1MKMA

Crystal structure of the thermotoga maritima iclr
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
246
structure length
246
Chain Sequence
MNTLKKAFEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKDKRYVPGYKLIEYGSFVLRRFNIRDIAHDHLVDIMKRTGETVHLILKDGFEGVYIDKVEGEQSIPMVSRLGMKVDLYSTASGKSILAFVPEKELKEYLKIVELKPKTPNTITNPRVLKRELEKIRKRGYAVDNEENEIGIMCVGVPIFDHNGYPVAGVSISGVARKFTEEKIEEYSDVLKEKAEEISRKLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Thermotoga maritima 0065, a member of the IclR transcriptional factor family.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
molecule keywords IclR transcriptional regulator
total genus 75
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
A PF09339 HTH_IclR IclR helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mkmA01
1.20.5.640 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1mkmA02
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1mkmA03
2LNBA 4IF4A 3HRMA 2O9AA 3PFIA 1J5YA 5BOXA 3REOA 4P96A 3K2NA 2GXGA 4M74A 1LJ9A 3WTUC 5J8FA 3HRTA 3GLXA 2A3SA 1OYWA 4Y3IA 1MGTA 2QQAA 2O3FA 3I53A 5D8KB 5BPIA 3HTSB 3BZ6A 3MFKA 2LB5A 1Y0UA 2DAOA 4HA8A 3RYPA 2V9VA 2GA2A 2OZ6A 3NEUA 4A5NA 2G7UA 5BQTA 3R0JA 1P4XA 2O9BA 3F8CA 1FY7A 1RUNA 4DN0A 1EH6A 1U5TB 1HSTA 4ZYGA 4UNOA 2Q2EA 5DUKA 2H27A 2F5FA 1TF1A 1J0RA 3LFKA 4D0PA 4G6QA 2W57A 1K78B 3E97A 3GEZA 4LRYC 1Z91A 3HSFA 2LF8A 4ENJA 2H6BA 3RPQA 2ISYA 1T2KA 2PG4A 1SD6A 2NRAC 4MCWA 4O0PA 3MF0A 4LLGF 1TNSA 4KMUX 2EB7A 3KCCA 2QBYA 3WTZA 1KQ8A 4BHBA 3D0SA 2ZJ2A 2FNPA 4OU0A 4EUVA 1KQ0A 4L5JA 2VOPA 3EETA 4N0BA 4AWXB 3H92A 2P7CB 1YIOA 1KU3A 3I64A 1D8KA 1YSPA 1OYIA 3HRUA 2R7FA 2HTSA 3E6MA 3M8EA 4M73A 2JZYA 4A2UA 5L3EA 4I09A 3LA3A 2KJCA 5FO5A 1R7JA 3ULQB 2W3EA 4MMNA 3BJNA 1ODDA 3CTAA 3LA7A 3RJPA 4BH9A 3V7RA 2HFHA 3K1PA 3FHZA 2E1NA 5DYMA 2EJRA 5LHIA 4PCQA 3J81Z 4TV7A 3MWMA 4CDGA 1LQ1A 5JVTA 1DPRA 2DW4A 5FB2A 1Q1HA 3KFWX 3WE2A 1S3JA 2UXXA 1S6LA 4EJWA 3HTUA 4CZZA 5CVUA 5J6XA 2JTVA 2JPCA 1W5TA 2MBFA 1R1VA 1TQPA 4OOIA 1X3UA 2W3DA 3S7PA 2EV5A 3NQOA 4P5OA 3L7WA 3HRSA 4O3MA 4OMYA 4MHGA 3WTTC 4U0YA 2GXBA 4EJTA 5K5BA 3DKWA 3MQ0A 2ACJA 1LEAA 1RZ4A 4EVIA 3S7NA 1S7AA 1LB2A 3RIRA 1TBXA 2F5DA 1U5TC 2P8TA 2V1DA 5DD4A 3RYRA 2OU2A 1O3RA 2RNJA 4G3KA 3QU6A 2R3SA 3HHHA 3V7SA 2LB9A 4LK0F 2M1BA 3HSEA 4G8XA 1YS7A 2XASA 2RQPA 3C7JA 2FBIA 4L9NA 3ZMVA 2L4MA 1BI3A 1RI7A 2W25A 1B6AA 4ENMA 5D6FA 4YIIA 4MN7A 4A0XA 1HSJA 3ERED 2VJWA 1G3TA 1OR7A 2BEOA 1HW1A 2DBBA 2Y48A 1B1BA 4ENKA 3EEAA 5F6FA 4IJGA 2A69F 2B18A 2ESNA 1K79A 2MH9A 3TO6A 1KGSA 5ILSA 3G3ZA 2H6CA 1QBJA 4UVBA 3BPVA 3BROA 4M71A 1SD4A 3FMQA 4MQVA 1REPC 2Y0MA 1XSXA 1YG2A 3NOPC 3IRQA 2RDPA 4F7ZA 1J7KA 2BV6A 4ESFA 5ICEA 2DQRA 3KO6A 5ICCA 2TDXA 5DV5A 4BYYA 1IF1A 1SMYF 5HLHA 4H0EA 1BC7C 4QPRA 4OINF 3HCYA 5LRRA 3IKVA 2A07F 4WX9A 5D6EA 1FYLA 1PUEE 2XAQA 4GO1A 2EFPA 1S29A 1SFXA 3CO6C 1Z6RA 4HBLA 1Z1DA 3SZTA 3COAC 2XAJA 4FHTA 3L2CA 2VT2A 2P6SA 3K1NA 5H6QA 4KN7X 1FP2A 3ZMTA 1J59A 3GZ5A 2Y79A 3ABTA 1YYVA 5H20A 2GIVA 4HQEA 4U7DA 5CLSA 1B59A 5F1RA 3F8BA 5L3DA 3IWZA 3KP4A 3V8LA 1W5SA 1WI9A 2P6TA 4HV5A 4LRXC 1IN8A 3V8JA 3E5XA 1KQ9A 2FMYA 4HZFA 1OYYA 3ZN1A 1I1SA 3FF5A 2G7HA 3H3UA 1ZLKA 3F3XA 3FMSA 3ZMZA 2DPUA 2FOKA 1LVAA 2RVCA 4L5IA 4A6DA 2O8XA 1K7AA 5FGMA 5DEQA 1T39A 4RGXA 2O6GE 4KN4X 4L9JA 4YOFA 1XGMA 2ZBKA 1IN5A 3ECOA 1CF7B 3ROUA 3TDUC 5ED4A 1F9NA 3KLOA 1BC8C 5LBQA 1IRGA 3T1BA 2AXLA 5KVRA 2OBPA 3P9CA 2VE9A 5DDGA 1ZREA 2X4HA 2V6CA 1QNTA 1K6OA 1IN4A 3DP7A 3HOTA 1R58A 2ZMEB 3IWFA 2RN7A 3HYIA 1FWZA 3J7AO 4R8HA 3F6OA 2IPQX 4U0VA 2CG4A 2HZTA 2D2WA 2LSOA 2E7XA 3JW4A 3QP5A 5LLQA 2MLGA 5LBRA 4ETXA 4MEYF 3GUDA 3GYHX 4OIRF 2HKXA 1BIBA 5ILVA 3P7NA 5AJGA 2EK5A 2L02A 5K5RA 4BQAA 2YR2A 2CO5A 2Q0OA 1EV7A 4LG0A 4ETZA 2PMHA 3KSIA 4CO8A 1MJ9A 4ZZDA 4JBAA 5D5XB 3EQLF 2JT1A 1MZBA 1D8JA 3JSOA 2FU4A 3ZQ5A 4EJUA 5F64A 2O61A 3GFMA 1JHHA 2M87A 2A61A 4Y15A 5D5UB 4DMZA 2OOLA 4EM1A 5D5VB 5JI6A 4XRFA 3ECHA 2O9CA 5HLGA 4ME4A 5IT9Z 5DUIA 1USTA 5AONA 3KSGA 1XSDA 2X0LA 2VEAA 1DP7P 3IRRA 3FMRA 3MEXA 2OA4A 5LHGA 5IT3A 5LHHA 2D1HA 3L9FA 3E6DA 4PZJA 5LRSA 3GXOA 5CJ9A 2K27A 1XDSA 4CYDA 1S7OA 1ZH5A 4IUKA 1A04A 2HQNA 4EJVA 1AWCA 2HEOA 4EGZA 1SFEA 2CSOA 3SFZA 2ZNYA 2CQKA 3BP8A 4FT8A 4L18B 3M7GA 3FX3A 2WC2A 5H6RA 1MJAA 5HVQC 4NHJA 2NNNA 1P6RA 5E18F 5L3BA 2IP2A 2PMUA 4KUMA 3RI4A 1OPCA 2PFBA 3ISPA 3WU1B 2O0YA 1O57A 2Z99A 3DPLC 5CVRA 4WCGA 2IA2A 5CVVA 3NHQA 3HIFA 3S7QA 2CFXA 3K69A 4M72A 1FBQA 1XMAA 4GYGA 4ENNA 2P7VB 1XGOA 3R60A 5BPDA 4CICA 1ZHFA 5ILUA 3F8FA 2AS5F 4IRHA 4P9FA 4U0WA 1BI0A 4KIGA 2CWEA 2COMA 1OKRA 3CO7C 3FXRA 1O3TA 3ML6A 1BN5A 4Q0IA 4MGRA 4XSZF 1YO5C 3BPXA 5ICFA 1T38A 1YW9A 2STWA 2VBWA 3SXYA 3D5LA 1GVJA 1JXSA 1GXPA 3CLOA 3ZP5A 1FPQA 2VE8A 3OOVA 2ETHA 3WG9A 2RV8A 2QZ8A 1YQAA 3U2RA 1ONVA 1R23A 4EMSA 3ZMDA 2ZKZA 4ZYHA 1I6XA 5FD6A 4RAZA 1XGSA 5HDKA 3WTXC 4UV8A 2M5WA 1O7FA 5JR3A 2KIMA 2VT3A 4OIPF 3QPHA 1H0MA 1T98A 1W7PD 1LDJA 2D45A 4A0ZA 1D3YA 4I7HA 3R0AA 1F1ZA 3IBRA 4BXUA 3HUGA 3KP5A 3T8RA 4CHUA 2GX5A 1EH7A 5HDGA 4MEXF 4IHTA 1FOKA 3EDPA 1TW2A 4YIFA 3BJAA 3GFIA 4LB5A 2W1TA 1ZG3A 1G4DA 4BHCA 1USSA 4EV0A 