1MKMA

Crystal structure of the thermotoga maritima iclr
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
246
structure length
246
Chain Sequence
MNTLKKAFEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKDKRYVPGYKLIEYGSFVLRRFNIRDIAHDHLVDIMKRTGETVHLILKDGFEGVYIDKVEGEQSIPMVSRLGMKVDLYSTASGKSILAFVPEKELKEYLKIVELKPKTPNTITNPRVLKRELEKIRKRGYAVDNEENEIGIMCVGVPIFDHNGYPVAGVSISGVARKFTEEKIEEYSDVLKEKAEEISRKLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords IclR transcriptional regulator
publication title Crystal structure of Thermotoga maritima 0065, a member of the IclR transcriptional factor family.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 75
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
A PF09339 HTH_IclR IclR helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mkmA01
1.20.5.640 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1mkmA02
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1mkmA03
3FM5A 2COMA 1W7PD 3IKVA 1IF1A 3WGIA 2OQRA 3QP6A 5J6XA 1R1TA 4M9XA 1RI7A 1FYLA 1Z9CA 4F7ZA 2XAGA 5FD5A 2E1NA 2NNNA 1RIOH 3GF2A 3O2PE 4HDVA 1U6GA 5LRRA 1XD7A 4ON0A 3BJOA 2GA2A 1FPQA 4EM0B 3R0AA 3F8MA 4M9SA 5KVRA 2IRFG 2XHKA 4IHSA 3GX4X 2KJBA 2DPDA 3P9CA 4Y15A 2EV5A 1PUEE 4BQAA 3KSFA 1QZYA 3ML6A 4MQ9F 3IKTA 1G3WA 3L9FA 2W3GA 4ETZA 1ZHFA 3T8TA 3E6DA 4AVPA 3EETA 3RDIA 1S6LA 4UV8A 4HQEA 4G7HF 3F21A 4O0PA 1J9IA 3LA2A 2F5DA 2WTEA 1IZ1A 1P6RA 4M71A 4FX4A 3SZTA 3F6OA 4QWQA 3KP7A 4EMSA 1R22A 1ZRDA 4KIFA 3TDZC 4EGYA 4LG0A 1BC8C 1R1VA 2W3FA 5D6FA 2D2WA 2AS5F 2CG4A 2STTA 3QU6A 1USTA 1LQ1A 2EA2A 4M73A 2QBYB 2VBXA 2WC2A 5TRDA 4ENNA 2F5CA 2W57A 1QBJA 1W4MA 1Z91A 2BBYA 2CGPA 3B73A 1O57A 3LSTA 3O3KA 5E17F 1BIAA 5D5WB 2VONA 1TW2A 5ERIA 1F5TA 5HLGA 4Q48A 2O9AA 2P5LC 3J7AO 5TJJA 3FMRA 3BDDA 3R4KA 3BWGA 1O3RA 3EEAA 2NRAC 1J5YA 1CGPA 4CYDA 4ZRRA 3QPHA 5E8GA 1HKQA 3GWZA 3TQNA 4ZYHA 2E1CA 3K2ZA 3KSIA 4LLGF 4RAYA 3HIFA 4ZZDA 4IVNA 2QQ9A 1YW9A 1T6SA 2IA0A 3G3ZA 3H3UA 2HYGD 4Q47A 1E2XA 2QQAA 3V7RA 3KEOA 3BOQA 3R4YA 2G9WA 3FM3A 3T0YA 3F6VA 4CHUA 1S7AA 2DT5A 5LHHA 1XGMA 3V4GA 2KIUA 1I5ZA 1ZAOA 2L4AA 3RI4A 1YS7A 1S3JA 1X3UA 1AOYA 2VC0A 4R6LA 4YFKF 1TNTA 3DF8A 3U2RA 3KEQA 4M74A 1FP1D 4BYYA 2JTVA 1XGOA 1LVAA 1Z1DA 2XSSA 4HX8A 5ICGA 2FNAA 1FSHA 4AIKA 3MQ0A 1GVJA 2IP2A 3TOBA 1LDJA 5L3FA 1B6AA 4OMZA 3LA3A 1T98A 3V7CA 2KRFA 4OIRF 4A6EA 5KK1A 2Z3YA 3RJPA 3G6OA 1DDNA 3EYYA 1E17A 2IJLA 2GA1A 2H6CA 1FZPB 1ZLJA 2IT0A 1S8NA 4I98B 3IRQA 2PI0A 3DXJF 3HRMA 1GXPA 4UVBA 3P7NA 4RGXA 1WI9A 3OBFA 2ISZA 3CITA 4HLXA 1RZ4A 1ZYRF 2OD5A 2V79A 3VOEA 2A61A 3CUQA 5DFXA 5J8CA 1JXSA 5FFXA 3IRRA 1IRGA 3R0JA 4OMYA 1G6NA 2QYOA 4UVAA 2GZWA 2PG4A 5D6EA 4WWCA 1A04A 2RVCA 3WU1B 5C5KA 3FMSA 5E1XA 4OIQF 2RKHA 1NHAA 1PP8F 4ETSA 5K1YA 5HDKA 1H9GA 1U5TA 2GX5A 1BOAA 2RC4A 2OOLA 3GW2A 1ODDA 2K4JA 3REOA 1SAXA 1GXQA 2Z5UA 5ICCA 4ASNA 5AIQA 2CYYA 5ILUA 1O3QA 2EFOA 5H20A 4GLQA 3E98A 4EJVA 3KE2A 1FT9A 1Z05A 3B02A 3ECHA 3I4PA 4UVCA 2PQ8A 3T1BA 3LQRA 3K0LA 2LNBA 5H6RA 3KFWX 3F3XA 1R00A 2HKOA 3VB2A 2FQ3A 2KJCA 3I53A 3I0TA 4P5OA 5DCMA 4HAMA 2LB5A 1OMIA 3WGGA 1ZN2A 2FMLA 1TW3A 1UFMA 1XN7A 4UV9A 2PN6A 3ECOA 1CF7A 1J75A 1BBYA 5A2QK 1ZH5A 1YQAA 3C1DA 1BIBA 3KP5A 1AWCA 4WXDA 2DQRA 3E3VA 1R36A 2V1DA 2RQPA 3PQKA 1U2WA 2Y79A 1BJAA 4L9NA 3MWMA 1YYVA 3GFIA 1HBXG 2XIGA 5J8FA 3SFZA 4G3WA 1D5VA 4DN0A 4I7HA 5HPFA 3WTUC 1ZREA 1L3LA 3R60A 4L9TA 2L02A 4O5VA 2L54A 4EJWA 3RFBA 1O3TA 1SD4A 1WWXA 3T8RA 3GVAA 1XDUA 2LF8A 3D5LA 5LEKA 2PJPA 3F8NA 4P9UA 1YW8A 2BEOA 1F1ZA 4L18B 4G3KA 3ZQ7A 4KIGA 2UWMA 4OINF 5EEGA 1YSQA 2ESNA 2MBFA 2J5PA 2HGVA 4KNYA 1XCVA 2JSCA 1I1SA 4JBAA 4LRZE 2HS5A 2W3EA 1XSVA 1KQ9A 2Y75A 2VJWA 1IN6A 1ZRFA 2IPQX 1XMAA 3OV8A 2EK5A 1WSUA 5D8LB 3E6CC 4S04A 2RNJA 4EV0A 3ZMSA 1JGSA 3WU0A 1YFHA 2OZ6A 3RTRA 3GLXA 1XB4A 1MJAA 3Q9SA 4MTEA 2PMHA 1J7KA 4XLNF 1TQIA 2DW4A 3ERED 3O5YA 2HQNA 3N4MA 3OOVA 2ADUA 2QUFA 1TNSA 4BHPA 1LEBA 3E5QA 1R23A 4ZZLA 3V8JA 4MMNA 4KICA 2HZTA 2FU4A 2F5EA 4L5IA 4IJGA 2B18A 4IHTA 5L3DA 2WV0A 1W5SA 1SFEA 1HKTA 3PQJA 3I58A 3I59B 1STZA 4HA8A 2FMYA 2Q0OA 3EQLF 4LK1F 3COAC 1ZG1A 4U7BA 2J5OA 4Q0JA 3F8CA 1Y0UA 2P7VB 2ZBKA 3QOPA 3CUOA 2H94A 2QWWA 5HS8A 1IN8A 2XRNA 1R5HA 1H0MA 1V4RA 4R1HA 2Q8KA 2HTJA 4HV5A 3HTUA 4G9YA 3QP5A 5IT3A 5D4RA 3HSRA 3F22A 4E70A 3P9KA 3ISPA 3IBRA 2QYBA 1YLFA 3NRVA 3KP6A 3H92A 4OIOF 5HOOA 3WTXC 3S7QA 2ZCWA 5FD6A 1SFUA 1KU7A 5D4SA 3M8FA 4KMFA 2VT3A 1IAWA 3ZMVA 4GYGA 1RUNA 1G4DA 4A5NA 3KZYA 1P4XA 5BS6A 2M87A 2QVOA 3NHQA 2EJRA 2XKOA 3U9GA 1UHMA 2Q2EA 4HV6A 1FP2A 4ENJA 2ZXJA 1ZG3A 4AIJA 3JW4A 3E97A 1R1UA 5CVVA 1K78B 4NHJA 2L3DA 1KYWA 4FHTA 2Y48A 3WTTC 5K5BA 1P92A 2O0YA 1XGSA 2QBYA 4XBFA 3GZ6A 4WXHA 3FX3A 5JI6A 1EV7A 4RQ9A 1DUXC 4WX9A 3WE3A 5CYVA 3MZHA 3LAJA 2A6HF 2ZNZA 4MGRA 2M5WA 1ONVA 1ZARA 3VEPA 3KP3A 4BHCA 2Z33A 1YTYA 3SHFA 1IRFA 3S7OA 2XASA 3LFKA 4RB1A 4LG0B 3W6KB 2OQGA 2CSOA 2VBZA 3GUDA 3FF5A 4ME4A 1W5TA 2E7XA 4ZYGA 4KMUX 1LEAA 4DQ2A 2FRHA 3MCZA 4MEYF 1RUOA 3RPUA 5H6QA 3NOUC 1SD6A 4OIPF 4Z1WA 3FXUA 5DCFA 5D5UB 1V3FA 5K5RA 4U88A 4UHTA 5D5VB 4MTDA 2OZUA 1TQMA 4AWXB 1MJBA 4XLPF 1MD0A 2XUBA 1LDKB 4RS8A 2W3HA 