1MKMA

Crystal structure of the thermotoga maritima iclr
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
246
structure length
246
Chain Sequence
MNTLKKAFEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKDKRYVPGYKLIEYGSFVLRRFNIRDIAHDHLVDIMKRTGETVHLILKDGFEGVYIDKVEGEQSIPMVSRLGMKVDLYSTASGKSILAFVPEKELKEYLKIVELKPKTPNTITNPRVLKRELEKIRKRGYAVDNEENEIGIMCVGVPIFDHNGYPVAGVSISGVARKFTEEKIEEYSDVLKEKAEEISRKLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Thermotoga maritima 0065, a member of the IclR transcriptional factor family.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
molecule keywords IclR transcriptional regulator
total genus 75
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
A PF09339 HTH_IclR IclR helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mkmA01
1.20.5.640 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1mkmA02
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1mkmA03
1OR7A 2MD5A 3S7OA 3V7SA 3KLOA 4KUMA 2YPRA 3H3UA 3VODA 4M9XA 5D6EA 5K5OA 2PN6A 4LMYA 1G4DA 4AD9A 3SXYA 1IAWA 3IKTA 5FLXK 4P9UA 2E1CA 4O0PA 1ZGJA 1R36A 3TGNA 4R1HA 3QAHA 2XKOA 2JZYA 2F2EA 3J81Z 4UVBA 3F23A 1DPRA 1IXCA 3KSIA 4EM2A 4NHJA 5LGUA 1I5ZA 4UVCA 1KU7A 1O7FA 4BH9A 2FA5A 2EJRA 3J80Z 4KDPA 3E6CC 3FXQA 3GFIA 5AIPA 2HGVA 3RJPA 3O3KA 4GYGA 1XGMA 2NYXA 2Z99A 4FHTA 3VV4A 4RB0A 2ADUA 2M87A 4YIFA 1GVJA 1BIBA 2P7VB 4WX9A 1BI3A 1BJAA 4Q4ZF 4Q47A 1O3QA 3PFIA 5HSQA 3D0SA 5DEQA 3I53A 4O5VA 2W3HA 3DBAA 1XGOA 5BQTA 2DO7A 3GW2A 2HZTA 4G3WA 4HV5A 1C0WA 5DDGA 3E6DA 4OIQF 4P96A 4JQFA 1TQMA 1Z6RA 1X3UA 1K6OA 5IT3A 2DTRA 3ML6A 1LQ1A 2AS5F 4MTEA 1P2FA 4N9IA 1S29A 4ZZDA 2V9VA 3LWFA 2EFNA 4Y5FA 4QWQA 4HF2A 2GA2A 1IN4A 4AWXB 1UHMA 1QZZA 3EDPA 2OZUA 2XSSA 1XSDA 2CSOA 5ICGA 5EEGA 3MF0A 2RNJA 1TNTA 5IT9Z 1OKRA 4R8HA 1BI2A 3SQNA 4MN7A 3O2PE 1J9IA 4RAYA 3H3ZA 2XGXA 3FMQA 1BI1A 1D8KA 1MDMA 1GXQA 5K5BA 4PGGA 1R22A 1MD0A 2XHKA 3RI4A 3EETA 1Q1HA 3FHZA 4HLXA 4ENJA 5LHHA 5IT9K 3FXRA 4D0PA 4B09A 2BEOA 2K27A 1O57A 2VT3A 3MEXA 4O8GA 1KYWA 4K2EA 4CDGA 4IRGA 4L9VA 1IW7F 4XSZF 1DDNA 4ETXA 3HRMA 1H9TA 1ZRCA 3KSGA 1Z9CA 1FSEA 2VONA 2V79A 2K86A 3KE2A 4LRXC 1RNLA 3V4GA 4G94A 3GEZA 4YOFA 3CI6A 3MFKA 1IRFA 5ILUA 4MGRA 1ZLKA 1GXPA 4EJVA 4GO1A 4IUKA 1W7PB 5LEJA 1KQ8A 2BBYA 3ZN1A 1R1TA 3H92A 1FBUA 4XRFA 3IRQA 1SD5A 3KSHA 3KETA 2ZFWA 4P55A 2W3EA 1LEBA 5K5RA 2EWNA 3LFKA 4P9FA 2QENA 2EA4A 1K7AA 2OZ6A 1USSA 5FB2A 5HS7A 4A5NA 3E5QA 3HCYA 3WTZA 2UWMA 2F5EA 3T8TA 1OPCA 3BJOA 2XUBA 2IA2A 3RIRA 4I02A 5D6FA 1Z05A 4G3VA 4I0AA 2DW4A 2MBFA 3KP4A 4YFXF 1JXSA 1UFMA 3BPVA 1ODDA 1A04A 2ZBKA 1PUEE 1XGNA 5HDGA 1LB2A 4LRZE 3ECHA 3NHQA 1EH6A 3BJ6A 4XLNF 3K9TA 4RAZA 2V1XA 1SFUA 3HTSB 1IN7A 2QQ9A 3RKXA 3IRRA 3D3OA 3W6JB 3ZQ5A 5D5XB 5DCMA 4IJGA 4EUVA 3I64A 3HOSA 1T6SA 1QO0D 2DPUA 3HRSA 4H0EA 4AIHA 3KP3A 1O7LA 4EGZA 3E3VA 5K1YA 2ZCWA 5CYVA 3ZMTA 4LLLA 2A07F 2G7HA 2XAFA 3RYRA 3O6BB 2MLGA 2HKOA 1CF7B 2STTA 1XN7A 1R1VA 1I6XA 2RQPA 5L8MA 2V1DA 5I5LA 2DK8A 2QLZA 1HKQA 2JTVA 1TTYA 4M6YA 1ZH5A 1D3YA 4KA4A 2VC0A 4LGWA 4EMSA 2HS5A 3ZN0A 4KIFA 4MEYF 4M9SA 5JI6A 1BC7C 5H6RA 1NHAA 1W5SA 1HSTA 3AAFA 2FNPA 3KZZA 3KSFA 1RUNA 4CGZA 5DUIA 1QBJA 2L4MA 5HS9A 3OOVA 2A68F 4MQ9F 4DNCA 3GXOA 3WTWC 3G73A 1ZRFA 3TOAA 5JFRA 1QNTA 2HDCA 3LFVA 3EEAA 1XGSA 2D1VA 4OINF 1LDKB 3G6OA 3J80K 2P7CB 3CTAA 2P5LC 2FQ3A 1YLFA 3S2WA 1YIOA 3CDHA 3JTGA 4E04A 4Z1WA 4R70A 4BXUA 2P6SA 3ABUA 2RKHA 4OIRF 1U5TA 2QWWA 1MGTA 2VXZA 5J8FA 3I59A 4Z2YA 1S6LA 1TQPA 1EH7A 1YO5C 4RQ9A 2W1TB 1HW2A 5CVUA 4ZYHA 3K1PA 1YKDA 2PMHA 1ZAOA 4U0VA 2QZ8A 1JE8A 4A5MA 2DI3A 1HQCA 3CUQA 5LHGA 1J2XA 2OA4A 1R5GA 4EM0B 3ELKA 3I5UA 1USTA 3EQLF 2UXNA 3GZ5A 4Y17A 2M5WA 4I0BA 2KIUA 2BE5F 1Y0UA 1W7PA 1S7OA 3I59B 2H27A 1Z6TA 3I0TA 2OQGA 4ZYDA 3P9CA 4UXNA 2RVCA 2KJCA 4N0BA 1XD7A 2EA2A 4CYDA 2LSOA 5HPFA 3BJAA 5KK1A 1SD4A 4KNYA 4EJWA 2FMYA 3KP5A 5A2QZ 1G3TA 2QYBA 3R0JA 3I58A 2MLKA 3I71A 3CO7C 1ZG5A 1O3RA 1I27A 6PAXA 1S8NA 2G9WA 1XMAA 2KRFA 2RV8A 4NQWA 2CG4A 2DAOA 4KMUX 3IWZA 4WXCA 4HOBA 5DV5A 3TQNA 2M7VA 3FXUA 3ZMVA 1B4AA 1HKTA 4L18B 4LK0F 3K2ZA 3ZQ7A 3ZMZA 2ISZA 2VKSA 1H0MA 5BOXA 1Z91A 4AVPA 3OBFA 2RN7A 1ZG3A 3IBRA 4ZZLA 2EV0A 1DPUA 2FBIA 5HOOA 3K0LA 4GLQA 2GWRA 2P8TA 1T38A 4OIPF 5AONA 1UCRA 1XCVA 3Q9SA 2GA1A 2COMA 1MDMB 2OQRA 4I09A 4RGXA 3CUQC 4MMNA 1HKSA 4IHTA 3DXJF 4Q5SF 2LB5A 3LA3A 4OMZA 3BY6A 2O3FA 4HA8A 2FSWA 3FMSA 2GZWA 3QPHA 4RB3C 3RTRA 5HVQC 3ABTA 2E1NA 4L9TA 1F4KA 2J5OA 3OOPA 2P5KA 3V7RA 5HLHA 1D5VA 4EGYA 2A3SA 3PQKA 1U6GA 1YW7A 1XCBA 1OMIA 1UB9A 2ISYA 3ZPLA 1TW3A 2GXGA 3IKVA 1U5TB 3GX4X 1XSXA 5LRSA 2CYYA 4Y15A 3RPQA 3R0AA 3MAJA 2EFPA 2O9AA 2DPDA 4G7OF 4ENMA 1MJBA 2O0YA 5L3GA 3F8NA 2PEXA 2LF8A 2Y48A 5FFZA 3C2WA 2B0LA 1SD7A 2FNAA 4KICA 4RGUA 3G3ZA 5HDKA 4QPRA 2KOIA 3K1NA 4N9HA 3NOPC 3J81K 2VBZA 3S7PA 1G3WA 4FX0A 3B02A 4IUHA 1LDDA 4BWIA 3L9FA 2NS0A 2HFHA 1WQ2A 2RGVA 5E1ZB 4KN7X 5ERIA 2KJBA 4WK8F 3LQRA 3O5YA 2XKPA 1W7PD 4RB2C 1F5MA 3R4KA 1R7JA 3GO5A 4GGGA 3W6KB 1J59A 2F5CA 4TV7A 2ZMFA 2M7UA 3BROA 3R60A 1G6NA 2Z5UA 1QPMA 4UNOA 2HGCA 2L01A 5FLXZ 2DQRA 5C5KA 2VOPA 5DUKA 2HOEA 1IXRC 5E17F 3WU0A 4PZJA 2IRFG 