4HF2A 4A5MA 5E1ZB 3CITA 2L4AA 2MC3A 5FLXK 3QAHA 1MC0A 3JSPA 3GO5A 3I71A 2Y8HA 2XROA 4YG2F 2DU9A 3WE3A 3L00A 3V8KA 5HSQA 4U7BA 5K5QA 2GA1A 1STZA 1R1UA 5A2QK 3MMHA 2HTJA 4CQHA 1B9MA 3I5UA 3KETA 2D1VA 1G3WA 3GW2A 2M8EA 2KRFA 5KK1A 3N97A 1G6NA 2F5EA 4Q47A 1P4WA 1ULYA 3K9TA 1O3SA 1IN7A 3TQNA 4RGUA 2Z3YA 3DFGA 1S8NA 5LEKA 1YW7A 5LGUA 5ICGA 1LDDA 4ESJA 2K02A 2DQLA 1ZARA 1FYKA 3DXJF 2FEZA 3F72A 3WODF 1W4MA 2XIGA 1SFUA 1FSEA 2XV4S 2IRFG 1FBUA 5EEHA 3Q9SA 1IAWA 4IHSA 2V1UA 4DQ2A 3M1EA 4ZYEA 4A0YA 1B4AA 1ZGJA 2FA5A 1QO0D 4P55A 1VTNC 5JFRA 3TO9A 1XB4A 2PN6A 2L01A 1TLHB 3CJNA 1L3LA 5DFXA 4Y17A 2VC1A 2ISZA 4QWQA 1ON1A 3EUHA 4K2EA 3G73A 3W6KB 2A68F 5J8CA 2EA4A 2DLLA 3C2WA 3MZHA 2VC0A 4LB6B 1KU2A 4Y5FA 1PDNC 2CYYA 3FZVA 4HOBA 3SHFA 1I5ZA 4BWIA 4LK1F 4YFKF 2ZCWA 1FYMA 2XAGA 4P9UA 3ELKA 4WWCA 3TOBA 1FX7A 3MCZA 3MAJA 3M9AA 5E20A 1KU9A 1WRJA 4IRGA 3KSHA 3FM5A 4AIJA 2P5VA 4Z2YA 1DPUA 5HPIA 4NB5A 4XLNF 4ZYDA 3RPUA 3T0YA 2EFQA 4JK1X 1E17A 4MDZA 2EV6A 4UV9A 2ZXJA 3G6OA 3PQKA 4G7OF 4RB2C 4KA4A 5BS6A 5L3GA 1XDUA 3LWFA 1I27A 1HKQA 4HX7A 1XMKA 2W84A 1HQCA 1LEBA 1XN7A 5HS9A 3O2PE 1ZRFA 1WWXA 4G9YA 2W3HA 2FSWA 2QQBA 1HXDA 4XSXF 1KA8A 2IA1A 1NHAA 4BNCA 2VN2A 3T5XA 5E17F 2VKSA 2M45A 5E1WA 2MD5A 4I98B 4LJZF 1FBSA 1T0FA 3GFJA 4OIOF 3K2ZA 5C5KA 5FLXZ 4L0ZB 2DPDA 3J80Z 2DFIA 3TGNA 5TRDA 3F8NA 1U5TA 4IRIA 4LD5A 4R70A 2HR3A 2OD5A 3HSRA 2NS0A 2K31A 4BHPA 2VXZA 3IHUA 4Q4ZF 2STTA 4UUVA 3C18A 3LQRA 1K78A 2HWVA 3JAMZ 2P4WA 3BOQA 3I59B 3MZYA 1CGPA 4IPAA 4UVAA 3LFVA 5K5OA 2M30A 2L54A 3DBAA 2KJBA 5DCMB 4HF1A 4HYEA 1YKDA 4KIFA 3BDDA 2LKPA 1XCVA 1QGPA 4JQFA 2ZO4A 2NYXA 4HLYA 1G3YA 1BBYA 1Z6TA 5CYVA 2R7DA 2F2EA 3H3ZA 3O3KA 4HW0A 2YPRA 2WV0A 2FBKA 1C0WA 2XVCA 5HPFA 2DO7A 4RGRA 2QM3A 4N9IA 1IXRC 3P9KA 3FXQA 3QPTA 4HDVA 3K1MA 1ZGAA 1YFHA 1O3QA 1KU7A 1D5VA 3DF8A 4G7HF 2QYOA 2VOOA 4B09A 2J5OA 3R4KA 4HF0A 3ZMSA 4U88A 1IXCA 3DPTA 1TQIA 3O6BB 3KP2A 3QOPA 4RS8A 1GXQA 2WWYA 2W1RA 2W3GA 3VB2A 1BJAA 1RUOA 2ZNZA 4IJAA 3CUOA 4L9TA 3BJ6A 3VV4A 3F23A 2ZFWA 1U6GA 3P9IA 3CUQC 4FX4A 2A6HF 2A5YB 2XAHA 3JAMK 3KSFA 2FF4A 2K86A 4KFCA 4PAUA 1R00A 4HAMA 2LDUA 2ADUA 4ETSA 1BI2A 4G3WA 5CVJA 3N4MA 1KYWA 5E8GA 1F5MA 1WQ2A 3WTWC 3E0YA 3WGHA 1V4RA 4PGGA 2E1CA 2KLIA 2W1TB 3TDZC 2OZUA 2YU3A 4Q0JA 1J75A 2HQRA 3RDIA 1IZ1A 1UCRA 4IVNA 3BY6A 2QENA 3IBJA 2K7LA 3B73A 3K0LA 1SD5A 4I0BA 1P2FA 1TTYA 3KP6A 1WSUA 1LNWA 4S04A 1L0OC 2DI3A 1P4AA 3IL2A 1EH8A 4HDUA 2CGPA 4ZRRA 2HYGD 4XLPF 5FD5A 3KLNA 2P5LC 2VODA 4I2OA 3F22A 1PP7U 4UVCA 1U8RA 2GZWA 4RB3C 2IA0A 4KMFA 4A12A 2VBZA 2HYFA 5HLIA 4WXCA 4Y13A 4IUHA 2OAZA 4FOFA 3KZYA 1T6SA 1Z9CA 1MKMA 1ZAOA 3LQQA 2EFOA 1BM9A 4RB1A 3WTYC 5DFYA 2QLZA 3NOTC 3I54A 4MNUA 2CW0F 3W6JB 1IN6A 2L3DA 4O01A 5EEGA 5DCFA 1QZYA 3OOPA 4AIKA 5TJJA 1MDMB 4L9VA 5E1XA 2FXAA 2KOIA 1V3FA 2ZMEA 2MH2A 1P92A 4R6LA 1FC3A 4LMYA 3KEQA 5AIPA 4HX8A 2XUBA 4XBFA 5JHUA 4R79A 3J80K 1SD7A 1ON2A 4ZH4F 2O03A 3S7OA 3U9GA 3U1DA 1SAXA 4ASNA 1E2XA 1FZPB 3ZMUA 4RQ9A 2XAFA 5HDNA 3RFBA 4A6EA 2PLYA 4R1HA 4I01A 4M6YA 4Z1WA 4WXHA 2HDCA 1WKMA 1H9TA 3GFLA 3C1DA 2Z9OA 2YX7A 3E6BA 1U78A 1HBXG 2VONA 1QZZA 1B9NA 4EU0A 4ESBA 1BI1A 4M6XA 2H09A 2PJPA 1JGSA 1Z7UA 4ON0A 2Z5UA 3E5QA 1IUYA 3CI6A 3ABUA 1HKSA 3E3VA 5L3FA 4EQQA 1UFMA 1FT9A 4QLCU 1UB9A 5FFZA 2LF7A 5LEJA 4PGHA 3RKWA 5FFXA 1R1TA 1FNNA 1FP1D 2OQGA 3R61A 1IRFA 2EA2A 2YX4A 4LGWA 2HS5A 2W85A 2RC4A 3RKXA 4CGZA 4I02A 5I5LA 4M9ZA 4RAYA 2IT0A 3T8TA 3GWZA 2PEXA 3KE2A 4CXFA 1YTYA 4KYWA 1IW7F 2K2NA 2FE3A 3HOSA 5HL6A 5LGNA 3SZPA 3GVAA 1CF7A 5L8MA 3GZ6A 3RKYA 4M9SA 2B0LA 3TO7A 1MJBA 4WXDA 3E98A 4PDKA 5DCMA 2PBIA 3KZZA 3LSTA 1BIAA 2KKOA 1VHMA 1ZLJA 3M8FA 5BMZA 3W2ZA 1HKTA 4BAYA 2DT5A 1YLFA 2VBYA 2K4JA 2BGCA 2K4BA 3DV8A 4LLLA 2GAUA 3FM3A 3EYIA 1QPMA 1R5GA 3L09A 4LG0B 3I58A 2HGVA 2QVOA 3TRCA 2FNAA 4GGGA 4ZZLA 3WU0A 2JSCA 4RGSA 6PAXA 4HV6A 1R5HA 1BOAA 1KYZA 2W24A 4OIQF 1O7LA 3CDHA 2XSSA 2V79A 2A6EF 2EFNA 1HW5A 1OMIA 2UWMA 2JRTA 2EWNA 3F8MA 3RTRA 3Q9VA 3ZPLA 4GW9A 1J9IA 3V7CA 3I59A 5DD8A 3IC7A 2FRHA 1GHCA 4RB0A 3I0TA 1AOYA 4Q48A 1RIOH 4YFNF 1G3SA 4WK8F 5LGTA 1J2XA 4WF2A 2PI0A 4E70A 5E8IA 5A2QZ 3B02A 3E5UA 3NOUC 4GXOA 2ESHA 2RKHA 3WTSC 1ZTUA 3D3OA 2V1XA 3KEOA 3LAJA 3S2WA 2UXNA 3QP6A 3QRFF 5HOOA 4O6JA 3ZQ7A 3LA2A 5D5WB 1F4KA 3VEPA 3TOAA 1ZG5A 3DQVC 4Q0HA 4AVPA 4UXNA 3ZN0A 1ZN2A 2VBXA 2YSRA 3WTVC 3LAPA 2Z33A 5AIQA 4Q5SF 4KDPA 4IXAA 1TD5A 3Q5FA 4EJOA 4L0YB 3QU3A 4HQMA 2KIUA 5D4RA 3I4PA 1YS6A 1DUXC 2QWWA 1ZYRF 2XHKA 3SQNA 2JPBA 3VODA 4E04A 3C3WA 4M9XA 3CUQB 1XGNA 2XRNA 1TQMA 3R4YA 3JTHA 2QUFA 1XD7A 2MLKA 3PQJA 1JHFA 1R36A 2OQRA 2C6YA 3HHGA 3NRVA 5HS8A 4MQ9F 4YFXF 4GLQA 3FXUA 2MA3A 1FSHA 1ZRDA 2Y75A 3E6CC 2XKOA 2PQ8A 2O99A 3OBFA 3FWEA 4NQWA 3F21A 2H94A 2KIFA 2J5PA 4KT5C 2VZWA 4I0AA 1W7PA 4HX4A 4N9HA 2GQQA 3OV8A 3VOEA 3IKTA 1XSVA 4FX0A 2F5CA 2FBHA 1Z05A 3AAFA 3BWGA 5IT9K 4LFUA 1UHWA 2IJLA 4GYIA 4EGYA 3WGIA 3J81K 2W3FA 4EM0B 2FQ3A 2IVMA 1UHMA 3KP7A 3JTGA 4GCVA 1JE8A 2M7UA 2Q8KA 2IW5A 2NNYA 1I1GA 5HS7A 3O5YA 5D4SA 2ELHA 2BBYA 4KNYA 1U3EM 2ZMFA 1HW2A 3KP3A 4O5VA 4O8GA 4EM2A 3BJOA 3CUQA 4AD9A 2BE5F 2HOEA 2M7VA 1RNLA 3DEUA 4G3VA 1MD0A 4AIHA 4LLNA 1R22A 2RGVA 4KIBA 1W7PB 2HGCA 2WTEA 4G94A 4OMZA 1FLIA 4G7ZF 4DNCA 1ZG1A 4HLXA 2FMLA 2DK5A 4G6DA 1H9GA 1TW3A 1YSQA 4YNRA 1YW8A 2DK8A 2P5KA 3TKYA 1MDMA 4S05A 2HKOA 2EV0A 2DTRA 4MTDA 5K1YA 1IXSB 1ZRCA 1TNTA 4MTEA 2E7WA 2QYBA 2NAZA 2UZKA 1F5TA 5CVIA 2QBYB 5ERIA 4Y2FA 3EYYA 3F6VA 2GWRA 3GF2A 4KICA 4UHTA 5L3CA 1XCBA 5D8LB 1U2WA 2XKPA 1SMTA 3V4GA 3VFZA 1LDKB 1DDNA 3R6SA 3WGGA 3GX4X 1QQIA 2EFWA 2QQ9A 1PP8F 4LRZE 2XGXA 2BYVE 4B8XA 2G9WA