1IUYA 5LBRA 2MD5A 2JPCA 4D0PA 3K1NA 2FBKA 2VT2A 5ICEA 2VODA 1BI0A 3GFJA 1W7PB 4PGGA 5DEQA 4A0YA 1OYYA 3RPQA 2UXXA 4HQMA 2EWNA 3VODA 2VOOA 4A0XA 3GFMA 1SMTA 4GO1A 4FOFA 2EB7A 2OBPA 2E7WA 1IXCA 3FXQA 4EJUA 2L01A 1T38A 4R79A 3DKWA 2FOKA 1OKRA 2RV8A 2HFHA 2VE8A 4DNCA 1QGPA 2YPRA 4YIIA 1FWZA 3FHZA 2XGXA 2V1UA 4EU0A 4LLNA 5ED4A 2FXAA 1UB9A 3WTSC 4IRGA 4UUVA 2P6TA 2IVMA 3DV8A 1P4AA 2WWYA 2W84A 4K2EA 2NYXA 4KYWA 3GEZA 1FX7A 5E8IA 1T39A 2D1HA 1PDNC 3TRCA 2W1RA 2M45A 4GW9A 5JVTA 5DD4A 3HRTA 6PAXA 3BPXA 4HLYA 1WKMA 4CDGA 3SQNA 3LQQA 5DUIA 4MHGA 4MQVA 2A3SA 4KFCA 1IW7F 5FB2A 2XVCA 3LAPA 5E20A 2K4BA 3V8LA 2MLGA 2GQQA 4R70A 2KIFA 3WTZA 5CLSA 4KIBA 1GHCA 3O6BB 3KSHA 3RIRA 1LNWA 2QLZA 1SD5A 1T0FA 4PCQA 3K2NA 2YX4A 5JR3A 3CO6C 1FYKA 5DDGA 2A07F 3IC7A 1L0OC 4A2UA 4M9ZA 2X0LA 4IUHA 3N97A 1YS6A 1MC0A 4L9JA 3D3OA 1S7OA 1EH7A 1SD7A 5D8KB 4JQFA 3I54A 2NS0A 3FZVA 4BNCA 2A5YB 2XROA 2LKPA 2HEOA 2MH2A 3L2CA 1Z6RA 1C0WA 1VTNC 4PZJA 2K02A 1BM9A 3H3ZA 4CICA 4RB2C 4XSZF 3ABUA 3KLNA 5L3CA 1U3EM 4LGWA 4MN7A 2ZMEB 5CJ9A 4LRYC 4PGHA 2F5FA 2XAJA 1U8RA 2H27A 3ULQB 1ON2A 1YG2A 2V1XA 4L0YB 2HQRA 5AIPA 3K69A 3BJAA 2UZKA 2GXBA 1LB2A 5HPIA 3Q9VA 2VN2A 4N0BA 1LJ9A 1FOKA 1KGSA 4LFUA 4GGGA 3QPTA 2H09A 2A69F 2HR3A 1DPUA 3JAMK 5BPIA 3U1DA 3LWFA 2FSWA 4AD9A 3RYPA 3VFZA 4XSXF 2O9CA 4KDPA 3TKYA 4Y5FA 4I02A 5JHUA 2Z99A 4R8HA 5HS9A 2GXGA 3CUQC 4BAYA 1ZTUA 3BY6A 4IXAA 3HSFA 3JAMZ 2JZYA 5A2QZ 1BN5A 2TDXA 1JHHA 2W3DA 1FYMA 2BE5F 1B9MA 3KP4A 4KT5C 3HOSA 4Y13A 4L0ZB 3F72A 3WODF 5DUKA 1I1GA 4CGZA 4HOBA 1RNLA 2OAZA 4LLLA 1BC7C 3QU3A 3TO7A 1KQ8A 2EV6A 1SFXA 3HSEA 1U5TC 4G8XA 2DLLA 1EH6A 2W1TB 2DU9A 1FY7A 4IRIA 4RGSA 4CQHA 4N9HA 2VE9A 4G94A 4G6DA 5LLQA 4I2OA 2JPBA 5LRSA 1KU9A 3KETA 4Q0HA 2EFNA 3BPVA 2DAOA 1IN4A 4NB5A 3BJNA 1FBUA 2ZMFA 2P5VA 1MKMA 3DP7A 2ZKZA 3DPTA 1P2FA 2JT1A 5DD8A 5CVIA 3FMQA 4I09A 4WF2A 4GYIA 4GCVA 4HX7A 5DYMA 3E0YA 2P6SA 4S05A 2M1BA 1O7LA 4H0EA 1EH8A 1XMKA 4YG2F 3GXOA 3ZMZA 2DI3A 4EM1A 4IRHA 3DPLC 4ESFA 1MDMA 2XAHA 3ZMDA 1TQPA 3M1EA 2G7UA 2OA4A 5LHIA 4O6JA 5I5LA 2PMUA 1KU2A 5FFZA 4Q5SF 5E18F 2QENA 2HKXA 3J80K 1ON1A 2EV0A 2KKOA 5CVUA 3V7SA 2G7HA 4U0WA 4ENKA 1K7AA 2ZJ2A 2X4HA 3K1PA 3MFKA 3CO7C 1PP7U 4M6YA 4HX4A 3E5XA 2QZ8A 5LBQA 4EVIA 2EA4A 3J80Z 3AAFA 2DK8A 2FBIA 2GIVA 3ELKA 3JTGA 1B9NA 1ZLKA 2M7VA 1ZGAA 1HXDA 5IT9K 1HQCA 3L00A 4O8GA 2KLIA 3HTSB 4EJTA 4FX0A 1XSDA 2VBWA 4I0AA 1MZBA 2P8TA 4G6QA 4U0VA 3HCYA 4Q0IA 3L7WA 5L3GA 2PFBA 1D8KA 2LDUA 3KP2A 3V8KA 3I5UA 3KZZA 2CO5A 5IT9Z 1YKDA 4KA4A 1FNNA 2RDPA 2RGVA 5LGNA 1B4AA 4Y2FA 3G73A 2DO7A 4LD5A 4KUMA 3GFLA 4KN7X 1TLHB 2CFXA 4L9VA 1J0RA 1FBSA 4RB0A 3P9IA 3EYIA 2FBHA 3TGNA 3R6SA 3ROUA 4YFXF 3WTWC 2HDCA 3IL2A 1H9TA 3E5UA 1TTYA 4KN4X 2LB9A 4BHBA 1K78A 3IWZA 4RB3C 2B0LA 5LEJA 1F4KA 4NQWA 3PFIA 3J81K 4GXOA 3JSPA 3C2WA 2A68F 2K7LA 4A0ZA 1R58A 2UXNA 1T2KA 3BJ6A 4QPRA 5F1RA 4A12A 1DP7P 3HHHA 3EDPA 3S7PA 5HS7A 4HYEA 2FNPA 2M30A 4YOFA 1OYIA 3J81Z 3GZ5A 1BI1A 3ZP5A 3M8EA 3MF0A 4QLCU 4CO8A 3TO6A 2R3SA 2RN7A 3JTHA 4JK1X 3TOAA 3WGHA 2D45A 1YIOA 4EJOA 2MA3A 4HF2A 3FXRA 2DPUA 3ZMTA 2HYFA 2JRTA 3K9TA 3BROA 2YX7A 3ZPLA 5D5XB 5E1ZB 4HF0A 2Y0MA 2HTSA 3CJNA 1FC3A 1I6XA 1WRJA 4YFNF 3ZQ5A 3ZMUA 2LSOA 3QAHA 4ZYEA 1TF1A 5E1WA 3IWFA 2STWA 4ZYDA 1IN5A 1W7PA 2GAUA 4ESBA 1MJ9A 2K86A 5HSQA 3NOPC 3KSGA 2VKSA 4I0BA 2XAQA 2ETHA 1DPRA 3BP8A 1O7FA 3HHGA 3W6JB 2MLKA 2ISYA 1K6OA 3DEUA 5AJGA 4A5MA 1R7JA 3EUHA 5BQTA 1KA8A 5HDNA 2BYVE 1UHWA 3SXYA 2BGCA 2O8XA 2K2NA 4ZH4F 2NAZA 1P4WA 4WXCA 4U0YA 4LB6B 1OPCA 4P96A 4P9FA 3RKYA 3MZYA 3ZN0A 1XDSA 2ZNYA 5LGTA 5DV5A 3HYIA 3I71A 4LRXC 2KIMA 4EUVA 1HKSA 4B09A 3FWEA 2DTRA 4FT8A 5BPDA 2YSRA 5FO5A 1HW2A 2DQLA 3D0SA 1I27A 1TD5A 4ESJA 2XV4S 1IN7A 4IPAA 4TV7A 3Q5FA 3DQVC 3R61A 3IHUA 1QO0D 4Q4ZF 4B8XA 3BZ6A 2W25A 1JE8A 2VZWA 5BOXA 1BI2A 4IJAA 1K79A 5L3BA 3NOTC 2W24A 5BMZA 4A6DA 2YR2A 3E6BA 3IBJA 2FEZA 1F9NA 3GYHX 1QQIA 3JSOA 4MEXF 5K5OA 1G3TA 1KU3A 4OU0A 2HGCA 3CI6A 1J2XA 4I01A 2ZO4A 4UNOA 3HUGA 3K1MA 2V6CA 2VOPA 2O6GE 2ESHA 4Z2YA 2IW5A 5LHGA 3CTAA 4LB5A 5ILSA 3SZPA 4RGRA 3CLOA 3MEXA 3HRSA 2FF4A 2O61A 2KOIA 3HOTA 4Y17A 1O3SA 4G7ZF 3E6MA 3CUQB 3LA7A 2W85A 2K27A 2VBYA 4EM2A 4EQQA 4U7DA 3W2ZA 2H6BA 5HVQC 3C18A 3OOPA 2V9VA 4O3MA 3MMHA 4RAZA 3S2WA 2R7FA 1YW7A 4XRFA 2ZMEA 3F23A 3LFVA 5F6FA 1U5TB 4HDUA 1XSXA 3KLOA 3DFGA 2VXZA 2ZFWA 4WCGA 4E04A 2PEXA 2A6EF 2CW0F 3C3WA 2IA2A 1XCBA 2GWRA 1IXSB 3F8BA 1J59A 1OR7A 2MH9A 3NEUA 2DK5A 2P4WA 4YNRA 1S29A 1XGNA 4AIHA 4P55A 1QPMA 2MC3A 2K31A 3WE2A 5AONA 4IF4A 1B1BA 4ENMA 2OU2A 3T5XA 2DFIA 3RKWA 5CVRA 3F8FA 2D1VA 1QZZA 5HLIA 4LMYA 5EEHA 4N9IA 4Y3IA 3MAJA 4UXNA 5DCMB 2DBBA 1YO5C 3QRFF 1UCRA 5CVJA 1VHMA 5ILVA 1OYWA 1SMYF 1ZGJA 1D8JA 3L09A 4G3VA 3I64A 5FGMA 2P5KA 3NQOA 1D3YA 1HSTA 3TDUC 1ZG5A 1CF7B 3TO9A 4OOIA 3RKXA 3M9AA 2IA1A 1USSA 3KCCA 2EFPA 1KYZA 1F5MA 3C7JA 3DBAA 4HF1A 1JHFA 4HZFA 2EFQA 4CZZA 4BH9A 2AXLA 1G3YA 5HDGA 4M72A 1ULYA 1YSPA 1QNTA 2W1TA 4BXUA 1B59A 3RYRA 2O99A 1WQ2A 2ACJA 1BI3A 4RGUA 1FSEA 3ZN1A 5FLXK 5L3EA 1LDDA 3S7NA 1Q1HA 3WG9A 2QM3A 3CDHA 2LF7A 4HBLA 2FE3A 1KQ0A 5K5QA 5JFRA 3HRUA 2PLYA 2O9BA 1IXRC 5LGUA 2NNYA 2M7UA 2CQKA 2O3FA 1HSJA 2HWVA 1FBQA 2ELHA 2BV6A 4L5JA 5FLXZ 1MGTA 4ETXA 1U78A 2Y8HA 5DFYA 4EGZA 1HW1A 4MNUA 1ZRCA 2PBIA 1Z6TA 2L4MA 2M8EA 4CXFA 1REPC 2XAFA 1R5GA 4PDKA 4PAUA 5ICFA 5L8MA 1HW5A 3WTYC 1G3SA 3GO5A 3M7GA 4YIFA 4WK8F 4G7OF 2F2EA 2HOEA 1TBXA 3ABTA 2Z9OA 4BWIA 4LJZF 2P7CB 2QQBA 3KO6A 4DMZA 2FA5A 4MDZA 1MDMB 4HW0A 2C6YA 2R7DA 4O01A 2CWEA 2XKPA 4MCWA 2EFWA 2VC1A 3I59A 3WTVC 3VV4A 1Z7UA 2YU3A 5HLHA 1FLIA 4M6XA 5HL6A 2O03A 4IUKA 5F64A 2VEAA 4LK0F
