4OPRA

Crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying g238s mutation
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEM-94 ES-beta-lactamase
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 103
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oprA00
3D4FA 4KZ5A 3BM6A 4QHCA 5KMWA 1LI9A 2P74A 2Q9MA 1ZG4A 5CGSA 4X55A 3WWXA 4Q8IA 3UNWA 2QPNA 1AXBA 1K54A 5CHMA 1ERQA 3M6HA 3E2KA 1K25A 5GLDA 4HBUA 3LY3A 2P9VA 2JCHA 5A91A 3HLFA 1JVJA 2ZMAA 1I2WA 3ZNTA 4BL3A 2R9XA 4PM8A 4LV3A 5TR7A 1NY0A 2WADA 1XGIA 3OPPA 1E3UA 1NYYA 3MZDA 3UE1A 2V20A 3N8RA 3N4IA 1BUEA 3LY4A 1G6AA 1O7EA 4RX3A 1Z6FA 2G2WA 1EI5A 1O07A 4L0LA 4E3MA 1Y54A 1KE3A 4KZBA 5M1AA 1GHPA 4Z9QA 1XPBA 1JWZA 3BFFA 4Y0TA 2WKIA 4K91A 2H5SA 4EBNA 4FSFA 4GN2A 3TG9A 5EOEA 2WAEA 4CJNA 1BLCA 5FI6A 1ZC2A 2HDQA 3MBZA 3HREA 3MZEA 3O88A 4H8RA 4DE2A 5DTSA 3A3JA 1NRFA 1HZOA 2CC1A 5EE8A 3VP3A 3M2JA 5FDHA 4BL2A 2JC7A 3GTCA 3WRZA 2Y2IA 3N8LA 1CI8A 4A5RA 5EECA 4GD6A 5KSCA 4ZDXA 1DJBA 3HUNA 4OPRA 5EVLA 5GLBA 3VOZA 3ZFZA 3RXWA 1BLSA 1M6KA 5M18A 2GDNA 4U0TA 1CI9A 4FH2A 2P9VB 4QJGA 4EQIA 4EV4A 1XA1A 2Y2GA 2Y2LA 1IKIA 4R4SA 1GHIA 4XUXA 4R3JA 4DDSA 1XGJA 4S2KA 1L2SA 3IWOA 5AQ9A 1NJ4A 1NXYA 4S2PA 4C75A 3G4PA 2EFUA 1K57A 1HTZA 4OKPA 3PAGA 4CPKA 3PBSA 1IELA 3HLBA 4PPRA 5HX9A 3GSGA 1L0DA 4KG2A 4HBTA 2WGIA 1KE0A 3HL9A 3LO7A 3CMZA 1XP4A 1LL9A 4O7DA 2OV5A 4E6WA 2ZM8A 3ISGA 4JPMA 3V3SA 4DDYA 3VP0A 3ITBA 3BLMA 1K56A 3O86A 4JF6A 4JXSA 3G31A 5EVIA 3V3RA 2H0TA 5F82A 3SH9A 1J9MA 4JXWA 4OP8A 1KVMA 2EX8A 4E3LA 2Y2QA 4GB7A 5L2FA 4KQQA 3Q07A 1YLJA 2WZXA 3S1YA 1VQQA 2J8YA 2DRWA 5EVID 4JXGA 1K55A 1TVFA 4MNRA 2IWBA 5TGFA 1ONHA 4S2OA 3NIAA 3UDXA 4BD1A 2A3UA 5DTTA 5JYPA 1H8ZA 3GVBA 4KZ7A 2OLVA 4WEJA 4KZAA 2FFYA 2H0YA 3PBQA 1XX2A 3UN7A 2VGKA 3NDEA 4OONA 3MKFA 5DF8A 4XXRA 3HLDA 2Y2MA 2XFSA 3OPLA 3WS2A 1OMEA 4OLGA 3SH7A 3TSGA 2IWCA 3IWIA 2ZQ7A 4QY5A 4XUZA 5EPHA 5HARA 3IXGA 1SCWA 2WAFA 2XEPA 2ZQ9A 4MEZA 4N9KA 4OOYA 4UAAA 4WZ5C 3VP1A 3WS4A 2ZM2A 4M3KA 1YMSA 2R9WA 2Y91A 4ZAMA 2Y2HA 3CZDA 3MXRA 4DE0A 3OPRA 4FD8A 2HP6A 3VFHA 3BFGA 1U60A 1JWVA 4OPZA 2EXBA 4NK3A 1L0FA 5FQKA 4OH0A 5JYOA 1MXOA 4QD4A 5FAQA 3LEZA 3SOIA 1I2SA 3DWZA 3G2ZA 4JF4A 4OOMA 1RCJA 4GD8A 2WGVA 3M6BA 1KDSA 4ZJ2A 4E6XA 1K4EA 1PZPA 3IQAA 1MWTA 4QU3A 4LV2A 5CHUA 3C4OA 3BFCA 5HAQA 2ZC5B 4KZ3A 2XD1A 5E2EA 2XLNA 4OQHA 3MXSA 2XD5A 2QMIA 3C7VA 3HBRA 3ZGAB 3MFDA 3E2LA 3IWQA 1PI5A 3FZCA 3GRJA 3PBRA 2ZC7A 3AGFA 4X68A 4E3OA 4R23A 4JKTA 4C6YA 1KGFA 3CJMA 5CEBA 3ZG5A 1H8YA 5A93A 1ESUA 2X71A 5F1FA 2V2FF 4QB8A 1E3UD 3HLCA 3ZDJA 3UE0A 3S22A 3UY6A 1ES3A 5GLCA 4S2NA 3OPHA 5EUAA 2ZJ9A 4GOGA 2OSUA 1YLWA 4OVDA 2XQZA 1FCOA 3N8SA 4OP5A 3IF6C 4RA7A 4B4ZA 5AQ7A 3RJUA 3G2YA 3GQZA 5CTNA 1FR6A 