1IYQA

Toho-1 beta-lactamase in complex with benzylpenicillin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAERRRDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Toho-1 beta-lactamase
publication title Acyl-intermediate Structures of the Extended-spectrum Class A beta -Lactamase, Toho-1, in Complex with Cefotaxime, Cephalothin, and Benzylpenicillin.
pubmed doi rcsb
source organism Escherichia coli
total genus 93
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1iyqA00
3VSLA 3CG5A 3GMWA 1RCJA 2HPBA 1E3UD 1PYYA 1YT4A 2J9OA 4PMAA 4WZ4A 4BENA 4E6XA 3EQVA 2EX8A 1K4FA 4Y7PA 4IBXA 4ZJ2A 1CEFA 3Q7VA 4K0WA 1FR1A 5HFOA 1WE4A 4DXCA 2ZQ9A 4GNUA 4U0XA 1O7EA 3PAGA 3ITBA 1K57A 2ZJ9A 3E2KA 3IF5A 2QZ6A 4HBUA 3ZG0A 3G34A 5HARA 4BQMA 3S4XA 3UPPA 3VOZA 4EBLA 3W4QA 4UA9A 5EOEA 1U60A 1DY6A 3S1YA 4GN2A 3GVBA 5DTSA 5CEBA 2WAFA 4LV1A 3MXRA 2XF3A 3Q7VB 2H10A 3AGDA 2G2UA 3IXDA 5CXWA 1ES4A 2WUQA 2BLSA 3WWXA 2HP6A 3WS4A 5M18A 2XD5A 2I72A 4QY5A 5GHXA 3M2JA 1K54C 5JYOA 3AGEA 1XKZA 5EOOA 2JCHA 5J8XA 4R3JA 4R0QA 4S2KA 3HUOA 3ITAA 5CRFA 1MY8A 1N4OA 3GSGA 1Y54A 3OC2A 2FFYA 2XD1A 4BD1A 5IHVA 3G31A 2X02A 4KG2A 1G68A 2H0TA 4RX2A 3VP1A 5HW3A 5FI2A 3DW0A 5FSRA 2HP5A 3SS5A 1PI5A 3UPNA 4JF5A 2Y2QA 5CGXA 2HDQA 1SKFA 1QMEA 2XR0A 3UPOA 3OPPA 5FI7A 1Q2PA 1KVLA 3BLSA 4OLGA 3LO7A 5CHMA 4DF6A 1NYYA 1IKGA 3HL9A 3BM6A 5M1AA 4UA6A 1KGEA 4EQIA 3BLMA 2ZM8A 1IKIA 1YMSA 3HBRA 3NI9A 1CI8A 2RCXA 4JLFA 2JC7A 2C6WB 4C3QA 3B3XA 3GR2A 3TOIA 3LEZA 1K57C 1BULA 1W8YA 2WK0A 2Y55A 2XQZA 3N6IA 3WRTA 4DXBA 5FQ9A 3UNWA 1SCWA 1LHYA 5E43A 4MNRA 1FOFA 4CPKA 2QPNA 3N8RA 3UO9A 2IWCA 1DJBA 1K6RA 1RGYA 1W5DA 3IH9A 1GA9A 3BFEA 5CERA 4DE0A 4QJGA 3IWIA 4S2NC 3N8SA 4ID4A 1JVJA 2P74A 5EE8A 1KGFA 1C3BA 4GB7A 3PAEA 4FCFA 1Z6FA 5GLBA 3SOIA 1SDNA 2IWBA 4K0XA 2J9PA 4E3MA 1TDLA 2X71A 2Y2PA 1M40A 2V1ZA 3VP4A 3M6BA 2OLUA 3O3VA 4KZ3A 1TDGA 2Y2OA 5CGSA 5DF9A 4X56A 3HUNA 1M6KA 1YLTA 4P85A 1LLBA 2ZQ8A 3VFFA 3NC8A 5KZHA 3C4PA 3WS5A 2FFFB 1ESUA 3NDEA 1LI9A 5CTMA 3W4OA 2ZQDA 4E3NA 4EV4A 1BSGA 1NJ4A 4CJNA 1NRFA 4R1GA 3HREA 3O88A 1H8ZA 5HAPA 1XPBA 4X68A 2Q9NA 3V50A 4YINA 4B4XA 2Y2LA 1SDEA 2A3UA 2ZQCA 3MZDA 1IYPA 1FQGA 3IH8A 2WKIA 2IWDA 1I2SA 5A92A 1CK3A 3IXHA 3IWOA 4QY6A 2HP9A 3ZNTA 1KE0A 5CHUA 4WEKA 4DDSA 5CEDA 4PPRA 3PBNA 5JYPA 1MXOA 2ZC4B 4P6BA 1GHIA 3FV7A 3MZFA 4NETA 4ZJ1A 4OQGA 3UE0A 3NDGA 1J9MA 1AXBA 5FASA 3IXGA 1MWSA 1KE4A 2EFUA 3G32A 3IT9A 4BJPA 2EX2A 3N4IA 4KZ8A 5M19A 2C5WB 3PBRA 4OLDA 4WMCD 1DJCA 5DVAA 2E8IA 1YQSA 2DNSA 3E2LA 3BRMA 2BG1A 4R3BA 2XK1A 5EVIA 4Q8IA 1HD8A 5A90A 3N7WA 1BT5A 1Q2QA 1O07A 2Y2HA 5E2HA 1K38A 3NBLA 3DTMA 3W4PA 3BEBA 5FI6A 3WS0A 4XUZA 3UDIA 5FA7A 2WKEA 1G6AA 4MEZA 2OV5A 2RL3A 2DCFA 5FDHA 4IEDA 4HBTA 1PZPA 2X01A 1I5QA 4XXRA 1PZOA 5EVIB 5FAPA 4EBNA 4E3JA 1PWCA 1ONHA 1GHMA 5CHJA 1FR6A 2ZC5B 4WBGA 3UE3A 4JBFA 5KMWA 4IVIA 3UY6A 4MBFA 5AQBA 5KSHA 4R4RA 4OQ0A 4E3KA 2J8YA 3ZVWA 2XFSA 2CC1A 1L0FA 2Y4AA 2ZQAA 3OPRA 4KZ7A 4EWFA 5A93A 1ESIA 1L0EA 4QD4A 4GDNA 5DTKA 1K56A 4KZBA 4OP8A 3VP0A 2Y2IA 4N1XA 4Y0OA 5HL1A 4M3KA 2EXAA 4PM7A 1L0GA 1HVBA 1XXMA 1WYBA 2WZZA 4FH4A 3HLEA 4X69A 1VM1A 5E2FA 2ZM0A 3RXXA 3ZG8B 1YLZA 4PM6A 3UDXA 4JKTA 4UAAA 4FSFA 3G2ZA 3GQZA 3ZHHA 1BTLA 2EFXA 3ZNYA 4PM8A 5EVIC 5AQ7A 3TSGA 1BZAA 1N9BA 4ZAMA 4EUZA 1SHVA 1DJAA 1NZOA 4U0TA 1H5XA 2WAEA 4O7DA 4U3TA 4E3LA 3A3EA 5DTTA 3V5MA 3IQAA 3UN7A 4GDBA 2R9WA 3ZVTA 1BLPA 4XUXA 3ZGAB 4GKUA 4X55A 4C6YA 4JXSA 1PW8A 3NY4A 1PWDA 2B5RA 4P0MA 5E2EA 1XGIA 4UA7A 3NCKA 1ZC2A 2WGVA 3PBTA 5G18A 1MWTA 4B88A 3IHAA 1BLSA 2PU2A 2VGJA 4GOGA 2HDUA 3G30A 5FAQA 5FQMA 3VSKA 4UHUA 3HLFA 1MBLA 1TVFA 5HAQA 2ZD8A 3LCEA 3Q1FA 3Q7ZA 1YMXA 4KZ4A 3VP2A 1YM1A 3IWQA 2Y2JA 2HDSA 4S2MA 4WZ5A 4BL2A 2OLVA 1NXYA 5BOHA 3IF6A 2EX6A 3VP3A 1LL9A 3GTCA 1IELA 2Z2MB 3ZG5A 5GLAA 2Q9MA 3MKFA 4PM9A 1KDSA 4L0LA 3ZFZA 3VOYA 3MXSA 3OPLA 4IVKA 4BD0A 4C75A 3M6HA 3NIAA 4X53A 5DF7A 3QNBA 1YLJA 3MKEA 1ZG6A 3HLCA 2V2FF 5TR7A 3BFFA 4KZAA 4OP5A 5D3OA 5HAIA 4ZTKA 3GRJA 3IF6B 1E25A 4E3IA 2ZLYA 5I94A 4OPYA 3P98A 4JXWA 4S2PA 3A3FA 1L0DA 1H8YA 3FKVA 4HEFA 4BL3A 4JXVA 4OQHA 5CECA 5AQ9A 1ALQA 1XA7A 5EVLA 3Q81A 5EECA 1FCNA 1BUEA 4DE3A 5F1FA 1MWRA 1NZUA 4FH2A 4S2OA 3SH8A 2ZQ7A 3SS3A 1PIOA 4QB8A 4F94A 1ZKJA 4KZ6A 4YFMA 1HTZA 4KQRA 4OPRA 3A3JA 3MFDA 4N92A 2WYXA 1LI0A 4OONA 3WS2A 2Y2MA 1E4DA 1IEMA 2XFTA 1JWZA 1IYQA 1MPLA 1FSWA 4KQQA 3DWKA 2PU4A 5FQIA 1RGZA 2EX9A 3OZHA 3V39A 2JBFA 1YLWA 3MZEA 4HESA 4EBPA 5GLCA 4LCLA 4DE1A 1FCOA 1FCMA 4LV2A 4ZBEA 1XGJA 5A91A 1HZOA 3M2KA 3OCNA 1MWUA 3PTEA 1RP5A 4RYEA 4OPQA 2V20A 2Y2GA 4JF6A 4WZ5C 5EVID 1JTGA 5CTNA 5EUAA 4PM5A 3IXBA 3IF6C 4P87A 2ZC3B 1CI9A 1ONGA 4JXGA 1QMFA 3FYZA 5F82A 3JYIA 3I7JA 2DRWA 4Z9QA 3V3RA 2H5SA 3UDFA 3WS1A 3OPHA 4LENA 3DWZA 3QHYA 4MLLA 4X6TA 1EI5A 4H8RA 2XLNA 5FQJA 2UWXA 4OOMA 3ZG7B 1K25A 1ES2A 1L2SA 3BECA 4S2NA 5FQKA 3C7VA 1XA1A 1BLHA 4N9KA 3VFHA 2OSUA 4S2IA 3CMZA 3RXWA 3SH9A 3HUMA 5GHYA 3OCLA 1ERMA 1FSYA 2Y2NA 4N9LA 5E2GA 2R9XA 2XEPA 2ZM2A 3GV9A 3HLGA 4OOYA 1IYSA 5TGFA 1PI4A 3W8KA 1ES5A 1NYMA 3O87A 2A49A 2P9VA 4D2OA 3ISGA 3P09A 4DRTA 3AGFA 4DE2A 4DDYA 3CJMA 1NY0A 4OKPA 4Y0TA 4ZDXA 2XGNA 1K56D 2GDNA 3G35A 4IBRA 1KDWA 2Y59A 4KG5A 3HLWA 3BFGA 4WEJA 5GHZA 3WRZA 4A5RA 4DKIA 3HLDA 1PWGA 1KGGA 4LV0A 2HDRA 4KG6A 4MBKA 1K6SA 2ZMAA 3FZCA 4R23A 1YLYA 1S6RA 3ZCZA 2P9VB 4RVAA 2VGKA 2WADA 4Y0UA 1K55A 1LL5A 4KZ9A 2H0YA 3N8LA 3QNCA 4GD8A 2EXBA 4R4SA 1PW1A 4LCMA 2WKHA 5FATA 4JPMA 5HX9A 2Y2KA 1IYOA 1TEMA 2ZC7A 1CEGA 1ERQA 4LV3A 5F1GA 2WGWA 3MBZA 4WYYA 5KSCA 1BLCA 1OMEA 3RJUA 1ES3A 1K4EA 2WZXA 1YLPA 2WGIA 1GA0A 4WM9A 3IHBA 4E6WA 2G2WA 4BLMA 3C5AA 3G2YA 3PBSA 4KZ5A 3HLBA 4N1HA 3LY3A 2WGWB 4B4ZA 5L2FA 2JE5A 1EROA 2J7VA 5AQAA 3ZDJA 3EQUA 4GD6A 3LY4A 1MKIA 4ZJ3A 3S22A 4GZBA 5U47A 3O86A 4S2JA 4OQIA 5FQQA 4WELA 5EPHA 2Z2LB 1KVMA 3C7UA 4RA7A 3HVFA 1JWVA 3VMAA 5CGWA 4S2LA 3V3SA 4RX3A 2QMIA 4FD8A 1JWPA 5FAOA 1XP4A 1W7FA 4OPZA 3BYDA 5TFQA 1K54A 3BFDA 3SH7A 3SS4A 4OH0A 1GCEA 1WYCA 5GL9A 3ZG9B 2PBYA 4QHCA 2ZC6B 1ZG4A 3G4PA 4QU3A 1XX2A 1KE3A 3Q82A 3BFCA 4OVDA 1W79A 1S0WA 5DF8A 1VQQA 4OOLA 1E3UA 1K55C 1W8QA 3FKWA 4KQOA 2XDMA 4MBHA 3CZDA 4E3OA 4KENB 3FWLA 3A3IA 4WMCA 4NK3A 1EWZA 2XH9A 3D4FA 3Q07A 3C4OA 3TG9A 3PBOA 5F83A 4K91A 1JTDA 3PBQA 5GLDA 3UE1A 1I2WA 2Y91A 1GHPA 3A3DA 4JF4A
chains in the Genus database with same CATH superfamily
