1MKMA

Crystal structure of the thermotoga maritima iclr
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
246
structure length
246
Chain Sequence
MNTLKKAFEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKDKRYVPGYKLIEYGSFVLRRFNIRDIAHDHLVDIMKRTGETVHLILKDGFEGVYIDKVEGEQSIPMVSRLGMKVDLYSTASGKSILAFVPEKELKEYLKIVELKPKTPNTITNPRVLKRELEKIRKRGYAVDNEENEIGIMCVGVPIFDHNGYPVAGVSISGVARKFTEEKIEEYSDVLKEKAEEISRKLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IclR transcriptional regulator
publication title Crystal structure of Thermotoga maritima 0065, a member of the IclR transcriptional factor family.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 75
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
A PF09339 HTH_IclR IclR helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mkmA01
1.20.5.640 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1mkmA02
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1mkmA03
1XGSA 2KIFA 1YSQA 2O0YA 3O3KA 2VONA 5LHIA 2P6TA 1SD7A 3BJAA 3EETA 4OIRF 2QQ9A 1CF7A 3MZYA 4G94A 3WGGA 4EMSA 3WTSC 3K1MA 4HOBA 2NYXA 3AAFA 1TLHB 2MD5A 2A07F 3CJNA 3BJ6A 2RDPA 4ESFA 2BYVE 2VT3A 3GXOA 3F6VA 2PMHA 2XUBA 4WXHA 3GWZA 4AIKA 1MZBA 3R0AA 2K7LA 4G6QA 4I01A 3O6BB 3FX3A 3WTZA 4ASNA 4A6EA 1FYLA 4MTEA 2UXNA 3KE2A 5FFXA 3ELKA 4O3MA 5CVIA 3GVAA 3QRFF 4G7HF 3FM3A 3KP5A 4U0VA 3E98A 4EJTA 4UV9A 4IJGA 2YSRA 1BBYA 1GXQA 4HYEA 2HS5A 1ZGAA 5AJGA 3KEOA 2W3DA 3IC7A 4PAUA 1X3UA 2RQPA 2VBYA 5LEJA 3CUQB 4EJUA 4MN7A 3RTRA 1D3YA 3RIRA 3P9KA 1GVJA 2O9AA 3I4PA 1EV7A 2ETHA 4L9NA 3FXQA 1Z05A 3D0SA 4MQ9F 2YX7A 3ECHA 4IRGA 2ZNYA 4E04A 3U1DA 3JSPA 1ZGJA 5JFRA 4IPAA 2Y75A 3QP5A 4K2EA 3K1PA 1F4KA 3KP6A 5FB2A 1SFUA 5A2QZ 1MJBA 2NNYA 4UVAA 4S05A 1BI1A 4O5VA 5E1XA 1B59A 2HOEA 2J5OA 1O3RA 1K6OA 1H9TA 3H3ZA 4RGSA 2L3DA 3WE3A 3KSGA 3H92A 1WKMA 2QBYB 3CO6C 3FMRA 2JSCA 5K1YA 3HIFA 2ZKZA 3P9IA 2XAHA 4U0YA 2QWWA 2EV5A 3NOTC 3WG9A 1FLIA 3RYRA 2BBYA 3GFIA 2ZJ2A 1V3FA 3LA2A 1TF1A 5D5UB 3PFIA 4IUHA 2R3SA 1P6RA 2ISYA 3B02A 4Y13A 3QAHA 1I1GA 1I27A 1ZHFA 4M6YA 3K1NA 3T8RA 2P5KA 1R1UA 4L0YB 1W4MA 1QBJA 2NRAC 2K31A 2ELHA 2HDCA 2B18A 4KN7X 2LSOA 3HRSA 4KYWA 2MA3A 1DP7P 1FBQA 3IKTA 4HDVA 3KO6A 1I6XA 5DCMA 2NNNA 4P55A 1XDUA 4KNYA 1P92A 3WU0A 3SQNA 4OOIA 3SZTA 4ESBA 4LFUA 3K69A 2MLKA 3L09A 4BHCA 2AS5F 2KRFA 2EFQA 2STWA 1XGMA 2P4WA 4L0ZB 2HQNA 2EV6A 2VOOA 1XMAA 3CO7C 3KP4A 1UFMA 3IWZA 2PEXA 3FWEA 3T0YA 2VC0A 3VODA 1ON1A 2W85A 2ADUA 1G3WA 1TW3A 1RIOH 3I53A 3ZMDA 2XASA 1QO0D 3HSRA 2FOKA 3FHZA 5HLHA 2IPQX 3DPTA 3GX4X 4Y5FA 1J75A 3RFBA 4EUVA 1S3JA 3ISPA 1YW9A 1S7OA 3J7AO 3GEZA 1U6GA 3JTGA 2GXBA 4IHTA 4A5MA 3T8TA 3FM5A 1Z1DA 2PN6A 3WE2A 4I7HA 4YFKF 5ILSA 1U2WA 2Y0MA 1JXSA 1ZTUA 1O3TA 1J2XA 1OPCA 4R79A 4I0BA 2V1UA 3WTTC 2Y48A 1DPRA 4LLGF 5LRSA 4HV5A 4BHPA 5DFYA 2Z99A 4Y3IA 1Z9CA 2JPBA 3EYYA 1KYWA 2FMYA 2A6EF 2CGPA 2G7HA 1BI3A 1XSXA 5K5QA 3F8CA 1T98A 2ESHA 4IRHA 5CVVA 5DFXA 3I0TA 3TO7A 2FBIA 3FZVA 5DD4A 5DYMA 4U7DA 2F5FA 4U88A 2M1BA 1YTYA 1MC0A 2OBPA 5FLXK 1U8RA 1W7PD 2VC1A 3I5UA 5HPFA 2L02A 2H94A 3RDIA 4NB5A 5HS9A 3EDPA 1BI0A 2O61A 3KSIA 4A0ZA 3IHUA 1ZG3A 4IF4A 2ZMFA 1UHWA 4XLPF 3FXRA 1R1VA 4HF1A 2XGXA 4WCGA 2KJCA 2JZYA 3GLXA 4I09A 1IN8A 4ZH4F 2GWRA 3BJOA 2YR2A 5ICGA 2XIGA 5DUIA 5ICEA 4KA4A 4MMNA 3HYIA 2COMA 1ZH5A 4AWXB 3W2ZA 4BQAA 1ZYRF 4KDPA 4QPRA 1K7AA 2HTJA 3KSHA 3CUQA 3ECOA 1IXRC 3L7WA 3ULQB 4Y17A 4QWQA 4HX7A 3T1BA 3H3UA 1KGSA 5H20A 2Z3YA 4HLYA 2STTA 4M74A 2XSSA 2M5WA 1OYIA 2CW0F 1SD6A 4KIGA 4ENNA 4L5JA 1Y0UA 5F64A 1K79A 1YYVA 3ERED 4EGZA 2F5DA 2KOIA 1S8NA 3HHHA 1HXDA 2W1TB 2H09A 2OU2A 1P2FA 3HRUA 2VEAA 1QGPA 3EYIA 3LA3A 2VXZA 2EB7A 2ZXJA 1BC7C 1J5YA 1DDNA 2ZNZA 4R6LA 1SD5A 1KU7A 4ON0A 3GFMA 5E8GA 2E1NA 1IN7A 2R7FA 4PGGA 5BOXA 3M7GA 3ZN1A 3C2WA 3GW2A 5KVRA 4AIJA 1MGTA 5LGTA 1T38A 3TO9A 1ZN2A 3U9GA 4U0WA 3O2PE 4G8XA 4G3WA 4G7OF 5K5RA 3OOVA 1FT9A 4KMUX 2G7UA 4Q4ZF 4TV7A 1V4RA 3QP6A 2IP2A 4WX9A 2MH9A 4HW0A 3WTVC 2OQGA 5DUKA 4ENJA 3J80Z 2HWVA 4MGRA 2HFHA 1U5TA 4KFCA 2FNAA 1JGSA 2CFXA 3QPTA 1YSPA 4EM0B 2CG4A 3IBRA 1KA8A 4AIHA 3R0JA 3J81Z 1S6LA 5E8IA 2OQRA 1R5HA 3GFLA 1XB4A 3KP2A 2LF7A 2FEZA 2VT2A 4LMYA 4UXNA 4HLXA 4Q5SF 3E3VA 3LAJA 5JVTA 3K2NA 2DPDA 1R23A 5IT9Z 1XGOA 2FU4A 5KK1A 5JR3A 3TDZC 3KLNA 4OMZA 3LQQA 3GZ6A 2HQRA 1IN5A 1ZG1A 1R1TA 1S7AA 1BM9A 5L3CA 2XAGA 4HAMA 4ZZDA 2A6HF 1FYMA 3WGHA 5LEKA 3BROA 3QU6A 4BH9A 3DV8A 1G3TA 5HDKA 5HL6A 2EFNA 3HTSB 1IUYA 3LFVA 3V7RA 3C7JA 3NOUC 5ED4A 5CJ9A 3QPHA 4A12A 1TBXA 4EGYA 1J0RA 1EH6A 3KLOA 4F7ZA 4FHTA 2WC2A 1TD5A 1R58A 1WI9A 4YNRA 3I64A 1D8KA 3Q9SA 4YIFA 1FBSA 2RC4A 1BC8C 2H6BA 4O01A 4HF2A 3MZHA 4KIFA 4UHTA 3VV4A 2VODA 4LLLA 1JHHA 3DF8A 2L01A 3C3WA 2QLZA 5FO5A 3VB2A 1R00A 2JT1A 4P5OA 1Q1HA 2FSWA 3DBAA 1GXPA 1UCRA 1O3QA 2DQLA 5BMZA 2XKPA 3I58A 3GFJA 1ON2A 2RKHA 1ZRCA 2DTRA 2Q0OA 2L4MA 3KP7A 2W57A 2V1DA 3REOA 1FYKA 4ZYEA 3I59B 4CZZA 1BIAA 5D4RA 1KU3A 5HDNA 4RGXA 3R4KA 2GA2A 1MDMA 5TRDA 2HTSA 4GYIA 1LJ9A 2BV6A 2RVCA 2GZWA 4KIBA 3BWGA 3BPXA 2P5LC 1HKTA 4YFXF 5DDGA 3MEXA 1ONVA 3IBJA 4I2OA 1T6SA 2RNJA 3HOTA 3L2CA 4U7BA 1O57A 1FNNA 4FOFA 2DK5A 1QZYA 1S29A 2L54A 1JE8A 