1NZUA 4P0MA 1W5DA 3OC2A 2ZQAA 4YINA 5E43A 5FQIA 3ITAA 1BTLA 3IXBA 1KVLA 4EBLA 1DJAA 1ESIA 3NBLA 3BECA 5FASA 1EROA 4WMCA 3B3XA 3IHBA 3G35A 3ZG7B 5DF7A 1NZOA 3GR2A 4IEDA 1JWPA 2HP5A 2EX9A 1YLTA 3HUOA 1ONGA 2G2UA 4LV0A 1GCEA 1PI4A 5A92A 4OQIA 3OZHA 2XR0A 4QY6A 4IVIA 1N4OA 2WKHA 4OOLA 4WMCD 1Q2QA 4S2JA 1I5QA 3P98A 1BLPA 1WYBA 2J9OA 1K54C 2Y2JA 3HUMA 3W4PA 5D3OA 4ZJ3A 1JTDA 1RGYA 4PM7A 2X01A 3G32A 1MWSA 2X02A 3O3VA 1RGZA 4WEKA 1MPLA 2IWDA 2WGWA 4PM5A 1CEGA 4P87A 3DWKA 3NI9A 3QNBA 2XDMA 4UA7A 1LI0A 3FKVA 1TDGA 3BFDA 2H10A 2DNSA 4GZBA 3SS4A 4KENB 3UPPA 5CGXA 3A3IA 3WS0A 4WELA 2RCXA 1EWZA 5TFQA 5AQAA 3UPOA 2XH9A 5KSHA 2ZM0A 5BOHA 3BFEA 4FCFA 1BLHA 4EWFA 1BT5A 1H5XA 1W7FA 2ZD8A 4HEFA 3SS3A 1RP5A 3FKWA 4N9LA 5E2FA 5AQBA 1K56D 3QNCA 3P09A 1BULA 5CRFA 3ZG9B 2PBYA 3BLSA 1GHMA 4N1HA 4WZ4A 5EOOA 5FATA 1LHYA 5HAPA 5F1GA 5G18A 1GA9A 4OQGA 3ZHHA 4BJPA 3HVFA 2Y2OA 4X69A 1G68A 2I72A 4X6TA 3C4PA 3IXDA 4JF5A 1YT4A 3O87A 3GV9A 5CXWA 1ALQA 2Z2LB 4KG6A 4KQRA 1MWUA 4R4RA 3N6IA 1PWCA 4MBFA 3WS5A 4R3BA 4EUZA 4WM9A 4YFMA 2C5WB 4DXCA 1IEMA 2WGWB 5FAOA 4BQMA 1N9BA 1ES5A 1SDNA 1YQSA 2HDSA 4EBPA 3SS5A 3NY4A 1K6SA 3IH8A 1K38A 2WZZA 1ES4A 1K57C 5FQ9A 3M2KA 2WK0A 1HVBA 2WUQA 2Y59A 3UDIA 4LCMA 1QMEA 1E25A 3VMAA 5M19A 5FQMA 1IYOA 1KGEA 3AGDA 3DTMA 2Y2NA 3NCKA 4B4XA 2Y2KA 4DE1A 3RXXA 4ZBEA 1FSWA 4KZ8A 1PW1A 3FYZA 1SKFA 2QZ6A 5EVIC 2BLSA 2JBFA 4JLFA 5FQJA 5FAPA 1CEFA 4LCLA 4F94A 2ZQ8A 2FFFB 4LV1A 1FCNA 3PBNA 4GDBA 4BD0A 3PAEA 1TDLA 2EXAA 1SDEA 3C7UA 3FWLA 1WYCA 3W4QA 3BEBA 3FV7A 3Q81A 3GMWA 4JBFA 4MLLA 2PU4A 1IYPA 1E4DA 4OPQA 2WKEA 4DXBA 3EQVA 3WS1A 5KZHA 3OCLA 2ZC6B 2EFXA 2HDRA 3G34A 1FR1A 4GDNA 3UE3A 2J7VA 3UO9A 5CHJA 1S0WA 3N7WA 3ZG8B 3S4XA 2ZLYA 5FQQA 4ID4A 1MY8A 4BENA 1LLBA 1DY6A 2Y4AA 5CEDA 4UHUA 4N1XA 1SHVA 4RYEA 3UDFA 4K0WA 4D2OA 3C5AA 5FI7A 4PM9A 3V5MA 4S2IA 4GNUA 4E3JA 5HW3A 1GA0A 1MBLA 4IBXA 4RVAA 4FH4A 2JE5A 2XFTA 3IF6B 3VSLA 1YLPA 4X56A 5GL9A 1VM1A 3HLWA 4ZJ1A 1MKIA 3IHAA 4S2MA 5FA7A 5E2HA 1YLZA 3ZG0A 2ZQCA 4GKUA 4N92A 2Z2MB 3IH9A 3ZCZA 1MWRA 1KDWA 4B88A 3ZVWA 5U47A 1IKGA 3A3FA 3A3DA 4LENA 1ERMA 3EQUA 1PZOA 1PYYA 3Q1FA 3VOYA 2DCFA 4NETA 3VFFA 4P85A 1S6RA 4KZ9A 3G30A 5DF9A 5GHXA 1FQGA 1TEMA 3LCEA 4Y0UA 5HL1A 2B5RA 4KZ6A 3JYIA 3W4OA 4WZ5A 2ZQDA 1FOFA 5CTMA 5CECA 1ZG6A 3NC8A 1YMXA 3I7JA 4Y7PA 5GHYA 1XXMA 1W8QA 4DKIA 1YM1A 3DW0A 4WYYA 2ZC4B 1BSGA 5DTKA 4OQ0A 1W79A 2HPBA 1YLYA 3VP2A 1C3BA 2A49A 1JTGA 4S2NC 1WE4A 2WYXA 3MKEA 5FI2A 1HD8A 2XK1A 2Q9NA 2ZC3B 3VSKA 4MBKA 4R0QA 4E3NA 3AGEA 2XF3A 3UPNA 4KQOA 3QHYA 1QMFA 3VP4A 5DVAA 1CK3A 4PMAA 1PW8A 3PTEA 4E3KA 1NYMA 4R1GA 2EX2A 3Q7VA 4BLMA 1W8YA 1FCMA 4ZTKA 3IT9A 1PWDA 3MZFA 1FSYA 2C6WB 2OLUA 1L0GA 2E8IA 3IXHA 4MBHA 5HAIA 4IBRA 4OPYA 