4PAUA 3KP2A 2W24A 4ETZA 2YSRA 4LB5A 3F21A 2W3FA 2IA0A 2JPBA 4P5OA 4LG0A 1Z7UA 3L2CA 5E8IA 3F8FA 3SFZA 2D45A 5E1XA 2Z3YA 3NRVA 4DMZA 3N4MA 3NOUC 4M72A 3WU1B 3CLOA 1OYIA 3SZTA 2Q2EA 5LGNA 1QZYA 2YX7A 2Y8HA 1EH8A 3JAMZ 4OIOF 1ZGAA 1OYYA 1TW2A 1P4WA 3DF8A 3SZPA 2TDXA 2W1RA 3GLXA 3MMHA 4FX4A 3LA7A 3DFGA 3E5UA 4EJOA 1R1UA 5DFYA 2GAUA 2XASA 2X4HA 2BGCA 5H6QA 3OV8A 1HBXG 2XVCA 5D5WB 4HQMA 5BMZA 2R3SA 3VFZA 5D8LB 3F72A 5LGTA 1J0RA 2JSCA 3T0YA 2OD5A 2WTEA 4G3KA 4OMYA 1KQ0A 4Q48A 3WGGA 3M7GA 4EQQA 5TRDA 1GHCA 1MKMA 1R23A 2Q0OA 2E7WA 1U2WA 3K2NA 5D4SA 3F8MA 2XV4S 1LEAA 3COAC 2ELHA 2CQKA 2FRHA 4A0ZA 2YR2A 2A6EF 1BC8C 2H6CA 1CGPA 1XDUA 4MHGA 1FYLA 2PG4A 3E6MA 2EFOA 5ICEA 3L09A 3LAPA 1QGPA 1IF1A 1HW1A 2DT5A 1P4XA 3P7NA 4A2UA 2NNYA 2R7DA 1FNNA 3KEQA 1KU9A 1ON2A 2HYGD 3ERED 5FO5A 3IWFA 5CVRA 3RDIA 2E7XA 4L9NA 3RKYA 4KIGA 3BOQA 3C18A 4KFCA 2MH9A 1XMKA 3FWEA 1ZTUA 5CVJA 4WF2A 3J7AO 3B73A 1T0FA 4L5IA 4LB6B 4HV6A 1ZLJA 3JSPA 3KO6A 3ECOA 1LDJA 1T2KA 5HLGA 2FU4A 4Y3IA 5ED4A 3CJNA 2OU2A 2XIGA 4LRYC 1ZARA 2AXLA 3GFLA 3GFJA 1HW5A 4HZFA 3E5XA 1SD6A 3ISPA 1FT9A 2XAHA 2H6BA 1RI7A 4U7BA 5DCFA 1ONVA 5LHIA 4LJZF 2K31A 5BS6A 2EV5A 4HBLA 2Y75A 2XROA 1IN8A 2HYFA 3R4YA 3PQJA 1SFXA 3TRCA 4NB5A 4L0YB 4L0ZB 3V8KA 5HS8A 4RGRA 3KFWX 3EYYA 1KU2A 2X0LA 1R5HA 3CUQB 4HF0A 4ASNA 1G3SA 2VBWA 2G7UA 4G6QA 4EV0A 3T1BA 3U9GA 4CQHA 5L3DA 1B9NA 4M9ZA 5ICCA 3GF2A 5DD4A 3DV8A 2OAZA 4YFKF 2HR3A 3F22A 3C1DA 3NQOA 5HL6A 1IN6A 1TD5A 1FYMA 2W3GA 4CZZA 4M6XA 2P4WA 1H9GA 5FD5A 1DP7P 3TOBA 5J6XA 3HRTA 4WXDA 2DBBA 1RZ4A 1ZREA 2FF4A 4IJAA 1IN5A 2KKOA 1WSUA 3QP6A 1XB4A 3MWMA 1U3EM 3BDDA 1DUXC 2VODA 2B18A 2W84A 5LRRA 2DLLA 3S7NA 3WTXC 2O9CA 4BYYA 3F6VA 1I1SA 3FX3A 4A0YA 4G6DA 3WE2A 4LLGF 1MJ9A 3HIFA 4ZH4F 3M9AA 1B6AA 5L3FA 1K78B 2EB7A 2VC1A 4IPAA 3MZYA 2ZNZA 1D8JA 1E17A 3KEOA 1ZYRF 4YIIA 4E70A 2ACJA 3F8CA 3ZMUA 1B1BA 3HHGA 3D5LA 1OYWA 4BHCA 5ICFA 5LEKA 3DKWA 2CGPA 2HKXA 3MQ0A 5AJGA 1YW9A 2Q8KA 4O3MA 2ESHA 3WTTC 2ZMEB 4UVAA 5D5VB 4YG2F 3ULQB 2ZNYA 4CXFA 1AOYA 1VHMA 3F6OA 1REPC 1WKMA 4BNCA 1FBSA 3E6BA 3NEUA 4HX8A 3GZ6A 3HYIA 3FM5A 5E18F 2DFIA 4RGSA 2QBYB 1JGSA 2MA3A 1MZBA 2IP2A 1ZG1A 1RIOH 4M73A 2EFQA 4HW0A 3KCCA 3FZVA 2Y0MA 4AIJA 2V6CA 3TO9A 4ON0A 3IC7A 3MZHA 4IXAA 3RYPA 1YQAA 4MCWA 1SAXA 2K4JA 2JPCA 3LAJA 2JT1A 1S3JA 3I4PA 3VEPA 2GXBA 2M45A 1U78A 1K79A 2W3DA 1ULYA 2LKPA 4U7DA 2L3DA 2QYOA 5AIQA 5HLIA 3TO6A 3KLNA 1FBQA 3E0YA 4L5JA 1U5TC 2NRAC 1JHFA 2LNBA 1J5YA 3V8JA 2P6TA 4GXOA 1J75A 2GX5A 5CVIA 1FYKA 2O61A 4G7HF 3K69A 2IW5A 2BV6A 3KP7A 3JSOA 2K2NA 4ESJA 1T39A 4UUVA 2QVOA 3T8RA 5A2QK 2EV6A 3HTUA 2ZO4A 5E1WA 1YSPA 1R00A 2ZJ2A 5CJ9A 2NAZA 5E20A 2PMUA 5LBRA 4EJUA 1WI9A 1KGSA 3CO6C 1K78A 5H20A 4S04A 2IVMA 2L02A 4A0XA 2ZXJA 1G3YA 1YTYA 1KU3A 1FX7A 4BHPA 2FOKA 5EEHA 4ESFA 2KIFA 4RS8A 2K02A 2PBIA 4WWCA 1B9MA 1O3TA 3JTHA 3WG9A 4BQAA 3ZMDA 2VJWA 5J8CA 4JK1X 5HPIA 2K4BA 2F5FA 1P4AA 4U88A 2F5DA 4HDUA 4MQVA 4ETSA 4Q0JA 4M71A 3QRFF 3DQVC 2FBKA 3IBJA 3QU3A 3WTSC 5L3BA 3WTUC 3GYHX 4PGHA 1YYVA 4UV8A 3K1MA 1MJAA 2W85A 2K7LA 3M1EA 5F6FA 2YU3A 3FMRA 4YNRA 3KZYA 2CFXA 3HOTA 4DQ2A 4ME4A 4KT5C 1F5TA 1FP2A 2W57A 1YG2A 2FMLA 1LVAA 3QP5A 3RKWA 3ROUA 3CITA 3GVAA 3TKYA 1FWZA 1W4MA 2W1TA 4GW9A 2FE3A 2DQLA 2M8EA 4I01A 1TF1A 1BM9A 1BOAA 2PI0A 1FSHA 3F3XA 5ILSA 1BI0A 2VN2A 4M74A 2R7FA 3CUOA 4ESBA 2XAQA 2J5PA 4CO8A 4OU0A 4G8XA 3NOTC 2HQRA 5JHUA 4S05A 4Y13A 5F64A 3WE3A 5JR3A 4Q0HA 3HHHA 4IRIA 2ESNA 3Q5FA 1SFEA 3P9IA 4LLNA 1XDSA 2ETHA 2OBPA 2ZMEA 4WCGA 1J7KA 2KIMA 5E8GA 4A12A 5KVRA 1V4RA 4BAYA 1FP1D 2HQNA 2V1UA 3WGIA 2KLIA 1WWXA 5D5UB 4KN4X 4DN0A 2PLYA 3R6SA 4PDKA 1IRGA 1EV7A 3REOA 1VTNC 1FPQA 2GQQA 5TJJA 2BYVE 2Z33A 4G7ZF 4HX4A 3ZMSA 2DK5A 1WRJA 5CLSA 2QUFA 3GUDA 2LDUA 1ZHFA 5FGMA 5DCMB 2HTJA 4XLPF 1YFHA 4LK1F 5D8KB 1UHWA 2VOOA 1HXDA 2XRNA 2D1HA 2VBYA 4XBFA 1F9NA 3BPXA 4KYWA 5FD6A 1BBYA 1O3SA 2LB9A 1P6RA 2QM3A 3DEUA 2IPQX 3DPLC 2GIVA 1L0OC 2MH2A 4FOFA 4L9JA 4MDZA 3WTVC 4KMFA 2VZWA 4RB1A 1E2XA 4UHTA 1LNWA 4R6LA 3SHFA 4IHSA 3Q9VA 4CHUA 2VT2A 3WTYC 1TLHB 3TDUC 3TDZC 2CO5A 1FC3A 1L3LA 4I2OA 2A69F 4HDVA 3LSTA 1KA8A 1ZRDA 2O03A 2VE8A 3DP7A 3FF5A 2A61A 4HQEA 3M8EA 4XSXF 4CICA 1PP7U 3HSEA 5LLQA 2FXAA 1SMYF 1P92A 3JAMK 4A6EA 2VEAA 2IA1A 2WWYA 2O99A 3TO7A 5FFXA 2D2WA 3VOEA 3EUHA 3IL2A 3BJNA 4UV9A 1TQIA 1TBXA 4ENKA 4PCQA 2M1BA 1FY7A 1AWCA 5HDNA 4U0YA 5DD8A 4EM1A 4I7HA 2C6YA 5DYMA 1XSVA 5ILVA 2JRTA 3E98A 1U8RA 1RUOA 4R79A 1IUYA 1KQ9A 2FBHA 1B59A 1QQIA 3IHUA 4QLCU 2HTSA 2YX4A 1CF7A 4LD5A 3FM3A 3V8LA 1I1GA 2QQBA 3R61A 1S7AA 5L3EA 5DFXA 2PQ8A 2STWA 3QPTA 3T5XA 1ZN2A 2VE9A 4LG0B 3ZP5A 2Z9OA 4Y2FA 2NNNA 1BIAA 1STZA 1MC0A 2A6HF 4HLYA 2L4AA 1T98A 1KYZA 3U2RA 1FLIA 3WODF 4EVIA 3C7JA 2HWVA 3BZ6A 2DU9A 5BPDA 3GWZA 3KP6A 1IXSB 3V7CA 4YFNF 2LF7A 2WV0A 4AIKA 3S7QA 1JHHA 3W2ZA 2P5VA 3WGHA 1Z1DA 4EJTA 3I54A 4B8XA 1R58A 1IZ1A 4IRHA 4MEXF 3HUGA 2O9BA 1ON1A 1FZPB 2CW0F 2UXXA 5F1RA 2HEOA 3BWGA 3GFMA 2QQAA 3L00A 4F7ZA 4MNUA 3JW4A 3RPUA 3C3WA 1HSJA 1LJ9A 3QOPA 3M8FA 3HSFA 2ZKZA 4IVNA 2OOLA 4HYEA 4U0WA 2FEZA 3HSRA 4O01A 2IJLA 4KIBA 2H94A 2QBYA 4HAMA 3L7WA 1FOKA 2IT0A 2H09A 2XAJA 2PFBA 4HX7A 2VBXA 1YS6A 2RDPA 4IF4A 4BHBA 2M30A 2Y79A 4FT8A 2PJPA 2L54A 3DPTA 2A5YB 3HRUA 3E97A 5L3CA 1YSQA 4ENNA 4G9YA 1YW8A 4ZYEA 4OOIA 4MTDA 3F8BA 5LBQA 4JBAA 2UZKA 4GYIA 1YS7A 3RFBA 5CVVA 2XAGA 3EYIA 3LQQA 2W25A 4I98B 5K5QA 5BPIA 4ZRRA 2O8XA 1SMTA 5JVTA 2WC2A 4ZYGA 4A6DA 2RC4A 4EU0A 4Q0IA 3N97A 3MCZA 2CWEA 3VB2A 1TNSA 2EK5A 5D4RA 4LFUA 1V3FA 3BP8A 3U1DA 3LA2A 4WXHA 4HF1A 2MC3A 2EFWA 1PDNC 2O6GE 1PP8F 1BN5A 4O6JA 1F1ZA 4GCVA 3P9KA 1W5TA 3QU6A
