1MKMA

Crystal structure of the thermotoga maritima iclr
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
246
structure length
246
Chain Sequence
MNTLKKAFEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKDKRYVPGYKLIEYGSFVLRRFNIRDIAHDHLVDIMKRTGETVHLILKDGFEGVYIDKVEGEQSIPMVSRLGMKVDLYSTASGKSILAFVPEKELKEYLKIVELKPKTPNTITNPRVLKRELEKIRKRGYAVDNEENEIGIMCVGVPIFDHNGYPVAGVSISGVARKFTEEKIEEYSDVLKEKAEEISRKLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IclR transcriptional regulator
publication title Crystal structure of Thermotoga maritima 0065, a member of the IclR transcriptional factor family.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 75
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
A PF09339 HTH_IclR IclR helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mkmA01
1.20.5.640 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1mkmA02
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1mkmA03
1JE8A 3V7CA 4KNYA 3GF2A 1GHCA 2LDUA 3ECOA 4B09A 1YSPA 4HLXA 2W25A 2NYXA 1I1SA 3VB2A 3L9FA 5AJGA 2YX7A 4Q48A 4ZZLA 1R1UA 2DO7A 1DPUA 4KT5C 4KIBA 5K1YA 2KIMA 1LDJA 3T5XA 5LHGA 3H92A 5BPIA 1DDNA 2OA4A 3BJAA 2G7HA 3RYRA 4U0WA 3SXYA 2XHKA 4P5OA 5LEJA 3KSHA 2EV6A 3C2WA 2EA4A 4N9IA 1YW7A 3J81Z 4L9JA 1XN7A 4ETSA 4Y17A 5DD8A 1DUXC 3P9CA 3K1PA 2OQRA 2H27A 2AXLA 5I5LA 1TQIA 1QNTA 4I01A 4UVAA 4DN0A 3BOQA 1ZH5A 2VC0A 4LLNA 3S7PA 2JTVA 4HF0A 6PAXA 1FNNA 5LLQA 1D8KA 2W3DA 1Y0UA 3QP5A 5LGTA 4Y2FA 1BN5A 3T8RA 3HTUA 5DUIA 2VE9A 2W84A 4K2EA 4IUHA 2HS5A 2K4JA 3M8FA 3PFIA 1XGMA 2RV8A 1O3QA 3M7GA 1F5TA 4KDPA 3I54A 4KIFA 2LSOA 4HV6A 2DBBA 3V8JA 1J0RA 2DU9A 3EUHA 3VOEA 1IN8A 2NRAC 1UHMA 3E3VA 5AONA 2HR3A 4NQWA 4I7HA 4PDKA 1YYVA 2A69F 1LNWA 2F5DA 1IXRC 4EJUA 1S29A 3HHHA 3M8EA 1EH6A 1HSJA 2XASA 4HDUA 1YG2A 3E6CC 2UXNA 4R79A 4MTDA 1YFHA 3SHFA 4O3MA 4CO8A 4F7ZA 4U7BA 3ERED 2P5VA 4ETZA 5ERIA 2ESHA 1XSVA 4Q0HA 1HBXG 4L0YB 3LAPA 5FD6A 3HYIA 1OR7A 1FC3A 4YIIA 4I09A 4O5VA 1QGPA 2K7LA 2RN7A 3K9TA 1S7OA 3TOBA 3KP2A 4ZYDA 1KA8A 2CSOA 4LMYA 5LRSA 5D5UB 2C6YA 1Z91A 2JRTA 3CDHA 3BPVA 1ZARA 5BPDA 4I98B 5D5WB 4G3VA 3Q9VA 4Q5SF 1G3TA 5HOOA 4L5IA 3DXJF 4ZH4F 2Z33A 2F5EA 2R3SA 1XB4A 4GO1A 4ESFA 1H0MA 3DP7A 1W5SA 1XCVA 5FGMA 3LSTA 1MGTA 2UXXA 4GXOA 4IXAA 2PFBA 2HFHA 4Q47A 2AS5F 4BNCA 1BBYA 1TTYA 3S7NA 3OOPA 2K2NA 5AIPA 3ISPA 2ACJA 4WXCA 1EH8A 2B0LA 3KSIA 5CJ9A 1K79A 2IJLA 1FT9A 3GW2A 3BY6A 2ZMFA 1D8JA 2LNBA 3FXRA 3WG9A 1K6OA 4EM0B 1IN5A 2XSSA 2F2EA 2LF7A 3K0LA 3JSOA 3HTSB 3ABTA 2VOPA 3KZZA 2M7UA 2WC2A 2OZ6A 3KCCA 3QP6A 5E1XA 1H9GA 2DI3A 2FOKA 4U0VA 3BJ6A 1I1GA 3E0YA 1W7PD 3LWFA 4NB5A 1CF7B 1ZYRF 3S2WA 2DQRA 1FZPB 5KVRA 3SZTA 3GZ5A 2V79A 3WTUC 1HSTA 5LRRA 3BDDA 2XAQA 3QU3A 1ON2A 3BZ6A 2EFWA 3KSFA 4UXNA 5ED4A 5D6FA 1ZLKA 1KU3A 2EFOA 1O57A 3NRVA 2R7FA 1SD6A 3R6SA 4RAYA 1PP8F 2A6HF 2P7VB 2QQAA 4N9HA 1WRJA 2M1BA 5FFZA 2P6SA 4P9FA 3O3KA 4B8XA 2A61A 4OMYA 5HDNA 1BI2A 4RB2C 2ZFWA 4ESJA 1YTYA 5FLXK 4ZYHA 4MEXF 2GZWA 3RPQA 3G3ZA 4LLGF 5CVIA 4HX7A 3WTWC 4IJAA 4YNRA 5C5KA 4OOIA 4ETXA 3Q5FA 4KIGA 1CGPA 3DEUA 4Y15A 4CZZA 5LHIA 4IUKA 2HKOA 3E6MA 3ROUA 2J5PA 2Z99A 2VBXA 4YFKF 1XDUA 1WKMA 2QVOA 4PGGA 4Y5FA 1K7AA 3I58A 2QZ8A 4CHUA 2HQRA 1CF7A 3U1DA 2W57A 4N0BA 1TQPA 4TV7A 2O8XA 4RAZA 3GEZA 2XVCA 2OZUA 4S05A 5ICCA 3EYIA 3QU6A 2VBWA 5LBRA 5TJJA 4IHTA 2PMHA 2EV0A 1ZN2A 3RKXA 3F21A 3F8BA 4A12A 3GXOA 1FBSA 2IRFG 3U2RA 3OBFA 3C18A 2STWA 1OPCA 3RDIA 1UFMA 4G7ZF 2E1NA 1RUNA 1RUOA 2ISZA 5FLXZ 2OD5A 4LK0F 2KIUA 5L8MA 2ZJ2A 3HIFA 1FWZA 2XIGA 2W1TB 1ULYA 2L4AA 3AAFA 1LEBA 1DP7P 1R23A 1Z6TA 3HSRA 3TO7A 5F64A 2K4BA 4IJGA 1VTNC 4G3KA 3HHGA 1BOAA 3KSGA 1TNTA 1SD5A 3GX4X 4OU0A 4PZJA 4YG2F 3S7QA 1FP1D 1LDDA 2YX4A 1ON1A 3W6KB 2RC4A 2YR2A 1R5GA 4JBAA 1SFUA 2RNJA 1IZ1A 2GQQA 2OAZA 1BI0A 1R36A 4U0YA 1B9NA 5L3BA 2L54A 2D1HA 2L3DA 3QPHA 5D5VB 2VBZA 5L3DA 4RGXA 1TD5A 2B18A 2PJPA 5KK1A 3JW4A 3VODA 2FRHA 5HSQA 2H94A 3WTTC 4HA8A 2FU4A 2PG4A 3RJPA 3NOTC 3RFBA 1ONVA 3CUQC 1YW9A 3HRSA 1HKQA 5HS8A 2Q0OA 4QLCU 4M6YA 4RB3C 3WODF 1P4AA 1USSA 2Z5UA 2W1TA 4HDVA 4LG0B 4EJWA 1OYWA 2DAOA 2P6TA 2ZMEB 3BPXA 2CG4A 1U5TB 2V9VA 3FWEA 1XGOA 3EQLF 1WWXA 4BAYA 4FT8A 1O3TA 2LB5A 3T8TA 4GGGA 3ZN1A 4IF4A 2QWWA 5JFRA 4MN7A 1XD7A 1LVAA 5DFYA 2R7DA 3F22A 1B59A 2YPRA 4O8GA 1EV7A 3NQOA 2NNNA 3E5QA 4M6XA 4XSZF 4G3WA 2GAUA 3ZMVA 5D5XB 4IRGA 1MJ9A 4O0PA 1U6GA 2P7CB 2VKSA 1BIBA 4CQHA 1WI9A 3WGHA 2IP2A 3R4YA 1GVJA 4KUMA 4KN7X 4Q0JA 3NHQA 1FSEA 3HUGA 5HLIA 4I02A 1L0OC 3F3XA 4Y3IA 1G3YA 1P2FA 3TGNA 1OKRA 4EV0A 3QRFF 1BI1A 5CVRA 1A04A 3FM5A 4YOFA 4BXUA 1XCBA 1FPQA 2VXZA 3LA3A 1XSXA 4G7HF 5D6EA 3RKYA 3I64A 4LG0A 2DT5A 1B9MA 2DW4A 4EVIA 2ZMEA 2FMYA 1ZREA 2HGVA 4G6DA 2HYFA 3HRUA 1U5TA 3V7SA 2ZKZA 1MKMA 4MEYF 1Z6RA 5EEGA 3VV4A 5DUKA 4UUVA 4M9ZA 4G94A 2ESNA 2QQBA 2KJCA 1Q1HA 3KP6A 5ILUA 3RKWA 2W3GA 3ZMSA 4AIJA 4CYDA 3IKTA 2FBHA 1JGSA 3PQJA 5D4SA 1ZRFA 2GXBA 2NS0A 2CGPA 2GX5A 4KICA 2JPBA 1WSUA 2HOEA 3FMRA 3L7WA 3ECHA 2EFQA 4L9TA 2K27A 2G9WA 2LB9A 4EJOA 4PGHA 4S04A 2H6CA 2STTA 4M9XA 3ML6A 3RYPA 3WU0A 1T38A 4H0EA 5FB2A 1LB2A 3E97A 3RPUA 1J59A 2QLZA 1ZG3A 3S7OA 4KYWA 2PMUA 5A2QK 2ETHA 