PD8A 3VOYA 3NOTC 1H8YA 3ZG0A 2HV1A 5TR7A 1NJ4A 4IVKA 1LLBA 4HP9A 4BD1A 2KX6A 3EQVA 5HDDA 1K54A 1IFQA 4GS9B 4KQOA 5A92A 2XK1A 3FKVA 2VKSA 1SHVA 1OTEA 3Q7ZA 4KQRA 2HP9A 5IHVA 4Q0IA 1T19A 1Y28A 2XLNA 3BLSA 1IOUA 3SS3A 2Q0OA 2HPBA 5F69A 4OOMA 1VQQA 1E4DA 5HSQA 1OJ5A 1JVJA 3NDGA 2Y2KA 3N8RA 1IKGA 3DAVA 2V1ZA 2J9PA 4IHQA 2QKPA 4H6JB 4OH0A 4JF6A 4E3IA 5G4ZA 3S7PA 3LI8A 4P87A 4DE3A 2XR0A 4FOFA 2Z2MB 4EETB 1XKZA 3DTEA 3LEQA 5CHUA 1K6SA 2ZC7A 5GHXA 4OQHA 4B4ZA 3LY3A 4P6BA 5FQMA 2OWJA 3MQQA 5DF7A 1XGIA 1ZG6A 2JE5A 1HTZA 2XD1A 2W3GA 3MXRA 5FL3A 3O5YA 2MJ6A 1YMXA 3QP5A 1IELA 4EQIA 2HF6A 3IF6A 2A49A 4NK3A 4R0QA 1YLJA 4LPZA 2G2WA 2W3DA 1OT6A 3RXWA 3FG8A 4KZ9A 3BQAA 1Q2PA 3HREA 3E2LA 2Y59A 3VP4A 1IEMA 2ZQDA 3P01A 4G3VA 3E2KA 3B33A 3PBQA 3VFFA 1HD8A 2ZBBA 4D60A 4GW9A 2FZ0A 3HUNA 4DRTA 3ZGAB 3NIAA 5EVEA 5E43A 4MNRA 3CAXA 3KYEA 4GDNA 4XT2A 3VOLA 4JXWA 1NWZA 3G2ZA 3FC7A 1ES5A 2Y2LA 1D06A 4KQDA 3WRTA 3EGXC 1GHIA 3IH8A 5GHYA 5FAOA 2M7VA 1TS8A 1I5QA 2VGLS 2HDRA 3NC8A 2G2UA 2XA7S 2A3UA 4K08A 3MXSA 3K3DA 1NRFA 2EX9A 3BECA 5CECA 5CRFA 3UB8A 3U4LP 5F1GA 1QMEA 1LI9A 4U0TA 2FFYA 2J3TC 1VETA 4KZ5A 1D1JA 5EVIB 2O99A 3KSIA 4R4SA 2V8FA 3CUEC 3V3SA 2J3TD 4G3WA 4S2PA 3LUQA 3PBRA 1RGYA 1VHMA 4II7A 4EUVA 4HP4A 4LV3A 1Y4OA 3TOIA 4I3JA 1IYPA 2PHYA 4UQIS 3QNCA 3A3FA 3C30A 4H8RA 4Y0TA 2X02A 2WK0A 3NY4A 4YFMA 2ZQCA 2KOIA 5CTMA 4S2JA 4E3LA 4MDZA 2Y2GA 4GCZA 1BULA 2UV0E 2L0WA 4WZ4A 1TS0A 4O8GA 2PD7A 4KZ6A 1QMFA 1K56A 1NLYA 1I2WA 4WEJA 2RCXA
chains in the Genus database with same CATH topology
2IWBA 4BENA 1TEMA 2Y2PA 3I7JA 2H10A 3RJUA 2P9VB 3VSKA 3ZNYA 4S2LA 3OPRA 3IHBA 1FCOA 4JXGA 4DE1A 2EX6A 1S0WA 1BLHA 2Y91A 4DXBA 4X69A 3W4QA 4WEKA 3WS2A 4E3NA 3G30A 4EBPA 1XA7A 4EV4A 4K0XA 5DVAA 3PTEA 3NCKA 1BLSA 2H0TA 1GHPA 3SOIA 3ZFZA 1EROA 2V20A 5GHZA 3BFEA 2IWDA 2OSUA 4WZ5A 1FCMA 1K54C 2P74A 3S4XA 2Q9NA 1YLZA 3OC2A 3UPPA 2PU2A 5FQIA 1AXBA 4IBRA 5HW3A 1CI9A 3IWQA 4OPZA 3IXDA 2XEPA 5CXWA 3UE1A 4Y7PA 4LENA 1BZAA 3G32A 4FH2A 1G6AA 1SCWA 3LEZA 3UY6A 1H5XA 1GHMA 2WGIA 1NY0A 2DRWA 4X68A 2ZQ8A 5CGWA 5E2GA 4DE0A 1SDNA 3BYDA 4UA9A 2Z2LB 3IXGA 3IF6B 5A90A 3HBRA 5DTTA 1U60A 5A91A 2XFSA 3TSGA 5DTSA 4JKTA 4LV1A 3IWOA 3G35A 3IXHA 4OOYA 1PZPA 1JWPA 2XDMA 1JTDA 2ZC6B 4ZJ1A 1ONGA 4KENB 1XGJA 1JWVA 3HLWA 4JF5A 4BLMA 1KE3A 2PBYA 1K57A 3C5AA 3NBLA 3LO7A 3FZCA 1CK3A 5EOOA 1PI4A 2JC7A 3PBTA 1O07A 5L2FA 1DJAA 1FSYA 2FFFB 4WBGA 4XXRA 5FAPA 5KZHA 2P9VA 1HVBA 4DF6A 5U47A 5G18A 5D3OA 1KGEA 1ERQA 2QZ6A 4WMCA 5DF8A 3CZDA 4S2KA 1WYCA 2I72A 2ZC5B 2WAEA 4WMCD 3UPOA 3ZNTA 4C75A 2Y2IA 3Q82A 5DTKA 1BT5A 1G68A 3LCEA 3GR2A 1L0GA 4KZ4A 3DWKA 3D4FA 4HEFA 4S2MA 4PM7A 2OV5A 3HLCA 3AGFA 4R23A 4DXCA 4S2IA 3OCNA 2CC1A 1K4EA 4OPYA 3LY4A 4LV2A 4N9KA 2WADA 1RP5A 4B4XA 2HP6A 4EBNA 1FQGA 5M19A 3BM6A 4BL3A 1MWTA 1PWGA 2ZC3B 1K6RA 3G4PA 3PBOA 3WS0A 5JYOA 2EFXA 5FI7A 1FR6A 1W8YA 4K91A 4DDSA 3ZCZA 4JBFA 1KGFA 4R3JA 2XD5A 5AQ9A 1EI5A 3BRMA 3WS1A 2C6WB 1M40A 3JYIA 3V3RA 4KG6A 3OPLA 4LCMA 4PMAA 3QHYA 3WWXA 3N7WA 5EPHA 3ZG5A 4B88A 1MKIA 4FH4A 4N1XA 3VP0A 3TG9A 4HBUA 2UWXA 3RXXA 1YLYA 5HARA 2WZXA 5HFOA 3IF5A 4OPRA 1TVFA 4OQIA 2WUQA 5CTNA 4S2NA 1ZC2A 3ZHHA 1ALQA 3VOZA 1KVLA 1L0EA 1K55A 4KZ3A 3OPHA 3GTCA 1N9BA 3GMWA 4KZBA 4BD0A 3AGEA 1OMEA 3A3DA 3DTMA 3S22A 4D2OA 3IWIA 4HBTA 2WGWB 4FCFA 1FSWA 4ZBEA 2Y2OA 1RGZA 2ZQAA 1MBLA 2Y2MA 3IQAA 4MBKA 5FA7A 4ZTKA 3PBNA 1L0FA 4M3KA 4RX3A 4QHCA 3HL9A 2Y55A 1PIOA 4NETA 4C6YA 2XF3A 4ZJ3A 1BLPA 3HLGA 2WYXA 3UDXA 1NZUA 3MZFA 1Z6FA 2HDUA 2XH9A 4RYEA 5EE8A 4UA6A 3VOYA 4BJPA 1IKIA 1H8YA 4CJNA 4UA7A 3ZG0A 5EECA 3BLMA 4UHUA 1YT4A 4JXVA 3IF6C 1NJ4A 5TR7A 3ITBA 4E3OA 2R9XA 2R9WA 1W79A 1CEGA 1IYQA 4EUZA 3G31A 4K0WA 4IVKA 4PM5A 3W4OA 1LLBA 3A3JA 3VSLA 4LV0A 4BD1A 1ERMA 4OONA 2ZM8A 3EQVA 1K38A 1K54A 5HAIA 2RL3A 3C4PA 4KQOA 4X56A 3V39A 2WGVA 3MZEA 1C3BA 4X6TA 3G2YA 1E25A 1DY6A 5A92A 3GVBA 2XK1A 4ZDXA 1IYOA 2H5SA 3FKVA 3Q7VB 1Q2QA 1XX2A 5F82A 3SH9A 4GDBA 1SHVA 5EVIC 3G34A 4BQMA 3ZDJA 1XPBA 3Q7ZA 4KQRA 2OLUA 4PPRA 1HZOA 4ID4A 4OVDA 5EUAA 5F1FA 2HP9A 2DCFA 3P09A 4OPQA 1SDEA 4QY6A 5IHVA 3P98A 1L0DA 3MKEA 1YQSA 4KQQA 4O7DA 1M6KA 4IVIA 2XLNA 3W8KA 3BLSA 5GLBA 3M6HA 5I94A 2ZC4B 4DDYA 4RA7A 5FQQA 3SS3A 1NXYA 2HPBA 1KE0A 4E3MA 2ZLYA 4OOMA 5FSRA 2Y2HA 4XUXA 1VQQA 1E4DA 1KVMA 1DJCA 3HUMA 1JVJA 3NDGA 4KZAA 5CGXA 2Y2KA 4QY5A 3O87A 1YLTA 3FYZA 3N8RA 5E2HA 1IKGA 5EVLA 4E3KA 2GDNA 2V1ZA 3UPNA 4UAAA 2J9PA 1H8ZA 2HDQA 3A3IA 4F94A 1J9MA 4OH0A 2EFUA 3HLEA 1ES3A 1LI0A 4JF6A 4OP8A 1S6RA 1N4OA 1CI8A 4E3IA 3UE0A 1JWZA 2XFTA 2Y4AA 3NDEA 2XQZA 3CMZA 3BFGA 3FKWA 3UO9A 3VFHA 3MZDA 3M6BA 4P87A 4DE3A 5CERA 2XR0A 2VGJA 3VP3A 2X71A 1E3UA 2Z2MB 4Y0UA 5GLAA 2Q9MA 5HAPA 1K25A 2VGKA 3FWLA 3CJMA 4PM6A 3UE3A 5GLCA 3DWZA 5FQJA 4R3BA 1XKZA 5AQ7A 1ONHA 1VM1A 3SH7A 3WS4A 4OKPA 2WZZA 1WE4A 5CHUA 1K6SA 2ZC7A 5GHXA 4OQHA 4B4ZA 5CEBA 2ZQ9A 3EQUA 3LY3A 3QNBA 3M2KA 4P6BA 4R4RA 4N1HA 3FV7A 5FQMA 4OLDA 2Y2NA 1XXMA 3M2JA 1PWDA 2OLVA 4OLGA 5BOHA 1TDGA 3SH8A 5DF7A 4OQ0A 3PAEA 