1RI7A 4LRYC 3MMHA 4GYGA 1D5VA 3S7PA 4XSZF 5BPDA 2O6GE 5AIQA 4B09A 1KU9A 2F5CA 4R1HA 2DAOA 2MBFA 4M73A 1F5TA 4RS8A 1SAXA 2VBZA 3KEQA 3ZMVA 1SFXA 3D5LA 3LSTA 2HEOA 2EFOA 2WTEA 3R4YA 3DPLC 2W1TA 2PLYA 1XN7A 2Q2EA 3DP7A 3M1EA 3RKYA 3RPUA 2A69F 5AIPA 4HQMA 2W24A 4FT8A 1AOYA 1IZ1A 4ME4A 3P7NA 4HA8A 3MF0A 4R70A 2K2NA 3JAMK 1XCVA 3RKXA 4I0AA 5CVRA 2J5PA 2VBXA 1HKSA 3KFWX 2LF8A 1I1SA 5HVQC 4IVNA 1SD4A 2FNPA 4WWCA 4S04A 4LG0B 4YFNF 2EFPA 5D5WB 3WGIA 2O9BA 1OMIA 2Z33A 4LGWA 1K78A 4ETZA 1IXCA 2XRNA 1G3SA 5J6XA 2X4HA 4XLNF 5D5VB 2CYYA 5ILVA 1R5GA 4PDKA 2M8EA 2RN7A 2XKOA 2QENA 1FP1D 1MKMA 5BS6A 3EQLF 2KIUA 3NRVA 5AONA 3F8NA 4ETSA 2V9VA 1LDKB 4EV0A 3BP8A 2G9WA 2V79A 5CLSA 2CWEA 2K4JA 3L00A 2PBIA 4LRZE 5L3DA 3CUQC 1QZZA 4OU0A 5LGNA 2QQAA 1IRGA 3RPQA 3V7SA 4UVBA 1YS7A 4JQFA 3HRMA 1PUEE 1HW5A 1OR7A 1YS6A 2W3EA 1LEBA 5BPIA 1L0OC 1BN5A 1HSJA 2LB5A 4NQWA 3TOAA 3I54A 4ZYDA 3WODF 2YX4A 3S2WA 4AD9A 1IF1A 2CSOA 4JK1X 3I71A 4D0PA 4DMZA 3F22A 2IW5A 3FF5A 4PZJA 2UZKA 3L9FA 4I02A 4GCVA 3E5QA 5HDGA 4Z1WA 3TRCA 4O0PA 1YLFA 5FD5A 3F21A 3GF2A 4HQEA 2Q8KA 4CO8A 3S7NA 1RUNA 3M8FA 3LA7A 5D8KB 3MCZA 1YW8A 2KKOA 2DK8A 1D8JA 3BPVA 3F8BA 5CVJA 2HZTA 1LVAA 1ULYA 4N0BA 1KU2A 5ICCA 4M71A 2VZWA 3TO6A 3ABUA 2JRTA 4LB6B 2IA2A 5FFZA 2D1VA 1WSUA 2DFIA 3K9TA 2KJBA 2A3SA 2P7VB 5FLXZ 2PI0A 4Q0JA 1NHAA 1QNTA 2B0LA 3ZPLA 3Q9VA 2VE8A 1W7PB 3R61A 3E6CC 2K86A 4CDGA 4DQ2A 2ZFWA 1UB9A 1U5TC 2GA1A 3W6JB 2UXXA 3NEUA 3F6OA 5LLQA 2EJRA 1U78A 1SMTA 2VE9A 4KT5C 3RYPA 4UUVA 4M6XA 2FBHA 2XAQA 2MH2A 3N4MA 1ODDA 3SZPA 3EEAA 1TTYA 1TNTA 3G6OA 2KIMA 2HYGD 2QYBA 3V8LA 3NHQA 4M72A 4L9VA 1P4WA 2HR3A 5LRRA 2QM3A 4YIIA 1FP2A 3K0LA 3V8KA 1E17A 4G6DA 2FQ3A 3LQRA 5ILUA 4O8GA 4RB0A 1ZAOA 2K02A 2QBYA 2ISZA 1BOAA 2PMUA 4IRIA 3SXYA 2OA4A 3ZMZA 4HBLA 2HKOA 2W1RA 2K27A 3ROUA 1P4AA 1TW2A 2QUFA 2VBWA 3GZ5A 5D6EA 2M7VA 5D8LB 2OZ6A 4MHGA 3QOPA 1YFHA 5D6FA 1B4AA 1LDJA 4G3KA 3HCYA 2NS0A 5J8FA 2QQBA 1ZREA 1KQ0A 1IXSB 4L5IA 4IUKA 4Q0IA 2HGCA 2BEOA 3HSEA 1MJAA 3R60A 4BWIA 3W6KB 1R22A 4B8XA 1LNWA 1IRFA 5E1WA 1KQ9A 4H0EA 4R8HA 2DLLA 1HQCA 3CLOA 4UV8A 5L3FA 3OOPA 3KCCA 4MEXF 4OMYA 3CDHA 1IN4A 2W3FA 1L3LA 4KICA 1H0MA 1KYZA 2O8XA 2IA0A 1REPC 1FSHA 2Y8HA 1KQ8A 1FZPB 4XBFA 1YKDA 2O03A 3F8MA 2OZUA 5F1RA 1T2KA 2EV0A 2O3FA 3N97A 5FGMA 2H6CA 1P4XA 4BAYA 3KZYA 3GO5A 3MWMA 4LRXC 2E7XA 1MJ9A 2O9CA 4M9ZA 3E6MA 1FC3A 2YPRA 1HW1A 3D3OA 5TJJA 5F6FA 1FSEA 3BZ6A 4Q48A 5HLGA 4LG0A 3GYHX 3G73A 3OBFA 2P6SA 3FXUA 3NQOA 5K5OA 1EH7A 3E6BA 1HKQA 3KZZA 3TGNA 2C6YA 4OIQF 2ZMEB 5HOOA 4GLQA 1PDNC 4CQHA 4EJOA 4EU0A 1A04A 2XAFA 2ZBKA 3BY6A 3DKWA 5E18F 3M9AA 1U3EM 1IN6A 3WTYC 4EJWA 5A2QK 2FBKA 2PJPA 5J8CA 1G4DA 2DW4A 2GQQA 2VJWA 4HX8A 4G3VA 2DBBA 3LAPA 4Q0HA 2LNBA 4P9FA 1H9GA 3COAC 1XD7A 2NAZA 3RKWA 2CO5A 4IXAA 4KUMA 2DU9A 4MEYF 4OIOF 3S7OA 1JHFA 2F2EA 3ZMTA 1Z6TA 2M7UA 4Z2YA 4BYYA 2DI3A 4MQVA 5L3EA 4RGUA 1LEAA 4YOFA 2M30A 4N9HA 1ZLKA 1J9IA 2QZ8A 2V6CA 1B1BA 1FBUA 4BHBA 2JPCA 3C18A 5FD6A 2W25A 2V1XA 1IW7F 1CGPA 2XROA 1HBXG 5E1ZB 1F1ZA 3ML6A 3NOPC 1YO5C 2O99A 2QVOA 3MAJA 1GHCA 1R36A 2LB9A 2DQRA 3U2RA 3FMQA 4HV6A 4DNCA 3E0YA 4NHJA 2FE3A 5L3GA 3ABTA 3V7CA 1YIOA 2Y79A 1J59A 1LQ1A 3ZP5A 4RAZA 4OIPF 1B9MA 4EJVA 3WTXC 1W5SA 5JI6A 2FA5A 4O6JA 1ZLJA 2D45A 3F72A 1LB2A 3CUOA 2EFWA 3HOSA 4EM1A 4A0XA 1RZ4A 3BDDA 2WWYA 2FXAA 1W7PA 3E6DA 5ERIA 4I98B 1XCBA 1QQIA 1USSA 1YW7A 2Z5UA 1YQAA 3TQNA 1U5TB 2ACJA 2AXLA 3V8JA 1R7JA 3DEUA 2GAUA 5K5BA 1BI2A 3G3ZA 2D1HA 2P5VA 2L4AA 1TQMA 4UNOA 2JTVA 1PP8F 4GGGA 1FPQA 4KMFA 4G7ZF 2GXGA 5LGUA 1BIBA 1USTA 2KLIA 1CF7B 1RNLA 3ZN0A 4LB5A 5H6QA 5EEGA 4MNUA 6PAXA 3Q5FA 3HUGA 4N9IA 4RAYA 2P8TA 4PGHA 4FX0A 4M9XA 3VOEA 2M87A 3F8FA 5D5XB 4P96A 3SFZA 4A5NA 4LLNA 2EA4A 1TNSA 2QYOA 5LHHA 2DT5A 1XMKA 4ETXA 4IJAA 1TQIA 4CGZA 5DV5A 1YG2A 3F23A 2H27A 1G6NA 5L8MA 4Y15A 2XAJA 2IT0A 5DEQA 2LDUA 5HSQA 4GXOA 2MC3A 3BOQA 2RGVA 3V4GA 3DXJF 4E70A 4L9TA 4AVPA 4EVIA 2HKXA 3HHGA 4WXDA 1IAWA 2E1CA 3JSOA 2W84A 3B73A 3KETA 2ZCWA 4XSXF 3OV8A 3VEPA 1FOKA 2HYFA 2A68F 4RQ9A 1C0WA 3RJPA 1F9NA 2XHKA 3JAMZ 4ZRRA 4XRFA 3TOBA 3BJNA 1EH8A 1WQ2A 2VOPA 3FMSA 5H6RA 1B9NA 3VFZA 4L18B 3CI6A 5CVUA 5HS7A 3ZMSA 2TDXA 3K2ZA 3ZQ7A 1VHMA 2PFBA 4A6DA 5EEHA 2RV8A 3SHFA 2EK5A 1SMYF 2ZO4A 4CICA 3MFKA 3HTUA 2DPUA 4CHUA 3HRTA 4KN4X 3LWFA 3ZQ5A 3DFGA 5I5LA 4ENKA 2K4BA 1T39A 1ZARA 4QLCU 1BJAA 5BQTA 1RUOA 3KSFA 1UHMA 4MTDA 2EA2A 3PQJA 4ZZLA 3E97A 3QU3A 1J7KA 3TKYA 2FF4A 3EUHA 2W3HA 2CQKA 3GUDA 4Y2FA 4HZFA 4RB1A 4ENMA 3CTAA 1ZG5A 2FRHA 2PQ8A 2A61A 1AWCA 5JHUA 2BGCA 4IHSA 2XV4S 3JTHA 2MLGA 4OINF 2DO7A 3TDUC 4UVCA 5HLIA 1QPMA 4RGRA 1O7LA 1MDMB 2ZMEA 4GO1A 1Z6RA 3IKVA 4EM2A 5E20A 3IRRA 2FMLA 4Q47A 3WU1B 1WRJA 4ZYHA 3CITA 5LBRA 1HW2A 5CYVA 4HX4A 2GIVA 2WV0A 4PCQA 1XDSA 2OAZA 4ZYGA 4L9JA 3IWFA 1FWZA 2XVCA 1XSDA 1MD0A 1OYWA 3JW4A 5LBQA 1I5ZA 5C5KA 2EWNA 4LD5A 3M8EA 2IA1A 3KP3A 4HDUA 5LHGA 2W3GA 2IRFG 4RB2C 3MQ0A 4BNCA 4YG2F 3O5YA 1OKRA 1DUXC 1Z7UA 2OOLA 2D2WA 4P9UA 2IVMA 5DCMB 4GW9A 2LKPA 1W5TA 2A5YB 4ESJA 2F5EA 2X0LA 4WF2A 1PP7U 4HF0A 1LDDA 1ZRDA 4EQQA 1TQPA 2PG4A 3I59A 1XGNA 3ZMUA 3C1DA 1HSTA 5HPIA 4WXCA 5D4SA 3J80K 3WTUC 2VN2A 1OYYA 1Z91A 5HS8A 4WK8F 3R6SA 1O7FA 3E5UA 2P7CB 1XSVA 1ZRFA 4DN0A 2VKSA 3J81K 3F3XA 4A0YA 2R7DA 4LK1F 4RB3C 1SFEA 2ESNA 5L3BA 2Z9OA 1FX7A 1WWXA 3S7QA 4MCWA 3PQKA 4LK0F 5IT9K 4FX4A 1STZA 2M45A 5DD8A 1FY7A 3IL2A 1K78B 3T5XA 5E17F 5ICFA 4M9SA 1DPUA 4CXFA 2UWMA 2IJLA 1E2XA 2YU3A 4JBAA 4CYDA 4BXUA 2E7WA 3DQVC 2OD5A 3E5XA 4A2UA 1VTNC 5IT3A 2BE5F 1T0FA 3P9CA 4G9YA 4MDZA 3HSFA 5DCFA 3WTWC 1F5MA 2HGVA 4LJZF 3IRQA 1O3SA 3RI4A 3LFKA 1B6AA 2GX5A 1G3YA