3BP8A 3ZMTA 5DV5A 2CW0F 1LQ1A 5K5RA 3K1NA 1U8RA 1FBUA 2HTJA 1HW5A 1Z05A 3IWFA 3QPTA 3WE2A 5L3EA 1Z1DA 1Z7UA 3RTRA 1W7PB 1ZLJA 4G7OF 3MF0A 4HOBA 1P6RA 4KFCA 1OYIA 3B73A 1V3FA 2D2WA 4I0BA 3I5UA 5E8IA 4WCGA 4ME4A 5JR3A 2W1RA 3BJOA 4QWQA 1RNLA 1DPRA 4GLQA 1KGSA 2IA1A 3CTAA 4DQ2A 2QYBA 2A68F 1K78B 1X3UA 3V4GA 5AIQA 1TF1A 2M5WA 5HLHA 4PAUA 2BE5F 3ULQB 1U5TC 3HSFA 2Y0MA 2JPCA 2PBIA 1MJAA 1AWCA 2W24A 2LF8A 3EYYA 1R5HA 1R7JA 1XMAA 3DQVC 4JK1X 3GLXA 2RQPA 5E17F 5F6FA 5A2QZ 1IN7A 3GFLA 4BHBA 5DFXA 3PQKA 1B6AA 3WGGA 4UVCA 5J8FA 1BJAA 1JHFA 1R22A 2XV4S 1MDMB 2MC3A 2ZNYA 1KU7A 1IXSB 4YFNF 2V1XA 1YS7A 4ENNA 4L0ZB 3ZP5A 3KETA 4RQ9A 1FBQA 1O7FA 4Z1WA 2P5LC 1B1BA 3R60A 4YIFA 3NEUA 5LGUA 1SFEA 2RVCA 3G73A 3LFVA 2MBFA 2MA3A 3TDUC 2KIFA 3FMQA 1SMYF 2KRFA 1ZG5A 3F8NA 1QPMA 2VJWA 1IN4A 3P7NA 1W7PA 2IT0A 3CUQB 2Y48A 1ZTUA 3E6BA 3J7AO 3IL2A 2UZKA 5DEQA 4MDZA 4L9VA 3Q9SA 2XAHA 3F72A 2XKOA 2FBKA 1K78A 3F6OA 4A0XA 5L3GA 3MWMA 3WTXC 2F5FA 1Z9CA 4AVPA 1KYWA 5ICGA 3FZVA 5HPIA 3IBJA 1QO0D 2O03A 2OQGA 3VEPA 4KA4A 4I2OA 4BYYA 2BV6A 3O6BB 2PEXA 3C3WA 1OMIA 1ZGAA 4RGUA 1YKDA 2A5YB 2XKPA 2FEZA 3JTHA 1YIOA 3V7RA 4XLNF 2BBYA 1MDMA 2ISYA 5BS6A 5JHUA 1F1ZA 3IHUA 3GUDA 4DMZA 2BYVE 2W85A 5HVQC 1GXPA 2CYYA 4U88A 4XLPF 1GXQA 3IRRA 4WK8F 3P9KA 3HRMA 4RS8A 2Y79A 3VFZA 1PDNC 4LRXC 2VODA 2O9AA 1R00A 2ZO4A 2O99A 4LRYC 2MD5A 2FF4A 1L3LA 1ZAOA 2F5CA 2MH2A 1KYZA 2G7UA 5F1RA 4G8XA 4LLLA 3E5UA 3ZMUA 1T2KA 2OU2A 3CUQA 4LFUA 4PCQA 2DPUA 4MHGA 1MJBA 4MGRA 5E1ZB 5K5BA 1WQ2A 1S8NA 4P96A 1J7KA 3LFKA 3DBAA 3F6VA 3K1MA 2QYOA 3I53A 4IRHA 3FXQA 5J6XA 1PUEE 1ZG1A 3TO6A 4IRIA 5DD4A 3RI4A 5H6RA 2XAJA 3KP4A 1SD7A 3M1EA 5HLGA 2HDCA 3KEQA 3F8CA 3WTZA 2FXAA 3E98A 4MQVA 3P9IA 2O9CA 1IF1A 1ODDA 2J5OA 3QOPA 4WWCA 2NAZA 3DKWA 2FE3A 2Z3YA 1HKTA 3ABUA 3W6JB 2PQ8A 3T0YA 3E5XA 3GVAA 4HQEA 1KQ0A 3I0TA 2XGXA 1C0WA 5H6QA 5J8CA 1XMKA 3EETA 2VEAA 1O3RA 3R0AA 2HEOA 3BWGA 2EJRA 3ZQ7A 1FYMA 3MZHA 1IRGA 1TW3A 2ZBKA 1J5YA 4AIKA 4L9NA 4LGWA 1TLHB 2GXGA 1USTA 5DCFA 3CO7C 3M9AA 4KMFA 5LEKA 1R1TA 1W5TA 3MMHA 5BMZA 3K2NA 4LB6B 4P9UA 1R1VA 2VT3A 3WU1B 3WTVC 1JXSA 2HGCA 3KZYA 2EK5A 3SFZA 4Y13A 2LKPA 1O7LA 4O01A 2WV0A 3DPTA 3TRCA 1G4DA 4OIPF 3ZMDA 1J9IA 4XBFA 2ZXJA 1G3WA 3E6DA 2OOLA 2GA1A 1B4AA 4Q4ZF 3D3OA 2QQ9A 1D5VA 3MAJA 1FSHA 5LHHA 5FO5A 3SZPA 2QM3A 3IWZA 1IRFA 1G3SA 5E20A 2Q2EA 3KE2A 5HPFA 2V1DA 3C7JA 4IHSA 4Z2YA 4L18B 3TKYA 4HX8A 3FHZA 2TDXA 3DFGA 2O0YA 4D0PA 4M74A 3B02A 5FFXA 1RZ4A 3SQNA 2Q8KA 4U7DA 2D1VA 3LAJA 2EB7A 2CQKA 1IW7F 2M87A 2ZCWA 4R8HA 1XSDA 2P4WA 2P8TA 2QUFA 1UHWA 4OINF 1MD0A 3T1BA 4EMSA 2DFIA 4O6JA 2VE8A 1P92A 4G6QA 2MLGA 1FLIA 2IA0A 2V6CA 1YSQA 5ICEA 1XGSA 4GYIA 5BQTA 4HBLA 2O6GE 2VC1A 2HZTA 5LBQA 3CITA 4RB0A 2HTSA 2MLKA 4I0AA 4ZZDA 1EH7A 4OIQF 3CUOA 3GFIA 4ENJA 4BWIA 4HAMA 3KFWX 1ZRCA 2KJBA 1KQ9A 2KOIA 5ICFA 2Y75A 2IVMA 4MTEA 1ZHFA 1BI3A 4EGZA 2BGCA 1TNSA 5IT3A 3OOVA 1HW1A 3V8KA 1G6NA 3GWZA 3JSPA 3TQNA 2FSWA 3KP7A 1F5MA 2NNYA 3IC7A 1E17A 1BC8C 4OIOF 5CLSA 2O61A 4UHTA 2QBYB 5ILVA 3R4KA 3F8FA 4EM2A 2CWEA 2FMLA 3C1DA 3N4MA 2PN6A 2FBIA 2VBYA 2QENA 4ENKA 2E1CA 2UWMA 4AWXB 2VZWA 3NOPC 1V4RA 1BIAA 2JSCA 3EDPA 4HZFA 3CJNA 1UCRA 3KP3A 1YLFA 5HS9A 4RGRA 1VHMA 1SFXA 4IPAA 2XRNA 1OYYA 4LB5A 4M71A 4WX9A 3O2PE 3WGIA 2WTEA 1FY7A 1STZA 3ZQ5A 5TRDA 4E04A 1T98A 5FD5A 1ZRDA 2EFNA 1IXCA 2V1UA 4HF1A 5L3CA 2BEOA 4UV8A 3I71A 3FF5A 3I59B 2Y8HA 4A0YA 3ELKA 3KP5A 4WXHA 4RB1A 5DDGA 4G9YA 3EEAA 1QZYA 2A3SA 3JTGA 3D0SA 1D3YA 5CVUA 4A2UA 4OMZA 2WWYA 3R61A 3IKVA 5D8LB 2W3FA 1JHHA 4JQFA 3TO9A 2QBYA 5L3FA 5ILSA 3MFKA 2K31A 1SAXA 2A6EF 2DTRA 5E8GA 3ZN0A 2DLLA 3N97A 2L4MA 1F9NA 2IPQX 5E18F 1XDSA 3LQQA 1U2WA 1J2XA 1HXDA 3D5LA 2COMA 2CFXA 1HQCA 3REOA 3HOTA 5E1WA 1TQMA 4OIRF 1FYKA 3BJNA 3JAMK 1LDKB 4FHTA 2H09A 3BROA 3FMSA 1YW8A 3TDZC 3MZYA 3TOAA 1O3SA 3DPLC 2EV5A 2DPDA 3ZMZA 4EQQA 1J75A 2HWVA 1YS6A 4MMNA 3K2ZA 2EA2A 3H3UA 4FX4A 4BHCA 1FX7A 1HW2A 4FX0A 2FQ3A 3I59A 1NHAA 4R70A 2E7XA 4HF2A 4KMUX 1HKSA 4E70A 4ON0A 1KQ8A 1S3JA 2MH9A 4CICA 2ELHA 2RKHA 1IUYA 2X4HA 2D45A 5HDKA 3FX3A 3L09A 1SMTA 4MQ9F 3MQ0A 5CVVA 4ZYEA 4FOFA 2DK8A 3R0JA 4MNUA 2IA2A 2O3FA 1T6SA 3WE3A 2KKOA 1QZZA 3K69A 3JAMZ 4EU0A 1TBXA 1U3EM 2EFPA 5CVJA 1UB9A 1W4MA 4HX4A 2P5KA 3KEOA 1PP7U 2GIVA 4A0ZA 4CGZA 4LRZE 2FNPA 2HQNA 3KLOA 4NHJA 2FA5A 4A6DA 4M9SA 4R6LA 1P4XA 2GWRA 1YQAA 3L2CA 4ENMA 4M73A 3FXUA 2H6BA 4M72A 2M45A 5BOXA 2VONA 1H9TA 4MCWA 1FOKA 1I6XA 4LD5A 3RIRA 3MEXA 4AD9A 2L01A 2EWNA 1F4KA 3MCZA 1SD4A 1RIOH 4LK1F 4P55A 4GYGA 3HCYA 2FNAA 2CO5A 3QAHA 3KO6A 4IVNA 4XSXF 4ESBA 3HSEA 3F8MA 3ZPLA 5D8KB 2PLYA 3DV8A 5DCMB 3CO6C 2VT2A 5HDGA 3F23A 4EJVA 3J80K 3LA2A 1MZBA 2KLIA 2GA2A 5D4RA 3FM3A 4L5JA 1S7AA 5JVTA 4LJZF 5HS7A 1T0FA 4BH9A 3HOSA 1FYLA 5HL6A 2JZYA 2K02A 1BC7C 5DYMA 1LEAA 4AIHA 4RGSA 5K5QA 5JI6A 3LQRA 1KU9A 3IBRA 2HKXA 1RI7A 2M30A 1ZGJA 3LA7A 1IAWA 2DK5A 2JT1A 3GZ6A 4HLYA 2XROA 3H3ZA 1YO5C 3GYHX 5EEHA 2K86A 3V8LA 5H20A 2XAGA 3O5YA 4UNOA 1LJ9A 4GW9A 5IT9K 2HYGD 2X0LA 2W3EA 4EJTA 2YU3A 1QBJA 4R1HA 3NOUC 5CYVA 2A07F 4EGYA 2ADUA 3GFMA 3HRTA 2RDPA 2Z9OA 2YSRA 4ZRRA 4HV5A 2O9BA 3J80Z 2L02A 3G6OA 3IRQA 1REPC 1BM9A 4EM1A 2M7VA 3OV8A 3KLNA 4HQMA 4BQAA 2IW5A 1I5ZA 4ZYGA 4HYEA 4A5MA 4GCVA 2E7WA 4UV9A 4YFXF 2VOOA 5DCMA 5K5OA 1AOYA 4EUVA 3I4PA 1KU2A 4A6EA 1S6LA 4UVBA 3WTYC 1TW2A 1IN6A 2XUBA 2W3HA 2M8EA 4CDGA 4WXDA 3GFJA 1T39A 3CLOA 4BHPA 3WTSC 5LGNA 2ZNZA 3W2ZA 1E2XA 2XAFA 2PI0A 1MC0A 2DQLA 3U9GA 2RGVA 3L00A 3GO5A 1P4WA 5IT9Z 3COAC 1R58A 1U78A 3DF8A 4XRFA 1FP2A 1XGNA 4QPRA 4CXFA 4WF2A 4Q0IA 3J81K 4DNCA 2VN2A 1I27A 3CI6A 4KN4X 1QQIA 4A5NA 4HW0A 2OBPA 4ASNA