chains in the Genus database with same CATH superfamily
3FKVA 1OR7A 4ZC3A 3LR3A 4A3DJ 5FKNA 3VODA 3H6PA 1LSVA 2XV5A 5FKKA 2YMKA 4F3QA 3N7WA 2EZIA 1NJ4A 4BGDA 2R4GA 4AD9A 3M06A 3K4NA 3SXYA 3L71J 3IKTA 1G1JA 4P9UA 1WCMJ 1XJ2A 1ZGJA 1R36A 3TGNA 3AEGC 4R1HA 3QAHA 2JZYA 2AXTC 4UVBA 1DPRA 3GMAA 3FXKA 5LGUA 2C9LY 4UVCA 1KU7A 1O7FA 4JQ0D 2OLVA 1HZOA 4NNJA 1DJAA 5GAHJ 4U3FG 2KX6A 2Z4EA 1ORKA 4GRIA 1XGMA 2Z99A 4FHTA 4MBFA 3F1OB 3VV4A 4RB0A 2ZLYA 1L4AB 2P7VB 4WX9A 1SVMA 1L0ND 3SOIA 1BGYD 3MKEA 2HVSA 1CK3A 5FQKA 2HP5A 1FR1A 2X1EA 3PIPF 2Y2ZA 3D0SA 3I53A 3OIPA 2ELKA 4LC1A 3DBAA 5APVA 1KOUA 3FKWA 1C0WA 2K88A 5DDGA 1BGYJ 3VMYA 4M6VA 4JQFA 1BCCE 3GG2A 4XR6A 2HXOA 1TQMA 1K6OA 5IT3A 2JC7A 3AE6C 1LQ1A 5IP9J 5U47A 4U7JA 5FASA 1L0LG 4N9IA 4L9FA 1PGOA 2Z6CA 2JKRM 4HF2A 3G9RA 5GADJ 1GMJA 5JYOA 2R7TA 1QZZA 2Z5IA 3AE8C 2L5GB 4J01A 1LFBA 1OT6A 1XSDA 4DCKA 4Y7PA 5EEGA 2CW7A 3GTPJ 3ZFZA 1X19A 5IT9Z 1CI6A 1GLNA 1W36D 4RAYA 3L35A 2IBZG 2OGUA 3FMQA 1R6RA 3NMDA 2R78A 4NETA 1GXQA 3P32A 3JRDA 1MD0A 2XHKA 4HLXA 4B44A 2VV6A 2B9SA 3TGUE 1ACFA 4M3KA 3BASA 4B09A 3MKZA 2CPBA 2BEOA 2W00A 1O57A 2QJKB 1E3PA 1KQLA 1WPKA 3HRMA 1LI0A 2TRTA 2XLNA 4NXEA 1FJLA 3KSGA 3HL9A 4DGWB 2PR5A 5EGOA 3A01A 4LRXC 2G0EA 4A3MJ 4BBTA 2FJ1A 2M8RA 2RREA 1XPBA 3CX5D 5ILUA 2QSGX 2K3PA 4DXBA 2DMTA 2KL4A 4KQRA 3NULA 1LE8A 3I56P 3U2AA 3TEDA 2DYSH 2O1JA 1FBUA 1L2SA 3AKZA 3L2VA 4P9FA 2EA4A 1WH5A 3A0BC 3OYGA 1DP9A 4F92B 3LSKA 3Q2YA 4DJGA 3P5JA 2F5EA 1G1IA 2FYZA 2ECBA 2DJIA 1G59A 4I02A 2AEMA 1Z05A 2W6AA 1YIJP 2KISA 3MVPA 2DW4A 2MBFA 3GR2A 4C7NB 3CUEA 3QQAA 3NTNA 3SEQA 3U4LP 5KMWA 5IOYA 3JSVC 1IO2A 3DKYA 4H0LC 1WH7A 1PUEE 5AQ7A 5HDGA 1NRJA 1X9VA 3ECHA 2R3CA 1PP9D 2ME6A 1M57D 2V1XA 1SFUA 1FE6A 2QQ9A 3RKXA 3IRRA 3CCSP 4L73A 3OL3A 5D5XB 3HBLA 5DCMA 2HV1A 1LVKA 4IJGA 3M0DC 2HVRA 1LT1A 4D9JA 2RKLA 1T6SA 1PP9J 1W1WE 1YJ9I 3L36A 1JNMA 4AIHA 3L2RA 4EGZA 3E3VA 5K1YA 4H6JA 2DMQA 1YLPA 2V8FA 3UE0A 3S1QJ 3O6BB 5AVVB 4M3DA 4HP9A 3UMDA 3H1KG 1LP1B 2Y0SN 2RQPA 3J7YJ 5KAFC 1Y39A 1HKQA 1MBKA 1ZH5A 3WHCA 2VC0A 4LGWA 4KIFA 3A3IA 4LENA 2E74B 4MEYF 4M9SA 3G31A 5JI6A 2ZB9A 2WPRA 3KZZA 3P8CE 3KSFA 3DU6A 1YE9A 3GF7A 1QBJA 2L4MA 3BR2A 5EZHA 4DNCA 1SQPK 1RC9A 1OMEA 2VQGA 1RGZA 3TP3A 3TOAA 4G12A 5JFRA 3E1RA 3G1MA 1XGSA 2GUSA 3KDPB 3CCJP 1FZGA 4YWZA 2WB1A 1PUFA 1LDKB 2HYNA 3G6OA 2P7CB 3GQZA 1L0EA 1YJWI 2XSJC 2C0WA 5M1BA 1SQBE 2LG4A 3VMXA 3T1XA 3FXDA 2I8DA 4BXUA 1D0XA 2E5ZA 1QX8A 3OAKA 4OIRF 1OCRH 2QWWA 2K3FA 5J8FA 3Q7ZA 1S6LA 1YO5C 3TGUG 3L74G 2HODB 2W1TB 2XC7A 3F1PA 4GDNA 2P10A 4U0VA 5BU5A 3QYFA 1ETWA 1JUMA 1R5GA 1QVFO 4DYCA 3HG9A 4NKPA 2M0CA 3ABKH 5HNFA 5JYPA 2ZSHB 1KFNA 2ZQCA 5FL3A 3I59B 3PBNA 5GAEJ 5J1UA 2CPSA 2IX7C 2RVCA 1IFDA 2KJCA 1XD7A 2E76C 4CYDA 1JKPC 2WPQA 4FH2A 3Q07A 1NAYA 4PV1D 4TT3H 3P8MC 2QYBA 2M34A 4ZDXA 3I71A 3CO7C 4KT0J 1VQ4P 4HEA2 2ID3A 3ZDMA 3M2KA 2DAOA 4WXCA 3LW5J 2DFFA 5EJCA 3FXUA 1O07A 2B87B 3M6BA 1KB9D 3ZMZA 2ISZA 1VDFA 2VKSA 1H0MA 1USEA 1Z91A 3OBFA 3SZGA 4PUSA 3IBRA 3V2NA 4GLQA 4BL2A 4I39A 1GDTA 1NLYA 1KORA 2X01A 1XCVA 3OY9A 5EZGA 3OYDA 5KLVJ 1OJ5A 3LY4A 1MWRA 4OAZA 4I09A 4MMNA 3UDFA 1DQUA 3U1CA 4IHTA 4Q5SF 1AU7A 5B5EE 2ZOIA 3F5HA 3LA3A 1V9YA 2KOGA 3JRGA 3K4LA 2A6TA 2R7QA 4RB3C 2KS1B 2QSIA 3C4PA 1LT9B 1F4KA 2J5OA 3OOPA 3BLSA 2P5KA 2XFSA 3EUHC 4ARZA 5K5GB 1U6GA 5DJTB 1UB9A 1Q90D 2CUZA 1GCEA 4PJMA 1M1JA 4MBHA 3IKVA 2WGVA 2GLOA 1PP9E 3K7AJ 5FAOA 4HBTA 3M3YJ 2E75D 4DOZA 4GFBA 2O9AA 5FKMA 4HSRA 4G7OF 5C39A 1Q2NA 1ZRTD 4I3IA 2KXPB 1ZV8A 1ZLLA 3H1HG 3IAS2 1VQ8I 4RGUA 3A2KA 5HDKA 2KOIA 2VBZA 2E1OA 2OTJP 1L0LK 1LDDA 2LTPA 1QPIA 3L9FA 2O5RA 1K4SA 3KYZA 4BMWA 4KN7X 5GHYA 3JRHA 1RF1B 1W7PD 1D7EA 2EH3A 1ZG6A 4ARZB 3CPTA 4BKXA 1H0TB 3IS2A 3CC2P 1G6NA 4PJJA 2Z5UA 2R7UA 2E75C 4XT2A 3OPPA 1S1CX 1X1DA 3C4OA 4XRSG 2HPMA 2ZJ9A 5FLXZ 3CX5E 5EE8A 5C5KA 5IHVA 3HPHA 1Z6FA 2DA7A 4IL6E 2PP6A 3UDXA 3HUNA 3K4CA 3KP2A 3TW8A 1BZAA 2VJ4A 3ZCZA 4KZBA 4LB5A 2W3FA 2IGKA 1FDIA 3I7JA 1H8ZA 3Q1FA 3F8FA 3L4FA 1SKOA 2BCCG 3C2HA 2JA5J 4YINA 5E2GA 4DMZA 1KGGA 4Y4RA 2FFFB 3WU1B 1KGFA 2NRGA 5HODA 1NTKG 3SZTA 5AW9B 5FRMA 4AFIA 3JAMZ 1RKTA 1ZTRA 3S4RA 3AGDA 3L72G 2QA4I 1BE3D 4OKPA 4PM6A 1K38A 4MFDA 2M9HA 1P4WA 2QF7A 3DF8A 3SZPA 5J4YA 1MH4A 4GODA 2W1RA 3HD7A 3H1JJ 4JGPA 3VE4A 1R1UA 2GAUA 2XASA 1SKFA 3CLQA 2QM8A 4WELA 5AQBA 3HTKA 4PSXA 5H6QA 3VYIA 1MNMC 3B4SA 4E6XA 2XVCA 1MSFC 1CI8A 3F72A 4DZJA 5LGTA 5IYBJ 2JSCA 1LNQA 2R93J 1SVOA 4A69C 3KYQA 1Q2PA 5TRDA 2RL3A 2WTYA 1K04A 2L7FP 3C8VA 4XFJA 3W67A 1NVOA 2OYHC 1BGYE 1FOWA 1RKWA 4PD4H 1OQYA 1R5LA 1EKEA 1UIXA 2CQKA 3B3XA 2M7BA 4XL9A 3A0RA 3K2AA 1A6QA 1BC8C 4IOAF 2WY7Q 3GTKJ 3C7UA 2Y69H 4E7KA 3PH0A 2FYNC 3W8KA 3ZR8X 2VRSA 3P7NA 