3CG5A 4PMAA 4ZJ2A 3S7OA 4U0XA 3T1SA 3PAGA 2ZJ9A 4HBUA 5HARA 3S4XA 3UPPA 4LRXC 3S1YA 3GVBA 3TJZC 1LSXA 3MXRA 2UV0E 3G6OA 4GHIB 1ES4A 4CQHA 3WS4A 3AGEA 5HPFA 4EEPA 3HUOA 2LB9A 1N4OA 3S7QA 1Y54A 2ACGA 2FH5A 3OC2A 4HJ3A 5IHVA 3UB5P 2JKGA 4G3KA 4KG2A 1G68A 2H0TA 3VP1A 5FI2A 3SS5A 4UEYA 5CGXA 1SKFA 3OPPA 1PNEA 3EWKA 3LO7A 4DF6A 1VB6A 3NI9A 1G6OA 2JC7A 4C3QA 3B3XA 3VE4A 2JKRM 2ZMVA 2QHKA 2AVXA 1W8YA 5L07A 4ARZA 3D9YA 3UMDA 5L10A 2IWCA 3IH9A 3BFEA 2OOLA 2P74A 5EE8A 1KGFA 3PAEA 4FCFA 1Z6FA 4HNBA 2IWBA 3NULA 1TDLA 3M6BA 2VV7A 3E98A 3HUNA 1M6KA 1YLTA 4NXEA 3EGXC 3VFFA 4F3LA 1CJFA 1XFNA 4R38A 3W4OA 2VLGA 2ZQDA 4E3NA 1D06A 1BSGA 4O0PA 3HREA 4B4XA 4H6JB 2A3UA 3MZDA 2ZQCA 2IWDA 2K2NA 4FUWA 1CK3A 1DP8A 3IWOA 2W1TA 2VGLM 3PBNA 3CHWP 5JYPA 5HZHA 3MZFA 4ZJ1A 4NXGA 3IXGA 3IT9A 4BJPA 2EX2A 3N4IA 5M19A 4WMCD 4I5SA 4OLDA 2VEAA 3NOUC 4R3BA 5HSQA 3BRMA 2BG1A 5A90A 4XT2B 2BTFP 3IX4A 4MMNA 3DTMA 3PXPA 3DBAA 3H7WA 2RL3A 5F68A 1PZPA 1I5QA 3K2NA 3T1XA 1PWCA 1ONHA 1TD5A 4HQAA 5KSHA 2JKTM 2CMNA 4NXBA 4E3KA 2XFSA 2Y4AA 5A93A 1ESIA 1L0EA 4N1XA 2EXAA 4LRZE 1HVBA 2P04A 3RTYA 1XXMA 1YSQA 1WYBA 3GDIA 3HLEA 5E2FA 2B18A 1YLZA 3V67A 1MKMA 4QWOA 3MF0A 4JKTA 4BWIA 1BTLA 3TW8A 3ZNYA 1AWIA 1DJAA 4U3TA 3LGOA 4Y15A 4GDBA 3ZVTA 1T1CA 2V0UA 4GOGA 2HDUA 2PT7A 5FQMA 3VSKA 4UHUA 1S67L 5HAQA 3Q1FA 3VP2A 2Y2JA 3R4KA 1S4RA 3IF6A 5DKLA 3VP3A 3GTCA 1IELA 2Z2MB 5AJGA 1NLYA 4PM9A 3CITA 3ZFZA 3OPLA 1P97A 3MJQA 3BQAA 3BFFA 4KZAA 5D3OA 5HAIA 4ZTKA 3GRJA 3FKVA 4HEFA 4OQHA 5CECA 4R3AA 3MQ0A 5EECA 1BUEA 3SH8A 3SS3A 4JGQA 4QB8A 3BWLA 4YFMA 3A3JA 3MFDA 4OONA 1E4DA 2XFTA 5AVEA 1FSWA 3O5YA 5FQIA 1LL8A 2JBFA 3MZEA 4HESA 4HOIA 3M2KA 3OCNA 3PTEA 4MN6A 3S7PA 2Y2GA 4JF6A 5L09A 3ZYTA 3IF6C 4JXGA 1ONGA 1MZUA 2DRWA 4NG2A 1L2SA 3BECA 1T1AA 4PHTA 4NEED 4N9KA 2OSUA 4S2IA 3CMZA 1EW0A 5E2GA 2XEPA 3W8KA 1ES5A 1NYMA 3P09A 3MQOA 3CJMA 1NY0A 2EA9A 4KG5A 4MN7A 4WUJA 3SZTA 4LV0A 1KGGA 2JKRI 1UWPX 1VETB 1Z09A 4JGOA 4MCWA 1N9NA 2P9VB 2M7VA 4GD8A 1N9LA 4O01A 1F9IA 1S1YA 4CLCB 1TEMA 4LV3A 1LSVA 4WYYA 1ES3A 1K4EA 1UGUA 2WZXA 1YLPA 5DJTA 4R6LA 3IHBA 2J80A 4E6WA 2G2WA 5MC7A 5A8BA 3C5AA 2KOIA 3LY3A 3MS6A 2JE5A 2J7VA 3ZDJA 3LY4A 1MKIA 2O9CA 3S22A 4GZBA 5EPHA 4RA7A 3VMAA 4S2LA 2QMIA 4FD8A 1JWPA 2V1AA 4OPZA 1Y4OA 3CPTB 3MSHA 5F6AA 3SS4A 1WYCA 4QHCA 1XX2A 2E8JA 5DF8A 1E3UA 3FKWA 4KQOA 2XDMA 5TBMB 3BY9A 4WMCA 2ZBBA 1OT9A 2Y91A 5IU1A 2PHYA 3JVUA 1SKOB 1K4FA 4IBXA 3Q7VA 1K57A 3E2KA 3VOZA 2PAVP 3W4QA 4WL9A 1U60A 1DY6A 2BASA 2JKTI 5CEBA 2FZ0A 2HP6A 5M18A 3T4SA 4QY5A 1X0OA 2JCHA 4G3WA 2J3WA 5J8XA 3U4LP 3ITAA 5EV0A 3GSGA 3G31A 2X02A 5HW3A 2ZMFA 3F1OA 5K5BA 4EXOA 3BLSA 3BM6A 4EQIA 3BLMA 1IKIA 1YMSA 4LPZA 2RCXA 3LIAA 3GECA 1K57C 3FC7A 5F5YA 5DJUA 4GJ4A 3N6IA 3WRTA 4DXBA 5FQ9A 4BBTA 1K6RA 5CERA 1W5DA 3LR0A 4S2NC 3N8SA 4G3VA 4ID4A 1JVJA 2O9BA 4BBUA 3SOIA 1SDNA 5EM0A 2Y2PA 1M40A 2V1ZA 2VV8A 2WKRA 4Y5FA 3VP4A 2OLUA 3O3VA 1LLBA 1YPRA 2W27A 3R7WA 2W3GA 1G28A 3UB9A 4CJNA 1XJ4A 1OJ5A 1H8ZA 4X68A 3V50A 4KQDA 1SDEA 1IYPA 1MC0A 4HI4A 2HGVA 3IH8A 1TS0A 4QY6A 2PDRA 5CEDA 4DDSA 4PPRA 1W63Q 3BQ8A 4QPRA 4HHDA 4ETXA 4WN5A 2EFUA 4GS9B 4KZ8A 2C5WB 3PBRA 4CLCE 4Q0HA 4Q8IA 2XK1A 2VKSA 3CWFA 1HD8A 1O07A 3IS2A 3B33A 5AVFA 3NBLA 3BEBA 4XUZA 1TS7A 3UDIA 4HJ4A 2DCFA 3LIEA 5EVIB 1OJGA 5CHJA 2ZC5B 4WBGA 5KMWA 2YKHA 3LYXA 3E0YA 5AQBA 4OQ0A 1DRMA 2J8YA 3ZVWA 4KZ7A 3OPRA 4QD4A 5DTKA 4LGWA 2Y2IA 2D01A 2WZZA 4FH4A 4I38A 3UDXA 2A24A 4FSFA 3G2ZA 3ZHHA 5AQ7A 4EUZA 4X25A 4U0TA 2WAEA 5DTTA 3V5MA 3UN7A 2R9WA 2VJWA 1BLPA 4XUXA 3ZGAB 4X55A 1VEUB 4EETB 1PW8A 3MQQA 2B5RA 2WGVA 3T50A 1BLSA 4KUOA 3QP1A 2VGJA 3G30A 5FAQA 2Z6DA 2ZD8A 4KZ4A 2HDSA 1ACFA 1F98A 4WZ5A 4BL2A 1NXYA 2XROA 3IX3A 1GSVA 3ZG5A 5GLAA 2Q9MA 3MKFA 1KDSA 4L0LA 4EESA 1XJ2A 4IVKA 4X53A 3QNBA 3MKEA 3LIBA 4YOFA 4MN5A 5I94A 1E25A 3DTEA 4OPYA 2D02A 3A3FA 1H8YA 4BL3A 4JXVA 3OBFA 5AQ9A 3Q81A 1W63M 5F1FA 1MWRA 1NZUA 4FH2A 2M1CA 1PIOA 4F94A 1H3QA 4N92A 2W3DA 3F1NA 1IYQA 3OZHA 5G4YA 4ESPA 4WF0A 4EBPA 4WLAA 1FCOA 4LV2A 3NOTC 5A91A 4L9GA 2V20A 4WZ5C 1JTGA 4P87A 2ZC3B 1CI9A 1QMFA 3FYZA 4Z9QA 3WS1A 2H5SA 3UDFA 4LENA 4EU0A 3BJNA 3DWZA 2ZL1B 2NUTC 4Y17A 1CF0A 2XLNA 2UWXA 4OOMA 1K25A 1ES2A 3ICYA 3C7VA 2JHEA 3LR5A 3RXWA 2J3TC 3SH9A 4IHQA 5HWTA 1IYSA 5TGFA 1S1ZA 5HD5A 2A49A 3ISGA 3AGFA 4DE2A 3EEAA 4DDYA 1PRQA 4OKPA 4Y0TA 2XGNA 3HCYA 4ME4A 3NOPC 5GHZA 3WRZA 4A5RA 2I9VA 4DKIA 2KLIA 2OAP1 4EW7A 2HDRA 1K6SA 2ZMAA 3FZCA 2VGKA 1JNUA 5J4EA 3D3OA 2H0YA 3QNCA 4R4SA 2Y2KA 3L9KA 2ZC7A 1ERQA 1BLCA 1OMEA 3RJUA 2WGIA 2XA7S 3U2AA 2JKFA 3DTIA 1Y28A 1PFLA 3PBSA 4N1HA 2WGWB 3H82A 4IUHA 5CX7A 4GD6A 5F69A 2V0WA 1OTDA 2YKFA 5U47A 3LR3A 3O86A 4S2JA 2OAQ1 4WELA 3LIDA 2EWWA 3HVFA 4RX3A 1XP4A 4NXFA 5TFQA 1F5MA 2ZOHA 1K54A 3BFDA 3EGDC 3SH7A 5GL9A 3ZG9B 4RQ9A 3F1PB 3Q82A 3D72A 1W79A 3QP6A 4I39A 2L1MA 1EWZA 2XH9A 3D4FA 4I3AA 1JTDA 3UE1A 1I2WA 2W0NA 2WKQA 3VSLA 1RCJA 1PYYA 1YT4A 2LB5A 3EQVA 1ZTUA 2EX8A 3A0SA 1CEFA 4K0WA 5HDDA 4GHIA 2OWHA 4Q0JA 3IF5A 2QZ6A 3ZG0A 3G34A 1OPXA 5EOEA 3LFVA 3LICA 2PD8A 4PAUA 2WAFA 3LI9A 4LV1A 5DFYA 2XF3A 1K0KA 2ZOIA 3IXDA 5CXWA 5L8MA 2BLSA 1S4SA 2XD5A 5GHXA 1K54C 1XKZA 1STZA 4R3JA 3CLOA 4R0QA 1OTAA 3UMEA 5CRFA 4BD1A 4B9OA 3LUQA 3KSIA 3DW0A 2HP5A 4JF5A 2Y2QA 2HDQA 3UPOA 5FI7A 4LLOB 4OLGA 2K31A 5CHMA 1NWZA 3HL9A 5M1AA 4UA6A 1KGEA 2G7UA 4YNRA 1CI8A 2O9AA 4CLCD 3TOIA 1BULA 4M4XA 2Y55A 3KSGA 3UNWA 1SCWA 1LHYA 2QPNA 3N8RA 3UO9A 1RGYA 1GA9A 4QJGA 3KYZA 2HF6A 4HJ6A 4EEUA 4ARZB 2J9PA 2Y2OA 2P08A 2GZAA 2ZQ8A 4H6JA 1NRJA 1IFQA 4ZRRA 3P01A 3NC8A 5KZHA 3C4PA 3WS5A 2FFFB 1ESUA 3OOVA 1NRFA 4R1GA 3O88A 1XPBA 3IX8A 2Q9NA 3EEHA 4YINA 3JPUA 4F3LB 1I2SA 5A92A 3IXHA 2B95A 2HP9A 3C38A 1KE0A 5CHUA 4WEKA 1XJ6A 1MXOA 4L9EA 3CAXA 4P6BA 3FV7A 4NETA 3NDGA 1AXBA 4XT2A 1MWSA 1KE4A 2W1TB 2QWSA 2E8IA 1GSXA 1T1BA 3E2LA 2DNSA 3KSFA 3N7WA 1BT5A 1T18A 3W4PA 3WS0A 4MEZA 3ZQ5A 4IEDA 5HWVA 2INWA 2XA7M 4E3JA 3C30A 3HJKA 3KYQA 3LI8A 1FR6A 3UE3A 4JBFA 3H7WB 4IVIA 3UY6A 4R4RA 3T4LA 3T4KA 2CC1A 1LSWA 4EWFA 1DP6A 1DP9A 3S7NA 4GDNA 1LT0A 4JGRA 4Y0OA 5HL1A 2W3EA 4M3KA 4P6ZS 4PM7A 1L0GA 3NECA 1J3WA 4X69A 3RXXA 2Y8HA 2IA2A 4PM6A 5LBRA 3GQZA 3VV4A 2EFXA 4PM8A 3TSGA 4Y3IA 4X1MA 2V8CA 1H5XA 4NKPA 4O7DA 4E3LA 4GKUA 3NY4A 1PWDA 4P0MA 5E2EA 3LR4A 3NCKA 1ZC2A 5G18A 1MWTA 5IT5A 3IHAA 2PU2A 4D60A 1UWNX 3HLFA 3DTKA 1YMXA 3DAVA 4PKYG 4IJGA 4DN0A 2HV1A 2EX6A 4I3JA 5FL3A 2VV6A 3MXSA 4C75A 4Y2FA 2GX5A 4BD0A 3NIAA 4GLQA 3FG8A 1ZG6A 3HLCA 5TR7A 3A0VA 3IF6B 4E3IA 2W1RA 2Q0OA 4S2PA 4UQIS 5EVLA 1XA7A 5HD3A 3C2WA 2PR5A 2ZQ7A 4KZ6A 3TE8A 4OPRA 2WYXA 1LI0A 2JN7A 3LEQA 3WS2A 2Y2MA 1IEMA 1JWZA 3C8CA 1MPLA 2L4RA 4KQQA 3DWKA 1RGZA 2EX9A 2VZWA 3V39A 1YLWA 4ZBEA 1XGJA 1HZOA 1NLZA 1RP5A 4OPQA 5EVID 3IXBA 3JYIA 5J7EA 4X1LA 2O0YA 3I7JA 3LIFA 4YWZA 2W3FA 2HJ9C 4MLLA 4X6TA 1EI5A 4H8RA 5FQJA 3ZG7B 5FQKA 1XA1A 1BLHA 3VFHA 2NUPC 3HUMA 4LFUA 5GHYA 3OCLA 1ERMA 1FSYA 5EVEA 2Y2NA 2R9XA 2ZM2A 3PYPA 4OOYA 1VETA 1PI4A 4EUVA 4MDZA 4D2OA 2P9VA 3T4QA 4ZDXA 1K56D 4IBRA 4WEJA 2GDNA 2Y59A 3BFGA 1T19A 4CLCA 3E4OA 3HLDA 3BY8A 4KG6A 4MBKA 1D7EA 4R23A 1YLYA 3OLOA 1VHMA 5G4ZA 4RVAA 3T1RA 4Y0UA 1LL5A 3T1QB 3B42A 3N8LA 2EXBA 3JVVA 1PW1A 3MMHA 4JPMA 5HX9A 1IYOA 5F1GA 1CEGA 3MBZA 2HJEA 1GA0A 4B93A 4Z1WA 3G2YA 4KZ5A 3HLBA 2KDKA 3CPTA 4B4ZA 5L2FA 1EROA 5AQAA 3A0RA 3UE6A 1L3LA 4OQIA 5FQQA 2B02A 2Z2LB 3C7UA 1JWVA 2EWVA 5FEGA 5HPIA 2V9AA 4IUKA 5FAOA 