chains in the Genus database with same CATH superfamily
1JE8A 4OQHA 4BBTA 2HDRA 3N8RA 3OW2O 3ECOA 1S9KD 3UB7A 4XA4A 2V9KA 1YSPA 4K0XA 2IBZG 1NZUA 3ICYA 4EBPA 5HWWA 2M4KA 5AJGA 2LP0A 3CJMA 4ZYAA 4HNUA 1CF0A 2BASA 1R1UA 3CX5E 3NC8A 1OX3A 3E4OA 4H44D 3TOIA 5LHGA 3KX2A 5BPIA 4BXXJ 3RYRA 3HL2A 1LL8A 4NETA 1HGZA 1LSWA 2VL8A 1AVOA 3C2GA 3MQOA 1IFQA 2O01H 4CCKA 1DUXC 4JBFA 2OQRA 2H27A 4ID4A 1LE8B 2R5ZB 1QNTA 4DN0A 3Q07A 4KJZA 1NTMK 1JTHB 5MC7A 6PAXA 5LLQA 1D8KA 3OSFA 1JO5A 1BE3J 4BE2A 1JVJA 3T8RA 1HA8A 3HTUA 4PM8A 4K2EA 1YIJP 2LH9A 3H1HD 1ETYA 1VQMI 4IUHA 2K4JA 2H0YA 1JTXA 1SFOJ 4S2OA 1VEUB 2KMUA 1F5TA 1NU1G 4KDPA 5TR7A 3BASA 3V4WA 2JA6J 3DKXA 2YIUB 3UB5P 2DBBA 1J0RA 1KE3A 2DU9A 2NRAC 1XP4A 4DJAA 2GOXB 4EBLA 2FXMA 1L4AB 4I7HA 3F1OB 1YYVA 5KJ7A 2LMDA 2W27A 4JF5A 4XICA 1E3OC 2R7VA 2ZC4B 1IXRC 4ZC3A 4EJUA 5KAFC 3M8EA 1VDFA 3EFFK 3ASOH 1Z09A 1K6SA 1IYPA 1HSJA 2XASA 4HDUA 4JGPA 4CPGA 4RX3A 2QSFX 3GHGC 5BU8B 3JRDA 4MTDA 4RX2A 2VQHA 3SHFA 1LE8A 2R5ZA 4XMYA 1VQOP 4AM3A 2P5VA 1X2NA 3IWQA 1JTHA 3AL0C 1M1KQ 1XSVA 5FROA 3SH8A 3L73D 3HYIA 1PPJD 3JRCA 1BE3G 2K7LA 2RN7A 3D9YA 5CCGD 4X55A 3HG9A 2C6YA 5L10A 1R8EA 4FCYA 1XS9A 4KT0J 3A5TA 1ETVA 1XXMA 4G3VA 1VEUA 3FHNA 4L5IA 3DXJF 4WZ5C 2X6OA 4ZH4F 3B8EB 2M2EA 2XPVA 3P32A 1SQVE 1TS6A 1XB4A 1VQPP 3MZEA 2XGEA 3WS4A 1BLPA 4X25A 4OAYA 4L0LA 1XCVA 1MGTA 1BDCA 3ULFA 4XM3A 1L4AA 3LIAA 1P84E 4Q47A 4BNCA 1PWGA 1TTYA 3S7NA 3OOPA 2W48A 1JGGA 2JVGA 3D72A 1PV3A 1JB0J 4WXCA 1EH8A 3CD6P 2B0LA 2LTPA 5CJ9A 1WFXA 4F94A 1ZELA 5GADJ 2NPSC 2F2EA 2E34A 1KFNA 1QLED 1SVFA 2IBZI 3A03A 1S0WA 3CZDA 2XLNA 3A1YA 1S4RA 3HTSB 3AFHA 1WZ2A 2WB1A 2OZ6A 4PPRA 2I1KA 1H9GA 4A3EJ 2FOKA 4EESA 1TEMA 4KQRA 2VJJA 2W0NA 1I1GA 3FX0A 4R3AA 1EC5A 4IOAF 3LWFA 3S2WA 1P7JA 2R93J 4HNVA 3CJQB 5KVRA 3OYNA 1P97A 2QSHX 3GZ5A 4M4XA 5HW3A 3PBSA 1HSTA 2NS7A 3BDDA 1VQNI 4IFDK 5ED4A 2Q7CA 1QHHD 1KU3A 1U9NA 4GHIB 1O57A 5EVIB 1SD6A 3R6SA 2V6EA 1PP8F 3AECC 2A6HF 2BW3B 2P7VB 4QMAA 4KZ9A 4M3GA 3W4PA 5KIZA 2MJ6A 4P9FA 1ACIA 4MBKA 2JMWA 3OY9A 2M3AA 2A61A 1QMFA 1BI2A 4B44A 4ESJA 3MBZA 2E5ZA 4ZYHA 2OUMA 4AUXA 2GZWA 4E4HA 3ABKH 2ID6A 2IBDA 2OTLI 1R5ID 1SQXE 4HYTB 1SDEA 4ETXA 3C2HA 4KIGA 1Y47A 5LHIA 2JKFA 1U9OA 4IUKA 2DFHA 1S1ZA 4CUGA 3WMM0 1RQUA 2Z99A 2UV0E 2VBXA 1X58A 3I5CA 4PGGA 3PR6A 4LGDE 1DD4A 4BD1A 2QKLB 2QZ8A 1VQ8I 5M19A 1SVLA 3U1DA 2W57A 2PR5A 2O8XA 2FXOA 1NYHA 3EYIA 5LBRA 2PMHA 2FFYA 5F27A 2EQRA 2NXNB 3O87A 4GHIA 5EVIA 5F69A 4RA2A 2BW3A 5HLTA 3H1IG 1N73C 4LK0F 4EWFA 2R4GA 3HIFA 1W79A 1FWZA 2W1TB 4GS9A 5AQBA 1D1JA 2IGOA 3JVVA 4JX4A 2BZTA 2X6WA 1PP9E 3MFDA 1FOFA 1EROA 3LSGA 2E8IA 1P84H 3N4XA 3E1RA 3I9V2 1VQQA 1BOAA 1SD5A 2FQ4A 4OU0A 1F9IA 5M1BA 4GODA 1FP1D 1LDDA 4QTRA 1U57A 3LIDA 1JUSA 3H7WB 5J47A 1SQVG 2COBA 3W6KB 5C3EJ 4AU7A 1TWCJ 3V42A 1BI0A 3BLSA 4U0YA 2N9YB 1Y28A 1FCMA 2K9MA 3EGXC 1K57C 3E1SA 2WSSH 3JRAA 2PJPA 2K85A 3CXHD 4UB8C 2PG4A 3CCSI 5TJHA 3NOTC 3RFBA 1MKIA 2KIQA 2LRDA 2ZJQF 2K3FA 5HS8A 2Q0OA 4IQ4A 2WB1N 3WODF 1P4AA 2YU9J 2L0WA 3PBQA 3C9IA 2BEZF 2W1TA 5IOYA 4BDZA 1SQXJ 4XKVA 3BPXA 2DMPA 3C1LA 2CG4A 1FTZA 4S2KA 1Y6IA 1XGJA 1WWXA 3O8GA 3HE5B 1O3TA 4HRIA 5TBMB 3ZN1A 1ES3A 2NS8A 3UPOA 2RCXA 4IF4A 1A02J 1XD7A 4KZAA 1LVAA 1PJRA 1WJCA 2R7DA 2YPRA 2W6BA 2WWWA 4O8GA 4EI2A 3LIFA 4RM2A 3H7WA 3ZMVA 5D5XB 1CJFA 2M4GA 3F5HA 4CQHA 4DDSA 2IFMA 3WGHA 2IP2A 1GVJA 3LSJA 2QGUA 3CJRB 4Q0JA 3TJZC 2R3CA 2WUQA 3F3XA 3G2ZA 2DMQA 4HEA2 1KILD 3V39A 1P2FA 4XLHA 2HPMA 4U3FD 3RK3E 4KQOA 1OKRA 4EV0A 3QRFF 4WZ5A 1A04A 1HLVA 4YOFA 1CEFA 1PP9J 4LV0A 1L0NE 5EE8A 5GTIE 1V5EA 3S3NA 2VIXA 5KAIC 4UAAA 1XSXA 3WHBA 1DJCA 1BR2A 3S4XA 4WVZA 2DT5A 2KI7B 2HXOA 2JA8J 2DW4A 1YM1A 3V7SA 2K1AA 2ZFUA 2ZKZA 2XZRA 4MEYF 4OLDA 5EEGA 3BY8A 4CYCB 4UUVA 3K4JA 3QH9A 3HE5A 3GV9A 2MABA 2QQBA 2KJCA 2ZVOB 1JKRC 5TBMA 3KYDB 1N7LA 2W3GA 2QSIA 2XU6A 4LV3A 3W6VA 3FKIJ 2N1TD 4R0QA 2IS2A 2DMWA 3SS5A 3H1JD 5GLCA 2XNDH 1WSUA 2K3PA 3FMRA 3M91A 3MKLA 1EZVD 1FMWA 2K27A 4JKTA 4XXRA 2ZM0A 3M6HA 4S04A 5IY5H 3IF6C 5FKNA 1RF0A 1LB2A 3TGUE 1J59A 1ZG3A 5B66E 1MWUA 3QP8A 4KYWA 2PMUA 5A2QK 3ZG7B 3P8CE 3BP8A 3I4NJ 1I3AA 5DV5A 2CW0F 5APWA 1U8RA 1FBUA 5HDDA 1HW5A 4ZKUA 2ACGA 3HDDA 3CDLA 4HBUA 1GZLA 2XGDA 1W7PB 3C8CA 3B73A 2OCEA 3SW1A 2ZC6B 1PIXA 2POHA 5FQMA 4CYCA 3BJOA 4QWQA 4GLQA 1KGSA 2IA1A 2ZB9A 1IYSA 2FZ0A 4DQ2A 1RR8C 1K78B 2XAUA 1F43A 1JY3P 1VQ7I 3V4GA 2K9YA 2ZMEC 2M5WA 1S9KE 1Z3XA 2BE5F 2GBYA 5GHZA 4BY7J 4I6MC 2WGIA 1WJDA 1U8BA 4IFFA 2E2JJ 1OTAA 2W24A 1KQGB 1OMEA 5IU1A 2DT7B 5E17F 2DFFA 5KLIB 4BHBA 4N6JA 3PQKA 3CC7P 3WGGA 4UVCA 1WYCA 4Q8IA 3PXPA 2D2CB 5AVWB 4PV1C 1BJAA 1JHFA 3CZ6A 2XV4S 1NY0A 1ZR4A 2MC3A 2V1XA 4ENNA 1L0NJ 2LYCA 1EW0A 3CP2A 2DYSH 