chains in the Genus database with same CATH superfamily
2YXRB 2KIFA 5EV0A 2QZ6A 1EJ9A 5F04A 3AE4C 3F0CA 2ZXWH 1SD7A 3L1PA 2R9XA 2LYCA 2LBFA 2IZ1A 2FYNB 1CF7A 1TS7A 4G94A 3PJRA 5C44J 3WTSC 4EMSA 4NQWB 1DEBA 3H1KD 5CCGC 2MD5A 2A07F 4YRVA 3BJ6A 3GXOA 1LT9C 2V7QJ 2IEKA 2XUBA 4WXHA 3NULA 4MN5A 1ZLLA 2HG5D 2JUCA 1FJKA 1OCTC 4P0MA 4LV3A 4GOFA 3H1LG 1XGIA 1SQQK 3CAXA 2E2HJ 3T97B 4NC7A 3MIWA 1HF0A 4PD4I 2EIMH 1TT5B 1PUFA 1NWZA 5B5EH 3K4NA 4U0VA 1TVFA 4EJTA 4JPZB 1SQBD 2VQHA 1ZGAA 1XS9A 2HI3A 3BFGA 4B4ZA 4MNRA 5FROA 1GL2D 4PAUA 1X3UA 1S9KE 3S93A 2QJKC 4D6TJ 1YLZA 3RTRA 4X1EA 3RCOA 4WUJA 4EESA 2HPIA 3RIRA 2M4KA 1PI4A 3I4PA 4LIVA 4L9NA 1KILE 3FXQA 1Z05A 3HUSA 5TISE 1QZEA 4MQ9F 2YX7A 4IRGA 3PHYA 2ZNYA 1K6RA 2OYHC 3Q7VA 3CF5F 3JSPA 3IR9A 1CI9A 3T4TA 3Q82A 5JFRA 3ZQHA 4KISA 1QU3A 4IPAA 2Y75A 3QP5A 3UY6A 3HJKA 4K2EA 1PV3A 3K1PA 3M07A 2YKFA 3BCCE 5L10A 3KP6A 2Z2MB 3HE5A 5A2QZ 4GHIB 4IKFA 1GW4A 1X22A 1MJBA 2NNYA 4Z6YA 2CH0A 2BTFP 2BY0A 2RAEA 4WBAA 1KYOI 2FY8A 1R5SA 1LI0A 1IK7A 2L3DA 3KSGA 4W97A 3H92A 1NTMJ 1B72A 2QBYB 4WMCD 3S4RA 3FK6A 1VEUB 1W7FA 5FSRA 1K6SA 4S2OA 2M0BA 4RAGA 3W3CA 3RYRA 3M4OJ 1IYOA 2ZJ2A 3LA2A 1Z09A 5EG0A 1N75A 3PFIA 4IUHA 3ERMA 4KHXA 1VM1A 4P6BA 2R5DA 4CPGA 3T1RA 1ZHFA 2GJ3A 1YLJA 3GMAA 1G8XA 3M9QA 1ETOA 3L75J 1O7EA 5KCMA 1QBJA 5KSHA 5B5EC 3QP4A 3EQVA 3A0RA 2LSOA 4KYWA 1FDMA 3M1CA 4L0LA 1FBQA 1W8YA 4E3MA 1T08B 3VN0A 1KB9E 5DCMA 3E4OA 3RL0C 1Y1WJ 4PD4D 1QRYA 2WITA 1CK3A 1NU1E 3T4JA 2X6XA 4B1RA 4OOIA 1G6OA 1WPKA 4XNFA 4YXDC 3K69A 1GU4A 1XJ3A 4BHCA 4HSRA 2AS5F 5FQ9A 2FYZA 1P84I 3CCQI 2N9YB 2IWCA 1XGMA 5AW9B 3GW6A 5DTSA 1TEMA 4L0ZB 1P7JA 1SQXE 1SC7A 3K4BA 1T95A 1N73C 1FU1A 4XR6A 2PEXA 2XF3A 2Y2IA 2VC0A 3IP4B 1ON1A 2FYUD 2ADUA 5CCGD 3LSJA 4HP9A 1RIOH 3I53A 4BY1J 1QO0D 5CX7A 5GAGJ 3FHZA 5KIZA 2IPQX 3NI9A 3O8ZA 1H0TA 2H8RA 3J7AO 3KDPB 4R3AA 3GEZA 2ACGA 3H7WB 1W2BO 4YINA 2JKRM 3JTGA 1EZVI 1Z21A 3KYLA 1Z1DA 2PN6A 3WE2A 3B71A 3CHWP 2JA6J 4YFKF 1U2WA 2Y0MA 3JRDA 1KYOD 5DS9A 2AQFA 3A01B 5APVA 4I0BA 4B4XA 3AG3H 1KE0A 5GLBA 3Q81A 1YJWI 5LRSA 2MW8A 3AEBC 4OQIA 1Z9CA 3EYYA 2FXMA 3HLDA 2DA3A 1NJIQ 1D06A 2VGJA 1T98A 5AVRB 3PM1A 3CCLI 3M91A 5DFXA 3IHAA 2FBIA 1TWGJ 2XSDC 1H8AC 1BE3D 1GHPA 4U88A 2EZHA 2B88A 2H89C 1G1JA 5E79H 1XP4A 1W7PD 3RDIA 2Y9YA 2QG4A 4KZ6A 2D2CD 1BI0A 4WBGA 5H2FH 4DJAA 1ZG3A 1UHWA 4E7ZA 2E35A 1YRNA 3OYMA 4N1HA 3NMDA 4D60A 2YR2A 5CKTA 5ICGA 2BZTA 5ICEA 2B87B 3HYIA 2COMA 2HQAA 4BQAA 2J3TC 3EWKA 4QPRA 3CCEI 2FFDC 2K9QA 1SANA 3L71G 2P9VB 1P84D 1I5QA 1NZOA 2EWVA 3HBLA 3H3UA 4A3GJ 5H20A 2JN7A 2Z3YA 4HLYA 2OAQ1 2BHYA 1MBLA 2M5WA 3BR6A 1OYIA 2AXTH 1T0FC 4KIGA 3MR0A 2HPCB 1ZGWA 2QHKA 1HVVA 3IXGA 1E0EA 4K0WA 2F5DA 4A3MJ 4B9OA 3OYDA 3VOLA 2H09A 1P2FA 2VEAA 4JF6A 5IU1A 2Q2EB 2VXZA 5GHZA 1A31A 2EB7A 2ZXJA 3BCBA 5FLMJ 2PMZA 2RKLA 2KISA 4RJTA 1BA5A 5FRNA 3W2VA 3HREA 2EWWA 1BLSA 3BR1A 3PAGA 1SD5A 3GFMA 1VQ5I 2R5YB 2R7FA 3PR6A 2Q5UA 5HWVA 3ZN1A 3BTCA 1K54A 1I2WA 1VQPI 3C2WA 3CPTB 2VASA 1ZMEC 2HVQA 4ZTJA 4NPFX 1R6RA 1OW6A 2R7TA 1LT0A 4NPEA 2NXNB 3U9GA 2CW7A 2M5AB 3CG5A 4DDSA 4G3WA 4G7OF 1S5LH 2Z16A 5E79C 1FT9A 4MO7A 4KMUX 4Q4ZF 1V4RA 4HJGH 1L0LE 2D01A 2MH9A 4HW0A 3T1QB 4A3FJ 1N7LA 3VFFA 1PRQA 2OQGA 1MSFC 1OXZA 4E7IA 5H2FC 5DUKA 2MFZA 3D6ZA 1P0ZA 3NWSA 3HPGA 4EM0B 3F89A 2M7BA 1JI8A 1KA8A 1BCCD 3R0JA 2J3WA 1OCZH 3C30A 1A35A 2Z2LB 1BJZA 5IT9Z 3LW5H 1XGOA 1PZOA 1NOHA 2CJJA 2HQRA 2E76C 3IV5A 2XAGA 2AXTC 2V8CA 3HJEA 2O01J 2X6OA 2XEPA 2VRSA 4DYRA 5AVZB 2A45I 3QU6A 3FGAD 4I3IA 3W67A 2RMZA 1PJRA 3B5NB 1K25A 1SP4A 1U60A 2L9NA 1L0NK 1PPJG 1OT6A 2EIJH 4F3QA 1IUYA 4MFEA 1FZFA 5CQEA 3RK2C 1HD8A 4WL9A 2G2WA 2IS2A 1JO5A 2E74C 3C7UA 4EBNA 4H8RA 1SQVJ 4PPRA 2HOSA 3CCUI 1TD5A 3H3VK 1KQFB 4I7ZC 1D8KA 2GZAA 2HPBA 1FS0E 1FJLA 2E5YA 1W36D 4YIFA 5B3SH 2RC4A 4PJNA 1BC8C 3CCQP 2K9LA 4HF2A 3VV4A 2VODA 2B63J 1JHHA 1U57A 3HL9A 3CWBJ 4IL6H 1S5LC 3H32A 5FO5A 4GS9B 1Q1HA 1VQ7P 3ICYA 4ZDLA 2DQLA 3HKZA 2XKPA 4LC1A 1IKIA 2RKHA 1ZRCA 2DMNA 3KP7A 2LXCB 2A06D 3C4PA 4ZYEA 3I59B 2OQQA 5CHJA 1T56A 2V26A 4CZZA 1BIAA 4F94A 4RGXA 3MD2A 4RYEA 2F6CA 1DEEG 2X1EA 3H1IJ 2GA2A 2EX9A 1H89A 5A90A 1MBJA 5L09A 2MD0A 2GZWA 3P09A 1MMDA 3ESWB 3S8PA 1QVUA 3HD7B 2R44A 4L76A 3PLNA 2P5LC 1YJWP 4YFXF 4GD6A 4N4OB 3Q3SA 4FASD 3VP3A 2H10A 4MLLA 5HODA 4HEA2 2DCFA 3HOTA 4U7BA 1PL5A 4P85A 4J19A 2HVRA 2DODA 2E5NA 1JE8A 5FKOA 4LRYC 4BUPA 1YJ9I 4OGQD 2KLOA 2M0CA 3OCNA 4N4NB 1AQ5A 1OT9A 3AKZA 4XSZF 1EKEA 3P8MC 4B09A 1N78A 1KU9A 2VI6A 2DAOA 4IHYA 3EFFK 4V19K 2HLOA 1Z3XA 1F5TA 3KEQA 1OTIA 3LSTA 3S9OA 1VETA 2HEOA 1F98A 3G30A 3R4YA 4BL2A 2W1TA 2PLYA 3ZNYA 3A0BE 4BKXA 1Y8QB 2L7FP 3M1EA 2HDDA 3ZYTA 3HGGA 5E3NA 1OX3A 3BTJA 1Y56A 1IZ1A 