1MKMA

Crystal structure of the thermotoga maritima iclr
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
246
structure length
246
Chain Sequence
MNTLKKAFEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKDKRYVPGYKLIEYGSFVLRRFNIRDIAHDHLVDIMKRTGETVHLILKDGFEGVYIDKVEGEQSIPMVSRLGMKVDLYSTASGKSILAFVPEKELKEYLKIVELKPKTPNTITNPRVLKRELEKIRKRGYAVDNEENEIGIMCVGVPIFDHNGYPVAGVSISGVARKFTEEKIEEYSDVLKEKAEEISRKLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Thermotoga maritima 0065, a member of the IclR transcriptional factor family.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
molecule keywords IclR transcriptional regulator
total genus 75
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
A PF09339 HTH_IclR IclR helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mkmA01
1.20.5.640 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1mkmA02
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1mkmA03
2E1NA 5LHHA 5FO5A 1ZRCA 3ULQB 5FGMA 4ESBA 3HUGA 3GXOA 4UV8A 4EUVA 2HOEA 4EGYA 1S3JA 5HDKA 4E04A 3GFMA 2A61A 3PQKA 4BAYA 2DBBA 5CVVA 5L3EA 1O3TA 4U0WA 3F22A 4Y2FA 1FOKA 3M8FA 1ON2A 2OQRA 2ZNYA 3R4YA 3L00A 3CITA 3QAHA 3J80K 3E98A 3O2PE 3EEAA 5L3BA 3M8EA 1K7AA 1YLFA 3FMQA 5DD4A 1K6OA 1BI3A 5CVUA 1ZTUA 2M5WA 3GWZA 2FMYA 4Q48A 3MAJA 4A0XA 5HL6A 1P2FA 1OYIA 4Y5FA 3G3ZA 1HW1A 1RZ4A 2ACJA 4P55A 3E6BA 1V4RA 2CFXA 3H3ZA 4A5NA 2VBXA 2PI0A 1XMAA 2XAQA 3HRTA 1LEBA 3L7WA 3F3XA 3J7AO 1TNTA 2IW5A 1IXCA 2E7WA 4BYYA 1UB9A 1TQIA 5LGUA 4LRZE 1QQIA 1IXSB 3TRCA 4CICA 5HS9A 3I0TA 4RGRA 1SFUA 3TOBA 5HS8A 4YOFA 4D0PA 4R8HA 1CF7B 3MFKA 4WXCA 4KIFA 3V8KA 1U8RA 4KN7X 1YW7A 1XDSA 4KIGA 2WC2A 3E97A 2PFBA 1DPUA 3PFIA 3CJNA 4YNRA 3R61A 2O03A 1GXPA 2JT1A 3I71A 5HPFA 1F5TA 2STTA 2ZNZA 3JTGA 2LB5A 3S7OA 5JI6A 3TKYA 2JPCA 1L0OC 4G8XA 3D5LA 3LSTA 1OR7A 2C6YA 5DFXA 3LQQA 2O6GE 4UVCA 4IUHA 4UNOA 2XASA 1IAWA 3KSGA 1ODDA 5D8KB 5HSQA 5ICFA 1SAXA 3CUOA 4QWQA 2EFWA 3RJPA 4ETSA 3KP7A 4LGWA 4H0EA 2ZMFA 2O61A 3FMSA 5D4SA 3IRQA 1I27A 4RGUA 1RNLA 1R7JA 2Y75A 1R1TA 4MDZA 5BMZA 3FWEA 2EB7A 2HTSA 2EFPA 1IZ1A 2XKPA 4XLPF 3E3VA 3F8BA 4PGGA 2BGCA 2D2WA 2IA1A 2QZ8A 2G9WA 2G7HA 5AONA 2HKOA 2W25A 3GO5A 2RNJA 3EYYA 4G3WA 1QZZA 4Z1WA 3EYIA 1Q1HA 5F64A 3MQ0A 3H92A 4MQ9F 3SZTA 2CW0F 2ESHA 2HGCA 4WXHA 2RDPA 2MA3A 3FXRA 2P7CB 2QUFA 3O3KA 1ZHFA 2P5VA 2J5PA 2W57A 1WWXA 2Q8KA 2EFQA 1D8KA 4Q47A 1KQ9A 3F8CA 4ZZDA 3HTUA 2QM3A 4HA8A 4OIOF 2EV5A 3J81Z 3RKYA 3JTHA 2DPUA 4G7OF 1P6RA 1XSDA 1ZGAA 2HZTA 2YSRA 4PCQA 2OQGA 1B4AA 1MDMB 3CO7C 1RIOH 4ENMA 3DF8A 1Z7UA 1I5ZA 3BDDA 3B02A 5LBQA 3KEQA 3K69A 1B6AA 4EM2A 4Y13A 1G6NA 4WWCA 4NHJA 1LNWA 5LBRA 3GZ5A 1JHHA 5FFXA 2HYGD 2RGVA 4IRGA 3T1BA 3IWZA 3K2NA 2H27A 2IVMA 3ZMUA 1BJAA 5DCFA 1LDDA 3BOQA 1MJ9A 3E0YA 2JZYA 1IN5A 1ZGJA 1G4DA 4KNYA 4KA4A 1HKQA 3LFKA 1HXDA 3KZYA 2A69F 3M1EA 5CVIA 4KMUX 1HKSA 2IP2A 5LHIA 1QPMA 1XGSA 3RYPA 4ZYGA 1RI7A 2Y0MA 3NOTC 4MHGA 1FBUA 2DO7A 3SHFA 1MKMA 3AAFA 4HBLA 1FYMA 2JTVA 3TDUC 1FWZA 4CQHA 2KRFA 2EJRA 2CSOA 4EJUA 2GA1A 5D4RA 2KKOA 3RTRA 2EFOA 3BJNA 4Q5SF 4HV5A 2W3EA 3F8NA 3HSRA 4KT5C 4WXDA 2H6BA 3DEUA 4P5OA 4N9IA 4G9YA 1YSPA 5A2QZ 2DFIA 3DPLC 1QZYA 3DBAA 3ZN0A 3NEUA 1ZG1A 1XMKA 3Q5FA 3L09A 2W85A 5FLXK 1LDKB 4M9SA 3K1MA 4N0BA 1TBXA 5ED4A 3F23A 4AIKA 4CXFA 3V7RA 1EV7A 3ZMZA 3FF5A 2FA5A 1D8JA 2FE3A 2W24A 4I02A 4LK1F 2RKHA 4BHPA 5LGTA 1FZPB 2HYFA 4U7BA 1USTA 2L02A 3MF0A 3DFGA 4Q0HA 5LRSA 1YSQA 3TOAA 2GZWA 2UXNA 3KP6A 3K1NA 4EM0B 5ERIA 2QENA 2O9BA 3WODF 1H9TA 3KLNA 4KFCA 4LJZF 4M6YA 1UCRA 3ZMVA 4R6LA 4G94A 4S05A 2PLYA 4QPRA 3IL2A 4IRIA 4IHTA 4OIQF 2VOPA 3JAMK 4I7HA 3GF2A 2O0YA 3GUDA 1H9GA 1K78A 2PQ8A 4LLGF 2V1XA 1SMTA 5HOOA 4DNCA 2O99A 2E1CA 3IHUA 1SD4A 2MLGA 3CO6C 2AXLA 2M45A 4MEXF 4L9VA 4S04A 1T38A 1BI1A 3D0SA 5ICGA 2FBKA 2GQQA 3C2WA 4A6EA 2VODA 3QPTA 2DPDA 3QU6A 3BWGA 1W5SA 1HSTA 5E1ZB 1ZYRF 3WG9A 3I59B 4AD9A 1IF1A 5EEHA 1J2XA 5BPIA 2K4JA 3K9TA 3U1DA 4KIBA 1ZG5A 4IXAA 2UWMA 2AS5F 5AIQA 1T0FA 4ZYHA 4KMFA 4JQFA 3RIRA 3OV8A 1S6LA 2L4AA 5AJGA 4MMNA 3FMRA 5H6QA 2DT5A 5AIPA 5F1RA 4E70A 4L0ZB 5DYMA 2M87A 2EK5A 3G73A 1QBJA 2BYVE 3E6DA 3I59A 2LF8A 2QQ9A 2VBWA 5ILVA 3WTSC 5JR3A 2COMA 2O3FA 5D5VB 2XAJA 1YS6A 4PZJA 3KSIA 4RQ9A 1OPCA 4ENNA 2W1TB 1IRGA 5HS7A 2XROA 2XSSA 2L54A 1W5TA 3ABTA 2VC1A 1CF7A 1HW5A 5DEQA 4HDVA 4HLXA 4RS8A 2PEXA 1O7FA 3T5XA 1XGMA 1XSVA 2E7XA 1S7OA 3I5UA 3HSEA 4AIHA 2EA4A 2LKPA 4BH9A 1TTYA 2VKSA 2DLLA 2IA0A 3HHHA 5CVJA 2M7VA 5D6FA 1STZA 4WX9A 2DI3A 1XN7A 1J7KA 2JSCA 2XHKA 2ADUA 4HV6A 2D1VA 2B18A 2PG4A 4EMSA 3EUHA 3KCCA 5D5UB 3DXJF 4Q0IA 4WCGA 1YIOA 2UZKA 2PBIA 4HF2A 1EH6A 4MGRA 1ONVA 4L0YB 1IN4A 1ZREA 1KU9A 4ESFA 1KYWA 4FT8A 3I53A 3TQNA 4YG2F 1B59A 3HOTA 2X4HA 5ILSA 1QGPA 2OBPA 3JSOA 4WF2A 1LJ9A 2F5EA 1BM9A 3RPUA 4HAMA 1YW8A 4RAYA 3WTYC 2YX7A 3V7CA 4P9FA 5DUIA 1O3QA 1Z9CA 1LB2A 2IPQX 3P9KA 2WTEA 2O9CA 1Z6TA 2BV6A 2KLIA 1P92A 1WI9A 3KP5A 1H0MA 3COAC 3ERED 1U5TA 2M8EA 5DCMB 3KE2A 2LSOA 1YKDA 1SFXA 1O57A 1IW7F 1F1ZA 5K5RA 3DP7A 3OBFA 4HQMA 2IT0A 3RKWA 1S8NA 2GAUA 1KU7A 3E5QA 1XCBA 1SD6A 5E20A 2XAGA 2QYOA 3QRFF 4IHSA 4JK1X 2VE8A 2M7UA 2EA2A 5J8CA 1T39A 3ZP5A 