1IYQA

Toho-1 beta-lactamase in complex with benzylpenicillin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAERRRDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toho-1 beta-lactamase
publication title Acyl-intermediate Structures of the Extended-spectrum Class A beta -Lactamase, Toho-1, in Complex with Cefotaxime, Cephalothin, and Benzylpenicillin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 93
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1iyqA00
2J7VA 4S2JA 4P0MA 4OQGA 5HAPA 1BLPA 2CC1A 5A91A 1YLPA 2P9VA 3A3FA 3M6HA 3RXWA 3IXHA 3ZVWA 1G68A 1BUEA 4KQRA 3MFDA 1XXMA 4WMCD 4KZ4A 1HVBA 3NY4A 3ZDJA 2ZD8A 4BD0A 3MKFA 4JKTA 4P85A 4NK3A 1OMEA 2ZQ9A 3M6BA 4OPRA 2EX9A 4EWFA 2H0YA 3PTEA 4S2KA 4B88A 4GDBA 4S2IA 1KE3A 4ZJ3A 1NXYA 4GN2A 5D3OA 1MWTA 1WYBA 2ZC3B 3TOIA 1M6KA 4OOMA 5I94A 2JC7A 1EI5A 2HP6A 4E3MA 1PWCA 4S2NC 1YQSA 2WKEA 1PI5A 3IWIA 1YMSA 2C5WB 4K0XA 4QD4A 5E2GA 1PZPA 4PM9A 3UPPA 4OQ0A 1PIOA 5CTMA 5E43A 1VQQA 4DKIA 5JYPA 3BFCA 3PAGA 1E25A 2ZM0A 4KZ9A 4X55A 2WGWA 4IVKA 3FKWA 3W4QA 4GD8A 4E3NA 1K56A 4GDNA 3VFFA 3UN7A 3OPRA 1KE4A 3UE1A 2Y2NA 1H8YA 1JWVA 4OONA 2HDUA 3N8RA 3FV7A 3UNWA 3WS5A 3S4XA 4JPMA 3C5AA 1LL5A 1XA7A 3C4OA 3NCKA 3NI9A 4OQHA 4MBFA 1PWGA 2Y2GA 2J9OA 2P74A 3GTCA 3MZDA 1MY8A 5EOOA 3IXBA 3VSLA 1K55C 1K54A 5G18A 4RX2A 3CJMA 1TEMA 2HDRA 3HUOA 5DF9A 3AGDA 5DTSA 4P87A 2WKIA 1I2SA 2Y2IA 3RXXA 4HBUA 1TDLA 1K4FA 4LV2A 5EE8A 1K55A 1KDWA 4WZ5C 5AQ7A 3WRTA 3WS2A 2XR0A 5L2FA 4C3QA 3DWZA 2I72A 1RGZA 2DNSA 4M3KA 1NYMA 2HP9A 1IKGA 4GNUA 4Y0TA 2XD1A 1O07A 2FFYA 4WZ5A 3GVBA 5E2HA 4GOGA 3UE3A 3ZG5A 4BLMA 1E3UA 2Q9MA 4C6YA 3G35A 3LO7A 1K25A 4R0QA 3BYDA 3VMAA 3N6IA 3A3IA 5A93A 3B3XA 5FI2A 4S2PA 4KENB 3WS4A 4ID4A 5CECA 3IXGA 1L0GA 3AGFA 2V1ZA 4R1GA 5GHXA 3G4PA 4OP5A 4KQQA 3O3VA 2QMIA 3PBSA 3UDIA 5HAQA 4KG6A 2OSUA 1BLSA 1IYQA 1YLJA 4OLGA 4RA7A 5CXWA 5EVIB 1NY0A 2ZM8A 2ZC5B 3LCEA 3Q7VB 3O87A 2EXAA 4ZBEA 1K6SA 4OKPA 1KVLA 4E3LA 5FAQA 2JCHA 5CHJA 3C7UA 4X6TA 2XQZA 5F82A 3FYZA 4L0LA 2Y2OA 4JF5A 3BLMA 4YINA 4JF6A 4HBTA 1W8YA 1ES4A 3VP0A 2EFUA 5GLCA 4C75A 2G2UA 1SHVA 5A90A 1C3BA 1H8ZA 3QNBA 4DXCA 3P98A 2VGJA 3A3JA 1HZOA 4QHCA 3IF6B 1BSGA 1IEMA 3LEZA 3VP2A 5DF7A 2HPBA 4BL2A 4DE2A 5HFOA 2WZZA 5CHMA 3WRZA 1YLYA 4WM9A 2ZC6B 4OVDA 4DE1A 5FSRA 4PMAA 3BFDA 5F1FA 4KZAA 4FCFA 1BTLA 5E2EA 4JF4A 2IWCA 4NETA 3VFHA 3P09A 4OLDA 1XA1A 5E2FA 1K56D 5CERA 3IXDA 3MXRA 4MBKA 1TVFA 1JWZA 3UE0A 4UA9A 2WUQA 3W4PA 2V20A 3QNCA 3HBRA 4ZJ1A 1VM1A 1DY6A 4QU3A 1MWUA 3QHYA 1K6RA 3A3DA 2B5RA 1K38A 1KGFA 4QY5A 5KSCA 2WGVA 3HUMA 4JXVA 4DE3A 2OV5A 1PW8A 3ZG7B 1BULA 1ES2A 4GB7A 1CEFA 3NDGA 4MEZA 4X56A 3V5MA 5KMWA 3HLWA 4F94A 5FQQA 1DJBA 1NZOA 1RP5A 2Y2LA 4FH2A 3PBQA 4R4SA 1FCMA 1FSWA 5GHZA 5HARA 1JVJA 2XD5A 5CGWA 4KG5A 3O88A 3ISGA 3NIAA 5FASA 1GHIA 3OPLA 2UWXA 4FSFA 1L0FA 2Y2HA 3ZG0A 3IF5A 3N8SA 5M1AA 1E3UD 3GR2A 3CG5A 3N8LA 4N1HA 1W5DA 4RVAA 4PPRA 4E6WA 1I2WA 1ZC2A 2Y55A 1K54C 1W79A 3S1YA 5F83A 4S2MA 4U0TA 5IHVA 3A3EA 2HDSA 4OQIA 4EUZA 2RCXA 1E4DA 4K91A 5FQJA 5JYOA 1ZG6A 4QJGA 2J9PA 3VOYA 2XF3A 3SH9A 3IT9A 1LL9A 5HAIA 4QB8A 1NJ4A 2Z2LB 1QMFA 4JXSA 4PM7A 2Y4AA 3GMWA 3UPOA 2R9XA 5HX9A 1ONGA 4WZ4A 4XXRA 4XUZA 3V50A 4ZDXA 3OCLA 1KVMA 4IBRA 2EX2A 5GHYA 3UPNA 4LCLA 2ZC4B 1YLTA 2H10A 3WWXA 3G31A 5CGSA 4OPQA 4MLLA 2WAFA 2ZQAA 2WZXA 1EROA 3CZDA 1RCJA 3W4OA 4CPKA 1LI9A 3DW0A 3N7WA 5GL9A 2ZC7A 2ZQCA 3G2ZA 1L2SA 4D2OA 1JWPA 2OLUA 1NZUA 5EVLA 5KZHA 1BLCA 2GDNA 1YM1A 1XX2A 4BENA 1GCEA 2E8IA 4QY6A 2XK1A 4Y0OA 2ZQ7A 3MXSA 4WYYA 3D4FA 5CEDA 1SDNA 5CTNA 4U3TA 2WADA 5FI6A 3GSGA 2Y59A 1SCWA 4LCMA 4DXBA 1L0DA 2XLNA 2Z2MB 1XGJA 4Y0UA 5M19A 5AQAA 3RJUA 3PBOA 2ZQDA 4S2LA 3ZFZA 3IWQA 1LLBA 4HEFA 4OH0A 2OLVA 3HLFA 2HP5A 2IWDA 1PI4A 3G2YA 1K4EA 2C6WB 3EQUA 4EBNA 4WEKA 1ES3A 2XGNA 3LY3A 4ZJ2A 3W8KA 4BJPA 1HTZA 2WYXA 5DF8A 4DDSA 3OPHA 1GHMA 5BOHA 5FA7A 2ZJ9A 1BLHA 2EXBA 4LV3A 2JE5A 4DF6A 1LI0A 3E2LA 4E3KA 2J8YA 2Y2PA 2P9VB 2QZ6A 3IHBA 1GHPA 4HESA 4DDYA 3OCNA 1WE4A 5AQBA 5FAOA 3SS4A 4N1XA 3ZCZA 1ES5A 3GV9A 2WK0A 5FQMA 3MZFA 1CEGA 4E6XA 4RYEA 5HL1A 3Q7ZA 4KG2A 4IEDA 2A3UA 3M2JA 5GLBA 1XP4A 1ZKJA 3PBRA 4KZ6A 1PW1A 4H8RA 5EOEA 3SS3A 5EVIC 2WGIA 5FQ9A 3ITBA 1G6AA 5DTKA 3HLGA 4EV4A 3ITAA 5CEBA 4MBHA 2QPNA 4OOLA 4DRTA 3MKEA 5EVIA 1ONHA 3HL9A 3Q7VA 4JXWA 5F1GA 5TGFA 3ZGAB 1K57A 3OC2A 1IYSA 1PZOA 2R9WA 2Y2QA 2WGWB 1IYOA 1TDGA 2EX8A 2JBFA 1CI8A 3OZHA 3EQVA 1MKIA 2XEPA 4N9LA 2PBYA 3NC8A 3SH8A 4E3JA 4OOYA 5J8XA 2FFFB 3DWKA 2VGKA 3NBLA 4U0XA 4OPZA 1ZG4A 5HW3A 1KGEA 3BLSA 1Q2PA 3IF6A 4R4RA 3VP1A 3IH8A 4R3JA 4EBLA 4UAAA 4JXGA 4GD6A 4OP8A 3BRMA 1MPLA 5CGXA 1HD8A 3V3RA 3DTMA 4FH4A 3HLCA 1MBLA 2Y2JA 4BL3A 2ZM2A 3CMZA 3UO9A 1LHYA 1BZAA 3IQAA 3VOZA 1WYCA 5EECA 3AGEA 3MBZA 2G2WA 3G30A 3UY6A 2H5SA 3BFEA 4EBPA 2BG1A 1FCNA 1DJCA 4R23A 2HDQA 2ZMAA 2Y2MA 3BM6A 4ZAMA 5M18A 1O7EA 5GLAA 1SKFA 2X01A 4FD8A 3UDXA 1ERQA 4KZ8A 4Z9QA 1MXOA 2XDMA 3IH9A 1XKZA 3ZVTA 4KZBA 3Q82A 3Q07A 5FQIA 4S2NA 2XFSA 3ZNYA 4IVIA 5U47A 4WBGA 2Y91A 1FSYA 1EWZA 4MNRA 1GA9A 3IHAA 3GRJA 4WMCA 3BFFA 3M2KA 3ZG9B 5DTTA 1KGGA 3SS5A 1U60A 3UDFA 1M40A 4KZ5A 4LV0A 1RGYA 3NDEA 3Q81A 1S6RA 4KZ7A 3V3SA 2ZQ8A 3G34A 4JLFA 3WS1A 5TFQA 2WKHA 3BFGA 4LV1A 4OPYA 1PYYA 1Q2QA 2X02A 3E2KA 3N4IA 3HVFA 4KQOA 2Q9NA 1DJAA 1FR1A 2XFTA 1IKIA 1QMEA 4E3IA 1H5XA 1YT4A 3BECA 3VP4A 1N9BA 4N92A 1GA0A 1XPBA 2ZLYA 1AXBA 3V39A 5GLDA 1IELA 4GKUA 5EUAA 3VSKA 4CJNA 1ESUA 5A92A 1IYPA 1BT5A 5FATA 1JTDA 4YFMA 4RX3A 3OPPA 3Q1FA 4UA6A 3SOIA 1YLWA 3WS0A 1FOFA 1CK3A 2XH9A 3HLEA 3HREA 4PM5A 1ERMA 1KDSA 4IBXA 3C7VA 1CI9A 4B4XA 1FCOA 3G32A 1FQGA 3JYIA 3TSGA 4B4ZA 2A49A 3TG9A 1YLZA 4R3BA 4GZBA 4P6BA 5EVID 2EX6A 5EPHA 3ZHHA 1JTGA 4BQMA 5FQKA 1MWSA 4K0WA 4XUXA 1KE0A 4JBFA 4X53A 1N4OA 1NRFA 4A5RA 3PAEA 4X69A 4S2OA 4UHUA 4KZ3A 5AQ9A 2WAEA 3FKVA 4ZTKA 3ZNTA 4X68A 4Y7PA 4LENA 3PBTA 4PM6A 2V2FF 3LY4A 3HLBA 5TR7A 5FI7A 2Y2KA 1W7FA 1SDEA 2BLSA 4DE0A 1J9MA 1ESIA 3FZCA 1S0WA 4UA7A 5CHUA 1ALQA 1NYYA 4EQIA 4WEJA 5KSHA 3HUNA 3BEBA 2DCFA 2H0TA 2RL3A 3HLDA 3ZG8B 3FWLA 4PM8A 3S22A 1K57C 3PBNA 1W8QA 2DRWA 4N9KA 3MZEA 3SH7A 1XGIA 3VP3A 1Y54A 1FR6A 4Q8IA 3C4PA 3O86A 2PU2A 2EFXA 3IWOA 3I7JA 5DVAA 4BD1A 2X71A 1I5QA 2IWBA 1PWDA 1MWRA 4E3OA 1L0EA 1YMXA 2PU4A 4O7DA 4WELA 5FDHA 1Z6FA 5CRFA 5FAPA 3IF6C 3GQZA
chains in the Genus database with same CATH superfamily