chains in the Genus database with same CATH superfamily
2LNBA 1S1YA 1H5XA 1U57A 2OV7A 4M74A 3D72A 1LJ9A 2IXSA 3W6VA 1SDNA 1MXOA 3GLXA 1Q2PA 2YO2A 5B5EE 3QP1A 3L75J 4LENA 2O3FA 3BQ8A 1H0TA 3BZ6A 3DU6A 2UWXA 2CMPA 1S72P 2R7XA 4LC1A 2PRFA 3OPRA 2OZ6A 2EFXA 4YWZA 1J3WA 3P32A 2EXAA 1OFCX 3R0JA 2IGMA 3O8ZA 1P4XA 1Y39A 4XN3A 1ESIA 3F8CA 1FY7A 2M4GA 2EINH 1U5TB 4BXLA 4UNOA 2BASA 1H8AC 5E3OA 2F5FA 4BE2A 1J0RA 2LKMA 3LCEA 5GAEJ 4G6QA 1HGVA 2XFTA 1JO5A 2LF8A 1KTMA 2H6BA 2ISYA 2C6WB 2JK3A 3TMOA 1Z3YA 1TL8A 1PPJG 3MF0A 4LLGF 1TNSA 4UB8C 4BRYA 2EB7A 1LL5A 4A3BJ 1VF5D 5JYPA 1H0TB 4DDSA 3FWLA 1KQ8A 5TFQA 1NTZG 4FUWA 1ERQA 5GHXA 3V2NA 4OU0A 3PIPF 4E3OA 3BCCD 2OWHA 3AGFA 1YIOA 1D8KA 1YSPA 2R7FA 2HTSA 2JMWA 3VP8A 4M73A 4A2UA 5L3EA 4I09A 1R7JA 2JKTI 5FKNA 1SZVA 5AVWB 3BJNA 1L4AB 1HD8A 4JXVA 1BLHA 3RJPA 1CEFA 2HFHA 1TC3C 3K1PA 3IS2A 1W79A 3MWMA 5TGTA 4BL0B 1DPRA 2K9MA 1GV2A 1MBEA 1WJDA 2RNGA 5FB2A 1Q1HA 3E7LA 2EIJH 3WE2A 4HNBA 3JRFA 4IVKA 2H1KA 1AJYA 1J1EC 1L4AC 1BE3J 2IZ0A 2WZXA 1NG7A 3KZIC 4CZZA 1Z67A 1ES2A 3G2YA 2NPSC 2JKGA 5E2GA 2M2EA 5CRFA 1G2CB 2P9VB 4QY6A 2M3AA 3FWNA 3ZQGA 4FH2A 1E3UD 3O6QB 4XICA 3G1OA 5FATA 4U0YA 3CCMP 4IL6X 1ES4A 4E3IA 2ACJA 2DFHA 2ZYDA 5M1BA 2JA5J 3V2QA 3L2UA 1R4NB 4AU7A 1RF0A 4EVIA 1FZEA 2YU9J 3P09A 1BL0A 3CESA 2KP6A 3NFQA 3VYRB 5B1BH 3FZCA 2OU2A 3V5MA 3AECC 2CUJA 3V7SA 2EX8A 3QH9A 2MKVA 2B9BA 2M1BA 4HHDA 3MFDA 4G8XA 2XPWA 1RP5A 4JPMA 3ZMVA 2L4MA 1RI7A 1B6AA 2RAEA 4NXFA 4XRMA 2I5UA 4A0XA 3R2PA 3V42A 2V1BA 1G3TA 1SVMA 1OR7A 2ZXXA 1L0LK 1PGJA 2W27A 2WT7A 1BW6A 2KLVA 5F6FA 5H2FE 2A69F 4PM5A 3BTJA 2OLVA 5HDCA 2WPQA 1QBJA 4B3AA 3M6HA 3FXLA 4UQIS 4M71A 5IP9J 3IXBA 1GMJA 3A0BC 1KFNA 1PP9D 3L36A 1YG2A 1HZOA 2HOAA 5FQQA 2WPRA 2QKLB 4F7ZA 5GAGJ 4U3FD 3KDPB 5ICEA 2V8CA 2OV5A 2OTLI 3KO6A 4L0LA 2L7KA 5DV5A 4BYYA 4M3BA 3A2KA 1HTLC 3U1CA 3ZG9B 4N78D 3HCYA 5LRRA 2K5CA 1FYLA 3AEEC 2ICWG 1JUNA 4GO1A 1JTGA 5JHFA 2L2OA 1NHLA 2WPSA 3CC7I 1MMDA 1N7SB 3TK1A 4IL6E 3L2CA 3JSVC 2P6SA 2PU2A 1IKGA 4KN7X 2Y79A 1IRZA 2Y59A 4HQEA 2DFEA 1WA9A 2FX0A 5CLSA 1NKNA 1R8EA 5F1RA 1FTZA 3V8LA 4BBSJ 2ZT9C 1W5SA 2P6TA 2PRRA 1H8YA 5AW1B 4HZFA 2WWWA 1IUFA 2H8WA 2JDIH 1OYYA 3ZN1A 4AUWA 2G7HA 4CLCC 1PYYA 5F69A 3FMSA 4BKXA 4I2LC 1KQGB 3OYJA 2FOKA 3S22A 1HLUP 4KG2A 5FGMA 4RA7A 1IJWC 3PH0A 5KAIE 4RGXA 3PLNA 5C3EJ 2O6GE 2IAIA 2KT0A 1GHPA 4GDOA 3ECOA 4DRTA 1CF7B 4JX5A 3N7NA 1D7EA 1X3WB 3C8VA 3RBZA 1F9NA 1JY2N 2AXLA 2OBPA 2KISA 1BGYE 3UPPA 1SFCA 1K6OA 1IN4A 4L73A 2AXTH 3HYIA 4WY4D 3HLGA 2B95A 1S5LE 3H1LJ 2BCCG 2IPQX 3CZ6A 3CX5E 1U0JA 1P84H 3DCFA 3AG3H 3JW4A 1K6RA 1YPRA 1E3HA 3CMEP 1D1JA 2JVHA 2MLGA 3O8HA 2QZ6A 2BY1A 4MEYF 3CC4I 4P0MA 2HKXA 3MBZA 1KONA 1FR1A 1YITI 5K5RA 1PUFA 3NWTA 2YR2A 3OS0A 3HUSB 4CZCA 4JF7A 2BCCJ 3KSIA 4HBTA 4JBAA 1BLPA 2VKDA 1AFOA 2Z5IA 2K1AA 1MZBA 2BZTA 4EJUA 3JPUA 1WYCA 4BBVA 2O61A 3QP4A 2DDBA 1JHHA 4WWIA 4FSFA 2A61A 4XA4A 4DMZA 4A3DJ 3L73E 2ECBA 1XPBA 2P81A 1FJLA 4ME4A 1NAFA 4HNVA 1XSDA 1NK3P 3MEXA 3A3DA 4JGPA 3WS2A 5IT3A 3OYHA 5LHHA 3L9FA 5AVVB 4GFBA 3E6DA 2V0UA 1F9IA 2XSDC 4GS9B 1LE8A 3IAM2 1S7OA 4IUKA 4EJVA 4EEPA 5CERA 1SFEA 2J7VA 5FJ8J 5E2FA 2ZNYA 4IOCF 4WL9A 3GBGA 2CQKA 1OQYA 4K35A 2V2FF 3FX3A 2WC2A 1SFCD 4DW6A 2E74B 4C3IJ 1P6RA 5EGOB 2PMUA 2PFBA 4MLOA 1SFOJ 2A45H 1URQD 1O57A 2Z99A 2HP5A 3BQAA 5E3MA 2JWDA 2XLNA 5CVVA 2X48A 5A93A 3II6A 3S7QA 4Y33A 4M72A 4GYGA 2XB0X 5APWA 3DEEA 4ZJZA 1N75A 4IRHA 4P9FA 4U0WA 1JJ8C 4UA9A 2ELJA 5DM6F 2LXCB 3HOYJ 3MN2A 3K70D 3HJKA 4MLLA 3Q07A 4IL6C 2YKPA 4XE5B 4XSZF 4L5EA 3BPXA 5ICFA 1T38A 2HVQA 3BLSA 1ERDA 1HVVA 2H1LA 3N8RA 3SFIA 3M06A 3OOVA 3PNTA 3WG9A 3IX4A 3BQYA 2HNHA 2X6XA 3U2RA 4EMSA 3CF2A 3ZMDA 4PJ0E 2DOEA 2ZKZA 2PBDP 2PBYA 2CUZA 4EETB 2E1MC 2G2UA 3WTXC 2H8PD 4E7SA 1UAAA 4HP4A 4GOEA 2ECCA 2PMZN 2WA0A 4OIPF 1L0FA 4QMAA 4WUJA 2P0WA 5HW3A 1ZMEC 1XJ6A 2D45A 4A0ZA 4S2OA 4BXUA 3LIDA 3S4XA 5FL3A 1SAUA 3T8RA 4CHUA 2F5VA 1EH7A 4BJTA 3GTGJ 2WK0A 4IHTA 5HAIA 1FOKA 3EDPA 3FKIJ 1CI9A 1K9MQ 3A1YA 3B6AA 1IYQA 3OCLA 4PKYG 3L74J 3CITA 1MMSA 2EPFA 1WH5A 2K9YA 2D5VA 3JSPA 2R7ZJ 1YE9A 5TJHA 1VQ4I 2XROA 2D2CC 3PSIA 5F6AA 3RK2B 4UA7A 3V8KA 5HSQA 2EFUA 3GLMA 2GA1A 2JR8A 4BDZA 3L37A 5A2QK 3MMHA 1LTIC 5CTMA 4OP8A 4W97A 5KK1A 2QSFX 3N97A 4E4HA 4UHUA 1G6NA 2F5EA 3OLOA 3H1HE 1FSWA 4Q47A 3H1LG 1KVMA 2P7JA 2Z3YA 2WZZA 2YIUC 3DFGA 1OVVA 5EVIC 2Y30A 2OC6A 1FEXA 1BDCA 3HUNA 1YW7A 1LDDA 4PM9A 1S7EA 2DQLA 1FYKA 4WY4C 1USEA 4L76A 2FEZA 3M9QA 1EI5A 5A91A 3TW6A 1KQFB 1IAWA 3S14J 2FA5A 1N9NA 4KQDA 3O3VA 1IRXA 3KHUA 1XB4A 2L01A 2LG4A 2Z2MB 3BG7A 1MV8A 2L0WA 1L3LA 4IEJA 5DFXA 3RL0C 4Y17A 2DW3A 1IFNA 4X6TA 1P9QC 2ZJPF 2A06G 3H3VK 4E7HA 3N05A 3PUFA 3EUHA 5J8CA 4HIAA 5DF8A 