3O6QB 3IHBA 2CUFA 2HNHA 1FJKA 4FCFA 2PFXA 3G35A 2MFZA 1Q86Q 3SS3A 5LGUA 1SFEA 1BW5A 1SS1A 2MBFA 2MA3A 4AQRD 3A0RA 1SMYF 4E7LA 1ZG5A 3F8NA 3FXJA 4UB6C 1QPMA 1ZGWA 3VYRB 3P7NA 1W7PA 3I4MJ 4BU2A 4BE0A 2IT0A 3ZQGA 3ZNYA 4EOTA 1YI2I 2I8DA 3UNWA 5DEQA 2L4RA 2Y2QA 5GTIH 1WCMJ 3Q9SA 1OLTA 3CC4P 5U47A 4RJTA 1K78A 2YXQB 5CRFA 1BR1A 3WTXC 2XDJA 1Z9CA 1YOVB 4I38A 4NXFA 2HP6A 4DYCA 3B3XA 3GTPJ 3VEPA 4XN0A 3TGUJ 2KLUA 1G6AA 4BYYA 1S5LH 4WY4C 2PEXA 1OMIA 3O8HA 4XLNF 2TRTA 5BS6A 3CESA 1LTIC 3GUDA 2RNGA 4DMZA 3ZGAB 3K5BA 1OZHA 2OCCH 1GXPA 3O6QA 2V7QH 4IL6X 4DDYA 4JXSA 3IRRA 4WK8F 2KDKA 5CGXA 3HPHA 2JJ7A 3VFZA 4LRXC 3ZQLA 1NKZB 1XX5A 2B95A 1L3LA 2WK0A 1S66L 2EX8A 2WKEA 1KYZA 4EEPA 2DYRH 4PD4H 4LLLA 2ZMAA 3E5UA 2HDDA 5FL3A 3KDPB 3ZMUA 2JJLA 2FXPA 2IZ1A 4MGRA 2Z4EA 3DAVA 3ZG5A 2O01N 1PPJE 2HF6A 4D1QA 2WSCJ 3GTMJ 4NXGA 3PTZA 3HJKA 2Q3EA 5C44J 3MFXA 1W1WE 3TO6A 1H3QA 2M0BA 3KEQA 1QL2A 2FXAA 3E98A 3G31A 3TGUG 1BDDA 2VJ5A 1KYOI 1S2EA 2XFSA 2D5VA 5I94A 1BT5A 1SFCD 5AW8B 2FE3A 1LUJB 3M07A 2R32A 2BY0A 3P5JA 1K05A 3FXKA 1FDMA 4ZTKA 3JCUH 3UB6A 1IJWC 2LC2A 2XGXA 2HI3A 1LTJB 3LI8A 2VKEA 2MKVA 1RE4C 5BOHA 1O3RA 3R0AA 2J59M 3Q5SA 2HEOA 4AYCA 1MSFC 1MFTA 5J4VA 3IV5A 1TW3A 2Q9IA 2CQ7A 1J5YA 4D6TJ 4HNBA 1NH3A 5FKLA 2VRSA 1Y9BA 5DCFA 1BA5A 2X1EA 1SVMA 2LKSA 1GW4A 3MZFA 3CCJI 3CCEI 1R1VA 2B89A 1JXSA 4RA7A 1KDSA 5FKMA 1FDOA 1Y39A 4M6VA 1T2KC 3TRCA 3OYGA 3A0BC 1G4DA 1YITI 3LSHA 4XR6A 4R4RA 1VF5D 4IHVA 3E6DA 2GA1A 2KL4A 2F6CA 2JSPA 3M9BA 3EGDC 3L7HA 1D5VA 1NG7A 3GZNB 2NVXJ 5DKKA 3MZWB 1MPLA 3P98A 2V1DA 1SCWA 4IHSA 1SKOB 2ZXEB 3TKYA 3FHZA 3MKEA 2PD7A 3DFGA 1LTJA 1JUMA 2O0YA 4PV1B 3WUTA 1JEKA 5FEFA 1Q1VA 2R7TA 1SQQD 3VP2A 1RZ4A 2ZLYA 5AVEA 4U7DA 2QJYC 3E2KA 5GAGJ 3VYIA 3LAJA 1WE4A 2EB7A 3PBNA 5DJUB 1OCTC 5EFWB 1T1BA 1XSDA 4Z9QA 5AQ9A 2FX0A 3GF3A 2HJ9C 1UHWA 1MD0A 3U1AA 1DH3A 4DZPA 5JLXA 2VKVA 3N7NA 1P92A 2WT7B 2OYHC 3H1HG 1VI0A 1ZOYC 1FLIA 1IDZA 5ICEA 1XGSA 2KZVA 2AQEA 2P67A 4KG5A 5BQTA 4HBLA 1V5GA 2YS9A 2HZTA 1YJ9I 2HTSA 4XN3A 2VPLA 2MLKA 2MG4A 1EH7A 2XF3A 4OIQF 3CUOA 3GFIA 4BWIA 3B33A 2MYSA 1QVUA 3BR0A 3IH8A 3IX4A 2WKPA 1KQ9A 1FZGA 2XSJC 1JI8A 4IHWA 3H1KD 1ZHFA 3V67A 1HW1A 1G6NA 2WAFA 2NVQJ 1D5YA 3AGEA 2KK7A 1P0ZA 3TQNA 5A92A 2FSWA 4ZKPA 3ZCOA 4FH2A 2NNYA 3V3RA 1E17A 2IGMA 5CBNA 4WY4B 1SKOA 5GPCA 5CLSA 3BG6A 4UHTA 2QBYB 3F8FA 2KSJA 2DXIA 3G4PA 5AW5B 2Y2LA 4A3KJ 2FMLA 1IOUA 2W00A 3FK6A 4DYQA 4QPQA 4AWXB 1K61A 2VZWA 1L0DA 1JWZA 3QNBA 5DJUA 1OW8A 3L73G 5KJ7D 5EFWA 3BATA 1PPJG 1UCRA 2AEMA 3D6ZA 4RGRA 2NVUB 1VHMA 2J7VA 2ECBA 3IH4A 2WT7A 1SFXA 4IPAA 2Y4AA 1OYYA 4M71A 4WX9A 4X56A 5C39A 2WTEA 1FY7A 1K9MQ 2WA0A 3V6IA 3VP8A 1X79B 5E79E 1E25A 3FPWA 1T98A 5EYRA 2Z6DA 4KISA 1CW5A 2E1MC 1JCCA 2EFNA 4GDBA 1IXCA 3UY6A 4HF1A 5L3CA 4RM3A 3NMDA 4UV8A 3S17J 3I71A 1HDPA 2HDUA 1XPBA 2QKPA 3NXSA 1URQC 3KP5A 4WXHA 5FLMJ 4RB1A 4G9YA 1N8RQ 3EEAA 5APVA 4GDNA 1QZYA 4M3KA 2K9JB 1JNMA 3CXHE 1NYMA 1HGVA 4A2UA 4OMZA 2WWYA 4AYBA 1MZUA 1J1EB 4WY4A 5J3WA 1JHHA 4JQFA 2QBYA 2ZQDA 4BBUA 1YQ4C 2A6EF 4PM9A 5E8GA 3RBZA 2K40A 2DLLA 1MWRA 1VQLP 2AHQA 1T1CA 4P6ZM 1L4AD 3G71I 1A31A 3UPNA 1HXDA 2HP9A 5J1YA 3HLWA 1PWDA 1HQCA 1LT9B 2OYIC 4HP4A 2ZQ9A 2PAVP 1FYKA 4IHQA 2C9NY 3FMSA 2P9VB 3TDZC 1WHUA 3TOAA 1UG2A 5EUAA 3ZMZA 3ITKA 4EQQA 3K4CA 5D3OA 4K91A 5CCHC 2IGNA 3L2WA 4NDLA 2OWHA 3IAOA 3GECA 3SH7A 1UMQA 5HNFA 4R70A 2KUBA 2E7XA 3T4KA 4KMUX 3ASNH 1KILE 5AW7B 4II7A 3H9JA 4TLFA 4U3FE 2K9JA 3N05A 3HUSC 3Q1MA 4XRSG 2J80A 3CMEI 1SMTA 4ZYEA 1A5JA 3BYDA 2YO2A 1I3QJ 3UE0A 2EXBA 2QM8A 1NTZE 4ABZA 1L2PA 2ZC2A 1TBXA 4KZ6A 4MN5A 2JCHA 1TWHJ 1AV1A 1U3EM 5CVJA 1UB9A 4E7HA 2P5KA 1M57D 1Q2NA 2WZ7A 1V9ZA 3EEHA 3BFDA 4XNFA 2P58A 2V2FF 2FA5A 2QRXA 2O5RA 3OOUA 4EERA 2QJYB 1KGFA 3T1SA 1LT9A 3VP9A 3FXUA 2H6BA 1D0ZA 3CAXA 4FD8A 3W4OA 3M9HA 5BOXA 2G0EA 1JT6A 1FOKA 3G6EP 4XORA 3SEZA 2M0MA 3OPHA 3MEXA 3H1JE 2NUTC 2P9VA 4B93A 4XE5B 2EWNA 3PAGA 4DE1A 3A2KA 4P6ZS 1IGNA 5CTMA 2LG4A 3CJTB 1L0NK 1UWPX 1RIOH 2Z16A 4LLOB 4LK1F 4GYGA 2FNAA 4IVNA 3BG5A 3EOIA 2PLYA 1HJBA 3DV8A 4YPCA 1FOYA 1D1AA 2P08A 4CCMA 3F23A 3NECA 5M5WJ 4JGRA 1GVDA 3J80K 1BZAA 1MZBA 3S4RA 2KLIA 2GA2A 4MBHA 4L5JA 1CZQA 5F6AA 4S2JA 4LJZF 2K9SA 5EZGA 1DEBA 3HOSA 3HLFA 5A91A 2K02A 4BJPA 2K9QA 5DYMA 1LEAA 4RGSA 5K5QA 3CCUP 3TDKA 3WS2A 3FXEA 3CXHH 1NVOA 2M30A 1FMVA 2PYPA 4HJ4A 2DK5A 3IH3A 4DOZA 3GZ6A 4HLYA 2K86A 1CK3A 4RMNA 5H20A 3F0CA 1LJ9A 3CDIA 3I3LA 5IT9K 2HYGD 2X0LA 2W3EA 1QBJA 1QVTA 3CC2P 4EGYA 2UWJE 4AYBN 2ADUA 3IR9A 1ZC2A 5B1BH 2RDPA 3A2AA 1J1DC 2WY8Q 2VASA 3RGUA 2HOAA 3OV8A 3G32A 2HYJA 1I5ZA 4ZYGA 4IL6E 4A5MA 4H44B 1W36D 1Z0XA 4UV9A 4YFXF 1XKZA 1Y8RB 1DY6A 3LIEA 1TW2A 4HJ6A 3O88A 3C38A 1NTZJ 2W3HA 4EW7A 3BCCD 5L09A 2V1ZA 3WTSC 2JUCA 1FBMA 1N7SC 1PZPA 1OTBA 1E2XA 2PI0A 2XSDC 3ZQIA 5L8RJ 1GCEA 4RYEA 2DQLA 1E79H 1FCNA 1BULA 3RKQA 3J81K 1W2EA 3UMEA 4KN4X 1QQIA 2C9LY 4D5CA 4HW0A 3H1JJ 1IRZA 3V7CA 4KNYA 1QZEA 1ZKGA 2LDUA 3CX5I 3TF5A 4IOCF 3GVBA 5IHVA 1I1SA 3L9FA 4JF7A 3QHYA 2B9SA 3IN6A 2I10A 1CI6B 3HOWJ 1JCDA 3AEDC 1DPUA 4KIBA 2EILH 4ZTJA 5K1YA 4OP8A 3T5XA 4U3FG 1KMIZ 5GTHE 3H92A 2KB7P 2Y2GA 2L7ZA 3NIAA 3LY3A 3WU2E 2EV6A 4H0LC 