5GLAA 1ZKJA 2VGJA 3HLGA 3ZNYA 4E3IA 2BG1A 4IVKA 5CGWA 4OLDA 1K4FA 3V50A 3BYDA 1KE4A 3Q7ZA 3ZVTA 2HDUA 4JXVA 4KZ4A 3CG5A 5I94A 1M40A 1PWGA 4WBGA 1ES2A 5A90A 2V1ZA 3V39A 2HP9A 4S2LA 3OCNA 4U0XA 5J8XA 3HLEA 4RX2A 1DJCA 4Y0OA 3SH8A 4C3QA 3PBOA 3WRTA 4U3TA 1L0EA 4PM6A 4X53A 1IYQA 4HESA 1Q2PA 2EX6A 1XA7A 5GHZA 3W8KA 1BZAA 3A3EA 1KGGA 2RL3A 3IF6A 3Q82A 5E2GA 4K0XA 5FSRA 3IF5A 3TOIA 4UA6A 5HFOA 4DRTA 4DF6A 2PU2A 1K6RA 1LL5A 2XGNA 2J9PA 5IHVA 5CERA 2Y2PA 4P6BA 1PIOA 3NDGA 4UA9A 3PBTA 1IYSA 3Q7VB 2Y55A 4DE3A 2UWXA 1XKZA 3BRMA 5F83A 1K55C 4KG5A 5EVIB
chains in the Genus database with same CATH superfamily
4KZ5A 3BM6A 5KMWA 1LSXA 4YNRA 5L09A 3UMDA 4IUHA 1ERQA 4HBUA 3BY8A 3LIBA 3BQAA 3ZNTA 3F1NB 3ZYTA 4E04A 1XGIA 3EEAA 1F2KA 3N4IA 3LY4A 4G3KA 1Y54A 1JWZA 4NG2A 5EOEA 2WAEA 4B9OA 4CJNA 3TW8A 2O0YA 3MZEA 3ULFA 3A3JA 1NRFA 3WRZA 3N8LA 1IFQA 4A5RA 4PHTA 4ZDXA 1DJBA 2V9AA 2VV6A 5EVLA 3D72A 5M18A 1OT9A 4FUWA 2PRFA 2P9VB 3MFXA 5G4ZA 2Q0OA 4EQIA 4EV4A 1F9IA 4R4SA 4XUXA 4S2KA 3IWOA 4EU0A 5AQ9A 1NJ4A 3H7WB 1K57A 4CPKA 4I3IA 3HLBA 2L1MA 5EM0A 3SZTA 5HX9A 1UGUA 2V8FA 1XJ6A 4JGRA 4KG2A 3HL9A 3LO7A 1XP4A 1LL9A 4BWIA 4E6WA 3LGOA 2V0UA 1S4RA 4YOFA 3V3SA 1D7EA 5DFXA 1K56A 1MZUA 3O86A 3V3RA 3SH9A 4E3LA 2ZL1B 3LFVA 3S1YA 1NLYA 1K55A 3DBAA 3UDXA 5TGFA 2M7VA 3H9WA 2W3DA 4WF0A 4F3LA 2FFYA 3ZQ5A 2Y2MA 2YKFA 2XFSA 3WS2A 1OMEA 4OLGA 2IWCA 3F1OB 2PYPA 4WZ5C 1X0OA 4HY8A 3E4OA 2R9WA 2HP6A 2LB5A 4OH0A 1CJFA 3G2ZA 4JF4A 1K4EA 4JGQA 2W3GA 3F1PB 3LR4A 2J80A 4GS9A 1N9NA 2XD1A 1SKOB 2XLNA 4OQHA 2QMIA 2QJ5A 3HBRA 1OTBA 3FZCA 2VEAA 4E3OA 4R23A 1S4SA 2X71A 5F1FA 2BASA 3T4SA 4QB8A 2V1AA 3UE0A 5EUAA 1YLWA 1HLUP 2J3WA 3N8SA 4RA7A 4B4ZA 3KYZA 4LRXC 2O9AA 3GQZA 3KX0X 3BQ8A 1K0KA 3OC2A 2ZQAA 5E43A 2Z6CA 3ITAA 2M7UA 1ESIA 4G3VA 3VE4A 3BECA 5F69A 4LRZE 2VA0A 3ZG7B 3G35A 5DF7A 1NZOA 4IEDA 1JWPA 2HP5A 2EX9A 1YLTA 2G2UA 1TS6A 2WKHA 4WMCD 1OTAA 1I5QA 3P98A 1VHMA 1JTDA 1RGYA 4I3AA 2X02A 2HJEA 1RGZA 3IBRA 1OTEA 3MQOA 2KLIA 3DWKA 4UA7A 1LI0A 3R4KA 2H10A 3NJAA 3SS4A 2A24A 1EWZA 5KSHA 4FCFA 1BLHA 3SS3A 3OBFA 3FKWA 1K56D 3CPTA 3KSHA 3GDIA 1VEUB 5HAPA 5F1GA 5G18A 2HF6A 3LIEA 2HJ9C 4X6TA 2I72A 3IXDA 3O87A 5CXWA 4H6JB 2Z2LB 4MDZA 1MWUA 4R4RA 3VV4A 1T18A 4II7A 4MBFA 3JVVA 2B18A 4WM9A 4YFMA 4DXCA 4BQMA 3HCYA 2HDSA 3L7HA 3SS5A 3NY4A 2D01A 4IJGA 3D9YA 1K57C 3L9KA 2Y59A 1E25A 2XSSA 5FQMA 2EWVA 2J3TD 1J3WA 2BLSA 4HP9A 5AJGA 5FAPA 5FL3A 2FFFB 3PHYA 3W4QA 4B93A 2PU4A 1IYPA 2WKEA 4DXBA 5HL6A 3T4TA 3E4PA 1G5UA 2WKRA 2ZC6B 4GDNA 3G34A 3N7WA 3ZG8B 4PAUA 1LLBA 2QWSA 5CEDA 4UHUA 3UDFA 4D2OA 4R6LA 4PM9A 3V5MA 3MXQA 4CLCA 1YLPA 1VM1A 2O99A 3TJZC 3EGXC 3EGDC 3ZVWA 1LL8A 3A3FA 3EQUA 4R70A 3Q1FA 3U2AA 2DCFA 1P97A 2W27A 5TBMA 4P85A 4GW9A 