5TBMA 1W7FA 3BYDA 5HWWA 4CLCC 5I5LA 3P7NA 2PBYA 2L0WA 1ZG4A 3G4PA 1KE3A 4OVDA 1S0WA 1VQQA 4P6ZM 1W8QA 3RFBA 4Y13A 3EOIA 4MBHA 3CZDA 4E3OA 1SKOA 3FWLA 3A3IA 4KENB 4FTXA 3TG9A 5F83A 3PBQA 5GLDA 1TF1A 5EM1A 1GHPA 3PR6A 4JF4A 1P9RA 3GMWA 2HPBA 2J9OA 1E3UD 1V9ZA 4WZ4A 2VA0A 4BENA 4E6XA 3KSHA 4Y7PA 2PRFA 1YAXA 5HFOA 1FR1A 1WE4A 4DXCA 2ZQ9A 4GNUA 1O7EA 3ITBA 5KIZA 4BQMA 3QP5A 4EBLA 4UA9A 3UB7A 4GN2A 5DTSA 3Q7VB 2H10A 3AGDA 1WA9A 2G2UA 3T12B 2WUQA 3WWXA 2I72A 3M2JA 5JYOA 2WKPA 2QYBA 5EOOA 4HIAA 1OTBA 4S2KA 1MY8A 2FFYA 1XFQA 2XD1A 4RX2A 2DMWA 4BMWA 5FSRA 1PI5A 3SW1A 3UPNA 2PYPA 1F2KA 4HY8A 3PHYA 4BBVA 1QMEA 2XR0A 2OWJA 1Q2PA 1KVLA 2XSSA 1NYYA 1IKGA 4UQIM 2ZM8A 3HBRA 3ULFA 3FPWA 3F1OB 1OT6A 4JLFA 2C6WB 3GR2A 3LEZA 1CQAA 3T4TA 2WK0A 3IBRA 2XQZA 5E43A 4MNRA 1FOFA 4CPKA 4EQ1A 2Z6CA 1DJBA 4DE0A 3IWIA 1C3BA 1H8MA 4GB7A 5GLBA 2VX8A 4FOFA 3T4JA 4K0XA 4E3MA 3CI6A 2X71A 4KZ3A 1TDGA 5CGSA 5DF9A 4X56A 4P85A 1IOUA 5TJJA 3NDEA 1LI9A 5CTMA 4LRYC 4GCZA 4EV4A 1NJ4A 1OTIA 5HAPA 2Y2LA 4HP9A 1FQGA 3R7WB 2WKIA 3TRCA 4GS9A 1D1JA 3BW6A 3ZNTA 3KYEA 3MFXA 2ZC4B 1GHIA 4OQGA 2PD7A 3UE0A 1J9MA 5FASA 5DFXA 4I3IA 2M7UA 2GJ3A 3G32A 5FEFA 3QP8A 5DVAA 1P9WA 1DJCA 3KX0X 1YSPA 4DJ3A 1YQSA 3KO6A 5EVIA 5DKKA 1Q2QA 4DJ2A 2Y2HA 5E2HA 1K38A 5FI6A 4L9FA 3HJIA 5FA7A 2WKEA 1G6AA 2OV5A 4E04A 5FDHA 4HBTA 1TS6A 2X01A 2PR6A 4XXRA 1PZOA 5FAPA 4EBNA 1OTEA 2QKPA 1GHMA 3IS2B 2K7SA 1HLUP 4MBFA 1ZHHB 5HDSA 2ZQAA 2W3HA 1L0FA 2V1BA 1S66L 1K56A 4KZBA 4OP8A 3VP0A 2O99A 2A2LA 2R78A 1VM1A 2ZM0A 3ZG8B 3B47A 4HH3A 4UAAA 2HZ5A 1VEUA 5EVIC 1BZAA 1N9BA 4ZAMA 1SHVA 1NZOA 3H9WA 3A3EA 2A24B 3IQAA 3QP2A 4C6YA 4JXSA 1G5UA 1GSWA 1XGIA 4UA7A 3PBTA 4B88A 5EFWA 5IS1A 1MBLA 1TVFA 4ETZA 3LCEA 3Q7ZA 1YM1A 3IWQA 1P0ZA 4S2MA 1A0KA 2OLVA 5BOHA 2H28A 3L7HA 1LL9A 2VK3A 3VOYA 3M6HA 5DF7A 1YLJA 2V2FF 4OP5A 5C5KA 2ZLYA 3K3CA 3P98A 4JXWA 1L0DA 4K08A 1ALQA 1FCNA 4DE3A 4S2OA 4EERA 5FDSA 1ZKJA 2KX6A 1HTZA 4KQRA 2J3TD 2PU4A 2QJ5A 4KUKA 1FILA 5GLCA 4LCLA 4DE1A 2Y79A 3E4PA 1FCMA 2QJ7A 1MWUA 2ZL1A 3F1NB 4RYEA 4DMZA 5CTNA 5EUAA 4Q0IA 4PM5A 3QP4A 1BYWA 5F82A 1TS8A 3UB6A 5HL6A 3V3RA 3OPHA 2P7JA 3UB8A 3QHYA 1H0MA 1N9OA 4S2NA 4HP4A 5HDCA 4N9LA 4PKYA 3GV9A 3HLGA 2VGLS 4R70A 3O87A 4O8GA 4DRTA 3G35A 1KDWA 1SZVA 3HLWA 3VOLA 1PWGA 3NHQA 1ODVA 1S6RA 3ZCZA 2WADA 1K55A 2MJ6A 4KZ9A 2PBDP 2GNXA 4LCMA 2WKHA 5FATA 3CUEA 1KOUA 2WGWA 1V9YA 5KSCA 1FIKA 3T4OA 4WM9A 2V8FA 4BLMA 4HH2A 3EQUA 4GW9A 1YKDA 4ZJ3A 2PYRA 3F1PA 1KVMA 5CGWA 3E4QA 3V3SA 3H82B 3MR0A 3RH8B 4OH0A 1GCEA 3FPVA 4II7A 2ZC6B 3IBJA 4QU3A 2XRNA 3BFCA 3NJAA 4OOLA 1K55C 3W2ZA 3MXQA 4NK3A 4JGPA 3Q07A 3C4OA 3CUEC 3PBOA 4K91A 5J3WA 3VE3A 1XJ3A 4AFIA 3K3DA 3A3DA
chains in the Genus database with same CATH topology
3VSLA 3CG5A 3GMWA 1RCJA 2HPBA 1E3UD 1PYYA 1YT4A 2J9OA 4PMAA 4WZ4A 4BENA 4E6XA 3EQVA 2EX8A 1K4FA 4Y7PA 4IBXA 4ZJ2A 1CEFA 3Q7VA 4K0WA 1FR1A 5HFOA 1WE4A 4DXCA 2ZQ9A 4GNUA 4U0XA 1O7EA 3PAGA 3ITBA 1K57A 2ZJ9A 3E2KA 3IF5A 2QZ6A 4HBUA 3ZG0A 3G34A 5HARA 4BQMA 3S4XA 3UPPA 3VOZA 4EBLA 3W4QA 4UA9A 5EOEA 1U60A 1DY6A 3S1YA 4GN2A 3GVBA 5DTSA 5CEBA 2WAFA 4LV1A 3MXRA 2XF3A 3Q7VB 2H10A 3AGDA 2G2UA 3IXDA 5CXWA 1ES4A 2WUQA 2BLSA 3WWXA 2HP6A 3WS4A 5M18A 2XD5A 2I72A 4QY5A 5GHXA 3M2JA 1K54C 5JYOA 3AGEA 1XKZA 5EOOA 2JCHA 5J8XA 4R3JA 4R0QA 4S2KA 3HUOA 3ITAA 5CRFA 1MY8A 1N4OA 3GSGA 1Y54A 3OC2A 2FFYA 2XD1A 4BD1A 5IHVA 3G31A 2X02A 4KG2A 1G68A 2H0TA 4RX2A 3VP1A 5HW3A 5FI2A 3DW0A 5FSRA 2HP5A 3SS5A 1PI5A 3UPNA 4JF5A 2Y2QA 5CGXA 2HDQA 1SKFA 1QMEA 2XR0A 3UPOA 3OPPA 5FI7A 1Q2PA 1KVLA 3BLSA 4OLGA 3LO7A 5CHMA 4DF6A 1NYYA 1IKGA 3HL9A 3BM6A 5M1AA 4UA6A 1KGEA 4EQIA 3BLMA 2ZM8A 1IKIA 1YMSA 3HBRA 3NI9A 1CI8A 2RCXA 4JLFA 2JC7A 2C6WB 4C3QA 3B3XA 3GR2A 3TOIA 3LEZA 1K57C 1BULA 1W8YA 2WK0A 2Y55A 2XQZA 3N6IA 3WRTA 4DXBA 5FQ9A 3UNWA 1SCWA 1LHYA 5E43A 4MNRA 1FOFA 4CPKA 2QPNA 3N8RA 3UO9A 2IWCA 1DJBA 1K6RA 1RGYA 1W5DA 3IH9A 1GA9A 3BFEA 5CERA 4DE0A 4QJGA 3IWIA 4S2NC 3N8SA 4ID4A 1JVJA 2P74A 5EE8A 1KGFA 1C3BA 4GB7A 3PAEA 4FCFA 1Z6FA 5GLBA 3SOIA 1SDNA 2IWBA 4K0XA 2J9PA 4E3MA 1TDLA 2X71A 2Y2PA 1M40A 2V1ZA 3VP4A 3M6BA 2OLUA 3O3VA 4KZ3A 1TDGA 2Y2OA 5CGSA 5DF9A 4X56A 3HUNA 1M6KA 1YLTA 4P85A 1LLBA 2ZQ8A 3VFFA 3NC8A 5KZHA 3C4PA 3WS5A 2FFFB 1ESUA 3NDEA 1LI9A 5CTMA 3W4OA 2ZQDA 4E3NA 4EV4A 1BSGA 1NJ4A 4CJNA 1NRFA 4R1GA 3HREA 3O88A 1H8ZA 5HAPA 1XPBA 4X68A 2Q9NA 3V50A 4YINA 4B4XA 2Y2LA 1SDEA 2A3UA 2ZQCA 3MZDA 1IYPA 1FQGA 3IH8A 2WKIA 2IWDA 1I2SA 5A92A 1CK3A 3IXHA 3IWOA 4QY6A 2HP9A 3ZNTA 1KE0A 5CHUA 4WEKA 4DDSA 5CEDA 4PPRA 3PBNA 5JYPA 1MXOA 2ZC4B 4P6BA 1GHIA 3FV7A 3MZFA 4NETA 4ZJ1A 4OQGA 3UE0A 3NDGA 1J9MA 1AXBA 5FASA 3IXGA 1MWSA 1KE4A 2EFUA 3G32A 3IT9A 4BJPA 2EX2A 3N4IA 4KZ8A 5M19A 2C5WB 3PBRA 4OLDA 4WMCD 1DJCA 5DVAA 2E8IA 1YQSA 2DNSA 3E2LA 3BRMA 2BG1A 4R3BA 2XK1A 5EVIA 4Q8IA 1HD8A 5A90A 3N7WA 1BT5A 1Q2QA 1O07A 2Y2HA 5E2HA 1K38A 3NBLA 3DTMA 3W4PA 3BEBA 5FI6A 3WS0A 4XUZA 3UDIA 5FA7A 2WKEA 1G6AA 4MEZA 2OV5A 2RL3A 2DCFA 5FDHA 4IEDA 4HBTA 1PZPA 2X01A 1I5QA 4XXRA 1PZOA 5EVIB 5FAPA 4EBNA 4E3JA 1PWCA 1ONHA 1GHMA 5CHJA 1FR6A 2ZC5B 4WBGA 3UE3A 4JBFA 5KMWA 4IVIA 3UY6A 4MBFA 5AQBA 5KSHA 4R4RA 4OQ0A 4E3KA 2J8YA 3ZVWA 2XFSA 2CC1A 1L0FA 2Y4AA 2ZQAA 3OPRA 4KZ7A 4EWFA 5A93A 1ESIA 1L0EA 4QD4A 4GDNA 5DTKA 1K56A 4KZBA 4OP8A 3VP0A 2Y2IA 4N1XA 4Y0OA 5HL1A 4M3KA 2EXAA 4PM7A 1L0GA 1HVBA 1XXMA 1WYBA 2WZZA 4FH4A 3HLEA 4X69A 1VM1A 5E2FA 2ZM0A 3RXXA 3ZG8B 1YLZA 4PM6A 3UDXA 4JKTA 4UAAA 4FSFA 3G2ZA 3GQZA 3ZHHA 1BTLA 2EFXA 3ZNYA 4PM8A 5EVIC 5AQ7A 3TSGA 1BZAA 1N9BA 4ZAMA 4EUZA 1SHVA 1DJAA 1NZOA 4U0TA 1H5XA 2WAEA 4O7DA 4U3TA 4E3LA 3A3EA 5DTTA 3V5MA 3IQAA 3UN7A 4GDBA 2R9WA 3ZVTA 1BLPA 4XUXA 3ZGAB 4GKUA 4X55A 4C6YA 4JXSA 1PW8A 3NY4A 1PWDA 2B5RA 4P0MA 5E2EA 1XGIA 4UA7A 3NCKA 1ZC2A 2WGVA 3PBTA 5G18A 1MWTA 4B88A 3IHAA 1BLSA 2PU2A 2VGJA 4GOGA 2HDUA 3G30A 5FAQA 5FQMA 3VSKA 4UHUA 3HLFA 1MBLA 1TVFA 5HAQA 2ZD8A 3LCEA 3Q1FA 3Q7ZA 1YMXA 4KZ4A 3VP2A 1YM1A 3IWQA 2Y2JA 2HDSA 4S2MA 4WZ5A 4BL2A 2OLVA 1NXYA 5BOHA 3IF6A 2EX6A 3VP3A 1LL9A 3GTCA 1IELA 2Z2MB 3ZG5A 5GLAA 2Q9MA 3MKFA 4PM9A 1KDSA 4L0LA 3ZFZA 3VOYA 3MXSA 3OPLA 4IVKA 4BD0A 4C75A 3M6HA 3NIAA 4X53A 5DF7A 3QNBA 1YLJA 3MKEA 1ZG6A 3HLCA 2V2FF 5TR7A 3BFFA 4KZAA 4OP5A 5D3OA 5HAIA 4ZTKA 3GRJA 3IF6B 1E25A 4E3IA 2ZLYA 5I94A 4OPYA 3P98A 4JXWA 4S2PA 3A3FA 1L0DA 1H8YA 3FKVA 4HEFA 4BL3A 4JXVA 4OQHA 5CECA 5AQ9A 1ALQA 1XA7A 5EVLA 3Q81A 5EECA 1FCNA 1BUEA 4DE3A 5F1FA 1MWRA 1NZUA 4FH2A 4S2OA 3SH8A 2ZQ7A 3SS3A 1PIOA 4QB8A 4F94A 1ZKJA 4KZ6A 4YFMA 1HTZA 4KQRA 4OPRA 3A3JA 3MFDA 4N92A 2WYXA 1LI0A 4OONA 3WS2A 2Y2MA 1E4DA 1IEMA 2XFTA 1JWZA 1IYQA 1MPLA 1FSWA 4KQQA 3DWKA 2PU4A 5FQIA 1RGZA 2EX9A 3OZHA 3V39A 2JBFA 1YLWA 3MZEA 4HESA 4EBPA 5GLCA 4LCLA 4DE1A 1FCOA 1FCMA 4LV2A 4ZBEA 1XGJA 5A91A 1HZOA 3M2KA 3OCNA 1MWUA 3PTEA 1RP5A 4RYEA 4OPQA 2V20A 2Y2GA 4JF6A 4WZ5C 5EVID 1JTGA 5CTNA 5EUAA 4PM5A 3IXBA 