2O1KA 3LSPA 1KU2A 3OS2A 3RL0D 1PDNC 1YJNP 3VMYA 3FZVA 5DJUB 5CQEA 5F04A 4FASD 4KQOA 3NI9A 5IOYA 4RDUA 3MCZA 4EQ1A 3M9AA 2QJKC 3K3CA 3IWIA 2PMZA 3WRTA 3HL9A 1IV6A 1WCMJ 2AHQA 3FM5A 4PJLA 4Z2YA 4OPYA 4NB5A 4R1GA 3T0YA 2FYUE 4JK1X 2XB5A 3CMMA 1E17A 4MDZA 1NTMG 3G6OA 2IS4A 3TNUA 3BRVB 4E3JA 1IZNB 3VP2A 4C2MJ 2NRGA 2IGOA 1WZ2A 1XMKA 4FTHA 4EESA 1JUSA 5HS9A 1AVYA 1ZRFA 4CLCB 1MNDA 4HOIA 4I38A 4F94A 3UB6A 2W3HA 2FSWA 2KS1B 3BWLA 4DE1A 3ZFZA 4XSXF 1JY3N 1L0NJ 2BHZA 1G8XA 1NHAA 3FPWA 5F83A 1AA7A 2YKQA 3Q3DA 1UMQA 4I98B 4XMYA 4PJ0C 2XGCA 3TOIA 1RGZA 4XLEA 4NQWB 3F8NA 1U5TA 4PMAA 1M1JA 1EDLA 3AFHA 1WH7A 2OD5A 3HSRA 3FG8A 3WS1A 4BHPA 2VKEA 2VXZA 3IHUA 2STTA 1BW5A 3L2WA 3C18A 3LQRA 2HWVA 1VNDA 3JAMZ 3MZYA 4IPAA 2M30A 3L71G 2JKFA 3RJUA 1A6QA 4NC7A 3H25A 5HD5A 3AL0C 1P84E 3BR3A 4K0XA 1QGPA 4JQFA 2NYXA 1A0KA 5KLVE 1MFZA 3EGDC 2R7DA 2Q1KA 3B5NA 2CS3A 2F2EA 2KNCA 2RREA 4I3AA 3CCQI 2FYNC 3H3ZA 4HW0A 2FBKA 3VMZA 5C4JJ 2DO7A 2R5ZB 1VQ7I 1RE3C 3E4PA 3FXQA 3RH8B 3QPTA 3HLCA 3TE8A 1V55H 1YFHA 1D5VA 3VFFA 2R5YB 2Q9IA 4OQIA 3R4KA 1GSXA 5AVZB 1IXCA 3GV9A 2IZ1A 3O6BB 2Y2QA 4NK3A 1NAYA 3MTUE 1OCCH 4YEJA 1GXQA 2EX6A 5M18A 3VB2A 4IJAA 3F0CA 3CUOA 4X6AJ 4L9TA 1NH4A 4BQQA 1BR1A 3F23A 3CMAI 1S72I 3P9IA 1M1JC 3CUQC 3DWKA 1ACFA 4OPQA 1OLTA 1UG0A 1DX7A 4A3CJ 5JLWA 4X56A 3JAMK 4F52A 2FF4A 3S9OA 5FLMJ 5J8XA 4HAMA 2LDUA 4LV3A 2ADUA 4A3GJ 1CQAA 2J80A 1FC2C 3N4MA 3JRGA 2MJ6A 5E8GA 1F5MA 5L10A 2VGJA 3WTWC 3E0YA 4KZ8A 1LSXA 1Z09A 2KLIA 5CGXA 1J75A 5EM0A 1IZ1A 1SLQA 2X1CA 1JKOC 1QHGA 4S2KA 4ZKPA 1LL9A 4HRIA 4IVNA 2FKWB 4H0LB 3AG1H 1ZTRA 3UE1A 3PTEA 1SD5A 1MNEA 2H43A 4PD4I 3UPNA 1IFQA 1XA7A 2ZYAA 2YMKA 3A0BH 1KN7A 1P4AA 4HDUA 1JY2O 4RESB 2WSCJ 4XLPF 1YIJP 4JQ0D 1BCCD 3HD7D 2LH9A 2FYZA 2ZJ9A 4KMFA 4ZMDA 3A5TA 3BY8A 3CCUI 2X71A 4Y13A 4R23A 5GLBA 2B63J 3U2AA 4E3KA 3KZYA 2P2UA 1T6SA 4W1UA 2LBFA 4KJMA 1RKWA 3H5RA 1N73B 1BM9A 5FQMA 4RB1A 1M40A 3WHBA 4WZ5C 4ZTJA 3SOIA 3DWLE 1IN6A 3PYPA 2LR2A 2OCCH 1JVJA 3CWBE 2E74C 1LFBA 3OOPA 5AW8B 1N73C 3GHGB 1RF1A 1BE3D 2QM8A 2MH2A 1P92A 1PGOA 2DA5A 1LJ2A 4HJGH 4XBFA 2R92J 1W36C 4AC0A 3OYLA 3J80K 3ZGAB 2O03A 3CX5D 4GJ4A 2RL3A 4RQ9A 2QQ8A 3ZHHA 1I3AA 3TYYA 2PLYA 1MBGA 4MBHA 5CBOA 4WXHA 4DIQA 4JLFA 3GFLA 4B4ZA 4R3BA 4YXDC 1Y47A 2VONA 4PJNA 4EU0A 1K54C 4M6XA 3B8EB 2H09A 2PJPA 1JGSA 2KX6A 1Z7UA 4ON0A 2LC2A 3SH8A 1JY3O 3K2AA 1HKSA 1A5JA 1DJCA 5L3FA 5K7FA 3E0JB 1W0TA 5LEJA 3RKWA 3HGYA 3MKLA 1NWZA 3D5SC 4YFMA 5TR7A 3KYZA 1ZN5A 2YX4A 1WE4A 4LGWA 1LWUC 5DJUA 4CGZA 2HDRA 5I5LA 2WITA 4M9ZA 1CZQA 2IT0A 2JSPA 3T8TA 3GWZA 2PEXA 2DODA 4CXFA 1JKRC 1NTKG 3CCSP 4KYWA 2K2NA 3OPLA 2J8YA 5HL6A 4KITB 4PSWA 5DTSA 1CF7A 1IFJA 1O4XA 1QLED 1BLSA 2HZ5A 5E2EA 3TO7A 5HNHA 3MXRA 1MJBA 3L70J 2X6YA 4WB4A 4WXDA 1XFQA 3E98A 4PDKA 2PAVP 2GZAA 3TP0A 5GPCA 1GHIA 1PYVA 4M3GA 1XKZA 3AEBC 4DT0A 3LIAA 4D60A 2BGCA 3VYSB 3WG7H 4OLGA 1HGZA 2HI3A 2ZOIA 4LLLA 3NBLA 1QPMA 1VL2A 3I58A 2FNAA 2Y55A 4RGSA 4KZ4A 1DU0A 3H9GA 3RK3D 2O3JA 2A6EF 3LNQA 1OMIA 3F8MA 3DTMA 1GW3A 4C46A 3HJEA 2IWCA 3IWOA 2DOAA 5DD8A 4RB0A 3I0TA 4Q48A 1RIOH 2BY3A 2XF7A 2KZJA 1G3SA 1FZBA 2Z6CA 5LGTA 3PJSK 2PI0A 3E5UA 3L74E 1FCNA 5G4ZA 2WSFH 3KEYA 1KILB 5M3MJ 3IAS2 3CWBD 2V1XA 2EZLA 4MN5A 3BVHA 1H89C 3QHYA 3S2WA 3QPSA 3IH3A 3QP6A 3QRFF 3E1SA 2GOMA 2Y31A 3LA2A 3MKYB 3N4XA 1ZG5A 4Q0HA 4LPZA 2H0TA 2A05A 3ZN0A 2VBXA 1CI6B 2WSFJ 4H4KC 3LAPA 1NXYA 2Z33A 5AIQA 2L4RA 4GDBA 1USDA 4IXAA 3QYBA 3QU3A 3ZXSA 1ZHHB 1BUEA 4XN0A 4RKUJ 1X0OA 2I8DA 2PR5A 3C3WA 3IUOA 2E71A 4DE3A 5IY5H 2R5YA 3R4YA 3LR4A 3G71P 2QUFA 5M3FJ 3KYDB 2IS2A 1SQPG 1K56A 1K25A 4Y0UA 3P8CD 2XDMA 1JHFA 1K4SA 4ZTKA 3NRVA 3S8PA 3SFEC 2WTYA 5BU8B 2Y75A 1QPIA 3V3RA 1I6HJ 2PQ8A 2O99A 3FWEA 4NQWA 3X2QH 3F21A 2H94A 2QJYC 3DTKA 4XXRA 3AGEA 2GJ3A 2GQQA 1EW0A 5KSHA 3T50A 5FKMA 2VV8A 1KE0A 2CH0A 5EOOA 1T95A 1DEEG 1X0TA 4JGOA 3BFFA 1QEXA 1TWCJ 4GCVA 5J1UA 1JE8A 5CHMA 2IW5A 2QJPC 5APVA 4C30A 2JE5A 1P84D 5D4SA 3L71J 2ZVNB 4BBUA 1GU5A 3MKFA 4O5VA 3ABVC 4O8GA 3CUQA 4AD9A 3B3XA 3RL0B 1QU3A 2HOEA 2BVMA 1MWSA 3H1IG 3K6GA 1MD0A 3D70A 3LY4A 5DF7A 2V0WA 1R22A 4BU2A 1AKHB 2YKFA 2WTEA 2R5ZA 4XUXA 3O88A 4OMZA 3L74D 2M7BA 4G6DA 3MKEA 1TW3A 2VX8A 3BY9A 4YNRA 5A92A 5IP7J 1YW8A 3GF3A 2HKOA 4QB8A 1SQVJ 5K1YA 3TW8A 2E7WA 3VPRA 1DD3A 3AE1C 5ERIA 4ABZA 2B9SA 3RK3C 3FXKA 3GF2A 1VQNP 1O7EA 5G18A 3CX5H 1U2WA 3VOZA 4X53A 2HDSA 3R6SA 3G4SI 3WGGA 3GX4X 2QCOA 3GDIA 5EZGA 4YIRX 1R6RA 3H1HJ 2MGQA 3OA7A 2BY0A 3BEBA 2G9WA 1H8ZA 3HRMA 2PX9A 2QIWA 5BOXA 2IBZD 4P96A 3C7UA 1RRJA 3WTUC 4A93J 2BY2A 3HRTA 2FYUD 2A3SA 1FBMA 3A0BE 2H5SA 1MGTA 4WY4A 2QQAA 3EUAA 2IDBA 4RLFA 4ZJ1A 2N8GA 4CYCA 4HA8A 3RYPA 4ANJA 4B44A 3NEUA 2G7UA 1IFDA 1OT9A 3PR6A 1GT0C 1RUNA 4DN0A 1EH6A 3L2RA 5DUKA 2H27A 1K55A 1HVBA 2FD5A 4XORA 1VDFA 4D0PA 2HOTA 4QIWN 1ETKA 1K78B 4CCNA 1KE3A 4ENJA 3RPQA 2QMIA 2GUSA 3R7WA 2PG4A 4MCWA 2VGLS 1LWUA 4IHVA 2YS9A 4M3FA 1ODVA 1RQUA 1ZGWA 2XU6A 1SKOB 2OWJA 5BVZA 5F5YA 3WTZA 2QGUA 4NPFX 3AEFC 2FNPA 4R4SA 2B87B 2ME0A 5CGSA 4WN5A 1YLTA 2VPLA 1D0YA 1HDPA 3H92A 3L72E 3RQ4A 2P7CB 3ZDMA 3I64A 1EDIA 3OR2C 4C2UA 1VM1A 4GOGA 1L0LJ 2JZYA 5FO5A 3G30A 3ULQB 1ZV8A 3U4LP 3LI9A 