chains in the Genus database with same CATH superfamily
3FM5A 2COMA 3IXDA 1W7PD 1IF1A 3WGIA 4QSHA 4HJ4A 2R7QA 3L75E 3QNCA 3WS0A 1R6RA 5J6XA 4HSRA 1IYQA 4M9XA 4V2FA 4OQIA 3A2KA 1FZCB 3H1KE 2E1NA 2VLAA 3O2PE 4HDVA 5LRRA 4DJAA 3IXGA 4KZ6A 3M2KA 5BU8B 5APWA 5KAIH 2ZL1A 3BRTB 1RR7A 1GK4A 3K4LA 1LTJB 2IS6A 2VGKA 1N7SA 3QWLA 2K9JB 5AQ7A 4YXWH 2V8CA 3P9CA 3S1KA 1SQVE 5APXA 4BQAA 3KSFA 1N73C 2E75B 4MQ9F 2ZLYA 2KP6A 4H13D 3H0DA 3ASOH 5GPAA 3E6DA 3Q0WA 2F5VA 4CCNA 4UV8A 1VEUA 3JSVC 3PBSA 3JRBA 4KQOA 1IZ1A 4M71A 1S5LH 4PSWA 3U1KA 2G3AA 1JVJA 4QWQA 3KP7A 1R22A 2IZ0A 1IO4A 1L2PA 3OPLA 2YXRB 1RGZA 2HJEA 2OLUA 2LKXA 3NTNA 5EG0B 1BC8C 4PMAA 3BECA 3HUMA 2W3FA 5D6FA 3IS2B 2XF7A 3VP3A 2CG4A 1L4AA 1USTA 2EA2A 1EI5A 4B47A 1ETKA 2XPUA 2VL8A 5TRDA 1K4TA 3A0SA 2F5CA 2BOLA 2W57A 1QBJA 1W4MA 5KKZB 3QQAA 3B73A 2DMTA 1NTZK 1EW0A 4X56A 3CX5I 5D5WB 3ZQCA 1TW2A 4R23A 1ZQ3P 4P85A 5KAIC 1MBJA 3J7AO 1OT6A 1HF0A 4OGQC 3FMRA 3BDDA 1EXIA 3EEAA 4R3AA 1TL8A 2IEKA 1BGYJ 4QMAA 2KOGA 3H1HJ 5E8GA 3S3OA 4EETB 1LL5A 1LI9A 4EXOA 4LLGF 1TWAJ 3MKFA 3M06A 4ZZDA 2XDJA 2FUG2 4JBFA 2HPCA 2ECCA 3WRZA 3H3UA 4BL3A 1SQPG 3F6VA 2NVYJ 5J1UA 4BY7J 5EFWA 4WBGA 5LHHA 3O86A 2KIUA 2L4AA 1SFCD 1S5LC 3O3VA 2E35A 3RI4A 3O87A 4EEPA 1KONA 1S3JA 2J9PA 4C2TA 1AHDP 4R6LA 4YFKF 3U2RA 5KLVD 4YXDC 4KZ8A 4M74A 1RESA 1X58A 3E7KA 2JTVA 1XGOA 3MMYB 1LVAA 1Z1DA 1LE8A 1GUUA 1GA0A 2BCCD 4WY4D 2SPZA 4E3KA 2FNAA 1FSHA 3MQ0A 3TOBA 5L3FA 1B6AA 1H3QA 2XK1A 3ZG0A 1NRFA 3IAOA 5CJ0A 5KK1A 3OYBA 3RJPA 3G6OA 3LFUA 2IJLA 2IXSA 1KE4A 2XDMA 4CLCC 2PFXA 3FGAD 4IBRA 4XM3A 3MXSA 4Y99C 1S8NA 2HF6A 1ZELA 5EVLA 1CJFA 1P9QC 3IRQA 2PI0A 3DXJF 2A06G 4XKVA 5A90A 1DP8A 2JKTM 4PK4A 4Y7NJ 1WI9A 3OBFA 3EQVA 1P0ZA 1TWHJ 5HD5A 4C2MJ 1ZYRF 4G12A 4N1HA 3CUQA 1HC8A 4RA7A 3G35A 4JOMA 1D0ZA 3MFDA 3NAUA 4D5CA 2V6EA 2RH0A 1Z3YA 2E19A 4OMYA 1G6NA 2M9HA 5FLVA 3M6BA 5F69A 3CHWP 2F4MB 1H8MA 1L0LD 3EFGA 2RVCA 3WU1B 3EUKL 4ZAMA 2E71A 4A3CJ 1T95A 5E1XA 1BOBA 4ETSA 4F52A 5EVIB 1SAUA 2KLVA 4ASWA 5TISH 5KZHA 2FBWC 2R7XA 2B87B 1ODDA 2N9YB 2Z5UA 3CXHE 1HZOA 4DW6A 5AIQA 5H20A 3EUAA 2VJ4A 3A01B 4WEKA 1NKZB 3FWLA 4OONA 3IX3A 3ZGAB 3E98A 1FT9A 4IL6H 3ECHA 4NXFA 5FKNA 2L9SA 2DYRH 1KORA 2LNBA 5H6RA 3MR0A 1DU0A 1SFOJ 1NWQA 1OW6A 2HKOA 3V6IA 2DA7A 3IP4B 1UWPX 2FQ3A 1D0XA 1F9IA 3H5NA 2L0WA 2NOJB 1GK6A 4FH2A 2LD5A 1YJWI 4EW7A 4GCZA 5C44J 2LB5A 1GW3A 4OOLA 1OMIA 2G8YA 1K25A 2WZ7A 1NTKD 1XN7A 3GRJA 2I9VA 4L9EA 1IFQA 1W0TA 1BBYA 5A2QK 5AW1B 4KZ7A 3MN2A 2DMWA 3KHUA 3K3DA 4WXDA 1GHIA 3QP4A 1SQPJ 5B1AH 2RQPA 2Y69H 3H36A 4LLHA 1U60A 3MWMA 3SFZA 4OGQD 2ZJRF 1FCOA 2DDBA 1VF5B 4D7MA 1X2NA 2P7JA 1X1CA 3ABMH 3R60A 1YJWP 1D06A 3PL8A 4EESA 5GAEJ 2L54A 5TISC 3WUTA 1O3TA 1SD4A 2FZ0A 1WWXA 1MNDA 2LF8A 1X1DA 5F08A 1YW8A 1F1ZA 3N8LA 4Z6YA 1EA3A 3A7OA 4BUPA 2UWMA 3OMYA 1EZVD 1MFZA 4IL6C 1JWPA 3G31A 3MS6A 3NY4A 3BTJA 3BY9A 3L71D 2JSCA 3I5CA 5BNGA 1I1SA 4JBAA 2QHKA 2HS5A 1XFQA 2W3EA 1QVGO 4GDOA 3HXLA 1IJDB 3PAEA 2MJ6A 2VJWA 1IN6A 1XG1A 1ZRFA 2GUVA 2IPQX 1SDEA 3E6CC 1UELB 4EV0A 2C0WA 1JGSA 3CCMP 5JYPA 1AWIA 3F9KA 4NPDA 3Q9SA 2K88A 2VGLS 2VQCA 4BBVA 1TQIA 3O5YA 2Y0CA 2EIJH 4KZBA 1AXBA 2R7SA 2QUFA 3DPUA 4BHPA 3CCEI 1LEBA 2KNCA 1FMWA 4KICA 1W5CE 3H6PA 5L2FA 4D6TJ 3TGUG 4II7A 4IHTA 5B5EH 5DJUA 3Q82A 5GAGJ 1SP4A 4M3DA 3EQLF 4H8RA 1ZG1A 4U7BA 5AQ9A 1Y0UA 2P7VB 2KDOA 4FE7A 1RR8C 3VYIA 2PU4A 2WTYA 3QOPA 2EA9A 2H94A 3DTIA 4GDBA 1FE6A 5M5WJ 4DJ3A 4BD0A 1WYBA 2Q5UA 3IUOA 4GHIA 1R5HA 2YNYA 2HTJA 2N1TC 5KLVE 3RK3E 2FKWB 1NG7A 2FFDC 4S2JA 3P9KA 3RZDJ 3CCEP 3F5HA 2QYBA 1FOFA 3KP6A 4BQMA 2VIXA 4OIOF 3FG8A 3L73E 1FJPA 3DEEA 5FD6A 1TS6A 1M90Q 1KU7A 2FXPA 3V2PA 2EX6A 4GYGA 1RUNA 4XKCA 2ICWG 3L72D 3KZYA 2QJYC 3AEAC 5J7EA 4ZJZA 5F68A 1EWZA 2BG1A 3IF6B 3U9GA 2W82A 2Q2EA 3VOZA 1FP2A 2A24A 4FISA 5APYA 4H44B 3E2KA 1IV6A 4Z1MH 1G1IA 4KUOA 2NS8A 3MFXA 3E1RA 1HWTC 1R1UA 2HDWA 5CVVA 1HTZA 2DA6A 3WTTC 4C30A 4D5FA 3K4KA 2QBYA 1RF1B 1X22A 4RQ9A 4E3JA 1NTZG 5FL3A 1MIJA 5B5EC 5HAPA 2YO2A 5CYVA 2A6HF 4MGRA 4DYCA 2M5WA 3O6QB 3VEPA 3IR9A 2V9PA 1XGIA 4BDZA 2IDBA 1WJBA 1XX2A 3SHFA 2VJ5A 4GN2A 4OVNF 1SQQD 3LFKA 4R3BA 3OYDA 1TDLA 3IF4A 1E3UD 2VASA 3DCFA 3FXJA 1SQXK 2ZQCA 5KLIC 1AQTA 4FH4A 2E7XA 4ZYGA 3UE3A 1KFNA 2WPQA 4K0XA 2FRHA 3PNVA 4MEYF 4EATA 4DZJA 1RUOA 1FZFA 2XD1A 2KSJA 1ACFA 3NOUC 1AKHB 3FXUA 1FOWA 5AQBA 3P09A 1QEXA 2QJKB 4MTDA 3CWBG 1N7SC 3RSNA 1URQA 1J3WA 2OQQA 1GV2A 4XLPF 4I3AA 3U21A 2XUBA 2JUCA 3RBXA 2W3HA 1IUYA 4BEHA 4EEFG 2E60A 4D0PA 2FBKA 3OA7A 1QGKB 3UKGA 2Q9MA 3A0RA 1PGQA 4A3MJ 1BA5A 4UEYA 2UXXA 4HQMA 1S7EA 2QF7A 3L74J 3TGUJ 3PNTA 2XEPA 1Y4OA 4EJUA 4II3A 4YIRX 4P1WA 4XR6A 2VJIA 2E5YA 3FHZA 2V1UA 3HLWA 1XPBA 3TE8A 4EU0A 4RAFA 