3IF6C 4P87A 2ZC3B 1CI9A 1ONGA 4JXGA 1QMFA 3FYZA 5F82A 3JYIA 3I7JA 2DRWA 4Z9QA 3V3RA 2H5SA 3UDFA 3WS1A 3OPHA 4LENA 3DWZA 3QHYA 4MLLA 4X6TA 1EI5A 4H8RA 2XLNA 5FQJA 2UWXA 4OOMA 3ZG7B 1K25A 1ES2A 1L2SA 3BECA 4S2NA 5FQKA 3C7VA 1XA1A 1BLHA 4N9KA 3VFHA 2OSUA 4S2IA 3CMZA 3RXWA 3SH9A 3HUMA 5GHYA 3OCLA 1ERMA 1FSYA 2Y2NA 4N9LA 5E2GA 2R9XA 2XEPA 2ZM2A 3GV9A 3HLGA 4OOYA 1IYSA 5TGFA 1PI4A 3W8KA 1ES5A 1NYMA 3O87A 2A49A 2P9VA 4D2OA 3ISGA 3P09A 4DRTA 3AGFA 4DE2A 4DDYA 3CJMA 1NY0A 4OKPA 4Y0TA 4ZDXA 2XGNA 1K56D 2GDNA 3G35A 4IBRA 1KDWA 2Y59A 4KG5A 3HLWA 3BFGA 4WEJA 5GHZA 3WRZA 4A5RA 4DKIA 3HLDA 1PWGA 1KGGA 4LV0A 2HDRA 4KG6A 4MBKA 1K6SA 2ZMAA 3FZCA 4R23A 1YLYA 1S6RA 3ZCZA 2P9VB 4RVAA 2VGKA 2WADA 4Y0UA 1K55A 1LL5A 4KZ9A 2H0YA 3N8LA 3QNCA 4GD8A 2EXBA 4R4SA 1PW1A 4LCMA 2WKHA 5FATA 4JPMA 5HX9A 2Y2KA 1IYOA 1TEMA 2ZC7A 1CEGA 1ERQA 4LV3A 5F1GA 2WGWA 3MBZA 4WYYA 5KSCA 1BLCA 1OMEA 3RJUA 1ES3A 1K4EA 2WZXA 1YLPA 2WGIA 1GA0A 4WM9A 3IHBA 4E6WA 2G2WA 4BLMA 3C5AA 3G2YA 3PBSA 4KZ5A 3HLBA 4N1HA 3LY3A 2WGWB 4B4ZA 5L2FA 2JE5A 1EROA 2J7VA 5AQAA 3ZDJA 3EQUA 4GD6A 3LY4A 1MKIA 4ZJ3A 3S22A 4GZBA 5U47A 3O86A 4S2JA 4OQIA 5FQQA 4WELA 5EPHA 2Z2LB 1KVMA 3C7UA 4RA7A 3HVFA 1JWVA 3VMAA 5CGWA 4S2LA 3V3SA 4RX3A 2QMIA 4FD8A 1JWPA 5FAOA 1XP4A 1W7FA 4OPZA 3BYDA 5TFQA 1K54A 3BFDA 3SH7A 3SS4A 4OH0A 1GCEA 1WYCA 5GL9A 3ZG9B 2PBYA 4QHCA 2ZC6B 1ZG4A 3G4PA 4QU3A 1XX2A 1KE3A 3Q82A 3BFCA 4OVDA 1W79A 1S0WA 5DF8A 1VQQA 4OOLA 1E3UA 1K55C 1W8QA 3FKWA 4KQOA 2XDMA 4MBHA 3CZDA 4E3OA 4KENB 3FWLA 3A3IA 4WMCA 4NK3A 1EWZA 2XH9A 3D4FA 3Q07A 3C4OA 3TG9A 3PBOA 5F83A 4K91A 1JTDA 3PBQA 5GLDA 3UE1A 1I2WA 2Y91A 1GHPA 3A3DA 4JF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VSL A;  3CG5 A;  3GMW A;  1RCJ A;  2HPB A;  1E3U D;  1PYY A;  1YT4 A;  2J9O A;  4PMA A;  4WZ4 A;  4BEN A;  4E6X A;  3EQV A;  2EX8 A;  1K4F A;  4Y7P A;  4IBX A;  4ZJ2 A;  1CEF A;  3Q7V A;  4K0W A;  1FR1 A;  5HFO A;  1WE4 A;  4DXC A;  2ZQ9 A;  4GNU A;  4U0X A;  1O7E A;  3PAG A;  3ITB A;  1K57 A;  2ZJ9 A;  3E2K A;  3IF5 A;  2QZ6 A;  4HBU A;  3ZG0 A;  3G34 A;  5HAR A;  4BQM A;  3S4X A;  3UPP A;  3VOZ A;  4EBL A;  3W4Q A;  4UA9 A;  5EOE A;  1U60 A;  1DY6 A;  3S1Y A;  4GN2 A;  3GVB A;  5DTS A;  5CEB A;  2WAF A;  4LV1 A;  3MXR A;  2XF3 A;  3Q7V B;  2H10 A;  3AGD A;  2G2U A;  3IXD A;  5CXW A;  1ES4 A;  2WUQ A;  2BLS A;  3WWX A;  2HP6 A;  3WS4 A;  5M18 A;  2XD5 A;  2I72 A;  4QY5 A;  5GHX A;  3M2J A;  1K54 C;  5JYO A;  3AGE A;  1XKZ A;  5EOO A;  2JCH A;  5J8X A;  4R3J A;  4R0Q A;  4S2K A;  3HUO A;  3ITA A;  5CRF A;  1MY8 A;  1N4O A;  3GSG A;  1Y54 A;  3OC2 A;  2FFY A;  2XD1 A;  4BD1 A;  5IHV A;  3G31 A;  2X02 A;  4KG2 A;  1G68 A;  2H0T A;  4RX2 A;  3VP1 A;  5HW3 A;  5FI2 A;  3DW0 A;  5FSR A;  2HP5 A;  3SS5 A;  1PI5 A;  3UPN A;  4JF5 A;  2Y2Q A;  5CGX A;  2HDQ A;  1SKF A;  1QME A;  2XR0 A;  3UPO A;  3OPP A;  5FI7 A;  1Q2P A;  1KVL A;  3BLS A;  4OLG A;  3LO7 A;  5CHM A;  4DF6 A;  1NYY A;  1IKG A;  3HL9 A;  3BM6 A;  5M1A A;  4UA6 A;  1KGE A;  4EQI A;  3BLM A;  2ZM8 A;  1IKI A;  1YMS A;  3HBR A;  3NI9 A;  1CI8 A;  2RCX A;  4JLF A;  2JC7 A;  2C6W B;  4C3Q A;  3B3X A;  3GR2 A;  3TOI A;  3LEZ A;  1K57 C;  1BUL A;  1W8Y A;  2WK0 A;  2Y55 A;  2XQZ A;  3N6I A;  3WRT A;  4DXB A;  5FQ9 A;  3UNW A;  1SCW A;  1LHY A;  5E43 A;  4MNR A;  1FOF A;  4CPK A;  2QPN A;  3N8R A;  3UO9 A;  2IWC A;  1DJB A;  1K6R A;  1RGY A;  1W5D A;  3IH9 A;  1GA9 A;  3BFE A;  5CER A;  4DE0 A;  4QJG A;  3IWI A;  4S2N C;  3N8S A;  4ID4 A;  1JVJ A;  2P74 A;  5EE8 A;  1KGF A;  1C3B A;  4GB7 A;  3PAE A;  4FCF A;  1Z6F A;  5GLB A;  3SOI A;  1SDN A;  2IWB A;  4K0X A;  2J9P A;  4E3M A;  1TDL A;  2X71 A;  2Y2P A;  1M40 A;  2V1Z A;  3VP4 A;  3M6B A;  2OLU A;  3O3V A;  4KZ3 A;  1TDG A;  2Y2O A;  5CGS A;  5DF9 A;  4X56 A;  3HUN A;  1M6K A;  1YLT A;  4P85 A;  1LLB A;  2ZQ8 A;  3VFF A;  3NC8 A;  5KZH A;  3C4P A;  3WS5 A;  2FFF B;  1ESU A;  3NDE A;  1LI9 A;  5CTM A;  3W4O A;  2ZQD A;  4E3N A;  4EV4 A;  1BSG A;  1NJ4 A;  4CJN A;  1NRF A;  4R1G A;  3HRE A;  3O88 A;  1H8Z A;  5HAP A;  1XPB A;  4X68 A;  2Q9N A;  3V50 A;  4YIN A;  4B4X A;  2Y2L A;  1SDE A;  2A3U A;  2ZQC A;  3MZD A;  1IYP A;  1FQG A;  3IH8 A;  2WKI A;  2IWD A;  1I2S A;  5A92 A;  1CK3 A;  3IXH A;  3IWO A;  4QY6 A;  2HP9 A;  3ZNT A;  1KE0 A;  5CHU A;  4WEK A;  4DDS A;  5CED A;  4PPR A;  3PBN A;  5JYP A;  1MXO A;  2ZC4 B;  4P6B A;  1GHI A;  3FV7 A;  3MZF A;  4NET A;  4ZJ1 A;  4OQG A;  3UE0 A;  3NDG A;  1J9M A;  1AXB A;  5FAS A;  3IXG A;  1MWS A;  1KE4 A;  2EFU A;  3G32 A;  3IT9 A;  4BJP A;  2EX2 A;  3N4I A;  4KZ8 A;  5M19 A;  2C5W B;  3PBR A;  4OLD A;  4WMC D;  1DJC A;  5DVA A;  2E8I A;  1YQS A;  2DNS A;  3E2L A;  3BRM A;  2BG1 A;  4R3B A;  2XK1 A;  5EVI A;  4Q8I A;  1HD8 A;  5A90 A;  3N7W A;  1BT5 A;  1Q2Q A;  1O07 A;  2Y2H A;  5E2H A;  1K38 A;  3NBL A;  3DTM A;  3W4P A;  3BEB A;  5FI6 A;  3WS0 A;  4XUZ A;  3UDI A;  5FA7 A;  2WKE A;  1G6A A;  4MEZ A;  2OV5 A;  2RL3 A;  2DCF A;  5FDH A;  4IED A;  4HBT A;  1PZP A;  2X01 A;  1I5Q A;  4XXR A;  1PZO A;  5EVI B;  5FAP A;  4EBN A;  4E3J A;  1PWC A;  1ONH A;  1GHM A;  5CHJ A;  1FR6 A;  2ZC5 B;  4WBG A;  3UE3 A;  4JBF A;  5KMW A;  4IVI A;  3UY6 A;  4MBF A;  5AQB A;  5KSH A;  4R4R A;  4OQ0 A;  4E3K A;  2J8Y A;  3ZVW A;  2XFS A;  2CC1 A;  1L0F A;  2Y4A A;  2ZQA A;  3OPR A;  4KZ7 A;  4EWF A;  5A93 A;  1ESI A;  1L0E A;  4QD4 A;  4GDN A;  5DTK A;  1K56 A;  4KZB A;  4OP8 A;  3VP0 A;  2Y2I A;  4N1X A;  4Y0O A;  5HL1 A;  4M3K A;  2EXA A;  4PM7 A;  1L0G A;  1HVB A;  1XXM A;  1WYB A;  2WZZ A;  4FH4 A;  3HLE A;  4X69 A;  1VM1 A;  5E2F A;  2ZM0 A;  3RXX A;  3ZG8 B;  1YLZ A;  4PM6 A;  3UDX A;  4JKT A;  4UAA A;  4FSF A;  3G2Z A;  3GQZ A;  3ZHH A;  1BTL A;  2EFX A;  3ZNY A;  4PM8 A;  5EVI C;  5AQ7 A;  3TSG A;  1BZA A;  1N9B A;  4ZAM A;  4EUZ A;  1SHV A;  1DJA A;  1NZO A;  4U0T A;  1H5X A;  2WAE A;  4O7D A;  4U3T A;  4E3L A;  3A3E A;  5DTT A;  3V5M A;  3IQA A;  3UN7 A;  4GDB A;  2R9W A;  3ZVT A;  1BLP A;  4XUX A;  3ZGA B;  4GKU A;  4X55 A;  4C6Y A;  4JXS A;  1PW8 A;  3NY4 A;  1PWD A;  2B5R A;  4P0M A;  5E2E A;  1XGI A;  4UA7 A;  3NCK A;  1ZC2 A;  2WGV A;  3PBT A;  5G18 A;  1MWT A;  4B88 A;  3IHA A;  1BLS A;  2PU2 A;  2VGJ A;  4GOG A;  2HDU A;  3G30 A;  5FAQ A;  5FQM A;  3VSK A;  4UHU A;  3HLF A;  1MBL A;  1TVF A;  5HAQ A;  2ZD8 A;  3LCE A;  3Q1F A;  3Q7Z A;  1YMX A;  4KZ4 A;  3VP2 A;  1YM1 A;  3IWQ A;  2Y2J A;  2HDS A;  4S2M A;  4WZ5 A;  4BL2 A;  2OLV A;  1NXY A;  5BOH A;  3IF6 A;  2EX6 A;  3VP3 A;  1LL9 A;  3GTC A;  1IEL A;  2Z2M B;  3ZG5 A;  5GLA A;  2Q9M A;  3MKF A;  4PM9 A;  1KDS A;  4L0L A;  3ZFZ A;  3VOY A;  3MXS A;  3OPL A;  4IVK A;  4BD0 A;  4C75 A;  3M6H A;  3NIA A;  4X53 A;  5DF7 A;  3QNB A;  1YLJ A;  3MKE A;  1ZG6 A;  3HLC A;  2V2F F;  