1FOSE 3BG7A 3DBLB 5IOZA 2ME0A 4L9JA 4M3BA 2ZT9C 5G4ZA 1XN7A 2CQNA 4Y17A 2KLOA 1OT6A 2ELKA 1CI9A 1KC8Q 1A6QA 3K1PA 5I5LA 4UVAA 3G1OA 4LLNA 3D5RC 1KQLA 3BWLA 4QY5A 3FISA 4ZDLA 4OQ0A 4Y2FA 2FYNC 3IFMA 2Y69H 3H1JG 3L70E 3RTYA 2WAEA 2VE9A 2XDMA 1Q82Q 4OLGA 2HS5A 1XGMA 2RV8A 1EZVG 4PUSA 3GCMA 4EIJA 4MBFA 5FASA 4CSWA 4X6AJ 4II3A 2LSOA 2ZL1B 5A90A 4HV6A 1CI6A 3E2LA 5B1AH 2FJ1A 5AW3B 3V2QA 2NPSD 4PKYG 3B47A 2F5DA 2IDBA 2PHYA 5FATA 2ZAEB 4Y28J 1S29A 2V4JC 3HHHA 2OSUA 2XR0A 3FXOA 1MNMC 2XK1A 1EH6A 5F04A 3G30A 5LD2C 4L9EA 3IAM2 2FUG2 2HQ5A 3L74D 3RJUA 2KLVA 2HPBA 4IL6H 1VQ9P 4R79A 5M5YJ 5FKOA 4GJ4A 2CFOA 4O3MA 3Q3DA 3AE3C 2WITA 1YJWP 2R0QC 5IPAA 3A02A 3GTQJ 3CCRP 4I7ZB 1FR1A 4A3DJ 4Q0HA 1HBXG 3F89A 4R23A 4CA0A 2FYUD 3L72E 5LRSA 1TWAJ 1Z91A 3QNCA 5HD3A 5CCGA 5BPDA 4WL9A 4WBAA 4I98B 4MFEA 5FSRA 3G1MA 2JC7A 4ZJ1A 2VGKA 5HOOA 1GA9A 3M6BA 2DOFA 4E6XA 4JX6A 2QJPC 2F5EA 2KYVA 4B88A 2ZL1A 2V0WA 3LR5A 3PYPA 2WVRA 5CJ4A 2Y59A 1KVLA 3SEQA 1TDGA 3UE3A 4IXAA 2PFBA 2KZGA 1N9NA 2K9NA 3FV7A 1OIPA 1BBYA 2JO1A 2K2NA 1TL8A 1SQQE 2LKXA 1DJAA 2WPRA 5GTHH 3KIOA 1K79A 3CMAP 1LI0A 1FT9A 3IX8A 1H5XA 4UEYA 4E3LA 2LNBA 3HLDA 3FXRA 2GLOA 4WWIA 1IN5A 3SH9A 1IO2A 3L70J 3VYSB 2XV5A 2LY2A 1WPKA 3VN0A 1N7SB 3NY4A 2UUZA 3ABTA 2VOPA 4D9JA 2WC2A 2R7RA 2DMTA 3QP6A 4E7ZA 1M1JC 4U0VA 2OARA 3E0YA 1W7PD 1QRYA 2W90A 2IS6A 4XLCA 4W97A 1FZPB 2P2UA 1AFOA 1FIKA 2LD5A 2VQGA 1NXYA 1JNUA 1QGKB 4GKGA 5GAHJ 3WTUC 5LRRA 3Q1FA 1GUUA 2JE5A 5F68A 5HZHA 5D6FA 3LEQA 1W0UA 2EFOA 1LSXA 4OPZA 3SS4A 1QU3A 3E0JB 3ZQCA 1SQPJ 2G2UA 2QQAA 4N9HA 2IAIA 2HVRA 1WRJA 1N25A 3MUDC 4BBSJ 1AQ5A 3L75E 2DA5A 3O3KA 3QPSA 1XC5A 4C3HJ 1CQTA 5F83A 4OMYA 3UN7A 2X71A 4I6ZA 3RPQA 3GLLA 3TK1A 4K0WA 1JKOC 4NC7A 5APQA 2QG4A 5CEBA 3NFQA 1QEXA 3IH2A 3L72J 2LY9A 3S1MJ 4XLFA 3DEUA 5FAOA 1OCCH 5CERA 4CZZA 2GUSA 2E74C 1N7SA 1X22A 3ROUA 3S32A 2R5YB 1LI9A 2RQQA 4YFKF 1S1YA 1ZKJA 2QVOA 3FG8A 4Y5FA 4BBVA 3A01B 4X1LA 4EETB 2HVQA 4TV7A 4RAZA 4Y7NJ 3IQAA 5KLVJ 1OTEA 2XVCA 2OZUA 1QVFO 4HEFA 3HLEA 4DKIA 1BW6A 3OAKA 1ZN2A 4A12A 4WEKA 5DVAA 3C18A 2EINH 3RDIA 3BR1A 4KT6A 1WYBA 1JY3N 1MMDA 3RZOJ 1SQQJ 2ISZA 2PAJA 3AEBC 3OPRA 1FAVA 4WMCA 3C5AA 5L8MA 3T4OA 1ULYA 1DP7P 1HWTC 3HSRA 4NXBA 1LVKA 4OAZA 5F64A 1CI8A 4KQDA 2HOTA 4IJGA 1K4SA 3M4OJ 4ZMDA 3NDGA 2BCCD 2Y2MA 5EGOB 1J3WA 1BOBA 1BGYE 3S2HJ 4O7DA 3KZIE 3V4QA 1ES4A 3S7QA 1L0LD 2R5YA 2DOAA 3GMWA 3H1ID 2KP6A 2K9LA 3LR3A 3PBTA 1XJ3A 5KTBA 5AQ7A 3A01A 3MMYB 2E60A 5HDCA 1ON1A 3CP8A 1VQMP 2YR2A 2XB5A 4JXWA 1SFUA 4BXLA 4ZJ2A 1IZ1A 1P9RA 3BFFA 2QJKB 2L54A 3PO3J 3LSPA 2K3RA 2Z5HA 3QPHA 2AVXA 3L75J 4RGXA 4GDOA 3RK3C 1TD5A 1GSXA 5KK1A 1QMEA 3JW4A 3VODA 2EIMH 5HSQA 3WTTC 3ZOBA 2FU4A 1SQQG 5FI2A 2BY1A 1NTKD 2F48A 4QLCU 4RB3C 2E5NA 1USSA 2Z5UA 4LG0B 2M8RA 3LNQA 4OKPA 3HBRA 4D5FA 4EJWA 1U5TB 4S2NA 2FH5A 3FWEA 1XGOA 3EQLF 1QA6A 4BAYA 2Z6CA 4K35A 3T8TA 4GGGA 5EGOA 5K5GB 5F1JA 2A45I 3JYIA 4MN7A 1KGEA 3CMMA 1X1BA 3T1XA 4F92B 1HH0A 2NUPC 3OYKA 2N1TB 1S4SA 2WGWB 2NNNA 3E5QA 4M6XA 2FFDC 3O3VA 4I99C 4IRGA 1MJ9A 4O0PA 3CWBD 3RQIA 2PJRB 1BIBA 3H1KG 1IRXA 2XF7A 3R4YA 2Y2PA 3H1LD 2CMNA 5HLIA 2PT7A 2QQ8A 1NTZK 5B66C 3ESWB 3LY4A 3A0SA 2A06D 3BRMA 4M3DA 1ETKA 2WKHA 3AEFC 2WMMA 3CCQI 3C7VA 1FPQA 1SC7A 1LTSC 2L7MP 2IFNA 2QM7A 4G7HF 1HOMA 4N9LA 5HD5A 4KENB 3I64A 4LG0A 2B87B 3EPZA 1B9MA 1RC9A 1NTMD 1BGYJ 1E3UA 1M7LA 1ZREA 2HYFA 1U5TA 1AKHB 3VV4A 3HKZN 1WH5A 4F91B 3BR3A 4DJGA 2JKVA 1S7EA 2JKGA 4AUWA 5ILUA 4QD4A 3VMZA 4PV1D 1U7MA 2ZYDA 1JKPC 3E1IA 2INWA 1JGSA 4HKZH 3DU6A 3PQJA 1S1CX 1PL5A 3IWOA 1U7JA 2GXBA 2NS0A 2CGPA 1UELB 2WGWA 1JUNA 3JRGA 1T19A 1OPXA 1K6RA 5M3MJ 1JY2O 2ZJ9A 2EFQA 2PJRA 3K70D 2ZYGA 4L9TA 2R7ZJ 1LTAC 2E2IJ 1OJGA 2G9WA 2E75B 5M3FJ 4EJOA 4HIAA 4M9XA 3ML6A 2WSEH 2OC6A 1T38A 3B5NB 4WYYA 4ASWA 5FB2A 5J1RA 3E97A 1VQNP 1WH7A 3FC7A 2IYPA 1YQSA 3S7OA 1BCCE 1YQ3C 2ETHA 3MKFA 4JYKA 1H0TB 4GD8A 3BVHA 5K5RA 3K4BA 5GLAA 3OYBA 1Z05A 1G28A 3WE2A 5FKKA 4PKYA 1Z1DA 2NVYJ 4MFDA 4DW6A 2NOJB 4IO9F 2B87A 4G7OF 3MF0A 4KFCA 4B1RA 3I5UA 1AKHA 3HZJA 5DF9A 5JR3A 3ZNTA 3PM1A 4WY4D 2OTLP 1ESIA 3P7KA 1SHVA 5CKTA 4NG2A 4HSRA 3OL3A 1FQGA 1S6RA 3H32B 3GG2A 5AIQA 5AW1B 1TVFA 3E4PA 5CHXA 1EDLA 1KYOD 1G5UA 2WADA 1MFZA 3MKWB 1WT6A 3BEBA 2E42A 5E2HA 1AWCA 3L71D 3AE1C 1R5HA 1R7JA 5KHDA 2V1AA 4EDFA 3FYZA 1OW7A 1VQ8P 3UDXA 2F4MB 3GLXA 5A2QZ 1IN7A 4ZJ3A 5AVVB 2CMPA 4N78D 3DLLF 3ERMA 1JY2N 1H89C 3PHYA 2E35A 1DGWY 1R22A 2DDAA 3B5NA 1KU7A 1IXSB 5CPRB 4YFNF 1YS7A 3UO9A 2XB0X 1IEMA 4HP9A 2CH0A 3CHWP 1W7FA 3KETA 3T4JA 1O7FA 5AVRB 3E7LA 1H0TA 1KZHA 4YIFA 4QPOA 4GB7A 4LV1A 3NEUA 3CCLI 2IBZE 2L5QA 3FMQA 4XLAA 2M8GX 4B47A 1IN4A 1AWIA 4S2LA 3T4SA 2ZOHA 2E43A 1ZTUA 2QJ7A 3J7AO 3IL2A 4GCZA 3HLCA 1VQKI 5GHXA 1B72B 1ES5A 4RVAA 3F72A 2BOLA 1LTBC 2Y2KA 3H25A 2R7SA 3F6OA 2BHZA 3H32A 3TMOA 2F5FA 3ZR8X 1KYWA 1NLZA 3SWKA 3L1PA 1RCJA 2NVTJ 3F1PB 2BV6A 4M3EA 4BACA 2V8CA 2CW8A 1BCCJ 4Y0TA 4RGUA 1FS0E 2HFED 4I1LA 1XPXA 2FEZA 3JTHA 3V7RA 1SFCB 1H88C 4N1XA 2BTFP 2ISYA 2QHKA 4GZBA 3RK2B 1ACFA 1F1ZA 4BENA 4U88A 5DTTA 1XG1A 2OLUA 1GXQA 2RL3A 3CCSP 2HJEA 3L74E 3HRMA 4RS8A 1PZOA 4DBQA 1PDNC 4L74A 2VODA 2O9AA 2B63J 4DCKA 2KFDA 