1FQGA 1TEMA 3W4OA 5CTMA 5CECA 1XXMA 4DKIA 1YM1A 3DW0A 4WYYA 5DTKA 2HPBA 2A49A 3MKEA 3VSKA 4E3NA 3UPNA 3QHYA 3VP4A 1XFQA 4MMNA 5G4YA 1L3LA 3Q7VA 4ZTKA 3MZFA 2M1CA 4YWZA 3UB7A 4HOIA 4OPYA 4E3IA 2VGJA 2BG1A 2NUTC 4Y15A 4KZ4A 3NHQA 1PWGA 4WBGA 4U0XA 3TE8A 1DJCA 3PBOA 3WRTA 4EERA 4PM6A 1STZA 4GJ4A 2EX6A 3W8KA 1BZAA 1KGGA 2RL3A 3SW1A 5E2GA 1OJ5A 4UA6A 4DF6A 2PU2A 1K6RA 1LL5A 2GNXA 2J9PA 5FEFA 4UA9A 4LPZA 1DRMA 3D4FA 2ZBBA 4QHCA 2P74A 2Q9MA 1ZG4A 3WWXA 4NEED 3UNWA 3E2KA 1K25A 3K3CA 5GLDA 1NRJA 4EXOA 4L9GA 2QKPA 3HLFA 3QP2A 2K2NA 4PM8A 4LV3A 3OPPA 3MZDA 3UE1A 3H82B 4KUOA 4Q0IA 4ME4A 1KE3A 5M1AA 3QP5A 4Z9QA 1XPBA 4Y0TA 2WKIA 4K91A 5L8MA 4FSFA 5HD3A 3LYXA 5FI6A 4UQIM 3MBZA 3HREA 3O88A 2V0WA 4H8RA 4ETZA 2KOIA 4DE2A 5DTSA 2HGVA 1HZOA 2CC1A 3VP3A 3HUNA 5GLBA 3VOZA 4GS9B 1CI9A 4ARZA 4EUVA 2Y2LA 3CHWP 2Y8HA 4G3WA 4S2PA 1LSVA 4PPRA 2WGIA 3HJIA 3P01A 4JPMA 3ITBA 3BLMA 3ICYA 1KVMA 2W3HA 4HQAA 4CLCC 4KQQA 3Q07A 2WZXA 3CLOA 1TVFA 1ONHA 4BD1A 4EW7A 5DTTA 1H8ZA 2OLVA 4KZAA 2H0YA 3MKFA 5IU1A 3UE6A 3OPLA 3SH7A 2ZQ7A 4QY5A 4XUZA 5EPHA 2WAFA 2XEPA 4OOYA 4I3JA 1YMSA 3UB5P 2Y91A 3EWKA 2NUPC 3CZDA 3UMEA 3MXRA 4FD8A 3BFGA 5EM1A 2EXBA 1UWPX 1A0KA 3M6BA 3MJQA 3IQAA 4XT2B 1TS0A 1S67L 2ZC5B 4KZ3A 3EEHA 4L9EA 5A8BA 3CPTB 2XD5A 3KSIA 3C7VA 4QWOA 3G6OA 4JKTA 1YSPA 1KGFA 5CEBA 1P9WA 3LR3A 1WA9A 4O8GA 5KIZA 3HLCA 3IX4A 3S22A 3UY6A 4S2NA 3IX8A 3OPHA 2ZJ9A 2OSUA 1FCOA 4LLOB 3RJUA 4P6ZS 3FG8A 5CTNA 1FR6A 1TD5A 4P0MA 4YINA 3IXBA 1KVLA 1EROA 4WMCA 3B3XA 3NOUC 3GR2A 4LV0A 5A92A 3OZHA 1Q2QA 4S2JA 3W4PA 3R7WA 4DJ3A 1MWSA 1H8MA 3O3VA 2WGWA 4PM5A 2XDMA 3UPPA 5CGXA 4WELA 5AQAA 3UPOA 5BOHA 4EWFA 1W7FA 2ZD8A 1RP5A 4N9LA 5AQBA 3B33A 1BULA 2PBYA 2WKPA 1GHMA 4CLCB 4WZ4A 3QP4A 5EOOA 1OTIA 1GA9A 4OQGA 4BJPA 3HVFA 2Y2OA 1ZTUA 3BWLA 1YAXA 3GV9A 1YPRA 2D02A 4KQRA 3N6IA 2V8CA 2XA7S 4Y13A 2C5WB 5FAOA 1SDNA 3E98A 3IH8A 1K38A 2WZZA 1ES4A 4Y3IA 2WKQA 2VV7A 4NXBA 4LGWA 4PKYA 1KGEA 4BMWA 2Y2NA 3RXXA 3IS2A 1FSWA 4KZ8A 1PW1A 3E4QA 3FYZA 1CEFA 2O9BA 4LV1A 3PBNA 4GDBA 2PBDP 3FPVA 1T1CA 3PAEA 2EXAA 3C7UA 3T50A 2ZMFA 3GMWA 2JKTM 4OPQA 3MMHA 5FEGA 3WS1A 1OT6A 2VK3A 4EETB 1S0WA 5F5YA 3DTIA 4BENA 1MY8A 4RYEA 3C5AA 2JKTI 5HWWA 1VETB 4GNUA 5HW3A 4IBXA 4RVAA 4KUKA 4FH4A 1FIKA 5GL9A 4Y17A 5FA7A 4BBTA 2PT7A 2Z2MB 1S1YA 1V9ZA 4B88A 5DKLA 2INWA 1ERMA 4NETA 3VFFA 3CUEA 2OAP1 3LCEA 3JYIA 2QHKA 1YMXA 3I7JA 4OQ0A 3VP2A 1GSXA 4S2NC 5FI2A 1HD8A 4R0QA 3AGEA 1GSWA 1QMFA 4PMAA 4E3KA 1NYMA 3NECA 4R1GA 4BLMA 1FCMA 1P0ZA 3V67A 2C6WB 1ZHHB 2E8IA 5HAIA 1ZKJA 3HLGA 4OLDA 1K4FA 4JXVA 3CG5A 5I94A 1M40A 4FTXA 2V1ZA 4S2LA 3LR5A 3PYPA 5F68A 4RX2A 4Y0OA 4ARZB 3JVUA 4C3QA 5IT5A 3GECA 4X53A 1IYQA 1Q2PA 5GHZA 3IF6A 2B02A 1H0MA 1UWNX 5HFOA 1CF0A 1S1ZA 