3CXHE 1ODDA 2NS8A 2H89C 1VEUA 3S2DJ 1TS7A 4BH9A 3E2KA 3DEWA 3ITKA 5KMWA 2E42A 4PCQA 3J81Z 3L70E 4TV7A 3AKZA 1SQBD 1G6OA 1LQ1A 5FKOA 1B8IB 2K40A 2DW4A 4HYTB 2WSCH 2CPBA 3UDIA 1HUCA 3OL3A 1RE3A 2ZQ7A 1S3JA 2UXXA 5GHYA 5H2FH 2V26A 5LD2C 2WAQN 3RTYA 2QVAA 5CVUA 5J6XA 2OTJI 1E0EA 2K85A 2HPMA 1R1VA 1TQPA 2D2CD 2W3DA 3CLQA 2QA4I 3S7PA 2BG1A 2EV5A 3NQOA 2Q1ZB 5CMZA 4P5OA 3L7WA 3UKGA 1E3UA 3T4LA 4UB6H 1M8OB 1TDGA 1J09A 2GXBA 1S0WA 3C4OA 1KILE 1FZCB 4BDYA 1YITP 5IT5A 2HU9A 1S7AA 1LB2A 3RIRA 1JM0A 4UB8H 3VFHA 1VQMI 4C3JJ 2R4GA 3H1KG 5B66H 4L9GA 3QU6A 4S0HB 5HZHA 2R3SA 5EPHA 1RKTA 3OR1C 4LK0F 2VGKA 3MVPA 4DZJA 2RQPA 2VJ5A 1S4RA 1KYOI 1X4OA 4BXFA 5FDSA 1WT6A 5D6FA 4YIIA 5GL9A 4G6TB 2VJWA 1MNMC 3H1KJ 4K3AA 2B18A 4CCLA 1K79A 1KGSA 3PO2J 2M0BA 4C9YA 4U3TA 4GDNA 5ILSA 1JWZA 1VETA 2H0YA 1SVOA 1GK6A 3ZQQA 4UVBA 1SQQD 3OYAA 3BROA 3DBLB 1SD4A 4MQVA 1AV1A 3L35A 1P84I 4XT2B 4PJMA 2Y0MA 1PUFB 3CJQB 4PFPA 1XSXA 4HSRA 3D4FA 3NOPC 4DYCA 3IRQA 1S66L 2JO1A 1E3OC 1J7KA 3H1ID 2BV6A 3K5BA 3M4OJ 1KB9H 2RH0A 4XUZA 4E6XA 2TDXA 3HE4A 1X2MA 1IF1A 3LO7A 3Q0UA 5HLHA 1URQC 3OCNA 1PP9G 4H0EA 2R78A 2WAFA 4RJTA 4OINF 3CC2I 3BZKA 2QSIA 1E5WA 2B5RA 1IC2A 1MWTA 3FYZA 3A0RA 2EFPA 5J3LA 2E1OA 2CPSA 3CO6C 4HBLA 3COAC 2EXBA 1JT0A 3LR0A 1JUPA 2XAJA 1W5DA 2OCEA 3CCYA 2WPVB 2DXIA 3NXSA 5GLCA 2CW8A 3QQAA 3ABTA 4OQHA 5B1AH 4U7DA 5AW3B 1B59A 1BR2A 3HUSA 3IWZA 4R4MA 1ETVA 4E7IA 4S2NA 1IN8A 5A8BA 1KQ9A 4H44B 3FKJA 5IS1A 2HVRA 1I1SA 3A3YB 5E3NA 1ZLKA 3BTCA 3CPTB 1FOXA 5FLVA 3J7ZI 3CCEI 2M9HA 2K7SA 2KFDA 2RVCA 2HODB 4L5IA 1OTBA 2XDVA 1VQQA 2XQZA 3L4FA 2XPVA 4KN4X 4YOFA 1XGMA 1Q86Q 2ZBKA 5FDHA 4II3A 1AQTA 4HI4A 5ED4A 3HOZJ 3KLOA 1BC8C 5LBQA 1OIPA 1XJ3A 4M4XA 1SQBE 1HH0A 2O01J 2VE9A 2CFOA 2QSHX 3T4QA 5HWVA 1QNTA 2NUTC 1WRGA 4C7NA 3HOTA 1R58A 2KIKA 2Q5UA 2LKXA 3J7AO 3F6OA 4JBFA 1KYOH 2P9VA 2D2WA 4MBKA 2LREA 4XKVA 4DBRA 2E7XA 3BRMA 4KUOA 1K0KA 2O01H 2DMNA 1G68A 3GUDA 3PO3J 3B6CA 1AHDP 4LCLA 1XXMA 4KZAA 1XX5A 4OIRF 3P8MC 5ILVA 5AJGA 2H8RA 2L02A 4H8RA 1AVOA 1ENHA 4LG0A 1YYCA 5AVRB 4CO8A 3AE6C 2PYPA 1Y8QB 1PP9J 5D5XB 1XJ4A 2H88C 1AWIA 4IHWA 3C2HA 3JSOA 2FU4A 1A35A 1Q2QA 2M87A 3JYIA 4Y15A 3CMYA 5D5UB 3IAOA 3HXLA 4EM1A 5D5VB 2M3EA 4XRFA 2XRLA 1P7IA 2O9CA 1SQQG 3SFDC 5AONA 3Q2YA 5E79H 2VEAA 3FMRA 1YTZI 1I3QJ 4IHYA 2JKVA 4KZ9A 2BEQD 3G31A 2CC1A 1X79B 3ZQLA 1NTMK 4OQ0A 2CRGA 3M0DC 3QNCA 4ZJ2A 3CCEP 1T08B 3UR3C 4TT3H 3SH9A 1AWCA 2HEOA 5CBNA 2NPSB 2CSOA 1EA3A 3H1JE 4PFOA 2HV1A 1V5FA 1MJAA 1YX5A 5HVQC 3LSJA 3LEZA 5E18F 5LFAA 2ITAA 2W83C 4BQNA 1CQTA 3ISPA 3WU1B 3GTJJ 1K04A 3O6QA 4ID4A 4AIDA 2OGUA 1VQ6P 3DPLC 3OWTA 5CVRA 3CMAP 5L8RJ 4WCGA 2B88A 2IA2A 3NHQA 4WMCA 4BD0A 1YJWI 1IJDB 1WJ5A 5E79E 4GN2A 1PGQA 2QJ5A 3GTKJ 2JWAA 3HLDA 5F0HA 5BPDA 4CICA 5HDSA 1ZHFA 5ILUA 2AS5F 3TP3A 2N1TB 1BI0A 2CWEA 3WMM0 5GLDA 2Q2EB 3CO7C 3FXRA 1O3TA 1BN5A 2A45I 3HB9A 4Q0IA 4MGRA 3CC4P 3WUVA 2VBWA 3D5LA 1JXSA 2Z5HA 5F1FA 1WHUA 2B87A 1NLYA 2A5WA 1O07A 1SHVA 2W6JH 1R23A 3S1QJ 1AA0A 1VPCA 2JCHA 3FX0A 5GTHC 5HDKA 1Y4OA 1JMMA 5K5GB 4UV8A 2M5WA 1K61A 1O7FA 1NTCA 1PGPA 2KL4A 2QPNA 4OH8B 1T98A 1W7PD 1LDJA 1YOVB 4I7HA 2K3RA 2INWA 3HUGA 3KP5A 1VQ9I 4UUTA 5F08A 2Y2IA 1KDSA 3JRBA 1JY3P 4IQ4A 5TISC 2GX5A 4GRIA 2DFFA 2KXPB 5HDGA 2Y91A 2C9LY 1Y9BA 2EX9A 5BU5A 1QL2A 1YQSA 3BJAA 1H8MA 3GFIA 3HDDA 2W1TA 1ZG3A 5KLIB 1USSA 4ASWA 4ZDPA 1R5LA 4AUXA 1ZRTD 3AE9C 4Y99C 2MC3A 5FLXK 3MZEA 1HWTC 3GTOJ 3I71A 3KPHA 4YG2F 2DNSA 1BSHA 2XFSA 4N1HA 4EEUA 4CPKA 5K5QA 4N4NB 3F1PB 1FOWA 3GRJA 1R1UA 5AW5B 3I5UA 4RBOA 1NU1K 1U60A 1P7JA 1EJ9A 1OJGA 2OYOA 3L73G 3QNBA 1RR7A 1VQ8P 2FBWC 3K9TA 2WKIA 1BULA 3TQNA 2CU7A 5DKKA 2AQEA 4R4LA 3D71A 2CV1A 1VQ8I 2KS1A 1T8IA 2P67A 3LW5J 3C7VA 3KPEA 3TG9A 4YRVA 3A03A 2WAEA 3M07A 2RCXA 1SFUA 1FSEA 3LSRA 1NRFA 3ZG8B 3TGUD 4B4XA 4GHIB 1LGHB 2V1UA 4ZYEA 2QRXA 4A0YA 2GOXB 2C0XA 4OPZA 4P55A 1VTNC 3O86A 3ZNYA 1SQPK 4ZAMA 1NRJA 2YKHA 1TLHB 2KLOA 2KSJA 2ISZA 4B3XA 3HPGA 2I1JA 2A68F 2EA4A 3C2WA 1XTGB 3HTKA 5J40A 2K9NA 2L5GB 4AYCA 2CYYA 2Y2NA 4HOBA 1JWPA 4AM3A 4YFKF 1SCWA 2R7VA 2XAGA 3ELKA 4WWCA 4JF4A 3MZ8A 3A02A 2C5WB 4JX4A 2WGVA 4KZ7A 3T4TA 1DU6A 3GMEA 2WSEH 1ZXGA 4AIJA 2P5VA 3C5AA 3HUMA 3EQVA 5TGFA 4YXWH 4XRSA 4UV9A 3PQKA 2HDDA 1NG6A 3MIWA 4G7OF 5BS6A 2BEZF 2A24A 3LWFA 4KT0J 4AYBN 5JLXA 1HKQA 5APXA 1OX3A 1MWUA 1XN7A 2QA4P 2VK3A 1BGYD 3VOLA 2JQ7A 1HXDA 1Z3XA 1LSWA 3LSGA 2OUMA 2IA1A 2Q6QA 1IYOA 1T2KC 4E6WA 2VN2A 1QVFO 3IXDA 4HJ4A 5E1WA 3RK3B 4KZ6A 4LJZF 3OYNA 4GS9A 1J1DB 1E25A 4K91A 1R9TJ 3K4LA 1UWNX 2COBA 4MO7A 5KAFH 5C5KA 4L0ZB 3FBNB 1D0XA 2VQGA 4FETA 2WB1N 1QMFA 3BG3A 2NS0A 2K31A 4UUVA 4HEFA 4KZBA 1K78A 3UO9A 3JRCA 2W0NA 2I72A 2TRTA 3D9YA 3R7WB 1LT0A 5DCMB 3W8KA 4HYEA 5TISE 1W1WE 1OCTC 3OIOA 2A49A 3RBXA 3BDDA 2LKPA 3L75G 3H9QA 3OIPA 1GA0A 4OP5A 3FV7A 2L9SA 1BBYA 1Z6TA 1N73A 3ZGKA 2QJPB 4D5FA 4AYBA 3PAGA 3O3KA 2WV0A 1FMWA 1LT9C 5J4YA 5HPFA 1BCCE 4N9IA 1PZOA 4H6JA 4E7LA 1K54A 4L9FA 4G7HF 4ARZB 1KORA 4B09A 2FXMA 3DWZA 1MZUA 4N92A 4U88A 3CJRB 4K0WA 3DPTA 2LP0A 3GVBA 1XS9A 3KP2A 3QOPA 4PSXA 5FRNA 1ZR4A 5AVSB 1NU1G 5GAHJ 2W1RA 5C4XJ 1NGMB 3TDKA 3H0DA 1SDEA 4Y7PA 4RLQA 4BGDA 3HLBA 2F4MB 