1XGIA 1ZG6A 2J7VA 1EWZA 2JE5A 3IH9A 4KG2A 2HP5A 1MWRA 1HTZA 2XD1A 2QMIA 3VP1A 5TFQA 5KMWA 3MXRA 4FD8A 1I2SA 3O3VA 5DF9A 3ISGA 1YLWA 1YMXA 2EX2A 2EX8A 5CEDA 1IELA 4EQIA 3IF6A 3NI9A 2A49A 1PYYA 4WM9A 2Y2JA 5HX9A 4WZ5C 3HLDA 4GB7A 4NK3A 4OOLA 4R0QA 3UDIA 2J9OA 3SS4A 1YLJA 2ZM2A 5CHMA 1MY8A 2G2WA 4P85A 3C7UA 1PW1A 4S2OA 2ZQ7A 4QB8A 3O88A 4EWFA 1XP4A 3BFDA 1IYSA 3N4IA 3SS5A 4Y0OA 3RXWA 4KZ9A 3VMAA 3ZG9B 1W7FA 1E3UD 3Q07A 4MLLA 5FI2A 3ZG8B 4KZ8A 2X01A 1Q2PA 3HREA 3E2LA 2Y59A 4N92A 1K55C 1ZG4A 2JBFA 4U0XA 3VP4A 4KZ7A 2EXBA 1JTGA 4MBHA 1IEMA 2ZQDA 2WKHA 1GA9A 3E2KA 3PBQA 4E3JA 5FQKA 3VFFA 1HD8A 5CGSA 3IXBA 3HUNA 4XUZA 5EOEA 2ZMAA 5EVIA 4DRTA 2ZJ9A 5FATA 5A93A 1KGGA 1K4FA 3ZGAB 4GN2A 3NIAA 3UDFA 1Y54A 1BSGA 4JF4A 4GNUA 1LL5A 3GSGA 4RX2A 4KG5A 4IEDA 5E43A 4MNRA 4GDNA 1FR1A 1PW8A 1LHYA 2QPNA 4JXWA 4DE2A 3V5MA 3DW0A 3G2ZA 4N9LA 1DJBA 4U3TA 3HUOA 1ES5A 4DKIA 2Y2LA 1NZOA 4PM8A 3WRTA 3GRJA 2PU4A 1GHIA 3IH8A 2DNSA 4X53A 5GHYA 4MEZA 3PBSA 3Q81A 5FAOA 5HAQA 2V2FF 4C3QA 1I5QA 4Q8IA 3BFCA 3UN7A 2EXAA 2HDRA 3NC8A 4EBLA 2G2UA 2Y2QA 2A3UA 2IWCA 2J8YA 3ITAA 3MXSA 4OP5A 5FQ9A 3BEBA 4X55A 3AGDA 1NRFA 1FOFA 2EX9A 1YMSA 3BECA 5CECA 5FDHA 3N6IA 4HESA 5CRFA 2WAFA 5F1GA 3OPPA 1YLPA 1QMEA 1LI9A 4OQGA 1PWCA 2FFYA 1L2SA 4U0TA 1CEFA 1NYMA 4GD8A 2C5WB 3N8LA 4KZ5A 4QU3A 5CHJA 1K57C 5E2EA 5J8XA 2B5RA 3MBZA 1KDWA 5EVIB 3N8SA 1MWUA 4GZBA 3BFFA 4R4SA 3W4PA 4E6XA 1FCNA 1SKFA 3ZVWA 3ZVTA 3V3SA 4S2PA 5EVID 1W8QA 3HLBA 4YINA 1O7EA 1RGYA 3PBRA 4P0MA 1MWSA 1ES4A 3Q1FA 4JXSA 3WRZA 4JLFA 4JPMA 4IBXA 2WGWA 4LV3A 4QJGA 1RCJA 5F83A 3CG5A 3TOIA 2BG1A 1GA0A 3ZG7B 4A5RA 1KE4A 4RVAA 3V50A 5KSCA 3OCLA 1IYPA 1LL9A 3HLFA 4L0LA 3B3XA 3GQZA 4GKUA 3WS5A 3QNCA 5M1AA 3S1YA 5GL9A 3A3FA 1BLCA 4H8RA 3IT9A 1YM1A 4GD6A 3O86A 1ESUA 2BLSA 2JCHA 3C4OA 1PZOA 3OZHA 2X02A 4Y0TA 4FSFA 2WK0A 3A3EA 4R1GA 5FASA 1W5DA 1WYBA 3NY4A 4PM9A 5FI6A 4YFMA 2ZQCA 5KSHA 1BTLA 2E8IA 1PI5A 4WELA 1BUEA 2H0YA 1ES2A 3C7VA 3HVFA 3MKFA 5CTMA 4GOGA 5M18A 1MPLA 3UNWA 2XGNA 4MBFA 4S2NC 4E6WA 3IHAA 4S2JA 4ZAMA 4QD4A 4E3LA 4Z9QA 1KDSA 2Y2GA 3Q7VA 1BULA 1XA1A 2WKIA 5JYPA 1NYYA 1ZKJA 3VP2A 1ESIA 4LCLA 4CPKA 3MFDA 4WZ4A 5HL1A 4KZ6A 2HDSA 5GLDA 4WYYA 5E2FA 1QMFA 1K56A 1MXOA 4BL2A 1TDLA 3GV9A 2WKEA 2ZM0A 5AQAA 4ZJ2A 1K56D 2ZD8A 5AQBA 1GCEA 5FAQA 1I2WA 3PAGA 4WEJA 2RCXA 5TGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IWB A;  4BEN A;  1TEM A;  2Y2P A;  3I7J A;  2H10 A;  3RJU A;  2P9V B;  3VSK A;  3ZNY A;  4S2L A;  3OPR A;  3IHB A;  1FCO A;  4JXG A;  4DE1 A;  2EX6 A;  1S0W A;  1BLH A;  2Y91 A;  4DXB A;  4X69 A;  3W4Q A;  4WEK A;  3WS2 A;  4E3N A;  3G30 A;  4EBP A;  1XA7 A;  4EV4 A;  4K0X A;  5DVA A;  3PTE A;  3NCK A;  1BLS A;  2H0T A;  1GHP A;  3SOI A;  3ZFZ A;  1ERO A;  2V20 A;  5GHZ A;  3BFE A;  2IWD A;  2OSU A;  4WZ5 A;  1FCM A;  1K54 C;  2P74 A;  3S4X A;  2Q9N A;  1YLZ A;  3OC2 A;  3UPP A;  2PU2 A;  5FQI A;  1AXB A;  4IBR A;  5HW3 A;  1CI9 A;  3IWQ A;  4OPZ A;  3IXD A;  2XEP A;  5CXW A;  3UE1 A;  4Y7P A;  4LEN A;  1BZA A;  3G32 A;  4FH2 A;  1G6A A;  1SCW A;  3LEZ A;  3UY6 A;  1H5X A;  1GHM A;  2WGI A;  1NY0 A;  2DRW A;  4X68 A;  2ZQ8 A;  5CGW A;  5E2G A;  4DE0 A;  1SDN A;  3BYD A;  4UA9 A;  2Z2L B;  3IXG A;  3IF6 B;  5A90 A;  3HBR A;  5DTT A;  1U60 A;  5A91 A;  2XFS A;  3TSG A;  5DTS A;  4JKT A;  4LV1 A;  3IWO A;  3G35 A;  3IXH A;  4OOY A;  1PZP A;  1JWP A;  2XDM A;  1JTD A;  2ZC6 B;  4ZJ1 A;  1ONG A;  4KEN B;  1XGJ A;  1JWV A;  3HLW A;  4JF5 A;  4BLM A;  1KE3 A;  2PBY A;  1K57 A;  3C5A A;  3NBL A;  3LO7 A;  3FZC A;  1CK3 A;  5EOO A;  1PI4 A;  2JC7 A;  3PBT A;  1O07 A;  5L2F A;  1DJA A;  1FSY A;  2FFF B;  4WBG A;  4XXR A;  5FAP A;  5KZH A;  2P9V A;  1HVB A;  4DF6 A;  5U47 A;  5G18 A;  5D3O A;  1KGE A;  1ERQ A;  2QZ6 A;  4WMC A;  5DF8 A;  3CZD A;  4S2K A;  1WYC A;  2I72 A;  2ZC5 B;  2WAE A;  4WMC D;  3UPO A;  3ZNT A;  4C75 A;  2Y2I A;  3Q82 A;  5DTK A;  1BT5 A;  1G68 A;  3LCE A;  3GR2 A;  1L0G A;  4KZ4 A;  3DWK A;  3D4F A;  4HEF A;  4S2M A;  4PM7 A;  2OV5 A;  3HLC A;  3AGF A;  4R23 A;  4DXC A;  4S2I A;  3OCN A;  2CC1 A;  1K4E A;  4OPY A;  3LY4 A;  4LV2 A;  4N9K A;  2WAD A;  1RP5 A;  4B4X A;  2HP6 A;  4EBN A;  1FQG A;  5M19 A;  3BM6 A;  4BL3 A;  1MWT A;  1PWG A;  2ZC3 B;  1K6R A;  3G4P A;  3PBO A;  3WS0 A;  5JYO A;  2EFX A;  5FI7 A;  1FR6 A;  1W8Y A;  4K91 A;  4DDS A;  3ZCZ A;  4JBF A;  1KGF A;  4R3J A;  2XD5 A;  5AQ9 A;  1EI5 A;  3BRM A;  3WS1 A;  2C6W B;  1M40 A;  3JYI A;  3V3R A;  4KG6 A;  3OPL A;  4LCM A;  4PMA A;  3QHY A;  3WWX A;  3N7W A;  5EPH A;  3ZG5 A;  4B88 A;  1MKI A;  4FH4 A;  4N1X A;  3VP0 A;  3TG9 A;  4HBU A;  2UWX A;  3RXX A;  1YLY A;  5HAR A;  2WZX A;  5HFO A;  3IF5 A;  4OPR A;  1TVF A;  4OQI A;  2WUQ A;  5CTN A;  4S2N A;  1ZC2 A;  3ZHH A;  1ALQ A;  3VOZ A;  1KVL A;  1L0E A;  1K55 A;  4KZ3 A;  3OPH A;  3GTC A;  1N9B A;  3GMW A;  4KZB A;  4BD0 A;  3AGE A;  1OME A;  3A3D A;  3DTM A;  3S22 A;  4D2O A;  3IWI A;  4HBT