1PUEE 3RFBA 3KP2A 3WTVC 1ZRFA 1JHFA 1DPRA 3WTTC 2GWRA 4XRFA 2OZ6A 2BEOA 1XDUA 1E2XA 1WQ2A 3LQRA 2Y48A 2CWEA 2ZMEB 2VBYA 5F6FA 5HLHA 1U2WA 1JXSA 3WTWC 4A0ZA 3W6JB 4BWIA 1ON1A 4KDPA 4P9UA 2Z33A 4MEYF 5A2QK 1HKTA 2W3HA 3ELKA 3IWFA 4HX8A 2KOIA 3ZPLA 2ELHA 2VN2A 2FU4A 5DUKA 2P5LC 1SMYF 3F8FA 1R58A 1ZN2A 3RPQA 5H20A 3MMHA 1UHWA 4ENJA 2TDXA 1KU3A 2JPBA 3ROUA 1B9NA 1W4MA 2ISYA 5J6XA 1XGOA 2OU2A 3GX4X 2QYBA 4IUKA 4XLNF 2FF4A 5TRDA 2K4BA 2LDUA 3HOSA 2QQBA 1UHMA 4F7ZA 4R79A 4ESJA 1S29A 2YR2A 5IT3A 4M74A 2DK8A 4WK8F 3LWFA 5DV5A 3V8LA 2XRNA 1BN5A 4MQVA 2V1DA 2VBZA 3GVAA 5HDGA 2ESNA 5DD8A 3TO9A 4EJTA 3E5UA 1IUYA 3KP3A 4M6XA 1MD0A 1OMIA 2RV8A 4RB0A 1EH7A 1GHCA 1D3YA 5C5KA 4U88A 4O5VA 3S2WA 4HLYA 5L3FA 2QVOA 1XSXA 4CZZA 1G3YA 3ZN1A 5CYVA 3I54A 3CLOA 2K27A 4EV0A 2VONA 4CO8A 2JRTA 3WU1B 4GYGA 5ILUA 3RYRA 1MC0A 4IJGA 1REPC 2MC3A 4XBFA 2RVCA 2LF7A 2MH9A 1SFEA 2V79A 1U3EM 1MJAA 3RDIA 2KJBA 4ON0A 1DUXC 3GYHX 1J0RA 3LAJA 3V4GA 4I2OA 4G7HF 5FD5A 2XKOA 4YFKF 4R1HA 2OOLA 3SXYA 2FNPA 3ZMTA 3S7PA 2K2NA 5D8LB 1J59A 3DPTA 1FPQA 1FBQA 1FSHA 4EGZA 3U9GA 1BI2A 5K1YA 1U6GA 4KUMA 1D5VA 4Q0JA 2H6CA 1S7AA 5LLQA 2FQ3A 3P9IA 2K7LA 4MTEA 4OIPF 1IN7A 1J9IA 1WRJA 3L9FA 3PQJA 4RGXA 1UFMA 3I64A 1YYVA 1KGSA 2FBIA 4UVBA 2W3DA 2PMUA 3KEOA 1IN8A 1WSUA 4L5JA 1VHMA 2STWA 3Q9SA 4NB5A 2V1UA 2P6SA 2PJPA 2NAZA 2IA2A 2O9AA 2KIFA 2Z5UA 3SFZA 3EETA 4ZYEA 4G6DA 1GVJA 5LHGA 5IT9K 4GYIA 3NHQA 5E1WA 2NS0A 2HGVA 4CHUA 3ZQ7A 2MH2A 3U2RA 1J75A 5I5LA 4UUVA 1RUNA 5BPDA 3MEXA 2XUBA 2NNYA 2Z9OA 3N4MA 2H94A 4Y3IA 1LDJA 3I4PA 4G3VA 4RGSA 1U78A 4EQQA 2DW4A 1OYYA 2XAHA 2MBFA 4M72A 4Y15A 2P4WA 2EV0A 1XB4A 2DTRA 1FP2A 1YFHA 1HW2A 5LEJA 1YQAA 1FP1D 2DU9A 5BS6A 4UVAA 2QBYA 2W1RA 2VE9A 1T98A 4K2EA 4M71A 4EM1A 1PP8F 1LVAA 4ASNA 4BQAA 2VT3A 1Z1DA 2DQLA 2GIVA 4I09A 2PMHA 1W7PD 3QP5A 1TQMA 2CGPA 2LB9A 3CTAA 3EQLF 1PP7U 4HYEA 2P8TA 3S7NA 4Q4ZF 4PDKA 4A2UA 2HS5A 4YIFA 2EWNA 2QWWA 3VB2A 4ZZLA 3VV4A 2ZO4A 1QO0D 4G6QA 1LEAA 3O6BB 2KIMA 2NYXA 5HVQC 2O8XA 1K79A 3KO6A 1AOYA 2CQKA 4GO1A 1FX7A 2KJCA 2Y79A 2GA2A 5E8IA 1KYZA 4FX0A 3WU0A 1CGPA 3KFWX 3WE3A 4LRYC 2CG4A 2VEAA 1ZG3A 2Y8HA 3DV8A 3ZMSA 2YPRA 1FBSA 2DK5A 3V8JA 5D5XB 2WV0A 4LLLA 3F6OA 3REOA 2KIUA 4MNUA 3V7SA 4AWXB 4LK0F 4I0AA 4OOIA 2D45A 2ETHA 4IVNA 1MZBA 5J8FA 3BY6A 4IRHA 4RAZA 5L3CA 3W2ZA 2QQAA 3WE2A 2IRFG 1R1VA 1XGNA 4AIJA 4O3MA 3HSFA 3QU3A 4LG0B 1V3FA 1F4KA 2EV6A 3VEPA 2QLZA 4M9XA 1T2KA 3M9AA 1O7LA 4EJOA 1ZARA 4MCWA 4TV7A 2RQPA 2L4MA 3BJ6A 5D6EA 1TD5A 1OYWA 2ZJ2A 5JFRA 2A6EF 1T6SA 3GEZA 4LLNA 3FM5A 3TO6A 3KSFA 3LFVA 3LA2A 1TQPA 2FOKA 4EU0A 4XSXF 3HRUA 4OU0A 3R4KA 3HRMA 2DQRA 2L01A 3S7QA 3R6SA 2HQRA 4LRXC 4UV9A 3ML6A 2OAZA 4Y17A 1IN6A 1B1BA 4HDUA 5BOXA 3CUQC 1F9NA 2Q2EA 1FC3A 1XCVA 2K86A 2D1HA 1C0WA 1NHAA 5K5OA 4BXUA 4OMZA 1U5TB 1TNSA 4JBAA 1YW9A 1Z05A 1ZLJA 3ZMDA 4DQ2A 4OIRF 4UHTA 4L18B 4UXNA 5HLIA 1TF1A 3IKVA 3KZZA 2MLKA 3HRSA 1ZAOA 3QPHA 4FHTA 4B09A 2Q0OA 2DAOA 1HSJA 4A0YA 4O01A 5KK1A 4U0VA 2BE5F 3MWMA 4A12A 1ZLKA 3NRVA 3HIFA 2VJWA 4LG0A 3FHZA 3ABUA 2CO5A 2FBHA 2XVCA 3CUQA 2FNAA 2R7DA 3T8TA 3JAMZ 3FXUA 3FM3A 4KICA 2VOOA 5L8MA 4QLCU 1I1SA 5FD6A 2HWVA 4HF1A 2WWYA 3IRRA 4LD5A 4BHCA 3I58A 4FOFA 2PN6A 3R60A 2HEOA 4IJAA 3CUQB 3R0AA 1FYKA 3T0YA 4BHBA 3JSPA 3WTXC 1YTYA 2J5OA 3W6KB 3O5YA 1A04A 1R36A 3BPXA 3ECHA 2P5KA 3F21A 3LA3A 1ZH5A 3WGIA 2UXXA 2VT2A 5H6RA 3SQNA 2ZBKA 2Z3YA 3B73A 1Z6RA 3BROA 2ZFWA 2F2EA 2GX5A 1Y0UA 3TO7A 1KQ8A 3KP4A 2M1BA 5DCMA 2YU3A 1KA8A 4Z2YA 4CYDA 2VXZA 1O3SA 1GXQA 5LEKA 2FSWA 2NNNA 5JVTA 3NOPC 3IBRA 4NQWA 3WTUC 2B0LA 1R22A 5LGNA 3L2CA 3Q9VA 2P7VB 2XIGA 4ETZA 3C18A 2RN7A 5BQTA 2W3FA 5CVRA 5E17F 1BBYA 4ZH4F 3K0LA 1HBXG 4IF4A 3K2ZA 1G3SA 2G7UA 4GGGA 1J5YA 3MZYA 4R70A 4GXOA 4EJVA 1YS7A 1E17A 3C3WA 3BP8A 3P7NA 3FX3A 4HQEA 4I0BA 1BC7C 4MN7A 3N97A 3KETA 4LFUA 1R5HA 4I98B 4L9JA 1BOAA 3DQVC 2M30A 4O6JA 5CJ9A 1K78B 4P96A 4A5MA 1ZRDA 5ICCA 1SD5A 2A68F 3H3UA 2FMLA 4YIIA 4HZFA 2F5CA 4G7ZF 5CLSA 5KVRA 1FYLA 3ISPA 5E1XA 3WTZA 2W3GA 2IJLA 5HPIA 2OD5A 3GFIA 5IT9Z 3ECOA 3E6MA 2R3SA 3VFZA 4YFNF 1XD7A 1R23A 4I01A 5E8GA 4ZRRA 4G3KA 3GFJA 3WGGA 4DN0A 5HDNA 4FX4A 2BBYA 3RI4A 3QOPA 5D5WB 3NOUC 2X0LA 3GW2A 4L5IA 1EH8A 2CYYA 5FB2A 1FLIA 3IBJA 1HQCA 4N9HA 1L3LA 3GZ6A 1JGSA 4BNCA 5K5BA 4PGHA 1RUOA 4KYWA 2A5YB 3OOPA 5FFZA 2MD5A 3J81K 2YX4A 4LB6B 2FXAA 3D3OA 1TW2A 2K31A 3M7GA 2NRAC 2H09A 2FEZA 3KSHA 3MZHA 5TJJA 1SD7A 1QNTA 3E5XA 2XAFA 4KN4X 4B8XA 3F6VA 1I1GA 4LB5A 1AWCA 1FT9A 1F5MA 3KLOA 3P9CA 3G6OA 3HHGA 2ZMEA 1I6XA 3BZ6A 1P4WA 4LMYA 3CDHA 4O8GA 2XGXA 2W1TA 3FXQA 3F8MA 2A6HF 4RB2C 2HKXA 2A3SA 1R5GA 2R7FA 4GW9A 1FNNA 3SZPA 4L9TA 3R0JA 2HQNA 1USSA 3E6CC 2F5DA 4YFXF 1TW3A 2VZWA 3NQOA 2ZKZA 3BPVA 2RC4A 4M73A 3OOVA 3C1DA 4DMZA 3BJOA 3MCZA 3VOEA 2F5FA 3C7JA 3HTSB 1KU2A 2K02A 2ZCWA 3JW4A 4RB1A 2GXBA 2ZXJA 1PDNC 4GCVA 1G3TA 2HFHA 3WGHA 4AVPA 2HR3A 3ZQ5A 1FY7A 1U5TC 1B9MA 2XV4S 1WKMA 2OA4A 1KQ0A 1BC8C 4O0PA 3GLXA 2V9VA 4M9ZA 1TLHB 2P6TA 3HYIA 4OMYA 3BJAA 2ISZA 1VTNC 1MDMA 1BI0A 4EVIA 1R00A 4U0YA 4HX7A 6PAXA 4GLQA 2Z99A 4A6DA 3FZVA 4ETXA 5L3GA 1JE8A 2FRHA 5L3DA 1YG2A 5E18F 1Z91A 3RKXA 5FLXZ 3LA7A 5DDGA 4PAUA 4HW0A 3TGNA 2HDCA 4RB3C 4EJWA 2V6CA 1X3UA 3LAPA 4CGZA 5EEGA 2VC0A 1W7PA 2L3DA 1MGTA 1O3RA 2GXGA 1BIAA 2EFNA 2OZUA 5LRRA 4ZYDA 5DFYA 3GFLA 5JHUA 1DDNA 3K1PA 1FSEA 3QP6A 1P4XA 2QBYB 4XSZF 1IXRC 1W7PB 1ULYA 1LQ1A 2LNBA 4MTDA 2A07F 1MJBA 1P4AA 4HX4A 4HF0A 3T8RA 4OINF 1IRFA 5HLGA 3IKTA 1DP7P 4U7DA 4IPAA 3IC7A 3VODA 1R1UA 3J80Z 1BIBA 5ICEA 1G3WA 4L9NA 2W84A 4ENKA 4CDGA 3CI6A 4ME4A 4HOBA 3HCYA 3TDZC 3F72A 2HTJA 3DKWA 1OKRA 5K5QA 1YO5C 3EDPA