3KYZA 4HY8A 3T4TA 4KUOA 3MQQA 4JGQA 4WL9A 2OAQ1 3RXWA 3FPVA 3CPTB 4L9FA 4KQRA 1VEUB 3MFDA 1XXMA 3NY4A 3ZDJA 4BD0A 1EW0A 3PTEA 4S2IA 1XJ2A 1NXYA 5HPFA 5D3OA 3LYXA 4E3MA 2WKEA 1PI5A 3IWIA 1YMSA 5HDSA 1PZPA 1S66L 1Y4OA 5JYPA 2HF6A 4X55A 4IVKA 1K56A 2L4RA 1H8YA 3A0SA 5HD5A 2HDUA 3FV7A 3NI9A 1V9YA 4MBFA 1PWGA 2Y2GA 2P74A 4LLOB 5EOOA 4HH3A 3L9KA 3IXBA 3CJMA 1TEMA 2HDRA 5DF9A 2WKIA 4BBTA 3WRTA 1K55A 4NG2A 3WS2A 1V9ZA 5L2FA 2DNSA 3OLOA 1IKGA 4WZ5A 2KOIA 3G35A 1MKMA 3UB5P 2VV6A 5IT5A 4I3IA 1K25A 2OWJA 4EUVA 2HGVA 3N6IA 3UB8A 4UQIS 4S2PA 1XJ6A 4ZRRA 5A8BA 4HH2A 5GHXA 4KQQA 2Y79A 3PBSA 5HAQA 1YLJA 4I38A 5CXWA 1NY0A 2ZM8A 3Q7VB 3BQ8A 4E3LA 2VX8A 2JCHA 2V1BA 4X6TA 2OWHA 3FYZA 3MJQA 4JF5A 2GJ3A 3BLMA 1ES4A 3VP0A 2G2UA 4ETXA 5A90A 3NOUC 2JKRM 3A3JA 4DXCA 1BSGA 1IEMA 4DE2A 4X1LA 1YLYA 2ZC6B 2M7VA 5E2EA 1X0OA 2PDRA 3VFHA 3P09A 4Q0IA 1K56D 3PXPA 3MXRA 2A2LA 2WUQA 2Y8HA 1DY6A 2ACGA 4QU3A 1XFNA 4O8GA 2JHEA 4GHIA 3E0YA 1PW8A 5FEFA 3HCYA 5KMWA 3HLWA 5FQQA 1DJBA 2Y2LA 4FH2A 1DP9A 2H28A 1OPXA 1JVJA 4KG5A 5FASA 2Y2HA 3GR2A 4N1HA 2PT7A 1W5DA 4PPRA 2HV1A 1W79A 4S2MA 2RCXA 4K91A 1ZG6A 5AVFA 2J9PA 3ICYA 2XF3A 5FDSA 3T50A 4PM7A 3UPOA 2Q0OA 2V1AA 4WZ4A 2W1TA 4XUZA 3V50A 4CLCC 3OCLA 2ZMFA 2IA2A 1YLTA 2H10A 1N9OA 4MLLA 2D01A 1EROA 3W4OA 3T4SA 1LI9A 3DW0A 3LIEA 2OLUA 5KZHA 4LPZA 2GDNA 1YM1A 2WKRA 3RFBA 2E8IA 3EOIA 2XK1A 3MXSA 5CTNA 2Y59A 3IX3A 3V67A 4AFIA 5J3WA 2K31A 1L0DA 5G4ZA 1TS0A 4WLAA 5IU1A 4UEYA 1TS8A 2ZQDA 3HJKA 4S2LA 1SKOA 3IX4A 2OLVA 2IWDA 1T1AA 1IOUA 2C6WB 4ZJ2A 4DDSA 5DF8A 3OPHA 4H6JA 5FA7A 4EETB 4E3KA 2Y2PA 3LR5A 1HLUP 1GHPA 4HESA 1WE4A 5FAOA 3SS4A 1CEGA 4HJ3A 5HL1A 2A3UA 5GLBA 1XP4A 3SS3A 4GW9A 1G6AA 3R7WA 4EV4A 4MBHA 2QPNA 4OOLA 2VGLM 3BWLA 2V8CA 3OC2A 2R9WA 3OZHA 4YNRA 1MKIA 4N9LA 3CI6A 3SH8A 2O9BA 4EXOA 4U0XA 3BLSA 3IF6A 4R3JA 4EBLA 1F98A 5CGXA 3V3RA 1HD8A 2Y2JA 4BL3A 3NECA 2QKPA 3UY6A 3G30A 3BFEA 4R23A 3UB7A 3LI8A 5GLAA 2D02A 1STZA 4P6ZM 4FD8A 3C30A 3UDXA 4KZBA 3BY8A 2XFSA 1EWZA 4MNRA 3W2ZA 3IHAA 3F1NA 3GRJA 3M2KA 4HQAA 1OTDA 2L0WA 5DTTA 3MQ0A 3SS5A 5DJUA 4KZ7A 3V3SA 2ZQ8A 4MMNA 4JLFA 3L7HA 3BFGA 2V8FA 4HI4A 3RTYA 1IKIA 1GA0A 1XPBA 1OTBA 4CJNA 1H3QA 1ESUA 1IYPA 3LR0A 1JTDA 3SOIA 3PR6A 3WS0A 1FOFA 5FEGA 3C7VA 1CI9A 2INWA 5AVEA 2NUTC 4EEUA 4P6BA 2VZWA 1KE0A 3DTIA 4I3JA 1NRFA 4S2OA 4UHUA 3ZNTA 3LY4A 1JNUA 2Y2KA 1W7FA 2BLSA 2XRNA 2PYRA 3FZCA 1S0WA 4UA7A 5KSHA 4DJ2A 3HUNA 1LSXA 1G6OA 2H0TA 4GHIB 3FWLA 3PBNA 4N9KA 4Y3IA 3C38A 1XGIA 3VP3A 2EFXA 3B33A 3T1XA 3C2WA 4O7DA 4HJ4A 2KDKA 5EM0A 4GJ4A 3A0RA 4K08A 2CC1A 4LGWA 3M6HA 3ZVWA 1G68A 3MR0A 2ZD8A 3MKFA 4JKTA 4NK3A 2ZQ9A 3M6BA 4EWFA 3NOPC 4GDBA 1LSVA 3QP8A 4GN2A 2W1TB 1WYBA 3HJIA 1M6KA 1PWCA 4S2NC 1YQSA 2NUPC 2WKQA 5E2GA 4PM9A 3UPPA 4OQ0A 5CTMA 1VQQA 1KOUA 4KZ9A 2WGWA 3OPRA 1KE4A 3UE1A 1YAXA 3CHWP 3UMDA 1JWVA 4OONA 3N8RA 1BYWA 5J7EA 3C5AA 3NCKA 3TJZC 2BASA 2V0UA 4X25A 5DTSA 1SKOB 4P87A 1I2SA 3RXXA 5AQ7A 4B93A 4C3QA 3IX8A 3DWZA 4H6JB 4GNUA 2XD1A 1O07A 2I9VA 5E2HA 3ZG5A 4BLMA 1E3UA 5HZHA 3BYDA 3B3XA 1VB6A 2JN7A 2K7SA 4G3VA 3WS4A 4ID4A 5CECA 3E98A 1S1YA 5FL3A 3R7WB 3G4PA 3UDIA 2OSUA 2ZC5B 2EXAA 4ZBEA 4OKPA 3CUEA 3H82A 1CF0A 1ODVA 3A0VA 4NEED 2EFUA 3P98A 1HZOA 3IF6B 3BY9A 4BL2A 4HIAA 3EGXC 5HFOA 3WRZA 5FSRA 3CLOA 4PHTA 1W63Q 5E2FA 3IXDA 2V20A 3QNCA 3TE8A 3EGDC 3HBRA 2VEAA 3LR4A 1MWUA 3A3DA 2B5RA 5KSCA 1YPRA 2WGVA 3F1NB 3T4JA 2B18A 1LT0A 1Z09A 1ES2A 3H7WA 3V5MA 4F94A 1RP5A 4R4SA 3PBQA 1MZUA 5HARA 5CGWA 3O88A 3OPLA 2UWXA 3U2AA 4FSFA 4KUKA 3IF5A 4F3LA 5M1AA 2W1RA 1E3UD 3CG5A 3N8LA 4E6WA 1K54C 3S1YA 4U0TA 4MN7A 5FQJA 5HDCA 1ZHHB 2P04A 3GMWA 5HX9A 1ONGA 4XXRA 1TS7A 4IBRA 5I5LA 4NXBA 2Z6CA 2ZQAA 3LR3A 4CPKA 4ARZA 2ZC7A 1JWPA 1NZUA 2QWSA 1GCEA 3CWFA 2Z6DA 5CEDA 4WYYA 4U3TA 4UQIM 3T4KA 3SZTA 1NWZA 1SCWA 4DXBA 2XLNA 2Z2MB 3RJUA 1FILA 3PBOA 5AJGA 3DAVA 3IWQA 1NLZA 5IS1A 1LLBA 4KQDA 3EQUA 4BJPA 1HTZA 1GHMA 2W3DA 3FC7A 2ZJ9A 4LV3A 1G28A 3E2LA 3UE6A 2HZ5A 3IHBA 2GNXA 3ZCZA 3GV9A 4EESA 4E6XA 3Q7ZA 4IEDA 3M2JA 2KX6A 4KZ6A 5EOEA 5HL6A 3CAXA 2WGIA 5DTKA 2XROA 5EVIA 1S1ZA 4FTXA 3ZGAB 2A24A 1PZOA 2WGWB 1IYOA 2EX8A 2JBFA 2DMWA 3EQVA 4E3JA 4OOYA 5J8XA 3NBLA 1Q2PA 3KYQA 4OP8A 3BRMA 4QPRA 2QJ7A 3DTMA 3HLCA 1MBLA 2ZM2A 3IQAA 5EECA 1XJ3A 1PFLA 3UB6A 4D60A 4EBPA 3UB9A 2BG1A 1FCNA 1DJCA 4JGRA 2HDQA 3VV4A 2X01A 4KZ8A 2FZ0A 3ZVTA 1OT9A 3Q07A 3Q82A 4S2NA 3E4QA 4WBGA 2Y91A 2E8JA 4Y13A 2W3GA 1GA9A 1DP6A 4WMCA 3D3OA 3BFFA 5HPIA 3NDEA 4EERA 2O99A 2YKHA 1PYYA 4KQOA 2Q9NA 1DJAA 1FR1A 3K2NA 5DKLA 1H5XA 1N9BA 4N92A 3H82B 1IELA 3VSKA 1BT5A 4YFMA 2QHKA 4WN5A 1ERMA 5EVID 1JTGA 4BQMA 3PHYA 2XSSA 5FQKA 1W63M 4GS9A 4JBFA 4X53A 3IBRA 4A5RA 4X69A 5DFYA 4X68A 5HSQA 3PBTA 3HLBA 2P7JA 2J3TD 1SDEA 3EEAA 5CHUA 3KYEA 1NYYA 4EQIA 2DCFA 3ZG8B 5L8MA 4FUWA 2ZOIA 3S22A 1K57C 1W8QA 3SH7A 4EU0A 3H7WB 4Q8IA 1FR6A 3LIFA 5DVAA 5F69A 5L07A 1YMXA 4WELA 4NXGA 2J7VA 4F3LB 4S2JA 5K5BA 5A91A 1YLPA 3A3FA 3IXHA 2LB5A 4WMCD 1OMEA 1AWIA 1KE3A 5MC7A 1UGUA 1UWPX 1MWTA 2ZC3B 5I94A 2HP6A 1L3LA 1N9NA 3BJNA 4MN6A 3QP5A 3DTEA 1PIOA 5E43A 3PAGA 1E25A 4ARZB 2PD8A 4O01A 4E3NA 4GD8A 4GDNA 3UN7A 2Y2NA 3UNWA 3WS5A 3EEHA 1LL5A 3MFXA 2J9OA 2PD7A 3GTCA 3NHQA 3MZDA 1T1CA 2PR6A 1K55C 1K54A 4RX2A 1SZVA 3HUOA 3AGDA 2QJ5A 2ZL1A 1YSQA 1TDLA 1K4FA 4HBUA 4LV2A 2PAVP 4WZ5C 2XR0A 2I72A 1NYMA 1T1BA 2HP9A 4GOGA 3UE3A 3LIAA 3LFVA 3LO7A 4R0QA 1TS6A 1F9IA 3A3IA 4I3AA 4KENB 4RQ9A 1OJGA 2V1ZA 4OP5A 5JYOA 3O3VA 2QMIA 4KG6A 4RA7A 4OLGA 5EVIB 3LCEA 3O87A 2A24B 1KVLA 3D72A 5DFXA 3T4OA 5CHJA 3C7UA 2LB9A 2XQZA 5F82A 4JF6A 3H9WA 5GLCA 1SHVA 1C3BA 3QNBA 4QHCA 2VGJA 3VP2A 4NXEA 1DRMA 3T1RA 4DN0A 1ACFA 4OVDA 3BFDA 2GX5A 1YKDA 4FCFA 4KZAA 1BTLA 3ZYTA 4JF4A 4NETA 4B9OA 4OLDA 2HJ9C 1TVFA 4DJ3A 1JWZA 4UA9A 3W4PA 3MS6A 3OBFA 1OJ5A 1K38A 1KGFA 4JXVA 4I39A 4WF0A 4DE3A 1GSWA 1BULA 4BMWA 1NZOA 1FSWA 1GHIA 1L0FA 3ZG0A 3N8SA 2QYBA 1H8MA 1D7EA 4RVAA 1ZC2A 2Y55A 3KSFA 5F83A 5IHVA 4Y15A 5DJTA 1S4RA 1E4DA 4HOIA 2B02A 3VOYA 1LL9A 4QB8A 1NJ4A 2Z2LB 1QMFA 1S67L 3UPNA 2ZC4B 4OPQA 4GS9B 4CLCA 2WAFA 3CZDA 2WKPA 3N7WA 5GL9A 3G2ZA 1L2SA 4D2OA 5EVLA 1BLCA 3LICA 1XX2A 4BENA 3KSHA 4QY6A 3KSIA 2ZQ7A 1GSVA 4Y0OA 2WADA 3T12B 2V0WA 3PYPA 2PR5A 1H0MA 4Q0JA 5EFWA 3P7NA 4QWOA 4Y0UA 5AQAA 3ZFZA 2W27A 1PI4A 1K4EA 4LRYC 3F1OA 4EBNA 1ES3A 2XGNA 4DF6A 5BOHA 2VKSA 2WYXA 1BLHA 2EXBA 2JE5A 4IUHA 2QZ6A 2G7UA 4DDYA 3OCNA 1ES5A 2WK0A 1CJFA 3MZFA 5FQMA 4RYEA 4BBVA 3GDIA 3CITA 1ZKJA 3LUQA 3PBRA 1PW1A 4H8RA 1TF1A 4JGPA 4CQHA 4L9EA 1PNEA 3C8CA 5TBMA 3R4KA 5G4YA 4DRTA 2K2NA 5L09A 3MKEA 3HL9A 4ME4A 5F1GA 5TGFA 4EQ1A 1K57A 1LSWA 5HD3A 3B47A 1CI8A 3ULFA 2XEPA 3NC8A 3K3DA 2VGKA 5KIZA 2KLIA 1ZG4A 1KGEA 4JXGA 3LGOA 4GD6A 1MPLA 1IFQA 4FH4A 5L10A 3CMZA 3UO9A 3G6OA 1BZAA 4CLCD 1OTEA 3AGEA 2ZL1B 3MBZA 3DTKA 2G2WA 2VLGA 2H5SA 1MC0A 3VE4A 3TW8A 2Y2MA 5M18A 1O7EA 1WA9A 1NRJA 3EWKA 1ERQA 4Z9QA 2XDMA 4X1MA 3ZNYA 5U47A 1J3WA 1GSXA 3T4QA 4MCWA 1S4SA 3ZG9B 1U60A 3UDFA 1M40A 1VETA 3LI9A 1S6RA 1YSPA 5TFQA 4LV1A 4OPYA 2X02A 3E2KA 2O0YA 1CQAA 1F2KA 1QMEA 1YT4A 3FPWA 5EUAA 5HWWA 3OPPA 3Q1FA 4UA6A 3K3CA 1YLWA 4PM5A 3HREA 4EEPA 3SW1A 1KDSA 4IBXA 1FCOA 3G32A 3OOVA 3JYIA 3TSGA 3TG9A 4R3BA 3S7NA 2EX6A 4L9GA 3ZHHA 5EVEA 1MWSA 4XUXA 2EA9A 5C5KA 3KSGA 4KZ3A 3GECA 2WAEA 5AQ9A 5HDDA 4LENA 1UWNX 4PM6A 2V2FF 5TR7A 4DE0A 1ESIA 5F68A 1ALQA 4PM8A 2DRWA 3MZEA 4PKYA 2PU2A 3I7JA 3JVUA 2B95A 2X71A 2VV8A 2PU4A 5FDHA 1Z6FA 