4ME4A 1FZCC 4HA8A 1NTMD 4R70A 3HGYA 3O8HA 1Y6IA 2JO1A 4LLHA 1RF1A 2OWJA 4CLCE 2M3EA 5CVRA 3A0HE 1DRMA 2J5PA 3KFWX 3PIPF 1BGYG 4IL6C 1I1SA 3S1YA 4P87A 5HVQC 2R7VA 4II3A 4BD1A 2O01H 1EXJA 1M8OB 5M18A 4S04A 1VFCA 4LG0B 4YFNF 4R38A 5D5WB 3M0DA 1VI0A 3LYXA 2JHEA 1OMIA 2OUMA 4LGWA 1YMSA 5HAIA 1IXCA 2IBDA 4RDUA 1S5LX 4E7HA 1WMKA 5AQAA 1R5GA 2QENA 3KZIH 2KIUA 3CQZJ 3IXDA 4ETSA 2O5RA 2G9WA 4NEED 4F93B 1VQ5P 3SDBA 4I1LA 3JRAA 1RE3C 4DYQA 1MH4A 2M7AA 3L72G 1QZZA 1HZOA 2QQAA 2EXBA 3S1MJ 4KZ8A 3FWLA 2C9LY 4JQFA 1VQPP 2POHA 1U0JA 4MBKA 2VPRA 3PYPA 3VP1A 2PAVP 3TOIA 5BPIA 2XV5A 3CD6I 1L0OC 2ME0A 4NQWA 1GV2A 3HG9A 3S2WA 4AD9A 1SQBE 3H82B 4GODA 1FC2C 2NZ2A 3M2KA 4JK1X 4Y99B 4DMZA 2Y0EA 3F22A 3NXSA 5FKNA 2GOMA 4ANJA 3L9FA 3VYRB 5HAPA 5CMZA 5CTNA 5EJCA 4U87A 1S1YA 4O0PA 3T97A 4E3LA 4OAZA 2I72A 1LE8A 3F21A 2K9MA 4IBXA 1O4XA 3MTUE 4JX5A 2Q8KA 4CO8A 3S7NA 5HD3A 2XD5A 1T3UA 3HLWA 4ASWA 2QJ7A 4YELA 2XRLA 2LKMA 3F8BA 4N0BA 3RQIA 2M2EA 1WSUA 5GP9A 1XX5A 3H1KG 1SKOB 2KJBA 1QHGA 4PJMA 5FLXZ 3L73J 3ZPLA 4BE1A 2GUSA 4WZ5A 3R61A 3EFGA 2WKEA 1YE9A 2X71A 4NXGA 1UB9A 3OR2C 2FQ4A 1JY2O 2C9NY 4IL6X 3CP8A 2Y2NA 1RQUA 2IYPA 4UUVA 1SQPJ 2MH2A 3N4MA 2IWBA 3SZPA 3KZIC 3EEAA 1KILB 2HYGD 2XR0A 3V8LA 4OWRB 4I2LC 1TT0A 4L9VA 2HR3A 4G12A 3V8KA 1KD1Q 1GW3A 2W6JH 3CC7I 1ZAOA 4PV1D 1TS6A 3K4JA 3FPWA 2QBYA 1BOAA 3PNYA 4UEYA 1VEUA 2L9VA 2FXPA 4DGWB 2XKMA 2OA4A 2V0WA 3SW1A 3TMOA 1W8QA 5BOHA 2WVRA 3GECA 2K27A 3UIAA 1EXIA 1WI3A 5D6EA 1NH3A 2WPRA 1VQKI 3C1LA 4MHGA 4WLAA 1B4AA 1IFDA 3O87A 2KRHA 1LDJA 4DT0A 3RJUA 2RREA 4IUKA 2QF7A 3PBTA 2BEOA 3R60A 5E2EA 5AVWB 2ZFCA 4JP0A 1R22A 1LNWA 3ASOH 1LWUB 5E1WA 1HOMA 4RMNA 2ID3A 1KQ9A 3CDHA 2WPSA 4EOTA 3H0GJ 1H0MA 4OLGA 3PSFA 1REPC 3LL7A 2Y8HA 1FZPB 3K6GA 1YKDA 2DA5A 2OZUA 3B4SA 3TW6A 3N97A 4JLFA 2QJPB 3G4SI 4FISA 3KZYA 1JKRC 4PMAA 5EM0A 2V4HA 2E7XA 5KHDA 2O9CA 1T1BA 1ODVA 1YJ9P 1FC3A 3D3OA 5F6FA 1FSEA 5HLGA 1IG7A 4B47A 3G73A 1CEFA 1NTKJ 3OBFA 1SVFA 2ZT9B 3NQOA 3RTYA 5K5OA 3H6PA 2DRWA 3E6BA 2XGDA 1ESIA 3NDEA 5HOOA 2VGLS 4BGDA 1YLYA 1S6RA 1A04A 3BT9A 2DMUA 1YAXA 1QVFO 1UG2A 3S14J 5K7FA 5HLTA 4JYKA 3H7WA 3C2GA 4S2KA 3NC8A 5FDSA 1LPQA 1PP9J 1OJ5A 1G4DA 2DW4A 2PHYA 2VJWA 4HX8A 4BE0A 3A01A 3JREA 3AE2C 1H9GA 5GADJ 3PFYA 5EOOA 3RKWA 2CO5A 3RSNA 1JT0A 4KUMA 3BTLA 3RBZA 1XTGB 2H8WA 2AEJA 2WSEJ 5B1AH 5JYPA 1JHFA 4CZCA 3ZMTA 4J00A 5C39A 4GNUA 2FYUG 1Z6TA 4Z2YA 2DI3A 4BYYA 4MQVA 2WGVA 4N9HA 2P81A 2BVLA 2V6CA 1B1BA 2BLSA 4LV1A 1YYCA 1SFCB 4BE2A 3E1IA 5EVIB 1HBXG 1OCPA 1F1ZA 3ML6A 1G68A 1YO5C 1LFPA 1R36A 3HEFA 1I6HJ 5B66H 1IYPA 1DY6A 2WT7A 1VNDA 3U2RA 4EEPA 3FMQA 4HV6A 4LCMA 3UPPA 3E0YA 1SQVD 2E36A 4DZJA 3W4PA 3LIEA 3RK3B 3DBRB 3OYGA 2WB1A 2HDUA 3JRBA 1FOFA 4A3LJ 2Z4EA 5AVEA 1W5SA 4HIAA 1LTJB 1KE3A 2WBMA 3F72A 2P9VA 3UMEA 3CUOA 4I3JA 3HOSA 1BE3G 3CWBD 5B5EE 3I56I 4A0XA 4MBFA 1WCMJ 3E6DA 5CPRB 1JCCA 3TL4X 1XCBA 3L74J 1USSA 2X1CA 1YMXA 2HPCA 1U5TB 5F5YA 2XNXA 4WWIA 3DEUA 1BI2A 1M90Q 2OCEA 1KZHA 3U59A 2L4AA 4UNOA 1U9NA 4FCYA 1FEXA 3HOZJ 1EQ7A 1USTA 1RNLA 3ZN0A 3H1ID 4F3LA 1GHMA 5EEGA 2XD1A 4MNUA 1NKZB 1IFQA 6PAXA 3Q5FA 4JGPA 2R5YA 1IDZA 4I39A 4FSFA 3VOEA 3F8FA 1KN7A 4P96A 2E5TA 4LLNA 2EA4A 2QYOA 5LHHA 3HXLA 3SS5A 1T8ZA 4N1XA 5DJUB 1X58A 1TWFJ 1GHIA 1NXYA 4HKZH 1WJBA 4GXOA 3V4GA 2ZC2A 1ZP0C 4XKCA 2PR5A 4L9TA 4EVIA 2OYIA 2HKXA 3B5NC 1SCWA 4XLFA 4WXDA 2E1CA 2AEMA 1Y39A 1OVVA 5B66C 4XSXF 3VEPA 3K4CA 2HYFA 2A68F 2R5ZB 4RQ9A 3TNUA 4KT0J 3NWTA 2E2JJ 3A4CA 1KQLA 4LOCA 1A02J 1XX2A 2DT7B 5EDNA 1IFPA 3V2PA 2BG1A 1EH8A 3CC7P 2R7QA 1ZKGA 3FMSA 1B9NA 4R3BA 1IKGA 1EZVG 4XLCA 4ARZB 2VKEA 4E3KA 3ZQ7A 2DW3A 5EEHA 5EFWA 2EK5A 4KQQA 3PJSK 1H8MA 2BY2A 4Y52J 1G28A 3HRTA 3ABMH 4KN4X 1KOUA 5EYRA 1UZCA 4S2LA 4ENKA 1PIOA 3IQAA 5TGTA 2A45H 3UE1A 3IUOA 5KLVG 4PK4A 3CX5I 4K3AA 1UHMA 5IP9J 1VQKP 3BRMA 1OFCX 2WUQA 2FF4A 2CK3H 2BEQD 2W3HA 1KFNA 1FMWA 1JWVA 4GB7A 2QSGX 4HZFA 4JYBA 1WYBA 2ZL1B 2DA7A 1MWTA 1Q1VA 5APUA 2A61A 4HG2A 5JHUA 1TWAJ 2XV4S 2DO7A 1H8ZA 4C3IJ 3TDUC 2EA9A 1BCCG 4UVCA 5HLIA 4KQDA 2L5GB 4A7PA 1MDMB 1X1AA 2CMPA 2DOFA 3IH8A 4Q47A 4XIDA 3WU1B 2W90A 3BECA 4DIQA 2ZJQF 3CITA 3HD7C 2GIVA 2WV0A 3LSPA 1GMJA 3BVHA 1KGFA 4I3AA 1JJ8C 5KAIH 2H0TA 3L2QA 2A06E 2XQZA 3D4FA 3JW4A 3G4SP 2H43A 1SQQJ 5FEFA 5C5KA 4DCKA 2EWNA 5LHGA 2K40A 1OQYA 4U3FG 3AE1C 3D5RC 4YG2F 4D6TE 3E4QA 3A0VA 1Z7UA 2OOLA 3BG7A 2D2WA 4P9UA 5J1YA 1Y9BA 2LKPA 1W5TA 2A5YB 2ZVOB 4A3EJ 4HF0A 1LDDA 5EM1A 1ZRTE 4EWFA 2PG4A 3I59A 1NAFA 1SQXJ 3BR5A 3ZVTA 3C1DA 4X0GA 1HSTA 4QTRA 1NLZA 5L8RJ 2FH5A 2VN2A 5EPHA 1Z91A 1RR7A 1RE4C 2K3FA 5DF7A 1O7FA 1K56A 1K38A 1KQGB 1XSVA 3CPWO 3F1PA 3WS1A 4DN0A 3LSHA 1FZAA 5E79E 4KJZA 2K9YA 4IFMA 3V50A 1SFEA 2CQXA 5AW0B 1WWXA 2XA7M 2ZC4B 5H2FE 3L73D 1FOXA 3A1YA 1YITP 3OZHA 2M45A 5DD8A 2TCTA 5ICFA 4M9SA 3DLLF 4C9YA 3CX5D 1E2XA 4CYDA 4BXUA 3AEDC 4KZ7A 3GG2A 1RETA 3GQZA 2ZJ9A 4IOCF 3P9CA 1ETVA 3E4PA 5EVLA 1PZQA 1B6AA 1YSQA 3O3KA 5IS1A 5KAIC 3L75E 2AXTE 2ZSIB 2QQ9A 3FXJA 3HZJA 3K1MA 3UDIA 5JVGF 2DXIA 3AAFA 2QJYB 2JA2A 5IPAA 3UKGA 4FD8A 2RDPA 1M56D 4ESFA 2BYVE 3K70C 2K85A 2PMHA 2IX7C 4Y99C 1Q82Q 1MZBA 2F4IA 3R0AA 3ZQIA 4QHCA 4P6ZM 4Y33A 3WTZA 4A6EA 