A;  2WGW B;  4FCF A;  1FSW A;  4ZBE A;  2Y2O A;  1RGZ A;  2ZQA A;  1MBL A;  2Y2M A;  3IQA A;  4MBK A;  5FA7 A;  4ZTK A;  3PBN A;  1L0F A;  4M3K A;  4RX3 A;  4QHC A;  3HL9 A;  2Y55 A;  1PIO A;  4NET A;  4C6Y A;  2XF3 A;  4ZJ3 A;  1BLP A;  3HLG A;  2WYX A;  3UDX A;  1NZU A;  3MZF A;  1Z6F A;  2HDU A;  2XH9 A;  4RYE A;  5EE8 A;  4UA6 A;  3VOY A;  4BJP A;  1IKI A;  1H8Y A;  4CJN A;  4UA7 A;  3ZG0 A;  5EEC A;  3BLM A;  4UHU A;  1YT4 A;  4JXV A;  3IF6 C;  1NJ4 A;  5TR7 A;  3ITB A;  4E3O A;  2R9X A;  2R9W A;  1W79 A;  1CEG A;  1IYQ A;  4EUZ A;  3G31 A;  4K0W A;  4IVK A;  4PM5 A;  3W4O A;  1LLB A;  3A3J A;  3VSL A;  4LV0 A;  4BD1 A;  1ERM A;  4OON A;  2ZM8 A;  3EQV A;  1K38 A;  1K54 A;  5HAI A;  2RL3 A;  3C4P A;  4KQO A;  4X56 A;  3V39 A;  2WGV A;  3MZE A;  1C3B A;  4X6T A;  3G2Y A;  1E25 A;  1DY6 A;  5A92 A;  3GVB A;  2XK1 A;  4ZDX A;  1IYO A;  2H5S A;  3FKV A;  3Q7V B;  1Q2Q A;  1XX2 A;  5F82 A;  3SH9 A;  4GDB A;  1SHV A;  5EVI C;  3G34 A;  4BQM A;  3ZDJ A;  1XPB A;  3Q7Z A;  4KQR A;  2OLU A;  4PPR A;  1HZO A;  4ID4 A;  4OVD A;  5EUA A;  5F1F A;  2HP9 A;  2DCF A;  3P09 A;  4OPQ A;  1SDE A;  4QY6 A;  5IHV A;  3P98 A;  1L0D A;  3MKE A;  1YQS A;  4KQQ A;  4O7D A;  1M6K A;  4IVI A;  2XLN A;  3W8K A;  3BLS A;  5GLB A;  3M6H A;  5I94 A;  2ZC4 B;  4DDY A;  4RA7 A;  5FQQ A;  3SS3 A;  1NXY A;  2HPB A;  1KE0 A;  4E3M A;  2ZLY A;  4OOM A;  5FSR A;  2Y2H A;  4XUX A;  1VQQ A;  1E4D A;  1KVM A;  1DJC A;  3HUM A;  1JVJ A;  3NDG A;  4KZA A;  5CGX A;  2Y2K A;  4QY5 A;  3O87 A;  1YLT A;  3FYZ A;  3N8R A;  5E2H A;  1IKG A;  5EVL A;  4E3K A;  2GDN A;  2V1Z A;  3UPN A;  4UAA A;  2J9P A;  1H8Z A;  2HDQ A;  3A3I A;  4F94 A;  1J9M A;  4OH0 A;  2EFU A;  3HLE A;  1ES3 A;  1LI0 A;  4JF6 A;  4OP8 A;  1S6R A;  1N4O A;  1CI8 A;  4E3I A;  3UE0 A;  1JWZ A;  2XFT A;  2Y4A A;  3NDE A;  2XQZ A;  3CMZ A;  3BFG A;  3FKW A;  3UO9 A;  3VFH A;  3MZD A;  3M6B A;  4P87 A;  4DE3 A;  5CER A;  2XR0 A;  2VGJ A;  3VP3 A;  2X71 A;  1E3U A;  2Z2M B;  4Y0U A;  5GLA A;  2Q9M A;  5HAP A;  1K25 A;  2VGK A;  3FWL A;  3CJM A;  4PM6 A;  3UE3 A;  5GLC A;  3DWZ A;  5FQJ A;  4R3B A;  1XKZ A;  5AQ7 A;  1ONH A;  1VM1 A;  3SH7 A;  3WS4 A;  4OKP A;  2WZZ A;  1WE4 A;  5CHU A;  1K6S A;  2ZC7 A;  5GHX A;  4OQH A;  4B4Z A;  5CEB A;  2ZQ9 A;  3EQU A;  3LY3 A;  3QNB A;  3M2K A;  4P6B A;  4R4R A;  4N1H A;  3FV7 A;  5FQM A;  4OLD A;  2Y2N A;  1XXM A;  3M2J A;  1PWD A;  2OLV A;  4OLG A;  5BOH A;  1TDG A;  3SH8 A;  5DF7 A;  4OQ0 A;  3PAE A;  1XGI A;  1ZG6 A;  2J7V A;  1EWZ A;  2JE5 A;  3IH9 A;  4KG2 A;  2HP5 A;  1MWR A;  1HTZ A;  2XD1 A;  2QMI A;  3VP1 A;  5TFQ A;  5KMW A;  3MXR A;  4FD8 A;  1I2S A;  3O3V A;  5DF9 A;  3ISG A;  1YLW A;  1YMX A;  2EX2 A;  2EX8 A;  5CED A;  1IEL A;  4EQI A;  3IF6 A;  3NI9 A;  2A49 A;  1PYY A;  4WM9 A;  2Y2J A;  5HX9 A;  4WZ5 C;  3HLD A;  4GB7 A;  4NK3 A;  4OOL A;  4R0Q A;  3UDI A;  2J9O A;  3SS4 A;  1YLJ A;  2ZM2 A;  5CHM A;  1MY8 A;  2G2W A;  4P85 A;  3C7U A;  1PW1 A;  4S2O A;  2ZQ7 A;  4QB8 A;  3O88 A;  4EWF A;  1XP4 A;  3BFD A;  1IYS A;  3N4I A;  3SS5 A;  4Y0O A;  3RXW A;  4KZ9 A;  3VMA A;  3ZG9 B;  1W7F A;  1E3U D;  3Q07 A;  4MLL A;  5FI2 A;  3ZG8 B;  4KZ8 A;  2X01 A;  1Q2P A;  3HRE A;  3E2L A;  2Y59 A;  4N92 A;  1K55 C;  1ZG4 A;  2JBF A;  4U0X A;  3VP4 A;  4KZ7 A;  2EXB A;  1JTG A;  4MBH A;  1IEM A;  2ZQD A;  2WKH A;  1GA9 A;  3E2K A;  3PBQ A;  4E3J A;  5FQK A;  3VFF A;  1HD8 A;  5CGS A;  3IXB A;  3HUN A;  4XUZ A;  5EOE A;  2ZMA A;  5EVI A;  4DRT A;  2ZJ9 A;  5FAT A;  5A93 A;  1KGG A;  1K4F A;  3ZGA B;  4GN2 A;  3NIA A;  3UDF A;  1Y54 A;  1BSG A;  4JF4 A;  4GNU A;  1LL5 A;  3GSG A;  4RX2 A;  4KG5 A;  4IED A;  5E43 A;  4MNR A;  4GDN A;  1FR1 A;  1PW8 A;  1LHY A;  2QPN A;  4JXW A;  4DE2 A;  3V5M A;  3DW0 A;  3G2Z A;  4N9L A;  1DJB A;  4U3T A;  3HUO A;  1ES5 A;  4DKI A;  2Y2L A;  1NZO A;  4PM8 A;  3WRT A;  3GRJ A;  2PU4 A;  1GHI A;  3IH8 A;  2DNS A;  4X53 A;  5GHY A;  4MEZ A;  3PBS A;  3Q81 A;  5FAO A;  5HAQ A;  2V2F F;  4C3Q A;  1I5Q A;  4Q8I A;  3BFC A;  3UN7 A;  2EXA A;  2HDR A;  3NC8 A;  4EBL A;  2G2U A;  2Y2Q A;  2A3U A;  2IWC A;  2J8Y A;  3ITA A;  3MXS A;  4OP5 A;  5FQ9 A;  3BEB A;  4X55 A;  3AGD A;  1NRF A;  1FOF A;  2EX9 A;  1YMS A;  3BEC A;  5CEC A;  5FDH A;  3N6I A;  4HES A;  5CRF A;  2WAF A;  5F1G A;  3OPP A;  1YLP A;  1QME A;  1LI9 A;  4OQG A;  1PWC A;  2FFY A;  1L2S A;  4U0T A;  1CEF A;  1NYM A;  4GD8 A;  2C5W B;  3N8L A;  4KZ5 A;  4QU3 A;  5CHJ A;  1K57 C;  5E2E A;  5J8X A;  2B5R A;  3MBZ A;  1KDW A;  5EVI B;  3N8S A;  1MWU A;  4GZB A;  3BFF A;  4R4S A;  3W4P A;  4E6X A;  1FCN A;  1SKF A;  3ZVW A;  3ZVT A;  3V3S A;  4S2P A;  5EVI D;  1W8Q A;  3HLB A;  4YIN A;  1O7E A;  1RGY A;  3PBR A;  4P0M A;  1MWS A;  1ES4 A;  3Q1F A;  4JXS A;  3WRZ A;  4JLF A;  4JPM A;  4IBX A;  2WGW A;  4LV3 A;  4QJG A;  1RCJ A;  5F83 A;  3CG5 A;  3TOI A;  2BG1 A;  1GA0 A;  3ZG7 B;  4A5R A;  