5CRFA 5FAPA 2PYPA 3GQZA 4YOFA 4P0MA 4HHDA 4OQGA 5HAPA 4LRXC 1BLPA 3MXQA 2P9VA 1D1JA 4CLCE 1BUEA 2YKFA 4KZ4A 1HVBA 4P85A 3T4LA 3E4PA 4OPRA 4ETZA 2EX9A 2H0YA 4S2KA 4B88A 1G5UA 4ZJ3A 2VJWA 3QP2A 3TOIA 4OOMA 2PHYA 2JC7A 1EI5A 2C5WB 4K0XA 4QD4A 4CLCB 4XT2A 2OOLA 4BWIA 2HJEA 4DKIA 3BFCA 2ZM0A 3LIBA 3FKWA 3W4QA 3VFFA 2ZOHA 2OAP1 4GLQA 5J4EA 2VK3A 3S4XA 4JPMA 3C4OA 1XA7A 4OQHA 4IHQA 4Y17A 2EWVA 3VE3A 1MY8A 4PKYG 3UMEA 3VSLA 5G18A 5DKKA 1DP8A 2Y2IA 3O5YA 5EE8A 1KDWA 3F1OB 2JKTI 1F5MA 1RGZA 4M3KA 3F1PA 3RH8B 4HP9A 1P9RA 1P0ZA 4Y0TA 2FFYA 3GVBA 2M1CA 2Q9MA 4C6YA 3IBJA 4ESPA 2EWWA 3VMAA 5HWVA 5A93A 1XFQA 5FI2A 4R6LA 1LL8A 3IXGA 1L0GA 3AGFA 1T18A 4R1GA 5TBMB 3CUEC 2ZBBA 1BLSA 1IYQA 1FIKA 1K6SA 4NKPA 5FAQA 3T1SA 4L0LA 2Y2OA 4YINA 4HBTA 1W8YA 2PBDP 4C75A 4Y2FA 1H8ZA 4HP4A 4GCZA 3LEZA 5DF7A 2HPBA 2GZAA 4R70A 2WZZA 5CHMA 5EM1A 4WM9A 1PRQA 4DE1A 4PMAA 4M4XA 5F1FA 2IWCA 1XA1A 3IS2A 3NULA 4DMZA 5CERA 4MBKA 1T19A 3UE0A 2VGLS 4ZJ1A 1VM1A 3QHYA 2O9CA 1K6RA 4QY5A 3HUMA 2J80A 4Z1WA 2OV5A 3ZG7B 4GB7A 1CEFA 3NDGA 4MDZA 4MEZA 1VETB 4X56A 1OTIA 4EW7A 4HJ6A 1FCMA 5GHZA 2XD5A 3ISGA 3NIAA 3FG8A 2W3FA 1ZTUA 5LBRA 2PRFA 1I2WA 1D06A 3MSHA 5TJJA 3CPTA 3A3EA 1VEUA 2HDSA 4OQIA 4P6ZS 5CX7A 4EUZA 1K0KA 4QJGA 3TRCA 3SH9A 3IT9A 3E4OA 5HAIA 4JGOA 4JXSA 2Y4AA 2R9XA 4ZDXA 1KVMA 4NXFA 2EX2A 5GHYA 4LCLA 4E04A 4HNBA 3WWXA 3G31A 5CGSA 4IJGA 2WZXA 1RCJA 3B42A 3T1QB 3LEQA 2ZQCA 4IUKA 4Y5FA 3ZQ5A 2W0NA 2R78A 3D4FA 1SDNA 5FI6A 3JVVA 3GSGA 4LCMA 2JKTM 4MN5A 3BQAA 1XGJA 2UV0E 3LIDA 5M19A 4PAUA 4HEFA 4OH0A 3HLFA 2HP5A 3G2YA 3S7PA 4BBUA 4WEKA 3NOTC 3W8KA 3LY3A 4YWZA 1LI0A 3S7OA 2J8YA 2P9VB 5AQBA 2O9AA 4N1XA 3P01A 2FH5A 4KG2A 2W3HA 1OTAA 1N9LA 5EVIC 5FQ9A 3ITBA 3HLGA 3ITAA 5CEBA 1ONHA 2CMNA 4XT2B 2VV7A 3Q7VA 4JXWA 4R3AA 4O0PA 1IYSA 2Y2QA 2J3TC 1TDGA 1Y28A 1TD5A 1A0KA 2PBYA 1P97A 2FFFB 3DWKA 3QP6A 2JKGA 4OPZA 5HW3A 1XJ4A 2BTFP 2V9AA 4R4RA 3JPUA 4WUJA 3IH8A 3VP1A 1VHMA 4UAAA 3MMHA 3KO6A 4LFUA 2MJ6A 1LHYA 4G3KA 3VOZA 1WYCA 3QP4A 3F1PB 2ZMAA 3BM6A 4ZAMA 1SKFA 3BW6A 1MXOA 3IH9A 1XKZA 3S7QA 5FQIA 1NLYA 4IVIA 1FSYA 1OT6A 4R38A 2P08A 1KGGA 3MF0A 4KZ5A 4LV0A 1RGYA 3Q81A 3DBAA 3G34A 3WS1A 2WKHA 2VA0A 1Q2QA 3N4IA 3HVFA 2XFTA 4E3IA 3U4LP 3BECA 3VP4A 3V39A 2ZLYA 1AXBA 3VOLA 2AVXA 5GLDA 4GKUA 5F5YA 4II7A 5A92A 5FATA 2J3WA 4G3WA 4RX3A 4FOFA 5F6AA 2JKFA 1P9WA 2XH9A 1CK3A 3HLEA 2W3EA 5EV0A 2ZMVA 4B4XA 1FQGA 3KX0X 4B4ZA 2A49A 1YLZA 4GZBA 5EPHA 2L1MA 4K0WA 2XA7M 2JKRI 2XA7S 1N4OA 3IS2B 3PAEA 3FKVA 4ZTKA 4Y7PA 5FI7A 3NJAA 1J9MA 5HWTA 4LRZE 4WEJA 3BEBA 2RL3A 3HLDA 3D9YA 3QP1A 1Y54A 3C4PA 3O86A 3IWOA 3MQOA 4Q0HA 4BD1A 2M7UA 1I5QA 2IWBA 1PWDA 1MWRA 4E3OA 1L0EA 4I5SA 3IF6C
chains in the Genus database with same CATH topology
2J7VA 4S2JA 4P0MA 4OQGA 5HAPA 1BLPA 2CC1A 5A91A 1YLPA 2P9VA 3A3FA 3M6HA 3RXWA 3IXHA 3ZVWA 1G68A 1BUEA 4KQRA 3MFDA 1XXMA 4WMCD 4KZ4A 1HVBA 3NY4A 3ZDJA 2ZD8A 4BD0A 3MKFA 4JKTA 4P85A 4NK3A 1OMEA 2ZQ9A 3M6BA 4OPRA 2EX9A 4EWFA 2H0YA 3PTEA 4S2KA 4B88A 4GDBA 4S2IA 1KE3A 4ZJ3A 1NXYA 4GN2A 5D3OA 1MWTA 1WYBA 2ZC3B 3TOIA 1M6KA 4OOMA 5I94A 2JC7A 1EI5A 2HP6A 4E3MA 1PWCA 4S2NC 1YQSA 2WKEA 1PI5A 3IWIA 1YMSA 2C5WB 4K0XA 4QD4A 5E2GA 1PZPA 4PM9A 3UPPA 4OQ0A 1PIOA 5CTMA 5E43A 1VQQA 4DKIA 5JYPA 3BFCA 3PAGA 1E25A 2ZM0A 4KZ9A 4X55A 2WGWA 4IVKA 3FKWA 3W4QA 4GD8A 4E3NA 1K56A 4GDNA 3VFFA 3UN7A 3OPRA 1KE4A 3UE1A 2Y2NA 1H8YA 1JWVA 4OONA 2HDUA 3N8RA 3FV7A 3UNWA 3WS5A 3S4XA 4JPMA 3C5AA 1LL5A 1XA7A 3C4OA 3NCKA 3NI9A 4OQHA 4MBFA 1PWGA 2Y2GA 2J9OA 2P74A 3GTCA 3MZDA 1MY8A 5EOOA 3IXBA 3VSLA 1K55C 1K54A 5G18A 4RX2A 3CJMA 1TEMA 2HDRA 3HUOA 5DF9A 3AGDA 5DTSA 4P87A 2WKIA 1I2SA 2Y2IA 3RXXA 4HBUA 1TDLA 1K4FA 4LV2A 5EE8A 1K55A 1KDWA 4WZ5C 5AQ7A 3WRTA 3WS2A 2XR0A 5L2FA 4C3QA 3DWZA 2I72A 1RGZA 2DNSA 4M3KA 1NYMA 2HP9A 1IKGA 4GNUA 4Y0TA 2XD1A 1O07A 2FFYA 4WZ5A 3GVBA 5E2HA 4GOGA 3UE3A 3ZG5A 4BLMA 1E3UA 2Q9MA 4C6YA 3G35A 3LO7A 1K25A 4R0QA 3BYDA 3VMAA 3N6IA 3A3IA 5A93A 3B3XA 5FI2A 4S2PA 4KENB 3WS4A 4ID4A 5CECA 3IXGA 1L0GA 3AGFA 2V1ZA 4R1GA 5GHXA 3G4PA 4OP5A 4KQQA 3O3VA 2QMIA 3PBSA 3UDIA 5HAQA 4KG6A 2OSUA 1BLSA 1IYQA 1YLJA 4OLGA 4RA7A 5CXWA 5EVIB 1NY0A 2ZM8A 2ZC5B 3LCEA 3Q7VB 3O87A 2EXAA 4ZBEA 1K6SA 4OKPA 1KVLA 4E3LA 5FAQA 2JCHA 5CHJA 3C7UA 4X6TA 2XQZA 5F82A 3FYZA 4L0LA 2Y2OA 4JF5A 3BLMA 4YINA 4JF6A 4HBTA 1W8YA 1ES4A 3VP0A 2EFUA 5GLCA 4C75A 2G2UA 1SHVA 5A90A 1C3BA 1H8ZA 3QNBA 4DXCA 3P98A 2VGJA 3A3JA 1HZOA 4QHCA 3IF6B 1BSGA 1IEMA 3LEZA 3VP2A 5DF7A 2HPBA 4BL2A 4DE2A 5HFOA 2WZZA 5CHMA 3WRZA 1YLYA 4WM9A 2ZC6B 4OVDA 4DE1A 5FSRA 4PMAA 3BFDA 5F1FA 4KZAA 4FCFA 1BTLA 5E2EA 4JF4A 2IWCA 4NETA 3VFHA 3P09A 4OLDA 1XA1A 5E2FA 1K56D 5CERA 3IXDA 3MXRA 4MBKA 1TVFA 1JWZA 3UE0A 4UA9A 2WUQA 3W4PA 2V20A 3QNCA 3HBRA 4ZJ1A 1VM1A 1DY6A 4QU3A 1MWUA 3QHYA 1K6RA 3A3DA 2B5RA 1K38A 1KGFA 4QY5A 5KSCA 2WGVA 3HUMA 4JXVA 4DE3A 2OV5A 1PW8A 3ZG7B 1BULA 1ES2A 4GB7A 1CEFA 3NDGA 4MEZA 4X56A 3V5MA 5KMWA 3HLWA 4F94A 5FQQA 1DJBA 1NZOA 1RP5A 2Y2LA 4FH2A 3PBQA 4R4SA 1FCMA 1FSWA 5GHZA 5HARA 1JVJA 2XD5A 5CGWA 4KG5A 3O88A 3ISGA 3NIAA 5FASA 1GHIA 3OPLA 2UWXA 4FSFA 1L0FA 2Y2HA 3ZG0A 3IF5A 3N8SA 5M1AA 1E3UD 3GR2A 3CG5A 3N8LA 4N1HA 1W5DA 4RVAA 4PPRA 4E6WA 1I2WA 1ZC2A 2Y55A 1K54C 1W79A 3S1YA 5F83A 4S2MA 4U0TA 5IHVA 3A3EA 2HDSA 4OQIA 4EUZA 2RCXA 1E4DA 4K91A 5FQJA 5JYOA 1ZG6A 4QJGA 2J9PA 3VOYA 2XF3A 3SH9A 3IT9A 1LL9A 5HAIA 4QB8A 1NJ4A 2Z2LB 1QMFA 4JXSA 4PM7A 2Y4AA 3GMWA 3UPOA 2R9XA 5HX9A 1ONGA 4WZ4A 4XXRA 4XUZA 3V50A 4ZDXA 3OCLA 1KVMA 4IBRA 2EX2A 5GHYA 3UPNA 4LCLA 2ZC4B 1YLTA 2H10A 3WWXA 3G31A 5CGSA 4OPQA 4MLLA 2WAFA 2ZQAA 2WZXA 1EROA 3CZDA 1RCJA 3W4OA 4CPKA 1LI9A 3DW0A 3N7WA 5GL9A 2ZC7A 2ZQCA 3G2ZA 1L2SA 4D2OA 1JWPA 2OLUA 1NZUA 5EVLA 5KZHA 1BLCA 2GDNA 1YM1A 1XX2A 4BENA 1GCEA 2E8IA 4QY6A 2XK1A 4Y0OA 2ZQ7A 3MXSA 4WYYA 3D4FA 5CEDA 1SDNA 5CTNA 4U3TA 2WADA 5FI6A 3GSGA 2Y59A 1SCWA 4LCMA 4DXBA 1L0DA 2XLNA 2Z2MB 1XGJA 4Y0UA 5M19A 5AQAA 3RJUA 3PBOA 2ZQDA 4S2LA 3ZFZA 3IWQA 1LLBA 4HEFA 4OH0A 2OLVA 3HLFA 2HP5A 2IWDA 1PI4A 3G2YA 1K4EA 2C6WB 3EQUA 4EBNA 4WEKA 1ES3A 2XGNA 3LY3A 4ZJ2A 3W8KA 4BJPA 1HTZA 2WYXA 5DF8A 4DDSA 3OPHA 1GHMA 5BOHA 5FA7A 2ZJ9A 1BLHA 2EXBA 4LV3A 2JE5A 4DF6A 1LI0A 3E2LA 4E3KA 2J8YA 2Y2PA 2P9VB 2QZ6A 3IHBA 1GHPA 4HESA 4DDYA 3OCNA 1WE4A 5AQBA 5FAOA 3SS4A 4N1XA 3ZCZA 1ES5A 3GV9A 2WK0A 5FQMA 3MZFA 1CEGA 4E6XA 4RYEA 5HL1A 3Q7ZA 4KG2A 4IEDA 2A3UA 3M2JA 5GLBA 1XP4A 1ZKJA 3PBRA 4KZ6A 1PW1A 4H8RA 5EOEA 3SS3A 5EVIC 2WGIA 5FQ9A 3ITBA 1G6AA 5DTKA 3HLGA 4EV4A 3ITAA 5CEBA 4MBHA 2QPNA 4OOLA 4DRTA 3MKEA 5EVIA 1ONHA 3HL9A 3Q7VA 4JXWA 5F1GA 5TGFA 3ZGAB 1K57A 3OC2A 1IYSA 1PZOA 2R9WA 2Y2QA 2WGWB 1IYOA 1TDGA 2EX8A 2JBFA 1CI8A 3OZHA 3EQVA 1MKIA 2XEPA 4N9LA 2PBYA 3NC8A 3SH8A 4E3JA 4OOYA 5J8XA 2FFFB 3DWKA 2VGKA 3NBLA 4U0XA 4OPZA 1ZG4A 5HW3A 1KGEA 3BLSA 1Q2PA 3IF6A 4R4RA 3VP1A 3IH8A 4R3JA 4EBLA 4UAAA 4JXGA 4GD6A 4OP8A 3BRMA 1MPLA 5CGXA 