2UXNA 2Y9ZA 2A45G 1H89C 1NTZJ 4M3FA 3ELKA 3SWYA 4O3MA 5CVIA 3W6VA 2Z6DA 3GVAA 2V6EA 1QA6A 3E98A 2ZBBA 2ZM2A 3IF6B 1GXQA 5AW1B 4WZ4A 2FX0A 4HYEA 4DJGA 2R78A 3P8CE 1FDIA 4UA7A 3BASA 1NTMG 3IC7A 2W3DA 3K2AA 2VBYA 2EX6A 5LEJA 1ZN5A 3CUQB 1S5LE 1D3YA 3P9KA 2ZOIA 1GVJA 2DJNA 4QMAA 1K56D 4GN2A 1HCRA 3HD7D 5KNLA 3HB9A 5GLCA 3UMDA 2Y2LA 4E04A 4FUWA 2QM7A 2V20A 5BNGA 1ES5A 3ZNTA 1YLWA 4XKBA 1YIJI 1R9TJ 4C2UA 1F4KA 4H44B 3CXHI 2LP0A 4H13B 2R7OA 1NTKD 3EGXC 3AE9C 4DYCA 1J1DB 3E2KA 1W5CC 1YPRA 2YKOA 5E1XA 3JR9A 1B59A 3HTKB 2HDWA 4GDNA 3H3ZA 5HNFA 2E71A 1JUNA 2E8JA 2HDSA 1WFXA 2ZVNB 1L0FA 1L0LJ 1PP9D 3HIFA 5HDDA 3WG9A 2KSEA 4PFOA 4WB4A 3MBZA 3U1AA 4U7JA 3G4PA 1V3FA 2L0KA 5F69A 3OPHA 1AWIA 4ZYAA 1P6RA 3E7KA 3L7HA 3CP2A 3M06A 3MHVA 3K1NA 1USEA 1HA8A 3T4QA 3GMWA 2WZZA 3BY9A 2K31A 1OJGA 2HDCA 4OPRA 5DKKA 4KN7X 4AC0A 3U1CA 3U1KA 3HRSA 1NWQA 1KILA 1DP7P 1PYYA 1I6XA 2LXBA 1XDUA 2LY2A 5KTBA 1JY2N 4IL6E 3WU0A 2KLVA 3CCMI 2UUZA 1NVOA 5CEBA 2KRFA 3FV7A 2STWA 1JMMA 2P4WA 4HY8A 5J47A 5IOZA 1SEUA 2QJPC 3EUHC 2ZC5B 2VOOA 1X2MA 4PM5A 1XMAA 3VP4A 3CO7C 1JY3P 1UFMA 2N1TB 5APXA 3WU2E 3PXPA 2K9SA 1TW3A 3NY4A 2C0WA 2ZT9C 3ZMDA 5CCHA 2XASA 1UIXA 2ZYGA 3H1HJ 1BSHA 1NRJA 1SVOA 3OL3A 1K55C 5FKKA 2DTZA 3PNTA 4Y5FA 3DWKA 2BCCG 1S3JA 1OTEA 2EZKA 2GXBA 2XAUA 2IS1A 4IHTA 1LWUA 1JCDA 3N4XA 3T8TA 2X48A 3BM6A 2MSYA 4B93A 4I7HA 3H0DA 5FA7A 1JXSA 1ZTUA 1SHVA 2V9PA 2LH9A 3CC4I 1OPCA 2V1UA 3WTTC 2XU6A 4LLGF 3VMAA 1BZAA 4GOEA 5DFYA 2Z99A 4Y3IA 3MZEA 2HJ9C 3CL3D 1L4AB 1BI3A 2OV5A 3F8CA 2O8KA 2BW3B 5HW3A 3VP2A 3KPEA 4R4RA 5J8XA 5DYMA 2GBYA 1LT9B 2OBPA 2EFUA 5C3EJ 4MLOA 4UB8H 2FYUK 4XLAA 5HPFA 1K4SA 1AV1A 4BDYA 5EVIC 1S9KD 5HS9A 3EDPA 1GZLA 1SZVA 3IHUA 4CYCB 2PBYA 3LCEA 3FXRA 4I6ZA 3DTKA 5AW6B 2Y2MA 2XGXA 4UAAA 2QVAA 3L9KA 1KILD 3CDIA 1IN8A 4XMYA 2DFHA 2JKTI 3H1JE 3OYFA 4B3AA 2XIGA 3RK3C 4MMNA 2ZMVA 4WY4C 1LTAC 3D5SC 1A36A 2QKPA 2QJKB 1K7AA 4E4HA 1IXRC 2FZ0A 3T12B 3BCCD 2CV0A 2AO9A 4WM9A 1VQ6I 3T1BA 2W1OA 1L0NJ 1X4PA 3KZIE 1SQVE 2STTA 2R92J 4S2NC 4LENA 3SJMA 2CW0F 2NPSC 5CECA 2VX8A 5CBOA 3TYYA 4ENNA 1Y0UA 2KOIA 5A93A 1HXDA 5CCHD 2NUTC 4YXWH 1SFCA 2QQ8A 3EYIA 2LK2A 3LA3A 1LJ2A 1FZGA 3SFEC 4FE4A 4DJ2A 4Y0OA 1DDNA 2R7RA 2ZNZA 3SZGA 2JQ7A 4R6LA 4XONA 3OYIA 3DW0A 2WTYA 2E1NA 4UA9A 4PGGA 3KYEA 4ZNCA 3FXLA 2HYJA 2JN6A 4X25A 4GZBA 5M19A 3G34A 5KVRA 3GTGJ 1MGTA 5KJ7A 1MBFA 3BLYA 1M57D 3TO9A 1ZN2A 2ZFUA 4M3KA 4U0WA 2KDZA 1LTJA 3O2PE 2WK0A 2PYRA 1YIJP 3H1IE 5K5RA 4Z9QA 3OOVA 4S2MA 1KB9D 3QP6A 2IP2A 1E5WA 2PP6A 5FQKA 2IPPA 1GCEA 3JRFA 3CCSI 2OLVA 3DU6A 4ENJA 3J80Z 1LP1B 1OJLA 1U5TA 3KEYA 2CFXA 3H9WA 2ZT9D 2CG4A 5J3LA 2WKIA 3UE0A 2WSCJ 4JX4A 5E8IA 2BHZA 1MPLA 5HFOA 1R5HA 5FI2A 1SQXD 3B33A 5EZGA 2FEZA 3FKIJ 4LMYA 3RL0B 4UXNA 3OYHA 1FSWA 3K2NA 1R23A 1Q90D 5KK1A 1HDDC 3H9QA 4ZJZA 2EIKH 3RXXA 1ZV8A 1IZNB 3GDIA 5M1AA 1VQ4I 3CWBG 1ZG1A 1R1TA 3LIDA 4JPMA 5DJUA 1EDKA 1BUEA 3B8EB 4UUTA 4ZZDA 1IC2A 2JRMA 4GFBA 3L4FA 3BROA 3HBRA 5KLIC 1MH3A 3A03A 3DV8A 3I7JA 4O7DA 1TC3C 1XTAA 3VYIA 3AEEC 3LFVA 3C7JA 1VQ8I 3NOUC 5ED4A 2R5ZA 5CJ9A 4A12A 1YX5A 1SFCD 1EH6A 2AHQA 3KLOA 2WC2A 1R58A 3CCMP 2E1OA 2Y2ZA 3Q9SA 4ARZA 3VYTB 1FBSA 2MABA 1HGZA 4L73A 3QNBA 4XN3A 3C4OA 1DJCA 3HC7A 4XOPA 1G2CB 5KJ7D 3VB2A 3UDXA 1KE4A 1BLHA 1GXPA 2PD8A 1RRJA 1UCRA 2EXAA 5BMZA 1Y8AA 1VQMI 2J8YA 3MFDA 1IFJA 5GHYA 1MWSA 3ZQCA 4B43A 4H4KC 4BL0B 2VXDA 2ZL1A 2V1DA 1FYKA 1NTZD 1CF0A 4G6TB 4OQ0A 5AVTB 4AYCA 5IP6A 4DBQA 1MDMA 5TRDA 3G31A 1KGEA 2KMUA 4GYIA 1HDPA 1CZQA 1L0EA 4Q8IA 1VQQA 1HKTA 3MUDA 5DDGA 5TJHA 3H9GA 4YFMA 4I2OA 3VP0A 2OYIC 3G9RA 2RNJA 4IVIA 4LV0A 4OQHA 3L2CA 1O57A 2FKWB 1QZYA 1T1AA 2HODA 2VV7A 1S29A 2L54A 5EF6A 2VKVA 3I55I 5LFAA 3OSGA 2JKVA 4NG2A 1YJNP 2JK3A 1K57C 4CCLA 5BPDA 2O6GE 3BG3A 3VDXA 2F5CA 1POGA 1T19A 3N7WA 2VKDA 2NOGA 2VBZA 3ZMVA 1QLED 1H88A 1D0XA 2WB1N 3G6EI 3CC2P 3O3VA 3VE3A 3GSGA 2Z6CA 3IH2A 3V2QA 3M6BA 2NVYJ 4QY5A 3RKYA 2ZJPF 2OGUA 3ZFZA 3JAMK 3S2DJ 3A2AA 1IO4A 4JXVA 1L0LD 4I0AA 1SQPE 3OYLA 2VBXA 1HKSA 3ZGAB 2HYNA 1VQ6P 3F1OB 1SD4A 5GPCA 3ABVC 4ZJ1A 4QPOA 3OIPA 5B66E 5APTA 4NC8A 5EOEA 3ZR8X 4X56A 2Z33A 3SEZA 2NVUB 2QEXP 4A3KJ 2JA5J 5M5XJ 2FD5A 1G3SA 5J6XA 4XLNF 4ZJ2A 4IFFA 2CYYA 2E60A 2M8EA 2XKOA 1EROA 2B9SA 2XF6A 3A3JA 3O8GA 1M1JA 1FQGA 1MKMA 1BL0A 3EQLF 5FATA 2VB6A 1S4RA 5K5GB 5AONA 2V9VA 2M3AA 4EV0A 3BP8A 5M3MJ 2CWEA 1F9IA 3C2HA 3QOEA 4BACA 3IHBA 4LRZE 3CUQC 2ECBA 5HWTA 4E6WA 4UVBA 3HRMA 3UB8A 1NTMK 3TF5A 2W3EA 2VV6A 1LEBA 3CUEA 1BN5A 2LB5A 3TOAA 4NXEA 4XLHA 1BSNA 1UHSA 4D0PA 1FOWA 4KUOA 2EZIA 4I02A 1MSEC 3M3YJ 4H13C 1QGKB 3MZFA 3E5QA 2RH0A 3O88A 4CLCA 2IZ0A 1J1DC 4Z1WA 4OPQA 3H1HD 4L9GA 3GF2A 1PGPA 2YMYA 2L0WA 2B02A 5D8KB 1KQSO 3RK2B 3A3DA 4AU7A 2JP3A 1AKHB 2E74B 3IF6A 2HQ5A 3BPVA 3VP9A 4I99C 2PJRB 5HD5A 2JDIH 2RL3A 1ULYA 4GCZA 4M71A 2VZWA 3TO6A 4I7ZB 1KZUB 2R7ZJ 2IXSA 3V5MA 2B0LA 4RM2A 1T18A 3WS5A 2K86A 3CXHH 1S4SA 4OOMA 2ZXEB 4DQ2A 4B44A 1Y1VJ 4C30A 5APWA 2GA1A 3W6JB 3NEUA 3F6OA 5LLQA 2EJRA 3JRGA 3ZQFA 2J7VA 3GHGA 2FFFB 4EETB 1ZG6A 4GDBA 3MZDA 1VQ8P 4A3CJ 4LITA 1YM1A 2JWAA 4NUBA 2KI7B 3PNVA 1D0ZA 4A3IJ 1P4WA 4C7RA 5LRRA 4G6DA 3HUGB 3LQRA 3HPHA 4O8GA 4RB0A 