1KE4 A;  4RVA A;  3V50 A;  5KSC A;  3OCL A;  1IYP A;  1LL9 A;  3HLF A;  4L0L A;  3B3X A;  3GQZ A;  4GKU A;  3WS5 A;  3QNC A;  5M1A A;  3S1Y A;  5GL9 A;  3A3F A;  1BLC A;  4H8R A;  3IT9 A;  1YM1 A;  4GD6 A;  3O86 A;  1ESU A;  2BLS A;  2JCH A;  3C4O A;  1PZO A;  3OZH A;  2X02 A;  4Y0T A;  4FSF A;  2WK0 A;  3A3E A;  4R1G A;  5FAS A;  1W5D A;  1WYB A;  3NY4 A;  4PM9 A;  5FI6 A;  4YFM A;  2ZQC A;  5KSH A;  1BTL A;  2E8I A;  1PI5 A;  4WEL A;  1BUE A;  2H0Y A;  1ES2 A;  3C7V A;  3HVF A;  3MKF A;  5CTM A;  4GOG A;  5M18 A;  1MPL A;  3UNW A;  2XGN A;  4MBF A;  4S2N C;  4E6W A;  3IHA A;  4S2J A;  4ZAM A;  4QD4 A;  4E3L A;  4Z9Q A;  1KDS A;  2Y2G A;  3Q7V A;  1BUL A;  1XA1 A;  2WKI A;  5JYP A;  1NYY A;  1ZKJ A;  3VP2 A;  1ESI A;  4LCL A;  4CPK A;  3MFD A;  4WZ4 A;  5HL1 A;  4KZ6 A;  2HDS A;  5GLD A;  4WYY A;  5E2F A;  1QMF A;  1K56 A;  1MXO A;  4BL2 A;  1TDL A;  3GV9 A;  2WKE A;  2ZM0 A;  5AQA A;  4ZJ2 A;  1K56 D;  2ZD8 A;  5AQB A;  1GCE A;  5FAQ A;  1I2W A;  3PAG A;  4WEJ A;  2RCX A;  5TGF A; 
#chains in the Genus database with same CATH topology
 2IWB A;  2P04 A;  1TEM A;  2Y2P A;  3LR3 A;  2H10 A;  3RJU A;  2P9V B;  3ZNY A;  4S2L A;  2W3F A;  3W4Q A;  3WS2 A;  4EBP A;  4HQA A;  1XA7 A;  4EV4 A;  4K0X A;  1GHP A;  3MJQ A;  3SOI A;  3HJK A;  1ERO A;  1K0K A;  3BFE A;  2V0W A;  1N9L A;  4HJ6 A;  1YLZ A;  2V9A A;  3OC2 A;  4NEE D;  4IBR A;  3IWQ A;  2XEP A;  3UE1 A;  3LIB A;  4Y7P A;  4LEN A;  2J3W A;  4IUH A;  3LEZ A;  3UY6 A;  4X68 A;  2ZQ8 A;  1SDN A;  3BYD A;  5L10 A;  2Z2L B;  3IF6 B;  3DBA A;  5A90 A;  1OJG A;  3S7N A;  3CWF A;  3ZYT A;  2XDM A;  1ONG A;  1KE3 A;  2FH5 A;  3NBL A;  1K57 A;  3C5A A;  5L07 A;  3LO7 A;  5EOO A;  3NHQ A;  5L2F A;  1DJA A;  5FAP A;  3SW1 A;  5G18 A;  1ERQ A;  3EGD C;  3CZD A;  4AFI A;  3QP1 A;  3ZNT A;  3Q82 A;  2A24 B;  1BT5 A;  3IX8 A;  5HWW A;  3MR0 A;  3D4F A;  4ETZ A;  4S2I A;  3LY4 A;  4LV2 A;  4EBN A;  1MWT A;  3PBO A;  1ZHH B;  1W8Y A;  4ARZ A;  2GNX A;  4I3A A;  5HWV A;  4L9F A;  2C6W B;  4HOI A;  4KG6 A;  4PMA A;  4LCM A;  1T1B A;  2VA0 A;  3ZG5 A;  4B88 A;  2VJW A;  2UWX A;  3RXX A;  5HAR A;  5HL6 A;  1TVF A;  1F5M A;  2WUQ A;  3UME A;  1ZC2 A;  3ZHH A;  1KVL A;  3MSH A;  3VE4 A;  4O01 A;  1OME A;  1UWN X;  3S22 A;  2WGW B;  4FCF A;  4NXE A;  3IX3 A;  4X1M A;  4ZTK A;  3PBN A;  1L0F A;  3HL9 A;  4NET A;  2XF3 A;  1BLP A;  1UGU A;  2WYX A;  1Z6F A;  3UMD A;  4ME4 A;  5EE8 A;  2PAV P;  2EWW A;  4BJP A;  3LR5 A;  2ZOI A;  3T4L A;  3BLM A;  4GHI A;  3IF6 C;  3ITB A;  4E3O A;  2R9X A;  1W79 A;  2H28 A;  2XRO A;  3G31 A;  3E4O A;  2Z6D A;  1NLZ A;  1P97 A;  4OON A;  2ZM8 A;  2LB5 A;  5HAI A;  2WGV A;  3G2Y A;  1DY6 A;  3GVB A;  3SH9 A;  3UB5 P;  4Y13 A;  3LIA A;  4JGP A;  4G3K A;  4QPR A;  5EM0 A;  2OLU A;  3D9Y A;  4ID4 A;  4OVD A;  4PPR A;  5F1F A;  2DCF A;  1SDE A;  1OTD A;  1L0D A;  2JKR I;  1YQS A;  4KQQ A;  1V9Z A;  4MN6 A;  3W8K A;  3M6H A;  5I94 A;  2ZC4 B;  4DDY A;  5FQQ A;  1NXY A;  3OOV A;  1KE0 A;  4E3M A;  3MF0 A;  2Y2H A;  1DJC A;  2JKR M;  3O87 A;  1YLT A;  2GDN A;  3UPN A;  3LFV A;  3A3I A;  1H0M A;  2EFU A;  1ES3 A;  1LI0 A;  3C2W A;  4OP8 A;  3G6O A;  4WL9 A;  3PXP A;  4Q0J A;  3VFH A;  3CHW P;  3FKW A;  3NUL A;  3S7O A;  1DP9 A;  1K25 A;  2B18 A;  2V1B A;  2EA9 A;  5AQ7 A;  4OKP A;  2INW A;  5CEB A;  3EQU A;  2AVX A;  3QNB A;  4N1H A;  3FV7 A;  3NOU C;  4CQH A;  4OQ0 A;  2VX8 A;  3BJN A;  2J7V A;  3U2A A;  2HP5 A;  3LIF A;  1MWR A;  4GLQ A;  3KYQ A;  5TFQ A;  5DF9 A;  1S67 L;  2EX2 A;  4H6J A;  2PRF A;  4YNR A;  3IX4 A;  5F5Y A;  4WF0 A;  3SS4 A;  3C7U A;  2JHE A;  4S2O A;  2ZQ7 A;  4MCW A;  4F3L A;  2O9A A;  1E3U D;  4MLL A;  4KZ8 A;  1H3Q A;  4EW7 A;  1K55 C;  3FPW A;  3BY9 A;  2VV8 A;  4WUJ A;  2ZJ9 A;  4X1L A;  5A93 A;  1K4F A;  3T4O A;  3UDF A;  1XJ4 A;  4KG5 A;  4DE2 A;  4I38 A;  2J80 A;  1FIK A;  1LT0 A;  3DW0 A;  3LGO A;  4U3T A;  3HUO A;  5DFY A;  4X53 A;  3Q81 A;  5HAQ A;  4C3Q A;  4Q8I A;  4WLA A;  3RFB A;  3ITA A;  5HDC A;  2Y79 A;  5FQ9 A;  3JVV A;  1ACF A;  5FDH A;  4HES A;  4EU0 A;  4BMW A;  4QWO A;  1NYM A;  5CHJ A;  4EEP A;  5E2E A;  5J8X A;  2B5R A;  3E4P A;  3FPV A;  3N8S A;  4GZB A;  3W4P A;  1FCN A;  2PDR A;  4DJ2 A;  1OTI A;  3ZVT A;  3HLB A;  4YIN A;  3Q1F A;  4JLF A;  4IBX A;  2ZOH A;  3SZT A;  2XA7 M;  3CG5 A;  4BBU A;  5J3W A;  2WKP A;  1KE4 A;  3V50 A;  3HLF A;  3B3X A;  3GQZ A;  4CLC B;  2Y8H A;  3R7W A;  1BLC A;  4B93 A;  3IT9 A;  4GD6 A;  2G7U A;  1ESU A;  1PZO A;  4FSF A;  3A3E A;  2OAP 1;  4PM9 A;  5FI6 A;  5KSH A;  1BTL A;  1YKD A;  4WEL A;  2H0Y A;  3C7V A;  1MKM A;  4GOG A;  3UNW A;  2XGN A;  3UB6 A;  4QD4 A;  4NXG A;  4Z9Q A;  1KDS A;  3Q7V A;  1XA1 A;  2WKI A;  4LRZ E;  4F3L B;  5G4Y A;  1TD5 A;  5GLD A;  3EOI A;  5E2F A;  1MZU A;  3EEH A;  2ZM0 A;  5AQA A;  4ZJ2 A;  5AQB A;  5FAQ A;  3PAG A;  5TGF A;  3I7J A;  4JXG A;  1S0W A;  1GSX A;  4WEK A;  3G30 