4LLNA 3F0CA 3OC2A 1I2WA 1QRYA 1L4AC 3LIDA 1JB0J 2YKQA 1A02J 2IVMA 1WCMJ 3GV9A 4HHDA 2WWYA 4K2EA 2EILH 2NYXA 2FOWA 1T39A 1PDNC 3SSUA 1SFKA 4EIJA 3HRTA 4JX6A 4HLYA 4LOCA 1BE3D 3K10A 3LQQA 4YEJA 4DKIA 4X53A 2K4BA 2GUSA 3H32B 1OJ5A 1VQ9I 3HOYJ 1ONGA 2EX2A 4R70A 2KIFA 1S9HA 5FQKA 4AYBN 4HKZH 3WTZA 4EEUA 1BW5A 3CF2A 1NU1D 3HOVJ 3TG9A 2A07F 4S0HB 1L0OC 3ZQFA 3Q1MA 4OPZA 1N25A 3F1PB 3N97A 1EH7A 2NS0A 3JC22 3FZVA 4P6ZS 3H5AA 4A3DJ 3EOIA 2LKPA 2HEOA 2MH2A 3L2CA 1VTNC 1NTZJ 3C1LA 1SQBE 1U9NA 4CICA 1VQ9P 2L7ZA 2WA0A 3D9YA 1ZG4A 3KLNA 3N8RA 4RKUJ 5APQA 4LGWA 1PWCA 4XIDA 4JYBA 3ULQB 4BMWA 1EZVI 4A5RA 3M9HA 1KQSO 3BJAA 1K4EA 4DDSA 1Z3XA 1JUMA 3C2GA 2GXBA 4EYYQ 3VYSB 2Z6DA 2NPSC 1FOKA 1KGSA 4EUZA 3QPTA 3CWBJ 1PFIA 1DPUA 2KFDA 2LLKA 4C7NB 1I2SA 3VOYA 1BCCG 1USDA 1SANA 4B44A 3GTQJ 3W2WA 2CPSA 1GU5A 3O8HA 3CMEP 1ZXGA 5JHFA 5AW9B 3D5RC 5L07A 3L4FA 4HB1A 3L2UA 2WSEJ 1LTAC 4BE2A 4R8HA 5HS9A 2M7AA 3CUQC 2ELJA 5GLCA 2CV2A 2RL3A 4IEJA 2K7SA 1V54H 3CCQI 1K6SA 1Z6FA 2W3DA 1FYMA 2OYHC 3HKZN 5KIZA 3KP4A 4KT5C 3HOSA 2IX7C 3WODF 3CMYA 2O01H 3HOWJ 3FHNA 2JHEA 5A93A 1KQ8A 5DKKA 1T8ZA 4PHTA 2W1TB 3I56I 4CQHA 2L2OA 1MBKA 4G6DA 4I2OA 4PJ0E 1G28A 4Q0HA 1HLUP 3BPVA 1M1JA 2E1MB 5CKTA 1LFPA 4MIMA 1FBUA 2WT7B 1FEXA 2LMDA 2P5VA 4GRIA 3CCQP 3DPTA 1T2KD 5DYMA 3E0YA 2N1TB 2P6SA 3U2AA 3BTLA 4K35A 1K55A 3KDPB 1K57A 4FUWA 3PP5A 5CHXA 5AVFA 3L2RA 1SQQE 3PIOF 2VGJA 4IRHA 1MDMA 2XAHA 3C2BA 3T1XA 3ZMDA 1CI9A 1W36D 4N4NB 4BE0A 5LHIA 3I56P 2NVXJ 5E3LA 4OPQA 2P9VB 4GKGA 3JRHA 1ON1A 2V7QJ 1D1AA 2QJYB 3GHGA 2DXIA 1U57A 4WVZA 3L75G 1XFNA 5HAQA 4BJTA 3H82B 2MFZA 1S1CX 3MFKA 1A35A 1TS0A 3CO7C 1PP7U 1BL0A 4M6YA 5LBQA 4QB8A 3J80Z 3A0BE 2OTJI 3AAFA 2FBIA 2GIVA 3JTGA 1KGEA 5GTHE 1NK2P 2Z6CA 2M7VA 1ZGAA 3L00A 1F43A 1SDNA 1D1JA 2KLIA 1UIIA 4O8GA 5IHVA 5K7FA 1GZLA 5HX9A 4DZPA 1ZR2A 2QGUA 5IOYA 3LUQA 5H2FE 1DU6A 3HCYA 1S1ZA 4KHXA 4Q0IA 3E2LA 3KP2A 3V8KA 1S66L 1VM1A 4KA4A 1BCCJ 4LD5A 5EE8A 4HRIA 1KFMA 2ZL1B 5AVYB 2EIKH 3LIBA 3HE5A 1J0RA 2OTJP 2EH3A 1G59A 2A49A 4UUTA 4ZTJA 3BQYA 2WBMA 3AG4H 2ZC2A 4YFXF 3U59A 3CJTB 3IL2A 1BE3E 3E5UA 3BTCA 2X1DA 2HLOA 4ZDPA 2ZT9C 1DJAA 2B0LA 5LEJA 1NHLA 2H1LA 2JCHA 3J81K 3JSPA 1PGPA 4UA9A 2NPSD 2K7LA 4A0ZA 3CG5A 4LPZA 3I3LA 4ZNCA 1MKIA 1PWDA 1X4OA 1VEUB 2YKFA 2WAFA 5EDNA 3K2AA 4X1LA 2Q9IA 2ZM0A 3ZQIA 4RJTA 1RKWA 5HS7A 2BVLA 1OYIA 3S32A 2VQGA 1WVRA 1BI1A 3JRIA 1OW7A 4WMCA 4QLCU 5EVID 1PGOA 1WE4A 3UPOA 3HBRA 1FTTA 2EZIA 2R3SA 2RN7A 1ESUA 3F1OA 1DEEG 2MA3A 3V42A 4GNUA 5D5XB 1XC5A 5E1ZB 1N9LA 3CJNA 1FC3A 1I6XA 4NETA 1QZEA 3LGOA 3FISA 1ETWA 3KYEA 1JY2P 2Z2SB 1KGGA 3IQAA 1BGYD 1JTGA 2X6XA 2WGWA 3H1HD 4ESBA 1LWUA 2Y2OA 4PM8A 2QJ5A 2K86A 2E74C 3KSGA 1L0EA 2XAQA 2KIQA 2E8JA 2Q3EA 1DPRA 2ZFCA 5G18A 3CLQA 3BQ8A 2IS1A 2ISYA 5AJGA 2HPCB 3RQIA 5HDNA 2JE5A 3ULFA 2O8XA 2VKVA 1BTLA 3MD2A 1P4WA 3WMM0 4ID4A 2E76C 1X3WB 4XNFA 4P9FA 3MZYA 3ZN0A 3AE2C 5CHJA 5EFWB 1XDSA 2ZNYA 3PO3J 3CCYA 3H1JE 3GTGJ 3MKEA 2HJ9C 1JOCA 1VZ0A 1GT0C 1SVMA 4EUVA 3BYDA 4IO9F 3AGFA 3OSFA 3IX8A 4AYBA 3ISGA 1VF5D 5F6AA 2DTRA 1GMJA 4CYCA 2MABA 2WAQN 2YSRA 5HDCA 1HW2A 2XV4S 1LE8B 5EOEA 3GTOJ 3H9WA 3FXDA 4PJMA 2R44A 1Z21A 5TBMA 2VPRA 4A6DA 2DT7B 1G5UA 3E6BA 1F9NA 5F0CA 4QPQA 1KTMA 5FKKA 3JSOA 3HUSA 4E4HA 4MEXF 4M3FA 1ETVA 5K5OA 3FKVA 2DA4A 4I01A 4HNVA 2VRSA 1HVBA 2KK7A 1LL9A 4IOAF 4X6TA 1P97A 5EF6A 5LHGA 4HQAA 4LB5A 5E2FA 3SZPA 1T19A 3MEXA 4B3XA 2D01A 3HRSA 1URQC 1LSXA 4KQDA 1XA7A 1SZVA 3BG9A 3S1MJ 4OLGA 1MUUA 1M56D 3H7WA 3V50A 3CUQB 3H1LE 4E6KG 4MN4C 4U7DA 2K5CA 2K9NA 5HVQC 2W6AA 3C18A 1SQXJ 2V9VA 2R7FA 3GBGA 3F23A 2ZMEA 1USEA 1ZMEC 3FXEA 4JPMA 3IH4A 5CCGD 1IK7A 1DJCA 1IC8A 2XF3A 4E04A 3NI9A 1KILC 2IA2A 4BY1J 1J59A 1OR7A 3NEUA 1KYOH 5FI7A 2A3UA 4YNRA 2NUTC 4AIHA 3A3JA 3PTEA 1QPMA 3CMAI 2J80A 2AXCA 1XTGB 2XR0A 4JXWA 3LIAA 2DFIA 3RKWA 5CVRA 3S2DJ 3SH9A 4Y33A 1QZZA 1XJ2A 3HKZA 3HL2A 2K9MA 4N9IA 1Q7YQ 1L2SA 4Y3IA 3T4KA 3CD6I 2C0XA 2PHYA 5GL9A 1WJCA 3MKLA 3DBRB 1GW4A 4UB8E 3QRFF 2MYSA 2UV0E 3G4SI 5CVJA 1VHMA 1SMYF 2QSGX 1D8JA 3L09A 2M0CA 2P5KA 1D3YA 3F1NB 1FILA 3OYGA 4OQGA 3RKXA 3M9AA 1SQPD 3CP8A 2EFPA 1MZUA 1KYZA 5E43A 4GIFA 5DM6F 1C3BA 2C5WB 1G3YA 3ITAA 4BGDA 3CMAP 1R71A 1BT5A 3M2JA 3BQZA 3LYXA 4ZMDA 1Y0NA 2HXOA 5CCHD 3RYRA 2ACJA 3HGGA 4B4ZA 3M0AA 1FSEA 3ZN1A 1TU3F 4E3MA 4H44D 4N78D 4DE3A 4XMYA 3WG9A 3CDHA 2BY0A 5FKOA 1LSWA 2RQQA 1DY6A 2FE3A 5K5QA 1FDIA 3HRUA 1GL2C 2NNYA 2OARA 1FU1A 2M7UA 3LICA 2YXQB 5FATA 4LIVA 3TK1A 2ELHA 4ETXA 1U78A 2I72A 2Y8HA 5DFYA 1HW1A 2B89A 2PBIA 2M8EA 2E76D 2VV8A 3SFEC 1A5JA 5ICFA 2J7VA 3WTYC 1G3SA 4YIFA 2B7EA 1HTLC 2HOEA 5CBOA 4ZJ2A 2IS2A 5FQIA 1ZW0A 3BG7A 5HARA 3FDYA 2P7CB 2QQBA 2IPPA 3KO6A 3S4XA 3UB5P 4IHWA 3EGXC 4X0GA 3S22A 5M19A 2C6YA 2ZSIB 4B48A 2XKPA 5JYOA 3HDDA 3VV4A 4ZJ3A 4GKUA 2ZB9A 5G4YA 1FLIA 1BGYE 5FQ9A 2O03A 1Y8RB 3H1HE 2Z1DA 4K0WA 3EFFK 1RH5B 1L0ND 4PD4E 1YT4A 1EDJA 3FPVA 3RL0B 2V1BA 3IKVA 2KNCB 4JF7A 3QP6A 4QWOA 5AW8B 2DFEA 4OH8B 4Z9QA 1BLPA 3HD7A 2H89C 1Z9CA 1Y8QB 5DJUB 2XAGA 5F27A 1RIOH 3GF2A 2Y2MA 3OPPA 3IFMA 4IFMA 1PWGA 1KD1Q 1XD7A 4ON0A 3V2RA 3BJOA 1PYVA 1LT9A 3VE4A 4J01A 1IYOA 2VJJA 4S2PA 1B72A 4NBQA 3IHAA 5K5GB 