1GL2A 3HTKA 2L9SA 1XJ4A 2PR6A 4C75A 2E75C 2K02A 3N8SA 2ELJA 3LI8A 2J5UA 3I4MJ 2CUFA 3M8JA 2WGIA 3HL2A 2PMUA 2MGQA 2Y2PA 3Q5SA 1K6YA 2A6TA 1KONA 4H0LB 2PU4A 4C3JJ 3FXDA 5FI6A 1RGZA 3P98A 3ROUA 1P4AA 1TW2A 3BG9A 2M7VA 2XDVA 4CCJA 3H1CA 1VQMP 4QPQA 2WPQA 4AQRD 1SLQA 3HCYA 1LGHB 2MJ6A 2QQBA 1EDJA 3DTMA 5HARA 1NTKG 1IXSB 4L5IA 3LY4A 1KGGA 1MJAA 3W6KB 4CLCD 5KAIE 2XF7A 4B8XA 1IRFA 1J1EB 3LSMA 3L2RA 4R8HA 1T3JA 1HQCA 4WMCA 5FAOA 3OOPA 3G71I 3MZWB 2DA4A 1PP9G 1YTZT 1L3LA 3CJRB 1VF5D 1KYZA 3L74E 1Q2PA 1L4AC 1FZCB 5D3OA 4XBFA 1VPCA 5F1RA 3R2PA 1T2KA 3OPRA 2EQRA 5J4YA 3FC7A 5DM6F 4DDYA 1D1AA 1LL9A 4LRXC 3PRJA 3MKZA 2N1TA 1OISA 1SVLA 5TBMB 5DTKA 3E6MA 2YPRA 3I55P 1U7MA 3W4OA 4BL3A 1Y4OA 3RZOJ 4NBQA 3TGNA 2C6YA 2L2OA 2ZMEB 3QPLA 4A3DJ 1TDLA 3GF7A 1PDNC 3G6EP 1H3QA 2WPVB 4EU0A 4H44D 1MXOA 1JKQC 4H13D 3AE6C 2P74A 3A3YB 2M1CA 2HP6A 3M9AA 1U3EM 3TK1A 3LMMA 1IN6A 4U0XA 2LR8A 4IHVA 2GQQA 3E1RA 4B88A 1H5XA 2OTKE 2LNBA 4HH2A 1XD7A 4X1MA 3HM5A 4XUXA 2LG4A 1W5DA 4MEYF 4Y7NJ 2QPNA 4ID4A 1GA0A 1EA3A 2PFXA 2FUG2 4CUGA 2BW3A 4XXRA 5CCGA 5L3EA 1W5CE 1J9IA 3A3IA 1LT9A 2N8GA 4BHBA 5CTMA 3OAKA 3DEEA 2H28A 2QVOA 3MAJA 1GHCA 4LCLA 3SYTA 4EBPA 4CYCA 1LFBA 3OYEA 4XKWA 4Y0TA 3GV9A 3ZCZA 1CI6B 3R7WB 3F1NA 3G1MA 3T4OA 3N7NA 5AQ9A 1J59A 2QRXA 3ZP5A 5E2GA 1B9MA 2M3BA 4N9KA 3LFUA 3FKVA 1TP4A 1VQOI 4E6XA 2ZAEB 2D45A 1AVOA 3PP5A 2Q9NA 4OOYA 1LB2A 1T2KD 4N92A 3BCAA 2Y55A 1RZ4A 1DP9A 1JJ6C 2R7XA 2FXAA 1W7PA 2N1TD 2I10A 4I98B 2OYHA 2Z5UA 2ACJA 3WS0A 2P5VA 4QIWN 1SVMA 4S2PA 2GLOA 1SQQE 1PP8F 3G35A 1FPQA 3K4MA 1GK4A 3FKWA 3C9IA 4G7ZF 2GXGA 2LBFB 1PI5A 1OR7C 1USDA 3N4IA 1CF7B 4LB5A 4II7A 3DWLE 3ITBA 2KX6A 4JBFA 1U8BA 1SQVK 5F1GA 1V9ZA 4PSXA 2IBZE 2GDNA 3IF4A 2Y0DA 2XA7S 2M87A 2HDQA 5GL9A 4XQFA 3BCCG 2E1MC 1LUJB 1XMKA 2DT5A 1TQIA 2PRRA 4CGZA 5DV5A 3F23A 5G18A 3BATA 3TSGA 4ZC3A 2IT0A 5DEQA 1VZ0A 5AQ7A 1K61A 5J3WA 2MC3A 3BOQA 4D7MA 3OYKA 4QB8A 1YQSA 1PIXA 1PUFB 2V2FF 2WAQA 3JSOA 2OYOA 2W84A 3OV8A 1FOKA 1C0WA 1LP1A 3OC2A 1RF0C 1QMEA 3Q7ZA 3HOXJ 2OWHA 1G59A 3S1RJ 2GM4A 1XGJA 5GTIH 2K37A 3H35A 4MN4C 5HS7A 1D1BA 3ZMSA 4ZAMA 5IHVA 1C3BA 2TDXA 2VK3A 3K2ZA 2PFBA 1BGYJ 4BQMA 1OTBA 4JX6A 4BQQA 3MFKA 2DPUA 1ETQA 2HXOA 4CHUA 3Q7VB 2EH3A 3ZQ5A 3DFGA 5I5LA 3Q5PA 1KVMA 1L2PA 1T39A 3LW5J 3FISA 3WUVA 1BJAA 1K73Q 4NC6A 3KSFA 1OMEA 4P6ZS 2YKQA 2EA2A 2NUPC 1J7KA 2F48A 3SWKA 5EE8A 3NJAA 2CQKA 1NU1G 1N73A 3GUDA 4Y2FA 1RC9A 2WSSH 4C46A 2FRHA 3ONQA 1AU7A 3OWTA 3UR3C 4S2JA 1G1IA 3JYIA 1HGVA 5IYDJ 2W83C 2ZQDA 2BGCA 3JTHA 3RK3E 2V1NA 4AIDA 3QP8A 3NIAA 3KYQA 1QPMA 2WADA 3L72J 3TW8A 5E20A 3IRRA 3HLFA 3G71P 4XM3A 2ZM8A 1KV4A 1GUUA 2PYPA 2AEFA 2Q3EA 3PBSA 3X2QH 3OPPA 2LOOA 2KZVA 5CYVA 3L2VA 3SEQA 4ZYGA 2KOGA 3NFQA 2QJ5A 2EBIA 2WY8Q 3SDGA 1FWZA 1PFIA 2NRGA 1XSDA 1NTZE 2ZQ8A 2ZC7A 1MD0A 1ORKA 1OYWA 1MMAA 1IELA 2KLUA 1URQC 3S32A 1HTZA 2D2CB 1G2CA 4F92B 2IRFG 5KSCA 2WKPA 3AE3C 1ZR2A 2FXOA 2M0MA 3O5YA 1OKRA 1W63Q 1IK9A 3T4SA 1DD4A 5DCMB 3IXHA 2KT0A 2V7FA 3L2WA 3CZ6A 4WF2A 1PP7U 4ZTFA 4EQQA 1TQPA 1XGNA 5GTIC 5HAQA 3ZMUA 1AHDP 5HPIA 5D4SA 1MV8A 1UWNX 3L70G 5AVSB 5HS8A 1D5YA 1NK3P 2G0EA 3R6SA 2XH9A 3V4WA 2VKSA 3J81K 1L0GA 3RL0D 4LK1F 2QM8A 3FWNA 3OMYA 4KG6A 4LPZA 4A93J 2Y69H 3HOYJ 4MCWA 3PQKA 2LR2A 2FFDA 3EUAA 3IL2A 5EUAA 2IJLA 4JBAA 3ZG0A 1NG6A 2KNCB 2K9JA 1H0TB 4A2UA 1NYYA 1VTNC 1RCJA 1R8EA 5IYBJ 2BE5F 1DU0A 3LICA 1T0FA 5K7HA 1KDSA 9ANTA 3HSFA 3WTWC 4IX7A 1F5MA 5HDCA 2DA2A 1GV5A 2DFFA 3KXDA 2A24A 1ES2A 3LFKA 3GCMA 5E2HA 5DJTB 2YO3A 1XGSA 5HWWA 3BQYA 5FASA 5APYA 4RX3A 2O0YA 5AW2B 3A3EA 4IHXA 4L75A 1RY3A 3IH9A 2A5WA 1FBMA 4EQIA 1JTHA 1XA7A 1Z77A 2DYRH 3BJAA 4EV4A 3EETA 4IOAF 2V4JC 4OIRF 3IX4A 3VTPC 4HOBA 2NYXA 4RM3A 1TLHB 2CQ7A 2VT3A 1S67L 1V5EA 3F1OA 1AQTA 3GWZA 1I39A 4AIKA 4D5FA 4I01A 3H1JJ 2IS4A 3FX3A 3HLCA 4IOIH 1Z6FA 1FYLA 1UWPX 4OPZA 4RA7A 1NTCA 3KE2A 3GTMJ 1DQUA 4XA4A 4LG3A 2KB7P 3FM3A 3KP5A 4KZ5A 2Y4AA 4RBOA 3S3NA 1VB6A 3WRTA 3K7AJ 4IJGA 4E3JA 4S2IA 1TS8A 2HS5A 4AM3A 1K4FA 3Q07A 1R71A 1PGJA 3W2WA 1K4EA 4EJUA 3VMYA 4XRMA 2JWTA 4XT2A 4FH2A 3A0BH 3H1HE 2ZC3B 2ETHA 3U4LP 3M9HA 3CMAI 3H5NA 2DA1A 3ECHA 2A49A 3U1DA 1XPBA 2A05A 1GD2E 1NG7A 3ZGKA 1ZGJA 1X8YA 3A0HH 2X02A 2P10A 1Y28A 2J3TD 3S2HJ 3L35A 5L2FA 1BOBA 4EUZA 5B1BH 4GD8A 5FB2A 2Z5IA 1WHUA 1RKWA 1ESUA 4UVAA 3OLOA 1BYWA 1BI1A 2ZYAA 3SS3A 3ZRGA 5GHXA 3NCKA 1O3RA 1MW7A 1K6OA 4H6JB 5FEGA 1H9TA 3WE3A 3HOUJ 2ZJRF 5J40A 5DKLA 1K8AQ 2QWSA 1ZTRA 5GAEJ 2JSCA 5K1YA 4NPDA 3P9IA 1N7SC 1TWCJ 4H0LC 4EI2A 4D6TD 2WV1A 2INWA 4EDFA 3GFIA 1S66L 5E43A 2P67A 2X6YA 5D5UB 1GVDA 3CCLP 2R3SA 2ISYA 3S16J 3B02A 4Y13A 1ZRTD 1I1GA 3VOZA 3CJMA 4IEDA 3T8RA 1Q86Q 2KP6A 2HP9A 1R1UA 3K10A 4V2FA 1PPJD 1FCNA 3CMEI 1W4MA 2NRAC 3MQQA 3UNWA 2ELHA 1IOUA 1P9WA 1MBGA 3IH3A 2B18A 3K4LA 1NAYA 1NTKK 1ZQ3P 5J1RA 3BLMA 2R4GA 3IKTA 4HDVA 3KO6A 1J1EC 2NS8A 1KDWA 2NNNA 5M1BA 3QNCA 4KNYA 1RKTA 1L0NE 2Y91A 1E25A 2WYXA 3SZTA 4ESBA 4HESA 2DJIA 4E3NA 4D9JA 3L09A 3A0BC 4GOGA 4XLEA 2FBWC 2ZQ7A 3FYZA 4WF0A 1XJ6A 3AECC 1ZR4A 1PGQA 3CCEP 1ENHA 2HQNA 1IYSA 3KP4A 5FDHA 1JTXA 3IWZA 4JF4A 4KT6A 5F0FA 3A0HC 1KTMA 1IDYA 4YEJA 3J7YJ 1FCOA 2W85A 4WELA 4DKIA 3AG1H 3BFDA 