A;  4CLC C;  1DP8 A;  4PAU A;  4X25 A;  2OSU A;  4WZ5 A;  1FCM A;  2P74 A;  2Q9N A;  3UPP A;  1LSW A;  2B95 A;  3IXD A;  5FEF A;  5CXW A;  5AVE A;  4FH2 A;  1G6A A;  1SCW A;  3IS2 A;  1OTB A;  2DRW A;  4R70 A;  3KO6 A;  2OWH A;  4UA9 A;  3HBR A;  5A91 A;  2XFS A;  3TE8 A;  1G6O A;  5DTS A;  4LV1 A;  3EWK A;  2JKG A;  1JWP A;  2L1M A;  2W1T B;  4BLM A;  4DN0 A;  1G5U A;  3UB7 A;  1CK3 A;  1PI4 A;  3PBT A;  1FSY A;  5F6A A;  2FFF B;  4DF6 A;  1KGE A;  2QZ6 A;  1WYC A;  2I72 A;  2WKQ A;  2ZC5 B;  3ZQ5 A;  3UPO A;  3K3C A;  2Y2I A;  4NXB A;  1L0G A;  3DWK A;  4YOF A;  4PM7 A;  2OV5 A;  3AGF A;  4R23 A;  4DXC A;  2CC1 A;  5EV0 A;  2VLG A;  3B42 A;  2ZC3 B;  4L9E A;  1T1A A;  4JBF A;  1KGF A;  2XD5 A;  1EI5 A;  3BRM A;  3LR0 A;  3JYI A;  2XSS A;  3QHY A;  3N7W A;  4Z1W A;  4FH4 A;  4HBU A;  3IF5 A;  4OPR A;  4LLO B;  4OQI A;  4R3A A;  5CTN A;  3H9W A;  3E0Y A;  1ALQ A;  3IS2 B;  3A0V A;  1K55 A;  1XJ3 A;  3GTC A;  3GMW A;  4KZB A;  4D2O A;  3IWI A;  2Y2O A;  2ZQA A;  4MBK A;  5FEG A;  4M3K A;  4QHC A;  2Y55 A;  1PIO A;  4ZJ3 A;  4DMZ A;  2OOL A;  2HJ9 C;  4EER A;  2Z6C A;  4UA6 A;  1XJ2 A;  4UHU A;  1NRJ A;  4JXV A;  2R9W A;  1IYQ A;  4K0W A;  3W4O A;  3A3J A;  3VSL A;  4EEU A;  1K38 A;  2RL3 A;  3C4P A;  3V39 A;  4X6T A;  4ZDX A;  2R78 A;  1IYO A;  2H5S A;  4Y2F A;  5F82 A;  3E98 A;  5EVI C;  4ETX A;  4BQM A;  3KSH A;  3TW8 A;  1XPB A;  2K31 A;  1FIL A;  2W1T A;  3BQ8 A;  4OPQ A;  3P98 A;  1TS7 A;  4O7D A;  1J3W A;  1M6K A;  4IVI A;  1F9I A;  5GLB A;  1SKO A;  4P6Z M;  4MN7 A;  4Y5F A;  2KDK A;  2NUP C;  5FSR A;  4XUX A;  4HNB A;  1F2K A;  5HPI A;  3HUM A;  4KZA A;  3FYZ A;  4HI4 A;  5EVL A;  1H8Z A;  4HHD A;  1J9M A;  3ICY A;  3CPT A;  1N4O A;  1CI8 A;  3UE0 A;  1JWZ A;  2XFT A;  2Y4A A;  3T50 A;  2XQZ A;  4PKY A;  3MZD A;  3LI9 A;  3VP3 A;  2X71 A;  1E3U A;  4NKP A;  5GLA A;  5HAP A;  4PM6 A;  2VGK A;  3FWL A;  3UE3 A;  3DWZ A;  3T12 B;  3LID A;  1VM1 A;  3VE3 A;  3SH7 A;  3LIC A;  1G28 A;  1WE4 A;  1BYW A;  2ZQ9 A;  3M2K A;  4R4R A;  2Y2N A;  3M2J A;  1PWD A;  2OLV A;  2D01 A;  4OLG A;  5BOH A;  5L8M A;  1TDG A;  3SH8 A;  3IH9 A;  4KG2 A;  2ZL1 A;  1D7E A;  3VP1 A;  5KMW A;  4KUO A;  1I2S A;  3O3V A;  3ISG A;  1DP6 A;  1H8M A;  2EX8 A;  3NI9 A;  1PYY A;  4WM9 A;  3IBR A;  3K2N A;  1MY8 A;  1S66 L;  1PW1 A;  3T1R A;  4EWF A;  3BFD A;  4P6Z S;  3SS5 A;  3VMA A;  1W7F A;  3Q07 A;  5FI2 A;  3T4K A;  5DFX A;  3ZG8 B;  5C5K A;  2WKR A;  4KZ7 A;  1JTG A;  4O0P A;  2WKH A;  1GA9 A;  2VK3 A;  5CGS A;  4XUZ A;  2ZMA A;  4ESP A;  1KGG A;  4GN2 A;  1Y54 A;  1BSG A;  1LL5 A;  4RX2 A;  2IA2 A;  4IED A;  1TS6 A;  1PW8 A;  3LIE A;  4IUK A;  3V5M A;  2O9B A;  2ZL1 B;  1NZO A;  3B47 A;  4PM8 A;  5HD3 A;  3GRJ A;  3VV4 A;  3HJI A;  3PBS A;  3A0R A;  1WA9 A;  3BFC A;  3UN7 A;  4EBL A;  2PYR A;  2J8Y A;  4OP5 A;  4X55 A;  3AGD A;  5DKL A;  4CLC D;  1FOF A;  1YMS A;  2I9V A;  3OPP A;  1YLP A;  2P08 A;  2PBD P;  2VZW A;  1L2S A;  1N9N A;  3N8L A;  4QU3 A;  1K57 C;  3MBZ A;  5L09 A;  1KDW A;  3NOP C;  3PHY A;  3T4J A;  1MWU A;  2OAQ 1;  2VGL M;  3BFF A;  4E6X A;  1SKF A;  3ZVW A;  3CIT A;  3CLO A;  5EVI D;  1ZTU A;  1O7E A;  3JVU A;  1MWS A;  4JXS A;  3WRZ A;  4JPM A;  2WGW A;  5HPF A;  4FTX A;  1RCJ A;  3OLO A;  5AVF A;  4CLC A;  2PT7 A;  2BG1 A;  3ZG7 B;  4A5R A;  5KSC A;  3H7W B;  3OCL A;  1LL9 A;  4L0L A;  4GKU A;  3WS5 A;  3T4T A;  3S1Y A;  1YM1 A;  2JCH A;  4RQ9 A;  1OTA A;  3L9K A;  4R1G A;  4HJ3 A;  2E8I A;  4PKY G;  2CMN A;  4KUK A;  3HVF A;  1ES2 A;  3MKF A;  5M18 A;  1MPL A;  4MBF A;  3IHA A;  1YSP A;  1P9W A;  3T4Q A;  5JYP A;  1NYY A;  1ZKJ A;  3VP2 A;  1JNU A;  1ESI A;  4LCL A;  4CPK A;  4WYY A;  2YKH A;  4BL2 A;  1TDL A;  3GV9 A;  2WKE A;  2ZD8 A;  1N9O A;  1GCE A;  4LRX C;  4XT2 B;  5K5B A;  4R38 A;  2ZMV A;  5AJG A;  2PYP A;  1S4S A;  3VSK A;  1YPR A;  1BLH A;  2Y91 A;  4X69 A;  3H7W A;  2BAS A;  4E3N A;  5DVA A;  3NCK A;  2H0T A;  4LFU A;  4I39 A;  4EES A;  3CI6 A;  2K2N A;  4IJG A;  5J4E A;  2PU2 A;  2V8C A;  5HW3 A;  1CI9 A;  1VB6 A;  1PFL A;  1W63 M;  1VEU A;  4R6L A;  4HH3 A;  1DRM A;  5J7E A;  1GHM A;  2WGI A;  2HGV A;  3D72 A;  4DE0 A;  3IXG A;  4M4X A;  3F1N A;  5DTT A;  3LYX A;  3T1X A;  3G35 A;  3IXH A;  1ODV A;  5IT5 A;  2ZC6 B;  2HZ5 A;  2JN7 A;  3T4S A;  4ZJ1 A;  1JWV A;  3EEA A;  3FZC A;  4HIA A;  2LB9 A;  1O07 A;  1Z09 A;  1LL8 A;  4XXR A;  3IBJ A;  4JGO A;  1AWI A;  1VET B;  5U47 A;  5D3O A;  1X0O A;  4S2K A;  3MS6 A;  4WMC D;  5HZH A;  1LSX A;  3GR2 A;  4KZ4 A;  5EFW A;  3MQO A;  3H82 A;  2M1C A;  3HLC A;  4OPY A;  1K4E A;  4N9K A;  2WAD A;  1FQG A;  3QP2 A;  1K6R A;  5JYO A;  2EFX A;  2HJE A;  3E4Q A;  3OBF A;  5AQ9 A;  1A0K A;  2GZA A;  1PRQ A;  1M40 A;  2L4R A;  3OPL A;  3JPU A;  3R7W B;  3P7N A;  5EPH A;  4N1X A;  3TG9 A;  2P7J A;  1YLY A;  4S2N A;  2NUT C;  3VOZ A;  3UB9 A;  4HY8 A;  3UE6 A;  2QWS A;  1N9B A;  4BD0 A;  