1HD8A 3V3RA 3DTMA 4FH4A 3HLCA 1MBLA 2Y2JA 4BL3A 2ZM2A 3CMZA 3UO9A 1LHYA 1BZAA 3IQAA 3VOZA 1WYCA 5EECA 3AGEA 3MBZA 2G2WA 3G30A 3UY6A 2H5SA 3BFEA 4EBPA 2BG1A 1FCNA 1DJCA 4R23A 2HDQA 2ZMAA 2Y2MA 3BM6A 4ZAMA 5M18A 1O7EA 5GLAA 1SKFA 2X01A 4FD8A 3UDXA 1ERQA 4KZ8A 4Z9QA 1MXOA 2XDMA 3IH9A 1XKZA 3ZVTA 4KZBA 3Q82A 3Q07A 5FQIA 4S2NA 2XFSA 3ZNYA 4IVIA 5U47A 4WBGA 2Y91A 1FSYA 1EWZA 4MNRA 1GA9A 3IHAA 3GRJA 4WMCA 3BFFA 3M2KA 3ZG9B 5DTTA 1KGGA 3SS5A 1U60A 3UDFA 1M40A 4KZ5A 4LV0A 1RGYA 3NDEA 3Q81A 1S6RA 4KZ7A 3V3SA 2ZQ8A 3G34A 4JLFA 3WS1A 5TFQA 2WKHA 3BFGA 4LV1A 4OPYA 1PYYA 1Q2QA 2X02A 3E2KA 3N4IA 3HVFA 4KQOA 2Q9NA 1DJAA 1FR1A 2XFTA 1IKIA 1QMEA 4E3IA 1H5XA 1YT4A 3BECA 3VP4A 1N9BA 4N92A 1GA0A 1XPBA 2ZLYA 1AXBA 3V39A 5GLDA 1IELA 4GKUA 5EUAA 3VSKA 4CJNA 1ESUA 5A92A 1IYPA 1BT5A 5FATA 1JTDA 4YFMA 4RX3A 3OPPA 3Q1FA 4UA6A 3SOIA 1YLWA 3WS0A 1FOFA 1CK3A 2XH9A 3HLEA 3HREA 4PM5A 1ERMA 1KDSA 4IBXA 3C7VA 1CI9A 4B4XA 1FCOA 3G32A 1FQGA 3JYIA 3TSGA 4B4ZA 2A49A 3TG9A 1YLZA 4R3BA 4GZBA 4P6BA 5EVID 2EX6A 5EPHA 3ZHHA 1JTGA 4BQMA 5FQKA 1MWSA 4K0WA 4XUXA 1KE0A 4JBFA 4X53A 1N4OA 1NRFA 4A5RA 3PAEA 4X69A 4S2OA 4UHUA 4KZ3A 5AQ9A 2WAEA 3FKVA 4ZTKA 3ZNTA 4X68A 4Y7PA 4LENA 3PBTA 4PM6A 2V2FF 3LY4A 3HLBA 5TR7A 5FI7A 2Y2KA 1W7FA 1SDEA 2BLSA 4DE0A 1J9MA 1ESIA 3FZCA 1S0WA 4UA7A 5CHUA 1ALQA 1NYYA 4EQIA 4WEJA 5KSHA 3HUNA 3BEBA 2DCFA 2H0TA 2RL3A 3HLDA 3ZG8B 3FWLA 4PM8A 3S22A 1K57C 3PBNA 1W8QA 2DRWA 4N9KA 3MZEA 3SH7A 1XGIA 3VP3A 1Y54A 1FR6A 4Q8IA 3C4PA 3O86A 2PU2A 2EFXA 3IWOA 3I7JA 5DVAA 4BD1A 2X71A 1I5QA 2IWBA 1PWDA 1MWRA 4E3OA 1L0EA 1YMXA 2PU4A 4O7DA 4WELA 5FDHA 1Z6FA 5CRFA 5FAPA 3IF6C 3GQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J7V A;  4S2J A;  4P0M A;  4OQG A;  5HAP A;  1BLP A;  2CC1 A;  5A91 A;  1YLP A;  2P9V A;  3A3F A;  3M6H A;  3RXW A;  3IXH A;  3ZVW A;  1G68 A;  1BUE A;  4KQR A;  3MFD A;  1XXM A;  4WMC D;  4KZ4 A;  1HVB A;  3NY4 A;  3ZDJ A;  2ZD8 A;  4BD0 A;  3MKF A;  4JKT A;  4P85 A;  4NK3 A;  1OME A;  2ZQ9 A;  3M6B A;  4OPR A;  2EX9 A;  4EWF A;  2H0Y A;  3PTE A;  4S2K A;  4B88 A;  4GDB A;  4S2I A;  1KE3 A;  4ZJ3 A;  1NXY A;  4GN2 A;  5D3O A;  1MWT A;  1WYB A;  2ZC3 B;  3TOI A;  1M6K A;  4OOM A;  5I94 A;  2JC7 A;  1EI5 A;  2HP6 A;  4E3M A;  1PWC A;  4S2N C;  1YQS A;  2WKE A;  1PI5 A;  3IWI A;  1YMS A;  2C5W B;  4K0X A;  4QD4 A;  5E2G A;  1PZP A;  4PM9 A;  3UPP A;  4OQ0 A;  1PIO A;  5CTM A;  5E43 A;  1VQQ A;  4DKI A;  5JYP A;  3BFC A;  3PAG A;  1E25 A;  2ZM0 A;  4KZ9 A;  4X55 A;  2WGW A;  4IVK A;  3FKW A;  3W4Q A;  4GD8 A;  4E3N A;  1K56 A;  4GDN A;  3VFF A;  3UN7 A;  3OPR A;  1KE4 A;  3UE1 A;  2Y2N A;  1H8Y A;  1JWV A;  4OON A;  2HDU A;  3N8R A;  3FV7 A;  3UNW A;  3WS5 A;  3S4X A;  4JPM A;  3C5A A;  1LL5 A;  1XA7 A;  3C4O A;  3NCK A;  3NI9 A;  4OQH A;  4MBF A;  1PWG A;  2Y2G A;  2J9O A;  2P74 A;  3GTC A;  3MZD A;  1MY8 A;  5EOO A;  3IXB A;  3VSL A;  1K55 C;  1K54 A;  5G18 A;  4RX2 A;  3CJM A;  1TEM A;  2HDR A;  3HUO A;  5DF9 A;  3AGD A;  5DTS A;  4P87 A;  2WKI A;  1I2S A;  2Y2I A;  3RXX A;  4HBU A;  1TDL A;  1K4F A;  4LV2 A;  5EE8 A;  1K55 A;  1KDW A;  4WZ5 C;  5AQ7 A;  3WRT A;  3WS2 A;  2XR0 A;  5L2F A;  4C3Q A;  3DWZ A;  2I72 A;  1RGZ A;  2DNS A;  4M3K A;  1NYM A;  2HP9 A;  1IKG A;  4GNU A;  4Y0T A;  2XD1 A;  1O07 A;  2FFY A;  4WZ5 A;  3GVB A;  5E2H A;  4GOG A;  3UE3 A;  3ZG5 A;  4BLM A;  1E3U A;  2Q9M A;  4C6Y A;  3G35 A;  3LO7 A;  1K25 A;  4R0Q A;  3BYD A;  3VMA A;  3N6I A;  3A3I A;  5A93 A;  3B3X A;  5FI2 A;  4S2P A;  4KEN B;  3WS4 A;  4ID4 A;  5CEC A;  3IXG A;  1L0G A;  3AGF A;  2V1Z A;  4R1G A;  5GHX A;  3G4P A;  4OP5 A;  4KQQ A;  3O3V A;  2QMI A;  3PBS A;  3UDI A;  5HAQ A;  4KG6 A;  2OSU A;  1BLS A;  1IYQ A;  1YLJ A;  4OLG A;  4RA7 A;  5CXW A;  5EVI B;  1NY0 A;  2ZM8 A;  2ZC5 B;  3LCE A;  3Q7V B;  3O87 A;  2EXA A;  4ZBE A;  1K6S A;  4OKP A;  1KVL A;  4E3L A;  5FAQ A;  2JCH A;  5CHJ A;  3C7U A;  4X6T A;  2XQZ A;  5F82 A;  3FYZ A;  4L0L A;  2Y2O A;  4JF5 A;  3BLM A;  4YIN A;  4JF6 A;  4HBT A;  1W8Y A;  1ES4 A;  3VP0 A;  2EFU A;  5GLC A;  4C75 A;  2G2U A;  1SHV A;  5A90 A;  1C3B A;  1H8Z A;  3QNB A;  4DXC A;  3P98 A;  2VGJ A;  3A3J A;  1HZO A;  4QHC A;  3IF6 B;  1BSG A;  1IEM A;  3LEZ A;  3VP2 A;  5DF7 A;  2HPB A;  4BL2 A;  4DE2 A;  5HFO A;  2WZZ A;  5CHM A;  3WRZ A;  1YLY A;  4WM9 A;  2ZC6 B;  4OVD A;  4DE1 A;  5FSR A;  4PMA A;  3BFD A;  5F1F A;  4KZA A;  4FCF A;  1BTL A;  5E2E A;  4JF4 A;  2IWC A;  4NET A;  3VFH A;  3P09 A;  4OLD A;  1XA1 A;  5E2F A;  1K56 D;  5CER A;  3IXD A;  3MXR A;  4MBK A;  1TVF A;  1JWZ A;  3UE0 A;  4UA9 A;  2WUQ A;  3W4P A;  2V20 A;  3QNC A;  3HBR A;  4ZJ1 A;  1VM1 A;  1DY6 A;  4QU3 A;  1MWU A;  3QHY A;  1K6R A;  3A3D A;  2B5R A;  1K38 A;  1KGF A;  4QY5 A;  5KSC A;  2WGV A;  3HUM A;  4JXV A;  4DE3 A;  2OV5 A;  1PW8 A;  3ZG7 B;  1BUL A;  1ES2 A;  4GB7 A;  1CEF A;  3NDG A;  4MEZ A;  4X56 A;  3V5M A;  5KMW A;  3HLW A;  4F94 A;  5FQQ A;  1DJB A;  1NZO A;  1RP5 A;  2Y2L A;  4FH2 A;  3PBQ A;  4R4S A;  1FCM A;  1FSW A;  5GHZ A;  5HAR A;  1JVJ A;  2XD5 A;  5CGW A;  4KG5 A;  3O88 A;  3ISG A;  3NIA A;  5FAS A;  1GHI A;  3OPL A;  2UWX A;  4FSF A;  1L0F A;  2Y2H A;  3ZG0 A;  3IF5 A;  3N8S A;  5M1A A;  1E3U D;  3GR2 A;  3CG5 A;  3N8L A;  4N1H A;  1W5D A;  4RVA A;  4PPR A;  4E6W A;  1I2W A;  1ZC2 A;  2Y55 A;  1K54 C;  1W79 A;  3S1Y A;  5F83 A;  4S2M A;  4U0T A;  5IHV A;  3A3E A;  2HDS A;  4OQI A;  4EUZ A;  2RCX A;  1E4D A;  4K91 A;  5FQJ A;  5JYO A;  1ZG6 A;  4QJG A;  2J9P A;  3VOY A;  2XF3 A;  3SH9 A;  3IT9 A;  1LL9 A;  5HAI A;  4QB8 A;  1NJ4 A;  2Z2L B;  1QMF A;  4JXS A;  4PM7 A;  2Y4A A;  3GMW A;  3UPO A;  2R9X A;  5HX9 A;  1ONG A;  4WZ4 A;  4XXR A;  4XUZ A;  3V50 A;  4ZDX A;  3OCL A;  1KVM A;  4IBR A;  2EX2 A;  5GHY A;  3UPN A;  4LCL A;  2ZC4 B;  1YLT A;  2H10 A;  3WWX A;  3G31 A;  5CGS A;  4OPQ A;  4MLL A;  2WAF A;  2ZQA A;  2WZX A;  1ERO A;  3CZD A;  1RCJ A;  3W4O A;  4CPK A;  1LI9 A;  3DW0 A;  3N7W A;  5GL9 A;  2ZC7 A;  2ZQC A;  3G2Z A;  1L2S A;  4D2O A;  1JWP A;  2OLU A;  1NZU A;  5EVL A;  5KZH A;  1BLC A;  2GDN A;  1YM1 A;  1XX2 A;  4BEN A;  1GCE A;  2E8I A;  4QY6 A;  2XK1 A;  4Y0O A;  2ZQ7 A;  3MXS A;  4WYY A;  3D4F A;  5CED A;  1SDN A;  5CTN A;  4U3T A;  2WAD A;  5FI6 A;  3GSG A;  2Y59 A;  1SCW A;  4LCM A;  4DXB A;  1L0D A;  2XLN A;  2Z2M B;  1XGJ A;  4Y0U A;  5M19 A;  5AQA A;  3RJU A;  3PBO A;  2ZQD A;  4S2L A;  3ZFZ A;  3IWQ A;  1LLB A;  4HEF A;  4OH0 A;  2OLV A;  3HLF A;  2HP5 A;  2IWD A;  1PI4 A;  3G2Y A;  1K4E A;  2C6W B;  3EQU A;  4EBN A;  4WEK A;  1ES3 A;  2XGN A;  3LY3 A;  4ZJ2 A;  3W8K A;  4BJP A;  1HTZ A;  2WYX A;  5DF8 A;  4DDS A;  3OPH A;  1GHM A;  5BOH A;  5FA7 A;  2ZJ9 A;  1BLH A;  2EXB A;  4LV3 A;  2JE5 A;  4DF6 A;  1LI0 A;  3E2L A;  4E3K A;  2J8Y