4BEHA 2ZMEC 1ACFA 2E76D 3G2BA 5EGOA 4Z1MH 3G2YA 3DPTA 5FLVA 3HUNA 3TP3A 3L75D 1J75A 3ISPA 1YW9A 1S7OA 2XGEA 1U6GA 1M40A 4A5MA 2H8PD 2J9OA 3BEBA 4N6JA 5ILSA 5IYCJ 1FCMA 1J2XA 3RK2D 4KJMA 4R79A 1BW6A 2IFMA 2VIXA 2Y48A 2E74D 3LR4A 2XZRA 1XG1A 3H32B 1ES3A 1KYWA 2FMYA 2CGPA 1OVUA 2G7HA 2P7JA 1FZCA 4DXBA 2ESHA 3MJQA 4IRHA 3I0TA 3TO7A 2L91A 2YMKA 3WRZA 5DD4A 4KZ3A 2M1BA 3W8KA 2Y31A 5EEAA 5TBMA 4DOZA 4BDZA 2PGDA 1HWTC 3I5UA 3P8CD 4XL9A 2F4OB 4PD4H 2L02A 4MBHA 2E19A 2I8DA 1GL2C 4NB5A 3KYZA 2O61A 3TGUG 4JYCA 3I4NJ 4RLQA 3ZDMA 1R1VA 4HF1A 2PDRA 5FRMA 3PTEA 3SSUA 3GLXA 4ZH4F 1NHLA 3O86A 4BJ5C 1IJWC 1WJDA 5DUIA 3S1QJ 4BRYB 1VQNI 1JEKA 1FSYA 4DF6A 1ZH5A 4AWXB 5KAFH 1ZYRF 4KDPA 5EVEA 1RE3A 2HTJA 3KSHA 3ECOA 5KLVJ 3L7WA 4AUXA 4HB1A 4QWQA 1RESA 1KGSA 1IFNA 3CCYA 4IEJA 2ZC6B 1ERDA 3OCLA 1PZPA 3W4QA 1EF4A 3M0AA 4PM7A 4H0LD 4M74A 2XSSA 4B3XA 4LGDE 2DOAA 2KRCA 5AVVB 3ABKH 1GSVA 5EECA 5F64A 1YYVA 3ERED 1JUSA 3WMM0 4BS9A 3HHHA 1BCCJ 2W1TB 3HRUA 3WHCA 1BR2A 2X51A 3RH8B 2CV1A 1KYOH 3OPLA 1OCRH 4PJJA 1Z7LA 3K3CA 4GHIA 3AE8C 5APQA 1DGRM 4M4XA 1YTZI 1FAVA 2SPZA 1EW0A 3C8CA 3CCUP 1RF1B 1SQBG 1XA1A 2HXIA 1KU7A 5E8GA 3L72D 3H1LE 2HOAA 3AEGC 2XPUA 3CESA 1CI6A 1QVTA 2JKGA 3M7GA 2IGNA 2CUZA 3LY3A 2RN0A 3GW2A 4ZKUA 2MKVA 4AIJA 5LGTA 2VJIA 3CWFA 1T38A 3CMAP 3OYBA 1VQLI 3GVBA 4G8XA 1LL8A 4U3FJ 1S0WA 2AVXA 3GTKJ 3MQOA 1JTGA 3QYEA 3HJIA 4WX9A 2K88A 3WTVC 3H9JA 1JNMA 4U3TA 2WSFH 2R3CA 1YX3A 3NARA 4EW7A 3H36A 4MGRA 3BZKA 4KFCA 2FNAA 1MBHA 1N25A 3QPTA 3CMYA 2OLUA 4ZJ3A 1PGOA 2Q6QA 4AIHA 1M1KQ 5MC7A 2OQRA 1N77A 1S72I 4UY8I 2LF7A 2PT7A 2Y0SN 3QYBA 1P84H 3GTJJ 3CXHE 4HLXA 4Q5SF 1JTDA 3E3VA 5KAFC 4DXCA 3HUSC 3MXQA 2DPDA 5AW5B 4XN0A 1YI2I 3TDZC 3KLNA 1E4DA 2VJ4A 2RQQA 1J09A 1A6IA 5E3LA 3GZ6A 1JY2P 1IN5A 2OF7A 1S7AA 3MN2A 2XB0X 4HAMA 5FJ8J 2NVTJ 4IBRA 1EC5A 4NKPA 3D72A 3AGEA 1FYMA 3WGHA 1JUMA 1LE8B 1OWAA 5JHFA 4BH9A 4A3BJ 3CMEP 3QWLA 3Q0UA 4ZDPA 4PM8A 2Y2JA 1K05A 1NU1K 1MUUA 5J4VA 3BQAA 2X1DA 1TWHJ 4BXXJ 2DYSH 4DBRA 3E1SA 3VWBA 1TBXA 4EGYA 1J0RA 2YIUC 1WI9A 5J1UA 3HLEA 3CJQB 4QD4A 1KMIZ 1JVJA 1SQXK 1WJAA 3LR5A 4K91A 1HJBA 3IFMA 4O01A 4KENB 1W2EA 4KIFA 4JXGA 3CI9A 4LLLA 2K3PA 3RZDJ 3KX0X 3GLMA 5AVXB 3DF8A 2V1ZA 2L01A 3P01A 4C3QA 2KPMA 2D2CC 1NKNA 3C3WA 4KZ4A 4P5OA 2FSWA 5DTDA 4QWOA 3DBAA 1X4OA 1O3QA 2I1JA 3TBIA 4AFIA 2L7MP 3GFJA 3H1JD 3AE7C 1DP3A 2DTRA 4HQAA 4BD0A 1GSXA 1K9MQ 3UNGC 3O6QB 3DAVA 2Y30A 5D4RA 1DU6A 3W68A 3HE4B 3RGUA 1NGMB 4BXLA 2HTSA 1N9NA 1LJ9A 2Y0CA 2BV6A 4CCMA 4KIBA 3BWGA 2Z5HA 3OIQA 2YU9J 2H7HA 3MEXA 1ONVA 1W79A 2B87A 4M6VA 4WY4B 4A3JJ 3CD6P 1VDFA 3VMZA 2GNXA 2DK5A 2C6WB 5KZHA 2Z2SB 2JE5A 5I94A 1RGYA 4XRSA 4NNJA 3ZXSA 1BR4A 1L0DA 2V1AA 2J80A 5AW7B 3BFFA 2NPSB 1G5UA 4R1HA 1WJFA 3D9YA 4HYTB 4M73A 3ISGA 5IT5A 1SAXA 3D5LA 1OCOH 2EFOA 2WTEA 3JRCA 1NTZK 2W4SA 2Q2EA 3DP7A 4IZZA 2A69F 1VQNP 4HQMA 1WGXA 4FT8A 1AOYA 2JJLA 3G1OA 1XCVA 3RKXA 2V7QH 2LF8A 2OTLI 3HUMA 2W0NA 3S3OA 1JOCA 2BEZF 1R5ID 2PAJA 5G4ZA 4IVNA 4X6AJ 3PUBA 4RAFA 3EQUA 3KHUA 3CPTA 2VV8A 3BR2A 3QPSA 3T1SA 3TJZC 1IFMA 2FNPA 4WWCA 1VQ7I 2EFPA 2K9NA 2X9DA 2O9BA 1HJ0A 4RESB 1ES4A 4OVNF 2M5AA 3MVPA 4ETZA 1MNDA 1Y54A 4EBLA 1N86A 3FZCA 2X4HA 4OLDA 2KNCA 3L71E 1XFQA 2RN7A 3EQ2A 1DX7A 3PIOF 3L37A 1FP1D 4CH7A 2WA0A 3NRVA 1JM0A 5CERA 4J01A 3F8NA 2ZOHA 1LDKB 1FOSE 2E5ZA 3HOVJ 2V79A 5DJTA 2K4JA 3L00A 2PBIA 4OU0A 5LGNA 3OIOA 1JT6A 1IRGA 3V7SA 1FIAA 3S4XA 1YS7A 3FIWA 2G8YA 1HW5A 3C8VA 1TDGA 1XPXA 1YS6A 3I5CA 1VQLP 4CSWA 2HP5A 2WAQN 3OW2O 1L0LK 4RKUJ 2HU9A 2HF6A 5F0CA 3P32A 3L70E 3GRJA 2O9LA 2YX4A 3MMYB 1Z67A 1IF1A 3PUFA 2CSOA 3I71A 3FF5A 4PZJA 3MKYB 3IN6A 2HV1A 4GCVA 4MFDA 4IHWA 2BCCJ 5HDGA 2KL4A 4QJGA 1W36C 2WT7B 1YLFA 5FD5A 5KLIB 1JTYA 1P9QC 1OIPA 3B42A 4Y0UA 3M8FA 3B5NA 3LA7A 3FBNB 4UB6H 1LL5A 4E3OA 2LREA 1K54C 3MCZA 4R23A 2JA7J 1XKZA 1S72P 2DK8A 5A91A 2HZTA 1LVAA 2OAP1 5F6AA 2CUJA 1FMVA 2WAFA 3VSLA 3OR1C 2W27A 1VF9A 5ICCA 1WJEA 3VSKA 1N9BA 3ABUA 2NVQJ 1YI2P 4LB6B 2IA2A 5FFZA 2JKRI 4C7NB 3K9TA 4FTHA 2R7UA 2A3SA 4LIUA 1D7EA 3HLBA 2PI0A 4Q0JA 1FZBA 2D5VA 2HVSA 2KP8A 2I5UA 2KHMA 1ACIA 1FDOA 5FI7A 1D7MA 3PO2J 2ZMAA 5E3OA 4CDGA 1P9RA 2ZFWA 3HLGA 4HBTA 2O1KA 1WZ2A 5GTIE 1X3ZB 2CU7A 2CC1A 2EFXA 4GS9A 4MEZA 4W80A 1SMTA 2XGCA 1MZUA 3MD0A 3UE6A 2FBHA 5DF8A 2MJZA 2NOJB 2E43A 1ODDA 3USSA 3M6HA 1TNTA 3G6OA 2VLGA 3NHQA 4IO9F 3MKLA 4M72A 4F3LB 2ID6A 3JCUH 1MBEA 2QM3A 2R93J 1E17A 3PBNA 3IS2B 1EZVD 4H6JA 1Y0NA 1ZW0A 1PPJE 3K5BA 4PSWA 1UMQA 4NDLA 4OGQC 4IRIA 4EQ1A 3N8LA 3ZCOA 3HD7A 4BENA 5JLXA 1HVBA 5CJ4A 3L36A 3ZMZA 2Y2GA 4HBLA 5KLVD 2W1RA 4GIFA 2QKMB 4PKYA 2BY1A 3CZDA 2OYIB 2OZ6A 3QOPA 3B6CA 1X1CA 4W7YA 5LD2C 3GLLA 4OH0A 3CCRI 5J8FA 3TNUB 1KQ0A 3BFEA 4HI4A 1J3WA 4HHDA 2HGCA 3HSEA 1X9VA 2KS1B 1ONGA 3BG6A 4UB6C 3AG2H 2A06G 1V5GA 2ZXIA 1SQPD 3DTEA 3IXBA 4BXFA 5FQMA 1ETXA 1FOYA 3B5ND 4H0EA 3CLOA 4UV8A 1MMGA 5EFWB 3UB5P 1T1CA 5L3FA 3WS4A 1PWGA 4OMYA 3OYCA 4X69A 4OAYA 3TE8A 5CGWA 2W3FA 3JVUA 4KICA 3AGDA 3SWFA 3QODA 4D6TG 3K3DA 1KQ8A 1WVRA 3A2KA 4GDOA 3VP8A 1RE4A 2UV0E 2JC7A 2EV0A 2WWWA 4YWZA 4HBUA 1P4XA 3MWMA 1H8YA 1JNUA 5M5WJ 1MJ9A 1IV8A 4M9ZA 1HW1A 3I56P 5TJJA 5CBNA 2UWXA 4U3FD 