chains in the Genus database with same CATH superfamily
3ULQB 3SWFA 3GXOA 1VQKI 1MBHA 1WYBA 5HDKA 1S4XA 2DBBA 5CVVA 3IX8A 5L3EA 1H89C 2W27A 2R9XA 3IF6C 2BXZA 3R4YA 2V6EA 1X9VA 4JXGA 3BFEA 1JTDA 3AE8C 1YLFA 1K4FA 3FMQA 3PBQA 1K6OA 1NXYA 1BI3A 3FXMA 2HDUA 4GCZA 3T4QA 1GA9A 1JUSA 2FMYA 4Q48A 3MAJA 1SC7A 4A0XA 4AVZA 1DY6A 1ERQA 3U1AA 5M3MJ 3CCMI 1RZ4A 2ACJA 4GB7A 1VQ4I 3E6BA 2CFXA 5FQ9A 3H3ZA 1NTKK 1J1DB 3SH9A 1SHVA 1XMAA 2XAQA 1LEBA 3L7WA 2P1JA 1SS1A 1DIPA 1BSGA 1IXCA 1Y4OA 3CQZJ 2CQ7A 2E7WA 2ITAA 5IYDJ 1BT5A 1FMWA 2F4IA 1DU6A 2N1TB 3CWBJ 1SFUA 1KZUB 3TOBA 5HS8A 4L9GA 3RTYA 4R8HA 1T0FC 3FBIB 1CF7B 3CF5F 5EYRA 2OPTA 4WXCA 3A5TA 4KIFA 3V8KA 4U7JA 3MKWB 3G6EP 1U8RA 1W36C 2ZC4B 1RGZA 4OQHA 4KIGA 1BW6A 2VJ4A 4M4XA 3Q07A 3G32A 4WY4D 3PFIA 4YNRA 2O03A 2JT1A 3BVHA 2JN7A 1F5TA 1IC2A 1KILC 2AXTH 4QU3A 2OYOA 1M1JA 1EWZA 4G8XA 2ECBA 2O8KA 1EW0A 3SOIA 1UIXA 4AM3A 2C6YA 1Z3YA 5DFXA 2BCCE 1XTGB 2O6GE 2EH3A 3BECA 4UVCA 4IUHA 2CFOA 3B6AA 1IAWA 5HSQA 1YLZA 3U2AA 3CUOA 2KX6A 2EFWA 1LTSC 3RJPA 2R92J 4LGWA 2ZMFA 3JREA 1R7JA 2HPBA 2PX9A 1CSBA 1R1TA 4MDZA 3E1IA 1NO4A 5L07A 1LTBC 2P9VA 4X55A 1U0JA 2CMNA 4JYBA 2X6OA 1IZNB 5APQA 1IZ1A 2XKPA 2YXRB 3OYBA 1R6RA 4IFFA 4BJ5C 4XLPF 3E3VA 4ZJZA 3DTKA 2G7HA 3IF4A 2MW8A 2W25A 2RNJA 3F1NA 3EYYA 1K38A 1QZZA 3N4IA 4CLCD 3MQ0A 4XUZA 2HG5D 2K9YA 1SDNA 2M5AB 2MA3A 1MFZA 3FXRA 2MJZA 1RGYA 3TJZC 2QUFA 1E3OC 4KG5A 3O3KA 1ZHFA 2QMIA 3VMYA 1AFOA 3HPHA 1LJ2A 4Q47A 1MNEA 4NETA 3CDLA 2QM3A 4OIOF 2EV5A 3T12B 3DBRB 1BUEA 4CCOA 5CTMA 1XSDA 1N2DC 1ZGAA 3NIAA 3CZ6A 4BBUA 2M7BA 1R4MB 3GTCA 4EATA 3T4SA 1RIOH 1TT0A 1YTZT 3W3CA 3OYHA 4HJGH 1Z7UA 1I5ZA 1FC2C 3IWIA 4DZOA 1B6AA 5E43A 4Y13A 1G6NA 4NHJA 2M3BA 2AVXA 3C7VA 3A3DA 5FFXA 2HYGD 2E1OA 1I2WA 1N73B 5FEFA 3EGDC 3LIAA 2DMTA 1BGYJ 5DCFA 4I39A 4KT0J 2H8PD 3EUAA 4FCFA 4DOZA 3DAVA 4DZJA 1PV3A 1G4DA 3RCOA 2HXIA 1HXDA 1K9MQ 3UPNA 3M1EA 4OWRB 2FFDA 2ZMEC 3RYPA 1CEGA 2L0WA 3NOTC 1U7MA 4MHGA 1FBUA 2DO7A 3FXEA 1ETKA 1MKMA 3AAFA 2HVRA 1FYMA 3BR1A 4DDSA 4EJUA 2WPSA 3PTZA 2GA1A 5D4RA 3FXDA 2MD0A 4PJNA 2KKOA 3DBLB 3BJNA 3PJSK 4HV5A 3AG3H 4BBSJ 5CX7A 4A3IJ 4A3GJ 4B1RA 4DW6A 3OY9A 1QMEA 3DEUA 2WZZA 1JUMA 1YSPA 2DFIA 1QZYA 2N9BA 5AW6B 2KIQA 3ZN0A 5FKNA 3L75J 5KJ7A 1EZVE 2G2UA 3VOZA 3MN2A 1HUCA 2JVGA 3F23A 4AIKA 2LBFA 4CXFA 3V7RA 3CXHE 1H3QA 2AHQA 2D01A 1SQVG 2FE3A 4U7BA 3L74G 3L2WA 1USTA 1S9KD 4UB8H 5EOOA 1JKPC 2GZWA 3MFDA 3K7AJ 3G4SP 2M0BA 3EFFK 1PIOA 3OCLA 4P1WA 3KLNA 4G94A 2VQLA 3G6EI 1M7LA 2KB7P 3WUUA 3PBOA 3JAMK 4I7HA 3GF2A 3KYEA 2C9LY 4LLGF 1U7JA 1HLVA 4DNCA 5B1BH 1Q90D 1SD4A 2Z5IA 2MLGA 4Y4RA 4L75A 2JKTI 1BI1A 3D0SA 3FX0A 5ICGA 3B71A 4PM7A 2I72A 2GUVA 2FXOA 1W5SA 4E4HA 1ZYRF 3WG9A 4LLOB 2R5YB 4AD9A 2LXCB 3K9TA 2E5TA 4KIBA 5J8XA 1X79B 3OCNA 2AS5F 1L0NJ 1LVKA 3HUGB 5AIQA 1T0FA 2FBWC 1E5WA 3TSIA 2IBZI 3LY3A 3TOIA 5AJGA 3BFFA 4MMNA 2ZYAA 3FMRA 2QJ5A 1T18A 2BASA 5F1RA 5AIPA 5FATA 2J3TC 3HLBA 3M6BA 4E70A 5DYMA 3CC7I 2M0CA 3E6DA 1A6QA 2VBWA 1B72A 4XE5B 2O3FA 3ZG5A 1YS6A 2X01A 2FYNC 1D06A 2W1TB 1VQNI 3SS4A 1MWSA 2DNSA 2VC1A 4XFJA 2E76B 4HDVA 1S0WA 2ZJRF 4BXLA 1YLTA 5EFWA 1ERMA 3PLNA 2L9VA 5F04A 1FZGA 4CCLA 1XSVA 3H1HD 4M3BA 2PU2A 3HSEA 1QVGO 1DJAA 1RE4C 3EFGA 2EA4A 1ZELA 3UIAA 2EXBA 3A3YB 3Q5PA 1TTYA 2IA0A 1VF5C 3ESWB 3HHHA 3A0RA 2CK3H 5D6FA 4WX9A 3H9GA 5APUA 1L0DA 1FOSE 3PTEA 1IGNA 1J7KA 1Y56A 1VQ7I 2JSCA 4R4RA 4E7ZA 1W8QA 3P5JA 4L76A 2DRWA 5D5UB 2P58A 1J9MA 3DXJF 4HF2A 1R71A 4DYRA 3N8RA 1SQPE 4I7ZC 4QTRA 1KYOD 4AQRD 1NU1D 3H82B 5L10A 1G1JA 3PNTA 3VFHA 3D5RC 2R7WA 2E76D 1NU1J 1BM9A 3RPUA 2F6CA 5B1AH 3V7CA 4P9FA 1O3QA 3BG9A 1LB2A 1QRYA 3HREA 3K4MA 2BV6A 4S0HB 2KLIA 5B66H 5BU5A 4DE3A 1LSWA 2ZM0A 2V1AA 3COAC 5CHXA 3ERED 1ZR4A 1H8ZA 4DZPA 4Y3OA 1YHQI 3BFDA 2M8EA 5DCMB 2LSOA 3SFEC 1TS8A 1O57A 4DOJA 3OR1C 1QGKB 3DP7A 3UB9A 4HQMA 3RH8B 4ZTFA 1LUJB 2E19A 3IH4A 1LE8B 2QYOA 2ID6A 4IHSA 2GLOA 2OTJP 1YM1A 2POHA 2K85A 4JK1X 4HSTA 3IWQA 1T39A 3OYIA 1LP1B 4CYCB 4JGPA 1OISA 1ZRFA 4LV2A 4ZBEA 4ZNCA 2ZC2A 2BEOA 1E2XA 3T1QB 3EUKL 2ZMEB 5HLHA 2QEXI 3HRNA 4WZ5A 4XOPA 2NOJB 3W6JB 3IXHA 4BWIA 1UHSA 1ON1A 4P9UA 4RKUJ 2DT6A 5A2QK 4EESA 1HKTA 3CJRB 1D0YA 2QJKB 2KOIA 1GL2D 5DUKA 2P5LC 3BFGA 5FDSA 1ZN2A 3LICA 4EV4A 3G31A 2LH9A 1KU3A 3H1JJ 2ISYA 2IDBA 2KL4A 5J6XA 2ZOHA 4HG2A 2QKPA 4F94A 1FOFA 3SH8A 2LDUA 3HOSA 2E2IJ 1GV5A 2IBZD 4X53A 1NAFA 3DTMA 3HPGA 2Z16A 4ZDLA 2ZQCA 4BL2A 1S1CX 1NTZD 1KVMA 5FLMJ 1YRNA 4XN0A 1GW3A 3A02A 3PL8A 4FISA 2BW3A 2N1TA 1R5SA 3H35A 1OJGA 4NC7A 2HNHA 1LHYA 5F6AA 4EJTA 5FKKA 1Z56A 3UDIA 2RV8A 2CQQA 2YKQA 5EOEA 4CCJA 4BL3A 3TNUA 2EFXA 5EVID 1LT9C 1X19A 3A2AA 4M3DA 4I1LA 1G3YA 5AQ7A 1FDOA 5J47A 1FZEA 2K27A 1KYOH 3OYFA 2IEKA 2JRTA 