5CQGA 1NU1E 3QODA 2BVLA 2V8FA 4XFJA 4QWOA 1FZCB 3RL0g 2C6WB 4G8XA 3VPRA 2BY3A 5CX7A 1H8AA 3TSGA 4LFUA 3A3EA 3AE9C 2E19A 1W5CE 3NARA 2ZBBA 4UA9A 1B72A 2XF6A 3FKJA 1J7KA 1IV6A 4Y33A 2FYUE 2PU4A 3K1MA 1KFMA 4FISA 2QYOA 3I53A 2H8RA 1PW8A 5J6XA 1PUEE 2EIKH 4OGQC 4IRIA 4H8RA 2L1MA 2XAJA 3KP4A 5HLGA 3F8CA 3WTZA 1NKNA 1VF5B 1SQPK 3F1PA 4WWCA 3DKWA 1FOWA 4DE0A 3LGOA 1HKTA 1Q2QA 1SFCA 1Z56A 3BCCG 2Q2EB 4JGQA 5F0CA 5KAFH 3WG7H 3H36A 5KCMA 1XMKA 3EETA 3CCMI 3BWGA 2EJRA 5FEGA 3QQAA 4AIKA 4L9NA 4LGWA 4BJTA 2GXGA 1R5SA 3BR2A 3M9AA 3FK7A 3S1RJ 4KMFA 1FZCA 1LWUC 1H8YA 5C4JJ 4DE2A 5BMZA 4IHXA 1EWZA 4BE1A 4P9UA 4MEZA 3WU1B 2X1CA 1IG7A 1E3PA 2HGCA 1JMBA 5KLVK 5CEDA 3M1CA 2VA0A 2EK5A 3SFZA 1G6OA 1O7LA 4WEJA 2W1OA 1RE3C 1VF9A 2ZSIB 3GSGA 3SSUA 1V5FA 3NJAA 2H0TA 2VPRA 2ZXJA 1B4AA 4Q4ZF 3VMYA 1LHYA 4FE7A 2W83C 4D60A 1VQ5I 1FSHA 5LHHA 2KNCB 1MBFA 3K3DA 3KYZA 3IWZA 1G3SA 2Q2EA 2CU7A 1VB6A 2Q9MA 1S5LX 4Z2YA 4L18B 2O01J 3IS2A 1NU1J 2DJIA 2Y9YA 1VETB 3D70A 1N78A 4IVIA 5FFXA 1YTZI 2Q8KA 3QP4A 1HTLC 2CQKA 2RAEA 1IW7F 4R8HA 3W3CA 1KZUB 1BSNA 5J7EA 4JPMA 2ZQ8A 4AVZA 5IT5A 5EDNA 1L0GA 2VE8A 4HI4A 3TE8A 4S0HB 1URQD 2MLGA 2V6CA 3IX3A 2L7KA 4GYIA 5E79C 3U2AA 2O6GE 2VC1A 4KZ3A 3AE8C 5LBQA 3B6CA 3M0DC 3CITA 4RB0A 1NLYA 4UB8E 1VQ7P 4I3JA 1RHZB 1NO4A 3GMEA 4ENJA 5F82A 4Y52J 4ZJZA 3KFWX 1WGXA 3Q0WA 1EDJA 4XOPA 1E3HA 3VOPA 4JYBA 1X0TA 1BI3A 4EGZA 1HF9A 5IT3A 3OOVA 1NWQA 2FFFB 2KNCA 1KONA 2C5WB 5DTSA 3JSPA 3TW6A 1T3JA 2V7FA 3L74G 2J58A 3H6PA 3GTGJ 1F5MA 3L2RA 5F5YA 1BC8C 4JYCA 1VETA 2O61A 1M8OB 5ILVA 5AW0B 4JF4A 4NPEA 1BTLA 5KKZC 4HESA 2VBYA 2QENA 2E1CA 1SEUA 2QA4I 4R4MA 3Q3SA 1BIAA 1M6KA 3MXRA 3K4LA 4HZFA 3LSRA 4C30A 1JMMA 2JA5J 2FYUG 2R9WA 3CPTB 5HS9A 3FWLA 1ETXA 1YI2P 2HVSA 2XRNA 1J2JB 2HP5A 3O2PE 2VJIA 3WGIA 3H1IE 1GV2A 4C3JJ 2A2LA 1HDDC 4DZOA 4E04A 3D1NI 3KPHA 1JUPA 4LCMA 3SDBA 4FUWA 2CUZA 3HC7A 4OPRA 2A05A 3AGDA 3GTOJ 3F1NB 1KILC 3Q0VA 1AHDP 3VFHA 4F52A 5DDGA 4OGQB 5DJTB 1P9QC 2QEXI 5CVUA 5TGTA 3OYDA 2ITAA 1MBGA 1VNDA 3TSIA 3BECA 3SZGA 2W3FA 4FH4A 1SVOA 5L3FA 2K31A 1H88A 3MKZA 2G3AA 3P09A 3ISGA 2L4MA 2LR8A 2EFXA 1XDSA 3LQQA 1YLZA 4GKUA 1YE9A 1D0XA 3HD7C 1ZG4A 3FWNA 3CPTA 3HOTA 5E1WA 4OIRF 5EM0A 4JPZB 3S1QJ 1BSGA 1TS8A 3JAMK 5FI6A 1LDKB 4FHTA 3U21A 2KQRA 3BROA 3S93A 2PYRA 3OYFA 2YO3A 2KP8A 1ZTRA 1DGRM 5JYOA 3ZYTA 1O3SA 2EV5A 2DPDA 5TISC 3CWBE 1N9OA 5APYA 2HWVA 2JWAA 3K2ZA 3H1LE 2Y0EA 5AVQB 2KRHA 4BHCA 5CHUA 4N92A 1NAFA 4OVNF 3BW6A 4FX0A 2FQ3A 1PI4A 3F1NA 1FR6A 3C4OA 2M3EA 5DJTA 4ON0A 1S3JA 1RH5B 3OCNA 1X19A 4UB8H 2A06E 2ELHA 5F1FA 4DXBA 5HDKA 2IPPA 1KOUA 1OR7C 3DU5A 4CCJA 2Y2NA 3AEGC 2O3FA 3WE3A 4ESPA 2KKOA 3LR0A 3PTEA 1YYCA 3LCEA 3K10A 1SQBK 3LSIA 3KEOA 2GM4A 4QIWN 4CGZA 4LRZE 3H1IJ 3KLOA 3CX5D 1H8ZA 3OYMA 4A6DA 4A3LJ 4M9SA 4CH7A 3CCJP 3CCEP 4M73A 4GS9B 1YJNI 2VK3A 4P0MA 1H9TA 2XGNA 1I6XA 1PFIA 1YLJA 1IK9A 1GK6A 4NNJA 3RL0C 1YITP 3VOLA 3HCYA 2CO5A 3QAHA 3KO6A 4XSXF 1N7SD 4IL6C 2A3UA 5D8KB 3AE6C 5HDGA 2M5AB 3UIAA 4QU3A 1MZ9A 1JWVA 3OR2C 5GPAA 3LA2A 3L36A 3N4IA 1SQVJ 1WRGA 5CHJA 4EV4A 4H13C 5HS7A 5HARA 2O8KA 5KAIH 2JZYA 1ETWA 3ZCZA 5EV0A 4Y99C 1M90Q 1LKXA 4BDYA 2HU9A 3H1CA 2IZ0A 2BCCG 2ECCA 4LG3A 4S2MA 1HC8A 2E76C 3LA7A 3ITAA 1L0LG 3A0HE 2XROA 2ID3A 4WMCD 4OQIA 2I1JA 3UMDA 3GYHX 3VYTB 3ITBA 4NEED 3V8LA 2Y2OA 5KKZB 3BZCA 3O5YA 3A3DA 3DBHB 3IF4A 1K38A 3HJIA 3L37A 4OWRB 3CCVI 2O1KA 2YU3A 5CYVA 5AVYB 1ZQ3P 2A07F 3CUEC 2LLKA 2UV1A 3NAUA 4H0LD 3L71E 5DS9A 1Y1WJ 1YJ9P 2Z9OA 2HYNA 2CRGA 2I72A 4HV5A 3ZRGA 2ZT9D 1XA7A 3OCLA 3J80Z 2L02A 1BM9A 2M7VA 5CMZA 1AXBA 1OTIA 1U0JA 4HYEA 3GW6A 3GHGB 2E7WA 2EFUA 1AOYA 3M0DA 1NTKG 2M5AA 2X51A 4PJLA 3WU2C 1GU4A 5E2EA 4LLHA 1V54H 3AL0B 3T12B 3WTYC 5EF6A 4OP5A 3JVUA 4A7PA 2L9VA 4JLFA 4B3XA 4BHPA 2AXTC 2XPUA 1EI5A 2ZNZA 1S4XA 1MC0A 3U9GA 1ZHHB 1P4WA 3UPPA 5IT9Z 2JKRM 3COAC 1R58A 3DF8A 4XRFA 2H5SA 3A7OA 4IBXA 1YPRA 3CI6A 2DA1A 4A5NA 1FEXA 2OBPA 3GF2A 4JOMA 3E7KA 1GHCA 3RCOA 3J7YJ 4HH3A 3CWBG 4B09A 3JRBA 5KSCA 3H1LG 2NYXA 4BUPA 3HD7B 1K54C 3TW7A 4YXWH 1Y54A 3ZVWA 4Q48A 1EJ9A 5HFOA 2ZJPF 3HGGA 4N1HA 1LDJA 1GW3A 2A06G 1DDNA 1XA1A 1FDIA 2OA4A 3GHGA 3BJAA 3QYEA 3M3YJ 2G7HA 1KQFB 4NQWB 2R44A 3M2JA 3UB9A 1W5DA 2Q3IA 3SXYA 4D7NA 2XHKA 2NPSB 1MWTA 1MIJA 3KSHA 3C2WA 3H0DA 2ZSHB 1GK4A 1WJEA 3J81Z 1W63Q 2DDBA 4ETSA 2ZM8A 1NTMG 5DD8A 5EVEA 2GDNA 1RQVA 3P9CA 1VQ6I 2W82A 4J00A 3V2PA 4BMWA 5A93A 3BOQA 2VC0A 3EUKL 3K4NA 2GXAA 4KG6A 1FNNA 1UIXA 4V19K 3G71P 1Y0UA 4MO7A 5LGTA 3BRTB 1BN5A 2LVSA 1IKIA 2L5GB 3TYYA 5AW2B 3AG3H 4R3JA 3B71A 3K3CA 5B5EE 3H5AA 2KS1B 4R38A 3M8FA 3PFIA 5LFAA 1E3UD 3LIBA 1U60A 3MD2A 3ZXSA 1G8XA 1GL2C 3T1QB 2PRFA 4DT0A 3PH0A 1ZXGA 3HD7A 1RETA 4OPYA 3A0HH 3HL9A 2PBYA 1Q2PA 3VOEA 1IN8A 2BVMA 2RMZA 1S5LE 3BR6A 1UHMA 4UUTA 2NOGA 3ABVC 1K4TA 5J8XA 3Q5RA 5GP9A 1KYOH 4NQWA 4PDKA 3IXBA 1SQXD 2A69F 2E36A 4RAFA 2JKTM 1LNWA 4OOLA 2NPSA 3G9RA 3AGFA 1X0OA 2Q1KA 3KYEA 4JXGA 3C2BA 2ZFCA 1YG2A 3CMEP 3ZDMA 3E6CC 1ZG6A 2UXNA 1TU3F 2OF7A 4YELA 3NWSA 3ERED 4H13B 4GD6A 5ERIA 2ESHA 4BD0A 4PD4E 1PGQA 4L0YB 3OYIA 2W8ZA 1A0KA 1OR7A 1FC3A 4YIIA 4O5VA 3TOBA 1S7OA 3KP2A 2CSOA 4PSWA 1V9YA 3L71G 2JRTA 3CDHA 3BPVA 