1JUPA 2NNYA 3LNQA 2DA5A 2KP8A 1FNNA 5HDCA 3AE9C 1JT0A 4DYRA 1IDYA 1VQQA 4GDBA 4LIVA 1E79H 4UB6C 5EVEA 3EUKL 2IZ0A 1WT6A 3C18A 1LWUA 2MH9A 3OLOA 1XMKA 1IGNA 2BASA 1N9LA 5CVJA 4RA2A 1UZCA 2Y2MA 4A3LJ 1H88C 3GMEA 5GPAA 3BLYA 3ESWB 4XORA 1GHIA 1T0FA 3VFFA 4HV6A 4K35A 4W7YA 3JSPA 3KO6A 1E3UA 1VF5C 4OAYA 1JY2O 3CJNA 4OGQB 1VETB 5FLMJ 1ZARA 3H1LD 5EECA 2J59M 3GFLA 3GFJA 1GL2C 2XGNA 1LHYA 1SQBJ 4HZFA 1SQQG 1NU1K 5APTA 1XXMA 2YXQB 1SFCA 1FR6A 4EUZA 4R23A 3H7WA 4HBLA 2XROA 1IN8A 1NTMK 5EPHA 2V1NA 5B66C 1U8BA 1M56D 3R4YA 1PWDA 1ZHHB 3M1CA 1NZOA 2QJ5A 3TRCA 2R5YA 2L9VA 4EI2A 4MEZA 1N86A 1JI8A 4RAGA 1KU2A 2R7OA 1JJ6C 2KS1A 2J7VA 3LR4A 3SS5A 1FAVA 3G6EP 5CBNA 1B72B 3LUQA 3T12B 4EV0A 3U9GA 4M3EA 3HUGB 2D2CD 3GF2A 1L4AD 2OAZA 4YFKF 3J7ZI 1EC5A 4P6BA 1TD5A 1KGEA 4OP5A 2PAVP 1SQPD 4M6XA 1J2JB 4DDYA 4KHXA 4H0LD 1RZ4A 2FF4A 3Q1MA 2JJLA 3C38A 2KKOA 2XPWA 5JLWA 5LFAA 3PLNA 3QP6A 1E5WA 2KSJA 1IRZA 3K4MA 2QM7A 2Y91A 1XB4A 1AV1A 2B18A 3B8EB 1OCCH 2W84A 2O9CA 4C3QA 1I1SA 4A0YA 1GVDA 1BLPA 3IF5A 2MG4A 2FYUE 1IKGA 3HE4B 2M0BA 4HH2A 4YIIA 2FD5A 4E70A 3ZMUA 1TDLA 3VYSB 1GU4A 2LK2A 4ASVA 1F36A 1YX3A 2VLAA 5ICFA 1DD3A 1NG6A 3DKWA 3AEEC 2ESHA 3MD2A 2ZMEB 4IOCF 2CK3H 1BSHA 3LI8A 3H1IG 1K4TA 1RESA 4YELA 1VHMA 1REPC 1WKMA 1J3WA 4BNCA 2XU6A 5J3WA 2N1TA 2C6WB 3HYIA 5CCHA 4XK4A 4X6AJ 2EX6A 4RGSA 1JGSA 2M3EA 4A3KJ 1OCOH 1U9OA 4RVAA 4M73A 2EFQA 3G4SP 3M9BA 3E4OA 3S22A 1WYBA 4C30A 3MZHA 1SAXA 2K4JA 1SQVK 5GHZA 3LAJA 3HLCA 2OCEA 1MNEA 1JTGA 3F1NA 3B5NB 5EVIA 2EIMH 2EQRA 1KILE 1J9MA 4PSWA 4D60A 3G71P 3RQIA 5IP6A 2YKFA 2W3DA 2LKPA 1Z77A 2L3DA 2QYOA 2Y9ZA 5HLIA 3TP0A 1J09A 3KLNA 1FBQA 4D2OA 1NU1E 3PBRA 1XTAA 4D6TJ 3BTIA 4K0XA 3EQ2A 2PD7A 2GX5A 1SQQE 1FYKA 4G7HF 3K69A 2CJJA 1ZQ3P 1PWGA 2BV6A 5CQGA 4OQHA 4LG3A 2XR0A 3VSLA 3BTLA 3CD6I 2WKRA 4ESJA 3FXMA 3PUFA 1U0JA 2D02A 3PHLA 3OW2O 5E1WA 1YSPA 1NH3A 5E20A 3AGEA 3P7KA 4EJUA 1WI9A 1YLJA 3SEZA 1KD1Q 4RAFA 1W0TA 2W90A 2E2JJ 2J3TD 5H20A 2CMPA 1QL2A 2HG5D 1FSYA 3NAUA 3L73D 2P0WA 2MFZA 2IVMA 2X71A 2ZXJA 1LP1A 2M4GA 2J9OA 3PP5A 2WT7A 4E3JA 4IFMA 3H9JA 2K5CA 2KIFA 1I39A 3T4KA 3PJRA 4WEKA 1BR1A 3JTHA 3WG9A 2IAIA 2Y2LA 1NTZG 5F04A 1W2EA 4B47A 1CW5A 2K4BA 3WHBA 3BTCA 5CHMA 4U88A 3LEQA 4MQVA 5AW5B 3DCFA 4ETSA 2XK1A 2F6CA 4M71A 3WRTA 4C3IJ 3UPNA 4OLGA 2JEEA 1Y9BA 3QU3A 1MZUA 3U59A 1I3QJ 5L3BA 4PGHA 1ZKGA 1K56D 4UV8A 3K1MA 2BCCJ 2W85A 1EDLA 2K7LA 2KDKA 2PYPA 3LO7A 2CFXA 2CFOA 2Q1ZB 4NG2A 3CITA 3GVAA 3TKYA 2CU7A 1FWZA 2W1TA 1L4AA 1HF9A 1L4AC 5KAIC 4MLOA 2DQLA 2I10A 3HC7A 1XP4A 3FC7A 3WUTA 1JUSA 1TF1A 3S2DJ 1BM9A 1BOAA 3LR0A 1AWIA 2EXAA 3RL0B 2MD0A 1KB9E 1IO4A 3DTMA 3JPUA 1Q82Q 3CUOA 4E3LA 3Q81A 4G8XA 5GLCA 1YIJI 3WE3A 2IPPA 1V55H 4Q0HA 1XFNA 2DRWA 3HRNA 4AC0A 1SC7A 1MFTA 1LE8B 3A5TA 1EZVD 1JY3N 1N9OA 1SQVD 3P9IA 3T97A 2WB1N 2ETHA 4WCGA 1J7KA 1IEMA 3JREA 1KTMA 3SWYA 4A12A 1PJRA 4BAYA 1FP1D 5B66H 3ITBA 5F82A 2OYHB 1EF4A 3NJAA 4PDKA 3FBIB 3MSHA 1FPQA 2E8IA 2Z33A 2LKMA 2KRCA 1ZHFA 3ABVC 1QLED 2QJKC 1GSWA 2GUVA 3KYEA 3NDGA 3LICA 4KUKA 3L75D 4LK1F 4XA4A 3UN7A 2FYUK 3FBNB 1F9NA 2LR8A 4KYWA 3IHBA 5FD6A 2LB9A 2ID6A 3DEUA 3IXDA 2GIVA 1QGKB 1KZHA 1TWAJ 4KMFA 1ERDA 2O1KA 2VZWA 1LNWA 4IKFA 1BOBA 4R6LA 1KILA 3EPZA 3WTYC 4FE4A 1TLHB 2HODA 2CO5A 3V3RA 1XGJA 4FTXA 2HLOA 2HDRA 3IF6A 1KA8A 3UPPA 2VE8A 2UV0E 2A61A 2BXZA 3OZHA 1MY8A 2NUPC 3HL2A 1FQGA 5CJ4A 2VL8A 2EFUA 4WEJA 3HSEA 2FXAA 2JKTM 3BR6A 2YKQA 1X1CA 2IZ1A 3LL7A 2VEAA 1PUFB 4ITVA 2IA1A 3BT9A 4UA9A 1IG7A 3OMYA 3TO7A 4JYCA 3B5NC 2HPBA 3MXQA 5FFXA 2D2WA 1ETKA 3IL2A 1JKQC 2LOOA 3V2RA 2OJED 4UB6E 2H1LA 1FY7A 3CF5F 2NOJB 3CCJI 1AVYA 2X9DA 1RY3A 2O7OA 3HKZA 4QHCA 2JRTA 1OXZA 2Y30A 3CWBE 4UQIM 5E43A 2P81A 5A8BA 2PMZA 1FZFA 1KQ9A 4M3LA 4JPMA 2E75B 2HTSA 2BY1A 3FM3A 3VP3A 4KZ8A 3W2WA 4C3HJ 1IFNA 1I1GA 3FPWA 1KYOD 1S7AA 5HW3A 4GIFA 5L3EA 1IC2A 5DVAA 1K83J 3T5XA 2E8JA 2VE9A 1N75A 4WBAA 2Z9OA 4P6ZS 4Y2FA 2FFYA 2NNNA 2LFBA 2P9VB 1ALQA 3CCEI 2POHA 1KYZA 3CCQP 5DTKA 5CTMA 4AYBA 3K4BA 3OSFA 3FXOA 4OONA 3GWZA 3S7QA 2LF7A 1JHHA 3UB8A 1Z1DA 1WJBA 1FSWA 3NFQA 2K9JA 2F48A 1DP8A 3BR5A 2X1DA 2OYHA 2XKMA 2L1MA 3FYZA 2HEOA 3GFMA 2QQAA 4ZJ2A 4HJ3A 3CMAP 2KNCA 3C3WA 5E3LA 3WU2H 3CWFA 1KC8Q 2OOLA 1HDPA 4U0WA 2KP6A 2ZVOB 4OVDA 4KIBA 2H94A 3UIAA 1Y54A 3G30A 5DJUA 3CCMP 1HGVA 1OT9A 2C0XA 4BL3A 1YS6A 5B5EH 3MJQA 2RDPA 2Y79A 2HPCA 1GL2D 2ZXIA 2L54A 1CQTA 1L0LE 5F68A 3FISA 1UG2A 2HDWA 1HJBA 3PNVA 3L75E 5LBQA 4GYIA 3LCEA 2N1TC 5CVVA 3WS2A 2XAGA 3BG3A 2ZJQF 1K56A 2RMZA 2BW3B 5K5QA 4ZRRA 4X6TA 4JBFA 5GLBA 4IQ4A 4EU0A 4ZJZA 3N97A 3OYHA 1Q7YQ 2JVGA 4B88A 2CWEA 2F4MB 3WU2E 4I2LC 3BQZA 1TNSA 2EK5A 3I5CA 2M2EA 1A31A 3BP8A 4WXHA 4HF1A 1H5XA 2EFWA 1BN5A 1F1ZA 4GCVA 3G71I 4GT1A 3K5BA 3S15J 3A0BE 3V7SA 1Z56A 3KLOA 2E74C 2CQ7A 4M9XA 3VMAA 2AHQA 2JA2A 5K5OA 3PRJA 3CWBD 4LMYA 5EV0A 4CCNA 3SWFA 4EIJA 2KLUA 5CCGA 4E3IA 5FLXK 2XKOA 2LY9A 4EM2A 1YRNB 2IFMA 3QP2A 4BH9A 3CC2I 2FA5A 2N9YB 2EJRA 3J80Z 3RL0D 4EBLA 5B5EC 2Q9MA 3GFIA 5AIPA 4XRSA 3EGDC 4BD1A 3RJPA 2HFED 3O3KA 1HGZA 4V2FA 3VMZA 4H6JB 3JRIA 4KZ6A 1N77A 3IHAA 2L7ZA 1GVJA 3WU2C 1BI3A 1S2EA 1FZEA 3H9GA 1P7IA 2PRFA 1W36C 2KIQA 3CC4I 5M19A 5FRNA 