5TR7 A;  3BFF A;  4KZA A;  4OP5 A;  5D3O A;  5HAI A;  4ZTK A;  3GRJ A;  3IF6 B;  1E25 A;  4E3I A;  2ZLY A;  5I94 A;  4OPY A;  3P98 A;  4JXW A;  4S2P A;  3A3F A;  1L0D A;  1H8Y A;  3FKV A;  4HEF A;  4BL3 A;  4JXV A;  4OQH A;  5CEC A;  5AQ9 A;  1ALQ A;  1XA7 A;  5EVL A;  3Q81 A;  5EEC A;  1FCN A;  1BUE A;  4DE3 A;  5F1F A;  1MWR A;  1NZU A;  4FH2 A;  4S2O A;  3SH8 A;  2ZQ7 A;  3SS3 A;  1PIO A;  4QB8 A;  4F94 A;  1ZKJ A;  4KZ6 A;  4YFM A;  1HTZ A;  4KQR A;  4OPR A;  3A3J A;  3MFD A;  4N92 A;  2WYX A;  1LI0 A;  4OON A;  3WS2 A;  2Y2M A;  1E4D A;  1IEM A;  2XFT A;  1JWZ A;  1IYQ A;  1MPL A;  1FSW A;  4KQQ A;  3DWK A;  2PU4 A;  5FQI A;  1RGZ A;  2EX9 A;  3OZH A;  3V39 A;  2JBF A;  1YLW A;  3MZE A;  4HES A;  4EBP A;  5GLC A;  4LCL A;  4DE1 A;  1FCO A;  1FCM A;  4LV2 A;  4ZBE A;  1XGJ A;  5A91 A;  1HZO A;  3M2K A;  3OCN A;  1MWU A;  3PTE A;  1RP5 A;  4RYE A;  4OPQ A;  2V20 A;  2Y2G A;  4JF6 A;  4WZ5 C;  5EVI D;  1JTG A;  5CTN A;  5EUA A;  4PM5 A;  3IXB A;  3IF6 C;  4P87 A;  2ZC3 B;  1CI9 A;  1ONG A;  4JXG A;  1QMF A;  3FYZ A;  5F82 A;  3JYI A;  3I7J A;  2DRW A;  4Z9Q A;  3V3R A;  2H5S A;  3UDF A;  3WS1 A;  3OPH A;  4LEN A;  3DWZ A;  3QHY A;  4MLL A;  4X6T A;  1EI5 A;  4H8R A;  2XLN A;  5FQJ A;  2UWX A;  4OOM A;  3ZG7 B;  1K25 A;  1ES2 A;  1L2S A;  3BEC A;  4S2N A;  5FQK A;  3C7V A;  1XA1 A;  1BLH A;  4N9K A;  3VFH A;  2OSU A;  4S2I A;  3CMZ A;  3RXW A;  3SH9 A;  3HUM A;  5GHY A;  3OCL A;  1ERM A;  1FSY A;  2Y2N A;  4N9L A;  5E2G A;  2R9X A;  2XEP A;  2ZM2 A;  3GV9 A;  3HLG A;  4OOY A;  1IYS A;  5TGF A;  1PI4 A;  3W8K A;  1ES5 A;  1NYM A;  3O87 A;  2A49 A;  2P9V A;  4D2O A;  3ISG A;  3P09 A;  4DRT A;  3AGF A;  4DE2 A;  4DDY A;  3CJM A;  1NY0 A;  4OKP A;  4Y0T A;  4ZDX A;  2XGN A;  1K56 D;  2GDN A;  3G35 A;  4IBR A;  1KDW A;  2Y59 A;  4KG5 A;  3HLW A;  3BFG A;  4WEJ A;  5GHZ A;  3WRZ A;  4A5R A;  4DKI A;  3HLD A;  1PWG A;  1KGG A;  4LV0 A;  2HDR A;  4KG6 A;  4MBK A;  1K6S A;  2ZMA A;  3FZC A;  4R23 A;  1YLY A;  1S6R A;  3ZCZ A;  2P9V B;  4RVA A;  2VGK A;  2WAD A;  4Y0U A;  1K55 A;  1LL5 A;  4KZ9 A;  2H0Y A;  3N8L A;  3QNC A;  4GD8 A;  2EXB A;  4R4S A;  1PW1 A;  4LCM A;  2WKH A;  5FAT A;  4JPM A;  5HX9 A;  2Y2K A;  1IYO A;  1TEM A;  2ZC7 A;  1CEG A;  1ERQ A;  4LV3 A;  5F1G A;  2WGW A;  3MBZ A;  4WYY A;  5KSC A;  1BLC A;  1OME A;  3RJU A;  1ES3 A;  1K4E A;  2WZX A;  1YLP A;  2WGI A;  1GA0 A;  4WM9 A;  3IHB A;  4E6W A;  2G2W A;  4BLM A;  3C5A A;  3G2Y A;  3PBS A;  4KZ5 A;  3HLB A;  4N1H A;  3LY3 A;  2WGW B;  4B4Z A;  5L2F A;  2JE5 A;  1ERO A;  2J7V A;  5AQA A;  3ZDJ A;  3EQU A;  4GD6 A;  3LY4 A;  1MKI A;  4ZJ3 A;  3S22 A;  4GZB A;  5U47 A;  3O86 A;  4S2J A;  4OQI A;  5FQQ A;  4WEL A;  5EPH A;  2Z2L B;  1KVM A;  3C7U A;  4RA7 A;  3HVF A;  1JWV A;  3VMA A;  5CGW A;  4S2L A;  3V3S A;  4RX3 A;  2QMI A;  4FD8 A;  1JWP A;  5FAO A;  1XP4 A;  1W7F A;  4OPZ A;  3BYD A;  5TFQ A;  1K54 A;  3BFD A;  3SH7 A;  3SS4 A;  4OH0 A;  1GCE A;  1WYC A;  5GL9 A;  3ZG9 B;  2PBY A;  4QHC A;  2ZC6 B;  1ZG4 A;  3G4P A;  4QU3 A;  1XX2 A;  1KE3 A;  3Q82 A;  3BFC A;  4OVD A;  1W79 A;  1S0W A;  5DF8 A;  1VQQ A;  4OOL A;  1E3U A;  1K55 C;  1W8Q A;  3FKW A;  4KQO A;  2XDM A;  4MBH A;  3CZD A;  4E3O A;  4KEN B;  3FWL A;  3A3I A;  4WMC A;  4NK3 A;  1EWZ A;  2XH9 A;  3D4F A;  3Q07 A;  3C4O A;  3TG9 A;  3PBO A;  5F83 A;  4K91 A;  1JTD A;  3PBQ A;  5GLD A;  3UE1 A;  1I2W A;  2Y91 A;  1GHP A;  3A3D A;  4JF4 A; 
#chains in the Genus database with same CATH topology
 3CG5 A;  4PMA A;  4ZJ2 A;  3S7O A;  4U0X A;  3T1S A;  3PAG A;  2ZJ9 A;  4HBU A;  5HAR A;  3S4X A;  3UPP A;  4LRX C;  3S1Y A;  3GVB A;  3TJZ C;  1LSX A;  3MXR A;  2UV0 E;  3G6O A;  4GHI B;  1ES4 A;  4CQH A;  3WS4 A;  3AGE A;  5HPF A;  4EEP A;  3HUO A;  2LB9 A;  1N4O A;  3S7Q A;  1Y54 A;  2ACG A;  2FH5 A;  3OC2 A;  4HJ3 A;  5IHV A;  3UB5 P;  2JKG A;  4G3K A;  4KG2 A;  1G68 A;  2H0T A;  3VP1 A;  5FI2 A;  3SS5 A;  4UEY A;  5CGX A;  1SKF A;  3OPP A;  1PNE A;  3EWK A;  3LO7 A;  4DF6 A;  1VB6 A;  3NI9 A;  1G6O A;  2JC7 A;  4C3Q A;  3B3X A;  3VE4 A;  2JKR M;  2ZMV A;  2QHK A;  2AVX A;  1W8Y A;  5L07 A;  4ARZ A;  3D9Y A;  3UMD A;  5L10 A;  2IWC A;  3IH9 A;  3BFE A;  2OOL A;  2P74 A;  5EE8 A;  1KGF A;  3PAE A;  4FCF A;  1Z6F A;  4HNB A;  2IWB A;  3NUL A;  1TDL A;  3M6B A;  2VV7 A;  3E98 A;  3HUN A;  1M6K A;  1YLT A;  4NXE A;  3EGX C;  3VFF A;  4F3L A;  1CJF A;  1XFN A;  4R38 A;  3W4O A;  2VLG A;  2ZQD A;  4E3N A;  1D06 A;  1BSG A;  4O0P A;  3HRE A;  4B4X A;  4H6J B;  2A3U A;  3MZD A;  2ZQC A;  2IWD A;  2K2N A;  4FUW A;  1CK3 A;  1DP8 A;  3IWO A;  2W1T A;  2VGL M;  3PBN A;  3CHW P;  5JYP A;  5HZH A;  3MZF A;  4ZJ1 A;  4NXG A;  3IXG A;  3IT9 A;  4BJP A;  2EX2 A;  3N4I A;  5M19 A;  4WMC D;  4I5S A;  4OLD A;  2VEA A;  3NOU C;  4R3B A;  5HSQ A;  3BRM A;  2BG1 A;  5A90 A;  4XT2 B;  2BTF P;  3IX4 A;  4MMN A;  3DTM A;  3PXP A;  3DBA A;  3H7W A;  2RL3 A;  5F68 A;  1PZP A;  1I5Q A;  3K2N A;  3T1X A;  1PWC A;  1ONH A;  1TD5 A;  4HQA A;  5KSH A;  2JKT M;  2CMN A;  4NXB A;  4E3K A;  2XFS A;  2Y4A A;  5A93 A;  1ESI A;  1L0E A;  4N1X A;  2EXA A;  4LRZ E;  1HVB A;  2P04 A;  3RTY A;  1XXM A;  1YSQ A;  1WYB A;  3GDI A;  3HLE A;  5E2F A;  2B18 A;  1YLZ A;  3V67 A;  1MKM A;  4QWO A;  3MF0 A;  4JKT A;  4BWI A;  1BTL A;  3TW8 A;  3ZNY A;  1AWI A;  1DJA A;  4U3T A;  3LGO A;  4Y15 A;  4GDB A;  3ZVT A;  1T1C A;  2V0U A;  4GOG A;  2HDU A;  2PT7 A;  5FQM A;  3VSK A;  4UHU A;  1S67 L;  5HAQ A;  3Q1F A;  3VP2 A;  2Y2J A;  3R4K A;  1S4R A;  3IF6 A;  5DKL A;  3VP3 A;  3GTC A;  1IEL A;  2Z2M B;  5AJG A;  1NLY A;  4PM9 A;  3CIT A;  3ZFZ A;  3OPL A;  1P97 A;  3MJQ A;  3BQA A;  3BFF A;  4KZA A;  5D3O A;  5HAI A;  4ZTK A;  3GRJ A;  3FKV A;  4HEF A;  4OQH A;  5CEC A;  4R3A A;  3MQ0 A;  5EEC A;  1BUE A;  3SH8 A;  3SS3 A;  4JGQ A;  4QB8 A;  3BWL A;  4YFM A;  3A3J A;  3MFD A;  4OON A;  1E4D A;  2XFT A;  5AVE A;  1FSW A;  3O5Y A;  5FQI A;  1LL8 A;  2JBF A;  3MZE A;  4HES A;  4HOI A;  3M2K A;  3OCN A;  3PTE A;  4MN6 A;  3S7P A;  2Y2G A;  4JF6 A;  5L09 A;  3ZYT A;  3IF6 C;  4JXG A;  1ONG A;  1MZU A;  2DRW A;  4NG2 A;  1L2S A;  3BEC A;  1T1A A;  4PHT A;  4NEE D;  4N9K A;  2OSU A;  4S2I A;  3CMZ A;  1EW0 A;  5E2G A;  2XEP A;  3W8K A;  1ES5 A;  1NYM A;  3P09 A;  3MQO A;  3CJM A;  1NY0 A;  2EA9 A;  4KG5 A;  4MN7 A;  4WUJ A;  3SZT A;  4LV0 A;  1KGG A;  2JKR I;  1UWP X;  1VET B;  1Z09 A;  4JGO A;  4MCW A;  1N9N A;  2P9V B;  2M7V A;  4GD8 A;  1N9L A;  4O01 A;  1F9I A;  1S1Y A;  4CLC B;  1TEM A;  4LV3 A;  1LSV A;  4WYY A;  1ES3 A;  1K4E A;  1UGU A;  2WZX A;  1YLP A;  5DJT A;  4R6L A;  3IHB A;  2J80 A;  4E6W A;  2G2W A;  5MC7 A;  5A8B A;  3C5A A;  2KOI A;  3LY3 A;  3MS6 A;  2JE5 A;  2J7V A;  3ZDJ A;  3LY4 A;  