A;  2Y2P A;  2P9V B;  2QZ6 A;  3IHB A;  1GHP A;  4HES A;  4DDY A;  3OCN A;  1WE4 A;  5AQB A;  5FAO A;  3SS4 A;  4N1X A;  3ZCZ A;  1ES5 A;  3GV9 A;  2WK0 A;  5FQM A;  3MZF A;  1CEG A;  4E6X A;  4RYE A;  5HL1 A;  3Q7Z A;  4KG2 A;  4IED A;  2A3U A;  3M2J A;  5GLB A;  1XP4 A;  1ZKJ A;  3PBR A;  4KZ6 A;  1PW1 A;  4H8R A;  5EOE A;  3SS3 A;  5EVI C;  2WGI A;  5FQ9 A;  3ITB A;  1G6A A;  5DTK A;  3HLG A;  4EV4 A;  3ITA A;  5CEB A;  4MBH A;  2QPN A;  4OOL A;  4DRT A;  3MKE A;  5EVI A;  1ONH A;  3HL9 A;  3Q7V A;  4JXW A;  5F1G A;  5TGF A;  3ZGA B;  1K57 A;  3OC2 A;  1IYS A;  1PZO A;  2R9W A;  2Y2Q A;  2WGW B;  1IYO A;  1TDG A;  2EX8 A;  2JBF A;  1CI8 A;  3OZH A;  3EQV A;  1MKI A;  2XEP A;  4N9L A;  2PBY A;  3NC8 A;  3SH8 A;  4E3J A;  4OOY A;  5J8X A;  2FFF B;  3DWK A;  2VGK A;  3NBL A;  4U0X A;  4OPZ A;  1ZG4 A;  5HW3 A;  1KGE A;  3BLS A;  1Q2P A;  3IF6 A;  4R4R A;  3VP1 A;  3IH8 A;  4R3J A;  4EBL A;  4UAA A;  4JXG A;  4GD6 A;  4OP8 A;  3BRM A;  1MPL A;  5CGX A;  1HD8 A;  3V3R A;  3DTM A;  4FH4 A;  3HLC A;  1MBL A;  2Y2J A;  4BL3 A;  2ZM2 A;  3CMZ A;  3UO9 A;  1LHY A;  1BZA A;  3IQA A;  3VOZ A;  1WYC A;  5EEC A;  3AGE A;  3MBZ A;  2G2W A;  3G30 A;  3UY6 A;  2H5S A;  3BFE A;  4EBP A;  2BG1 A;  1FCN A;  1DJC A;  4R23 A;  2HDQ A;  2ZMA A;  2Y2M A;  3BM6 A;  4ZAM A;  5M18 A;  1O7E A;  5GLA A;  1SKF A;  2X01 A;  4FD8 A;  3UDX A;  1ERQ A;  4KZ8 A;  4Z9Q A;  1MXO A;  2XDM A;  3IH9 A;  1XKZ A;  3ZVT A;  4KZB A;  3Q82 A;  3Q07 A;  5FQI A;  4S2N A;  2XFS A;  3ZNY A;  4IVI A;  5U47 A;  4WBG A;  2Y91 A;  1FSY A;  1EWZ A;  4MNR A;  1GA9 A;  3IHA A;  3GRJ A;  4WMC A;  3BFF A;  3M2K A;  3ZG9 B;  5DTT A;  1KGG A;  3SS5 A;  1U60 A;  3UDF A;  1M40 A;  4KZ5 A;  4LV0 A;  1RGY A;  3NDE A;  3Q81 A;  1S6R A;  4KZ7 A;  3V3S A;  2ZQ8 A;  3G34 A;  4JLF A;  3WS1 A;  5TFQ A;  2WKH A;  3BFG A;  4LV1 A;  4OPY A;  1PYY A;  1Q2Q A;  2X02 A;  3E2K A;  3N4I A;  3HVF A;  4KQO A;  2Q9N A;  1DJA A;  1FR1 A;  2XFT A;  1IKI A;  1QME A;  4E3I A;  1H5X A;  1YT4 A;  3BEC A;  3VP4 A;  1N9B A;  4N92 A;  1GA0 A;  1XPB A;  2ZLY A;  1AXB A;  3V39 A;  5GLD A;  1IEL A;  4GKU A;  5EUA A;  3VSK A;  4CJN A;  1ESU A;  5A92 A;  1IYP A;  1BT5 A;  5FAT A;  1JTD A;  4YFM A;  4RX3 A;  3OPP A;  3Q1F A;  4UA6 A;  3SOI A;  1YLW A;  3WS0 A;  1FOF A;  1CK3 A;  2XH9 A;  3HLE A;  3HRE A;  4PM5 A;  1ERM A;  1KDS A;  4IBX A;  3C7V A;  1CI9 A;  4B4X A;  1FCO A;  3G32 A;  1FQG A;  3JYI A;  3TSG A;  4B4Z A;  2A49 A;  3TG9 A;  1YLZ A;  4R3B A;  4GZB A;  4P6B A;  5EVI D;  2EX6 A;  5EPH A;  3ZHH A;  1JTG A;  4BQM A;  5FQK A;  1MWS A;  4K0W A;  4XUX A;  1KE0 A;  4JBF A;  4X53 A;  1N4O A;  1NRF A;  4A5R A;  3PAE A;  4X69 A;  4S2O A;  4UHU A;  4KZ3 A;  5AQ9 A;  2WAE A;  3FKV A;  4ZTK A;  3ZNT A;  4X68 A;  4Y7P A;  4LEN A;  3PBT A;  4PM6 A;  2V2F F;  3LY4 A;  3HLB A;  5TR7 A;  5FI7 A;  2Y2K A;  1W7F A;  1SDE A;  2BLS A;  4DE0 A;  1J9M A;  1ESI A;  3FZC A;  1S0W A;  4UA7 A;  5CHU A;  1ALQ A;  1NYY A;  4EQI A;  4WEJ A;  5KSH A;  3HUN A;  3BEB A;  2DCF A;  2H0T A;  2RL3 A;  3HLD A;  3ZG8 B;  3FWL A;  4PM8 A;  3S22 A;  1K57 C;  3PBN A;  1W8Q A;  2DRW A;  4N9K A;  3MZE A;  3SH7 A;  1XGI A;  3VP3 A;  1Y54 A;  1FR6 A;  4Q8I A;  3C4P A;  3O86 A;  2PU2 A;  2EFX A;  3IWO A;  3I7J A;  5DVA A;  4BD1 A;  2X71 A;  1I5Q A;  2IWB A;  1PWD A;  1MWR A;  4E3O A;  1L0E A;  1YMX A;  2PU4 A;  4O7D A;  4WEL A;  5FDH A;  1Z6F A;  5CRF A;  5FAP A;  3IF6 C;  3GQZ A; 
#chains in the Genus database with same CATH topology
 3KYZ A;  4HY8 A;  3T4T A;  4KUO A;  3MQQ A;  4JGQ A;  4WL9 A;  2OAQ 1;  3RXW A;  3FPV A;  3CPT B;  4L9F A;  4KQR A;  1VEU B;  3MFD A;  1XXM A;  3NY4 A;  3ZDJ A;  4BD0 A;  1EW0 A;  3PTE A;  4S2I A;  1XJ2 A;  1NXY A;  5HPF A;  5D3O A;  3LYX A;  4E3M A;  2WKE A;  1PI5 A;  3IWI A;  1YMS A;  5HDS A;  1PZP A;  1S66 L;  1Y4O A;  5JYP A;  2HF6 A;  4X55 A;  4IVK A;  1K56 A;  2L4R A;  1H8Y A;  3A0S A;  5HD5 A;  2HDU A;  3FV7 A;  3NI9 A;  1V9Y A;  4MBF A;  1PWG A;  2Y2G A;  2P74 A;  4LLO B;  5EOO A;  4HH3 A;  3L9K A;  3IXB A;  3CJM A;  1TEM A;  2HDR A;  5DF9 A;  2WKI A;  4BBT A;  3WRT A;  1K55 A;  4NG2 A;  3WS2 A;  1V9Z A;  5L2F A;  2DNS A;  3OLO A;  1IKG A;  4WZ5 A;  2KOI A;  3G35 A;  1MKM A;  3UB5 P;  2VV6 A;  5IT5 A;  4I3I A;  1K25 A;  2OWJ A;  4EUV A;  2HGV A;  3N6I A;  3UB8 A;  4UQI S;  4S2P A;  1XJ6 A;  4ZRR A;  5A8B A;  4HH2 A;  5GHX A;  4KQQ A;  2Y79 A;  3PBS A;  5HAQ A;  1YLJ A;  4I38 A;  5CXW A;  1NY0 A;  2ZM8 A;  3Q7V B;  3BQ8 A;  4E3L A;  2VX8 A;  2JCH A;  2V1B A;  4X6T A;  2OWH A;  3FYZ A;  3MJQ A;  4JF5 A;  2GJ3 A;  3BLM A;  1ES4 A;  3VP0 A;  2G2U A;  4ETX A;  5A90 A;  3NOU C;  2JKR M;  3A3J A;  4DXC A;  1BSG A;  1IEM A;  4DE2 A;  4X1L A;  1YLY A;  2ZC6 B;  2M7V A;  5E2E A;  1X0O A;  2PDR A;  3VFH A;  3P09 A;  4Q0I A;  1K56 D;  3PXP A;  3MXR A;  2A2L A;  2WUQ A;  2Y8H A;  1DY6 A;  2ACG A;  4QU3 A;  1XFN A;  4O8G A;  2JHE A;  4GHI A;  3E0Y A;  1PW8 A;  5FEF A;  3HCY A;  5KMW A;  3HLW A;  5FQQ A;  1DJB A;  2Y2L A;  4FH2 A;  1DP9 A;  2H28 A;  1OPX A;  1JVJ A;  4KG5 A;  5FAS A;  2Y2H A;  3GR2 A;  4N1H A;  2PT7 A;  1W5D A;  4PPR A;  2HV1 A;  1W79 A;  4S2M A;  2RCX A;  4K91 A;  1ZG6 A;  5AVF A;  2J9P A;  3ICY A;  2XF3 A;  5FDS A;  3T50 A;  4PM7 A;  3UPO A;  2Q0O A;  2V1A A;  4WZ4 A;  2W1T A;  4XUZ A;  3V50 A;  4CLC C;  3OCL A;  2ZMF A;  2IA2 A;  1YLT A;  2H10 A;  1N9O A;  4MLL A;  2D01 A;  1ERO A;  3W4O A;  3T4S A;  1LI9 A;  3DW0 A;  3LIE A;  2OLU A;  5KZH A;  4LPZ A;  2GDN A;  1YM1 A;  2WKR A;  3RFB A;  2E8I A;  3EOI A;  2XK1 A;  3MXS A;  5CTN A;  2Y59 A;  3IX3 A;  3V67 A;  4AFI A;  5J3W A;  2K31 A;  1L0D A;  5G4Z A;  1TS0 A;  4WLA A;  5IU1 A;  4UEY A;  1TS8 A;  2ZQD A;  3HJK A;  4S2L A;  1SKO A;  3IX4 A;  2OLV A;  2IWD A;  1T1A A;  1IOU A;  2C6W B;  4ZJ2 A;  4DDS A;  5DF8 A;  3OPH A;  4H6J A;  5FA7 A;  4EET B;  4E3K A;  2Y2P A;  3LR5 A;  1HLU P;  1GHP A;  4HES A;  1WE4 A;  5FAO A;  3SS4 A;  1CEG A;  4HJ3 A;  5HL1 A;  2A3U A;  5GLB A;  1XP4 A;  3SS3 A;  4GW9 A;  1G6A A;  3R7W A;  4EV4 A;  4MBH A;  2QPN A;  4OOL A;  2VGL M;  3BWL A;  2V8C A;  3OC2 A;  2R9W A;  3OZH A;  4YNR A;  1MKI A;  4N9L A;  3CI6 A;  3SH8 A;  2O9B A;  4EXO A;  4U0X A;  3BLS A;  3IF6 A;  4R3J A;  4EBL A;  1F98 A;  5CGX A;  3V3R A;  1HD8 A;  2Y2J A;  4BL3 A;  3NEC A;  2QKP A;  3UY6 A;  3G30 A;  3BFE A;  4R23 A;  3UB7 A;  3LI8 A;  5GLA A;  2D02 A;  1STZ A;  4P6Z M;  4FD8 A;  3C30 A;  3UDX A;  4KZB A;  3BY8 A;  2XFS A;  1EWZ A;  4MNR A;  3W2Z A;  3IHA A;  3F1N A;  3GRJ A;  3M2K A;  4HQA A;  1OTD A;  2L0W A;  5DTT A;  3MQ0 A;  3SS5 A;  5DJU A;  4KZ7 A;  3V3S A;  2ZQ8 A;  4MMN A;  4JLF A;  3L7H A;  3BFG A;  2V8F A;  4HI4 A;  3RTY A;  1IKI A;  1GA0 A;  1XPB A;  1OTB A;  4CJN A;  1H3Q A;  1ESU