4P6BA 1PIOA 1CQAA 1XFNA 1N9LA 3PBTA 2Y55A 5F6AA 2UWXA 5F83A 2V1BA 1K55C 3VOLA 1XJ2A 4X55A 4Q8IA 1SZVA 1AXBA 4CLCE 2P9VA 5A91A 2I9VA 2ZMAA 1I2WA 2R9XA 1NY0A 2WADA 2EA9A 2MJ6A 4HHDA 1NYYA 2V20A 2LB9A 3N8RA 2W1TA 1G6AA 3H7WA 1Z6FA 2G2WA 4KZBA 4QPRA 5HD5A 4GN2A 2J3TC 4X1LA 3DAVA 3LI9A 3LI8A 5EE8A 5EFWA 1TF1A 2JC7A 5HPIA 5KSCA 5EECA 3LR0A 4OPRA 3ZFZA 1BLSA 4U0TA 4FH2A 1YSQA 1AWIA 4BBVA 4X25A 1H3QA 1L2SA 3K3DA 3DTKA 3G4PA 4OKPA 1IELA 3GSGA 1L0DA 4NXGA 4MN7A 3IX3A 2Y79A 4DJ2A 1PRQA 4O7DA 3ISGA 5EVEA 3A0RA 4DDYA 3VP0A 3G31A 4NKPA 3B47A 4Q0HA 4GB7A 5L2FA 1YLJA 2IA2A 3F1PA 2DRWA 5EVID 4JXGA 3UB6A 1SKOA 2IWBA 2VZWA 4S2OA 3NIAA 5JYPA 4WEJA 4GHIA 3QP1A 3JPUA 5HWVA 1P9RA 4OONA 4WUJA 5DF8A 4XXRA 3HLDA 3CUEC 2P7JA 3IWIA 2ACGA 3IXGA 2JN7A 4MEZA 3WS4A 5HDCA 2ZOIA 2Y2HA 1VB6A 3S7PA 3VFHA 1U60A 5CX7A 4NK3A 5FQKA 2PDRA 2R78A 1MXOA 3LEZA 3SOIA 4WN5A 1RCJA 2KX6A 4GD8A 2WGVA 4ZJ2A 4QU3A 3C4OA 3BFCA 5HAQA 5E2EA 3MXSA 1XJ4A 3ZGAB 3MFDA 3E2LA 3IWQA 4F3LB 1PI5A 2KDKA 3PBRA 2ZC7A 3LICA 3CJMA 2K31A 3ZG5A 1H8YA 4LRYC 1ESUA 3U4LP 2V2FF 2PYRA 1FILA 3O5YA 5DFYA 3TRCA 3RFBA 4GOGA 1GSVA 1G28A 4OP5A 3IF6C 5AQ7A 3G2YA 1NZUA 3KYEA 1W5DA 5FQIA 1BTLA 1DJAA 3NBLA 1OPXA 5HZHA 1NLZA 3IHBA 1VEUA 5DJUA 3HUOA 1ONGA 3LIDA 5TJJA 1DP6A 4HNBA 4OQIA 4QY6A 2XR0A 4OOLA 2UV0E 4PKYG 4H6JA 1WYBA 2J9OA 2Y2JA 3HUMA 1N9OA 5FDSA 4PM7A 1V9YA 2JKRM 3G32A 3LIFA 2X01A 4KQDA 2IWDA 4R3AA 1CEGA 4P87A 3NI9A 3KO6A 3QNBA 3OOVA 5L10A 2DNSA 3CAXA 4KENB 2HZ5A 2RCXA 2XH9A 1ODVA 3T12B 2JKRI 1BT5A 1MC0A 5E2FA 5J7EA 3ZG9B 4BBUA 4EEPA 3BLSA 4N1HA 5FATA 3CI6A 4X69A 1G68A 2VKSA 3C4PA 4JF5A 2PHYA 1ALQA 2XRNA 4KG6A 3VE3A 3WS5A 4EUZA 1ACFA 3UB8A 1N9BA 1ES5A 1D06A 4P6ZM 3NOTC 3M2KA 2WK0A 2WUQA 5IS1A 3UDIA 2A24B 5M19A 5HWTA 2PR6A 1IYOA 3DTMA 3NCKA 4B4XA 2W3FA 4DE1A 4ZBEA 2Z6DA 1DP9A 2O9CA 1SKFA 4JLFA 1Y4OA 4LCLA 2GZAA 1FCNA 5J4EA 1TDLA 2VGLS 3T1RA 1PFLA 3FWLA 3BEBA 3MF0A 2G7UA 3FV7A 2P04A 3Q81A 3T4JA 1D1JA 4HJ4A 4O0PA 4EESA 1XJ3A 3OCLA 1W63Q 2J7VA 3T1SA 5EV0A 3LUQA 5CHJA 5FQQA 2E8JA 3C30A 1DY6A 4N1XA 1SHVA 4K0WA 4NXFA 4E3JA 1GA0A 1MBLA 1EW0A 3IF6B 4JGOA 1MKIA 3MQQA 4GKUA 3BJNA 4N92A 3ZCZA 1MWRA 1KDWA 2OAQ1 1LT0A 5U47A 3A3DA 2XA7M 1PYYA 5HDSA 1S6RA 4Y2FA 4KZ9A 5GHXA 5HL1A 5I5LA 1Z09A 5GHYA 1OJGA 3CWFA 2ZC4B 1YLYA 1C3BA 1JTGA 1WE4A 2W1TB 2WYXA 2VJWA 2Q9NA 4MBKA 4KQOA 3C8CA 3T4LA 1PW8A 4I39A 2W1RA 2EX2A 3KYQA 4D60A 3IT9A 2OOLA 2H28A 1FSYA 5DJTA 1L0GA 4IBRA 2YKHA 3V50A 3BYDA 1KE4A 3Q7ZA 5TBMB 4HJ3A 3T1XA 4Q0JA 3P7NA 2HP9A 1T19A 3HLEA 2PD7A 2CMNA 3H82A 4ZRRA 4U3TA 1L0EA 4HESA 1XA7A 3Q82A 5FSRA 4K0XA 3T1QB 3IF5A 2XGNA 3FPWA 4UEYA 5IHVA 3NDGA 1IYSA 3Q7VB 2FH5A 4DE3A 1XKZA 1IOUA 4KG5A 1LI9A 5CGSA 2QPNA 1K54A 5CHMA 3M6HA 4EEUA 4GLQA 3LY3A 2JCHA 