1ZARA 1E5WA 2KS1A 2H1KA 2ME6A 1IC2A 3ABLH 2ZC5B 4PFOA 4Q5SF 2M7AA 1N73B 2J3WA 4E7JA 2UWXA 2ZC7A 2R3SA 2YMYA 4BQNA 3QWLA 4GO1A 5B3SH 4ESFA 3M2KA 3FXDA 1PP9D 4PJNA 3RXWA 2XFTA 1W5SA 3OYHA 3T1RA 2DFEA 1HBWA 3U1CA 3DLAA 4PK4A 2G8YA 2V1NA 2UXXA 5H2FE 4JXVA 4OQGA 3WHCA 1ERQA 4XKWA 2AS5F 3JCUE 1LGHB 5AIPA 3ISPA 2ACJA 5IYBJ 2E75D 4E6WA 4FQGA 4DJ3A 1O7EA 2ZMFA 3KYCB 1D8JA 3L2VA 1XTAA 3B5ND 3AG4H 3HGYA 3WG9A 1K6OA 4B48A 3L2QA 2FD5A 4JX5A 2XSSA 1M1EB 3K0LA 4DBRA 4C2UA 5L2FA 5L07A 5CGSA 3KZZA 3KCCA 4RLQA 3Q0UA 5JHFA 5FDHA 5E1XA 2M3BA 4CLCC 1SLQA 3A0BH 1ZYRF 2XKMA 4L5EA 1PW1A 1JWPA 1N73A 3EWKA 3M06A 1AVYA 1IFMA 4LENA 1POGA 2XAQA 3QU3A 3C30A 3BZ6A 5B5EH 4LC1A 2V7QJ 1WJFA 4QY6A 1PIOA 3H1HE 3LL7A 2M1BA 5IP6A 1HTZA 2YIUC 2LKMA 4C3QA 1O4XA 4OOMA 2XRLA 4BL2A 3Q7ZA 5FRMA 1YTYA 4B9OA 1HJ0A 5FLXK 4MEXF 1GHIA 5DTKA 1L4AC 4FTHA 4RAGA 3W2AA 1RESA 4GT1A 5CVIA 4IJAA 1T1AA 5C5KA 4OOIA 3Q5FA 1CGPA 1BJZA 3H9GA 2KXPB 4Y15A 3KZIC 3H0GJ 3OPPA 3PSIA 1AA0A 2DA6A 2XF5A 3GLMA 1K7AA 3I58A 1K57A 1OW6A 4CHUA 2HQRA 3FIWA 1ZRTD 1L0ND 4RO0A 2R78A 2Y0CA 4S05A 2E8JA 2VBWA 2OLVA 1YLYA 3A3JA 4IHTA 2EV0A 4ZAMA 2XA7M 3F8BA 3L73E 1DP3A 2IRFG 4UA6A 2IWDA 2STWA 2E1NA 5GAEJ 1RUOA 3SDGA 1R4MB 2D01A 1ZW0A 5EPHA 4IZZA 2OD5A 1IZNB 5HDSA 3HLGA 1HD8A 3ABMH 3OIQA 1ES2A 2ZJ2A 1ESUA 5FQJA 1SZVA 2L4AA 1NOHA 3AAFA 3N6IA 1LEBA 3NTNA 1G68A 1Z6TA 3TO7A 3G4SI 4RLFA 2K4BA 5H2FH 3DPUA 3PJSK 1MUUA 3OS0A 1VTNC 4ARZB 3RK2D 4G3KA 2V26A 3I56I 3T4QA 1TNTA 3GX4X 4XIDA 4L9GA 3MXQA 4YG2F 2ZXIA 1T6AA 5HWTA 4KZBA 2Y31A 3IF6B 2LBFB 3L2UA 2YX4A 1ITYA 1JTGA 4X53A 2RC4A 1R5GA 4ZTFA 3UDIA 2OAZA 3DTMA 3BTJA 2KX6A 4OH8B 1B9NA 3H1HJ 1LL5A 1SQVK 4I39A 2D1HA 2L3DA 2H10A 2VBZA 5L3DA 2B18A 1FJLA 3I55I 2H94A 1FOXA 4Y4RA 1HVVA 4HA8A 2WKQA 3HRSA 1IFNA 3UE6A 3HE4B 2R7WA 4M6YA 3OIPA 2DN0A 1TT5B 2W7NA 2DAOA 5EVIC 2P6TA 2ZMEB 2XA7S 2V9VA 4P87A 2QJ5A 4ARZA 4FT8A 1PYVA 4L76A 2GJ3A 1GA0A 2J3TC 5JFRA 4S2PA 5BU5A 1QL1A 4GOEA 3L4FA 1TC3C 2XC7A 1K25A 1B59A 3IF6A 2LBFA 1EV7A 3NQOA 4XSZF 3BQ8A 4G3WA 3L73J 1R71A 3FZCA 2OTJI 2H1LA 2Y9ZA 2P7CB 2VKSA 1H8MA 1WI9A 3IH9A 3DCFA 4KUMA 1XX2A 3NHQA 3Q2YA 1WVRA 3HUGA 1W36C 1JY2P 4I02A 4CLCB 4KUOA 3H35A 3MN2A 1DP8A 1SDNA 1YLWA 4D6TD 4FETA 4Y3OA 2EX2A 2Y2HA 3FM5A 4BXUA 1XCBA 3OC2A 3N7WA 2VXZA 3LA3A 2WV1A 1RKTA 3HE4A 3W8KA 2F4IA 2V9PA 3G34A 4BJ6C 1OT9A 5EVLA 3BTCA 3RXXA 1YAXA 4EVIA 2ZMEA 2HGVA 4RBOA 1PI5A 5KZHA 4G6DA 5FQIA 4DIQA 3HRUA 2KZIA 1MKMA 1Z6RA 2OWJA 4G94A 1IFPA 2ESNA 1SQXK 2RN0A 3KP6A 1O07A 3ZMSA 4AIJA 5GL9A 2OAQ1 5D4SA 3BY9A 3KQGA 2GX5A 2JPBA 1RGYA 2DA7A 2QIWA 3L7WA 3ECHA 1N86A 1XGIA 3LO7A 4HQAA 1DU6A 4PGHA 2STTA 1NH4A 1LNQA 3RYPA 3WU0A 3HEFA 4N4NB 4CLCA 1X1PA 3RPUA 1KB9I 2QLZA 3D71A 2EH3A 5J3LA 1TDLA 3GTJJ 1LQ1A 3BCBA 2IS4A 1ZP0C 2F4OB 3IWFA 1XJ4A 5APTA 2Z2LB 1MH4A 3HVFA 3MIWA 1Z7UA 3RTRA 2WPVB 4BRYB 2M7BA 1KE0A 1N9LA 2WY7Q 1D1BA 4HOBA 1P6RA 2KOGA 1OYIA 2D2WA 4I0BA 3HB9A 2KDOA 4DF6A 1K4EA 4WCGA 4MNRA 2P7JA 1PWCA 1J9MA 4ME4A 3QOEA 4WZ4A 1FSWA 1EKEA 1RNLA 1DPRA 5FI7A 1MMGA 3CTAA 1IYQA 1X4PA 4AC0A 2QYBA 2DJNA 1MH3A 1D06A 1X3UA 3F1OA 1TF1A 3ULQB 3A3FA 3HSFA 2JRMA 1XFNA 2Z5IA 4S2IA 1MJAA 2LF8A 3PBOA 4X68A 3VFFA 1XMAA 3DQVC 3CX5H 5F6FA 1T3UA 3CLQA 4V2FA 2GZAA 2MGQA 2QPNA 5J8FA 3PHLA 1Z67A 4O9BA 3TW8A 3J7ZI 3H82B 4KZ8A 3ZG9B 4L0ZB 1TWGJ 4RQ9A 4WELA 5JVGF 3TBIA 1TS0A 4UHUA 2VKDA 4LV2A 4G12A 1ERMA 3PO2J 1UIIA 4H4KC 1B8IB 1YX5A 2RVCA 3TDUC 1FZEA 4FSFA 2KSEA 1RF0C 1K73Q 2KRFA 4BRYA 3WRTA 4HSTA 4OGQD 1W2BO 2KT0A 2Y48A 2PR6A 1YHQI 2JR8A 1W5CC 4WB4A 2JQ7A 3W67A 1OCPA 2Y2ZA 3UR3C 3SFDC 1LJ2A 2UZKA 3VSLA 3PRJA 4MDZA 1T56A 5AVSB 2XKOA 3FBIB 4AVPA 1LTGC 2JP3A 1JM0A 3FZVA 5HPIA 1EF4A 3IBJA 3B4SA 2O03A 2OQGA 3G2YA 4BLMA 4E3OA 2OQQA 4I2OA 4KITB 1BSHA 1K56A 4K3AA 2N8GA 3T50A 3C3WA 1D7MA 1RE4A 3ZQFA 4MN6A 3QYFA 1YKDA 2A5YB 2P74A 4TT3H 3V5MA 1YIOA 2BBYA 2EZLA 3H82A 5JHUA 3IHUA 2XH9A 2BY2A 1MNDA 2BYVE 5HVQC 2CYYA 1DD3A 2Y2JA 3IF5A 1M56D 2VJ4A 4KHXA 1FZBA 2OYHB 2Y79A 1B8IA 4IOIH 1R00A 1EZVE 4YIRX 3H5RA 2FF4A 1ZAOA 2MSYA 1IC8A 2G7UA 4MN4C 5F1RA 1T2KA 3V3SA 2LREA 4PCQA 2L91A 1HVBA 4MHGA 2EA9A 3K6GA 1WQ2A 1S8NA 1X4OA 1T18A 3BFCA 1LSVA 3LFKA 3DBAA 1VQ4I 2QMIA 3CMYA 2X48A 1UWNX 4IRHA 1R9TJ 5M1AA 3RI4A 5H6RA 2RREA 1EXJA 3Q81A 1SD7A 3M1EA 2HDCA 1PGOA 1X3WB 2O9CA 1IF1A 1W0TA 1ODDA 2J5OA 2NAZA 2Z3YA 4F3LB 2AEFA 2PQ8A 3T0YA 3E5XA 1MBLA 3AE7C 4N4OB 2PU2A 4HG2A 3N8SA 2H28A 2ZXHA 1KQ0A 3JPUA 1C0WA 5H6QA 2JN6A 3OS2A 5KLIC 2VEAA 3S22A 4I5SA 3ZQ7A 1FYMA 3MZHA 2D2CC 3CCQP 1GTWA 2OYHA 2M9HA 1MSEC 3OYCA 1ZR2A 2QF7A 2ZBKA 3P01A 4U3FJ 3BT9A 4A3MJ 2E2HJ 4Y0UA 5LEKA 1R1TA 1W5TA 4C3IJ 3MMHA 1R6RA 2E1MB 1K0KA 3OMYA 3BLYA 1IELA 4LB6B 1S72I 4IQJA 2CPBA 2VT3A 3K2AA 3WTVC 3S3MA 5HWVA 1URQB 2L9NA 1UGUA 2E5TA 2A49A 2YKFA 1GT0C 3QWOC 4Y13A 2X85A 2B5RA 3PNTA 4DZJA 4I2LC 4BWNA 4XBFA 2GOMA 1G3WA 4NKPA 1T0FC 5G4YA 2W6JH 1Y8AA 3HOYJ 3MAJA 4BBRJ 4BQMA 3SZPA 2X01A 3BTLA 4F3LA 2QM3A 3M8JA 1IRFA 5E20A 4N3YB 1GSWA 2ZM2A 4MLOA 4HX8A 2TDXA 3VWBA 4D0PA 2WZXA 4NXEA 3G2BA 1GV5A 4M74A 2CUJA 2OYIB 3B02A 1K55C 4KZ7A 3SQNA 3B42A 5IP7J 4D2OA 3VMXA 1MY8A 3WRZA 4L73A 4QB8A 3S3OA 2M87A 2L0KA 2P4WA 2QUFA 1N77A 