1O3QA 3N6IA 5HSQA 2PAJA 2GIZA 4O5VA 5KLIB 2W3HA 3FPVA 4W7ZA 1K55C 2HDUA 2NVXJ 5HAIA 3H82B 2Y2HA 1VETA 4HV5A 2R9WA 3E6DA 1BR2A 3U1AA 2OV5A 4HESA 2XF5A 4CLCC 1SFCC 1Z6RA 1X3UA 1FDOA 2VPLA 3SH9A 4S2MA 2QSHX 4LLOB 2Y4AA 1P2FA 1S29A 3LWFA 1I2WA 1TDGA 2D2CB 4QWQA 1IN4A 3BYDA 2Q2EB 3JCUE 4OQ0A 1AVOA 4HBUA 3PNTA 4ZKPA 4OQIA 5AVRB 2E76D 3M9HA 4BJ6C 3O2PE 1NTMJ 2JKVA 1PWCA 4BDYA 5GTIE 3Q3DA 3H3ZA 1MNDA 1DIPA 1BI1A 3L2UA 2P67A 5CGSA 2DT7B 2LMDA 4DE2A 4PGGA 1R22A 3BQAA 4QPQA 1NU1J 3ITKA 2E5YA 1BLHA 5LHHA 5IT9K 4GB7A 2EA9A 1OJGA 1S5LE 3UB5P 1G8XA 4D0PA 4ZDPA 4B9OA 2V2FF 4CPKA 3MEXA 3VYUB 4O8GA 4IRGA 4L9VA 1IW7F 4FISA 3EQUA 4CYCB 3GTQJ 3UPOA 1ZRCA 2AQEA 4NPFX 1Z9CA 3P8CD 1EQ7A 3LSMA 3S2HJ 5DM6F 2Q9IA 3OYEA 1RNLA 2PJRA 2L91A 3HUSA 3BWLA 4JF5A 2IGMA 2R0QC 1M40A 4MGRA 1ZLKA 1GXPA 2OTJI 5APXA 4IFDK 4KZ4A 4EJVA 1W7PB 2LREA 2KMUA 1KQ8A 4NBQA 3CMEI 4B4CA 1SD5A 4TLFA 4K3AA 4D1QA 2ZFWA 3CZ6A 5K5RA 2EWNA 2QENA 5FSRA 1D06A 3PTZA 3IF4A 2F5VA 1GT0C 2J3TC 3M8JA 4N1XA 3H35A 4C46A 3T8TA 3BJOA 3ZQFA 2DDAA 1SQXG 2IA2A 1NG7A 3CQZJ 2J3WA 2HPIA 4G3VA 4I0AA 5EVIB 3KP4A 3NWTA 2ZYAA 3WUUA 1GW4A 2P74A 2M5AA 4LRZE 2G2UA 1VQOP 3NHQA 4C7RA 2GM4A 4RLQA 4RAZA 1NTCA 5F27A 3TNUA 4IVIA 2FYUD 3VYRB 3D3OA 3GTGJ 4LV3A 2X6WA 2H10A 3K4KA 3C8CA 2BZTA 1CQAA 4PK4A 3I64A 1Z7LA 2Y0EA 1LL8A 2FZ0A 4KZ5A 3KP3A 1Y1WJ 1BLSA 2ZCWA 2OC6A 5CYVA 1VFCA 3CP2A 2XAFA 3RYRA 2JMWA 5C4JJ 2STTA 3HLGA 1XN7A 3V50A 2PDRA 5L8MA 3A4CA 1TTYA 4LV0A 3G2BA 3NC8A 1BCCD 1DU0A 1Z09A 3C9IA 1BC7C 1W5SA 3AAFA 2L5QA 1L0NJ 2MABA 1RUNA 1TS0A 5F1GA 2LH9A 3WTWC 2ZVNB 1ZRFA 3GDIA 1JTYA 2HDCA 3G34A 3D70A 2D1VA 4OINF 3CCEP 4PJ0C 2PRRA 1PI4A 3AE1C 2P5LC 1VQLP 1YLFA 3S2WA 4E04A 2WGWA 1EDKA 4R70A 3ABUA 2RKHA 4C7NA 3A0VA 1U5TA 5EFWB 4L5EA 4LITA 5F0HA 3I59A 4I38A 3CJTB 4BS9A 5FQMA 1SVLA 1EH7A 3MR0A 3DLLF 3H5NA 4IO9F 4C3JJ 4ZJ1A 3H82A 2PMHA 2DI3A 1VF9A 1LT9A 4KQOA 2DOEA 4K0WA 5E2EA 1KV4A 2J8YA 5TR7A 4EM0B 1WJCA 1YAXA 3B71A 4EOTA 1USTA 3EQLF 2R5YB 5LD2C 2M5WA 4RMNA 1W7PA 5CQEA 1S7OA 4ZJ3A 2H27A 4BXFA 1URQA 2OQGA 3P9CA 1X8YA 4IOIH 4P1WA 3MZEA 4HOIA 2BY2A 2E71A 2WPSA 3AL0C 4KNYA 1BDDA 3TJZC 3MIWA 2DYRH 1N73A 1Y1VJ 1ERMA 3I58A 4A3CJ 3QWLA 1VPCA 1ZG5A 3RL0g 3FG8A 2G9WA 2XPUA 2KRFA 3FGAD 2GDNA 4M3GA 2RV8A 4NQWA 1MMAA 3MQOA 4I7ZC 2CG4A 3IWZA 1B4AA 4LK0F 2C9NY 5BOXA 1IFJA 3MZWB 4Y99C 4XKWA 2OLUA 5HOOA 3DBHB 3K0LA 2IYOA 5AW1B 4OPZA 2GWRA 3CJRB 5EG0B 4OIPF 1A02J 5AONA 5FQQA 3TNUB 4I3AA 3BRVB 1QMEA 2GA1A 2OQRA 1UELB 3CUQC 1HKSA 4WY4D 2LKXA 1BT5A 4O9BA 4OMZA 2O3FA 4HA8A 2FSWA 2GZWA 2ZJSE 3KYLA 3RTRA 4KISA 1IK9A 2ZJRF 2E43A 4ESPA 5DTSA 3KQGA 2E1NA 3QHYA 5HLHA 1D5VA 1JM0A 3H1JD 1BE3E 3L71E 1OMIA 5KAIH 2ISYA 1NY0A 5H2FE 3ZPLA 2A24B 1YM1A 2GXGA 1YQ4C 3P09A 1FMWA 1XSXA 5LRSA 2CRGA 2ZQ8A 4ASWA 5G4ZA 3HOXJ 4E7ZA 3W6VA 5GTHC 5EVIC 3TSGA 4ENMA 1MJBA 2XGEA 4KZ7A 2O0YA 2PEXA 2LF8A 2Y48A 2LLKA 3TYYA 2FYUG 1PI5A 1LTTC 1NTMD 2P1JA 1HDDC 2FNAA 4PM5A 3G3ZA 4PKYA 4QPRA 1G3WA 4I99C 1EDIA 4BWIA 4DJ3A 2NS0A 3NIAA 3USSA 3PBQA 5TFQA 4ZAMA 1S4RA 3CL3D 4DE1A 2CQNA 1SCWA 4WK8F 5DKKA 1YX5A 4IHYA 1GA9A 2KNCB 1F5MA 3IP4B 3Q0UA 4Y52J 4AYBN 4RM3A 3GO5A 5AVXB 1J59A 2F5CA 4TV7A 1LTJA 1D0YA 4CCMA 3R60A 1AKHA 3OCLA 4EEFG 4UNOA 4X0GA 1T33A 3K10A 1Q81Q 2XNDH 2L01A 4WBGA 2DQRA 1IK7A 2Y2JA 2HOEA 1IXRC 1VQ6I 1W7FA 2NZ2A 2Z16A 1NO4A 3F21A 3MUDA 5J1YA 3RK2C 3KPHA 3DTKA 2IA0A 3ZGKA 2JPBA 4LG0A 3L2CA 1VQ7I 4E7JA 3SFZA 4E3OA 3E1SA 2Z3YA 1T8IA 3N4MA 1NWZA 1R4NB 2LKSA 1W63Q 1ONGA 5F69A 1N73B 3CLOA 1OYIA 3SS3A 2Q2EA 4XN3A 1YT4A 5LGNA 1QZYA 3IH4A 2VKVA 2YX7A 2OAP1 4NXFA 1JUNA 4OIOF 5DTTA 4S2PA 2QEXP 2BW3A 2JWAA 2F4OB 3NDEA 1DEEG 1T2KD 3D72A 2VLGA 2OYIB 4B3AA 3HJIA 2WSFH 1A02F 4Y0UA 3LA7A 1GUUA 2JKFA 1I3AA 3QP1A 4UA6A 1MV8A 3ZVTA 1IELA 2JJ7A 4PHTA 5FEGA 4HQMA 3GVBA 2R3SA 1NGMB 3T4TA 1J0RA 3T0YA 1WI3A 2WTEA 2MKVA 3N8LA 4J19A 4OMYA 3ONQA 4XNFA 3JCUC 4N4NB 1XX2A 2H43A 2VV8A 1MW7A 2JA7J 2V9KA 3Q0VA 3OPRA 1MKMA 2DA3A 4DDSA 2Q0OA 2KI7B 5EM0A 1U2WA 3K2NA 3F8MA 1LT9C 1DU6A 1V9ZA 1BCCJ 1L0DA 5KAFE 2RQQA 3VP4A 1W8YA 2PU4A 1HCRA 2ELHA 2FRHA 4K91A 5DTDA 1TC3C 5FAQA 1OISA 4GD6A 2WAFA 1LTSC 4MN4C 2H6CA 3PO3J 3FK7A 1FYLA 3M2JA 3AE3C 4II3A 4WF0A 3E6MA 4AU7A 2EFOA 1X1BA 5ICEA 4GKUA 3L09A 2DOAA 1PGJA 1P4XA 4S2LA 1NK2P 3GLMA 1M6KA 3TBIA 1DJBA 4QD4A 3KEQA 3H1LE 2Q3EA 3S3NA 1DGWY 3CCMI 1ON2A 3ERED 4WL9A 3A3DA 1JGGA 2XFTA 1N8RQ 3RDIA 4L9NA 3OWTA 4OH8B 4PM9A 2EXBA 4KFCA 1YLYA 2ZMAA 4EERA 1D1CA 2HJ9C 3S1MJ 3CCVP 5HDDA 3QPSA 4WB4A 3B73A 4HH3A 4L5IA 1NYMA 2NVTJ 1ZLJA 2R32A 2VV7A 3ECOA 1VQPP 3BVHA 1ZW0A 4Y3IA 2OU2A 2XIGA 4CH7A 5FROA 3IXGA 4IEDA 2ZYGA 1HW5A 2DNSA 1GSVA 4EBNA 1FT9A 1FZAA 5F5YA 2ZC2A 1RI7A 4U7BA 2DODA 1ONVA 2QSFX 2R7WA 2BLSA 3TG9A 2E5TA 2Y0CA 3CP8A 2K31A 3KX0X 5BS6A 2EV5A 4JP0A 1YQ3C 1R5ID 3PQJA 2JSPA 1P84D 4ID4A 4L0ZB 4H44C 1MH3A 4I5SA 1BYWA 1ZN5A 3KFWX 4MN5A 3VYTB 2IDBA 2X0LA 2DXIA 4EYYQ 4HF0A 4BQQA 2OYIC 2VBWA 3LIAA 3O86A 2VUMJ 3HREA 4H8RA 5KZHA 3F1PB 4M9ZA 1SQVE 3DV8A 2H89C 3F22A 3AGFA 3NQOA 2E36A 4EATA 3S93A 1IN6A 2XQZA 2EZKA 2W3GA 2OUMA 1HWTC 2MJZA 2P4WA 1SDNA 5FD5A 1YJWP 1VEUB 2PR6A 3O87A 1OCTC 2WZXA 1P84E 2DMPA 4IJAA 1SZVA 3RGUA 1PVEA 