A;  1IYP A;  3LR0 A;  1JTD A;  3SOI A;  3PR6 A;  3WS0 A;  1FOF A;  5FEG A;  3C7V A;  1CI9 A;  2INW A;  5AVE A;  2NUT C;  4EEU A;  4P6B A;  2VZW A;  1KE0 A;  3DTI A;  4I3J A;  1NRF A;  4S2O A;  4UHU A;  3ZNT A;  3LY4 A;  1JNU A;  2Y2K A;  1W7F A;  2BLS A;  2XRN A;  2PYR A;  3FZC A;  1S0W A;  4UA7 A;  5KSH A;  4DJ2 A;  3HUN A;  1LSX A;  1G6O A;  2H0T A;  4GHI B;  3FWL A;  3PBN A;  4N9K A;  4Y3I A;  3C38 A;  1XGI A;  3VP3 A;  2EFX A;  3B33 A;  3T1X A;  3C2W A;  4O7D A;  4HJ4 A;  2KDK A;  5EM0 A;  4GJ4 A;  3A0R A;  4K08 A;  2CC1 A;  4LGW A;  3M6H A;  3ZVW A;  1G68 A;  3MR0 A;  2ZD8 A;  3MKF A;  4JKT A;  4NK3 A;  2ZQ9 A;  3M6B A;  4EWF A;  3NOP C;  4GDB A;  1LSV A;  3QP8 A;  4GN2 A;  2W1T B;  1WYB A;  3HJI A;  1M6K A;  1PWC A;  4S2N C;  1YQS A;  2NUP C;  2WKQ A;  5E2G A;  4PM9 A;  3UPP A;  4OQ0 A;  5CTM A;  1VQQ A;  1KOU A;  4KZ9 A;  2WGW A;  3OPR A;  1KE4 A;  3UE1 A;  1YAX A;  3CHW P;  3UMD A;  1JWV A;  4OON A;  3N8R A;  1BYW A;  5J7E A;  3C5A A;  3NCK A;  3TJZ C;  2BAS A;  2V0U A;  4X25 A;  5DTS A;  1SKO B;  4P87 A;  1I2S A;  3RXX A;  5AQ7 A;  4B93 A;  4C3Q A;  3IX8 A;  3DWZ A;  4H6J B;  4GNU A;  2XD1 A;  1O07 A;  2I9V A;  5E2H A;  3ZG5 A;  4BLM A;  1E3U A;  5HZH A;  3BYD A;  3B3X A;  1VB6 A;  2JN7 A;  2K7S A;  4G3V A;  3WS4 A;  4ID4 A;  5CEC A;  3E98 A;  1S1Y A;  5FL3 A;  3R7W B;  3G4P A;  3UDI A;  2OSU A;  2ZC5 B;  2EXA A;  4ZBE A;  4OKP A;  3CUE A;  3H82 A;  1CF0 A;  1ODV A;  3A0V A;  4NEE D;  2EFU A;  3P98 A;  1HZO A;  3IF6 B;  3BY9 A;  4BL2 A;  4HIA A;  3EGX C;  5HFO A;  3WRZ A;  5FSR A;  3CLO A;  4PHT A;  1W63 Q;  5E2F A;  3IXD A;  2V20 A;  3QNC A;  3TE8 A;  3EGD C;  3HBR A;  2VEA A;  3LR4 A;  1MWU A;  3A3D A;  2B5R A;  5KSC A;  1YPR A;  2WGV A;  3F1N B;  3T4J A;  2B18 A;  1LT0 A;  1Z09 A;  1ES2 A;  3H7W A;  3V5M A;  4F94 A;  1RP5 A;  4R4S A;  3PBQ A;  1MZU A;  5HAR A;  5CGW A;  3O88 A;  3OPL A;  2UWX A;  3U2A A;  4FSF A;  4KUK A;  3IF5 A;  4F3L A;  5M1A A;  2W1R A;  1E3U D;  3CG5 A;  3N8L A;  4E6W A;  1K54 C;  3S1Y A;  4U0T A;  4MN7 A;  5FQJ A;  5HDC A;  1ZHH B;  2P04 A;  3GMW A;  5HX9 A;  1ONG A;  4XXR A;  1TS7 A;  4IBR A;  5I5L A;  4NXB A;  2Z6C A;  2ZQA A;  3LR3 A;  4CPK A;  4ARZ A;  2ZC7 A;  1JWP A;  1NZU A;  2QWS A;  1GCE A;  3CWF A;  2Z6D A;  5CED A;  4WYY A;  4U3T A;  4UQI M;  3T4K A;  3SZT A;  1NWZ A;  1SCW A;  4DXB A;  2XLN A;  2Z2M B;  3RJU A;  1FIL A;  3PBO A;  5AJG A;  3DAV A;  3IWQ A;  1NLZ A;  5IS1 A;  1LLB A;  4KQD A;  3EQU A;  4BJP A;  1HTZ A;  1GHM A;  2W3D A;  3FC7 A;  2ZJ9 A;  4LV3 A;  1G28 A;  3E2L A;  3UE6 A;  2HZ5 A;  3IHB A;  2GNX A;  3ZCZ A;  3GV9 A;  4EES A;  4E6X A;  3Q7Z A;  4IED A;  3M2J A;  2KX6 A;  4KZ6 A;  5EOE A;  5HL6 A;  3CAX A;  2WGI A;  5DTK A;  2XRO A;  5EVI A;  1S1Z A;  4FTX A;  3ZGA B;  2A24 A;  1PZO A;  2WGW B;  1IYO A;  2EX8 A;  2JBF A;  2DMW A;  3EQV A;  4E3J A;  4OOY A;  5J8X A;  3NBL A;  1Q2P A;  3KYQ A;  4OP8 A;  3BRM A;  4QPR A;  2QJ7 A;  3DTM A;  3HLC A;  1MBL A;  2ZM2 A;  3IQA A;  5EEC A;  1XJ3 A;  1PFL A;  3UB6 A;  4D60 A;  4EBP A;  3UB9 A;  2BG1 A;  1FCN A;  1DJC A;  4JGR A;  2HDQ A;  3VV4 A;  2X01 A;  4KZ8 A;  2FZ0 A;  3ZVT A;  1OT9 A;  3Q07 A;  3Q82 A;  4S2N A;  3E4Q A;  4WBG A;  2Y91 A;  2E8J A;  4Y13 A;  2W3G A;  1GA9 A;  1DP6 A;  4WMC A;  3D3O A;  3BFF A;  5HPI A;  3NDE A;  4EER A;  2O99 A;  2YKH A;  1PYY A;  4KQO A;  2Q9N A;  1DJA A;  1FR1 A;  3K2N A;  5DKL A;  1H5X A;  1N9B A;  4N92 A;  3H82 B;  1IEL A;  3VSK A;  1BT5 A;  4YFM A;  2QHK A;  4WN5 A;  1ERM A;  5EVI D;  1JTG A;  4BQM A;  3PHY A;  2XSS A;  5FQK A;  1W63 M;  4GS9 A;  4JBF A;  4X53 A;  3IBR A;  4A5R A;  4X69 A;  5DFY A;  4X68 A;  5HSQ A;  3PBT A;  3HLB A;  2P7J A;  2J3T D;  1SDE A;  3EEA A;  5CHU A;  3KYE A;  1NYY A;  4EQI A;  2DCF A;  3ZG8 B;  5L8M A;  4FUW A;  2ZOI A;  3S22 A;  1K57 C;  1W8Q A;  3SH7 A;  4EU0 A;  3H7W B;  4Q8I A;  1FR6 A;  3LIF A;  5DVA A;  5F69 A;  5L07 A;  1YMX A;  4WEL A;  4NXG A;  2J7V A;  4F3L B;  4S2J A;  5K5B A;  5A91 A;  1YLP A;  3A3F A;  3IXH A;  2LB5 A;  4WMC D;  1OME A;  1AWI A;  1KE3 A;  5MC7 A;  1UGU A;  1UWP X;  1MWT A;  2ZC3 B;  5I94 A;  2HP6 A;  1L3L A;  1N9N A;  3BJN A;  4MN6 A;  3QP5 A;  3DTE A;  1PIO A;  5E43 A;  3PAG A;  1E25 A;  4ARZ B;  2PD8 A;  4O01 A;  4E3N A;  4GD8 A;  4GDN A;  3UN7 A;  2Y2N A;  3UNW A;  3WS5 A;  3EEH A;  1LL5 A;  3MFX A;  2J9O A;  2PD7 A;  3GTC A;  3NHQ A;  3MZD A;  1T1C A;  2PR6 A;  1K55 C;  1K54 A;  4RX2 A;  1SZV A;  3HUO A;  3AGD A;  2QJ5 A;  2ZL1 A;  1YSQ A;  1TDL A;  1K4F A;  4HBU A;  4LV2 A;  2PAV P;  4WZ5 C;  2XR0 A;  2I72 A;  1NYM A;  1T1B A;  2HP9 A;  4GOG A;  3UE3 A;  3LIA A;  3LFV A;  3LO7 A;  4R0Q A;  1TS6 A;  1F9I A;  3A3I A;  4I3A A;  4KEN B;  4RQ9 A;  1OJG A;  2V1Z A;  4OP5 A;  5JYO A;  3O3V A;  2QMI A;  4KG6 A;  4RA7 A;  4OLG A;  5EVI B;  3LCE A;  3O87 A;  2A24 B;  1KVL A;  3D72 A;  5DFX A;  3T4O A;  5CHJ A;  3C7U A;  2LB9 A;  2XQZ A;  5F82 A;  4JF6 A;  3H9W A;  5GLC A;  1SHV A;  1C3B A;  3QNB A;  4QHC A;  2VGJ A;  3VP2 A;  4NXE A;  1DRM A;  3T1R A;  4DN0 A;  1ACF A;  4OVD A;  3BFD A;  2GX5 A;  1YKD A;  4FCF A;  4KZA A;  1BTL A;  3ZYT A;  4JF4 A;  4NET A;  4B9O A;  4OLD A;  2HJ9 C;  1TVF A;  4DJ3 A;  1JWZ A;  4UA9 A;  3W4P A;  3MS6 A;  3OBF A;  1OJ5 A;  1K38 A;  1KGF A;  4JXV A;  4I39 A;  4WF0 A;  4DE3 A;  1GSW A;  1BUL A;  4BMW A;  1NZO A;  1FSW A;  1GHI A;  1L0F A;  3ZG0 A;  3N8S A;  2QYB A;  1H8M A;  1D7E A;  4RVA A;  1ZC2 A;  2Y55 A;  3KSF A;  5F83 A;  5IHV A;  4Y15 A;  5DJT A;  1S4R A;  1E4D A;  4HOI A;  2B02 A;  3VOY A;  1LL9 A;  4QB8 A;  1NJ4 A;  2Z2L B;  1QMF A;  1S67 L;  3UPN A;  2ZC4 B;  4OPQ A;  4GS9 B;  4CLC A;  2WAF A;  3CZD A;  2WKP A;  3N7W A;  5GL9 A;  3G2Z A;  1L2S A;  4D2O A;  5EVL A;  1BLC A;  3LIC A;  1XX2 A;  4BEN A;  3KSH A;  4QY6 A;  3KSI A;  2ZQ7 A;  1GSV A;  4Y0O A;  2WAD A;  3T12 B;  2V0W A;  3PYP A;  2PR5 A;  1H0M A;  4Q0J A;  5EFW A;  3P7N A;  4QWO A;  4Y0U A;  5AQA A;  3ZFZ A;  2W27 A;  1PI4 A;  1K4E A;  4LRY C;  3F1O A;  4EBN A;  1ES3 A;  2XGN A;  4DF6 A;  5BOH A;  2VKS A;  2WYX A;  1BLH A;  2EXB A;  2JE5 A;  4IUH A;  2QZ6 A;  2G7U A;  4DDY A;  3OCN A;  1ES5 A;  2WK0 A;  1CJF A;  3MZF A;  5FQM A;  4RYE A;  4BBV A;  3GDI A;  3CIT A;  1ZKJ A;  3LUQ A;  3PBR A;  1PW1 A;  4H8R A;  1TF1 A;  4JGP A;  4CQH A;  4L9E A;  1PNE A;  3C8C A;  5TBM A;  3R4K A;  5G4Y A;  4DRT A;  2K2N A;  5L09 A;  3MKE A;  3HL9 A;  4ME4 A;  5F1G A;  5TGF A;  4EQ1 A;  1K57 A;  1LSW A;  5HD3 A;  3B47 A;  1CI8 A;  3ULF A;  2XEP A;  3NC8 A;  3K3D A;  2VGK A;  5KIZ A;  2KLI A;  1ZG4 A;  1KGE A;  4JXG A;  3LGO A;  4GD6 A;  1MPL A;  1IFQ A;  4FH4 A;  5L10 A;  3CMZ A;  3UO9 A;  3G6O A;  1BZA A;  4CLC D;  1OTE A;  3AGE A;  2ZL1 B;  3MBZ A;  3DTK A;  2G2W A;  2VLG A;  2H5S