1MKI A;  2O9C A;  3S22 A;  4GZB A;  5EPH A;  4RA7 A;  3VMA A;  4S2L A;  2QMI A;  4FD8 A;  1JWP A;  2V1A A;  4OPZ A;  1Y4O A;  3CPT B;  3MSH A;  5F6A A;  3SS4 A;  1WYC A;  4QHC A;  1XX2 A;  2E8J A;  5DF8 A;  1E3U A;  3FKW A;  4KQO A;  2XDM A;  5TBM B;  3BY9 A;  4WMC A;  2ZBB A;  1OT9 A;  2Y91 A;  5IU1 A;  2PHY A;  3JVU A;  1SKO B;  1K4F A;  4IBX A;  3Q7V A;  1K57 A;  3E2K A;  3VOZ A;  2PAV P;  3W4Q A;  4WL9 A;  1U60 A;  1DY6 A;  2BAS A;  2JKT I;  5CEB A;  2FZ0 A;  2HP6 A;  5M18 A;  3T4S A;  4QY5 A;  1X0O A;  2JCH A;  4G3W A;  2J3W A;  5J8X A;  3U4L P;  3ITA A;  5EV0 A;  3GSG A;  3G31 A;  2X02 A;  5HW3 A;  2ZMF A;  3F1O A;  5K5B A;  4EXO A;  3BLS A;  3BM6 A;  4EQI A;  3BLM A;  1IKI A;  1YMS A;  4LPZ A;  2RCX A;  3LIA A;  3GEC A;  1K57 C;  3FC7 A;  5F5Y A;  5DJU A;  4GJ4 A;  3N6I A;  3WRT A;  4DXB A;  5FQ9 A;  4BBT A;  1K6R A;  5CER A;  1W5D A;  3LR0 A;  4S2N C;  3N8S A;  4G3V A;  4ID4 A;  1JVJ A;  2O9B A;  4BBU A;  3SOI A;  1SDN A;  5EM0 A;  2Y2P A;  1M40 A;  2V1Z A;  2VV8 A;  2WKR A;  4Y5F A;  3VP4 A;  2OLU A;  3O3V A;  1LLB A;  1YPR A;  2W27 A;  3R7W A;  2W3G A;  1G28 A;  3UB9 A;  4CJN A;  1XJ4 A;  1OJ5 A;  1H8Z A;  4X68 A;  3V50 A;  4KQD A;  1SDE A;  1IYP A;  1MC0 A;  4HI4 A;  2HGV A;  3IH8 A;  1TS0 A;  4QY6 A;  2PDR A;  5CED A;  4DDS A;  4PPR A;  1W63 Q;  3BQ8 A;  4QPR A;  4HHD A;  4ETX A;  4WN5 A;  2EFU A;  4GS9 B;  4KZ8 A;  2C5W B;  3PBR A;  4CLC E;  4Q0H A;  4Q8I A;  2XK1 A;  2VKS A;  3CWF A;  1HD8 A;  1O07 A;  3IS2 A;  3B33 A;  5AVF A;  3NBL A;  3BEB A;  4XUZ A;  1TS7 A;  3UDI A;  4HJ4 A;  2DCF A;  3LIE A;  5EVI B;  1OJG A;  5CHJ A;  2ZC5 B;  4WBG A;  5KMW A;  2YKH A;  3LYX A;  3E0Y A;  5AQB A;  4OQ0 A;  1DRM A;  2J8Y A;  3ZVW A;  4KZ7 A;  3OPR A;  4QD4 A;  5DTK A;  4LGW A;  2Y2I A;  2D01 A;  2WZZ A;  4FH4 A;  4I38 A;  3UDX A;  2A24 A;  4FSF A;  3G2Z A;  3ZHH A;  5AQ7 A;  4EUZ A;  4X25 A;  4U0T A;  2WAE A;  5DTT A;  3V5M A;  3UN7 A;  2R9W A;  2VJW A;  1BLP A;  4XUX A;  3ZGA B;  4X55 A;  1VEU B;  4EET B;  1PW8 A;  3MQQ A;  2B5R A;  2WGV A;  3T50 A;  1BLS A;  4KUO A;  3QP1 A;  2VGJ A;  3G30 A;  5FAQ A;  2Z6D A;  2ZD8 A;  4KZ4 A;  2HDS A;  1ACF A;  1F98 A;  4WZ5 A;  4BL2 A;  1NXY A;  2XRO A;  3IX3 A;  1GSV A;  3ZG5 A;  5GLA A;  2Q9M A;  3MKF A;  1KDS A;  4L0L A;  4EES A;  1XJ2 A;  4IVK A;  4X53 A;  3QNB A;  3MKE A;  3LIB A;  4YOF A;  4MN5 A;  5I94 A;  1E25 A;  3DTE A;  4OPY A;  2D02 A;  3A3F A;  1H8Y A;  4BL3 A;  4JXV A;  3OBF A;  5AQ9 A;  3Q81 A;  1W63 M;  5F1F A;  1MWR A;  1NZU A;  4FH2 A;  2M1C A;  1PIO A;  4F94 A;  1H3Q A;  4N92 A;  2W3D A;  3F1N A;  1IYQ A;  3OZH A;  5G4Y A;  4ESP A;  4WF0 A;  4EBP A;  4WLA A;  1FCO A;  4LV2 A;  3NOT C;  5A91 A;  4L9G A;  2V20 A;  4WZ5 C;  1JTG A;  4P87 A;  2ZC3 B;  1CI9 A;  1QMF A;  3FYZ A;  4Z9Q A;  3WS1 A;  2H5S A;  3UDF A;  4LEN A;  4EU0 A;  3BJN A;  3DWZ A;  2ZL1 B;  2NUT C;  4Y17 A;  1CF0 A;  2XLN A;  2UWX A;  4OOM A;  1K25 A;  1ES2 A;  3ICY A;  3C7V A;  2JHE A;  3LR5 A;  3RXW A;  2J3T C;  3SH9 A;  4IHQ A;  5HWT A;  1IYS A;  5TGF A;  1S1Z A;  5HD5 A;  2A49 A;  3ISG A;  3AGF A;  4DE2 A;  3EEA A;  4DDY A;  1PRQ A;  4OKP A;  4Y0T A;  2XGN A;  3HCY A;  4ME4 A;  3NOP C;  5GHZ A;  3WRZ A;  4A5R A;  2I9V A;  4DKI A;  2KLI A;  2OAP 1;  4EW7 A;  2HDR A;  1K6S A;  2ZMA A;  3FZC A;  2VGK A;  1JNU A;  5J4E A;  3D3O A;  2H0Y A;  3QNC A;  4R4S A;  2Y2K A;  3L9K A;  2ZC7 A;  1ERQ A;  1BLC A;  1OME A;  3RJU A;  2WGI A;  2XA7 S;  3U2A A;  2JKF A;  3DTI A;  1Y28 A;  1PFL A;  3PBS A;  4N1H A;  2WGW B;  3H82 A;  4IUH A;  5CX7 A;  4GD6 A;  5F69 A;  2V0W A;  1OTD A;  2YKF A;  5U47 A;  3LR3 A;  3O86 A;  4S2J A;  2OAQ 1;  4WEL A;  3LID A;  2EWW A;  3HVF A;  4RX3 A;  1XP4 A;  4NXF A;  5TFQ A;  1F5M A;  2ZOH A;  1K54 A;  3BFD A;  3EGD C;  3SH7 A;  5GL9 A;  3ZG9 B;  4RQ9 A;  3F1P B;  3Q82 A;  3D72 A;  1W79 A;  3QP6 A;  4I39 A;  2L1M A;  1EWZ A;  2XH9 A;  3D4F A;  4I3A A;  1JTD A;  3UE1 A;  1I2W A;  2W0N A;  2WKQ A;  3VSL A;  1RCJ A;  1PYY A;  1YT4 A;  2LB5 A;  3EQV A;  1ZTU A;  2EX8 A;  3A0S A;  1CEF A;  4K0W A;  5HDD A;  4GHI A;  2OWH A;  4Q0J A;  3IF5 A;  2QZ6 A;  3ZG0 A;  3G34 A;  1OPX A;  5EOE A;  3LFV A;  3LIC A;  2PD8 A;  4PAU A;  2WAF A;  3LI9 A;  4LV1 A;  5DFY A;  2XF3 A;  1K0K A;  2ZOI A;  3IXD A;  5CXW A;  5L8M A;  2BLS A;  1S4S A;  2XD5 A;  5GHX A;  1K54 C;  1XKZ A;  1STZ A;  4R3J A;  3CLO A;  4R0Q A;  1OTA A;  3UME A;  5CRF A;  4BD1 A;  4B9O A;  3LUQ A;  3KSI A;  3DW0 A;  2HP5 A;  4JF5 A;  2Y2Q A;  2HDQ A;  3UPO A;  5FI7 A;  4LLO B;  4OLG A;  2K31 A;  5CHM A;  1NWZ A;  3HL9 A;  5M1A A;  4UA6 A;  1KGE A;  2G7U A;  4YNR A;  1CI8 A;  2O9A A;  4CLC D;  3TOI A;  1BUL A;  4M4X A;  2Y55 A;  3KSG A;  3UNW A;  1SCW A;  1LHY A;  2QPN A;  3N8R A;  3UO9 A;  1RGY A;  1GA9 A;  4QJG A;  3KYZ A;  2HF6 A;  4HJ6 A;  4EEU A;  4ARZ B;  2J9P A;  2Y2O A;  2P08 A;  2GZA A;  2ZQ8 A;  4H6J A;  1NRJ A;  1IFQ A;  4ZRR A;  3P01 A;  3NC8 A;  5KZH A;  3C4P A;  3WS5 A;  2FFF B;  1ESU A;  3OOV A;  1NRF A;  4R1G A;  3O88 A;  1XPB A;  3IX8 A;  2Q9N A;  3EEH A;  4YIN A;  3JPU A;  4F3L B;  1I2S A;  5A92 A;  3IXH A;  2B95 A;  2HP9 A;  3C38 A;  1KE0 A;  5CHU A;  4WEK A;  1XJ6 A;  1MXO A;  4L9E A;  3CAX A;  4P6B A;  3FV7 A;  4NET A;  3NDG A;  1AXB A;  4XT2 A;  1MWS A;  1KE4 A;  2W1T B;  2QWS A;  2E8I A;  1GSX A;  1T1B A;  3E2L A;  2DNS A;  3KSF A;  3N7W A;  1BT5 A;  1T18 A;  3W4P A;  3WS0 A;  4MEZ A;  3ZQ5 A;  4IED A;  5HWV A;  2INW A;  2XA7 M;  4E3J A;  3C30 A;  3HJK A;  3KYQ A;  3LI8 A;  1FR6 A;  3UE3 A;  4JBF A;  3H7W B;  4IVI A;  3UY6 A;  4R4R A;  3T4L A;  3T4K A;  2CC1 A;  1LSW A;  4EWF A;  1DP6 A;  1DP9 A;  3S7N A;  4GDN A;  1LT0 A;  4JGR A;  4Y0O A;  5HL1 A;  2W3E A;  4M3K A;  4P6Z S;  4PM7 A;  1L0G A;  3NEC A;  1J3W A;  4X69 A;  3RXX A;  2Y8H A;  2IA2 A;  4PM6 A;  5LBR A;  3GQZ A;  3VV4 A;  2EFX A;  4PM8 A;  3TSG A;  4Y3I A;  4X1M A;  2V8C A;  1H5X A;  4NKP A;  4O7D A;  4E3L A;  4GKU A;  3NY4 A;  1PWD A;  4P0M A;  5E2E A;  3LR4 A;  3NCK A;  1ZC2 A;  5G18 A;  1MWT A;  5IT5 A;  3IHA A;  2PU2 A;  4D60 A;  1UWN X;  3HLF A;  3DTK A;  1YMX A;  3DAV A;  4PKY G;  4IJG A;  4DN0 A;  2HV1 A;  2EX6 A;  4I3J A;  5FL3 A;  2VV6 A;  3MXS A;  4C75 A;  4Y2F A;  2GX5 A;  4BD0 A;  3NIA A;  4GLQ A;  3FG8 A;  1ZG6 A;  3HLC A;  5TR7 A;  3A0V A;  3IF6 B;  4E3I A;  2W1R A;  2Q0O A;  4S2P A;  4UQI S;  5EVL A;  1XA7 A;  5HD3 A;  3C2W A;  2PR5 A;  2ZQ7 A;  4KZ6 A;  3TE8 A;  4OPR A;  2WYX A;  1LI0 A;  2JN7 A;  3LEQ A;  3WS2 A;  2Y2M A;  1IEM A;  1JWZ A;  3C8C A;  1MPL A;  2L4R A;  4KQQ A;  3DWK A;  1RGZ A;  2EX9 A;  2VZW A;  3V39 A;  1YLW A;  4ZBE A;  1XGJ A;  1HZO A;  1NLZ A;  1RP5 A;  4OPQ A;  5EVI D;  3IXB A;  3JYI A;  5J7E A;  4X1L A;  2O0Y A;  3I7J A;  3LIF A;  4YWZ A;  2W3F A;  2HJ9 