2QRXA 1N25A 3MWMA 1U3EM 3M9QA 1DUXC 5FKLA 4UHUA 1YITP 4A3EJ 5LRRA 5EG0A 3F6VA 1W5DA 3FX3A 2OF7A 4ZH4F 2EWVA 5L3FA 2EB7A 2ZNZA 3KYCB 3QYEA 2LXCB 1KZUB 1ZKJA 2YMYA 2ACJA 2ZT9B 1BULA 2FQ4A 5HWTA 1HVBA 3HHGA 4FD8A 4XN0A 5CEBA 1BE3J 1KQGB 5LEKA 5CCHD 2IBZE 2HKXA 4NXBA 2Q8KA 4O3MA 5J4VA 5C44J 3WTTC 3MKLA 1PGQA 2JCHA 4IBXA 3OYAA 5D5VB 3CPTB 4YG2F 5IU1A 1ES4A 3OOUA 1NK3P 4JGOA 1S5LH 2WKPA 1IJWC 3FDYA 2EZHA 2CV1A 3NEUA 2NPSC 5EOEA 1ZOYC 3N4XA 2FKWB 5KLVE 3LGOA 3FM5A 1MWUA 2PFXA 2QBYB 2ZOHA 3SH7A 3JCUH 2E60A 1MZBA 2IP2A 1S7EA 1ZG1A 4AIDA 3DEEA 3L73E 4HW0A 1O4XA 2W6BA 4QWOA 3KCCA 1BW6A 2VA0A 5AVTB 2FFDC 2WMMA 3IC7A 1R5SA 4AQRD 1MBGA 1IRXA 2EPFA 4MLLA 1M7LA 3HM5A 1ZXGA 1TWFJ 1S3JA 3VEPA 2GXBA 1X3ZB 3BC8A 3GSGA 1QU3A 2WWWA 3NI9A 1ULYA 4P6ZM 4PM8A 4X25A 4U7DA 5AIQA 2QPNA 1MMNA 4N4OB 3KYDB 4L5JA 2NRAC 1OTAA 3MKWB 2P6TA 1WHUA 2CV0A 2QA4P 4OOMA 2O61A 1GHMA 1SP4A 2J80A 1T6AA 4ANJA 3JSOA 1MUUA 5B66E 1ZC2A 5F1JA 1MXOA 3RK3E 1SDEA 5E3OA 5FQ9A 4UUVA 4K08A 4E4HA 2ZO4A 2JHEA 1RF0A 2XF7A 2NAZA 3GRJA 3T1RA 5LBRA 1OR7C 1HLVA 2Y2GA 2PYRA 3CO6C 1QA6A 3KIOA 1FOXA 4S2KA 3W3CA 5M3FJ 3VN0A 4S04A 2EBIA 4PV1C 1PPJG 4KQQA 3FZCA 1SVFA 3BCBA 3H32A 3AE5C 4BHPA 2WSCH 3ZVWA 5EEHA 3RKQA 1HBWA 2AVXA 2V0UA 2QCOA 3OYBA 4RESB 4WWCA 1O3TA 4A7PA 3AL0B 2VJWA 5J8CA 1DRMA 4JK1X 4PJ0H 2N9BA 1ETVA 5IPAA 5AVQB 2XRLA 2F5DA 4DJAA 1N7SC 4FSFA 1YI2I 2W83C 1TU3F 1QMFA 4BBVA 2DOFA 4KG6A 4GHIA 2ZQAA 2B5RA 3WTSC 1SS1A 2A5WA 1MJAA 2YU3A 3FMRA 5H2FC 4UA7A 5JHFA 5HNHA 1T3JA 2B02A 1YG2A 1LVAA 3RKWA 3ROUA 1LWUC 3BATA 2EINH 2V9AA 1W4MA 1MPLA 1S67L 1B8IB 3HZJA 3EFGA 4WZ4A 1NXYA 4KENB 1R9TJ 1FSHA 3FXJA 3F3XA 4GS9B 2DA4A 5KAFH 1BL0A 1RPWA 4ZDLA 1IFMA 4BBUA 2EIJH 2J5PA 1SHVA 2FXMA 3L70G 4XLAA 2P7JA 1I2SA 4Y13A 1YJNP 1RRJA 5F64A 3AEAC 3D6YA 1QVTA 3HHHA 4IRIA 1WJEA 3ZYTA 2ZJPF 1SFEA 4LLNA 4S2NC 3W2AA 2NXNB 2ZMEA 2Y0DA 1JCDA 2E42A 1I5QA 1V4RA 1CEGA 1HOMA 2QJYB 2V1UA 1YTZI 1VQ8P 5D5UB 4KN4X 2PLYA 4BE0A 1IRGA 3RPUD 1EV7A 3REOA 3EWKA 4OOYA 5TJJA 1DGRM 3ZMSA 3T4JA 1ESIA 5GPCA 3GUDA 2LDUA 1U9NA 5FGMA 3IH8A 2GOMA 4B3XA 4WZ5A 4XLPF 2EFXA 2CW8A 1UHWA 2VOOA 4E7SA 1YJNI 3B5ND 2P9VA 4BRYB 4NDLA 3BPXA 1BBYA 2XA7M 3HGGA 1IYSA 1HVVA 2V0WA 2IPQX 5HAPA 3DPLC 1T1CA 1L0OC 3F89A 4L9JA 3WTVC 4RB1A 2CMNA 2RAEA 1DEBA 4OWRB 3PAGA 1M8OB 3H1IE 3D4FA 2V6EA 4EW7A 1IKIA 3SHFA 5TBMA 4IHSA 3BCCD 4N1HA 3GMWA 3TDZC 2IBDA 4I2OA 4UEYA 3Q3SA 4JF6A 1YYCA 2WSCJ 2OYIA 1FOSF 3BR0A 1ES5A 3ZQQA 3KZIE 1FIAA 4UUSA 3I56I 1QL1A 1TT5B 2Q5UA 2QE7H 5L2FA 1JTXA 2UWJE 4EV4A 3L2WA 5HAQA 3O6QB 4QB8A 3R2PA 2WSSH 2AO9A 4JXGA 1TBXA 3L37A 5KNLA 4ENKA 4DE0A 3HOWJ 2M1BA 1TWHJ 2WYXA 1AWCA 5HDNA 2PJRB 4A3GJ 4QMAA 4U0YA 5DD8A 3S16J 4EM1A 1RE4A 3L7HA 3TW7A 4E6WA 1SKOB 2WK0A 5GHXA 2H8RA 1U8RA 3GHGC 1RUOA 1FMVA 4HQAA 2J5UA 3H5RA 2FBHA 1D7MA 1S4SA 2K9LA 2L9SA 1QQIA 4FE7A 1CF7A 1T3UA 1KYOI 2ELJA 3T4OA 4LV1A 1RHZB 3RK3C 3TF5A 3L71D 1FDMA 3LY3A 1ZN2A 1VNDA 3ZP5A 1BIAA 3CCSI 3UNWA 1STZA 2A6HF 3CDLA 4P87A 5I94A 1T98A 4PD4D 4ZYAA 3A7OA 3U2RA 4EVIA 3CC7P 3C7JA 4HNVA 4WY4C 4C6YA 3EQVA 3TK1A 4GZBA 4AIKA 4YFNF 2WV0A 2WKIA 3W2ZA 4F91B 4B1RA 3WGHA 4EJTA 1CI9A 1Y28A 1Z0XA 2VJIA 3IF6C 1R58A 4IHQA 4KJZA 1IZ1A 1FOFA 3CI9A 1BUEA 2O9BA 4HKZH 1ON1A 1K05A 3OIQA 2UXXA 2Z2SB 2L9NA 5F1RA 1RQUA 2WBMA 3VOYA 1UAAA 1S9KE 2P08A 3JW4A 3RPUA 1HSJA 2HNHA 2OWJA 3UY6A 2H0YA 2ZL1A 2ZKZA 4HYEA 4C2TA 2IJLA 4JLFA 4HAMA 1O7EA 4NUBA 3QNCA 2H09A 3BZCA 2PFBA 1NZUA 4HX7A 2GOXB 2VBXA 4KZ3A 2IEKA 4CLCB 4BHBA 2DA6A 1MBEA 2V7QH 3E97A 1YSQA 1IZNB 4ENNA 4G9YA 1YW8A 5DJTA 2K7SA 3CG5A 4A93J 4NPEA 1TS7A 1SQPG 4A3BJ 3HGYA 2V8CA 4ZYEA 2RH0A 1Y0NA 1AFOA 1FC2C 2JP3A 1PZOA 1SQVJ 5CX7A 2UZKA 1YS7A 4PMAA 3H1KJ 3TL4X 3EYIA 3LQQA 2W25A 3GHGA 4I98B 4V2GA 2YXRB 3ZHHA 5BPIA 2O8XA 4GHIB 1SMTA 5JVTA 3RTYA 4A6DA 2RC4A 2WITA 1VF5B 3IH3A 2JBFA 3MCZA 3A0HC 2JVHA 1U57A 3U1DA 2KSEA 3V3SA 3HLDA 2VIXA 4E3NA 4O6JA 3BM6A 1K8AQ 1LTAC 3L75J 3QU6A 4Y3OA 3L2QA 1H8MA 1D1BA 3S7OA 3DEWA 4KUMA 3E4PA 3H3UA 5D6EA 1KQSO 2PN6A 4Y33A 3H1LG 3Q5SA 1K57A 1G4DA 5FJ8J 5KIZA 2E1CA 2A06G 1T1AA 2DFHA 4O0PA 2X48A 3SW1A 5TJHA 2F2EA 1PZPA 3VP0A 1NRFA 3F23A 4LIUA 1IXCA 4KG5A 4LOCA 3BG9A 1DH3A 3LIEA 4R3AA 1YBKA 3ICYA 3PSFA 1UJ8A 3E6CC 1NTZK 3CMZA 4PD4I 4DZOA 2HGVA 4UAAA 3SFIA 1TEMA 5APYA 4BXXJ 5CHXA 4BQNA 1NYHA 2M87A 4YIFA 1VQMI 1BIBA 3IX4A 2JRMA 3MD0A 1X0TA 1VQ9I 3RJUA 1OW8A 3B42A 1TL8A 1FOYA 4JX5A 4Q47A 5CCGD 2PGDA 5FDSA 1M1JC 3BFCA 3HE5B 5L09A 2A24A 2NUTC 5BQTA 2ZXHA 2HZTA 4XLFA 4G3WA 3ZQCA 1FJKA 2O8KA 1Z3YA 2IWDA 4N9LA 2DTRA 3ML6A 3I55I 3K70D 2QGUA 3JRCA 4Y99B 2RNGA 4Y5FA 4DZPA 4XRMA 5HX9A 3ISGA 1UHMA 3EDPA 1LPQA 2K9JB 1ITYA 2XSSA 1XJ3A 2CSOA 5ICGA 1NKZB 2KB7P 1XA1A 2R5ZA 4EETB 3SQNA 4MN7A 3EOIA 1J9IA 3H1JE 1RF0C 5EUAA 5FI6A 3VE3A 4HEFA 2L2OA 4HJGH 1MDMA 4QJGA 5K5BA 4D6TE 3RI4A 1BE3G 1LL5A 3EETA 1JO5A 3FHZA 3Q5PA 1EROA 1S66L 1TWCJ 2K27A 1NKNA 2VT3A 3M6HA 2GBYA 2ZC7A 3JRBA 4CDGA 3WS5A 5FA7A 1DDNA 1OCPA 4S2OA 2QKLB 2WSEJ 1FSEA 5FI2A 2VKEA 2AXCA 2K86A 3KE2A 1LL9A 3ZQLA 3V4GA 3V67A 1C3BA 1WJAA 2KFDA 3ZG7B 1OFCX 5KJ7A 3W4QA 4HHDA 4H13D 3A02A 1S0WA 1R1TA 1JTHA 3OYKA 3UKGA 5AVFA 2IS1A 4XRFA 3IRQA 3KETA 