1JVJA 1Y28A 3DTEA 4BL3A 4GHIB 5TR7A 1E3UA 5HPFA 2ZMVA 4HJ6A 1BUEA 4HH3A 1O7EA 4RX3A 1EI5A 1O07A 4L0LA 4E3MA 3C2WA 1GHPA 3BFFA 4EBNA 2H5SA 3TG9A 3KSGA 4CQHA 1BLCA 1F5MA 1ZC2A 5DKKA 2HDQA 5HSQA 3M2JA 5FDHA 3UB9A 4BL2A 3GTCA 2Y2IA 1CI8A 4GD6A 3RXWA 1M6KA 3MS6A 1YKDA 2GDNA 4FOFA 3D3OA 2JKGA 4QJGA 1XA1A 2Y2GA 3RTYA 1IKIA 1GHIA 4R3JA 4DDSA 1XGJA 2VLGA 4DMZA 1NXYA 5L07A 4C75A 2EFUA 1HTZA 3PAGA 3PBSA 2L4RA 2K7SA 5HDDA 4HBTA 4HI4A 1KE0A 4MCWA 3CMZA 2OV5A 4M4XA 3BY9A 2ZM8A 4EQ1A 4JF6A 4JXSA 5EVIA 2H0TA 5F82A 1J9MA 4JXWA 4OP8A 2EX8A 2Y2QA 4XT2A 2AVXA 2B95A 4MN6A 2DMWA 1VQQA 2J8YA 2BTFP 4MNRA 2A3UA 3F1NA 1JNUA 3GVBA 4KZ7A 3PBQA 1XX2A 3UN7A 2VGKA 3NDEA 4Y5FA 3IBJA 3TSGA 5HARA 4ESPA 1SCWA 4UAAA 2ZQ9A 4GCZA 4N9KA 3VP1A 4AFIA 2ZM2A 4M3KA 4ZAMA 4DE0A 3OPRA 3MQ0A 4LFUA 3S7OA 1JWVA 4OPZA 1L0FA 3RH8B 5JYOA 4QD4A 5FAQA 1I2SA 3DWZA 4OOMA 1KDSA 4E6XA 1PZPA 1MWTA 4LV2A 5CHUA 2OWHA 3B42A 3GRJA 3AGFA 4X68A 4C6YA 2QYBA 5A93A 2XROA 3QP6A 4HH2A 1E3UD 3ZDJA 4IHQA 1ES3A 5GLCA 4K08A 1MKMA 3MR0A 4OVDA 2XQZA 4R38A 4HP4A 2ZL1A 4ETXA 5AVFA 2P08A 4EBLA 5FASA 2JKFA 1GCEA 1PI4A 3C38A 4IVIA 1N4OA 1BLPA 3S7QA 3F1OA 1K54C 2JHEA 2HV1A 5D3OA 1T1AA 4ZJ3A 3NULA 1T1BA 3BW6A 4IUKA 4WEKA 1MPLA 1KOUA 5K5BA 3FKVA 1TDGA 3BFDA 4GZBA 3NOPC 5MC7A 3A0VA 3A3IA 3WS0A 3MSHA 5TFQA 2A2LA 3LEQA 2ZM0A 3BFEA 5C5KA 1H5XA 4HEFA 2GX5A 3KSFA 3QNCA 3P09A 5CRFA 2L0WA 1LHYA 3ZHHA 4X1MA 4RQ9A 1YT4A 1PWCA 4I38A 3R7WB 4R3BA 1G6OA 4MN5A 1IEMA 2WGWB 1PNEA 1YQSA 4JGPA 4EBPA 1K6SA 1F98A 5FQ9A 1HVBA 1VETA 4LCMA 1QMEA 1S66L 3VMAA 2OWJA 3LIAA 3AGDA 2GJ3A 2Y2KA 4O01A 3CITA 5EVIC 2QZ6A 2JBFA 5FQJA 4F94A 2ZQ8A 4BD0A 3S7NA 1SDEA 1WYCA 4JBFA 4MLLA 1E4DA 2VV8A 3EQVA 3T4KA 5KZHA 4I5SA 5LBRA 2EFXA 2HDRA 1FR1A 3UE3A 3UO9A 3S4XA 3T4OA 2ZLYA 4ID4A 1NWZA 2Y4AA 3A0SA 3T4QA 5FI7A 4S2IA 1BYWA 2JE5A 2XFTA 2QJ7A 3W2ZA 3VSLA 2W0NA 4X56A 3HLWA 4ZJ1A 3IS2B 3IHAA 4S2MA 3PR6A 5E2HA 1YLZA 3ZG0A 2ZQCA 3IH9A 4CLCD 4Z1WA 1IKGA 4LENA 1PZOA 4L9FA 1TS8A 3VOYA 3E0YA 3G30A 5DF9A 1LSWA 4Y0UA 2B5RA 3OLOA 4KZ6A 4WZ5A 2ZQDA 1FOFA 2PAVP 1TS7A 1ZG6A 3NC8A 4Y7PA 1W8QA 1BSGA 2W3EA 1W79A 2VX8A 2XK1A 2ZC3B 2PR5A 2XF3A 5DVAA 1CK3A 3PTEA 1W8YA 4DN0A 1PWDA 2VGLM 3EOIA 4UQIS 1DP8A 2OLUA 3IXHA 4MBHA 5GLAA 4WL9A 2EWWA 3ZNYA 5J3WA 4IVKA 5CGWA 2ZOHA 4WLAA 3ZVTA 2HDUA 1ES2A 5A90A 3V39A 5J8XA 3OCNA 3FC7A 1W63M 3QP8A 3PXPA 2FZ0A 5AVEA 3SH8A 2PD8A 3A3EA 3TOIA 4DRTA 1OTDA 3K2NA 4NXEA 2Y2PA 3HJKA 5CERA 3BRMA 4HIAA 5EVIB
chains in the Genus database with same CATH topology