4EERA 4B4XA 1J1DC 3U1CA 4Y0OA 4M9SA 2CH0A 5KVRA 3C38A 3KX2A 4GHIB 4LV2A 2XA7M 2IRFG 1Y39A 1N4OA 3LSKA 1KN7A 1IFIA 3UDFA 2R7UA 4D7NA 4FETA 2DPDA 1RHZB 1WJFA 1K55C 1K57C 3MSHA 2WADA 3BZCA 3IWOA 3S1NJ 1G3WA 1VFCA 3L9FA 2W3GA 3T4LA 4ETZA 4FTXA 3KYCB 3V4WA 1P7IA 4N92A 3CCRP 5EGOA 2OLVA 3F21A 1CI6A 2Z16A 4AM3A 2F5DA 2JKFA 4OPYA 5AVZB 3GMAA 1G2CB 3P32A 3GHGC 4FX4A 3F6OA 1E0EA 1ZRDA 2Q2EB 2DNSA 2A24B 1A02F 4KIFA 3TDZC 4H6JA 3QODA 3ZQHA 2ZM2A 1FQGA 1SEUA 3LW5J 2D2WA 1IKIA 2V8FA 2STTA 4B93A 3QU6A 1SKOA 2XF6A 1LQ1A 3L2QA 2QBYB 1NLYA 2M8RA 1BZAA 3A0VA 4XA4A 3LOCA 3MP7B 1NTMD 1Z91A 2CGPA 2R7VA 1KB9H 3LSTA 4W7ZA 3CMMA 5E17F 4QPOA 1TP4A 2Y2KA 1WJ5A 5ERIA 1F5TA 4H0LC 2R7OA 1XGJA 2P5LC 5KMWA 2OSUA 1Y1VJ 3ZOBA 4K91A 3T1RA 1CGPA 2CMPA 3SS5A 4JYKA 1FSWA 3QPHA 1EF4A 3GWZA 3TQNA 3GZNB 4ZYHA 2INWA 3V67A 4RAYA 3HIFA 2DCFA 2IA0A 4YRVA 4KJZA 4BBUA 1T33A 4PFPA 2K40A 2HYGD 4RLQA 1E2XA 3HOZJ 2QQAA 3V7RA 3KEOA 3BOQA 2G9WA 3SS4A 3FM3A 4CHUA 1S7AA 2WAQA 4L75A 4BEHB 3IH9A 1YIJI 1XGMA 2JA6J 5F1GA 3Q0UA 3FV7A 1I5ZA 5M5XJ 1KE0A 2QJPC 1YQ4C 3MXQA 1YS7A 4GT1A 1P7JA 1P84D 2Y9YA 4FSFA 1UAAA 3LNQA 4PKYA 1SQPE 1T1BA 1VQ7P 2IS4A 4HX8A 3JRFA 4AIKA 3NCKA 5B66H 2IP2A 1LDJA 4OMZA 1HD8A 3CC7I 1Q90D 4A6EA 2K9SA 1W2BO 1K54A 4N78E 3RK2B 1EDKA 1E17A 1DD3A 3D4FA 1YIJP 2WKEA 2IT0A 1YYCA 1YM1A 4XLHA 3RXXA 1W7FA 1NYYA 1QHHD 1FAVA 3SOIA 3W4OA 1S5LE 4B3AA 1GXPA 1S0WA 5F83A 2DFHA 1S5LX 2OD5A 4NNJA 3L35A 5DFXA 1O4XA 5IYCJ 3ZCZA 1IRGA 3MZDA 3S1RJ 3R0JA 1RGYA 3VP8A 2GZWA 2PG4A 1WHUA 4WWCA 1J9MA 2Y0SN 3CC7P 5C5KA 2A06E 3QYFA 1Y9BA 3S17J 4UB6H 2RKHA 3HEFA 3W6VA 5HDKA 2CV0A 1Z09A 3BR1A 3JRGA 1FIPA 2FYUK 2RC4A 3UPPA 1NTZD 3SFDC 4CLCE 3GW2A 1GXQA 5EM1A 2CYYA 5ILUA 4X1MA 1O3QA 1NK3P 4HNUA 4EJVA 3KE2A 3B02A 2NOGA 1H8AC 1P9WA 3I4PA 5J4YA 2PQ8A 1K38A 3T1BA 5B66C 3LQRA 1IDYA 3K0LA 3OS1A 3QPLA 3E1IA 1ESIA 3I4NJ 1JMBA 4D6TE 1YE9A 2LBFB 2DMPA 3I0TA 2A45G 3HOXJ 1SFCA 2XDVA 5CPRB 2EZHA 2D02A 1J1EB 1ZN2A 2FMLA 2E2HJ 1BJZA 1UFMA 4WN5A 4UV9A 2R92J 1ETXA 3ECOA 1CF7A 3HUSC 1J75A 1ZH5A 3C1DA 2E34A 1L0FA 1T0FC 4HBUA 4NEED 4LGDE 3E3VA 5KSHA 4B1RA 4WY4A 2DJIA 4Y3OA 1U2WA 1BJAA 3R7WA 1AJYA 4L9NA 2D2CD 4AYCA 5CTMA 4BBTA 1JY2N 3CX5H 3LIFA 3RK3B 3B42A 4G3WA 4HG2A 1YPRA 1MZ9A 2DOAA 4UB6C 2PR5A 3WTUC 1ZREA 3H1ID 3JR9A 3D72A 2L02A 5CMZA 3AEEC 2CUEA 3GSGA 2IYOA 3J7YJ 3GVAA 5E2HA 2PJPA 3F8NA 1FR1A 2PU2A 3VFFA 3VP4A 4L18B 4IVKA 2ZJ9A 2DCEA 3M8JA 4G3KA 1JCCA 1YSQA 2WV1A 2KLOA 4B43A 2QSHX 1LT1A 4BLMA 3BG6A 3OYKA 4DXBA 1ODVA 2QCOA 1H8ZA 4MN6A 1OR7C 1H89A 1M1JB 3R2PA 3CQZJ 5KAFE 3QYEA 3OV8A 4N3YB 2EK5A 1JTHA 3II6A 3OPHA 3GTJJ 5CTNA 4B9OA 3CCLI 2WPVB 3ZMSA 3WU0A 4BU2A 1YFHA 2KPMA 3CCSI 4Y28J 5TISE 4EOTA 4MTEA 2PMHA 2L4RA 1J7KA 4XLNF 1KB9D 3OR1C 2DW4A 3CCVI 2GIZA 2KLUA 5AVUB 4A3GJ 3OLOA 3N4MA 4O7DA 2ADUA 2AEMA 4BRYB 3GHGB 3E5QA 2WVRA 4IL6X 4ZZLA 4MMNA 2HZTA 2FU4A 3ZXSA 3L70G 4IJGA 1GSXA 2W00A 2WV0A 1X4PA 5L3DA 1SFEA 4W97A 5GADJ 2BXZA 5TGFA 1STZA 4KUKA 2LR8A 3C4PA 4LK1F 3COAC 5DF8A 3CCLP 4Q0JA 3F8CA 1X1PA 3AG2H 2NRGA 3RXWA 2O5RA 2IWDA 2QWWA 5HS8A 4BJPA 3L74E 2M3EA 3TGUE 1H0MA 1V4RA 4R1HA 1P84E 3HTUA 4A3LJ 3Q5PA 1WFXA 5BVZA 1PIXA 5D4RA 5KTBA 3RH8B 3JRCA 2WMMA 2XFTA 3F22A 3ISPA 4H0LB 1YLFA 3NRVA 3RZOJ 2DDAA 3H92A 3QHYA 4DE1A 3JYIA 5HOOA 3JRAA 3CI9A 2ZCWA 1SFUA 5D4SA 3ZVTA 3DEWA 2PX9A 1IAWA 2L1MA 3N4XA 3MKZA 3HBLA 4A5NA 3HE5B 5BS6A 1T18A 3NHQA 2WSFH 2WITA 2K9QA 2IBDA 2Y2QA 4ENJA 2MG4A 4WWIA 3BCAA 3TW6A 3JW4A 2LYCA 3E97A 1K61A 1BYWA 1ZR4A 2L3DA 1KYWA 4FHTA 3UE1A 1P92A 1IV8A 4XBFA 1RP5A 1L0LK 1EV7A 1DP6A 1JWZA 1DUXC 4WX9A 2HI3A 4HNTA 2XPVA 1DH3A 3WE3A 2PR6A 3LAJA 2ZNZA 1FC2C 3ZGKA 1P84I 3Q5SA 1ONVA 1ZARA 3N05A 4DDYA 1JY3O 4A3KJ 4OAZA 4XLAA 1VQ5P 4LG0B 4FCFA 3W6KB 2OQGA 3BZKA 3HD7C 2CV1A 1W79A 2HYJA 2CSOA 2X6OA 2G2WA 1W5TA 2WY8Q 3SS3A 4ZTKA 1LEAA 1U7MA 4LLOB 3F1OB 2M0MA 1LT9C 4BDYA 2JA7J 5H6QA 5DKLA 4L9FA 1SD6A 5IY5H 1YITI 1DX7A 1DJBA 5KJ7C 4U88A 2IBZG 5D5VB 4D60A 4LG3A 1HGZA 3HOUJ 4TT3H 5DF7A 5IPAA 3WUUA 1OCCH 1OT9A 1M1EB 1NTKK 4I1LA 3U1AA 1MSEC 4OH0A 3PIPF 1VQ4I 1R5SA 2VODA 3G71P 2WGWB 1OYYA 3H1JG 1LWUB 3ITBA 3L75D 5EEAA 2NVQJ 2VOOA 3CWBE 5AW6B 3L70J 5M1BA 5HLTA 3LMMA 3K4CA 2FYNC 5IS1A 1Z0XA 1T38A 4I7ZB 1GU4A 1YMXA 4R79A 5K7ZA 2Y91A 1YITP 2VE8A 5EV0A 4DNCA 3GTPJ 2VPLA 1W2EA 2R5BA 4WL9A 3WHBA 3FX0A 2YPRA 2JBFA 2E5ZA 1LGHB 4ZBEA 1HDPA 4Y0TA 5FRMA 1UB9A 1PP9G 4D2OA 5CXWA 3CZ6A 3DBHB 3DV8A 2ZQDA 1YRNB 2J3TD 2W84A 4XRSA 3HLFA 3GEZA 2QKLB 1FX7A 5E8IA 2CQXA 1SQVD 1ERDA 3TRCA 2M45A 5DD4A 2O1KA 1JKRC 1OQYA 2Y0SA 4KFCA 1IW7F 5FB2A 2XVCA 4UA6A 1NTCA 3V8LA 3CP2A 4YWZA 2GQQA 2O9LA 2ZAEB 4NC6A 3H1LG 3BTIA 3PH0A 3AEDC 5CLSA 3O6BB 3KSHA 4CSWA 3RIRA 2HG5D 2LXBA 1SD5A 3UB9A 4I76A 5JR3A 4L9GA 3ZNYA 1WPKA 2XF5A 3IC7A 3KZIC 5F0HA 4X55A 1SKFA 5AVSB 1DD4A 2FYUG 2YIUB 3NC8A 5J3LA 3E7LA 4LCLA 5D8KB 4JQFA 3EUHC 3L36A 3H7WB 2CK3H 3DU5A 4PJLA 1KE3A 4FQGA 4XQFA 3OYIA 2JDIH 2I1JA 2JKVA 2CPBA 2MSYA 2PJRA 2KS1A 4BL2A 4MN7A 2ZMEB 2X6WA 2F5FA 2XAJA 4XT2A 5DTDA 3OYEA 5E2GA 1YG2A 2O8KA 4X69A 3T4QA 4H13C 3RL0D 5AIPA 3CCJI 1HH0A 5AVEA 4O9BA 2VN2A 3BASA 3T1SA 2QQ8A 4GGGA 3GF3A 4PKYG 2IWBA 1X1BA 5BPIA 4IVIA 2JVGA 