1VQKP 1L0NE 3CXHH 4HNTA 4P55A 3KPEA 3LFKA 1CJFA 1K7AA 4MIMA 4U3FJ 1SQPJ 4ZKUA 3E5QA 3HCYA 3S32A 4JYKA 1A36A 5DF9A 2JKRI 2MJ6A 4IEJA 3HDDA 1Q86Q 2HOTA 4E7LA 4XUXA 2DCFA 3HJKA 5M18A 4CUGA 4UQIS 4OPYA 3GTCA 4YFXF 2V26A 1N2DC 4OPQA 3GF3A 1UFMA 3Q7VA 3BPVA 1CF0A 1A5JA 2OARA 2LR2A 2HYJA 1EWZA 1A04A 2ZBKA 1JJ8C 1E3HA 1FEXA 4HPQA 3G4PA 3MZFA 1XGNA 2WA0A 4WVZA 1UWNX 2YO2A 1EH6A 1X1AA 4H13C 4XLEA 3BJ6A 4XLNF 3K9TA 1MSEC 3T4QA 4M3FA 3MKFA 2ZMEC 4UY8I 1IN7A 5G18A 3ZRGA 2XDMA 2FFDA 3ZQ5A 4JBZA 4R0QA 4EDFA 2WQYC 2KPMA 3CXHE 2V1ZA 5E79H 2BY0A 1QO0D 2DPUA 5GTHE 4H0EA 1O7LA 3MMYB 2ZXEB 5B1BH 3ZMTA 2M0MA 2A07F 3MZ8A 1WZ2A 4NEED 1E0EA 4HNUA 2MLGA 2HKOA 1CF7B 3BRMA 4XUZA 1R1VA 2L9RA 2N8GA 2V1DA 2JTVA 1K4EA 2NPSD 4EMSA 2Y55A 1YMXA 5H6RA 1NHAA 1HSTA 5DUIA 2WKHA 2JA8J 4LPZA 2A3UA 2A68F 4MQ9F 3GXOA 1ODVA 3G73A 1V5FA 4WUJA 3WUVA 1N7SA 3QOEA 4WMCD 4GN2A 1HH0A 1SANA 3CTAA 1JMBA 2FQ3A 2ZXWH 1ETQA 3SH8A 3CDHA 1YIOA 3JTGA 3HUMA 3IAM2 2QVAA 2P6SA 2VB6A 1MGTA 3FKJA 2V1AA 3IWOA 3N8SA 1FCOA 1HW2A 5CVUA 4ZYHA 3K1PA 1NWQA 1ZAOA 4Q8IA 1K0KA 1JE8A 3V6IA 1XX5A 1HQCA 5JLXA 2B9BA 2XAUA 1SFCD 4GOGA 3CCQI 2QJYC 3UE1A 2W1OA 1T18A 4AM3A 5IYCJ 4Y17A 3JRFA 1T19A 4I0BA 1Y0UA 2ZT9D 5KSCA 3KZIC 4CJNA 4H0LB 3I0TA 3M4OJ 4XMYA 4ZYDA 1FTZA 5EEAA 1X2NA 4UXNA 4N0BA 1S9KD 2TCTA 1ZG4A 2EA2A 4RLFA 1SQXJ 3BJAA 2V9PA 4ZBEA 3PIOF 1SD4A 4EJWA 4GDOA 1ETOA 1N7SB 2FMYA 3KP5A 4E6KG 5A2QZ 3CWBG 2KZIA 1GA0A 3R0JA 3BQ8A 4XIDA 2MLKA 2OQQA 5B3SH 1NTKE 3OSGA 6PAXA 1XMAA 2D5VA 3L72E 3L74D 4C2MJ 2G3AA 1E4DA 3AECC 1SQXD 2MC4A 2A45H 4KMUX 4PM7A 4HOBA 5DV5A 3TQNA 2M7VA 2FBWC 3ZMVA 1N73C 4FCYA 4B4ZA 2NS7A 1HKTA 1ZRTE 4S2NA 1U60A 3ZQ7A 2Y2KA 1F43A 1HTZA 1AXBA 1ZG3A 3G4SI 4BJTA 5EVID 1JOCA 3HOVJ 3CHWP 3A0HH 2FBIA 3C1LA 4GDFA 2GNXA 2BHZA 2FX0A 1UCRA 1RR7A 3Q9SA 5GP9A 3E0JB 1HUCA 1B8IA 2YKOA 2Q6QA 2COMA 1MDMB 3VWBA 5F83A 1K73Q 1SQVG 1GTWA 1G2CA 1R71A 4BD0A 2KQRA 1VQ4I 4LCLA 3V2QA 3FMSA 4P85A 1S4XA 3F1NB 2E2IJ 3ITAA 5HVQC 1ESUA 4P0MA 4EGYA 2R7VA 1YW7A 5CBOA 1JY3O 4C9YA 1T56A 4BACA 2NS8A 5G4YA 3DWLE 3M0DA 5AW7B 2WAQA 1G5UA 1U5TB 3OYJA 2W82A 1NYYA 1IUFA 3ZNYA 4EEPA 3MAJA 2EFPA 4PJNA 2EX8A 4WMCA 5KCMA 2YKHA 1VQMP 3H1CA 5KSHA 4Y7NJ 2HPCB 2B0LA 1SD7A 3C2GA 1G68A 4S2IA 1S9HA 1TZLA 1K61A 3S7PA 3B02A 4IUHA 5F1FA 2HFHA 1QHHD 1WQ2A 2BOLA 2E5NA 2IS2A 1J1DC 2RGVA 5E1ZB 1GD2E 4QU3A 3IF6B 5ERIA 2IGOA 1P84I 4XLCA 3LQRA 5APWA 2XKPA 3QODA 4RB2C 1EA3A 1VQ5P 3JRAA 1P84H 5F0CA 3O8ZA 1VQ9P 3BY9A 3DLAA 2L7MP 4D5FA 5BU8B 1Y4OA 2ICWG 2COBA 2XSDC 4AUXA 2M7UA 4BY1J 2WGIA 4M3BA 1QPMA 3CCRI 2HGCA 1YOVB 3L70J 5TISE 3DWZA 3L73G 3B47A 2M1CA 4BEHB 2VOPA 2FUG2 5E17F 4PZJA 1CI6B 4PAUA 4R4RA 1HC8A 3L70D 2W24A 2YSRA 5BOHA 3S1YA 2OCCH 1KONA 1OWAA 3G2YA 4P5OA 1Z7UA 1G6OA 2KRHA 2D45A 1AKHB 5E1XA 1RGYA 4BDZA 3KXDA 3UR3C 2XB5A 3NOUC 4M72A 3D5RC 1PYVA 2P04A 2WZZA 5AVUB 4F52A 2E34A 2WSEH 3MN2A 2DA2A 2QWSA 4KZAA 1EH8A 4MFEA 3D9YA 1N78A 3DBRB 1ZGAA 4X55A 3GW6A 1OYYA 3CCRP 1TW2A 5E79E 2I1JA 2GJ3A 1Q2QA 3GBGA 3E5UA 4EJOA 5DFYA 2Y31A 2X4HA 2ZL1B 3V5BA 2BGCA 3OV8A 1HBXG 5D5WB 1BSNA 3VFZA 1PW8A 4EQIA 1LFUP 1H8YA 2A45I 3HXLA 4OGQC 1VQ7P 3HUSB 5EOOA 3SS4A 1KQ0A 1HLUP 2LVSA 3WGGA 2HP6A 3LSHA 3M7GA 3PAEA 4LGDE 3L75G 1OTBA 5CCGC 1R23A 2FXPA 1WGXA 4E7IA 4JGQA 1KE0A 3RK3D 3V39A 4MNRA 2XV4S 3L72J 1PPJD 1KB9I 5E2HA 2WUQA 2VGKA 2Y9YA 2YR2A 3VOPA 2OPTA 2PBDP 4CLCD 4BUPA 1PZQA 1CGPA 4MHGA 1ZP0C 3AG4H 1SQXE 2AXTH 2PG4A 4FASD 1KE4A 5CGWA 3O3VA 5KKZC 5IT5A 3LAPA 1QGPA 1AQ5A 1IF1A 2YO3A 4H44B 1HW1A 3H1HE 1OVUA 4A2UA 1N9BA 3UB9A 3GLLA 1KU9A 3F0CA 4U3FD 4ZMDA 3EEHA 3UO9A 2ZQDA 2HYGD 4IBRA 5FO5A 4XQFA 4KJMA 1PGPA 2JKTI 3DKXA 1A6IA 3OA7A 4JF4A 4WF2A 3V42A 3J7AO 3PL8A 3TOIA 2L0WA 4JX4A 4LB6B 3Q5RA 4XXRA 1LDJA 1JNUA 4PJ0E 1NJIQ 5BNGA 2FU4A 1YJ9P 1X1PA 3LW5H 1NAFA 3ZCOA 2AXLA 4A5RA 1QVGO 1MWSA 3SJMA 3RBXA 5LHIA 4Y0OA 4XM3A 3FV7A 2PD8A 3PBSA 4HY8A 2HYFA 2W48A 1YITI 1RQVA 1P0ZA 3RZOJ 1ZELA 2HQ5A 3I4MJ 3V8KA 5HS8A 4RGRA 4IHXA 5FDHA 3UMEA 2Z5HA 1XA7A 5CGXA 1X4PA 1R5HA 4Y28J 4ASNA 3Q7VB 3L70E 3S1NJ 5EVLA 1G3SA 1OCZH 3T1BA 3TMOA 1B9NA 5DD4A 2WVRA 2HR3A 5HL6A 3K4JA 5IS1A 1LTBC 2X1CA 1RE3C 5CCHC 1H9GA 3CESA 2ZBBA 2Y2QA 1MBJA 4X1MA 1BLCA 3TOBA 5J6XA 2IS6A 1S1ZA 3HRTA 3FXEA 3JVUA 2WGWB 2JN7A 2H88C 1TVFA 3NXSA 2HZ5A 3CMMA 2BY3A 3UB7A 2L4RA 3QWOC 1HTLC 4ZTFA 2YS9A 1V54H 4PV1B 3S7NA 1FILA 5KLIC 3PTEA 4JF7A 2ZC5B 4G6DA 3UB6A 4LLGF 2XD1A 3HIFA 1B6AA 1K78B 4WWIA 2F4IA 2MYSA 1KN7A 4IPAA 3MZYA 1D8JA 1E17A 3RBZA 5HARA 3LSGA 4I6MC 1KILC 2YUSA 1GK4A 3N7NA 5C3EJ 4NC8A 1B1BA 3D5LA 1OYWA 1RF1C 2Y2OA 2EILH 5TISH 4DXCA 2CGPA 3MQ0A 2QKMB 1RH5B 4X68A 2R7SA 3CXHI 3S8PA 3U21A 4CXFA 4F93B 1IYQA 1AOYA 3F6OA 4U3FE 3VPRA 2BVLA 5KJ7D 2PMZN 3GZ6A 2O9LA 3OR1C 3IXBA 2ZC3B 5GL9A 4IHVA 1W0UA 1R49A 3ZG0A 5BVZA 3FZVA 4AIJA 4F55A 2V6CA 5CERA 2DT6A 4HP4A 3R7WB 3HOYJ 4ON0A 2ME0A 3B5NA 3QYBA 1PRQA 5HDSA 3H1ID 2JPCA 1NTMG 2JT1A 3I4PA 3QP8A 1W8QA 4GCZA 2EX9A 5JVGF 1U78A 1RE4C 1NTKJ 3E1IA 1KILB 2WT7B 3TO6A 3IUOA 3HE5A 3E0YA 2ECCA 3CMAI 3OPLA 3MQQA 3BRTB 3HEFA 3D1NI 2LNBA 3H1JG 2EWWA 1J5YA 4GXOA 1J75A 4EWFA 1J1EC 2O3JA 1T08B 1XPXA 4BRYA 2IW5A 3F1OA 2SPZA 3KZIH 1NTZE 3BEBA 