2Y59A 5ILUA 3RYRA 1MC0A 4IJGA 4U3FE 2MC3A 4XBFA 4RAGA 2ZMVA 1XS9A 2LF7A 2M1CA 2HV1A 1NTCA 3M06A 2V9PA 2DTZA 3V4GA 4B3AA 3OPRA 2BHZA 1GSVA 3E4OA 2FNPA 3S7PA 2K2NA 1J59A 4FTXA 1N7SC 2IBDA 1FPQA 3H6PA 2ZOIA 1FOSF 1NWQA 4EGZA 2QSGX 3NWSA 5G4ZA 2IBZE 1U6GA 3MQQA 2YXQB 4KUMA 4ITVA 4PV1D 4R1GA 1NTKE 2H6CA 4RVAA 3P9IA 2K7LA 4X56A 4MTEA 4P6ZM 3MBZA 2DA5A 5FQJA 3M9BA 2VPRA 2MJ6A 4JF5A 3MUDA 3AE9C 2XPWA 3L75G 5TGTA 1ONGA 3KEOA 1IN8A 2I5UA 5KHDA 1WSUA 1PUFB 5D3OA 1VHMA 1JGGA 5APWA 2NAZA 1Z6FA 2Z5UA 4HB1A 4DJAA 4R0QA 3ICYA 2MH2A 1UWNX 2ZQ7A 4E3JA 2XPUA 2O01J 2XUBA 4KQDA 4IKFA 1JKRC 1VETA 3N4MA 3PFYA 2KRCA 3B3XA 5H2FE 1KQSO 2G8YA 2I1KA 3VP2A 3S2HJ 3I3LA 2OCCH 2DW4A 3HE4A 3KYQA 2ZVNB 3ITBA 2DA6A 4NDLA 4Y15A 2CUJA 2P4WA 1XB4A 5FL3A 2Y2HA 4XMYA 4IL6E 2QSIA 3WS5A 5LEJA 1YQAA 1FP1D 4UVAA 2VE9A 4RMNA 4FUWA 3M6HA 1Z77A 4R3JA 2YUSA 4EM1A 1LVAA 3F1NB 4BQAA 2FXPA 1DEBA 3RK2B 4II7A 3OC2A 2K7SA 2LB9A 3EQLF 5EG0A 1DD3A 2P8TA 2JRMA 4PDKA 1DH3A 4E7HA 1MMNA 3CWBG 1K4SA 1ONHA 4G6QA 5DTKA 3CESA 2NYXA 1XX2A 4L74A 3KO6A 2MG4A 1U8BA 4UUSA 3G2BA 4Y99B 2CQKA 1FX7A 2E43A 2Y79A 1LE8A 4PV1B 1AVYA 2DT7B 1KYZA 1L0NK 1CGPA 4M3GA 1D7EA 5CMZA 3CC4P 1NG7A 3KFWX 2QGUA 4W7ZA 3BZKA 2Q3IA 2M3EA 4LOCA 3V8JA 1HBWA 2LP0A 4LLLA 2Z2SB 2KIUA 1MMGA 3L71J 5GLDA 2QA4I 1MZBA 1MFTA 1IFPA 5AVZB 2Y2JA 3H1KJ 3W2ZA 5HAQA 2QQAA 3WE2A 2LR8A 1R1VA 3HD7C 4UAAA 4AIJA 4GODA 3E0JB 1SQBG 1VQOP 1L0EA 3BRTB 4LG0B 2IS6A 1F4KA 3ITAA 4BDYA 4DXCA 3S1NJ 3AEAC 3VN0A 4D6TE 3M9AA 4NXEA 3WHBA 1VQ5P 4MCWA 1FCOA 4E6WA 4JXSA 5D6EA 1GD2E 3G1MA 4OONA 3VE3A 4HHDA 3G35A 3MS6A 2ZJ2A 1T6SA 1QEXA 1WPKA 3FYZA 4LLNA 3LFVA 5BVZA 2PR5A 3LIEA 3LA2A 3CCJI 3V6IA 4OH0A 1VFCA 3OYKA 1FJKA 1U57A 3HRMA 4XT2A 3HL2A 1LSVA 3I55I 3S7QA 4GS9B 1SQVD 3ULFA 4Y17A 1IN6A 2NVXJ 4HDUA 2Q2EA 2WUQA 4HP9A 2P08A 2ZQAA 2K86A 3RPUD 1NHAA 4WEJA 2EX9A 1P84D 1G2HA 1YI2P 1RF1C 3SDBA 4JBAA 1YW9A 1X2MA 3GV9A 1ZLJA 5H2FC 3H1KE 3VPRA 3H9QA 3KIOA 2W90A 3L75D 3EGXC 1TF1A 5FQQA 4JX4A 1WJCA 1BDDA 3JRFA 1OCPA 4C3QA 2OGUA 1PGQA 5F1GA 3HKZN 2PAVP 3CXHD 1SP4A 4EXOA 4R4SA 4CA0A 3NTNA 3L1PA 4B09A 2Q0OA 1VPCA 3T4OA 2HDWA 3Q0WA 3VP0A 3KZIC 2M9HA 4A0YA 4M3FA 5KK1A 1JWVA 1SQBJ 1NTKG 1S4SA 2Z6CA 2QEXP 3MWMA 4IHYA 5B5EC 3C8VA 3C2BA 3FHZA 2K3PA 4CCMA 3ZHHA 1MZ9A 1G6AA 1SFCD 3E2KA 1RQUA 2N9YB 1YLWA 1P9RA 2FNAA 4OPYA 1ZQ3P 3ZQIA 5FRNA 2M8RA 2VOOA 5A91A 3VP4A 5FD6A 2HWVA 2JP3A 2XDMA 4IHWA 2O1JA 4BHCA 3I58A 4E3NA 1DP9A 5GHZA 2HDDA 1GA0A 2K9JB 4IJAA 1J1EC 5AW2B 2XF5A 2XD1A 3R0AA 2KDOA 5GAEJ 1KB9H 3A0HH 1L2PA 3O5YA 4BBRJ 3AGDA 2QKLB 1GSWA 4BQOA 3CCVP 2OLVA 2OYHB 1T1CA 4S2JA 2NZ2A 3F21A 1ZH5A 2LTPA 2PR6A 2VT2A 3BQYA 3LSHA 1K55A 2VUMJ 1Z6RA 2ZFWA 3X2QH 2O7OA 3JRAA 3TO7A 5E3OA 5GP9A 2CV1A 1KQ8A 1GW4A 1RR7A 1GMJA 2M1BA 4RO0A 1DQUA 3F1PA 4Z2YA 4PJ0C 1GXQA 4DYCA 5KTBA 2FSWA 5C44J 3A0BH 1L0LG 3IBRA 4PD4E 3OPLA 4UA9A 3V5MA 4DBRA 5LGNA 3L2CA 2XB0X 3Q9VA 4BUPA 4W7YA 1YIJP 5CVRA 5E17F 2IPPA 4OWFA 4CCNA 3CAXA 1JVJA 2DFEA 3B33A 3OAKA 1G3SA 2G7UA 4I99C 1SQXE 1J5YA 3Q0VA 3OL3A 1YS7A 3AFHA 4O7DA 1EJ9A 3C3WA 1N9NA 2E2HJ 1SQVK 3BLYA 3FK6A 3FX3A 3A2KA 1MKIA 1IEMA 1HWTC 4I0BA 4MN7A 5J1RA 4D7NA 1J1EB 4BJPA 3SWKA 4I98B 3G2ZA 3DQVC 4Q8IA 3BCCJ 1X2NA 3HLDA 1ZRDA 1LTJB 2WAFA 5ICCA 3UB5P 2L91A 2R7XA 1P84H 2K5CA 1BCCD 1EZVI 2N1TC 4M3EA 5CJ4A 1R8EA 2H7HA 2A3UA 4CPGA 1FJLA 5IT9Z 2R3SA 4F93B 1PI5A 2XU6A 1W2BO 1LTJA 1XD7A 1R23A 5E8GA 1VQPP 1MMSA 5AW3B 3GFJA 1MH4A 1YYCA 3K4LA 2WWWA 2JWDA 3MZEA 1TWFJ 1D1JA 5D5WB 1W2EA 1CK3A 2K3FA 4G6TB 3IBJA 3K10A 4W97A 3IH8A 4S2LA 1PPJD 3GTOJ 4P6BA 2LC2A 1RUOA 2VV8A 2HU9A 3OOPA 4DRTA 2FFFB 1FIAA 5K5GB 1YJWP 5KJ7D 3GMWA 4LB6B 3AEFC 2FQ4A 1TW2A 1NTME 3HTKB 1T3UA 4A3EJ 5FI2A 3M7GA 2WB1A 3HLWA 5TJJA 3O8ZA 3HXLA 2P7JA 4FH4A 4LB5A 1NK2P 2ZQDA 3SSUA 1AWCA 5A90A 3CP8A 3JVUA 3AGFA 1F5MA 2XC7A 1AKHB 3N6IA 1LTJC 3SZGA 4MN4C 2EWVA 4O8GA 3BTIA 1ZKJA 2A6HF 2EBIA 3S15J 2RL3A 1PGOA 1JY3O 2BOLA 2HVQA 4L9TA 2JR8A 4L73A 5JVGF 1ITYA 2Q2EB 1S5LX 2ZKZA 5CERA 3OOVA 1OR7C 4F91B 3MXQA 2HPMA 4DMZA 4JBZA 1ZG6A 2PYPA 4WUJA 1WI3A 3CCYA 1TDGA 3JW4A 4RB1A 1YJ9I 2VB6A 1X1AA 2GJ3A 1BGYD 3D71A 2D2CD 2BVLA 4WMCD 3IH9A 2QJPC 3GLXA 5FROA 1TLHB 3SW1A 3GTLJ 3OLOA 1BI0A 1R00A 4XNFA 4U0YA 4HX7A 2DJNA 4A6DA 4J19A 4ETXA 1A02J 1KN7A 2Y0CA 1K4EA 3EQVA 1LFUP 3RKXA 4GZBA 5FLXZ 3LA7A 5DDGA 4PAUA 2XNDH 2JUGA 1W5CC 4EBLA 5EF6A 1ES4A 1X3UA 5AVTB 5EEGA 2VC0A 2R4GA 1W7PA 2FKWB 4F3LA 4GIFA 2ZJ9A 1O3RA 4YFMA 3HBRA 1XJ6A 1E25A 4WVZA 3U1KA 2KT0A 1HTZA 2EFNA 2OZUA 2HXOA 4BEHB 4IL6X 4ZYDA 5CHUA 2AEMA 1ZC2A 3GFLA 5KMWA 1DDNA 2YKHA 4JYKA 3S3OA 1FSEA 3QP6A 2HP5A 3RK2C 3QP4A 4GKUA 1P84I 5AVUB 3CXHI 3HOYJ 1BZAA 1ULYA 5GTIE 2E71A 2CUEA 2A07F 2VKDA 3ONQA 2YKFA 3S8PA 5HLGA 1BLHA 4IPAA 1KB9I 1PZOA 2QPNA 2K9MA 2XDJA 1NG6A 2DN0A 1BIBA 3MZFA 4L9NA 2W84A 4ENKA 3CI6A 4ASVA 2B9SA 3DWZA 3HCYA 3TDZC 3PO3J 4DE0A 3DKWA 1YO5C 3EDPA 2LYCA 4Y99C 5FO5A 3VYUB 3G71I 4UV8A 1KILB 2HOEA 3HOZJ 3L71D 2M3AA 3GFMA 4IQJA 3PQKA 5IHVA 2H1LA 1EQ7A 4TT3H 3W6VA 2FZ0A 2OQRA 1SQVE 3ZDJA 3ZFZA 3ITKA 3L00A 2W7NA 3J80K 1CW5A 2FD5A 3H1KG 1HA8A 1K7AA 1W1WE 4UHUA 4C3HJ 5DF7A 5CVUA 1ZTUA 4IX7A 1H89A 2I1JA 1IC8A 1OXZA 3C8CA 