3G2BA 4F93B 2A6TA 2LK2A 3K3CA 2FSWA 4MBHA 4JP0A 4AD9A 4KDPA 3TW7A 5JHUA 3H1JJ 3OYCA 3UO9A 2K3FA 3BY6A 3JAMZ 1T6AA 1KB9I 5A2QZ 1IFNA 1J2JB 2TDXA 1YX3A 1BCCE 1OX3A 2BE5F 1B9MA 5CBNA 3CCJP 4DBRA 4BBSJ 3F72A 2XQZA 1I1GA 4HOBA 1RNLA 3CC4P 4IHQA 4HNBA 3QU3A 5KJ7D 3CZDA 1WJDA 1R9TJ 4KZ9A 3H0GJ 1TS7A 4BBRJ 1PP9J 2GZAA 2DODA 4GOGA 3ZQLA 2VE9A 4G94A 2JPBA 5LRSA 3KETA 2HOAA 2DRWA 1ONHA 2DAOA 3RGUA 3I7JA 1VQLI 2PBYA 1T08B 2ZQAA 3FMQA 4GYIA 4GCVA 1M1KQ 3UB7A 5GHYA 3U4LP 4H0EA 1YLJA 3H1LJ 4GD8A 1RETA 1ENHA 5J4EA 2CC1A 3MKYB 2J9OA 3IH2A 1R8EA 1SFCC 2DI3A 1GHMA 4ESFA 4A7PA 3RBZA 2B63J 5C3EJ 1RRJA 4DYRA 4O6JA 1W63M 2PMUA 3V4QA 4PV1B 4GB7A 5FFZA 2PP6A 2FYUJ 4Q5SF 1G1JA 2QENA 3H5RA 5CEBA 3J80K 2EV0A 1JNUA 1B8IA 1WRGA 9ANTA 2G7HA 4WY4C 3N8SA 3CXHD 4ENKA 4OP8A 3FXKA 3G30A 1VQLP 1NAFA 3K1PA 2HP9A 3E5XA 1W8QA 3MQQA 4MN5A 4NC8A 1JJ8C 1CF0A 2BCCG 3W68A 4BQQA 3JCUE 4RA2A 1UZCA 5HFOA 3L2WA 2KDZA 4IBXA 5L10A 1K73Q 1WGXA 1RKTA 4FX0A 1K05A 4HSTA 5GP9A 1XSDA 2HYNA 3UPNA 1K4SA 1OIPA 4G6QA 4U0VA 3HD7B 3EQUA 1TZLA 5GAHJ 3L7WA 1D8KA 2CO5A 1EC5A 3KYLA 3ABLH 1YKDA 2RDPA 5LGNA 4ZDLA 4Y2FA 1NAYA 1LT9B 2MC4A 3G73A 2M8GX 3OYLA 1H89C 1B72B 2EX9A 2OYIB 5FAPA 4MLLA 4C6YA 2CFXA 1NLZA 1FBSA 2YO3A 3P9IA 1LKXA 3RK2D 1Q2QA 3L9KA 4XK4A 2ME6A 4BQOA 3J7ZI 1L0LG 2IGNA 3NFQA 3L7HA 1F4KA 1NU1K 2KYVA 3A5TA 2KZGA 4NQWA 5IU1A 1TC3C 2WZZA 2MJZA 4RMNA 2KZJA 3C2WA 3BFEA 3RCOA 2DA1A 2UXNA 1SVLA 5EGOB 1T2KA 2WKIA 1CI6B 2HOTA 3BJ6A 2KQRA 4QPRA 5F1RA 4HEA2 4A12A 4BXLA 1IELA 4EI2A 4E7ZA 3S7PA 4HYEA 4BENA 4U0TA 2AXTE 4H6JB 1BDCA 4V2GA 2NUPC 5FEGA 4YELA 1PUFB 2A2LA 3PFYA 5CQEA 3ITKA 3TO6A 1Q86Q 4M4XA 5EYRA 3E4OA 4EJOA 4N9KA 2HYFA 2V9AA 3L37A 1T1CA 2XH9A 1SQXE 3ZPLA 3UNWA 2NVTJ 3IAS2 3UN7A 4HF0A 2Y0MA 3P98A 1YLZA 3C5AA 3ZMUA 1ZRTD 2LG4A 4DOZA 4ZYEA 1TF1A 5CGSA 1N75A 2HDUA 2FD5A 1ZOYC 3JPUA 3HLCA 1MJ9A 1U0JA 2CQNA 5IT5A 5HSQA 1S1YA 4XL9A 1OJGA 4I0BA 1AA0A 1YJ9I 3I55I 3BP8A 1X19A 1IK9A 1LFUP 2MLKA 4WB4A 4WEJA 5AQAA 1R7JA 4R4RA 2W6BA 2BYVE 3SXYA 2K2NA 2JJ7A 2NAZA 2HP6A 4U0YA 4QTRA 3HJEA 1OPCA 3RKYA 2E2JJ 2Z4EA 5LGTA 2JVHA 4R4LA 4LIUA 5DV5A 2BCCJ 4KG2A 3HYIA 1OTBA 3I71A 2WKQA 3RK3D 5J4VA 1EZVG 1UIXA 4OVDA 5FO5A 5TR7A 4MFDA 2DQLA 1Z67A 1I27A 1VL2A 4ESJA 3L73D 3EWKA 4TV7A 5A91A 3FIWA 3DQVC 3I55P 1OZHA 3KEYA 4H13B 3BZ6A 2W25A 1JE8A 1VETB 3B5ND 4I2LC 2B95A 5EPHA 2NPSA 2YR2A 4UQIS 2FEZA 4PJ0H 1QQIA 1KU3A 5APSA 1A6QA 2X48A 3S1QJ 4A3IJ 3QP1A 4I5SA 2O6GE 2XKMA 2ESHA 1Y54A 1TT0A 3KIOA 3CTAA 1E3PA 5ILSA 1L0LJ 3CLOA 1SVFA 5GTIH 3KPHA 5EVIA 2GOXB 3CMZA 4CCLA 3HOTA 3MXRA 1TEMA 2GLOA 4G7ZF 3E0JB 2LXCB 3E6MA 2MKVA 2W0NA 2OYHA 5FI2A 2VBYA 3HLDA 1BUEA 2CUZA 2CJJA 2Y2HA 3B71A 2H6BA 2JJLA 3FXLA 1GTWA 1OVVA 4NXGA 3OIQA 1KGFA 2ZC6B 2LKSA 1BR4A 4RAZA 3S2WA 1BSGA 1PW8A 1K56A 4BWNA 4XE5B 4IEDA 2QZ6A 5F6FA 4D6TG 2UUZA 4HDUA 2EFUA 3KLOA 3VE3A 4JYCA 2VXZA 3S15J 1FOSE 4WCGA 3BCBA 2PEXA 2A6EF 3UDXA 2XGEA 1XCBA 1IXSB 2MH9A 2DK5A 1IDZA 2P4WA 1S29A 3JRDA 1BLSA 2QEXI 1NTKJ 4NKPA 1HJ0A 2MC3A 1V5GA 4HBTA 3ZYTA 3LSGA 5AONA 1PRQA 1B1BA 2OU2A 3F8FA 1IKGA 5HLIA 4LMYA 4RAGA 2BW3A 1PVEA 2DBBA 3A0HH 1SFCB 1YO5C 2FX0A 3V5MA 3L72G 5ILVA 3FXOA 5FRNA 5DJTA 1T3JA 3CF5F 5FGMA 4PPRA 4XRSG 1CF7B 3VMZA 2K9YA 3AGDA 3TO9A 1MMGA 5GTIC 4OOIA 3AL0B 3CPTA 2IA1A 3KCCA 2WGVA 1N9BA 1RQVA 1PPJG 1KILE 4XONA 4HF1A 5KSCA 3HLGA 4BH9A 1IFJA 4WY4B 2AXLA 5HDGA 4M72A 1XXMA 3CXHI 2QEXP 4BXUA 2AVXA 3R7WB 2KIKA 2JWAA 1B59A 5AW3B 1WQ2A 3W3CA 3DU6A 3PUFA 2TRTA 4E3LA 1A31A 1LDDA 3B6AA 3W4PA 2HPIA 5GHXA 2AEJA 1PI4A 4E7IA 4M3BA 1KQ0A 2PLYA 5FSRA 1H5XA 2WY7Q 3SJMA 3C8VA 4BACA 1KV4A 4FCYA 5FLXZ 4L5JA 2BV6A 2JN7A 2HOSA 4A93J 1QA6A 3D6YA 1ZRCA 5J1RA 1ZV8A 2OF7A 1MSFC 1REPC 2JA5J 1GV5A 5IOZA 3WRTA 3MZEA 3NULA 1HOMA 4G7OF 3ABTA 3A0HC 1LUJB 2VX8A 3K6GA 4LJZF 1GCEA 3Q81A 1N73B 2F4IA 2FXOA 3PBNA 1SQBD 4MDZA 2ZVNB 1ZRTE 2R7DA 4E7LA 5TJHA 2EFWA 3G6EI 4HP9A 5TFQA 3OYNA 3O8GA 3PJSK 1E3HA 2V2FF 5HLHA 1BLHA 1KYOE 3JVUA 3CESA 3BW6A 2WZXA 2DT6A 3VWBA 3L74G 5I94A 3G9RA 2OQRA 5JVGF 4JF5A 2B5RA 1XA1A 2XGDA 1RI7A 4HYTB 4F7ZA 2OCCH 1U6GA 1YX5A 4CCKA 2GA2A 2YKPA 1U9OA 4NDLA 2PYRA 5CGXA 3R0AA 3B3XA 3TYYA 1PNEA 3F8MA 4P87A 2XHKA 1NYHA 2GM4A 4IHSA 3GX4X 2KJBA 5CCHA 2K3RA 1NU1G 3L72J 4OGQB 2EV5A 1PUEE 1MY8A 2WKHA 2ZC5B 3V5BA 3FBIB 4OWFA 3IKTA 3ONQA 1ZHFA 3T8TA 4AVPA 3S1YA 2D5VA 2J5UA 3RDIA 1VB6A 5E3MA 3SDBA 4O0PA 2RN0A 2L0KA 4GS9A 5EUAA 2JKRM 4C7RA 1P6RA 3FKWA 2Y9ZA 3SZTA 1YLYA 3VP1A 4EMSA 3I9V2 3CJRB 4WZ5A 3RJUA 1RQUA 2PD7A 4C3IJ 2J59M 2L9NA 5HNHA 2ZQ8A 2R5ZA 2IFMA 2Y2PA 1IC2A 3MKWB 1FZCC 2COBA 2HODA 4M73A 2JMWA 1UG0A 2VBXA 1EDLA 2WC2A 3HTKA 4EQ1A 4PM6A 4ENNA 2HVSA 2BBYA 1AKHA 1O57A 2HV1A 5HDDA 1U8BA 5HWWA 4Y52J 2I10A 1FOXA 1LL8A 4ITVA 1LTJC 1BIAA 1E3OC 1G8XA 1JY3N 2GNXA 2WSCH 4Q48A 2O9AA 3BR3A 4FTHA 2JKTI 2LY9A 5TJJA 3EEHA 1NXYA 1O3RA 3DKYA 2E75C 2LKMA 1E25A 2NRAC 1J5YA 1K04A 5FA7A 1FZAA 4CLCB 3LO7A 4MFEA 4ZRRA 4Y99B 2VGLM 5EECA 2V26A 3AE6C 2W83C 5CX7A 4ASVA 3LEZA 1RF0C 5C39A 3KSIA 2M5AB 1ZTRA 1VQ6I 4IVNA 2QQ9A 3DTKA 4X1EA 1NOHA 1T6SA 2X85A 3LSRA 1JNMA 4Q47A 3HVFA 2B9SA 2GBYA 3QH9A 1HDDC 2HNHA 4UB8H 3V4GA 4AUWA 4JPZB 3DWLE 1OISA 3GTLJ 1X3UA 