3D4FA 4KZ5A 3BM6A 4QHCA 5KMWA 1LI9A 2P74A 2Q9MA 1ZG4A 5CGSA 4X55A 3WWXA 4Q8IA 3UNWA 2QPNA 1AXBA 1K54A 5CHMA 1ERQA 3M6HA 3E2KA 1K25A 5GLDA 4HBUA 3LY3A 2P9VA 2JCHA 5A91A 3HLFA 1JVJA 2ZMAA 1I2WA 3ZNTA 4BL3A 2R9XA 4PM8A 4LV3A 5TR7A 1NY0A 2WADA 1XGIA 3OPPA 1E3UA 1NYYA 3MZDA 3UE1A 2V20A 3N8RA 3N4IA 1BUEA 3LY4A 1G6AA 1O7EA 4RX3A 1Z6FA 2G2WA 1EI5A 1O07A 4L0LA 4E3MA 1Y54A 1KE3A 4KZBA 5M1AA 1GHPA 4Z9QA 1XPBA 1JWZA 3BFFA 4Y0TA 2WKIA 4K91A 2H5SA 4EBNA 4FSFA 4GN2A 3TG9A 5EOEA 2WAEA 4CJNA 1BLCA 5FI6A 1ZC2A 2HDQA 3MBZA 3HREA 3MZEA 3O88A 4H8RA 4DE2A 5DTSA 3A3JA 1NRFA 1HZOA 2CC1A 5EE8A 3VP3A 3M2JA 5FDHA 4BL2A 2JC7A 3GTCA 3WRZA 2Y2IA 3N8LA 1CI8A 4A5RA 5EECA 4GD6A 5KSCA 4ZDXA 1DJBA 3HUNA 4OPRA 5EVLA 5GLBA 3VOZA 3ZFZA 3RXWA 1BLSA 1M6KA 5M18A 2GDNA 4U0TA 1CI9A 4FH2A 2P9VB 4QJGA 4EQIA 4EV4A 1XA1A 2Y2GA 2Y2LA 1IKIA 4R4SA 1GHIA 4XUXA 4R3JA 4DDSA 1XGJA 4S2KA 1L2SA 3IWOA 5AQ9A 1NJ4A 1NXYA 4S2PA 4C75A 3G4PA 2EFUA 1K57A 1HTZA 4OKPA 3PAGA 4CPKA 3PBSA 1IELA 3HLBA 4PPRA 5HX9A 3GSGA 1L0DA 4KG2A 4HBTA 2WGIA 1KE0A 3HL9A 3LO7A 3CMZA 1XP4A 1LL9A 4O7DA 2OV5A 4E6WA 2ZM8A 3ISGA 4JPMA 3V3SA 4DDYA 3VP0A 3ITBA 3BLMA 1K56A 3O86A 4JF6A 4JXSA 3G31A 5EVIA 3V3RA 2H0TA 5F82A 3SH9A 1J9MA 4JXWA 4OP8A 1KVMA 2EX8A 4E3LA 2Y2QA 4GB7A 5L2FA 4KQQA 3Q07A 1YLJA 2WZXA 3S1YA 1VQQA 2J8YA 2DRWA 5EVID 4JXGA 1K55A 1TVFA 4MNRA 2IWBA 5TGFA 1ONHA 4S2OA 3NIAA 3UDXA 4BD1A 2A3UA 5DTTA 5JYPA 1H8ZA 3GVBA 4KZ7A 2OLVA 4WEJA 4KZAA 2FFYA 2H0YA 3PBQA 1XX2A 3UN7A 2VGKA 3NDEA 4OONA 3MKFA 5DF8A 4XXRA 3HLDA 2Y2MA 2XFSA 3OPLA 3WS2A 1OMEA 4OLGA 3SH7A 3TSGA 2IWCA 3IWIA 2ZQ7A 4QY5A 4XUZA 5EPHA 5HARA 3IXGA 1SCWA 2WAFA 2XEPA 2ZQ9A 4MEZA 4N9KA 4OOYA 4UAAA 4WZ5C 3VP1A 3WS4A 2ZM2A 4M3KA 1YMSA 2R9WA 2Y91A 4ZAMA 2Y2HA 3CZDA 3MXRA 4DE0A 3OPRA 4FD8A 2HP6A 3VFHA 3BFGA 1U60A 1JWVA 4OPZA 2EXBA 4NK3A 1L0FA 5FQKA 4OH0A 5JYOA 1MXOA 4QD4A 5FAQA 3LEZA 3SOIA 1I2SA 3DWZA 3G2ZA 4JF4A 4OOMA 1RCJA 4GD8A 2WGVA 3M6BA 1KDSA 4ZJ2A 4E6XA 1K4EA 1PZPA 3IQAA 1MWTA 4QU3A 4LV2A 5CHUA 3C4OA 3BFCA 5HAQA 2ZC5B 4KZ3A 2XD1A 5E2EA 2XLNA 4OQHA 3MXSA 2XD5A 2QMIA 3C7VA 3HBRA 3ZGAB 3MFDA 3E2LA 3IWQA 1PI5A 3FZCA 3GRJA 3PBRA 2ZC7A 3AGFA 4X68A 4E3OA 4R23A 4JKTA 4C6YA 1KGFA 3CJMA 5CEBA 3ZG5A 1H8YA 5A93A 1ESUA 2X71A 5F1FA 2V2FF 4QB8A 1E3UD 3HLCA 3ZDJA 3UE0A 3S22A 3UY6A 1ES3A 5GLCA 4S2NA 3OPHA 5EUAA 2ZJ9A 4GOGA 2OSUA 1YLWA 4OVDA 2XQZA 1FCOA 3N8SA 4OP5A 3IF6C 4RA7A 4B4ZA 5AQ7A 3RJUA 3G2YA 3GQZA 5CTNA 1FR6A 1NZUA 4P0MA 1W5DA 3OC2A 2ZQAA 4YINA 5E43A 5FQIA 3ITAA 1BTLA 3IXBA 1KVLA 4EBLA 1DJAA 1ESIA 3NBLA 3BECA 5FASA 1EROA 4WMCA 3B3XA 3IHBA 3G35A 3ZG7B 5DF7A 1NZOA 3GR2A 4IEDA 1JWPA 2HP5A 2EX9A 1YLTA 3HUOA 1ONGA 2G2UA 4LV0A 1GCEA 1PI4A 5A92A 4OQIA 3OZHA 2XR0A 4QY6A 4IVIA 1N4OA 2WKHA 4OOLA 4WMCD 1Q2QA 4S2JA 1I5QA 3P98A 1BLPA 1WYBA 2J9OA 1K54C 2Y2JA 3HUMA 3W4PA 5D3OA 4ZJ3A 1JTDA 1RGYA 4PM7A 2X01A 3G32A 1MWSA 2X02A 3O3VA 1RGZA 4WEKA 1MPLA 2IWDA 2WGWA 4PM5A 1CEGA 4P87A 3DWKA 3NI9A 3QNBA 2XDMA 