4Q48A 2ZQAA 2ZSHB 4LG0A 2P6SA 1XTCC 1EH7A 3KZZA 1T6AA 1B8IB 4GLQA 2KFDA 4EJOA 3JCUC 4UA6A 1DGWY 2ZBKA 2WGWB 3DKWA 5E18F 1PWCA 3AL0B 2P0WA 1I3QJ 1NYMA 5A2QK 4HSTA 2PJPA 5J8CA 5CGXA 3OY9A 2ITAA 1ERMA 3LAPA 2J59M 4P9FA 3IAS2 3GTQJ 2OTLP 4NK3A 3DKXA 3COAC 4JXSA 2UV1A 3JVVA 2P1JA 4R4LA 1NH4A 3HOWJ 2WKHA 2M7UA 4XORA 4RGUA 2M30A 1ZLKA 1NZUA 4RO0A 3H82A 3VYUB 1BDCA 2XC7A 4HP4A 5FD6A 1BGYE 4XICA 3OYNA 4OP5A 1IO2A 2W25A 3QP1A 2V1XA 1IW7F 1CGPA 3L75G 3WU2H 2KIQA 5E1ZB 1D1JA 2HNHA 1NYHA 1QL1A 3ZG5A 2LB9A 2DQRA 2YKHA 1RF1C 2E34A 2PRFA 3F1PB 2J9PA 4DNCA 1EDIA 5L3GA 3V7CA 4U0TA 3DBLB 3S22A 1SQBK 4BRYA 4RAZA 4JBZA 4JXWA 3FXMA 5F82A 4EJVA 3M0DC 5CQGA 5JI6A 1SS1A 2FA5A 2GIZA 1TS0A 3MSHA 3BR3A 1ZLJA 2NVXJ 1SKOA 2EFWA 1R5LA 2DDAA 2L7ZA 3L72E 2JUGA 3BDDA 2YUSA 1YBKA 3V6IA 1T33A 2FFYA 4P1WA 1K83J 3UPOA 1NRFA 4PV1C 2AXLA 1R7JA 2GAUA 5K5BA 3CCVI 3G1LA 3G3ZA 2D1HA 5F68A 4BBUA 2JTVA 3I9V2 4GGGA 4KMFA 1I50J 5LGUA 1BIBA 4D2OA 3MZ8A 2FYNC 1OLTA 1QVGO 1W0TA 3W2AA 5H6QA 3S1NJ 3TGUE 5HNHA 2HJEA 3B47A 3EEHA 2P8TA 4PGHA 1K04A 4FX0A 4M9XA 2E75B 5D5XB 3HUOA 2QKLB 4A5NA 1TNSA 2IYOA 2O7OA 4ETXA 2CPBA 1G6NA 1Z3YA 2XAJA 5HSQA 3MXSA 3ZG8B 4ZMDA 4AVPA 4C6YA 4FH4A 3E7LA 3FK7A 2R5BA 3H1KE 3WU2C 1IAWA 4I76A 4D5CA 2JKTM 1FR1A 3KETA 3K70D 1LSXA 1YLPA 3MFXA 3L74D 2RCXA 2JCHA 1QHHD 2XHKA 3JAMZ 4ZRRA 3DEWA 2Y2QA 5CRFA 3TOBA 2LRDA 4A69C 1JUPA 1WQ2A 5H6RA 3LR0A 3VFZA 1UG0A 3WS2A 5CVUA 2JMWA 1X0OA 1DH3A 3AEFC 2AQEA 1DD3A 2IS6A 5BU5A 4WZ5C 1SMYF 3HTUA 3LWFA 1S2EA 3RQ4A 4PHTA 2VJJA 2K4BA 4W7ZA 4N78D 2ZLYA 4HJ4A 1ZARA 4BJ6C 5BQTA 2C0XA 1NJ4A 1KB9I 3EUHA 3LIBA 2Q7CA 2QIWA 3CCRP 2IBZI 4RB1A 4DW6A 2BXZA 3CTAA 1AWCA 3HRNA 1U7JA 1WT6A 3TG9A 5A8BA 1GSWA 3MKWB 4I6MC 4PM9A 1M6KA 2QCOA 4RGRA 5C4JJ 2KZJA 3IKVA 4EM2A 5FKMA 1FTTA 1K55A 2FMLA 2ZXHA 2XB5A 4ASVA 2LLKA 4ZYHA 5LBRA 4JOMA 4HX4A 1ETYA 4DOJA 3WWXA 1XDSA 2OAZA 1HH0A 1ZOYC 4BMWA 4L9JA 4Y4RA 5LBQA 3S17J 2RNGA 3JRIA 2P08A 4R1GA 4LD5A 2IA1A 2KZGA 2OCCH 4HDUA 5CGSA 3H25A 2R32A 1JWPA 4IHQA 2J58A 1DUXC 1BW5A 5L07A 2BCCD 4ABZA 1YQ3C 2F5EA 2X0LA 4QSHA 1ZRDA 3O6QA 3JRHA 5EVIA 1BTLA 1A02F 3ITKA 3HE4A 1ETKA 1X19A 3WTUC 1OYYA 2IGKA 1X0TA 4XK4A 4E6KG 3E5UA 1MIJA 2P7CB 2M8RA 3V3RA 3BC8A 2PU2A 2I9VA 1ZRFA 4A0YA 2R7DA 3UN7A 5HL1A 4RB3C 3DKYA 4PD4E 4B48A 1UGUA 5L3BA 3Q5RA 4NXFA 3DBHB 4WY4A 3S7QA 4LK0F 5IT9K 1STZA 1K78B 3T5XA 5E3MA 5F0HA 3U21A 2UWMA 1SQQD 4S0HB 3H1JG 3U2AA 4UB8C 1WH5A 2E7WA 1GT0C 5IT3A 4S2NA 1Y8RB 1RQVA 3CDLA 2IBZD 3KX2A 4MDZA 2NPSA 1ETWA 5DCFA 1MY8A 4LJZF 5KAFE 3IRQA 1O3SA 1UJ8A 3MGNA 1DIPA 2FYUE 5J7EA 4I38A 4D7NA 3G2ZA 3UE3A 2VONA 1SQVG 5LHIA 2YNYA 3RL0g 4IFDK 2P6TA 2OJED 3F9KA 3LEZA 2O01N 5TR7A 4TT3H 4HEFA 1CSBA 3MZYA 3OS2A 2DN0A 3PH0A 3WGGA 4BBTA 3UPNA 3CJNA 4RVAA 4BLMA 3F6VA 2E1MB 3ABLH 1KYOE 2ZB9A 2ELKA 2V0UA 3M2JA 2K7LA 4G6QA 3O6BB 3H5AA 4CCOA 3KPHA 3P7KA 4ASNA 4N9LA 5AVQB 4MTEA 2K7SA 1T8IA 5FFXA 3CCVP 1Q7YQ 1E3HA 3QRFF 1LTBC 4G7HF 4TLFA 1BE3E 4KZ9A 4UV9A 2YSRA 1BBYA 4RX2A 2BVMA 4BBSJ 5AJGA 3VYSB 3KEOA 5EVID 3H1IG 3GTOJ 3IX3A 1OVRA 2RQPA 1TL8A 4OONA 1WE4A 4MN7A 1CW5A 4XFJA 1XFNA 4PJ0H 2B9BA 1PWDA 3ASNH 1KORA 1ERQA 4GT1A 2O9AA 1EV7A 1M1EB 3CX5H 4JGOA 3D0SA 1WH7A 1YITI 1OW7A 3RK3D 4WY4D 3ZDJA 5JYOA 3GR2A 3H1LJ 1S1CX 1S4XA 1I2SA 3TP0A 2H5SA 3V39A 1HUCA 4ZBEA 1YLTA 1P84E 2NS7A 2MYSA 3BYDA 1F36A 1SFUA 3LI9A 2YO2A 4PJLA 4S05A 2QE7H 1ZK8A 2GUVA 4O5VA 4Y3OA 3T4KA 2NPSD 2HOEA 2J5OA 4KQRA 4RGSA 3FHNA 2JVGA 1WKMA 3CO6C 2ZJSE 3FMRA 3P5JA 3CMZA 3UB9A 3CC4P 2ZKZA 2XAHA 4YTPC 4NXBA 4U0YA 2QWWA 4UQIM 2X01A 2EV5A 3NOTC 2WAEA 1FLIA 2KYVA 4C7NA 2BBYA 4V2GA 1TF1A 1EZVE 4HH3A 1URQB 3QAHA 1I27A 4M6YA 2R7SA 5FKLA 4GKGA 3ZQLA 3FKJA 3Q2YA 2P5KA 2BOLA 4II2A 4XRSG 4Y7PA 4L0YB 3EPZA 1PW8A 1TU3F 5KLVE 5GTHH 2MA3A 5FAQA 1U9OA 3LO7A 3BW6A 4P55A 1IUFA 4DE0A 1P92A 3SQNA 2VA0A 3IS2A 3GTPJ 3BR0A 3Q1MA 4LFUA 2MLKA 4PJ0C 2VLAA 3KYDB 3BRVB 3VE4A 3A0SA 2EFQA 5TFQA 5JLWA 3I3LA 3ZHHA 1XXMA 1BCCE 1FJPA 2EV6A 3SOIA 4OH8B 3TW7A 2HOTA 3JC22 3FWEA 3T0YA 2KXPB 3VODA 3BTIA 1R4NB 4WEKA 5KMWA 1LLBA 2Q1KA 3E0JB 1G3WA 4WN5A 2Y2KA 3HSRA 3BG5A 5AVUB 2FOKA 3ULFA 3V67A 5HLHA 2Y2HA 3OL4A 3GX4X 3RFBA 2KS1A 4EUVA 3BZCA 1K57A 2D02A 3V2RA 1ZHHB 4JF7A 3AL0C 4DZOA 3IT9A 2IDBA 1QL2A 1K0KA 3FM5A 4U3FE 3QQAA 5F27A 1X3WB 5G4YA 1LT1A 1O3TA 2DOEA 4XUZA 3BCCJ 3GMEA 1DPRA 2KQRA 1SFKA 2WSEH 4HV5A 4BHPA 2XGNA 2JPBA 5DTTA 2A6EF 2C5WB 1XSXA 5K5QA 2H1LA 2P58A 1X1BA 1L2SA 2L4RA 2AXCA 5CVVA 4BQNA 2WKQA 4MN6A 2QSFX 3L73G 1LVKA 3FZVA 4U7DA 2F5FA 1YTYA 1MC0A 5FLXK 3MKFA 4F55A 1U8RA 1SDEA 2EZLA 2VC1A 4C3HJ 1BDDA 2H94A 3CCSP 5GTHC 3KSIA 4A0ZA 3E2LA 4IF4A 3OYJA 2ZMFA 1SQPG 1M7LA 4XLPF 1B8IA 2BY3A 2LKSA 1D1CA 4WCGA 3PL8A 2WGWA 2KJCA 2JZYA 4I09A 2GWRA 3BJOA 3HVFA 4KA4A 2ZYDA 1ZELA 1DP8A 3FXKA 3Q3DA 3AE5C 3W2ZA 1ITYA 1LTGC 2DMTA 4CJNA 3CUQA 3ULQB 4Y17A 2HODB 1BT5A 3B3XA 4QY6A 5CJ0A 3PBQA 4HX7A 3D70A 1VQ4P 2IFNA 4IQ4A 4M3GA 1NU1J 3CMMA 2X85A 1SD6A 5IOYA 4L5JA 1YHQI 1K79A 4EGZA 1S8NA 3PBOA 4BBVA 3DTIA 3UDFA 2OU2A 2LY9A 1QGPA 3Q1FA 1BC7C 3C2BA 1J5YA 2K3RA 3Q0VA 2OTJI 1IYQA 2TRTA 4GKUA 3DU5A 3RXWA 4ON0A 4O9BA 1Y47A 2Q9IA 2E2IJ 1OTAA 4F91B 1IN7A 1IJDB 4AYBA 5BOXA