A;  1MC0 A;  3VE4 A;  3TW8 A;  2Y2M A;  5M18 A;  1O7E A;  1WA9 A;  1NRJ A;  3EWK A;  1ERQ A;  4Z9Q A;  2XDM A;  4X1M A;  3ZNY A;  5U47 A;  1J3W A;  1GSX A;  3T4Q A;  4MCW A;  1S4S A;  3ZG9 B;  1U60 A;  3UDF A;  1M40 A;  1VET A;  3LI9 A;  1S6R A;  1YSP A;  5TFQ A;  4LV1 A;  4OPY A;  2X02 A;  3E2K A;  2O0Y A;  1CQA A;  1F2K A;  1QME A;  1YT4 A;  3FPW A;  5EUA A;  5HWW A;  3OPP A;  3Q1F A;  4UA6 A;  3K3C A;  1YLW A;  4PM5 A;  3HRE A;  4EEP A;  3SW1 A;  1KDS A;  4IBX A;  1FCO A;  3G32 A;  3OOV A;  3JYI A;  3TSG A;  3TG9 A;  4R3B A;  3S7N A;  2EX6 A;  4L9G A;  3ZHH A;  5EVE A;  1MWS A;  4XUX A;  2EA9 A;  5C5K A;  3KSG A;  4KZ3 A;  3GEC A;  2WAE A;  5AQ9 A;  5HDD A;  4LEN A;  1UWN X;  4PM6 A;  2V2F F;  5TR7 A;  4DE0 A;  1ESI A;  5F68 A;  1ALQ A;  4PM8 A;  2DRW A;  3MZE A;  4PKY A;  2PU2 A;  3I7J A;  3JVU A;  2B95 A;  2X71 A;  2VV8 A;  2PU4 A;  5FDH A;  1Z6F A;  5CRF A;  5FAP A;  2PYP A;  3GQZ A;  4YOF A;  4P0M A;  4HHD A;  4OQG A;  5HAP A;  4LRX C;  1BLP A;  3MXQ A;  2P9V A;  1D1J A;  4CLC E;  1BUE A;  2YKF A;  4KZ4 A;  1HVB A;  4P85 A;  3T4L A;  3E4P A;  4OPR A;  4ETZ A;  2EX9 A;  2H0Y A;  4S2K A;  4B88 A;  1G5U A;  4ZJ3 A;  2VJW A;  3QP2 A;  3TOI A;  4OOM A;  2PHY A;  2JC7 A;  1EI5 A;  2C5W B;  4K0X A;  4QD4 A;  4CLC B;  4XT2 A;  2OOL A;  4BWI A;  2HJE A;  4DKI A;  3BFC A;  2ZM0 A;  3LIB A;  3FKW A;  3W4Q A;  3VFF A;  2ZOH A;  2OAP 1;  4GLQ A;  5J4E A;  2VK3 A;  3S4X A;  4JPM A;  3C4O A;  1XA7 A;  4OQH A;  4IHQ A;  4Y17 A;  2EWV A;  3VE3 A;  1MY8 A;  4PKY G;  3UME A;  3VSL A;  5G18 A;  5DKK A;  1DP8 A;  2Y2I A;  3O5Y A;  5EE8 A;  1KDW A;  3F1O B;  2JKT I;  1F5M A;  1RGZ A;  4M3K A;  3F1P A;  3RH8 B;  4HP9 A;  1P9R A;  1P0Z A;  4Y0T A;  2FFY A;  3GVB A;  2M1C A;  2Q9M A;  4C6Y A;  3IBJ A;  4ESP A;  2EWW A;  3VMA A;  5HWV A;  5A93 A;  1XFQ A;  5FI2 A;  4R6L A;  1LL8 A;  3IXG A;  1L0G A;  3AGF A;  1T18 A;  4R1G A;  5TBM B;  3CUE C;  2ZBB A;  1BLS A;  1IYQ A;  1FIK A;  1K6S A;  4NKP A;  5FAQ A;  3T1S A;  4L0L A;  2Y2O A;  4YIN A;  4HBT A;  1W8Y A;  2PBD P;  4C75 A;  4Y2F A;  1H8Z A;  4HP4 A;  4GCZ A;  3LEZ A;  5DF7 A;  2HPB A;  2GZA A;  4R70 A;  2WZZ A;  5CHM A;  5EM1 A;  4WM9 A;  1PRQ A;  4DE1 A;  4PMA A;  4M4X A;  5F1F A;  2IWC A;  1XA1 A;  3IS2 A;  3NUL A;  4DMZ A;  5CER A;  4MBK A;  1T19 A;  3UE0 A;  2VGL S;  4ZJ1 A;  1VM1 A;  3QHY A;  2O9C A;  1K6R A;  4QY5 A;  3HUM A;  2J80 A;  4Z1W A;  2OV5 A;  3ZG7 B;  4GB7 A;  1CEF A;  3NDG A;  4MDZ A;  4MEZ A;  1VET B;  4X56 A;  1OTI A;  4EW7 A;  4HJ6 A;  1FCM A;  5GHZ A;  2XD5 A;  3ISG A;  3NIA A;  3FG8 A;  2W3F A;  1ZTU A;  5LBR A;  2PRF A;  1I2W A;  1D06 A;  3MSH A;  5TJJ A;  3CPT A;  3A3E A;  1VEU A;  2HDS A;  4OQI A;  4P6Z S;  5CX7 A;  4EUZ A;  1K0K A;  4QJG A;  3TRC A;  3SH9 A;  3IT9 A;  3E4O A;  5HAI A;  4JGO A;  4JXS A;  2Y4A A;  2R9X A;  4ZDX A;  1KVM A;  4NXF A;  2EX2 A;  5GHY A;  4LCL A;  4E04 A;  4HNB A;  3WWX A;  3G31 A;  5CGS A;  4IJG A;  2WZX A;  1RCJ A;  3B42 A;  3T1Q B;  3LEQ A;  2ZQC A;  4IUK A;  4Y5F A;  3ZQ5 A;  2W0N A;  2R78 A;  3D4F A;  1SDN A;  5FI6 A;  3JVV A;  3GSG A;  4LCM A;  2JKT M;  4MN5 A;  3BQA A;  1XGJ A;  2UV0 E;  3LID A;  5M19 A;  4PAU A;  4HEF A;  4OH0 A;  3HLF A;  2HP5 A;  3G2Y A;  3S7P A;  4BBU A;  4WEK A;  3NOT C;  3W8K A;  3LY3 A;  4YWZ A;  1LI0 A;  3S7O A;  2J8Y A;  2P9V B;  5AQB A;  2O9A A;  4N1X A;  3P01 A;  2FH5 A;  4KG2 A;  2W3H A;  1OTA A;  1N9L A;  5EVI C;  5FQ9 A;  3ITB A;  3HLG A;  3ITA A;  5CEB A;  1ONH A;  2CMN A;  4XT2 B;  2VV7 A;  3Q7V A;  4JXW A;  4R3A A;  4O0P A;  1IYS A;  2Y2Q A;  2J3T C;  1TDG A;  1Y28 A;  1TD5 A;  1A0K A;  2PBY A;  1P97 A;  2FFF B;  3DWK A;  3QP6 A;  2JKG A;  4OPZ A;  5HW3 A;  1XJ4 A;  2BTF P;  2V9A A;  4R4R A;  3JPU A;  4WUJ A;  3IH8 A;  3VP1 A;  1VHM A;  4UAA A;  3MMH A;  3KO6 A;  4LFU A;  2MJ6 A;  1LHY A;  4G3K A;  3VOZ A;  1WYC A;  3QP4 A;  3F1P B;  2ZMA A;  3BM6 A;  4ZAM A;  1SKF A;  3BW6 A;  1MXO A;  3IH9 A;  1XKZ A;  3S7Q A;  5FQI A;  1NLY A;  4IVI A;  1FSY A;  1OT6 A;  4R38 A;  2P08 A;  1KGG A;  3MF0 A;  4KZ5 A;  4LV0 A;  1RGY A;  3Q81 A;  3DBA A;  3G34 A;  3WS1 A;  2WKH A;  2VA0 A;  1Q2Q A;  3N4I A;  3HVF A;  2XFT A;  4E3I A;  3U4L P;  3BEC A;  3VP4 A;  3V39 A;  2ZLY A;  1AXB A;  3VOL A;  2AVX A;  5GLD A;  4GKU A;  5F5Y A;  4II7 A;  5A92 A;  5FAT A;  2J3W A;  4G3W A;  4RX3 A;  4FOF A;  5F6A A;  2JKF A;  1P9W A;  2XH9 A;  1CK3 A;  3HLE A;  2W3E A;  5EV0 A;  2ZMV A;  4B4X A;  1FQG A;  3KX0 X;  4B4Z A;  2A49 A;  1YLZ A;  4GZB A;  5EPH A;  2L1M A;  4K0W A;  2XA7 M;  2JKR I;  2XA7 S;  1N4O A;  3IS2 B;  3PAE A;  3FKV A;  4ZTK A;  4Y7P A;  5FI7 A;  3NJA A;  1J9M A;  5HWT A;  4LRZ E;  4WEJ A;  3BEB A;  2RL3 A;  3HLD A;  3D9Y A;  3QP1 A;  1Y54 A;  3C4P A;  3O86 A;  3IWO A;  3MQO A;  4Q0H A;  4BD1 A;  2M7U A;  1I5Q A;  2IWB A;  1PWD A;  1MWR A;  4E3O A;  1L0E A;  4I5S A;  3IF6 C; 
#chains in the Genus database with same CATH homology
 2J7V A;  4S2J A;  4P0M A;  4OQG A;  5HAP A;  1BLP A;  2CC1 A;  5A91 A;  1YLP A;  2P9V A;  3A3F A;  3M6H A;  3RXW A;  3IXH A;  3ZVW A;  1G68 A;  1BUE A;  4KQR A;  3MFD A;  1XXM A;  4WMC D;  4KZ4 A;  1HVB A;  3NY4 A;  3ZDJ A;  2ZD8 A;  4BD0 A;  3MKF A;  4JKT A;  4P85 A;  4NK3 A;  1OME A;  2ZQ9 A;  3M6B A;  4OPR A;  2EX9 A;  4EWF A;  2H0Y A;  3PTE A;  4S2K A;  4B88 A;  4GDB A;  4S2I A;  1KE3 A;  4ZJ3 A;  1NXY A;  4GN2 A;  5D3O A;  1MWT A;  1WYB A;  2ZC3 B;  3TOI A;  1M6K A;  4OOM A;  5I94 A;  2JC7 A;  1EI5 A;  2HP6 A;  4E3M A;  1PWC A;  4S2N C;  1YQS A;  2WKE A;  1PI5 A;  3IWI A;  1YMS A;  2C5W B;  4K0X A;  4QD4 A;  5E2G A;  1PZP A;  4PM9 A;  3UPP A;  4OQ0 A;  1PIO A;  5CTM A;  5E43 A;  1VQQ A;  4DKI A;  5JYP A;  3BFC A;  3PAG A;  1E25 A;  2ZM0 A;  4KZ9 A;  4X55 A;  2WGW A;  4IVK A;  3FKW A;  3W4Q A;  4GD8 A;  4E3N A;  1K56 A;  4GDN A;  3VFF A;  3UN7 A;  3OPR A;  1KE4 A;  3UE1 A;  2Y2N A;  1H8Y A;  1JWV A;  4OON A;  2HDU A;  3N8R A;  3FV7 A;  3UNW A;  3WS5 A;  3S4X A;  4JPM A;  3C5A A;  1LL5 A;  1XA7 A;  3C4O A;  3NCK A;  3NI9 A;  4OQH A;  4MBF A;  1PWG A;  2Y2G A;  2J9O A;  2P74 A;  3GTC A;  3MZD A;  1MY8 A;  5EOO A;  3IXB A;  3VSL A;  1K55 C;  1K54 A;  5G18 A;  4RX2 A;  3CJM A;  1TEM A;  2HDR A;  3HUO A;  5DF9 A;  3AGD A;  5DTS A;  4P87 A;  2WKI A;  1I2S A;  2Y2I A;  3RXX A;  4HBU A;  1TDL A;  1K4F A;  4LV2 A;  5EE8 A;  1K55 A;  1KDW A;  4WZ5 C;  5AQ7 A;  3WRT A;  3WS2 A;  2XR0 A;  5L2F A;  4C3Q A;  3DWZ A;  2I72 A;  1RGZ A;  2DNS A;  4M3K A;  1NYM A;  2HP9 A;  1IKG A;  4GNU A;  4Y0T A;  2XD1 A;  1O07 A;  2FFY A;  4WZ5 A;  3GVB A;  5E2H A;  4GOG A;  3UE3 A;  3ZG5 A;  4BLM A;  1E3U A;  2Q9M A;  4C6Y A;  3G35 A;  3LO7 A;  1K25 A;  4R0Q A;  3BYD A;  3VMA A;  3N6I A;  3A3I A;  5A93 A;  3B3X A;  5FI2 A;  4S2P A;  4KEN B;  3WS4 