2R3CA 1T2KC 1AOYA 4EQIA 2Y0EA 2Y2JA 2V7FA 3DF8A 5CERA 1MBEA 3PTZA 4I3JA 3OY9A 5DM7F 4BYYA 5KKZC 2ID6A 4AIDA 3C9IA 2BASA 1KILA 3RTYA 1QL2A 5ICGA 2R32A 1AU7A 1VQ6P 1DGRM 1W36C 3LA3A 2R5YB 2H8RA 5AVWB 1MMNA 2Z3YA 4QD4A 2FFYA 1DDNA 3H25A 2GA1A 2H6CA 5A92A 2F48A 3SWYA 1NU1J 4L76A 1FZBA 3F1PA 4UVBA 3P7NA 4RGXA 3TSIA 1RZ4A 3VOEA 2WYXA 1YTZT 3IRRA 1W5DA 1ZG6A 2QYOA 4DGWB 4UVAA 2JWTA 1JUSA 5D6EA 3S2HJ 1IYPA 1A04A 3FMSA 3BRVB 4OIQF 1NHAA 4BS9A 3TW8A 4UB8C 4UUSB 5E2EA 4PV1D 1H9GA 3VMAA 3BLYA 2GX5A 3ICYA 1BOAA 4D1QA 2OOLA 5AW0B 3REOA 3GTCA 1SAXA 3HGYA 2F6CA 5ICCA 1MWUA 4ASNA 2R4GA 2EFOA 4GLQA 2CQQA 3OYHA 4LV0A 3MD0A 1L0NK 5GHZA 1GL2A 1JKPC 4UVCA 2PJRB 2KS1B 2RKLA 2W6JH 1H88A 5MC7A 1R00A 3K7AJ 3TNUA 3BLSA 4C2UA 2KRHA 4XT2B 3H9JA 1PFLA 5DCMA 1Q1VA 3UDIA 4HAMA 1V55H 2ZJQF 4E6XA 3WGGA 3ZFZA 1VQ8I 1TW3A 2N8GA 5KNLA 2IBZD 2PN6A 4NUBA 1N7LA 1LTSC 3SDGA 1DP3A 3H9QA 1U7JA 3KP5A 1AWCA 3S93A 2DQRA 2ZMAA 3BC8A 4EBPA 1M8OB 5AVQB 1V9YA 3PQKA 1TDGA 2DFFA 1HBWA 2IZ1A 2Y2GA 1VQNI 1JTDA 5FQMA 4BJ5C 2X1EA 3H1JD 1YYVA 5EVIC 1OTDA 2LRDA 2C9NY 3GFIA 1HBXG 1LP1A 2XIGA 5J8FA 4AC0A 5B66E 2H28A 3P8CE 2Q9NA 5C4XJ 2E75D 3T1QB 2GDNA 4L9TA 1Q2PA 3FBNB 3E4PA 4EJWA 3OIOA 3DWZA 3RFBA 4CH7A 2WT7A 1VQ8P 1EXJA 3ZQGA 3T8RA 5GLDA 4II2A 5LEKA 1I3AA 3VYUB 1PP9D 3KX0X 1ETYA 3ZQ7A 3IT9A 1PYYA 1OVUA 3HZJA 1VQPI 3K4NA 4BL0B 2ESNA 1WYCA 2J5PA 1VQMI 4KNYA 1VQNP 1K4FA 3TSGA 3OOUA 1TWGJ 1SLQA 1NTMK 1KQ9A 2Y75A 3TOIA 4HJ6A 1LNQA 2P10A 5FLMJ 1ES2A 2W4SA 2A45I 1XMAA 2Z5HA 3W2AA 3UY6A 1WSUA 1NWZA 2FFDB 2QSFX 4S04A 3H1LD 5JLWA 1MFTA 1NJIQ 4DJGA 3LI8A 3H82A 4DZOA 2WSCJ 2JKRI 3RTRA 1MJAA 3HE4A 3ERED 2ZYAA 4AQRD 4P6ZM 1T1AA 1JUPA 2HQNA 1I5QA 2J8YA 1VF5C 3C7UA 3DTMA 3OOVA 3B47A 5E79E 1LJ2A 5FKLA 1BSHA 3TL4X 1R23A 3V8JA 2JEEA 3GR2A 2HPMA 4U87A 4L5IA 1HKTA 3PQJA 3I59B 3ABVC 1ZLLA 2FMYA 2YKOA 3NBLA 2J5OA 2QM8A 3S4RA 3AE5C 2ZBKA 1VQKI 3CUOA 4OKPA 1IN8A 2XRNA 5CRFA 3L70E 4S2OA 4IKFA 1O07A 1FTZA 4HV5A 4G9YA 1KC8Q 2IWCA 3HSRA 1HA8A 5KLIB 5JLXA 4E70A 1LT0A 4ZDXA 3CC2I 2KZIA 5FAQA 2VXDA 3CX5E 3QP2A 2PYPA 3Q7VA 3CJQB 1BULA 3BT9A 2VT3A 4M3EA 1OWAA 3ZMVA 2WKPA 3OPRA 2HQAA 1G4DA 3QYBA 5FKMA 1N7SB 3D6ZA 1P4XA 1TVFA 4BKXA 2M87A 2QVOA 5M18A 4CJNA 2QA4I 5CCGC 1K6YA 2XKOA 1VQKP 1F98A 5HNFA 1ZKGA 1ZG3A 4L74A 4AIJA 2Y31A 2BY1A 2KUBA 4NHJA 5K5BA 2E1OA 2O0YA 4NQWB 3PBTA 2OV5A 3C8CA 5JI6A 3CC2P 1BSNA 2QMIA 3ZG8B 4PSXA 1SQXG 3T4OA 3SEQA 3BY8A 3PUBA 3LSIA 1IRFA 3QOEA 2GXAA 2XASA 4M3GA 2B88A 4RB1A 1BDDA 2QA4P 1L4AB 3S16J 2OC6A 1ETOA 2LY2A 4DQ2A 3MCZA 3RPUA 4KJMA 2V0UA 2ZJSE 1R4NB 3SEZA 4NK3A 1JUNA 1V3FA 5K5RA 2LH9A 1JEKA 1TQMA 1LLBA 4AWXB 1MJBA 2JR8A 4JGRA 5CCHC 4PJJA 1MD0A 3IF6C 1I39A 3B8EB 4RS8A 4H44C 4C3JJ 2MD5A 2JPCA 4I3IA 2VT2A 5ICEA 4PD4D 3T12B 1BI0A 5DEQA 4A0YA 3RPQA 4M6VA 2BZTA 3AFHA 2GOMA 2IBZE 5F04A 3K4MA 2L7MP 1RF1C 1SMTA 4GO1A 4FOFA 3KQGA 2E7WA 1IXCA 2HDDA 3FK7A 3MUDC 3DKWA 1OKRA 2FH5A 4WZ5C 1FBMA 1QGPA 4JLFA 3A3DA 2XGXA 2DMNA 1WJAA 3G32A 2WQYC 1NO4A 1Y56A 5ED4A 2FXAA 3LL7A 1H8AA 3PBOA 4IRGA 3OJAB 3HPGA 1KQGB 3O8ZA 4UUVA 1P4AA 1LSVA 2ZMVA 3GCMA 2O01J 2XSDC 2ZOHA 2CW8A 4U3FG 2QKMB 2D1HA 2W1RA 4GW9A 1ERQA 6PAXA 2A05A 1DRMA 2QJKC 3SQNA 4RDUA 2QG4A 4WZ4A 5DUIA 4MHGA 2A3SA 5IYBJ 5E20A 1PP9E 2MLGA 3FPWA 3WS1A 2NPSB 2ZFUA 4KIBA 1GHCA 2CMNA 5AVTB 5CEDA 1ETQA 1LNWA 1WI3A 2QLZA 2IBZI 3VN0A 1DIPA 1T0FA 4PCQA 3K2NA 4UA7A 3CO6C 4AVZA 1FYKA 4P6BA 5DDGA 3P7KA 1GHPA 1NJ4A 4A2UA 5FAOA 4M9ZA 4AU7A 1XTCC 3LCEA 2DOEA 1Z56A 2QRXA 2LOOA 5KAFH 1YS6A 4L9JA 3D3OA 1SD7A 2OGUA 2EIMH 3GLMA 4BNCA 2XROA 1L0NG 1Z6RA 1ERMA 4PUSA 1C0WA 4PZJA 4CUGA 2OYHB 4XOTA 4XRMA 1K6RA 4ZDOA 1RE4A 3NARA 4RB2C 2FYUE 2VKHA 4XSZF 4F92B 1IUFA 5L3CA 1U3EM 3CPWO 4U0XA 1LTBC 1PZQA 3HL9A 5CJ9A 2H27A 4X25A 2V1XA 4EBLA 4R3JA 2BEQD 2HQRA 3NIAA 5M3FJ 3KZIE 2W48A 3T97A 3K69A 1Z7LA 5AVXB 3IH8A 3PYPA 3V39A 3IXBA 5EZHA 2OWHA 1LB2A 3KXDA 3GW6A 3ZQQA 5HPIA 3M91A 3CUEA 1UHSA 4Y4RA 2M3AA 5DTSA 3BR6A 3F1NA 2HR3A 3JAMK 2H0TA 1OTAA 4IZZA 3LWFA 1JTXA 1P84H 3VFZA 2Y55A 2OTLI 2O9CA 3LIEA 2BW3B 4MLOA 1F2KA 4J00A 2B9BA 1V5EA 3DKXA 3TKYA 1OTEA 4Y5FA 3CWFA 4I02A 2Z99A 2LR2A 1IOUA 2GXGA 4GDNA 2Y2IA 5DJTB 2JZYA 5KAFC 1YLTA 2X02A 3VFHA 2QPNA 4Y13A 5J8XA 3ZG9B 2EFXA 4CGZA 3CPTB 2OAZA 3D5SC 4LLLA 1BC7C 2BHYA 1LTGC 3CCMI 4JGOA 1QVUA 4FD8A 3QNBA 3HSEA 2DLLA 1EH6A 2DU9A 1FY7A 4IRIA 1NTMG 2V20A 3AE3C 4RGSA 4N9HA 3CD6P 1VDFA 2OTLP 2Z2LB 3G4SP 2PT7A 4U3FJ 1IN4A 2M7BA 4NB5A 2X71A 3W2VA 3BJNA 1VI0A 2ZMFA 3M07A 5FI6A 3MIWA 3DP7A 2ZKZA 1P2FA 5DD8A 5CVIA 4I09A 2RCXA 3OIPA 4HX7A 1H88C 2M1BA 2X9DA 3OYMA 4MO7A 1GDTA 1O7LA 3LI9A 1Y6IA 1XMKA 4YG2F 1IG7A 1S2EA 2R93J 3GXOA 3ZMZA 2A06D 1TQPA 3M1EA 2OA4A 3GMWA 2WK0A 2ZQ7A 4HH3A 2XLNA 4WUJA 4CLCD 3V7SA 3TJZC 4F94A 2YUSA 1L0NJ 1IFPA 2X4HA 2ZT9B 1S4RA 4HX4A 2QZ8A 3RKQA 1AA7A 2DK8A 3ELKA 3SW1A 1Y47A 5F0FA 5G4ZA 1HXDA 4ESPA 4D6TD 2E1MC 1HQCA 2E5NA 2L5GB 3V2NA 2EWWA 3G4PA 3HTSB 3FKJA 4UAAA 3M0DA 4I0AA 2CU7A 4JBZA 2ZOIA 1FJKA 4CPKA 3A3YB 1S4XA 3BCCG 1FCMA 5L3GA 2LP0A 2WSEH 5IT9Z 4OOYA 1FNNA 2RGVA 2JO1A 5FJ8J 2BCCE 1BW6A 4KG5A 4F3LA 2DO7A 4KQRA 5IP7J 5KJ7A 3GFLA 1SQVK 4KN7X 2JA2A 2AEFA 2QKPA 1MNEA 4L9VA 3WHCA 