3AGE A;  3DTM A;  4HBT A;  1FSW A;  1RGZ A;  1MBL A;  2Y2M A;  5FA7 A;  3ULF A;  5EM1 A;  4UEY A;  1CF0 A;  3R4K A;  2HDU A;  3DTK A;  2XH9 A;  4RYE A;  2VEA A;  5DJT A;  5TBM B;  1IKI A;  4CJN A;  3KYZ A;  4UA7 A;  5EEC A;  3MXQ A;  3C38 A;  1YT4 A;  3MQ0 A;  4Q0H A;  1CEG A;  1OPX A;  3W2Z A;  4EUZ A;  4PM5 A;  2PR6 A;  3NEC A;  1P9R A;  4LV0 A;  1ERM A;  3HCY A;  5MC7 A;  1PNE A;  4X56 A;  3MZE A;  1C3B A;  1E25 A;  3Q7V B;  1Q2Q A;  1XX2 A;  4GDB A;  3DTI A;  2D02 A;  3G34 A;  3ZDJ A;  2VV7 A;  5EUA A;  1HZO A;  4BBV A;  3P09 A;  4QY6 A;  3F1O A;  3MKE A;  4GHI B;  1P0Z A;  2PR5 A;  1TF1 A;  1UWP X;  4RA7 A;  5HDS A;  2ZLY A;  2O9C A;  1KVM A;  1T1C A;  5CGX A;  4QY5 A;  5E2H A;  3QP8 A;  4E3K A;  4UAA A;  1V9Y A;  2HDQ A;  2GJ3 A;  4GJ4 A;  4F94 A;  3HLE A;  5IS1 A;  2E8J A;  1S6R A;  3NDE A;  3UO9 A;  3CMZ A;  2K7S A;  3BFG A;  3M6B A;  5CER A;  2VGJ A;  4GS9 A;  4Y0U A;  2Q9M A;  3CJM A;  5GLC A;  5FQJ A;  4R3B A;  1ONH A;  3WS4 A;  1SKO B;  2WZZ A;  2QHK A;  3RH8 B;  1XFN A;  4OLD A;  1XXM A;  3RTY A;  2QJ5 A;  4HH2 A;  3PAE A;  1EWZ A;  2QMI A;  2ZMF A;  3TJZ C;  4FD8 A;  3CPT B;  1S4R A;  1YLW A;  4JGR A;  2JKT I;  5CED A;  5HX9 A;  2Y2J A;  4WZ5 C;  3HLD A;  3V67 A;  4GB7 A;  4OOL A;  3UDI A;  2J9O A;  2ZM2 A;  5CHM A;  4P85 A;  3BWL A;  3PYP A;  4QB8 A;  3O88 A;  4LRY C;  1KOU A;  1XP4 A;  1GSW A;  4NG2 A;  1IYS A;  3N4I A;  1CJF A;  4Y0O A;  1MC0 A;  3ZG9 B;  1T18 A;  2X01 A;  3MFX A;  4JGQ A;  4N92 A;  1ZG4 A;  2JBF A;  4U0X A;  2EXB A;  4I3I A;  4MBH A;  4ZRR A;  2V0U A;  3D3O A;  3LR4 A;  1GSV A;  2A2L A;  4E3J A;  5FQK A;  3IXB A;  3T1Q B;  5EOE A;  5EVI A;  5FAT A;  2ACG A;  4JF4 A;  4GNU A;  3GSG A;  1FR1 A;  1LHY A;  2QPN A;  5LBR A;  4N9L A;  1XJ6 A;  1DJB A;  5HWT A;  4DKI A;  1CQA A;  2PU4 A;  3BW6 A;  2DNS A;  4MEZ A;  3C8C A;  2V2F F;  2XRN A;  2EXA A;  3MMH A;  2VV6 A;  2Y2Q A;  2IWC A;  3BEB A;  1LSV A;  4WN5 A;  3GEC A;  3N6I A;  1W63 Q;  5DJU A;  2QJ7 A;  2WAF A;  2QYB A;  2W0N A;  4OQG A;  1PWC A;  1CEF A;  4GD8 A;  2C5W B;  4Y3I A;  5KIZ A;  4L9G A;  2BTF P;  5IU1 A;  1W8Q A;  4NXF A;  4P0M A;  1ES4 A;  1YSQ A;  3S7Q A;  5A8B A;  1HLU P;  4MMN A;  4QJG A;  5F83 A;  2KLI A;  1GA0 A;  4RVA A;  5M1A A;  5GL9 A;  4YWZ A;  5TJJ A;  3O86 A;  2BLS A;  5I5L A;  3C4O A;  3OZH A;  2GX5 A;  4EQ1 A;  5F68 A;  5FAS A;  1W5D A;  1WYB A;  4CLC E;  4MN5 A;  4ARZ B;  1PI5 A;  1BUE A;  4E6W A;  4S2N C;  4ZAM A;  1SZV A;  5DKK A;  4I5S A;  4UQI M;  5FDS A;  1STZ A;  3L7H A;  3MFD A;  5HL1 A;  2HDS A;  1MXO A;  2A24 A;  3F1P A;  1K56 D;  1YAX A;  3F1O B;  3PR6 A;  2W3E A;  4BEN A;  3OPR A;  3IHB A;  1FCO A;  4DE1 A;  2EX6 A;  4DXB A;  3PTE A;  3GDI A;  1BLS A;  3ZFZ A;  3H82 B;  4DJ3 A;  2V20 A;  2JKT M;  5GHZ A;  2IWD A;  1K54 C;  3S4X A;  2B02 A;  5FQI A;  1AXB A;  4OPZ A;  2JKF A;  3CUE A;  4E04 A;  1BZA A;  3G32 A;  3TRC A;  1EW0 A;  2YKF A;  4HJ4 A;  1H5X A;  1NY0 A;  4BBT A;  5CGW A;  5E2G A;  4LGW A;  1U60 A;  1S1Y A;  3TSG A;  3QP6 A;  4JKT A;  2DMW A;  3IWO A;  4OOY A;  1PZP A;  1JTD A;  4KEN B;  1XGJ A;  3HLW A;  4JF5 A;  3F1N B;  5CX7 A;  3QP4 A;  2PBY A;  2JC7 A;  4WBG A;  5KZH A;  2P9V A;  4FUW A;  1HVB A;  2W27 A;  4WMC A;  5DF8 A;  2WAE A;  4C75 A;  4BWI A;  5DTK A;  1G68 A;  3LCE A;  3T1S A;  1F98 A;  3F1P B;  4HEF A;  4S2M A;  5HD5 A;  3OCN A;  1RP5 A;  4B4X A;  2HP6 A;  4EXO A;  2O0Y A;  5M19 A;  3BM6 A;  4BL3 A;  1PWG A;  3G4P A;  3WS0 A;  5FI7 A;  1FR6 A;  4PHT A;  3A0S A;  4K91 A;  4DDS A;  3ZCZ A;  2M7U A;  1XFQ A;  4R3J A;  3WS1 A;  3V3R A;  2V1A A;  3WWX A;  2EWV A;  4Y15 A;  1MKI A;  1OT9 A;  4Y17 A;  3VP0 A;  1L3L A;  3KX0 X;  2WZX A;  5HFO A;  4B9O A;  5TBM A;  1VEU B;  3KSF A;  3NJA A;  1L0E A;  4KZ3 A;  3OPH A;  2W1R A;  3A3D A;  3BY8 A;  1S1Z A;  4ZBE A;  3IQA A;  4RX3 A;  4C6Y A;  3HLG A;  3UDX A;  1NZU A;  3MZF A;  3KSG A;  2W3H A;  2PD8 A;  3VOY A;  3NOT C;  1H8Y A;  3ZG0 A;  2HV1 A;  5TR7 A;  1NJ4 A;  4IVK A;  1LLB A;  4HP9 A;  4BD1 A;  2KX6 A;  3EQV A;  5HDD A;  1K54 A;  1IFQ A;  4GS9 B;  4KQO A;  5A92 A;  2XK1 A;  3FKV A;  2VKS A;  1SHV A;  1OTE A;  3Q7Z A;  4KQR A;  2HP9 A;  5IHV A;  4Q0I A;  1T19 A;  1Y28 A;  2XLN A;  3BLS A;  1IOU A;  3SS3 A;  2Q0O A;  2HPB A;  5F69 A;  4OOM A;  1VQQ A;  1E4D A;  5HSQ A;  1OJ5 A;  1JVJ A;  3NDG A;  2Y2K A;  3N8R A;  1IKG A;  3DAV A;  2V1Z A;  2J9P A;  4IHQ A;  2QKP A;  4H6J B;  4OH0 A;  4JF6 A;  4E3I A;  5G4Z A;  3S7P A;  3LI8 A;  4P87 A;  4DE3 A;  2XR0 A;  4FOF A;  2Z2M B;  4EET B;  1XKZ A;  3DTE A;  3LEQ A;  5CHU A;  1K6S A;  2ZC7 A;  5GHX A;  4OQH A;  4B4Z A;  3LY3 A;  4P6B A;  5FQM A;  2OWJ A;  3MQQ A;  5DF7 A;  1XGI A;  1ZG6 A;  2JE5 A;  1HTZ A;  2XD1 A;  2W3G A;  3MXR A;  5FL3 A;  3O5Y A;  2MJ6 A;  1YMX A;  3QP5 A;  1IEL A;  4EQI A;  2HF6 A;  3IF6 A;  2A49 A;  4NK3 A;  4R0Q A;  1YLJ A;  4LPZ A;  2G2W A;  2W3D A;  1OT6 A;  3RXW A;  3FG8 A;  4KZ9 