A;  4ID4 A;  5CEC A;  3IXG A;  1L0G A;  3AGF A;  2V1Z A;  4R1G A;  5GHX A;  3G4P A;  4OP5 A;  4KQQ A;  3O3V A;  2QMI A;  3PBS A;  3UDI A;  5HAQ A;  4KG6 A;  2OSU A;  1BLS A;  1IYQ A;  1YLJ A;  4OLG A;  4RA7 A;  5CXW A;  5EVI B;  1NY0 A;  2ZM8 A;  2ZC5 B;  3LCE A;  3Q7V B;  3O87 A;  2EXA A;  4ZBE A;  1K6S A;  4OKP A;  1KVL A;  4E3L A;  5FAQ A;  2JCH A;  5CHJ A;  3C7U A;  4X6T A;  2XQZ A;  5F82 A;  3FYZ A;  4L0L A;  2Y2O A;  4JF5 A;  3BLM A;  4YIN A;  4JF6 A;  4HBT A;  1W8Y A;  1ES4 A;  3VP0 A;  2EFU A;  5GLC A;  4C75 A;  2G2U A;  1SHV A;  5A90 A;  1C3B A;  1H8Z A;  3QNB A;  4DXC A;  3P98 A;  2VGJ A;  3A3J A;  1HZO A;  4QHC A;  3IF6 B;  1BSG A;  1IEM A;  3LEZ A;  3VP2 A;  5DF7 A;  2HPB A;  4BL2 A;  4DE2 A;  5HFO A;  2WZZ A;  5CHM A;  3WRZ A;  1YLY A;  4WM9 A;  2ZC6 B;  4OVD A;  4DE1 A;  5FSR A;  4PMA A;  3BFD A;  5F1F A;  4KZA A;  4FCF A;  1BTL A;  5E2E A;  4JF4 A;  2IWC A;  4NET A;  3VFH A;  3P09 A;  4OLD A;  1XA1 A;  5E2F A;  1K56 D;  5CER A;  3IXD A;  3MXR A;  4MBK A;  1TVF A;  1JWZ A;  3UE0 A;  4UA9 A;  2WUQ A;  3W4P A;  2V20 A;  3QNC A;  3HBR A;  4ZJ1 A;  1VM1 A;  1DY6 A;  4QU3 A;  1MWU A;  3QHY A;  1K6R A;  3A3D A;  2B5R A;  1K38 A;  1KGF A;  4QY5 A;  5KSC A;  2WGV A;  3HUM A;  4JXV A;  4DE3 A;  2OV5 A;  1PW8 A;  3ZG7 B;  1BUL A;  1ES2 A;  4GB7 A;  1CEF A;  3NDG A;  4MEZ A;  4X56 A;  3V5M A;  5KMW A;  3HLW A;  4F94 A;  5FQQ A;  1DJB A;  1NZO A;  1RP5 A;  2Y2L A;  4FH2 A;  3PBQ A;  4R4S A;  1FCM A;  1FSW A;  5GHZ A;  5HAR A;  1JVJ A;  2XD5 A;  5CGW A;  4KG5 A;  3O88 A;  3ISG A;  3NIA A;  5FAS A;  1GHI A;  3OPL A;  2UWX A;  4FSF A;  1L0F A;  2Y2H A;  3ZG0 A;  3IF5 A;  3N8S A;  5M1A A;  1E3U D;  3GR2 A;  3CG5 A;  3N8L A;  4N1H A;  1W5D A;  4RVA A;  4PPR A;  4E6W A;  1I2W A;  1ZC2 A;  2Y55 A;  1K54 C;  1W79 A;  3S1Y A;  5F83 A;  4S2M A;  4U0T A;  5IHV A;  3A3E A;  2HDS A;  4OQI A;  4EUZ A;  2RCX A;  1E4D A;  4K91 A;  5FQJ A;  5JYO A;  1ZG6 A;  4QJG A;  2J9P A;  3VOY A;  2XF3 A;  3SH9 A;  3IT9 A;  1LL9 A;  5HAI A;  4QB8 A;  1NJ4 A;  2Z2L B;  1QMF A;  4JXS A;  4PM7 A;  2Y4A A;  3GMW A;  3UPO A;  2R9X A;  5HX9 A;  1ONG A;  4WZ4 A;  4XXR A;  4XUZ A;  3V50 A;  4ZDX A;  3OCL A;  1KVM A;  4IBR A;  2EX2 A;  5GHY A;  3UPN A;  4LCL A;  2ZC4 B;  1YLT A;  2H10 A;  3WWX A;  3G31 A;  5CGS A;  4OPQ A;  4MLL A;  2WAF A;  2ZQA A;  2WZX A;  1ERO A;  3CZD A;  1RCJ A;  3W4O A;  4CPK A;  1LI9 A;  3DW0 A;  3N7W A;  5GL9 A;  2ZC7 A;  2ZQC A;  3G2Z A;  1L2S A;  4D2O A;  1JWP A;  2OLU A;  1NZU A;  5EVL A;  5KZH A;  1BLC A;  2GDN A;  1YM1 A;  1XX2 A;  4BEN A;  1GCE A;  2E8I A;  4QY6 A;  2XK1 A;  4Y0O A;  2ZQ7 A;  3MXS A;  4WYY A;  3D4F A;  5CED A;  1SDN A;  5CTN A;  4U3T A;  2WAD A;  5FI6 A;  3GSG A;  2Y59 A;  1SCW A;  4LCM A;  4DXB A;  1L0D A;  2XLN A;  2Z2M B;  1XGJ A;  4Y0U A;  5M19 A;  5AQA A;  3RJU A;  3PBO A;  2ZQD A;  4S2L A;  3ZFZ A;  3IWQ A;  1LLB A;  4HEF A;  4OH0 A;  2OLV A;  3HLF A;  2HP5 A;  2IWD A;  1PI4 A;  3G2Y A;  1K4E A;  2C6W B;  3EQU A;  4EBN A;  4WEK A;  1ES3 A;  2XGN A;  3LY3 A;  4ZJ2 A;  3W8K A;  4BJP A;  1HTZ A;  2WYX A;  5DF8 A;  4DDS A;  3OPH A;  1GHM A;  5BOH A;  5FA7 A;  2ZJ9 A;  1BLH A;  2EXB A;  4LV3 A;  2JE5 A;  4DF6 A;  1LI0 A;  3E2L A;  4E3K A;  2J8Y A;  2Y2P A;  2P9V B;  2QZ6 A;  3IHB A;  1GHP A;  4HES A;  4DDY A;  3OCN A;  1WE4 A;  5AQB A;  5FAO A;  3SS4 A;  4N1X A;  3ZCZ A;  1ES5 A;  3GV9 A;  2WK0 A;  5FQM A;  3MZF A;  1CEG A;  4E6X A;  4RYE A;  5HL1 A;  3Q7Z A;  4KG2 A;  4IED A;  2A3U A;  3M2J A;  5GLB A;  1XP4 A;  1ZKJ A;  3PBR A;  4KZ6 A;  1PW1 A;  4H8R A;  5EOE A;  3SS3 A;  5EVI C;  2WGI A;  5FQ9 A;  3ITB A;  1G6A A;  5DTK A;  3HLG A;  4EV4 A;  3ITA A;  5CEB A;  4MBH A;  2QPN A;  4OOL A;  4DRT A;  3MKE A;  5EVI A;  1ONH A;  3HL9 A;  3Q7V A;  4JXW A;  5F1G A;  5TGF A;  3ZGA B;  1K57 A;  3OC2 A;  1IYS A;  1PZO A;  2R9W A;  2Y2Q A;  2WGW B;  1IYO A;  1TDG A;  2EX8 A;  2JBF A;  1CI8 A;  3OZH A;  3EQV A;  1MKI A;  2XEP A;  4N9L A;  2PBY A;  3NC8 A;  3SH8 A;  4E3J A;  4OOY A;  5J8X A;  2FFF B;  3DWK A;  2VGK A;  3NBL A;  4U0X A;  4OPZ A;  1ZG4 A;  5HW3 A;  1KGE A;  3BLS A;  1Q2P A;  3IF6 A;  4R4R A;  3VP1 A;  3IH8 A;  4R3J A;  4EBL A;  4UAA A;  4JXG A;  4GD6 A;  4OP8 A;  3BRM A;  1MPL A;  5CGX A;  1HD8 A;  3V3R A;  3DTM A;  4FH4 A;  3HLC A;  1MBL A;  2Y2J A;  4BL3 A;  2ZM2 A;  3CMZ A;  3UO9 A;  1LHY A;  1BZA A;  3IQA A;  3VOZ A;  1WYC A;  5EEC A;  3AGE A;  3MBZ A;  2G2W A;  3G30 A;  3UY6 A;  2H5S A;  3BFE A;  4EBP A;  2BG1 A;  1FCN A;  1DJC A;  4R23 A;  2HDQ A;  2ZMA A;  2Y2M A;  3BM6 A;  4ZAM A;  5M18 A;  1O7E A;  5GLA A;  1SKF A;  2X01 A;  4FD8 A;  3UDX A;  1ERQ A;  4KZ8 A;  4Z9Q A;  1MXO A;  2XDM A;  3IH9 A;  1XKZ A;  3ZVT A;  4KZB A;  3Q82 A;  3Q07 A;  5FQI A;  4S2N A;  2XFS A;  3ZNY A;  4IVI A;  5U47 A;  4WBG A;  2Y91 A;  1FSY A;  1EWZ A;  4MNR A;  1GA9 A;  3IHA A;  3GRJ A;  4WMC A;  3BFF A;  3M2K A;  3ZG9 B;  5DTT A;  1KGG A;  3SS5 A;  1U60 A;  3UDF A;  1M40 A;  4KZ5 A;  4LV0 A;  1RGY A;  3NDE A;  3Q81 A;  1S6R A;  4KZ7 A;  3V3S A;  2ZQ8 A;  3G34 A;  4JLF A;  3WS1 A;  5TFQ A;  2WKH A;  3BFG A;  4LV1 A;  4OPY A;  1PYY A;  1Q2Q A;  2X02 A;  3E2K A;  3N4I A;  3HVF A;  4KQO A;  2Q9N A;  1DJA A;  1FR1 A;  2XFT A;  1IKI A;  1QME A;  4E3I A;  1H5X A;  1YT4 A;  3BEC A;  3VP4 A;  1N9B A;  4N92 A;  1GA0 A;  1XPB A;  2ZLY A;  1AXB A;  3V39 A;  5GLD A;  1IEL A;  4GKU A;  5EUA A;  3VSK A;  4CJN A;  1ESU A;  5A92 A;  1IYP A;  1BT5 A;  5FAT A;  1JTD A;  4YFM A;  4RX3 A;  3OPP A;  3Q1F A;  4UA6 A;  3SOI A;  1YLW A;  3WS0 A;  1FOF A;  1CK3 A;  2XH9 A;  3HLE A;  3HRE A;  4PM5 A;  1ERM A;  1KDS A;  4IBX A;  3C7V A;  1CI9 A;  4B4X A;  1FCO A;  3G32 A;  1FQG A;  3JYI A;  3TSG A;  4B4Z A;  2A49 A;  3TG9 A;  1YLZ A;  4R3B A;  4GZB A;  4P6B A;  5EVI D;  2EX6 A;  5EPH A;  3ZHH A;  1JTG A;  4BQM A;  5FQK A;  1MWS A;  4K0W A;  4XUX A;  1KE0 A;  4JBF A;  4X53 A;  1N4O A;  1NRF A;  4A5R A;  3PAE A;  4X69 A;  4S2O A;  4UHU A;  4KZ3 A;  5AQ9 A;  2WAE A;  3FKV A;  4ZTK A;  3ZNT A;  4X68 A;  4Y7P A;  4LEN A;  3PBT A;  4PM6 A;  2V2F F;  3LY4 A;  3HLB A;  5TR7 A;  5FI7 A;  2Y2K A;  1W7F A;  1SDE A;  2BLS A;  4DE0 A;  1J9M A;  1ESI A;  3FZC A;  1S0W A;  4UA7 A;  5CHU A;  1ALQ A;  1NYY A;  4EQI A;  4WEJ A;  5KSH A;  3HUN A;  3BEB A;  2DCF A;  2H0T A;  2RL3 A;  3HLD A;  3ZG8 B;  3FWL A;  4PM8 A;  3S22 A;  1K57 C;  3PBN A;  1W8Q A;  2DRW A;  4N9K A;  3MZE A;  3SH7 A;  1XGI A;  3VP3 A;  1Y54 A;  1FR6 A;  4Q8I A;  3C4P A;  3O86 A;  2PU2 A;  2EFX A;  3IWO A;  3I7J A;  5DVA A;  4BD1 A;  2X71 A;  1I5Q A;  2IWB A;  1PWD A;  1MWR A;  4E3O A;  1L0E A;  1YMX A;  2PU4 A;  4O7D A;  4WEL A;  5FDH A;  1Z6F A;  5CRF A;  5FAP A;  3IF6 C;  3GQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...