C;  4MLL A;  4X6T A;  1EI5 A;  4H8R A;  5FQJ A;  3ZG7 B;  5FQK A;  1XA1 A;  1BLH A;  3VFH A;  2NUP C;  3HUM A;  4LFU A;  5GHY A;  3OCL A;  1ERM A;  1FSY A;  5EVE A;  2Y2N A;  2R9X A;  2ZM2 A;  3PYP A;  4OOY A;  1VET A;  1PI4 A;  4EUV A;  4MDZ A;  4D2O A;  2P9V A;  3T4Q A;  4ZDX A;  1K56 D;  4IBR A;  4WEJ A;  2GDN A;  2Y59 A;  3BFG A;  1T19 A;  4CLC A;  3E4O A;  3HLD A;  3BY8 A;  4KG6 A;  4MBK A;  1D7E A;  4R23 A;  1YLY A;  3OLO A;  1VHM A;  5G4Z A;  4RVA A;  3T1R A;  4Y0U A;  1LL5 A;  3T1Q B;  3B42 A;  3N8L A;  2EXB A;  3JVV A;  1PW1 A;  3MMH A;  4JPM A;  5HX9 A;  1IYO A;  5F1G A;  1CEG A;  3MBZ A;  2HJE A;  1GA0 A;  4B93 A;  4Z1W A;  3G2Y A;  4KZ5 A;  3HLB A;  2KDK A;  3CPT A;  4B4Z A;  5L2F A;  1ERO A;  5AQA A;  3A0R A;  3UE6 A;  1L3L A;  4OQI A;  5FQQ A;  2B02 A;  2Z2L B;  3C7U A;  1JWV A;  2EWV A;  5FEG A;  5HPI A;  2V9A A;  4IUK A;  5FAO A;  5TBM A;  1W7F A;  3BYD A;  5HWW A;  4CLC C;  5I5L A;  3P7N A;  2PBY A;  2L0W A;  1ZG4 A;  3G4P A;  1KE3 A;  4OVD A;  1S0W A;  1VQQ A;  4P6Z M;  1W8Q A;  3RFB A;  4Y13 A;  3EOI A;  4MBH A;  3CZD A;  4E3O A;  1SKO A;  3FWL A;  3A3I A;  4KEN B;  4FTX A;  3TG9 A;  5F83 A;  3PBQ A;  5GLD A;  1TF1 A;  5EM1 A;  1GHP A;  3PR6 A;  4JF4 A;  1P9R A;  3GMW A;  2HPB A;  2J9O A;  1E3U D;  1V9Z A;  4WZ4 A;  2VA0 A;  4BEN A;  4E6X A;  3KSH A;  4Y7P A;  2PRF A;  1YAX A;  5HFO A;  1FR1 A;  1WE4 A;  4DXC A;  2ZQ9 A;  4GNU A;  1O7E A;  3ITB A;  5KIZ A;  4BQM A;  3QP5 A;  4EBL A;  4UA9 A;  3UB7 A;  4GN2 A;  5DTS A;  3Q7V B;  2H10 A;  3AGD A;  1WA9 A;  2G2U A;  3T12 B;  2WUQ A;  3WWX A;  2I72 A;  3M2J A;  5JYO A;  2WKP A;  2QYB A;  5EOO A;  4HIA A;  1OTB A;  4S2K A;  1MY8 A;  2FFY A;  1XFQ A;  2XD1 A;  4RX2 A;  2DMW A;  4BMW A;  5FSR A;  1PI5 A;  3SW1 A;  3UPN A;  2PYP A;  1F2K A;  4HY8 A;  3PHY A;  4BBV A;  1QME A;  2XR0 A;  2OWJ A;  1Q2P A;  1KVL A;  2XSS A;  1NYY A;  1IKG A;  4UQI M;  2ZM8 A;  3HBR A;  3ULF A;  3FPW A;  3F1O B;  1OT6 A;  4JLF A;  2C6W B;  3GR2 A;  3LEZ A;  1CQA A;  3T4T A;  2WK0 A;  3IBR A;  2XQZ A;  5E43 A;  4MNR A;  1FOF A;  4CPK A;  4EQ1 A;  2Z6C A;  1DJB A;  4DE0 A;  3IWI A;  1C3B A;  1H8M A;  4GB7 A;  5GLB A;  2VX8 A;  4FOF A;  3T4J A;  4K0X A;  4E3M A;  3CI6 A;  2X71 A;  4KZ3 A;  1TDG A;  5CGS A;  5DF9 A;  4X56 A;  4P85 A;  1IOU A;  5TJJ A;  3NDE A;  1LI9 A;  5CTM A;  4LRY C;  4GCZ A;  4EV4 A;  1NJ4 A;  1OTI A;  5HAP A;  2Y2L A;  4HP9 A;  1FQG A;  3R7W B;  2WKI A;  3TRC A;  4GS9 A;  1D1J A;  3BW6 A;  3ZNT A;  3KYE A;  3MFX A;  2ZC4 B;  1GHI A;  4OQG A;  2PD7 A;  3UE0 A;  1J9M A;  5FAS A;  5DFX A;  4I3I A;  2M7U A;  2GJ3 A;  3G32 A;  5FEF A;  3QP8 A;  5DVA A;  1P9W A;  1DJC A;  3KX0 X;  1YSP A;  4DJ3 A;  1YQS A;  3KO6 A;  5EVI A;  5DKK A;  1Q2Q A;  4DJ2 A;  2Y2H A;  5E2H A;  1K38 A;  5FI6 A;  4L9F A;  3HJI A;  5FA7 A;  2WKE A;  1G6A A;  2OV5 A;  4E04 A;  5FDH A;  4HBT A;  1TS6 A;  2X01 A;  2PR6 A;  4XXR A;  1PZO A;  5FAP A;  4EBN A;  1OTE A;  2QKP A;  1GHM A;  3IS2 B;  2K7S A;  1HLU P;  4MBF A;  1ZHH B;  5HDS A;  2ZQA A;  2W3H A;  1L0F A;  2V1B A;  1S66 L;  1K56 A;  4KZB A;  4OP8 A;  3VP0 A;  2O99 A;  2A2L A;  2R78 A;  1VM1 A;  2ZM0 A;  3ZG8 B;  3B47 A;  4HH3 A;  4UAA A;  2HZ5 A;  1VEU A;  5EVI C;  1BZA A;  1N9B A;  4ZAM A;  1SHV A;  1NZO A;  3H9W A;  3A3E A;  2A24 B;  3IQA A;  3QP2 A;  4C6Y A;  4JXS A;  1G5U A;  1GSW A;  1XGI A;  4UA7 A;  3PBT A;  4B88 A;  5EFW A;  5IS1 A;  1MBL A;  1TVF A;  4ETZ A;  3LCE A;  3Q7Z A;  1YM1 A;  3IWQ A;  1P0Z A;  4S2M A;  1A0K A;  2OLV A;  5BOH A;  2H28 A;  3L7H A;  1LL9 A;  2VK3 A;  3VOY A;  3M6H A;  5DF7 A;  1YLJ A;  2V2F F;  4OP5 A;  5C5K A;  2ZLY A;  3K3C A;  3P98 A;  4JXW A;  1L0D A;  4K08 A;  1ALQ A;  1FCN A;  4DE3 A;  4S2O A;  4EER A;  5FDS A;  1ZKJ A;  2KX6 A;  1HTZ A;  4KQR A;  2J3T D;  2PU4 A;  2QJ5 A;  4KUK A;  1FIL A;  5GLC A;  4LCL A;  4DE1 A;  2Y79 A;  3E4P A;  1FCM A;  2QJ7 A;  1MWU A;  2ZL1 A;  3F1N B;  4RYE A;  4DMZ A;  5CTN A;  5EUA A;  4Q0I A;  4PM5 A;  3QP4 A;  1BYW A;  5F82 A;  1TS8 A;  3UB6 A;  5HL6 A;  3V3R A;  3OPH A;  2P7J A;  3UB8 A;  3QHY A;  1H0M A;  1N9O A;  4S2N A;  4HP4 A;  5HDC A;  4N9L A;  4PKY A;  3GV9 A;  3HLG A;  2VGL S;  4R70 A;  3O87 A;  4O8G A;  4DRT A;  3G35 A;  1KDW A;  1SZV A;  3HLW A;  3VOL A;  1PWG A;  3NHQ A;  1ODV A;  1S6R A;  3ZCZ A;  2WAD A;  1K55 A;  2MJ6 A;  4KZ9 A;  2PBD P;  2GNX A;  4LCM A;  2WKH A;  5FAT A;  3CUE A;  1KOU A;  2WGW A;  1V9Y A;  5KSC A;  1FIK A;  3T4O A;  4WM9 A;  2V8F A;  4BLM A;  4HH2 A;  3EQU A;  4GW9 A;  1YKD A;  4ZJ3 A;  2PYR A;  3F1P A;  1KVM A;  5CGW A;  3E4Q A;  3V3S A;  3H82 B;  3MR0 A;  3RH8 B;  4OH0 A;  1GCE A;  3FPV A;  4II7 A;  2ZC6 B;  3IBJ A;  4QU3 A;  2XRN A;  3BFC A;  3NJA A;  4OOL A;  1K55 C;  3W2Z A;  3MXQ A;  4NK3 A;  4JGP A;  3Q07 A;  3C4O A;  3CUE C;  3PBO A;  4K91 A;  5J3W A;  3VE3 A;  1XJ3 A;  4AFI A;  3K3D A;  3A3D A; 
#chains in the Genus database with same CATH homology
 3VSL A;  3CG5 A;  3GMW A;  1RCJ A;  2HPB A;  1E3U D;  1PYY A;  1YT4 A;  2J9O A;  4PMA A;  4WZ4 A;  4BEN A;  4E6X A;  3EQV A;  2EX8 A;  1K4F A;  4Y7P A;  4IBX A;  4ZJ2 A;  1CEF A;  3Q7V A;  4K0W A;  1FR1 A;  5HFO A;  1WE4 A;  4DXC A;  2ZQ9 A;  4GNU A;  4U0X A;  1O7E A;  3PAG A;  3ITB A;  1K57 A;  2ZJ9 A;  3E2K A;  3IF5 A;  2QZ6 A;  4HBU A;  3ZG0 A;  3G34 A;  5HAR A;  4BQM A;  3S4X A;  3UPP A;  3VOZ A;  4EBL A;  3W4Q A;  4UA9 A;  5EOE A;  1U60 A;  1DY6 A;  3S1Y A;  4GN2 A;  3GVB A;  5DTS A;  5CEB A;  2WAF A;  4LV1 A;  3MXR A;  2XF3 A;  3Q7V B;  2H10 A;  3AGD A;  2G2U A;  3IXD A;  5CXW A;  1ES4 A;  2WUQ A;  2BLS A;  3WWX A;  2HP6 A;  3WS4 A;  5M18 A;  2XD5 A;  2I72 A;  4QY5 A;  5GHX A;  3M2J A;  1K54 C;  5JYO A;  3AGE A;  1XKZ A;  5EOO A;  2JCH A;  5J8X A;  4R3J A;  4R0Q A;  4S2K A;  3HUO A;  3ITA A;  5CRF A;  1MY8 A;  1N4O A;  3GSG A;  1Y54 A;  3OC2 A;  2FFY A;  2XD1 A;  4BD1 A;  5IHV A;  3G31 A;  2X02 A;  4KG2 A;  1G68 A;  2H0T A;  4RX2 A;  3VP1 A;  5HW3 A;  5FI2 A;  3DW0 A;  5FSR A;  2HP5 A;  3SS5 A;  1PI5 A;  3UPN A;  4JF5 A;  2Y2Q A;  5CGX A;  2HDQ A;  1SKF A;  1QME A;  2XR0 A;  3UPO A;  3OPP A;  5FI7 A;  1Q2P A;  1KVL A;  3BLS A;  4OLG A;  3LO7 A;  5CHM A;  4DF6 A;  1NYY A;  1IKG A;  3HL9 A;  3BM6 A;  5M1A A;  4UA6 A;  1KGE A;  4EQI A;  3BLM A;  2ZM8 A;  1IKI A;  1YMS A;  3HBR A;  3NI9 A;  1CI8 A;  2RCX A;  4JLF A;  2JC7 A;  2C6W B;  4C3Q A;  3B3X A;  3GR2 A;  3TOI A;  3LEZ A;  1K57 C;  1BUL A;  1W8Y A;  2WK0 A;  2Y55 A;  2XQZ A;  3N6I A;  3WRT A;  4DXB A;  5FQ9 A;  3UNW A;  1SCW A;  1LHY A;  5E43 A;  4MNR A;  1FOF A;  4CPK A;  2QPN A;  3N8R A;  3UO9 A;  2IWC A;  1DJB A;  1K6R A;  1RGY A;  1W5D A;  3IH9 A;  1GA9 A;  3BFE A;  5CER A;  4DE0 A;  4QJG A;  3IWI A;  4S2N C;  3N8S A;  4ID4 A;  1JVJ A;  2P74 A;  5EE8 A;  1KGF