2ZFWA 2Y2JA 3AE8C 3W2VA 1XC5A 2V6EA 2A6HF 2OTJP 1VEUB 4NBQA 1CF0A 4PAUA 4XFJA 2CMNA 4G3WA 2A6TA 2A06E 3ZCOA 5APSA 2KDKA 2VJIA 4HNUA 3VSKA 1WQ2A 1LT9A 1YT4A 2GLOA 4BEHA 3TDZC 4Q0JA 3RDIA 4BJ5C 1T1BA 2LLKA 1T18A 1UWPX 2V9AA 4DF6A 1GVDA 1FZFA 2VPRA 4EIJA 2E5NA 2X51A 1S5LX 1TTYA 3N8SA 3KP6A 4S04A 2JP3A 5APTA 2BVLA 2PJRB 5CEDA 1L0OC 2DI3A 3H82B 5CCHA 3IL2A 1EH8A 3V67A 3UDXA 2YIUB 5FD5A 3KLNA 4BS9A 2R93J 4UVCA 2GZWA 2W6AA 2IA0A 5APYA 4A12A 2M0CA 2VBZA 1OJLA 4EBPA 5HLIA 1UHSA 3L7HA 3OYEA 3SDBA 1GTWA 1NZUA 4OKPA 1VQ9P 1GD2E 3HREA 3T1RA 3T4JA 1WI3A 3JC22 1MKMA 3CCLI 4I99C 1W36D 3LQQA 4E3NA 4QSHA 1XGIA 2R7UA 4MNUA 3NARA 2CW0F 3CCVI 2WKPA 2EILH 3PUBA 3KIOA 5EEGA 2QJKB 3DLAA 1TT0A 3CDLA 3EFFK 3CCRI 1MDMB 4L9VA 2ME6A 2X01A 2OARA 2FXAA 3TSIA 2IX7C 2XGDA 3U1KA 4KQRA 2ZMEA 1PVEA 3KYLA 2DJIA 2D02A 1X22A 3KEQA 4XR6A 5MC7A 1SD7A 3DBRB 3KQGA 3LL7A 3U9GA 3U1DA 4JGRA 4W7YA 1SVFA 3GTLJ 1CEGA 1T0FC 3ZMUA 1EZVG 2XAFA 1I39A 2LY1A 2E35A 2MC4A 1VQ5I 1X8YA 4EBNA 4I01A 1Y1WJ 3MJQA 3OYFA 2HDCA 1NTZJ 3C2GA 1VQ7P 2VQLA 1JGGA 1HBXG 4KZ3A 3BECA 4ESBA 1XTCC 2RN0A 3M91A 2EWWA 1L0ND 5HL1A 2M4KA 1VQLI 3KZIE 4E3MA 5M5YJ 1S67L 3N8LA 3DW0A 2JA8J 1LFUP 4DOZA 3NWSA 3FK6A 2EZKA 3E3VA 3IQAA 3LI8A 1WJAA 1UFMA 1FT9A 4QLCU 1UB9A 1Y1VJ 3IH2A 2EWVA 1AU7A 5APUA 4PGHA 1ZKJA 3CPTA 2O8KA 3CCMI 4WZ5A 2ZXEB 1OCRH 3R61A 1KDWA 4DYRA 2ZQ8A 2FYUK 2W85A 1SC7A 1H3QA 5HX9A 2KLUA 4GODA 5AVUB 4RAYA 3E4QA 1S9HA 4IEDA 2HJ9C 4HY8A 2ZC4B 3PHYA 3BFDA 3SZPA 1XMXA 1H8AA 1YRNA 3JCUC 4IFDK 1N7SD 3M0DA 2QWSA 2E19A 2R9XA 2K9LA 1R5ID 3UB7A 1NTKD 1PJRA 2MYSA 2PGDA 1VHMA 4M3LA 4BRYB 3WU2E 1FMVA 1EROA 3ISGA 3W2ZA 3QYFA 1MH3A 2XKMA 3UDFA 1F36A 4MN6A 1HJBA 2VBYA 4EW7A 2WZ7A 4MIMA 5HARA 2JUCA 2K4BA 4R3JA 2GAUA 2QVOA 3WU0A 2DA7A 2JSCA 6PAXA 4HV6A 4II7A 1KYZA 2W24A 1LP1A 1KVLA 1JB0J 3C1LA 2EWNA 1UELB 1SVLA 2VASA 5FROA 5M19A 2E74D 1GZLA 1AQ5A 3IC7A 2B89A 2NVTJ 2Y4AA 2M1CA 4YFNF 4P85A 2I1KA 2J59M 4E70A 4UUSA 3W2WA 3K4BA 4GXOA 1S2EA 2HPBA 1LTJC 3LIEA 2HP6A 3D3OA 1W63M 4D1QA 1ZLLA 4WBGA 2N1TD 2I9VA 2UXNA 2Z1DA 3ZG7B 3ZQ7A 3FPVA 1Q7YQ 3EQUA 3LSMA 3CCJI 3CWBG 5J7EA 2ID6A 1ZN2A 2VIXA 2YSRA 2OPTA 4D6TJ 1LT1A 3E1RA 4L0YB 1A02J 2KIUA 1ZYRF 1SQQE 3SQNA 3IR9A 4E04A 3LUQA 3CUQB 3ZG5A 2UUZA 2Z6DA 2OYHC 4IVIA 1S6RA 4YTPC 2DA1A 2E43A 3CXHI 4F3LA 1IO4A 5D3OA 4HSTA 4MQ9F 4YFXF 4M3DA 4LGDE 3FXUA 4F3QA 3H1CA 2JA7J 2ZC7A 1L0NG 5GTHH 3HLEA 2MJZA 1VQOP 4XLHA 5DVAA 4BMWA 4I0AA 4IX7A 5EV0A 1W7PA 4N9HA 5GADJ 4LV0A 1F2KA 3VOEA 3IKTA 4GB7A 1PZQA 1YJWP 1QVTA 3OMYA 1K57A 1IDYA 2Y0CA 4LFUA 3KYCB 2BXZA 4Z6YA 2Z16A 3J81K 1JTXA 2ZQCA 4H44C 3HRNA 1X58A 2QG4A 3NMDA 2FYNB 3JTGA 4PM6A 2Y9ZA 1CW5A 2M7UA 4X1LA 5EDNA 1I1GA 4X55A 1IFMA 4Y4RA 3OYKA 3QOEA 1NJ4A 2BBYA 1HW2A 1BGYJ 4OONA 1WJFA 5IOZA 3GG2A 3BJOA 4GD8A 4WLAA 3ZDJA 5KSCA 2BE5F 2V1AA 3DEUA 3BC8A 2IBDA 4WVZA 2RGVA 4UB6E 1W7PB 1HF0A 2WKHA 4XKCA 1JNMA 4G7ZF 1ZG1A 2JN6A 4B43A 4H6JB 1H9GA 2GNXA 3CD6P 4WEJA 3PNVA 1YSQA 4ARZA 2J3TD 2DK8A 2P5KA 4FCYA 2FXOA 2DTRA 2MW8A 1KGFA 1TNTA 4RM3A 4MTEA 2QYBA 3DKXA 1DH3A 2LR8A 3E7KA 4Y2FA 2W48A 1VQPP 3G32A 2AEMA 3RXXA 1JTDA 1PW8A 3L71D 4HBUA 3SEQA 4CUGA 2YXRB 1KZUB 1XCBA 1DGWY 3K10A 1N8RQ 3VFZA 5IU1A 1FDMA 1LTTC 1S9KE 3CD6I 1QQIA 4GOFA 3P98A 1W8YA 4K08A 3A0HH 1PP8F 4LRZE 1KE4A 1NTKE 3UMDA 1JEKA 5J3WA 2BYVE 1LLBA 4NXGA 4IF4A 2O9AA 3PFIA 2DYSH 3PBSA 3I7JA 3REOA 3B5NC 3EFGA 2JJLA 5J8FA 1BCCJ 1RESA 5KIZA 4PV1D 1OYWA 3AEDC 4Y3IA 2IPPA 1FSYA 2HDQA 3MXSA 5BPIA 5K7HA 1G1IA 1T3JA 2LOOA 1Z6FA 1ZKGA 4EATA 3MFKA 1Y0UA 1RPWA 1UIXA 2V9VA 5KAIC 5KLIC 2GA2A 2ZJQF 4A5NA 3Q82A 4IO9F 3H6PA 2EIMH 2BW3A 1VFCA 3CHWP 3H5AA 4IZZA 4C3HJ 4DBQA 1HSTA 2Q2EA 1TF1A 4QU3A 3LFKA 2W57A 4LRYC 3G2ZA 4QJGA 1T1AA 1T2KA 2NRAC 4JKTA 3SS3A 1YHQP 3QYEA 1N7SC 3OW2O 4AFIA 4KMUX 4J00A 5DKLA 2QBYA 2IS1A 2HFED 4BHBA 3D0SA 1PI5A 2ZJ2A 4EUVA 1N7LA 1KQ0A 1QVUA 4N0BA 3PBOA 3L73J 2R7RA 1W63Q 3GECA 4FD8A 4PJ0H 3I9V2 3HRUA 3KYEA 5B5EC 3VOPA 1GV5A 3I5CA 1SQVG 3E6MA 4JF5A 2HJEA 1NYHA 1VQNI 2AXTE 3FXJA 1BOBA 2KQRA 3LA3A 3L2QA 4PUSA 2KJCA 3NTNA 2W3EA 1KQLA 5EVLA 1MPLA 3T4SA 2EBIA 5FQIA 3LA7A 2LK2A 1L0LE 3TNUB 1ZR2A 4LV1A 3F5HA 1ACIA 1K55C 2IBZE 2L91A 2EJRA 4D6TG 1N25A 3FKWA 5KHDA 4CLCA 3U21A 1Y8AA 3BCAA 2PT7A 1TWFJ 5FEGA 1WMKA 1MMNA 4ZDLA 4BQOA 4EJWA 2JJ7A 3IF6A 3WUUA 4GD6A 3QWLA 5IPAA 3KYQA 3G1MA 2G2WA 2JUGA 3BR6A 1L2SA 4XT2A 2JTVA 2JPCA 1PPJE 4H0LC 4P1WA 1T33A 1PRQA 1OW7A 2Q7CA 4JF6A 1J2JB 2HG5D 4RO0A 5FAPA 4S2JA 5EFWA 2DOFA 2H10A 1OXZA 4OMYA 2CQXA 4MHGA 3WTTC 1X3ZB 3H1KD 3PAEA 1VETB 3UE6A 2ID3A 3HM5A 2M7AA 1GL2A 2R5DA 2XF6A 1ES3A 2IS6A 1TBXA 2E76D 3N4IA 1IFIA 2E36A 1UGUA 1V5EA 3KX2A 1SEUA 3TSGA 4UUSB 4CCOA 2XK1A 1O3RA 4HPQA 3LOCA 1SQBK 1NOHA 3HHHA 4KG6A 3BASA 3M0AA 2LB9A 4GHIA 2ZM0A 3HSEA 1YS7A 3ZNTA 3C7JA 4XLCA 2FBIA 4BBRJ 2KNCB 2KPMA 2W25A 2H7HA 5AW6B 4GZBA 2E5YA 3MQQA 5EFWB 3IH9A 3HL2A 4R38A 1BR4A 1HSJA 5AW4B 3ERED 1W2EA 2BEOA 4S2MA 4JBZA 1BDDA 1B1BA 2YNYA 4CSWA 4IJGA 1R4MB 2MH9A 1BGYG 1SQXG 2P04A 3LSKA 1LKXA 1T1CA 3BG5A 3AE3C 3HLFA 2QKPA 4PK4A 1MFTA 2H6CA 2DYRH 4A3EJ 3HKZA 3VN0A 3Q81A 3L75E 2KDOA 2XD1A 3FMQA 1MY8A 1REPC 4FE7A 4I6MC 3Q0VA 1ES5A 2JN7A 