3UB8A 3GZNB 1NH3A 2FY8A 3HE5B 1OX3A 4Y5FA 1T3JA 4P55A 3WS0A 4M3KA 2IWDA 3UO9A 3L36A 2PI0A 3KZIH 1IKGA 3HRTA 2RN0A 4D6TD 1AQTA 1U60A 5B5EH 1P84E 1OTAA 3O87A 2PP6A 1LP1A 4BYYA 3TRCA 1GK6A 1N9LA 3I7JA 5HS9A 4RGRA 1NTZJ 1YITP 1F98A 3M07A 3BG5A 1WYCA 1G5UA 3D1NI 1VQ9P 5IOZA 3L70E 2IS4A 3I9V2 1T2KD 3HKZA 2WPVB 4XKVA 1XDSA 3NY4A 2PFBA 5HZHA 1O7EA 1DPUA 2VJJA 2X1EA 2KHMA 3CJNA 1GXPA 4E3KA 1NYMA 4IL6C 3VOPA 4CLCB 1N78A 2A45G 2BHYA 1N8RQ 3JTGA 2WGWB 3CD6P 3S7OA 3TKYA 3J7YJ 2JPCA 3D5LA 3LSTA 3EQ2A 1S72P 2JHEA 3HTKA 3LQQA 4II3A 1SEUA 2XLNA 4UNOA 3I56P 1OCCH 2XASA 4PKYA 5D8KB 2L4RA 4S2PA 3LOCA 4I38A 4D1QA 3LNQA 4ETSA 4H0EA 3UPOA 5FI7A 3FMSA 3IHAA 3IRQA 2KXPB 5GTIC 2IS2A 5BMZA 3F1PB 1H8MA 2ZC7A 2ZM8A 2ME6A 2PAJA 1J1DC 2EFPA 3PBTA 1CI8A 4PGGA 1CJFA 1YQSA 2G9WA 1PGPA 1K0KA 1YMXA 5EGOA 1USEA 2HKOA 4BKXA 1S6RA 2Y2MA 3PIPF 3EYIA 5F64A 4H13D 3MKFA 1WJFA 1PPJE 3SZTA 2OYIA 2ESHA 3E1RA 3VP3A 3WU2E 4WXHA 1MIJA 2WKPA 4NPEA 1B8IA 2P7CB 4BY1J 4X1MA 2J5PA 2W57A 1ETWA 1WWXA 1FOWA 2Q8KA 1JKOC 9ANTA 3HUNA 5EVEA 1KQ9A 2PYRA 3F8CA 1A6IA 4E3MA 1WZ2A 2WSFJ 2E75B 4HA8A 1VQKP 1SQQG 4C9YA 1CI6B 3AL0C 2WA0A 3JTHA 1T33A 2D02A 2B95A 3MXSA 5IYBJ 2YSRA 1W5CE 4PCQA 5U47A 1B4AA 3CO7C 4PSWA 3DF8A 3GW6A 4B9OA 5EVIA 2VL8A 5AVSB 1NRJA 2IXSA 2N8GA 3BDDA 5LBQA 2HP9A 2Y55A 2VRSA 4U0XA 3K69A 1XX5A 1PRQA 5TGFA 4WWCA 3GZ5A 1JHHA 2Y2QA 4JP0A 3T1BA 3IWZA 3OPHA 2IVMA 2IWCA 5EM0A 2KNCA 3ZMUA 1MMAA 1LNQA 3LGOA 2ZD8A 1ZGJA 4KNYA 1NVOA 5FQKA 1HKQA 1K61A 3LFKA 1X0TA 3Q7VA 2A69F 5KAIE 3LYXA 3CCQP 4F55A 3E4QA 1HKSA 5LHIA 4C3IJ 4ZYGA 2Y0MA 4JF4A 3SHFA 1SQQE 5AW4B 4AU7A 4HBLA 2JQ7A 2JTVA 2WGVA 2BCCD 2KRFA 4PJ0E 1IDYA 3SS5A 4BD0A 3D72A 3UMDA 2WAQN 3HVFA 1T6AA 2L7ZA 4Q5SF 3HLGA 2P04A 4GHIB 3TW6A 3MKZA 3TGUE 1MWTA 4WXDA 4P5OA 1WJBA 3A01B 1SVOA 3RXWA 4G9YA 2KSJA 4DJGA 3KYCB 4R3AA 3DBAA 3M9HA 3CCRI 1XA1A 2FXMA 1L0NG 4LIVA 3LSIA 4W80A 1Z3XA 1OJLA 3L09A 3SH7A 2E75C 1LDKB 1MUUA 1XC5A 1TBXA 1Q2NA 2WB1N 4MLOA 1IFIA 3NAUA 4PD4I 1DP3A 5MC7A 2FA5A 1XKZA 4LK1F 4BHPA 3MP7B 2BLSA 3NFQA 1TS7A 2HYFA 1NTMD 1YAXA 3MF0A 3DFGA 5LRSA 1YSQA 4OVDA 4Y7NJ 2UXNA 2K3RA 3K1NA 4EM0B 2VGKA 3WODF 2ZYDA 1UZCA 4LJZF 1Q81Q 2PLYA 4QPRA 1MNDA 2WSEH 2NUPC 4IRIA 4IHTA 4OIQF 4BENA 5FJ8J 1H9GA 4BXFA 2XR0A 3VMAA 1H0TA 1JT6A 2V1XA 4BQNA 1BSHA 1SMTA 5HOOA 1FU1A 2E1CA 3IHUA 2P9VB 2AXLA 1A02F 2M45A 4ZTJA 2PT7A 2GQQA 3C2WA 3W4PA 3Q3SA 3BWGA 2VGLM 3H1KD 4GRIA 1UGUA 1HSTA 1TWAJ 1M1EB 3V2RA 3TGUD 1Y0NA 1IF1A 2KS1B 1SFOJ 3HLEA 2K4JA 1BR2A 1VI0A 4KHXA 1ACFA 1VQ8P 3V5BA 3L73E 3IXDA 1BTLA 1SQPD 5F0FA 5K7HA 4JQFA 3RIRA 2RH0A 3L9KA 1GHPA 5M3FJ 1RPWA 3H0GJ 2A06E 1DJBA 1UJ8A 3C4OA 4R4MA 3FC7A 1HVVA 2AXCA 3QYEA 1YMSA 2AXTC 3LIFA 5HW3A 2LF8A 3USSA 1L0LE 4LV1A 2X48A 3NJAA 2Y9ZA 5D5VB 2QIWA 2XAJA 2XA7M 4PZJA 2ZT9B 1MZUA 2L7FP 4C2MJ 4BQQA 1NU1K 4RQ9A 1IFNA 3ERMA 3L2UA 5F1JA 1IRGA 3AEDC 1OTIA 3IUOA 4JGRA 2XROA 3PHLA 2L54A 2XSSA 3BR5A 2RCXA 2E1MC 1CF7A 1JCDA 1HW5A 5DEQA 4RS8A 5E3NA 1KDSA 1O7FA 4D5FA 1XFQA 1KQLA 1JMBA 1WJDA 3OYMA 2JJ7A 5CRFA 1XGMA 4B93A 1KYOE 4R3BA 2FYUK 4AIHA 2PHYA 5HDSA 1Y54A 4XM3A 4BH9A 2DLLA 3JPUA 3V2QA 4DGWB 3LR3A 3MUDC 4HKZH 3Q0UA 3LSPA 2P2UA 1XN7A 1AA0A 2XHKA 2VIXA 1H0TB 2ADUA 1RE3A 4HV6A 2D1VA 2PG4A 2Y9YA 4EMSA 3EUHA 2FFYA 1M8OB 1UMQA 4Q0IA 3LL7A 3V3SA 3WRZA 3V39A 5AW7B 4XUXA 1IN4A 2CW8A 1KYWA 4FT8A 3FZCA 4ESFA 1LKXA 1QGPA 4ID4A 3RZOJ 2YMYA 3LR0A 4GD6A 1NKZB 2WZ7A 1MBKA 5G4YA 1MWRA 1VQLI 1KONA 1JY2N 1UIIA 4XKBA 3GTQJ 2IPQX 3P9KA 1X4PA 1WI9A 4YXDC 3GHGC 3KP5A 2Q1KA 5AW8B 1VL2A 1FIPA 1E79H 4H0LD 4HEFA 1YKDA 1SFXA 1NTZK 5EVLA 1XP4A 2KFDA 1K6RA 1IW7F 3CC4I 3I56I 1OTDA 4C46A 1X58A 4OGQC 2Z1DA 1X1DA 1NOHA 1N73C 2B9BA 1G2CB 2HJ9C 5EZHA 2VE8A 5J8CA 4QWOA 2P74A 3LSJA 3CDIA 3RFBA 2CPBA 1DPRA 3WTTC 3H5RA 4XRFA 1OW8A 1XDUA 4H44B 3LQRA 2CWEA 2FYZA 5F6FA 3RL0B 2KDZA 4YEJA 4Y0OA 3JC22 1WCMJ 4I6MC 1XG1A 5FSRA 4KDPA 3G30A 2ECCA 4HX8A 2X6YA 2VN2A 3PXPA 1R58A 4IEJA 3GRJA 5H20A 3MMHA 1S9KE 1LTIC 2XF3A 2TDXA 2Y4AA 2EX6A 3H1LD 2JPBA 2LK2A 3ROUA 4D5CA 3NBLA 3DTEA 1W5DA 4V2FA 1XGOA 1BE3E 2D5VA 2FF4A 5TRDA 3OYAA 3CMAP 4EUZA 3CPTA 5BU8B 1RKTA 2NUTC 4R79A 1XFNA 1S29A 2YR2A 5IT3A 2OV7A 1OTBA 3H7WB 1NLYA 5HARA 2WTYA 2DK8A 4FE7A 5DV5A 1PWGA 4HBTA 1BN5A 4MQVA 2NVQJ 1G8XA 3VP8A 3FHNA 3GVAA 2LR2A 3S4XA 1G59A 1N9OA 5GLCA 2VK3A 2DMWA 5TR7A 2QJYC 1MD0A 3L37A 3RSNA 1I5QA 1H88C 1GHCA 4S2OA 4U88A 3CZDA 3CPWO 4HLYA 5FASA 3I54A 1FQGA 4EV0A 1QVTA 2VONA 4E6XA 3BQ8A 1ZLLA 3PM1A 1V9ZA 1NHLA 1REPC 2EQRA 2RVCA 2MH9A 3KPHA 4BL0B 4EEPA 4U3FJ 1CQTA 2V79A 1MWUA 2JDIH 3B5NB 4ON0A 2OYIB 4HJ4A 2XKOA 4N6JA 5KLVJ 2EZLA 2V9AA 1TDLA 4B4CA 5CGSA 5D8LB 4A3MJ 3DPTA 1JTHB 3S2DJ 1GSXA 4BS9A 1FBQA 3BR2A 1UAAA 4WLAA 4DF6A 1V5GA 2WYXA 5K1YA 1SQXG 5M1AA 1D5VA 1FJPA 1CF0A 2B87B 5LLQA 2VKEA 2FQ3A 4C6YA 3DLLF 2I10A 3P8CD 5F27A 3S22A 1WRJA 3L9FA 3PQJA 3UE0A 1HD8A 3K4CA 1UFMA 3VMZA 3I64A 3JRGA 4UVBA 2W3DA 1VNDA 3V2NA 2GBYA 5BNGA 4L5JA 2STWA 1KGEA 4NB5A 2PJPA 1EA3A 4BRYB 1ZKGA 1PI4A 3S9OA 4G6DA 1GVJA 2F48A 2NS0A 1RH5B 3ZQ7A 1RRJA 5HD3A 3OMYA 4UUVA 1RUNA 2WAEA 3MEXA 2WPRA 2NNYA 3AE3C 2QA4P 1ES5A 3L73J 2Z9OA 4M6VA 3V4QA 1LDJA 3I4PA 5CCHA 1IO2A 4XLFA 