A;  1C3B A;  4GB7 A;  3PAE A;  4FCF A;  1Z6F A;  5GLB A;  3SOI A;  1SDN A;  2IWB A;  4K0X A;  2J9P A;  4E3M A;  1TDL A;  2X71 A;  2Y2P A;  1M40 A;  2V1Z A;  3VP4 A;  3M6B A;  2OLU A;  3O3V A;  4KZ3 A;  1TDG A;  2Y2O A;  5CGS A;  5DF9 A;  4X56 A;  3HUN A;  1M6K A;  1YLT A;  4P85 A;  1LLB A;  2ZQ8 A;  3VFF A;  3NC8 A;  5KZH A;  3C4P A;  3WS5 A;  2FFF B;  1ESU A;  3NDE A;  1LI9 A;  5CTM A;  3W4O A;  2ZQD A;  4E3N A;  4EV4 A;  1BSG A;  1NJ4 A;  4CJN A;  1NRF A;  4R1G A;  3HRE A;  3O88 A;  1H8Z A;  5HAP A;  1XPB A;  4X68 A;  2Q9N A;  3V50 A;  4YIN A;  4B4X A;  2Y2L A;  1SDE A;  2A3U A;  2ZQC A;  3MZD A;  1IYP A;  1FQG A;  3IH8 A;  2WKI A;  2IWD A;  1I2S A;  5A92 A;  1CK3 A;  3IXH A;  3IWO A;  4QY6 A;  2HP9 A;  3ZNT A;  1KE0 A;  5CHU A;  4WEK A;  4DDS A;  5CED A;  4PPR A;  3PBN A;  5JYP A;  1MXO A;  2ZC4 B;  4P6B A;  1GHI A;  3FV7 A;  3MZF A;  4NET A;  4ZJ1 A;  4OQG A;  3UE0 A;  3NDG A;  1J9M A;  1AXB A;  5FAS A;  3IXG A;  1MWS A;  1KE4 A;  2EFU A;  3G32 A;  3IT9 A;  4BJP A;  2EX2 A;  3N4I A;  4KZ8 A;  5M19 A;  2C5W B;  3PBR A;  4OLD A;  4WMC D;  1DJC A;  5DVA A;  2E8I A;  1YQS A;  2DNS A;  3E2L A;  3BRM A;  2BG1 A;  4R3B A;  2XK1 A;  5EVI A;  4Q8I A;  1HD8 A;  5A90 A;  3N7W A;  1BT5 A;  1Q2Q A;  1O07 A;  2Y2H A;  5E2H A;  1K38 A;  3NBL A;  3DTM A;  3W4P A;  3BEB A;  5FI6 A;  3WS0 A;  4XUZ A;  3UDI A;  5FA7 A;  2WKE A;  1G6A A;  4MEZ A;  2OV5 A;  2RL3 A;  2DCF A;  5FDH A;  4IED A;  4HBT A;  1PZP A;  2X01 A;  1I5Q A;  4XXR A;  1PZO A;  5EVI B;  5FAP A;  4EBN A;  4E3J A;  1PWC A;  1ONH A;  1GHM A;  5CHJ A;  1FR6 A;  2ZC5 B;  4WBG A;  3UE3 A;  4JBF A;  5KMW A;  4IVI A;  3UY6 A;  4MBF A;  5AQB A;  5KSH A;  4R4R A;  4OQ0 A;  4E3K A;  2J8Y A;  3ZVW A;  2XFS A;  2CC1 A;  1L0F A;  2Y4A A;  2ZQA A;  3OPR A;  4KZ7 A;  4EWF A;  5A93 A;  1ESI A;  1L0E A;  4QD4 A;  4GDN A;  5DTK A;  1K56 A;  4KZB A;  4OP8 A;  3VP0 A;  2Y2I A;  4N1X A;  4Y0O A;  5HL1 A;  4M3K A;  2EXA A;  4PM7 A;  1L0G A;  1HVB A;  1XXM A;  1WYB A;  2WZZ A;  4FH4 A;  3HLE A;  4X69 A;  1VM1 A;  5E2F A;  2ZM0 A;  3RXX A;  3ZG8 B;  1YLZ A;  4PM6 A;  3UDX A;  4JKT A;  4UAA A;  4FSF A;  3G2Z A;  3GQZ A;  3ZHH A;  1BTL A;  2EFX A;  3ZNY A;  4PM8 A;  5EVI C;  5AQ7 A;  3TSG A;  1BZA A;  1N9B A;  4ZAM A;  4EUZ A;  1SHV A;  1DJA A;  1NZO A;  4U0T A;  1H5X A;  2WAE A;  4O7D A;  4U3T A;  4E3L A;  3A3E A;  5DTT A;  3V5M A;  3IQA A;  3UN7 A;  4GDB A;  2R9W A;  3ZVT A;  1BLP A;  4XUX A;  3ZGA B;  4GKU A;  4X55 A;  4C6Y A;  4JXS A;  1PW8 A;  3NY4 A;  1PWD A;  2B5R A;  4P0M A;  5E2E A;  1XGI A;  4UA7 A;  3NCK A;  1ZC2 A;  2WGV A;  3PBT A;  5G18 A;  1MWT A;  4B88 A;  3IHA A;  1BLS A;  2PU2 A;  2VGJ A;  4GOG A;  2HDU A;  3G30 A;  5FAQ A;  5FQM A;  3VSK A;  4UHU A;  3HLF A;  1MBL A;  1TVF A;  5HAQ A;  2ZD8 A;  3LCE A;  3Q1F A;  3Q7Z A;  1YMX A;  4KZ4 A;  3VP2 A;  1YM1 A;  3IWQ A;  2Y2J A;  2HDS A;  4S2M A;  4WZ5 A;  4BL2 A;  2OLV A;  1NXY A;  5BOH A;  3IF6 A;  2EX6 A;  3VP3 A;  1LL9 A;  3GTC A;  1IEL A;  2Z2M B;  3ZG5 A;  5GLA A;  2Q9M A;  3MKF A;  4PM9 A;  1KDS A;  4L0L A;  3ZFZ A;  3VOY A;  3MXS A;  3OPL A;  4IVK A;  4BD0 A;  4C75 A;  3M6H A;  3NIA A;  4X53 A;  5DF7 A;  3QNB A;  1YLJ A;  3MKE A;  1ZG6 A;  3HLC A;  2V2F F;  5TR7 A;  3BFF A;  4KZA A;  4OP5 A;  5D3O A;  5HAI A;  4ZTK A;  3GRJ A;  3IF6 B;  1E25 A;  4E3I A;  2ZLY A;  5I94 A;  4OPY A;  3P98 A;  4JXW A;  4S2P A;  3A3F A;  1L0D A;  1H8Y A;  3FKV A;  4HEF A;  4BL3 A;  4JXV A;  4OQH A;  5CEC A;  5AQ9 A;  1ALQ A;  1XA7 A;  5EVL A;  3Q81 A;  5EEC A;  1FCN A;  1BUE A;  4DE3 A;  5F1F A;  1MWR A;  1NZU A;  4FH2 A;  4S2O A;  3SH8 A;  2ZQ7 A;  3SS3 A;  1PIO A;  4QB8 A;  4F94 A;  1ZKJ A;  4KZ6 A;  4YFM A;  1HTZ A;  4KQR A;  4OPR A;  3A3J A;  3MFD A;  4N92 A;  2WYX A;  1LI0 A;  4OON A;  3WS2 A;  2Y2M A;  1E4D A;  1IEM A;  2XFT A;  1JWZ A;  1IYQ A;  1MPL A;  1FSW A;  4KQQ A;  3DWK A;  2PU4 A;  5FQI A;  1RGZ A;  2EX9 A;  3OZH A;  3V39 A;  2JBF A;  1YLW A;  3MZE A;  4HES A;  4EBP A;  5GLC A;  4LCL A;  4DE1 A;  1FCO A;  1FCM A;  4LV2 A;  4ZBE A;  1XGJ A;  5A91 A;  1HZO A;  3M2K A;  3OCN A;  1MWU A;  3PTE A;  1RP5 A;  4RYE A;  4OPQ A;  2V20 A;  2Y2G A;  4JF6 A;  4WZ5 C;  5EVI D;  1JTG A;  5CTN A;  5EUA A;  4PM5 A;  3IXB A;  3IF6 C;  4P87 A;  2ZC3 B;  1CI9 A;  1ONG A;  4JXG A;  1QMF A;  3FYZ A;  5F82 A;  3JYI A;  3I7J A;  2DRW A;  4Z9Q A;  3V3R A;  2H5S A;  3UDF A;  3WS1 A;  3OPH A;  4LEN A;  3DWZ A;  3QHY A;  4MLL A;  4X6T A;  1EI5 A;  4H8R A;  2XLN A;  5FQJ A;  2UWX A;  4OOM A;  3ZG7 B;  1K25 A;  1ES2 A;  1L2S A;  3BEC A;  4S2N A;  5FQK A;  3C7V A;  1XA1 A;  1BLH A;  4N9K A;  3VFH A;  2OSU A;  4S2I A;  3CMZ A;  3RXW A;  3SH9 A;  3HUM A;  5GHY A;  3OCL A;  1ERM A;  1FSY A;  2Y2N A;  4N9L A;  5E2G A;  2R9X A;  2XEP A;  2ZM2 A;  3GV9 A;  3HLG A;  4OOY A;  1IYS A;  5TGF A;  1PI4 A;  3W8K A;  1ES5 A;  1NYM A;  3O87 A;  2A49 A;  2P9V A;  4D2O A;  3ISG A;  3P09 A;  4DRT A;  3AGF A;  4DE2 A;  4DDY A;  3CJM A;  1NY0 A;  4OKP A;  4Y0T A;  4ZDX A;  2XGN A;  1K56 D;  2GDN A;  3G35 A;  4IBR A;  1KDW A;  2Y59 A;  4KG5 A;  3HLW A;  3BFG A;  4WEJ A;  5GHZ A;  3WRZ A;  4A5R A;  4DKI A;  3HLD A;  1PWG A;  1KGG A;  4LV0 A;  2HDR A;  4KG6 A;  4MBK A;  1K6S A;  2ZMA A;  3FZC A;  4R23 A;  1YLY A;  1S6R A;  3ZCZ A;  2P9V B;  4RVA A;  2VGK A;  2WAD A;  4Y0U A;  1K55 A;  1LL5 A;  4KZ9 A;  2H0Y A;  3N8L A;  3QNC A;  4GD8 A;  2EXB A;  4R4S A;  1PW1 A;  4LCM A;  2WKH A;  5FAT A;  4JPM A;  5HX9 A;  2Y2K A;  1IYO A;  1TEM A;  2ZC7 A;  1CEG A;  1ERQ A;  4LV3 A;  5F1G A;  2WGW A;  3MBZ A;  4WYY A;  5KSC A;  1BLC A;  1OME A;  3RJU A;  1ES3 A;  1K4E A;  2WZX A;  1YLP A;  2WGI A;  1GA0 A;  4WM9 A;  3IHB A;  4E6W A;  2G2W A;  4BLM A;  3C5A A;  3G2Y A;  3PBS A;  4KZ5 A;  3HLB A;  4N1H A;  3LY3 A;  2WGW B;  4B4Z A;  5L2F A;  2JE5 A;  1ERO A;  2J7V A;  5AQA A;  3ZDJ A;  3EQU A;  4GD6 A;  3LY4 A;  1MKI A;  4ZJ3 A;  3S22 A;  4GZB A;  5U47 A;  3O86 A;  4S2J A;  4OQI A;  5FQQ A;  4WEL A;  5EPH A;  2Z2L B;  1KVM A;  3C7U A;  4RA7 A;  3HVF A;  1JWV A;  3VMA A;  5CGW A;  4S2L A;  3V3S A;  4RX3 A;  2QMI A;  4FD8 A;  1JWP A;  5FAO A;  1XP4 A;  1W7F A;  4OPZ A;  3BYD A;  5TFQ A;  1K54 A;  3BFD A;  3SH7 A;  3SS4 A;  4OH0 A;  1GCE A;  1WYC A;  5GL9 A;  3ZG9 B;  2PBY A;  4QHC A;  2ZC6 B;  1ZG4 A;  3G4P A;  4QU3 A;  1XX2 A;  1KE3 A;  3Q82 A;  3BFC A;  4OVD A;  1W79 A;  1S0W A;  5DF8 A;  1VQQ A;  4OOL A;  1E3U A;  1K55 C;  1W8Q A;  3FKW A;  4KQO A;  2XDM A;  4MBH A;  3CZD A;  4E3O A;  4KEN B;  3FWL A;  3A3I A;  4WMC A;  4NK3 A;  1EWZ A;  2XH9 A;  3D4F A;  3Q07 A;  3C4O A;  3TG9 A;  3PBO A;  5F83 A;  4K91 A;  1JTD A;  3PBQ A;  5GLD A;  3UE1 A;  1I2W A;  2Y91 A;  1GHP A;  3A3D A;  4JF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...