4OINF 1YLTA 3QP2A 1R4NB 4LOCA 1N9BA 4EMSA 4F3QA 2EBIA 2ZXXA 4O6JA 4YRVA 4E6KG 4RESB 4G6QA 3QPLA 4CCLA 2JK3A 3SOIA 1YSQA 4LITA 1URQA 4B4CA 4PHTA 4E3MA 5FRNA 1NTCA 3AE5C 2GUVA 1T08B 4EUZA 3AE4C 2G2WA 2VV8A 1NJ4A 1FE6A 4I0AA 3HUSB 4ZZDA 1ZRTE 3QP1A 5HAPA 4ANJA 1G2HA 2Y30A 1WMKA 1ZRCA 2KOIA 5ICFA 2IVMA 1NTZD 3IXDA 3LMMA 1SQXG 1JOCA 3H5NA 4MTEA 2BXZA 3BG9A 2M34A 2BGCA 3R7WB 3CF2A 5HL1A 3V8KA 3GWZA 2ZVNB 3PLNA 3EQ2A 4ZDPA 4PSXA 3KP7A 4IX7A 2EX6A 2H8WA 1Y0NA 3TL4X 3IC7A 3HD7D 4W1UA 4OIOF 3VOZA 2Q5UA 1JJ8C 4EM2A 2OYIA 3RH8B 3C1DA 1GDTA 2PN6A 2FBIA 3CCLP 5FA7A 3NOPC 2HG5D 1V4RA 3IAS2 2JSCA 3EDPA 1KDWA 1IYOA 1BLHA 4NK3A 1LTJC 5FAQA 1YLFA 1PGJA 4PMAA 2OGUA 4NPFX 2VQCA 5CCHA 1NGMB 3DEWA 1KORA 1TP4A 1Z3YA 4K08A 3S1YA 1VQKP 1SKFA 2RKLA 3DKYA 2X6YA 5F0FA 3GQZA 1NK2P 2DTZA 5TRDA 1FZAA 4J19A 1ZK8A 1JTDA 1IFIA 5FD5A 1RP5A 3DTEA 3HUSA 4A3JJ 1PP9G 1NK3P 2B7EA 3K7AJ 3IXGA 4CPKA 4Z6YA 3ZHHA 2BEOA 5AVTB 3FF5A 3I59B 3HXLA 2Y8HA 5J4YA 4IHYA 3M0AA 4X1MA 2OPTA 2X1DA 3R7WA 1D3YA 1DQUA 1T95A 5D8LB 1UG0A 2JA7J 3TO9A 3ZQQA 5ILSA 3MFKA 4HB1A 1SAXA 2W6AA 3EQUA 2DTRA 3Q82A 1P84I 4X1EA 3ZN0A 1DX7A 3BFGA 4C7NB 4PJ0E 1ODVA 4KUKA 2IPQX 5E18F 1C3BA 3RL0D 4E7KA 2VKHA 3D5LA 2Y2IA 2COMA 5J1UA 1LPQA 1J1DB 3KXDA 1YIJI 2W4SA 1G59A 1TQMA 1FCOA 1ONHA 3EUHC 4NPDA 3HUOA 3HPGA 3BC8A 2H09A 2A45H 3O8ZA 3DPLC 4CZCA 5DF8A 4H13D 3K70C 4HY8A 5HAIA 4MMNA 2ZQAA 3FBNB 1HW2A 3D6YA 1HLUP 2WAQA 3I59A 3PIPF 2K37A 4H6JB 4E70A 2AEJA 1KQ8A 4D6TE 4CICA 1L0FA 2E76D 4XQFA 2KDZA 1Z77A 3HTKB 1IUYA 2X4HA 3J7AY 1T8IA 3LW5J 3FX3A 1CSBA 4MQ9F 3MQ0A 3UB8A 2A45G 4FOFA 2DK8A 5E3MA 3R0JA 2HPIA 3CCMP 1VQOI 1T6SA 5A8BA 4NUBA 3JAMZ 3H1KE 4FTXA 4C7NA 4R4LA 3TP3A 3MKYB 4PJJA 1W4MA 4HX4A 1PP7U 1ZN5A 3A0HC 4EEUA 2PMZA 2FNPA 1APLC 1W8YA 3LICA 2O7OA 5C4XJ 3LSKA 1P4XA 2CV2A 1YQAA 4EXOA 4ENMA 3NDEA 4M72A 3T4TA 3PFYA 1L0NG 1NHLA 3LW5H 3D5SC 3VP3A 1BYWA 3WWXA 2L01A 3MZDA 4HH2A 2B9BA 4H0LB 3MCZA 1NAYA 2V0UA 1VQPI 2ZT9B 3JR9A 1XJ6A 4UA7A 3F8MA 2HOSA 5B66H 4LIVA 2VT2A 4H6JA 3U1KA 1VQ5P 4GFBA 3HUNA 4C2TA 2WBMA 3AG2H 2XQZA 2V1BA 3BQYA 3HTKA 3V2NA 1YRNB 3CD6I 2EPFA 5K7FA 1T0FA 5E2GA 3L70D 2FYNB 1MNEA 1PGPA 5TFQA 4AIHA 1P7IA 1DRMA 5JI6A 3PUBA 3LQRA 3SFIA 2DNSA 1KU9A 3WS0A 4PJMA 2HKXA 2Q1ZB 1XFQA 1ZGJA 1IAWA 2I5UA 2WKRA 4E3KA 2JT1A 5EEAA 1J1EC 1OISA 3A3YB 3H3ZA 1YO5C 5EEHA 2DMUA 1K55A 2M0CA 4C9YA 2XD5A 4GW9A 4EJTA 3OIOA 4R1HA 3NOUC 2WSCH 4PJ0H 3LSMA 3GFMA 2E71A 3OLOA 1MBKA 4BQOA 4LIUA 3IHAA 3VOYA 2YSRA 4HJGH 3VE3A 1SQPD 1K6YA 1IK7A 5BVZA 3IRQA 3G6OA 1LT9C 4RKUJ 5CHMA 2BHYA 2WPQA 2IW5A 3OR1C 4GOFA 4KJMA 1GU5A 5K5OA 3T97B 4EUVA 2VX8A 1TT0A 3S1NJ 4M3FA 2R7QA 2RH0A 1KU2A 3OS1A 4UVBA 1IFJA 4DRTA 1IN6A 4CDGA 1YRNA 4WXDA 2PD8A 3H1KJ 3GFJA 3SWYA 3L72D 1Q81Q 4J01A 2OV5A 5LGNA 4U0TA 2TCTA 3VP0A 5CBOA 4EATA 2RGVA 1TWFJ 3GO5A 1BUEA 2O9LA 3VP1A 4HHDA 1U78A 1FP2A 1XGNA 1GL2D 3S15J 2QA4P 4CCOA 2YKOA 3OA7A 3B6AA 2R9XA 3ZQHA 2QJPB 5FJ8J 2WAQN 5GTIC 4C2MJ 1LFPA 5KLVD 5B5EC 2P04A 2JBFA 4IBRA 2JDIH 2ELJA 4AFIA 4IEJA 4HLXA 2LY1A 2W25A 5GHYA 3VB2A 1ALQA 2YX7A 4ZZLA 4A3GJ 1ZV8A 4U87A 2DO7A 1S5LC 4KT5C 2KIMA 2ZJRF 4D6TG 2M1CA 2V20A 2GIZA 4HBTA 1KV4A 3T97A 4U0WA 2PMZN 4P5OA 5LEJA 1OWAA 2EA4A 4N9IA 5CXWA 2QEXP 1YW7A 2J5UA 2WQYC 3EFGA 2V4HA 1X2MA 3KEYA 2R92J 1K04A 4YXDC 1M1JB 2AXLA 2JA2A 4NBQA 1TQIA 4I01A 2Z2SB 1ZH5A 3S7PA 1RPWA 2JTVA 4HF0A 3EUAA 3HJEA 2W3DA 1N75A 3DTIA 3QP5A 2BEQD 5E2FA 1I50J 3NWTA 1D0YA 2CQQA 4W7YA 5DUIA 2W84A 1M40A 1IFDA 2PBDP 2HODB 3QYBA 2ZQCA 1O3QA 4DJ2A 3M7GA 3L75D 4OWFA 3S14J 1J09A 4EBNA 4CCNA 3I54A 4KIFA 2WSEJ 1MBHA 3V8JA 3EUHA 4QJGA 1K83J 3JRHA 3E3VA 5H2FC 4UQIM 4XRMA 5AONA 2HR3A 1CEGA 3JCUC 3LFUA 1F2KA 3AE2C 2AXCA 4DXCA 3MJQA 2QZ6A 2E74B 4PD4I 1MV8A 2HXIA 4H44C 3U59A 3IXHA 4ZNCA 3BR5A 4CLCD 2FY8A 1YFHA 2DOEA 3RPUD 2Y0SA 1M1JA 3R2PA 2HZ5A 4CO8A 4F7ZA 3DW0A 4U7BA 2EIJH 4ETZA 3PNYA 3MSHA 3KYLA 1L0EA 2VQLA 3LAPA 5FD6A 2XD1A 3BCCE 4I09A 1QGPA 3RQ4A 3K9TA 3W68A 4ZYDA 1KA8A 4YEJA 4JBZA 4LMYA 3DEEA 5D5UB 3IWIA 3NBLA 3OYJA 4C75A 1QHGA 4XLEA 2HODA 1YJNP 5AW6B 4P6BA 5D5WB 3Q9VA 1G3TA 3BQAA 5AVXB 2Z33A 3GTLJ 1NRJA 3MUDA 1YMSA 1H0MA 2IS1A 3DP7A 3PNVA 1GHMA 3HLBA 3LEZA 5FGMA 1MBEA 3LSTA 4GXOA 3BLMA 4QSHA 5J4EA 2HFHA 1TZLA 3D4FA 3OWTA 1BGYD 2J9PA 3AEAC 2XEPA 5KAFE 1AQTA 1S67L 3PJRA 2EZHA 1ENHA 1A02F 2FBWC 3KSIA 5AVFA 5AW9B 1EDIA 3HUMA 2IJLA 1JTYA 4A93J 3GW2A 3BY6A 3CF5F 1Z7LA 4EM0B 4UQIS 2LF7A 2PDRA 3RBXA 3S9OA 4KG2A 3JSOA 3VE4A 1PFLA 2IWCA 1KTMA 2K88A 2M7UA 3VP4A 1TS7A 2DI3A 3BJ6A 1Y1VJ 3RK3B 4NB5A 1CF7B 1USDA 3K4MA 3CCVP 2AQFA 5FAPA 2DQRA 2EZKA 3GBGA 4PFPA 2DMNA 2N9BA 3SZTA 2V79A 1LFBA 4JQ0D 1HZOA 1ON2A 3ZG8B 2EFWA 3KSFA 4UXNA 1GD2E 1ZLKA 5F0HA 5CCGC 3MTUE 3NRVA 2R7FA 4RAYA 4E7IA 3JRIA 2KIKA 1XTCC 5DTDA 2JHEA 5FFZA 2P6SA 4B8XA 1K56D 4V2GA 5HDNA 4JF6A 4RB2C 2ZFWA 3HREA 2HDSA 1I2SA 3G1LA 4DOJA 1SQBD 3G3ZA 4LLGF 3BCCJ 2FFDB 4HX7A 3WTWC 4P1WA 4YNRA 5TISE 3BM6A 3TNUB 3PL8A 1R5LA 2HKOA 3E6MA 1OFCX 5GLBA 2J5PA 3PP5A 5E79H 2YMKA 1XDUA 1IO4A 1WKMA 3AKZA 4EQIA 2LOOA 4R1GA 1KQSO 1CF7A 5FQKA 1T2KD 3CC7I 1USEA 4N0BA 1TQPA 4I7ZC 3GEZA 3MD0A 4BL0B 2CUEA 5ICCA 4MIMA 3QU6A 1NJIQ 2YNYA 4UY8I 5TJJA