1IELA 4G3VA 3MXRA 4AC0A 3QODA 4GKGA 2X85A 4WY4A 3BRMA 3GHGA 2EV0A 1O4XA 1DP8A 3KPEA 4YXWH 1HW2A 5BS6A 2JK3A 3KEYA 3N7NA 2O01N 3MFXA 3UN7A 2V1BA 1Z1DA 4TLFA 5HWWA 1W7PD 3QP5A 2DMUA 3VFFA 4HNVA 1Z7LA 3MD2A 4UB8E 4HYEA 4OOYA 3CMYA 2NVYJ 1JY3P 2EWNA 2QWWA 3VB2A 4ZZLA 3VP9A 1QO0D 1IRZA 4BD1A 3O6BB 2VQGA 2O8XA 5E79C 1AOYA 4GO1A 3CJMA 4U3FD 4JBFA 2GOXB 1RETA 2GA2A 5J1YA 5KJ7C 3WU0A 4XONA 3WE3A 1S5LE 1ZG3A 3H36A 2R7TA 1MSEC 2Y8HA 1BLCA 4QIWN 4MNUA 2HZ5A 3BCAA 4LK0F 4I0AA 1BJZA 1KMIZ 3H1LJ 2D45A 2ETHA 4IVNA 1GHMA 3BY6A 2EIMH 4XIDA 3LR4A 4LPZA 2HDQA 2XGEA 1FZCA 4O3MA 2KMUA 3DEEA 4ZDOA 4GDNA 3TEDA 5G18A 1TZLA 2Y31A 1ZARA 3B47A 3KYZA 1U9NA 3TGUJ 2Q7CA 4FE4A 5LFAA 2L4MA 3BJ6A 1L4AC 2KOGA 3S4RA 5AW1B 1OYWA 3LR5A 2E34A 3K4JA 3Q82A 3H9WA 3GEZA 3KSFA 4XLEA 3HJEA 2ZAEB 2MFZA 3OIOA 4HJ3A 2OTLI 5CPRB 3MZDA 1WHUA 2R32A 2XNXA 4F92B 1MSFC 2VKVA 4B43A 1M57D 5M1BA 4BLMA 4LRXC 1ZRTD 4FSFA 4ZKPA 4BQMA 4EERA 4S2MA 5BOXA 4D6TG 2JA2A 1P7IA 3O3VA 1C0WA 3D6ZA 3JCUC 4WZ5C 2ZT9D 1U5TB 1HZOA 1ESUA 5C4XJ 3PO2J 1R49A 1Z05A 2BG1A 3H9JA 1ODVA 4UY8I 3HOXJ 1SKFA 2XV5A 3M2KA 1NRFA 3H1LE 4RLFA 3KZZA 1K56A 3GMEA 2QQ8A 5DJTA 3QPHA 2E60A 2ZJPF 2DAOA 1HSJA 4O01A 2J5UA 2BE5F 4I3IA 4IOIH 1SVFA 2AXTE 1ZLKA 4QSHA 2CO5A 3A1YA 3H1HG 1AQ5A 2XVCA 3TYYA 4HNTA 1YBKA 4GFBA 1XXMA 3ZQFA 3QP8A 2VLAA 2R7DA 3T8TA 5AW9B 3JAMZ 3FXUA 2Y0SA 2ZB9A 2FX0A 5L8MA 1IOUA 4QLCU 2ZQ9A 3FPWA 3IRRA 1Q82Q 3BTLA 2XA7S 2Y0SN 4Z1MH 3VE4A 2W1OA 5TISC 2PN6A 2HQ5A 2HEOA 3TW7A 4BRYA 1T95A 5HFOA 3TF5A 1H88A 2IX7C 3DPUA 3E1SA 3L7HA 2YU9J 3WTXC 2OWHA 3W6KB 3LI8A 1A04A 1Y47A 2LFBA 1EZVD 5L8RJ 4BGDA 1VETB 1B8IB 3ECHA 1TS0A 5HNFA 2P5KA 1PP9J 1I6HJ 3LA3A 1PZPA 2B87A 2UXXA 2PRFA 1NTKJ 4II2A 2V20A 2B5RA 4EW7A 1KFNA 5EVIB 1G2CA 5AVWB 2GX5A 1Y0UA 4JX5A 4FH2A 3KP4A 1MBEA 4X0GA 4K0WA 4JF7A 4PK4A 1O3SA 1FR1A 3LCEA 5JVTA 1LL5A 3L72J 3NOPC 1S5LH 1TVFA 2RKLA 4B88A 3WTUC 1R22A 3L75E 5KLIB 4AUWA 2P7VB 2XIGA 1OCTC 4EIJA 5BQTA 5LD2C 4PPRA 5APYA 4ZH4F 3FXKA 4MFDA 4IF4A 3L70J 2E35A 4GGGA 4M3LA 4GXOA 1BW5A 5J3LA 2KIKA 3MGNA 1GCEA 2WSCJ 3BP8A 5E79E 4GDFA 4HQEA 2VJIA 1BC7C 3JCUE 3QNBA 1JKQC 5EJCA 3CWFA 5KLVE 1DX7A 4WY4C 2C9NY 1BR4A 1R5HA 4LV0A 4BJ6C 3J7ZI 1BOAA 3CHWP 1W0TA 3M3YJ 4P96A 4A5MA 4PUSA 1LPQA 4L5EA 2Q9NA 1YOVB 3H3UA 2CU7A 3L2RA 2YS9A 2JA6J 4YIIA 3A3FA 3DLAA 3ISPA 5E1XA 4XKWA 1W7FA 4LV3A 3HL9A 5J40A 5HPIA 2KZJA 4D2OA 1GVDA 3TBIA 1RF1A 3NWTA 3VFZA 2M5AA 1FDMA 4UEYA 2V1NA 4ZRRA 4XLHA 1GLNA 4NNJA 5K7FA 2HPIA 3MKEA 3L74E 3H1JE 1G28A 3KXDA 5KKZB 2J59M 1EH8A 5FB2A 1FLIA 1L3LA 4BDZA 3PYPA 5C4JJ 4KQRA 1LLBA 2K9NA 5HLTA 1QHGA 4PGHA 2LREA 1QVFO 2WITA 3Q7ZA 5DKKA 2FYUJ 1PNEA 1OQYA 4IFMA 1SANA 3D3OA 3GCMA 1MBGA 4MEZA 2IZ0A 3CX5H 4NUBA 3BR3A 2NRAC 2H09A 3CCMP 4PSXA 3KSHA 5BOHA 1N25A 1QNTA 3W67A 3E5XA 1KOUA 2WSEJ 4KQQA 1KB9E 4DXBA 3IH3A 1FOYA 1LT9B 3GTGJ 4HY8A 1WJEA 3CMMA 2YIUC 2K9JA 3GR2A 3NECA 2YKPA 3G6OA 2ZMEA 3WRTA 2XQZA 2FFDC 4RESB 3CDHA 3R7WB 1DJCA 3MR0A 3S1MJ 2HKXA 1OWAA 2A3SA 4IOAF 1D1CA 1NWZA 1VEUB 3OYDA 3RBZA 3ZGAB 5F83A 3K4KA 3SZPA 3N8SA 2OF7A 2XZRA 3N8LA 4GOGA 5CGWA 1KE3A 2OWJA 3R0JA 2HQNA 1LT9A 1USSA 2K88A 3QQAA 3K5BA 3GTJJ 2F5DA 4YFXF 2CW7A 2VZWA 2RC4A 1GTWA 3BJOA 4PHTA 1NYHA 3MCZA 2F5FA 3C7JA 1L4AA 1F2KA 2GXBA 4KJMA 1K4TA 3BTCA 3U21A 1PDNC 3ZG0A 3WGHA 4WZ4A 1FY7A 2XV4S 2OA4A 3GLLA 3CMEP 2V9VA 4M9ZA 4YELA 4OMYA 1MDMA 2XDVA 4EVIA 1JTGA 2WAQA 4GLQA 2DA2A 2A06D 2Z99A 3H25A 2KK7A 1JE8A 2FRHA 5TISE 5E18F 4ZJ3A 3BG6A 1URQB 1JWPA 4EQ1A 5EV0A 2KISA 1MGTA 4RX3A 1BE3G 2QJYB 2GDNA 5LRRA 5DFYA 3P32A 1LI9A 2DMPA 1NZUA 4S2KA 3MIWA 3AEBC 5IP6A 5JHUA 2A45I 1X0OA 2JA7J 2JVHA 1P4XA 5KLVG 1IXRC 2OV5A 1W7PB 2LKXA 3HB9A 3K3CA 3CCEI 5KAFH 2LNBA 1L2SA 3LUQA 3AEEC 3W2AA 3H5NA 1P4AA 4HX4A 2E8JA 1HJ0A 3T8RA 4X25A 1K05A 1PFLA 4YRVA 3AKZA 1NTMJ 3MQOA 3VODA 1R1UA 4BACA 3FXJA 5ICEA 2GM4A 2VGJA 4V19K 1JY2O 2UUZA 3F72A 2HTJA 5K5QA 2ZLYA 2E1NA 4PKYG 1ZRCA 5FGMA 4ESBA 2E42A 2VGLS 5FEGA 3BATA 1OFCX 3F1OA 4EUVA 4EGYA 1S3JA 1SFCB 1ZTRA 4E04A 3PBRA 3QHYA 4R23A 2ID3A 4BAYA 4U0WA 3F22A 4UB8C 4JKTA 4Y2FA 3M8FA 1ON2A 2ZNYA 5CXWA 4RBOA 2KZVA 4WMCA 3EUHC 4LENA 3EEAA 5L3BA 4E7KA 1T1BA 3HOWJ 1L0LK 3K3DA 5DD4A 1S9HA 3RQIA 2M5WA 1P0ZA 2KZIA 1OIPA 2M2EA 5HL6A 2CJJA 1K55C 3N05A 5GHXA 4LCMA 4HOIA 1OYIA 4A93J 1BCCE 3G3ZA 1HW1A 1N4OA 2X6XA 1V4RA 1AHDP 3M8JA 2LRDA 2HF6A 3DTIA 2O9LA 4ABZA 3CCLI 2IW5A 4ZC3A 3FXLA 2EA9A 3ZCOA 4I3AA 4LRZE 4KUKA 1TQIA 1TU3F 1QQIA 4CICA 2RMZA 2HODB 3I0TA 3H1JD 3TG9A 4YOFA 2UWXA 2VQHA 4B3XA 1Z09A 2ELKA 5AVYB 5DM6F 3V50A 1HTLC 4N78D 2L7KA 2IGNA 2I9VA 5JYOA 1YW7A 3E97A 2DYSH 1M1JC 4ZMDA 1SQQK 1P7JA 1SQBD 4UB6C 5HPFA 2STTA 2ZNZA 4RAFA 3S14J 2JEEA 3L72G 3W68A 2A45H 4MFEA 3HUSB 3H1JG 3IF6B 2JKFA 1JY3N 2W0NA 1DEEG 3KSGA 1IG7A 1ODDA 2HZDA 5ICFA 1Y8AA 3M2JA 4NG2A 2KNCB 2O61A 5M5XJ 5D4SA 2LBFB 4RGUA 3GVBA 1PL5A 5KAFE 2R5ZA 2HDSA 5F0HA 3FWEA 2MSYA 1EC5A 4IHXA 3F8BA 2BGCA 5TJHA 3IXBA 2NPSD 5AONA 2V4HA 3VSKA 3EPZA 1W36D 2EPFA 4G3WA 3VTPC 3ZG8B 3AE4C 1DGWY 5B66E 2H8RA 3ABKH 5CCHC 3CUEC 3K4BA 4MQ9F 2L5GB 3LO7A 2X71A 2CW0F 2YIUB 3C9IA 2WSFH 3MVPA 2RDPA 4BWNA 2FFDB 3BC8A 1HGZA 1IK7A 5GTHC 2ZXHA 2EFQA 1D8KA 