4ESFA 3P8CE 2DQRA 1RHZB 1AKHA 5ICCA 5KJ7A 2ZYGA 1QRYA 2NUPC 3IKVA 2WSEJ 3HOXJ 4N9LA 2QKMB 5FI7A 1SFXA 3OPPA 2LMDA 1S1ZA 1Z1DA 4B93A 3W2AA 3DTIA 3CQZJ 1ETXA 2P10A 4A3LJ 3T12B 2BCCE 4WEKA 3FC7A 3ZMTA 4X68A 5H20A 2GIVA 1W0UA 1ESUA 1OVRA 3VE3A 2EH3A 3F8BA 3I4MJ 5L3DA 4O7DA 4ITVA 3PBQA 3VE4A 1VQPI 4HV5A 4LRXC 2HZDA 5FA7A 3V8JA 1NZOA 3E5XA 1NLZA 2Q9NA 3C9IA 2O5RA 1ZG6A 2WY7Q 1SP4A 3MS6A 3S4RA 3FF5A 3H3UA 2JHEA 2UWJE 3F3XA 3H1LE 3TL4X 1PFLA 3VYIA 3ZMZA 3RGUA 1IFPA 5CEBA 2XZRA 1NU1D 4A6DA 2Q3EA 3QP2A 1K7AA 4AQRD 3BTLA 1T39A 1G1JA 2E5ZA 3D5RC 2DMPA 1OTDA 1IN5A 4PD4H 1QGKB 1TWAJ 1TVFA 4EXOA 1FS0E 3ROUA 3TDUC 5CPRB 2M34A 4I76A 2OAP1 2G8YA 2XNXA 2B02A 5FQKA 1E4DA 2E5TA 1ZREA 2K37A 2X4HA 1NWQA 2F4IA 5J1YA 2OYHB 1JKQC 3IWFA 3SJMA 1FWZA 1FZGA 3UB5P 4R8HA 2AEFA 5J4VA 4U0VA 2CG4A 2HZTA 1YM1A 2ZJRF 2XC7A 3PFYA 4N4OB 2ZOHA 1LWUB 1N2DC 5LBRA 2CV2A 4F55A 4XLFA 2VV7A 3GYHX 4CLCE 5IYDJ 5EZHA 3VWBA 2DMUA 4NXEA 2B7EA 1E3PA 4ZKUA 2Q0OA 1TS8A 1EV7A 1Z7LA 2PMHA 3MZWB 2BLSA 5B3SH 1SQVD 1MJ9A 2IFMA 4ZZDA 5AQ7A 4DZPA 2FFDC 5E3LA 5B5EH 1SKFA 3EQLF 3TW7A 3T1SA 2JT1A 2VQHA 1D8JA 3F9KA 3ZQ5A 1SQXD 1DP8A 4PHTA 3GFMA 2E60A 2H28A 5AW7B 5DM7F 1SQBJ 4GT1A 4UB8E 5JI6A 2M5AB 3IP4B 5HLGA 2WADA 1I50J 5IT9Z 5DUIA 1ZW0A 2X0LA 1DP7P 4GNUA 3IRRA 4B86A 3VP1A 1Z56A 2OA4A 5LHGA 1XTAA 1GSVA 3L2VA 1KV4A 1KQSO 1F43A 3PBRA 1JUMA 5LRSA 3GXOA 3MHVA 2K27A 1XDSA 1N86A 4CYDA 3SW1A 2HQNA 3SS4A 1IO2A 5EYRA 4EGZA 3HZJA 3IH4A 3SFZA 4FISA 3A7OA 3BP8A 1FCOA 4KENB 1DEBA 3OYGA 1R71A 5H6RA 4NHJA 1MIJA 2K9JB 2CW7A 2K88A 3S1YA 1X9VA 1BZAA 3RI4A 4Y0TA 1OPCA 1OTEA 1YAXA 5F82A 3PBTA 2CUFA 4PV1B 1L0GA 4BE1A 4J19A 4ZJ3A 5IYBJ 2Z2SB 4A3IJ 4DZOA 3DPUA 3TF5A 4JOMA 2CFXA 1XMAA 4WF0A 2P7VB 2A06D 4FE4A 4N1XA 2XAUA 4ZDXA 4M6VA 4NETA 2G0EA 1FAVA 1VF5B 5EJCA 2FOWA 5AVTB 5CECA 4QY5A 4WYYA 3JREA 3UE0A 3BW6A 3Q5SA 1YW9A 2STWA 3BLYA 2QE7H 4MFEA 3S15J 1GVJA 1GXPA 4LOCA 1Y0NA 3L9KA 2WMMA 2ETHA 5KZHA 3HOVJ 2RV8A 1YQAA 3BT9A 2J9PA 1JKPC 4CCKA 1HTZA 2EZHA 1K57C 2EZIA 2ZFUA 1OW6A 4ZYHA 1Q1VA 3VTPC 4RAZA 4B9OA 4X0GA 1GL2C 4CA0A 3GTQJ 2XF5A 5E79C 2X1DA 1XPXA 4ZNCA 2KIMA 1VF5C 3DAVA 3M2JA 3QPHA 2K3FA 1D7MA 3B33A 4NC6A 2K9QA 3GTCA 1ZG4A 4U3FE 2VUMJ 1ONGA 4FCFA 4BBTA 4MEXF 3LMMA 3V2RA 1YLJA 3A3IA 4M3KA 4X69A 3WS0A 4EV0A 1N77A 1ETOA 1NYYA 2L4AA 1T2KD 3QAHA 1MC0A 1Y8RB 3UIAA 4KG5A 1YLZA 4IBRA 4WZ4A 5F0FA 3Q3SA 2DU9A 1RETA 2YMYA 4U7BA 1DP3A 2Y0DA 2W1OA 3D1NI 3EOIA 1TZLA 3CWFA 3HGGA 3A01A 3CP2A 5EVIA 3IFMA 1P9WA 4CQHA 1B9MA 3VSLA 3MKZA 2V8FA 3KETA 4YINA 1NVOA 1JCCA 1DP6A 3NC8A 2ZC6B 1P0ZA 1IN7A 1X2NA 4RGUA 1V9YA 5TBMB 2DCEA 2W4SA 1S8NA 3TGUG 3S93A 5LGUA 5ICGA 2Y2HA 2K02A 3EUHC 1XJ2A 1G6AA 3DXJF 3NECA 5CJ0A 4GDFA 5AVXB 2BOLA 1KMIZ 2XIGA 4CLCD 4YPCA 2XV4S 1FBUA 3HUSC 4OPRA 3Q9SA 1JI8A 4DOJA 4IHSA 3CCUP 4DQ2A 3M1EA 3PSFA 1B4AA 1QO0D 4DCKA 1YJ9I 5JFRA 1BE3G 3TO9A 2M8GX 3W4PA 1SQVK 2GM4A 3CJNA 1WPKA 1EZVI 2DMWA 2C9NY 3G73A 5KLVD 2AXTC 2DLLA 3MZHA 3RK2D 2VC0A 2QSGX 4XIDA 3L72J 3SHFA 3UMEA 3BFGA 1YTZT 2L0KA 2XR0A 1FYMA 4I1LA 4V19K 1YX3A 2X6WA 2WYXA 4NXBA 3MAJA 1S5LH 1WRJA 4IRGA 3A3JA 5HPIA 4ZYDA 3RPUA 1W5CC 1FOSE 1VQKP 4XONA 2R9WA 1LNQA 1N9OA 3HOWJ 4D7MA 3UN7A 3HVFA 1I27A 5CCHC 4CH7A 1GDTA 5E2HA 1HQCA 3GQZA 1LEBA 3ZQCA 1WWXA 4JPZB 3OC2A 4G9YA 3CC2P 5CTNA 2QQBA 3W67A 4IFMA 3W4OA 3ULFA 2ZT9B 3T5XA 2E76B 1S4SA 2VKSA 4BJPA 3GMWA 2M45A 2MD5A 2FQ4A 2ELKA 1FBSA 4U7JA 1T0FA 4OIOF 2VXDA 4QWOA 3BFEA 3MZDA 3K2ZA 3TGUJ 2DPDA 2DFIA 3TGNA 4I7ZC 3K4CA 5HODA 1MBFA 1G2CA 1NKZB 3BCCJ 3DU5A 4LD5A 3K7AJ 5EEAA 2QHKA 2WGIA 1FJPA 3AE2C 3GLLA 1BJZA 4Q4ZF 2FFYA 2RQQA 5EE8A 3I59B 1CGPA 3LFVA 3CCQP 5FKKA 2KJBA 4HF1A 4BENA 3DTEA 4BD1A 5KNLA 3L1PA 2LXBA 1PL5A 5AVQB 3EQ2A 1YQ4C 1NTME 1XCVA 1FOFA 3PRJA 2ZO4A 3RCOA 1SANA 3S3MA 5JVGF 5CYVA 4MBFA 3IH8A 1K73Q 2XDJA 2N1TA 3H5NA 5HLTA 3K4MA 4C2TA 2FY8A 5CXWA 4EOTA 4H13D 2UV0E 5A90A 2QM3A 4Y0OA 1IXRC 2DA2A 1HBWA 3K1MA 4IL6H 1VB6A 1I2WA 2WKQA 1X1CA 4BXXJ 3CPWO 3RL0g 2J5OA 4HF0A 2JKTM 3ZMSA 1M56D 1FJKA 3I56P 1JMBA 4RS8A 1HJ0A 2WWYA 1DJAA 2CQQA 1LSVA 3C8CA 1FILA 3BJ6A 4LIUA 4FX4A 1X19A 2XD5A 3L71E 3ZQFA 2XAHA 3A0HE 1WJCA 3CX5I 4KFCA 1ITYA 3HJIA 5CVJA 5CCGD 4EERA 2V7FA 4BACA 4MN4C 1Q2NA 1V5GA 4PGGA 4S2NC 2E1CA 2W1TB 3GZNB 1UCRA 1N7SA 3IF5A 2LVSA 4A3JJ 3G9RA 3WU2H 1FZAA 1Z77A 2XPUA 4IBXA 1K4TA 1YMXA 3K70C 3IBJA 1YIJI 3K0LA 3Q7VA 4I0BA 1P2FA 1V54H 2OAQ1 4J01A 1WSUA 2E8JA 2CQNA 1JWVA 3CWBJ 2CGPA 2LY2A 2PHYA 2P5LC 2VODA 3H36A 4I2OA 3F22A 1U8RA 4HH2A 1M7LA 3U1AA 1NTMJ 3HBRA 4LCMA 1ALQA 1FOYA 4WXCA 5DTKA 3Q5PA 1JT6A 3PP5A 4IUHA 3BG9A 1WVRA 1PI4A 4RX2A 1W5CE 2OLUA 2OAZA 3J7YJ 4EWFA 5KJ7D 4QTRA 1ZAOA 4XQFA 4IHXA 4ZDOA 5GPAA 4E7ZA 1S4XA 3GHGC 2EFOA 3WTYC 3EGXC 4XK4A 5CHXA 3W6JB 1KC8Q 2L3DA 4BL2A 4O01A 2KHMA 1GSWA 1FOSF 3BCCE 2Y0SA 5TJJA 1HLVA 5E1XA 1JJ6C 2RKLA 2Z4EA 4R6LA 4FTXA 3C30A 1FC3A 1U8BA 5AIPA 3HOUJ 4HX8A 4GIFA 4R79A 3QPLA 3OPHA 1ON2A 1IK7A 1SAXA 4ASNA 4QD4A 3ZQIA 5HFOA 3VP3A 1FZPB 1LTGC 1X1AA 5HDNA 3RFBA 1KGGA 5J47A 1JY2P 3ZCZA 2I10A 4M6YA 3K4KA 4Z1WA 1GA9A 2E1MB 1GUUA 3GCMA 1WKMA 3CMEI 5EVEA 4U0XA 3C1DA 3S3OA 3E6BA 2EIKH 3SWYA 1U78A 5DS9A 1OMEA 1QZZA 4R3AA 1BI1A 2R44A 