3GG2A 5L8RJ 4RB0A 4IOCF 4LV1A 1G2CA 3TGNA 3L2VA 2WWWA 3FXMA 4YPCA 3LSHA 2Z5IA 2UWJE 3TBIA 2LB9A 4BHBA 1VPCA 1K78A 4BXXJ 1PPJD 2E74B 4PD4I 3CAXA 1XTAA 2P2UA 4GXOA 1JTYA 4RX3A 3UIAA 2E43A 4GS9B 4WBAA 3ASNH 1DP7P 1NTMJ 3EDPA 1X2MA 1L0LE 1RE3A 1FOYA 2M30A 5F82A 2E76B 2KDKA 3LR5A 2LC2A 2EZLA 1T8IA 2R5ZB 1Y8AA 3PM1A 4CO8A 5HL1A 3JTHA 4JK1X 3TOAA 3WGHA 1ES3A 1HCRA 4RESB 2HODB 2D45A 1YIOA 2K37A 2ZC4B 3FXRA 2DPUA 4ZJ1A 2JRMA 2L7FP 3HTKB 2JKGA 2P04A 3BROA 2JQ7A 2OYOA 1OMEA 2V7QH 3AE1C 4GODA 3TF5A 2D2CC 1WJEA 3OWTA 3AE8C 3OCNA 3AEBC 1WRJA 3ZQ5A 3LY3A 3QAHA 3VDXA 5E1WA 4F55A 1N78A 4OQ0A 3IWFA 2STWA 4ABZA 1W7PA 3MGNA 1NY0A 2W8ZA 5A8BA 2M1CA 2X51A 2XB0X 1NTKE 2BY3A 4N4OB 4E3OA 4HJGH 3PRJA 3HHGA 1URQB 1Y1WJ 1K6OA 3DEUA 2Y4AA 3BG5A 3EUHA 2VB6A 3H1IG 5BQTA 1KA8A 1UHWA 2BGCA 1KMIZ 3ABKH 4LB6B 4P96A 3PLNA 3L74D 3TGUD 2L7KA 4DXCA 5KAIE 1MMDA 1Q82Q 2KIMA 4BD1A 4BJ6C 4B09A 3UE6A 3FWEA 1OCPA 2KL4A 2JSPA 5BPDA 2KRCA 3D0SA 3BCCJ 1TD5A 3WS2A 2R9XA 4QHCA 1IN7A 4IPAA 1AFOA 3VSKA 1JI8A 1F36A 3R61A 1KILB 3IHUA 4Q4ZF 4B8XA 5BOXA 1BI2A 4IJAA 1K79A 5L3BA 3NOTC 2W24A 3DLAA 2VV7A 3P5JA 2YKHA 4GZBA 3M3YJ 1YHQI 1MV8A 5HODA 1EZVE 1G3TA 2H8PD 2HGCA 3HRNA 2H8WA 3WU2H 5B3SH 3HUGA 3K1MA 3L71E 4ZTFA 3UMDA 4Z2YA 1KZHA 1IEMA 2IW5A 3HUNA 2XFSA 3LSPA 1R4MB 3T50A 2ZXEB 2N1TD 1MPLA 1Y28A 4Y17A 1O3SA 5M3MJ 4M3LA 1NG6A 1ORKA 2JC7A 2W85A 3Q1FA 2G0EA 3BG3A 1PZPA 3ZNTA 4QU3A 1YI2I 1KVLA 3MMHA 1YHQP 3NECA 3CMEI 4XRFA 1ES4A 3LFVA 4CCMA 2BY2A 2KISA 1NRJA 1G6OA 2LBFA 5FROA 3T4SA 1LTTC 2ZM8A 3C3WA 3DBLB 4XUXA 4KT6A 3HG9A 2LFBA 2HQ5A 1XGNA 3AE7C 3A02A 1GL2B 2RNGA 3AG3H 2K31A 3WE2A 3JCUH 3T5XA 1WZ2A 2D1VA 3TNUB 3C4OA 1YI2P 2M4GA 4UXNA 5DCMB 1JY2O 3TMOA 3WU2C 1UCRA 4C9YA 1OYWA 3BVHA 1ZGJA 3G34A 3CWBD 5KCMA 1PL5A 3N7NA 5FDHA 3NQOA 1HSTA 3TDUC 1ZG5A 3GF7A 3KYQA 4EBNA 2W1OA 2OWJA 3H1IJ 1F5MA 3IXHA 3ERMA 2EFQA 2YMYA 3BFGA 4CZZA 1IJWC 1NYMA 3B5NA 2UV1A 3L72E 1N7SD 1PJRA 1IFDA 4WLAA 1LP1B 2O99A 3QWOC 3CJMA 4RGUA 3W4QA 1E5WA 4HH2A 5FLXK 5L3EA 3G1LA 3S7NA 2AHQA 1CW5A 2LF7A 4HPQA 4E3NA 1PPJE 3NDGA 1RE4C 1T3UA 4E7JA 1R5ID 1Q2NA 2I1KA 1GSVA 4IFFA 1IXRC 2HPBA 5APUA 1PIOA 2RREA 3Q5RA 2WB1N 1QX8A 1FBQA 2Z2MB 1MGTA 4U7JA 5GTIE 1S9KD 3NJAA 1XPXA 2AXTH 1Z6TA 2L4MA 1GSWA 2W90A 3NWTA 2XAFA 3JCUC 4PDKA 4EV4A 1JT0A 3SH8A 2V9KA 3PO2J 5L8MA 3UMEA 1J1DB 2X01A 3CUEC 4BQNA 1L4AD 1A36A 1K8AQ 3M7GA 3UB6A 3GMEA 1TBXA 2ZSHB 2Z9OA 4BWIA 1ZHHB 4S2IA 1NH4A 3IHBA 4BRYA 1I50J 2FA5A 3OZHA 4NXBA 1MDMB 5AW2B 4C75A 1EQ7A 4JGQA 1MWRA 3ESWB 5LD2C 3A3IA 5C4JJ 1XJ6A 1FMVA 3HE4B 4M3KA 3H1KG 2J3TC 1CQTA 4IL6E 4M6XA 2CRGA 5HL6A 2Q1KA 1HJBA 2BLSA 4JX4A 2KMUA 5F64A 5FQQA 2DMUA 2JP3A 4PAUA 4LK0F 3J7AY 1N8RQ 2EINH 4EDFA 2EPFA 4GOFA 4RBOA 1YOVB 4HEFA 1R1TA 3OSGA 1FYLA 2LREA 4S2NA 2ACGA 1KVMA 3OR2C 5FD5A 2NNNA 1OXZA 3A0HE 2PMZN 3HREA 1SQVG 2P74A 3CCSP 2R7WA 4PJNA 5KLVK 1APLC 2PAJA 5DTTA 1MMAA 4XFJA 1FPQA 3CCVP 4EWFA 3AG1H 2HZDA 5L09A 4EM0B 3HC7A 2AXTC 2MD0A 3VP0A 1EROA 1AV1A 1ACIA 4XORA 2D2CB 3VP2A 4Y15A 1MBGA 1JKOC 1QZYA 3ML6A 1BCCD 1SC7A 1S72I 4NPEA 2OV7A 5CJ4A 2EWVA 2XGCA 1PV3A 1K9MQ 4DIQA 2HDSA 2XSJC 4E7KA 3EETA 3Q7VB 1G2HA 1S6LA 4HQEA 4G7HF 1J9IA 2IAIA 3LA2A 1N2DC 2DA3A 2WTEA 4CPGA 1PGJA 1TWFJ 1NU1E 4KZ3A 1OCRH 1FDOA 3RL0C 3C30A 2DN0A 3QPSA 4I6ZA 4EGYA 4LG0A 1R1VA 3NXSA 2QJPB 2AS5F 3OYJA 4X6AJ 3NWSA 3RQ4A 1S72P 4C46A 1OTIA 1Q81Q 1TS8A 3BFCA 3O3KA 3IV5A 3TP0A 3M0DC 4WYYA 2VONA 2V4JC 5HLGA 2ZBBA 4R38A 3M1CA 3CXHH 1K56D 1K83J 1S6RA 2MW8A 3K4JA 3R4KA 3BWGA 5F1FA 2FXMA 1N9NA 5BOHA 2ITAA 3GTKJ 4LC1A 4CYDA 2DYSH 4LENA 2IFNA 1HUCA 4FE4A 1W63Q 1HKQA 3VMXA 1I6HJ 2E1CA 1LPQA 3K2ZA 3L75J 1YW9A 1VQQA 3D71A 5B5EE 3G3ZA 3H35A 3R4YA 4L0LA 3T0YA 4MEZA 3H1KJ 2DT5A 3VYRB 2H1KA 3LR3A 3FYZA 3MQOA 1ZAOA 3WG7H 5HW3A 3LR4A 2DMQA 1N77A 2VC0A 1TNTA 1YRNA 3KEQA 4KENB 1FP1D 4N6JA 3S9OA 5CECA 4WF0A 4HIAA 3ZCOA 2XSSA 3H1CA 2AQFA 1RE3C 1SQVJ 1GVJA 2ME0A 2VI6A 2EXAA 4CCJA 4B88A 1H0TA 1T98A 3V7CA 2KRFA 4OIRF 3LSMA 3H3VK 2Y30A 2HDRA 3N6IA 3EYYA 1VQ4P 4CYCB 1BLCA 1FZPB 1ZLJA 2XZRA 2EX8A 4KG6A 2M34A 2OAP1 3CDLA 4E6WA 4I98B 3PXPA 3BFFA 4HOIA 3HRMA 2YMKA 4L73A 5TBMB 2ISZA 3CITA 4NXEA 4HLXA 5FDSA 2V79A 2A61A 5J8CA 1JXSA 1S9KE 3HUSB 3LW5H 5FFXA 4HJ3A 3CCUI 3WS5A 3VSLA 4ARZA 3K4BA 5M5YJ 1TT5B 1SHVA 4WM9A 2M4KA 3IH3A 2LY1A 2QE7H 1FS0E 4JF6A 1E3UA 1W1WE 3AEGC 2P08A 1PP8F 1OFCX 3BEBA 1P9RA 5K1YA 1K0KA 1SQBK 2KI7B 1U5TA 2Y0DA 2VLGA 1VQOI 4RYEA 1EKEA 2K4JA 4OP5A 3MZFA 1W0UA 1SQXD 2M3BA 1YLPA 3V2QA 4XLFA 2ZT9D 1MXOA 1MW7A 3A3FA 1Z05A 2WSSH 3ZG5A 3RK2C 2TCTA 1RPWA 3M9BA 2KZVA 3CCUP 3JVVA 3BFDA 2HFED 2OPTA 1UJ8A 1IO2A 3KFWX 1OCOH 3F3XA 3WUVA 2DW3A 3VB2A 2KJCA 3I53A 2KX6A 4P5OA 1LFBA 3T97B 1EDIA 5AW5B 2NS7A 1FSYA 1VQOP 1FOSF 2XA7S 1YQAA 5K7HA 4GFBA 1BIBA 2ZXWH 3CDIA 2XC7A 2V4HA 4XN3A 1R36A 2V1DA 2I8DA 2FJ1A 3A4CA 3BR0A 2Y79A 3GVBA 5IYDJ 4GDFA 5CGWA 5EVEA 2X1CA 3VOPA 1GLNA 5DTKA 1YJNI 2QWSA 1D5VA 2WB1A 4DN0A 4I7HA 3ZRGA 5HPFA 1L3LA 3VP9A 3EGDC 2BTFP 4ZC3A 1PI5A 4O5VA 3QP8A 2E74D 2WSFJ 1V5FA 4DOJA 1XDUA 2KXPB 3PNYA 1ZN5A 3D5LA 4P9UA 2BEOA 1JY3P 3ZHHA 1W8YA 4PM7A 4KIGA 1XMXA 4OINF 5EEGA 4P0MA 3PJRA 2MBFA 2HGVA 1X3ZB 2OTKE 4U3FD