5EE8A 1JCCA 4ZZDA 3HTUA 3H3VK 1SFCA 3UMEA 1TS6A 4DE1A 3QNCA 3HBLA 3QYBA 1RE3C 2L0KA 4IFDK 3FWLA 1TWCJ 2OQGA 3HUSC 4ENMA 2NPSB 3B02A 2WKEA 1VQ4P 3KEQA 4EM2A 3L74J 3GLMA 1LNWA 3OIQA 2RGVA 2KSEA 5J3WA 2H27A 2QRXA 4WL9A 5J4VA 4GNUA 3E0YA 2JBFA 1JJ8C 3UKGA 2Y91A 3H0DA 4KA4A 2O3JA 3JRCA 2QM8A 3C2GA 3RGUA 5EEAA 5HX9A 1QPMA 4PM5A 3CP2A 3M9QA 1FWZA 4MN5A 4CQHA 5C39A 1G6OA 2CPSA 1XMXA 4XLAA 2EJRA 3CC2P 4HNBA 2EWWA 4UB6E 1JOCA 2ZL1B 2J80A 3RTRA 2EFOA 4JYCA 2H0YA 2GIZA 2W3EA 3F8NA 1SFKA 1HOMA 1RF0A 4HEA2 3TGUG 4R38A 5FRMA 1JM0A 4JGOA 4WY4B 2VQCA 4H6JB 1ZGWA 1LTAC 5A2QZ 2BCCJ 1MBJA 3DPLC 5AQBA 4HSRA 3LFUA 5H2FH 5A8BA 3NC8A 2OTKE 1XMKA 2ZL1A 4NXFA 3Q5FA 2W85A 3JVVA 5FLXK 5ED4A 2E8IA 4IHQA 3H1LG 3O6QA 2R0QC 4HYTB 3FKWA 4QJGA 1USDA 3ZMZA 2W6AA 1MXOA 1L4AD 5DJUA 4YTPC 4I02A 2RKHA 1KORA 5LGTA 4DDYA 2XGNA 1FZPB 3WWXA 1XA7A 3CMEI 2L02A 2HP6A 3VMXA 3TOAA 4XXRA 1XPXA 4AYBN 4DJ2A 2J3TD 4WWIA 2NS8A 3H82A 4XT2B 2QENA 2O9BA 4KFCA 4RA7A 4M6YA 1UCRA 4R6LA 3H1IJ 2VA0A 2CQNA 4OOLA 4AYCA 1MBFA 2DYRH 3C5AA 5AQ9A 3L70G 3A0SA 2VOPA 3OYNA 1MW7A 3HE5A 2V7FA 1K78A 3CXHH 4KT6A 5FKMA 3OOUA 5AVQB 5FAQA 2O99A 2XSDC 5FQIA 4KISA 3DU6A 1X3ZB 4MEXF 4L9VA 2PDRA 3PBNA 4S04A 3QWLA 3T4KA 4K35A 5GL9A 1QVUA 1F9IA 3SWYA 4A6EA 3QPTA 1P97A 4N4NB 4QY5A 5EEHA 1K8AQ 1OW6A 3C1LA 3AGEA 2AQEA 1ZG5A 2PBYA 2EILH 2UWMA 3ZGKA 4ZYHA 1WE4A 1ALQA 3IX4A 2XKMA 3LEZA 1YJNI 2ZC5B 3K6GA 1LSXA 2R7SA 1IO4A 3IFMA 4XL9A 1HDDC 1PWDA 2DT5A 4EWFA 5E2GA 2M87A 1Q1VA 2EK5A 3G73A 2BYVE 1FDIA 3I59A 4N9LA 4HH2A 1JT0A 5ILVA 3S1RJ 3WTSC 5JR3A 2COMA 1LWUB 4HESA 2J9PA 2L2OA 3T4TA 3SFIA 1GV2A 1YE9A 3KSIA 1FAVA 3DW0A 1FR6A 1JTYA 3MJQA 2ZC3B 1QZEA 3HUOA 5HS7A 1IFMA 4HLXA 5KKZC 3PHYA 4YPCA 3T5XA 2ME0A 3LEQA 2X6WA 3I5UA 2WKIA 2K40A 4G12A 2Q1ZB 2EX8A 2B63J 2FYUE 4FCYA 5CQGA 1SQQD 2Q9MA 3OJAB 1K83J 3D5SC 2JA5J 2QF7A 1IKIA 2M7VA 2K9LA 1STZA 3BG7A 1XTCC 1K25A 1IUFA 1P9QC 2B18A 4KZ6A 1VQMP 2JJLA 4WCGA 1YIOA 2PBIA 4EEFG 2UV0E 1JMMA 4MGRA 1ONVA 4L0YB 1ZREA 1N73A 4YG2F 3HOTA 2X4HA 5ILSA 5EFWB 1PVEA 1BCCG 4ZKUA 5F1FA 5AVXB 4WELA 3AG2H 4C7RA 2QSFX 4BXXJ 2V2FF 4OLDA 4HAMA 2CV2A 4RAYA 1SCWA 3WTYC 2YX7A 1NYYA 5DUIA 1Z9CA 3FKJA 3ZQGA 4ARZB 1IYSA 3FWNA 4P87A 1T56A 1AU7A 4XN3A 1OZHA 3CPTB 4ASWA 1U5TA 5DM7F 4JPZB 4F3QA 5CHMA 3GECA 1ES2A 3AE6C 5FAPA 4ANJA 4BE1A 1A31A 1IFJA 3IAOA 5F82A 5M19A 4H13C 5KLIC 4D6TJ 3A0BC 1N77A 3OBFA 2IT0A 3RKWA 1VQ9I 1KTMA 2HPCA 3IT9A 1KU7A 3E5QA 3HDDA 3MZWB 5E20A 3HD7A 2FUG2 3QRFF 2KPMA 4UUTA 2X1DA 4KJZA 1KC8Q 3Q2YA 3B8EB 1GDTA 4E7IA 2M7UA 3CC2I 2C5WB 3ZP5A 1YQ4C 1KE4A 1NKNA 4QPQA 3UDXA 1PUEE 2CUFA 2ZXWH 1JHFA 3RL0D 3U59A 3BZCA 3UNWA 2HFED 4C2UA 1GT0C 2GWRA 2OZ6A 1H8YA 3FPVA 3RBXA 3O6QB 1Y39A 4B4ZA 2VBYA 2R78A 4ZJ1A 3ZDMA 1FZFA 3S3NA 2IFNA 4OLGA 5E3LA 4NC6A 3OL4A 1ZOYC 1Q2QA 2Z33A 3ELKA 5HWTA 3M0DC 3ZPLA 2ELHA 1GU5A 2FU4A 1JNUA 4H6JA 3VOYA 5M5WJ 1SMYF 3F8FA 3O86A 2HYJA 3WMM0 3RPQA 1JTXA 1UHWA 4ENJA 1PJRA 3DWLE 1OT6A 1ORKA 2H0TA 3TP0A 2QYBA 4IUKA 3PRJA 1E3UA 2K4BA 1D7MA 2XB5A 3T4LA 3OPPA 2QQBA 1HLUP 3RL0g 4ESJA 1K04A 3CC7P 5HL1A 3LW5H 1W63M 1OCRH 4WK8F 3LWFA 3V8LA 5APTA 1FCNA 2OJED 2V1DA 2VBZA 2ESNA 3W4QA 2WY7Q 3G2YA 5DD8A 1G68A 1NTZG 1NK3P 3KP3A 1D3YA 3C38A 5C5KA 4OP8A 4H44C 4DYQA 3S2WA 5B3SH 1NGMB 5L3FA 2QVOA 4GD8A 3ZN1A 5CYVA 1IFQA 3L73G 3CLOA 4CO8A 1V54H 4UA7A 4B86A 3WU1B 4GYGA 1ETYA 1ESIA 2Y2OA 1AA7A 2R44A 2JKVA 1JI8A 1PZQA 4K08A 2DDBA 1SFEA 2Y2LA 1YLPA 3RDIA 2W82A 2KJBA 5E2HA 2PMZA 1J0RA 3LAJA 4I2OA 2VKHA 1SDEA 4YFKF 4U3TA 4JLFA 1T8ZA 2E36A 1K54A 2DA1A 3FGAD 3ZMTA 2PRRA 4RDUA 3L71E 3A0BE 1SAUA 1Y1VJ 3FBNB 3AE5C 3U9GA 3RK3B 3P7KA 2A5WA 5KIZA 1SQXJ 1V9YA 1OMEA 1S7AA 2BEQD 5TBMB 3PUFA 2AQFA 2JWTA 5KAIC 3B42A 1D1AA 4E3OA 4OIPF 4KZ3A 1J9IA 1M1JB 4RGXA 4XRSG 3QOEA 2J9OA 3RJUA 1KGSA 4KG2A 4CH7A 5FI6A 4PJ0H 2IAIA 3FK7A 3H5AA 5KLVK 3GBGA 3ZQCA 4ZDXA 4ZYAA 1LWUC 2P6SA 3MMYB 4EYYQ 1KD1Q 5TBMA 2O9AA 4E6KG 3SFZA 4ZYEA 2QWSA 4GN2A 5LHGA 5HAPA 2WKHA 3NHQA 5E1WA 1AJYA 1SQBK 1TT5B 2HGVA 3OYEA 3U2RA 5I5LA 1L0NE 3IF5A 3CCLP 3QPSA 3Q1MA 2H94A 4Y3IA 1EF4A 1U78A 3OYGA 4OP5A 4EQQA 5A92A 5CCGD 5F0CA 2VX8A 3PP5A 2MBFA 5IYCJ 2A24B 4PM8A 5EG0B 4I7ZB 2DTRA 3O88A 2DU9A 1GZLA 3GMAA 4HP4A 5KAFC 4OQGA 1FILA 1N7SB 1LI0A 4U0TA 1PP8F 4ASNA 5GAHJ 5APVA 5IP7J 2GIVA 2DA4A 2PMHA 2SPZA 2DA3A 1M56D 1HCRA 3CCEP 1TQMA 2CGPA 1GL2C 3CTAA 3NXSA 1PP7U 3NARA 3S7NA 4Q4ZF 5IT5A 4A2UA 2HS5A 4YIFA 2WKQA 1OTEA 3D9YA 3LW5J 2ZO4A 4XA4A 1NLZA 2DFHA 2KIMA 3C7UA 2OUMA 3G34A 2KJCA 3PAEA 5FAOA 1WMKA 2V0WA 5E8IA 4FX0A 1EKEA 3TL4X 2NVTJ 3OYLA 1LTTC 1PYYA 4LRYC 2CG4A 5DF8A 5GTHE 3DV8A 3ZMSA 5GTIH 1FBSA 2WV0A 3F6OA 3REOA 2JE5A 3V7SA 1UWPX 1RE4A 2HPCB 1R5LA 3A01A 5L3CA 2KP6A 2C6WB 2AEFA 1NAYA 2IRFG 1YRNB 1ETXA 2OAP1 4H0LC 4WYYA 2E1MB 3TDKA 1V3FA 2WZXA 1WGXA 1S5LC 3VEPA 1QX8A 2QLZA 5AQAA 4M9XA 4I5SA 5EDNA 4OPRA 1O7LA 4EJOA 1EDJA 2VI6A 1SLQA 1POGA 1TP4A 3J7AY 2RQPA 5DJTB 2FYUD 2P81A 2Y0DA 1VF5B 1TD5A 1WFXA 5JFRA 2A6EF 1XPBA 1VQLP 1I2SA 3FM5A 3TO6A 2E5NA 3PAGA 2Y2IA 1AKHA 2A6TA 4XSXF 3CD6I 1IYQA 4B44A 4OU0A 3R4KA 4DBQA 2YNYA 5GPCA 2DQRA 1ZK8A 2L01A 2K37A 2DXIA 2IZ1A 4A3LJ 3T97B 2OYHC 3P8MC 4UV9A 2PU4A 1OCOH 3FV7A 