A;  3BQA A;  1Q2P A;  3HRE A;  3E2L A;  2Y59 A;  3VP4 A;  1IEM A;  2ZQD A;  3P01 A;  4G3V A;  3E2K A;  3B33 A;  3PBQ A;  3VFF A;  1HD8 A;  2ZBB A;  4D60 A;  4GW9 A;  2FZ0 A;  3HUN A;  4DRT A;  3ZGA B;  3NIA A;  5EVE A;  5E43 A;  4MNR A;  3CAX A;  3KYE A;  4GDN A;  4XT2 A;  3VOL A;  4JXW A;  1NWZ A;  3G2Z A;  3FC7 A;  1ES5 A;  2Y2L A;  1D06 A;  4KQD A;  3WRT A;  3EGX C;  1GHI A;  3IH8 A;  5GHY A;  5FAO A;  2M7V A;  1TS8 A;  1I5Q A;  2VGL S;  2HDR A;  3NC8 A;  2G2U A;  2XA7 S;  2A3U A;  4K08 A;  3MXS A;  3K3D A;  1NRF A;  2EX9 A;  3BEC A;  5CEC A;  5CRF A;  3UB8 A;  3U4L P;  5F1G A;  1QME A;  1LI9 A;  4U0T A;  2FFY A;  2J3T C;  1VET A;  4KZ5 A;  1D1J A;  5EVI B;  2O99 A;  3KSI A;  4R4S A;  2V8F A;  3CUE C;  3V3S A;  2J3T D;  4G3W A;  4S2P A;  3LUQ A;  3PBR A;  1RGY A;  1VHM A;  4II7 A;  4EUV A;  4HP4 A;  4LV3 A;  1Y4O A;  3TOI A;  4I3J A;  1IYP A;  2PHY A;  4UQI S;  3QNC A;  3A3F A;  3C30 A;  4H8R A;  4Y0T A;  2X02 A;  2WK0 A;  3NY4 A;  4YFM A;  2ZQC A;  2KOI A;  5CTM A;  4S2J A;  4E3L A;  4MDZ A;  2Y2G A;  4GCZ A;  1BUL A;  2UV0 E;  2L0W A;  4WZ4 A;  1TS0 A;  4O8G A;  2PD7 A;  4KZ6 A;  1QMF A;  1K56 A;  1NLY A;  1I2W A;  4WEJ A;  2RCX A; 
#chains in the Genus database with same CATH homology
 2IWB A;  4BEN A;  1TEM A;  2Y2P A;  3I7J A;  2H10 A;  3RJU A;  2P9V B;  3VSK A;  3ZNY A;  4S2L A;  3OPR A;  3IHB A;  1FCO A;  4JXG A;  4DE1 A;  2EX6 A;  1S0W A;  1BLH A;  2Y91 A;  4DXB A;  4X69 A;  3W4Q A;  4WEK A;  3WS2 A;  4E3N A;  3G30 A;  4EBP A;  1XA7 A;  4EV4 A;  4K0X A;  5DVA A;  3PTE A;  3NCK A;  1BLS A;  2H0T A;  1GHP A;  3SOI A;  3ZFZ A;  1ERO A;  2V20 A;  5GHZ A;  3BFE A;  2IWD A;  2OSU A;  4WZ5 A;  1FCM A;  1K54 C;  2P74 A;  3S4X A;  2Q9N A;  1YLZ A;  3OC2 A;  3UPP A;  2PU2 A;  5FQI A;  1AXB A;  4IBR A;  5HW3 A;  1CI9 A;  3IWQ A;  4OPZ A;  3IXD A;  2XEP A;  5CXW A;  3UE1 A;  4Y7P A;  4LEN A;  1BZA A;  3G32 A;  4FH2 A;  1G6A A;  1SCW A;  3LEZ A;  3UY6 A;  1H5X A;  1GHM A;  2WGI A;  1NY0 A;  2DRW A;  4X68 A;  2ZQ8 A;  5CGW A;  5E2G A;  4DE0 A;  1SDN A;  3BYD A;  4UA9 A;  2Z2L B;  3IXG A;  3IF6 B;  5A90 A;  3HBR A;  5DTT A;  1U60 A;  5A91 A;  2XFS A;  3TSG A;  5DTS A;  4JKT A;  4LV1 A;  3IWO A;  3G35 A;  3IXH A;  4OOY A;  1PZP A;  1JWP A;  2XDM A;  1JTD A;  2ZC6 B;  4ZJ1 A;  1ONG A;  4KEN B;  1XGJ A;  1JWV A;  3HLW A;  4JF5 A;  4BLM A;  1KE3 A;  2PBY A;  1K57 A;  3C5A A;  3NBL A;  3LO7 A;  3FZC A;  1CK3 A;  5EOO A;  1PI4 A;  2JC7 A;  3PBT A;  1O07 A;  5L2F A;  1DJA A;  1FSY A;  2FFF B;  4WBG A;  4XXR A;  5FAP A;  5KZH A;  2P9V A;  1HVB A;  4DF6 A;  5U47 A;  5G18 A;  5D3O A;  1KGE A;  1ERQ A;  2QZ6 A;  4WMC A;  5DF8 A;  3CZD A;  4S2K A;  1WYC A;  2I72 A;  2ZC5 B;  2WAE A;  4WMC D;  3UPO A;  3ZNT A;  4C75 A;  2Y2I A;  3Q82 A;  5DTK A;  1BT5 A;  1G68 A;  3LCE A;  3GR2 A;  1L0G A;  4KZ4 A;  3DWK A;  3D4F A;  4HEF A;  4S2M A;  4PM7 A;  2OV5 A;  3HLC A;  3AGF A;  4R23 A;  4DXC A;  4S2I A;  3OCN A;  2CC1 A;  1K4E A;  4OPY A;  3LY4 A;  4LV2 A;  4N9K A;  2WAD A;  1RP5 A;  4B4X A;  2HP6 A;  4EBN A;  1FQG A;  5M19 A;  3BM6 A;  4BL3 A;  1MWT A;  1PWG A;  2ZC3 B;  1K6R A;  3G4P A;  3PBO A;  3WS0 A;  5JYO A;  2EFX A;  5FI7 A;  1FR6 A;  1W8Y A;  4K91 A;  4DDS A;  3ZCZ A;  4JBF A;  1KGF A;  4R3J A;  2XD5 A;  5AQ9 A;  1EI5 A;  3BRM A;  3WS1 A;  2C6W B;  1M40 A;  3JYI A;  3V3R A;  4KG6 A;  3OPL A;  4LCM A;  4PMA A;  3QHY A;  3WWX A;  3N7W A;  5EPH A;  3ZG5 A;  4B88 A;  1MKI A;  4FH4 A;  4N1X A;  3VP0 A;  3TG9 A;  4HBU A;  2UWX A;  3RXX A;  1YLY A;  5HAR A;  2WZX A;  5HFO A;  3IF5 A;  4OPR A;  1TVF A;  4OQI A;  2WUQ A;  5CTN A;  4S2N A;  1ZC2 A;  3ZHH A;  1ALQ A;  3VOZ A;  1KVL A;  1L0E A;  1K55 A;  4KZ3 A;  3OPH A;  3GTC A;  1N9B A;  3GMW A;  4KZB A;  4BD0 A;  3AGE A;  1OME A;  3A3D A;  3DTM A;  3S22 A;  4D2O A;  3IWI A;  4HBT A;  2WGW B;  4FCF A;  1FSW A;  4ZBE A;  2Y2O A;  1RGZ A;  2ZQA A;  1MBL A;  2Y2M A;  3IQA A;  4MBK A;  5FA7 A;  4ZTK A;  3PBN A;  1L0F A;  4M3K A;  4RX3 A;  4QHC A;  3HL9 A;  2Y55 A;  1PIO A;  4NET A;  4C6Y A;  2XF3 A;  4ZJ3 A;  1BLP A;  3HLG A;  2WYX A;  3UDX A;  1NZU A;  3MZF A;  1Z6F A;  2HDU A;  2XH9 A;  4RYE A;  5EE8 A;  4UA6 A;  3VOY A;  4BJP A;  1IKI A;  1H8Y A;  4CJN A;  4UA7 A;  3ZG0 A;  5EEC A;  3BLM A;  4UHU A;  1YT4 A;  4JXV A;  3IF6 C;  1NJ4 A;  5TR7 A;  3ITB A;  4E3O A;  2R9X A;  2R9W A;  1W79 A;  1CEG A;  1IYQ A;  4EUZ A;  3G31 A;  4K0W A;  4IVK A;  4PM5 A;  3W4O A;  1LLB A;  3A3J A;  3VSL A;  4LV0 A;  4BD1 A;  1ERM A;  4OON A;  2ZM8 A;  3EQV A;  1K38 A;  1K54 A;  5HAI A;  2RL3 A;  3C4P A;  4KQO A;  4X56 A;  3V39 A;  2WGV A;  3MZE A;  1C3B A;  4X6T A;  3G2Y A;  1E25 A;  1DY6 A;  5A92 A;  3GVB A;  2XK1 A;  4ZDX A;  1IYO A;  2H5S A;  3FKV A;  3Q7V B;  1Q2Q A;  1XX2 A;  5F82 A;  3SH9 A;  4GDB A;  1SHV A;  5EVI C;  3G34 A;  4BQM A;  3ZDJ A;  1XPB A;  3Q7Z A;  4KQR A;  2OLU A;  4PPR A;  1HZO A;  4ID4 A;  4OVD A;  5EUA A;  