2FYUG 2FFDB 3E5QA 1ERMA 1IUYA 2KDZA 3ABUA 1Y6IA 1RCJA 4UB6C 2A24B 2V7QH 2LRDA 5FFZA 2LF7A 3IV5A 1JTHA 2ZMVA 1OZHA 2WGWB 5FFXA 1R1TA 2MABA 1FNNA 4CYCB 1IRFA 5HNFA 2EA2A 3NULA 4E6KG 2V7QJ 2HS5A 2RC4A 3RKXA 3ZYTA 4XM3A 2VKHA 4UQIM 2WUQA 4G12A 3KE2A 1YTYA 1IW7F 3FXEA 1M1JB 3HE4B 1R5SA 2Y2GA 3HOSA 1X1DA 1SQPE 4C7NB 3GVAA 4R0QA 1ZOYC 3D6ZA 3G4PA 2HPCB 4M9SA 5TBMA 5CKTA 1D1CA 2PU4A 3FK7A 4N3YB 5FAOA 1MBLA 1T3UA 2Y2LA 1SQPJ 2IGNA 1N9BA 1XA1A 1JTHB 1WFXA 1M1KQ 3GSGA 3OL4A 1ZLJA 2DA6A 3M8FA 5BMZA 2WGWA 2HQ5A 4ESPA 3HE5B 4BAYA 4B1RA 2K4JA 1ONHA 1XP4A 2Q3IA 2JA2A 3DV8A 4OAYA 3M2KA 2M3BA 3BTIA 3EYIA 4LG0B 4OGQD 2HGVA 3TRCA 5KCMA 2GDNA 5HAPA 4ZZLA 1R5HA 2CUEA 4WMCD 4OIQF 1O7LA 5EM1A 2HDWA 1VQ6I 1VQ4P 1SFKA 2A45G 1OWAA 3F1NB 2EFNA 1HW5A 2UWMA 2XF3A 1TWGJ 2P08A 1EDJA 3V39A 5EUAA 3Q9VA 3ZPLA 4GW9A 3JRAA 3OAKA 3PBNA 1J9IA 3V7CA 3H7WA 4EUZA 2DA4A 4WELA 3HLWA 4NKPA 1UJ8A 3AL0B 1GHCA 1AOYA 1KOUA 2HODA 5AQBA 2P58A 3Q5RA 1NU1J 1OW8A 5CHJA 1SFCC 2GIZA 3S16J 5A2QZ 5CQGA 2FH5A 1LTBC 1NY0A 2R7SA 3NOUC 4LLOB 3IF4A 3WTSC 3RZDJ 5CX7A 2HF6A 3KEOA 3LGOA 2ZQ9A 2M8RA 2R7OA 2FUG2 4LV2A 5HOOA 4EQIA 4NDLA 4BY1J 3BQZA 4DYQA 5D5WB 1F4KA 3TOAA 3VMAA 3LICA 3DQVC 2N1TC 4TLFA 4KDPA 4PPRA 2E76C 3Q5FA 1TEMA 4EJOA 1KILD 1YLYA 1LUJB 4HQMA 2KB7P 2O1JA 5D4RA 3VDXA 2R32A 1Y28A 1FQGA 1DUXC 2QWWA 3B47A 3FGAD 2XHKA 5F1GA 2JPBA 1T8ZA 4M9XA 4LITA 1EXJA 4KHXA 1NTZE 1W7FA 3A0VA 5FEFA 5FQ9A 3FDYA 1TQMA 1FDOA 1EC5A 1XD7A 2MLKA 3QP8A 3PQJA 1YI2P 4BEHB 3A4CA 1R36A 2OQRA 3HHGA 3JRIA 1FSHA 4W80A 1J9MA 3E6CC 2XKOA 1TS0A 2J5PA 1PZPA 4KT5C 4C7RA 1MZ9A 1I5QA 1WJBA 1XSVA 3M3YJ 4FX0A 2F5CA 1LTJB 3BR5A 1I2SA 4DE2A 1OTAA 1Z05A 5AVYB 5C44J 3AAFA 2Y2OA 3CG5A 3FXOA 2PFXA 1UHWA 3H32A 2IJLA 4GYIA 5F1JA 1LT9B 1D1BA 2ZVOB 5KAIH 2IBZI 4NC8A 4FQGA 3NY4A 3CXHH 2E75C 3RXWA 2CJJA 2IVMA 4N9KA 1L0NK 2Q8KA 2JWTA 5IYCJ 2NNYA 4JX6A 2LYCA 2LBFB 3A2AA 1XGJA 3OSGA 3S1RJ 2J9OA 2ZMFA 2WV1A 3A3EA 4EM2A 3L70D 4XLAA 3W68A 1EKEA 2Y69H 3MUDC 2X6OA 2XA7S 4P6BA 1RNLA 2AQFA 3F89A 2NOGA 3AG4H 4AIHA 4LLNA 1R49A 3IXHA 2Y2ZA 1Q81Q 2FXPA 1Y54A 4HLXA 2FMLA 4ZC3A 2DK5A 4OAZA 1YBKA 1GK4A 4NPEA 3LIBA 3BM6A 1MDMA 3G2BA 4S05A 2QJYB 5CCHD 2EV0A 4HJ3A 5GHZA 3LYXA 4EBLA 1ZRCA 2UZKA 1F5TA 5CVIA 4GKGA 1QX8A 2QBYB 3NDGA 5GTIC 1URQB 4RVAA 4XL9A 3ITAA 2DN0A 4KICA 3FXDA 4OVNF 3UNGC 2KIQA 2ZSHB 4BJ6C 5L3CA 5HWWA 1BLCA 3SH7A 4OGQC 1MMAA 2A3UA 2ZMEC 3VP0A 2YO3A 2ZC5B 4PM8A 5DTTA 3PTZA 3ZG0A 4MEZA 1LDKB 2PR6A 2XA7M 2NZ2A 2XGXA 2K9SA 2VKVA 3NIAA 1KD1Q 4P6ZS 2KYVA 2WKRA 1F98A 1NYMA 3S17J 1DD4A 1V9ZA 2PD8A 1J5YA 3RK2C 1VQ5P 1NTZK 2NVUB 2PD7A 3K2NA 1K56D 2GXGA 3NAUA 3A01B 1LVKA 2ZD8A 4QPOA 2POHA 3I53A 5D8KB 4U3FJ 3HTSB 3UPOA 3G6EP 5B66E 3FIWA 2LB5A 3U59A 2DAOA 3B5ND 4I3IA 2HYNA 5BQTA 2M0MA 3E4OA 3Q7VB 3H1JJ 2ZB9A 2O9BA 3V50A 3H35A 4NPDA 5G4YA 1NK2P 1ZELA 4Y52J 4ZYGA 3G6EI 3OSFA 1RQVA 4DXBA 2X9DA 3AE4C 1QZEA 4FH4A 4A5RA 3K4JA 3E97A 3GEZA 2L9RA 3TEDA 1Z91A 3HSFA 3LSIA 1SD6A 4L74A 2VB6A 1FU1A 1XFNA 2XSJC 4O0PA 1YRNB 3CL3D 3VP9A 3VYUB 4RX3A 1M1EB 2L9NA 3G4SP 3KCCA 1GL2B 2WSSH 4DGWB 2TCTA 3MUDA 1B72A 4L5JA 2VOPA 3EETA 1PW1A 2Q9MA 2UV1A 4AWXB 1KU3A 2KSEA 1OYIA 2V20A 4BY7J 3M8EA 5FKLA 1J1EB 2F4OB 2C0WA 4R4RA 2ZFCA 5L2FA 3H1IJ 4B88A 5F68A 4MMNA 3TBIA 3V3SA 3IX3A 3CTAA 1BE3E 2ZC2A 4HG2A 3H1KE 1HA8A 4Z1MH 1G59A 3V7RA 5FASA 1VI0A 3BRTB 2VQCA 1HCRA 2WB1A 1LI9A 3FHZA 2E1NA 5DYMA 5LHIA 1HF9A 4KISA 4XRSG 4HKZH 4AVZA 4CDGA 5JVTA 3WS5A 3KXDA 4D9JA 5AVFA 3H9WA 3KFWX 3H0GJ 5IHVA 2X85A 1FE6A 1S6LA 3VYTB 2XNDH 3W3CA 1FIAA 3L74G 3MFXA 4PM7A 4D6TD 1A02F 1PP9E 2KP8A 3V5BA 3HTUA 5C39A 3B4SA 2FZ0A 4BWNA 4DE0A 1MBJA 4Y99B 3NCKA 1W5TA 2MBFA 3FXMA 4OOIA 1S1CX 1X3UA 3MZFA 4OOMA 4EDFA 1GL2D 1RGYA 5L07A 3BZCA 4UEYA 3HRSA 4O3MA 3SWFA 3F1NA 2V4JC 4EJTA 1VZ0A 5KLVG 5K5BA 2KK7A 1MBHA 3DKWA 3MQ0A 1LEAA 3CCJP 1RZ4A 3H7WB 3IF6C 3EPZA 3S7NA 1PWDA 2F5DA 3HC7A 4HH3A 3AGDA 1U5TC 2JVGA 2P8TA 2V1DA 5DD4A 2WAQA 3RYRA 4EEFG 5L09A 2RNJA 4G3KA 4C6YA 3M8JA 1MUUA 2MSYA 3PJRA 4DJGA 3ITBA 3P7KA 3N7WA 2J5UA 2XASA 5GTIE 4L9NA 1DY6A 1DIPA 2IGKA 1L0DA 1BI3A 1K4EA 4ENMA 4N78E 3OYCA 4E7KA 4MN7A 2YUSA 3G34A 3S1MJ 3I55I 2VI6A 1HW1A 2DBBA 2Y48A 4ENKA 3EEAA 2ESNA 2QJ7A 2YKOA 3TO6A 1P9RA 5HAQA 2GXAA 2DDAA 3ZQHA 3MQOA 5KKZC 3LR5A 5M5WJ 2P74A 3G3ZA 1TWHJ 5EG0B 3BPVA 1U7MA 3LR3A 3FBIB 3HPHA 2RDPA 4CJNA 2O9LA 3MMYB 4OGQB 4KJZA 4L75A 4GKUA 2R3CA 3Q0WA 2KRHA 2EX2A 1SS1A 1SMYF 3JRDA 3GHGA 1RF1B 4DXCA 3BCBA 1XX2A 2E8IA 1BC7C 4QPRA 4H13B 4Q8IA 4BL3A 3ESWB 2A07F 4WX9A 5D6EA 1PUEE 2XAQA 1FR6A 1T6AA 3HD7A 1S29A 4CCMA 3G1LA 2HOSA 1C3BA 1Z6RA 4JXSA 3SZTA 1CK3A 1RE4C 4FHTA 2VL8A 3O8GA 5FQJA 2VT2A 1YQ3C 4S2IA 3K1NA 4OOLA 5H6QA 4A3MJ 1FP2A 1J59A 3GZ5A 3C2BA 3CMZA 1YYVA 4BQMA 1MKIA 1WGXA 2XV5A 3T4OA 2W6BA 5HDDA 1ORKA 1U9NA 3KP4A 2LY9A 3CUEA 4OH0A 5EF6A 1WI9A 2FMYA 3WWXA 3L73D 1SQQJ 3HKZN 1EZVE 2HXIA 4ASVA 3CP8A 3HD7B 1QVGO 4A3KJ 2DPUA 1RC9A 1LVAA 1Q90D 1P97A 2O8XA 2ZT9D 3H1JD 5DEQA 3LY3A 1LL8A 1ZC2A 4L9JA 3IHBA 1KILA 5FI6A 1OR7C 2ZQDA 3SEZA 3KX0X 1LTJA 2BCCD 1IRGA 2KRCA 3T1BA 5KVRA 1RR8C 3P9CA 4F93B 5IP6A 1T56A 4B4CA 5DDGA 3DKYA 2Y2MA 2V6CA 1D06A 3CZDA 1OCZH 3DP7A 2N9BA 2WT7B