3HB9A 1XS9A 3H9WA 1OLTA 1LJ2A 5EYRA 5GTIC 1WE4A 3ABLH 3CCUI 4DBRA 1GK6A 4IL6H 2QVOA 1MFZA 3AE7C 5HFOA 3HTUA 2VKHA 1PNEA 5CJ9A 1WYCA 2PMUA 3UE6A 1X22A 4I7ZB 4YPCA 3PYPA 1FIPA 1JY2N 4WM9A 3HVFA 3WS4A 3LIDA 2L02A 4A0XA 1G3YA 2GZAA 2NVUB 1XG1A 3C2BA 1FX7A 2FOKA 4U87A 4F94A 3H0DA 1VF5D 3H25A 4RS8A 2IBZI 2A45G 2K02A 2IYPA 1KDSA 1MBHA 2PBIA 1B9MA 2K1AA 3ZMDA 1MMGA 2DCEA 2E76B 4BBSJ 3MKYB 1P4AA 5C4XJ 3OC2A 2HOSA 4HDUA 3OYIA 3S1RJ 2DJNA 2H1KA 4Q0JA 3R7WA 5CECA 4EBPA 2WADA 4WY4A 4PPRA 2L0KA 3ZOBA 1BSGA 2FBKA 2XA7S 1FBMA 3CCUP 3GYHX 4H44D 3A3JA 4XOTA 1T0FC 5GTHH 5F6FA 5CTNA 4NC7A 1JEKA 3KZYA 5FI7A 1URQC 1G2HA 1G2CB 4N9KA 5K7FA 2W57A 1JTHB 2A06D 4R4SA 3QP5A 1RP5A 1GL2B 2CS3A 3VP1A 3X2QH 4L74A 2LC2A 4I01A 5GTIH 2UWXA 3DWKA 1OZHA 1N9NA 1EJ9A 2PBYA 5ILSA 1BI0A 3HD7B 2VN2A 1PW1A 2R7FA 3ZQHA 4ESBA 4BY7J 4N78E 4CO8A 2HQRA 2ACGA 1YMSA 5JHUA 4S05A 1VQKI 1YI2P 1H89C 3CC4P 3W2VA 2ZFCA 2ZC6B 3RCOA 3Q5FA 3SFEC 2UUZA 4L9GA 1MBFA 1XDSA 2K9SA 4BQMA 4XKVA 2OBPA 2A06E 2KIMA 3MZDA 5E8GA 3BLMA 2Q3IA 5KVRA 4OQGA 3CZDA 1WJ5A 2KLIA 3H1KE 1WWXA 1P7JA 1IYOA 4CYCA 1K55A 3CCLI 3CCYA 1S72I 5EF6A 3DW0A 2Q1KA 3IWQA 1WRJA 1RR8C 2QUFA 2R44A 3NY4A 1BCCG 4LLHA 5DCMB 2HTJA 2H5SA 1YFHA 1BJZA 4U0TA 2K9YA 5MC7A 5DKLA 1KVLA 1IJDB 1PPJE 3KX2A 1P6RA 2B89A 1Y8RB 4XKBA 1W5CE 4I76A 1XJ6A 2QM3A 2M5AB 5AVYB 3IT9A 3FHNA 1OPXA 1Y47A 4FOFA 4MDZA 4Y0TA 4BL0B 1E2XA 4UHTA 4DBQA 3MP7B 3RZDJ 3IXHA 2QHKA 2OTLP 2A05A 3Q9VA 2VT2A 3A0HE 1DY6A 1S72P 3TDUC 2JUGA 1FC3A 1L3LA 3RK2D 3MS6A 3H1HJ 1ZRDA 2O03A 1L0NK 3L72D 3L74E 3FF5A 4HQEA 4NXGA 3M8EA 4XSXF 4B86A 1T1BA 2AEJA 4Z1MH 3D5SC 2I72A 4A6EA 3TGUJ 1YPRA 3O8GA 2O99A 3IQAA 1T2KC 2BCCD 3B33A 1WA9A 4DF6A 4UV9A 1TQIA 1SQQK 2KZGA 3Q0WA 3H9QA 5FATA 1OVRA 1ENHA 3A01B 3L71G 2NOGA 2C6YA 2JR8A 1Q1VA 1XSVA 5ILVA 3LOCA 1E25A 4OGQD 4D7MA 3IV5A 4QLCU 3CPWO 3CWBJ 1XMXA 3L73J 2DMWA 2DN0A 2BEQD 2X51A 2PQ8A 4E7HA 3AFHA 4BQOA 4LG0B 2R9XA 5APUA 1GV5A 2L4AA 3AEDC 4GJ4A 2I1KA 2LRDA 1DP3A 1SQQD 4L76A 3G6EI 1FLIA 4W97A 3WODF 2HWVA 3BZ6A 2DU9A 5BPDA 1IXSB 3HKZN 4QTRA 5EM1A 5CHUA 2PHYA 2K40A 5FQJA 3I3LA 3GHGB 3D6ZA 4XONA 2OSUA 3PR6A 3ZXSA 1VB6A 2E2HJ 4MEXF 3HUGA 3L74J 1FZPB 1LI9A 2CW0F 1IFPA 5IOZA 3BWGA 3IS2B 3BCCG 1ETXA 2XH9A 3CXHD 4F7ZA 2M4KA 2WV1A 4MNUA 3IH9A 3BQYA 2IGNA 2JN6A 4JXWA 3AG2H 3H1IJ 2JDIH 2QMIA 5APQA 3QOPA 3HSFA 3NCKA 4IVNA 3HSRA 1OIPA 3HOZJ 4O01A 2WKEA 1SQBK 1FOKA 1OTEA 3WS0A 1PIXA 3UDIA 3CUEC 3CMYA 2XAJA 3CC7I 1SQXK 2R7XA 2LD5A 2M30A 2PJPA 2E35A 4X1LA 3DPTA 1Z67A 2A5YB 1OVVA 4YEJA 3RSNA 2ZM0A 5A90A 4UUSB 4YIRX 4OOIA 3NWSA 3QP4A 4BE1A 4JBAA 4AUWA 3RFBA 2ZM8A 2HI3A 3LSJA 4L0LA 1S6RA 3ASOH 4RKUJ 1YRNA 4O7DA 5KTBA 2WC2A 2O01J 2CC1A 4ZYGA 2WKQA 4WY4B 4Q0IA 3OYCA 3MFXA 4KZ9A 3E2KA 2RCXA 5J4EA 3VB2A 1PYYA 5D4RA 3Q82A 2JO1A 5EDNA 3CDIA 1V3FA 2B7EA 2D2CC 3LA2A 1IV6A 2X6YA 2MC3A 4IHWA 4L9EA 4W80A 3TSIA 2ZSIB 4KQDA 2VX8A 1H89A 3P9KA 1W5TA 3PBOA 4BLMA 1H88A 2E19A 2MD5A 1FZCC 2YPRA 2A49A 1E3OC 3I55P 4CA0A 4EXOA 1H0TA 1IAWA 2CH0A 3CAXA 3A0SA 3QPLA 3T97B 2KZJA 4YRVA 3B6CA 3HLFA 1I6HJ 1NTKD 3J81Z 5APSA 2HJEA 3OL4A 3KSIA 4NHJA 2OWHA 4HYTB 4N92A 1I5ZA 1MKIA 1VZ0A 4HJ6A 4KDPA 1X3WB 3C7VA 1MIJA 3FXQA 3HD7D 2IBZD 1URQB 3HBRA 3DTEA 4GYGA 3H3VK 2NYXA 3W4OA 1VQ5I 3ZGAB 3C5AA 4JKTA 2ADUA 2EX2A 4D6TG 4YXWH 1BJAA 4Q4ZF 1N7LA 1T8ZA 3PFIA 2K85A 2DW3A 2FXOA 5DEQA 3OCNA 3H0GJ 2VGLM 3FXLA 1XGOA 2VGJA 2G2WA 1IFQA 2DO7A 3GW2A 1K6SA 3G1OA 4EEUA 3IH2A 1FOSE 3RH8B 4OIQF 4P96A 4PJLA 3WS1A 2L7KA 4M4XA 1S5LX 3BR1A 1XJ4A 2KDOA 1GHPA 2VKDA 1A0KA 4ZNCA 5DJUB 1FCMA 1RE3A 2X6XA 2AS5F 4MTEA 3ZQGA 1P9QC 4ZZDA 1D5YA 2V9VA 4CCKA 3MBZA 2EFNA 1JVJA 1KB9H 3HD7C 1Z21A 5FQIA 2GA2A 2Q9NA 4AWXB 5GAGJ 2DA1A 5KKZB 3ZDJA 5E2FA 2OZUA 1MMDA 1CSBA 1FZCB 3MF0A 2RNJA 1TNTA 1OKRA 2W0NA 4DJ2A 4R8HA 2R92J 1EDJA 1BI2A 5H2FH 1K57C 4UUTA 4XLHA 3LSRA 3A03A 2XGXA 2AQFA 3S14J 2MGQA 3SDBA 4DRTA 1EZVE 1D8KA 1IC8A 2LBFA 4EQ1A 3MFDA 1K6YA 4XT2B 2B88A 1H8AC 1Q1HA 4ENJA 2HP9A 3CMEP 3TE8A 3BG7A 3FXRA 3IX8A 1A35A 3WMM0 4QSHA 4BXLA 1KYWA 4K2EA 2DMNA 4XE5B 5E79C 4XSZF 3K3DA 4ETXA 3EUAA 1H9TA 2K9NA 1OW7A 2VONA 1KDWA 2QJ7A 2V79A 4G6TB 3II6A 3GV9A 3QH9A 4XOPA 4G94A 3GEZA 4YOFA 3CI6A 3MFKA 1IRFA 2HVQA 2JQ7A 4U0XA 3IR9A 4IUKA 4GO1A 4E3MA 5LEJA 3QNBA 3MUDC 4MBKA 2BBYA 1LTIC 3DAVA 3ZN1A 3CCLP 2I5UA 3H92A 2ZD8A 3KSHA 3OJAB 5FEFA 4EESA 2W3EA 1LEBA 2OZ6A 1SAUA 1USSA 5J1RA 5FB2A 1MZ9A 5HD3A 5HS7A 4A5NA 5J8XA 2HZDA 4YFMA 3WTZA 1HJ0A 2UWMA 1OPCA 2XUBA 2J9PA 1J1DB 3RIRA 2FH5A 5D6FA 5L8RJ 1D1AA 2D01A 2BVMA 1B72A 1JXSA 2BHYA 1ODDA 1YHQI 2ZYDA 3WWXA 1M1JB 2IWCA 4RJTA 2N1TD 1Y8AA 1LB2A 2ZFUA 1ES2A 5AVSB 2OTKE 4D5CA 5IYDJ 2OYOA 1ZR2A 1M1KQ 3G35A 3HTSB 1YTZT 3W6JB 1HD8A 1D1JA 2IXSA 1EXIA 2EIKH 3T50A 4EUVA 4BEHA 5HWVA 2VJJA 2OTLI 1JKOC 3HOSA 2WZ7A 3TDKA 3HRSA 2W7NA 5AW6B 3SYTA 4A3JJ 3WRZA 4OOLA 5GLAA 4LLLA 4WLAA 2G7HA 2YU9J 1JWZA 1VM1A 2W4SA 2DDBA 5EGOB 1I6XA 5KHDA 1AHDP 5B1AH 3TGUD 2QKPA 2K9QA 3BCAA 3L9KA 5I5LA 3KHUA 2DK8A 2QLZA 4X69A 5A93A 1UWPX 4M6YA 5KJ7C 3OYMA 1D3YA 4KA4A 1NU1D 2BCCE 3BFFA 2HS5A 2HF6A 3A3EA 3ZN0A 5J3LA 3ULFA 2IS4A 4UB8H 2FNPA 1JY3P 2K9MA 4CCLA 4CGZA 3KEYA 3LSIA 4N6JA 5HS9A 3OOVA