5F1F A;  2HP9 A;  2DCF A;  3P09 A;  4OPQ A;  1SDE A;  4QY6 A;  5IHV A;  3P98 A;  1L0D A;  3MKE A;  1YQS A;  4KQQ A;  4O7D A;  1M6K A;  4IVI A;  2XLN A;  3W8K A;  3BLS A;  5GLB A;  3M6H A;  5I94 A;  2ZC4 B;  4DDY A;  4RA7 A;  5FQQ A;  3SS3 A;  1NXY A;  2HPB A;  1KE0 A;  4E3M A;  2ZLY A;  4OOM A;  5FSR A;  2Y2H A;  4XUX A;  1VQQ A;  1E4D A;  1KVM A;  1DJC A;  3HUM A;  1JVJ A;  3NDG A;  4KZA A;  5CGX A;  2Y2K A;  4QY5 A;  3O87 A;  1YLT A;  3FYZ A;  3N8R A;  5E2H A;  1IKG A;  5EVL A;  4E3K A;  2GDN A;  2V1Z A;  3UPN A;  4UAA A;  2J9P A;  1H8Z A;  2HDQ A;  3A3I A;  4F94 A;  1J9M A;  4OH0 A;  2EFU A;  3HLE A;  1ES3 A;  1LI0 A;  4JF6 A;  4OP8 A;  1S6R A;  1N4O A;  1CI8 A;  4E3I A;  3UE0 A;  1JWZ A;  2XFT A;  2Y4A A;  3NDE A;  2XQZ A;  3CMZ A;  3BFG A;  3FKW A;  3UO9 A;  3VFH A;  3MZD A;  3M6B A;  4P87 A;  4DE3 A;  5CER A;  2XR0 A;  2VGJ A;  3VP3 A;  2X71 A;  1E3U A;  2Z2M B;  4Y0U A;  5GLA A;  2Q9M A;  5HAP A;  1K25 A;  2VGK A;  3FWL A;  3CJM A;  4PM6 A;  3UE3 A;  5GLC A;  3DWZ A;  5FQJ A;  4R3B A;  1XKZ A;  5AQ7 A;  1ONH A;  1VM1 A;  3SH7 A;  3WS4 A;  4OKP A;  2WZZ A;  1WE4 A;  5CHU A;  1K6S A;  2ZC7 A;  5GHX A;  4OQH A;  4B4Z A;  5CEB A;  2ZQ9 A;  3EQU A;  3LY3 A;  3QNB A;  3M2K A;  4P6B A;  4R4R A;  4N1H A;  3FV7 A;  5FQM A;  4OLD A;  2Y2N A;  1XXM A;  3M2J A;  1PWD A;  2OLV A;  4OLG A;  5BOH A;  1TDG A;  3SH8 A;  5DF7 A;  4OQ0 A;  3PAE A;  1XGI A;  1ZG6 A;  2J7V A;  1EWZ A;  2JE5 A;  3IH9 A;  4KG2 A;  2HP5 A;  1MWR A;  1HTZ A;  2XD1 A;  2QMI A;  3VP1 A;  5TFQ A;  5KMW A;  3MXR A;  4FD8 A;  1I2S A;  3O3V A;  5DF9 A;  3ISG A;  1YLW A;  1YMX A;  2EX2 A;  2EX8 A;  5CED A;  1IEL A;  4EQI A;  3IF6 A;  3NI9 A;  2A49 A;  1PYY A;  4WM9 A;  2Y2J A;  5HX9 A;  4WZ5 C;  3HLD A;  4GB7 A;  4NK3 A;  4OOL A;  4R0Q A;  3UDI A;  2J9O A;  3SS4 A;  1YLJ A;  2ZM2 A;  5CHM A;  1MY8 A;  2G2W A;  4P85 A;  3C7U A;  1PW1 A;  4S2O A;  2ZQ7 A;  4QB8 A;  3O88 A;  4EWF A;  1XP4 A;  3BFD A;  1IYS A;  3N4I A;  3SS5 A;  4Y0O A;  3RXW A;  4KZ9 A;  3VMA A;  3ZG9 B;  1W7F A;  1E3U D;  3Q07 A;  4MLL A;  5FI2 A;  3ZG8 B;  4KZ8 A;  2X01 A;  1Q2P A;  3HRE A;  3E2L A;  2Y59 A;  4N92 A;  1K55 C;  1ZG4 A;  2JBF A;  4U0X A;  3VP4 A;  4KZ7 A;  2EXB A;  1JTG A;  4MBH A;  1IEM A;  2ZQD A;  2WKH A;  1GA9 A;  3E2K A;  3PBQ A;  4E3J A;  5FQK A;  3VFF A;  1HD8 A;  5CGS A;  3IXB A;  3HUN A;  4XUZ A;  5EOE A;  2ZMA A;  5EVI A;  4DRT A;  2ZJ9 A;  5FAT A;  5A93 A;  1KGG A;  1K4F A;  3ZGA B;  4GN2 A;  3NIA A;  3UDF A;  1Y54 A;  1BSG A;  4JF4 A;  4GNU A;  1LL5 A;  3GSG A;  4RX2 A;  4KG5 A;  4IED A;  5E43 A;  4MNR A;  4GDN A;  1FR1 A;  1PW8 A;  1LHY A;  2QPN A;  4JXW A;  4DE2 A;  3V5M A;  3DW0 A;  3G2Z A;  4N9L A;  1DJB A;  4U3T A;  3HUO A;  1ES5 A;  4DKI A;  2Y2L A;  1NZO A;  4PM8 A;  3WRT A;  3GRJ A;  2PU4 A;  1GHI A;  3IH8 A;  2DNS A;  4X53 A;  5GHY A;  4MEZ A;  3PBS A;  3Q81 A;  5FAO A;  5HAQ A;  2V2F F;  4C3Q A;  1I5Q A;  4Q8I A;  3BFC A;  3UN7 A;  2EXA A;  2HDR A;  3NC8 A;  4EBL A;  2G2U A;  2Y2Q A;  2A3U A;  2IWC A;  2J8Y A;  3ITA A;  3MXS A;  4OP5 A;  5FQ9 A;  3BEB A;  4X55 A;  3AGD A;  1NRF A;  1FOF A;  2EX9 A;  1YMS A;  3BEC A;  5CEC A;  5FDH A;  3N6I A;  4HES A;  5CRF A;  2WAF A;  5F1G A;  3OPP A;  1YLP A;  1QME A;  1LI9 A;  4OQG A;  1PWC A;  2FFY A;  1L2S A;  4U0T A;  1CEF A;  1NYM A;  4GD8 A;  2C5W B;  3N8L A;  4KZ5 A;  4QU3 A;  5CHJ A;  1K57 C;  5E2E A;  5J8X A;  2B5R A;  3MBZ A;  1KDW A;  5EVI B;  3N8S A;  1MWU A;  4GZB A;  3BFF A;  4R4S A;  3W4P A;  4E6X A;  1FCN A;  1SKF A;  3ZVW A;  3ZVT A;  3V3S A;  4S2P A;  5EVI D;  1W8Q A;  3HLB A;  4YIN A;  1O7E A;  1RGY A;  3PBR A;  4P0M A;  1MWS A;  1ES4 A;  3Q1F A;  4JXS A;  3WRZ A;  4JLF A;  4JPM A;  4IBX A;  2WGW A;  4LV3 A;  4QJG A;  1RCJ A;  5F83 A;  3CG5 A;  3TOI A;  2BG1 A;  1GA0 A;  3ZG7 B;  4A5R A;  1KE4 A;  4RVA A;  3V50 A;  5KSC A;  3OCL A;  1IYP A;  1LL9 A;  3HLF A;  4L0L A;  3B3X A;  3GQZ A;  4GKU A;  3WS5 A;  3QNC A;  5M1A A;  3S1Y A;  5GL9 A;  3A3F A;  1BLC A;  4H8R A;  3IT9 A;  1YM1 A;  4GD6 A;  3O86 A;  1ESU A;  2BLS A;  2JCH A;  3C4O A;  1PZO A;  3OZH A;  2X02 A;  4Y0T A;  4FSF A;  2WK0 A;  3A3E A;  4R1G A;  5FAS A;  1W5D A;  1WYB A;  3NY4 A;  4PM9 A;  5FI6 A;  4YFM A;  2ZQC A;  5KSH A;  1BTL A;  2E8I A;  1PI5 A;  4WEL A;  1BUE A;  2H0Y A;  1ES2 A;  3C7V A;  3HVF A;  3MKF A;  5CTM A;  4GOG A;  5M18 A;  1MPL A;  3UNW A;  2XGN A;  4MBF A;  4S2N C;  4E6W A;  3IHA A;  4S2J A;  4ZAM A;  4QD4 A;  4E3L A;  4Z9Q A;  1KDS A;  2Y2G A;  3Q7V A;  1BUL A;  1XA1 A;  2WKI A;  5JYP A;  1NYY A;  1ZKJ A;  3VP2 A;  1ESI A;  4LCL A;  4CPK A;  3MFD A;  4WZ4 A;  5HL1 A;  4KZ6 A;  2HDS A;  5GLD A;  4WYY A;  5E2F A;  1QMF A;  1K56 A;  1MXO A;  4BL2 A;  1TDL A;  3GV9 A;  2WKE A;  2ZM0 A;  5AQA A;  4ZJ2 A;  1K56 D;  2ZD8 A;  5AQB A;  1GCE A;  5FAQ A;  1I2W A;  3PAG A;  4WEJ A;  2RCX A;  5TGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...