2JA8J 2Y2PA 2LG4A 4BBTA 1FC3A 2P67A 3OW2O 1XCVA 3I4NJ 3BRVB 1QPIA 5K5OA 1BGYE 2GZAA 2HODA 2CH0A 5HWVA 2R5BA 1D0ZA 4OMZA 2B02A 3B4SA 1FZBA 3CCVI 3ZMDA 4DQ2A 1ZW0A 4L18B 4UXNA 4R4LA 4WN5A 3V4WA 5HLIA 3F1OB 1QA6A 1L0LJ 4MBHA 1ETOA 5KNLA 2EIKH 2R7VA 2G2WA 4QMAA 2RREA 2ZMAA 4HPQA 4DIQA 5EZGA 2O01H 2EINH 3E2LA 2WGIA 4A69C 3JRIA 2EZKA 3G1OA 4A3CJ 1C3BA 1IYPA 3OS2A 4U0VA 1EXIA 2DOFA 2NS7A 3WG7H 3HM5A 4A12A 1EZVG 3A3IA 3NRVA 3HIFA 3ABUA 2R7OA 2DMQA 2A06G 1I3QJ 2FBHA 1N75A 2ZXIA 3SS3A 3GDIA 4X1LA 2J3WA 4FQGA 4I76A 3RK2D 1I1SA 2M8GX 3IX3A 1YJNP 4FOFA 3B5ND 1X8YA 3PH0A 3E4PA 5EGOB 4QD4A 1KGFA 1FYKA 3T0YA 4BHBA 3P09A 3V67A 3GQZA 2LY9A 5CHJA 2OTJI 5EECA 3WGIA 1IRXA 5H6RA 3WU2C 3SQNA 2ZBKA 2Z3YA 3GSGA 2CRGA 3IHBA 1XTAA 2YU3A 1KA8A 3BW6A 2D2CC 4CYDA 2VXZA 1RR8C 1Z21A 1XJ3A 4HJ6A 4BBVA 1SQPJ 1LT1A 3OS0A 2ACGA 4FETA 3H1IE 3S1KA 3ZYTA 1ZR2A 3CCJP 2PGDA 3C18A 5J4EA 2WT7B 1RCJA 2W3FA 2MKVA 1BBYA 3SDGA 3V2PA 4JOMA 5E2FA 3K0LA 3U4LP 1HBXG 2O1KA 1RESA 1KYOI 4CLCA 1VF9A 4EJVA 1VQ5I 2H28A 1WH5A 3CWBE 4S2NC 1NZOA 1E17A 2XPVA 4I3JA 1SVLA 1JTHA 1PIXA 3G4SI 3N97A 3KETA 3AE1C 3C30A 1KFMA 1VQ7P 4LIUA 5CJ0A 2Q3EA 2M30A 4O6JA 1K78B 3TE8A 4UQIM 1BCCJ 3KDPB 2LLKA 2A68F 3L2QA 2XRLA 2FMLA 3CJTB 2F5CA 4G7ZF 5KVRA 2BY2A 1QU3A 2IJLA 2X02A 2E74C 3OR2C 1XJ4A 5CCGA 2OD5A 3GFIA 3E6MA 1OJ5A 1T19A 4JPMA 3O8GA 1YQ3C 5GTHH 3SEQA 5E79H 3VDXA 4DN0A 4FX4A 2BBYA 2LXBA 3GW2A 4L5IA 4AYBA 3OIPA 1S1YA 1HQCA 4N9HA 3GZ6A 1S67L 1A35A 3SFDC 1JGSA 4BNCA 2KYVA 4OPQA 5FFZA 4KG6A 2MD5A 1XGJA 1Y8QB 4DCKA 1S1ZA 1E3UD 5JLXA 4KZ7A 1VZ0A 1RC9A 3GF7A 3KYLA 3BY9A 3MZHA 1SD7A 2F5VA 4DE2A 3F6VA 1I1GA 3JSVC 3G71P 4NXGA 1T8IA 1FT9A 3CWBD 1Y1WJ 1S2EA 5DTTA 3BZ6A 1FMVA 1Y9BA 2ZXEB 3BASA 1JB0J 2XGXA 2W1TA 3FXQA 4PFOA 3F8MA 4J00A 1L4AB 4RB2C 2R5YA 2EZHA 1QL2A 1R5GA 2R7FA 2X9DA 2ICWG 4KZ8A 4GW9A 2W4SA 2G3AA 1PPJG 3VYIA 3ISGA 3CX5E 2Z5HA 3KHUA 4IHVA 3H1HE 1TW3A 4EBNA 1G1IA 2JKGA 3BPVA 4N92A 2QG4A 3C1DA 3LSGA 2MGQA 2Y0EA 2FYUG 2H5SA 2JC7A 3H1CA 3HTSB 5KZHA 2K02A 2ZCWA 1IV8A 2NRGA 1NTMK 2ZXJA 3AL0B 2AEJA 1RHZB 2KUBA 4AVPA 2V7QH 2HR3A 3B5NA 1X4OA 1JUPA 1B9MA 1WKMA 2Y2NA 2XF6A 4O0PA 1PUFA 2P6TA 1URQD 4CZCA 4EOTA 1VTNC 1BGYG 5CECA 1A5JA 1BULA 5L3DA 4OKPA 1T08B 1DP6A 2DCFA 4PD4D 1Z91A 4AIDA 3L4FA 4RB3C 2L9NA 3IAM2 1YIJI 4MBKA 3LAPA 4CGZA 3ZVTA 2XF7A 1HC8A 3CCSP 1MMDA 3RL0C 2GXGA 2MYSA 3LSKA 4YINA 2W83C 2ZSIB 2H89C 2XH9A 3WS2A 4D60A 3KQGA 4BE0A 2H88C 4PFPA 5HDDA 1E4DA 3E7KA 1GU4A 2ZSHB 2E74D 1X1BA 4EETB 1L0GA 4MTDA 2R7UA 1MJBA 4RJTA 4GDOA 5TISH 2M4GA 1ZHHB 4HF0A 2L7MP 4OINF 3BQAA 1IRFA 1DP7P 4H8RA 3II6A 3IP4B 3H7WA 2PD8A 4OAYA 1Y8RB 1BOBA 2LMDA 2DODA 1A36A 5AW0B 1K6SA 4OQ0A 3CCUP 2BW3B 5GAGJ 4ME4A 2DFFA 1OKRA 3A03A 4FD8A 5LHHA 5HAIA 3BT9A 3T97A 1T2KC 3HUGA 1IFDA 3HUSA 3T1SA 1J3WA 2LD5A 5TFQA 4C3JJ 2A61A 3WS4A 2Z4EA 4RYEA 3JYIA 1O3TA 5GLAA 3A0HE 1FOKA 1ES3A 4ESPA 2QHKA 1FZCB 3CITA 3QAHA 3E98A 2KZGA 3O2PE 3M8EA 2IGKA 2VXDA 5KCMA 4NEED 3QYFA 3OYJA 1VM1A 3GWZA 2OYHA 2P0WA 2R7ZJ 2IBZG 4W1UA 4ZDPA 1WRGA 1YX3A 4CLCE 2XAUA 2C0WA 1P2FA 1EDLA 1Q86Q 3MZ8A 5KLVD 4L9EA 2KLUA 4A5NA 1JUNA 1IV6A 4LITA 4YWZA 4CPKA 2IS1A 2VBXA 1YLYA 3F3XA 3J7AO 1TNTA 3BR0A 4FASD 1KILE 4C30A 1UB9A 2ELJA 5LGUA 1IXSB 4E3LA 2DOAA 2V8CA 2Z2MB 4D0PA 4AFIA 2IGOA 2BTFP 3LY4A 2WGWA 1HF0A 1RQVA 3TW8A 3MFKA 1K57A 3BWLA 1SKOB 1MNMC 2N1TD 4KN7X 1K56D 1RF0C 3BEBA 3UR3C 3UB6A 2WC2A 4U87A 2LKSA 2UWJE 1V5EA 3NDEA 3D4FA 3R61A 3I55P 1YX5A 2WBMA 5FQMA 3I71A 1SVMA 2JMWA 3FKVA 5F68A 1CZQA 1BL0A 4K0XA 2LB5A 2F4MB 5JI6A 4OH8B 5B5EE 3LIBA 1L0OC 3AECC 1URQA 2F4OB 1OR7A 2C0XA 5FDHA 1KZHA 4PV1C 2QKMB 1N86A 1OW7A 2Z2LB 1Z0XA 1E0EA 2CMPA 1SAXA 1OPXA 4QWQA 1R9TJ 5J4YA 4X68A 2E5ZA 4NPDA 3WU2H 3KP7A 5E3MA 2V26A 2JKRI 3BG3A 2ZVOB 3CCRP 1I27A 2A24A 1RNLA 1O07A 2Y75A 4HI4A 1ZXGA 3S1QJ 3FXOA 1MY8A 3NI9A 3CLQA 2EB7A 3OYCA 2HTSA 1LL9A 3ABVC 1HF9A 1PWCA 1FTZA 3OS1A 1EROA 5AVRB 1OT9A 1YJ9P 3VYRB 2D2WA 2QZ8A 2IA1A 4GOEA 2XD5A 3LIDA 2W6BA 1NU1G 2K9QA 3GO5A 4Z1WA 3MSHA 1AVOA 1Q1HA 4EEUA 2M0MA 2R3CA 3H92A 1XGIA 4YIRX 3ZCZA 3KX2A 2X1CA 2HGCA 1V55H 2P5VA 1W63Q 4WF0A 5EPHA 1Q7YQ 1VQNP 1X1PA 1FOXA 4P6ZS 3DEWA 3A0HC 4RLQA 3PUBA 3J81Z 3RKYA 1PYVA 2DPUA 4G7OF 1P6RA 1NTZE 1FS0E 2HZTA 4UUSB 5B66C 3IQAA 2GXAA 1MDMB 5KAIH 5GADJ 1K6YA 5DJUB 5HNHA 4CLCC 3GHGB 5DTSA 3CX5D 4C7NB 4Y0UA 5HD5A 5EVIC 4H4KC 5LBRA 1QMFA 5HDCA 4F52A 2IFMA 4IRGA 3K2NA 3FDYA 2NOGA 1X22A 2WSCH 5CEDA 1BJAA 3ZNYA 1LDDA 3BOQA 1MJ9A 2W48A 2JZYA 1D1BA 3K70C 1TC3C 2H1KA 3S16J 1AV1A 5J7EA 3C2HA 1ZRTE 1IN5A 2H10A 5GPAA 1W0UA 3VP1A 2OCEA 3DKXA 2ZM2A 3ZOBA 3KZYA 5CVIA 4KMUX 2IP2A 1XGSA 1URQC 1RI7A 5EM1A 4BEHA 3ZXSA 3TDUC 1CQAA 3M4OJ 2JO1A 2HQAA 3NDGA 4RM3A 2CSOA 1BLSA 3R7WA 5AVFA 3UNGC 1CI9A 2QJKC 5DF9A 2GOMA 1NH4A 4EQIA 4S2NA 3BCBA 3HSRA 4KT5C 3HJIA 1N9BA 2H6BA 3OSFA 3BR6A 2RAEA 1I3AA 2PFXA 2WKRA 4N9IA 1N7LA 1I50J 2QVAA 4NPFX 3HD7D 5KSCA 3NEUA 1ZG1A 3IF6A 2G0EA 3U1CA 3ZQLA 1KQFB 4M9SA 2Y30A 3K1MA 5IPAA 4N0BA 5CCGC 2JSPA 1DRMA 3EWKA 2WK0A 1EV7A 1FSYA 3FF5A 1D8JA 2PBDP 3C4PA 2W24A 3M0AA 3CG5A 2NPSC 1L0FA 3N7WA 5APSA 3WUVA 4Q0HA 4H0LB 4DJ3A 3KP6A 2XGCA 2V9KA 5ERIA 1H9TA 5CCHD 1D0XA 3ZMVA