4UA7A 1LI0A 3FKVA 1TDGA 3BFDA 2H10A 2DNSA 4GZBA 3SS4A 4KENB 3UPPA 5CGXA 3A3IA 3WS0A 4WELA 2RCXA 1EWZA 5TFQA 5AQAA 3UPOA 2XH9A 5KSHA 2ZM0A 5BOHA 3BFEA 4FCFA 1BLHA 4EWFA 1BT5A 1H5XA 1W7FA 2ZD8A 4HEFA 3SS3A 1RP5A 3FKWA 4N9LA 5E2FA 5AQBA 1K56D 3QNCA 3P09A 1BULA 5CRFA 3ZG9B 2PBYA 3BLSA 1GHMA 4N1HA 4WZ4A 5EOOA 5FATA 1LHYA 5HAPA 5F1GA 5G18A 1GA9A 4OQGA 3ZHHA 4BJPA 3HVFA 2Y2OA 4X69A 1G68A 2I72A 4X6TA 3C4PA 3IXDA 4JF5A 1YT4A 3O87A 3GV9A 5CXWA 1ALQA 2Z2LB 4KG6A 4KQRA 1MWUA 4R4RA 3N6IA 1PWCA 4MBFA 3WS5A 4R3BA 4EUZA 4WM9A 4YFMA 2C5WB 4DXCA 1IEMA 2WGWB 5FAOA 4BQMA 1N9BA 1ES5A 1SDNA 1YQSA 2HDSA 4EBPA 3SS5A 3NY4A 1K6SA 3IH8A 1K38A 2WZZA 1ES4A 1K57C 5FQ9A 3M2KA 2WK0A 1HVBA 2WUQA 2Y59A 3UDIA 4LCMA 1QMEA 1E25A 3VMAA 5M19A 5FQMA 1IYOA 1KGEA 3AGDA 3DTMA 2Y2NA 3NCKA 4B4XA 2Y2KA 4DE1A 3RXXA 4ZBEA 1FSWA 4KZ8A 1PW1A 3FYZA 1SKFA 2QZ6A 5EVIC 2BLSA 2JBFA 4JLFA 5FQJA 5FAPA 1CEFA 4LCLA 4F94A 2ZQ8A 2FFFB 4LV1A 1FCNA 3PBNA 4GDBA 4BD0A 3PAEA 1TDLA 2EXAA 1SDEA 3C7UA 3FWLA 1WYCA 3W4QA 3BEBA 3FV7A 3Q81A 3GMWA 4JBFA 4MLLA 2PU4A 1IYPA 1E4DA 4OPQA 2WKEA 4DXBA 3EQVA 3WS1A 5KZHA 3OCLA 2ZC6B 2EFXA 2HDRA 3G34A 1FR1A 4GDNA 3UE3A 2J7VA 3UO9A 5CHJA 1S0WA 3N7WA 3ZG8B 3S4XA 2ZLYA 5FQQA 4ID4A 1MY8A 4BENA 1LLBA 1DY6A 2Y4AA 5CEDA 4UHUA 4N1XA 1SHVA 4RYEA 3UDFA 4K0WA 4D2OA 3C5AA 5FI7A 4PM9A 3V5MA 4S2IA 4GNUA 4E3JA 5HW3A 1GA0A 1MBLA 4IBXA 4RVAA 4FH4A 2JE5A 2XFTA 3IF6B 3VSLA 1YLPA 4X56A 5GL9A 1VM1A 3HLWA 4ZJ1A 1MKIA 3IHAA 4S2MA 5FA7A 5E2HA 1YLZA 3ZG0A 2ZQCA 4GKUA 4N92A 2Z2MB 3IH9A 3ZCZA 1MWRA 1KDWA 4B88A 3ZVWA 5U47A 1IKGA 3A3FA 3A3DA 4LENA 1ERMA 3EQUA 1PZOA 1PYYA 3Q1FA 3VOYA 2DCFA 4NETA 3VFFA 4P85A 1S6RA 4KZ9A 3G30A 5DF9A 5GHXA 1FQGA 1TEMA 3LCEA 4Y0UA 5HL1A 2B5RA 4KZ6A 3JYIA 3W4OA 4WZ5A 2ZQDA 1FOFA 5CTMA 5CECA 1ZG6A 3NC8A 1YMXA 3I7JA 4Y7PA 5GHYA 1XXMA 1W8QA 4DKIA 1YM1A 3DW0A 4WYYA 2ZC4B 1BSGA 5DTKA 4OQ0A 1W79A 2HPBA 1YLYA 3VP2A 1C3BA 2A49A 1JTGA 4S2NC 1WE4A 2WYXA 3MKEA 5FI2A 1HD8A 2XK1A 2Q9NA 2ZC3B 3VSKA 4MBKA 4R0QA 4E3NA 3AGEA 2XF3A 3UPNA 4KQOA 3QHYA 1QMFA 3VP4A 5DVAA 1CK3A 4PMAA 1PW8A 3PTEA 4E3KA 1NYMA 4R1GA 2EX2A 3Q7VA 4BLMA 1W8YA 1FCMA 4ZTKA 3IT9A 1PWDA 3MZFA 1FSYA 2C6WB 2OLUA 1L0GA 2E8IA 3IXHA 4MBHA 5HAIA 4IBRA 4OPYA 5GLAA 1ZKJA 2VGJA 3HLGA 3ZNYA 4E3IA 2BG1A 4IVKA 5CGWA 4OLDA 1K4FA 3V50A 3BYDA 1KE4A 3Q7ZA 3ZVTA 2HDUA 4JXVA 4KZ4A 3CG5A 5I94A 1M40A 1PWGA 4WBGA 1ES2A 5A90A 2V1ZA 3V39A 2HP9A 4S2LA 3OCNA 4U0XA 5J8XA 3HLEA 4RX2A 1DJCA 4Y0OA 3SH8A 4C3QA 3PBOA 3WRTA 4U3TA 1L0EA 4PM6A 4X53A 1IYQA 4HESA 1Q2PA 2EX6A 1XA7A 5GHZA 3W8KA 1BZAA 3A3EA 1KGGA 2RL3A 3IF6A 3Q82A 5E2GA 4K0XA 5FSRA 3IF5A 3TOIA 4UA6A 5HFOA 4DRTA 4DF6A 2PU2A 1K6RA 1LL5A 2XGNA 2J9PA 5IHVA 5CERA 2Y2PA 4P6BA 1PIOA 3NDGA 4UA9A 3PBTA 1IYSA 3Q7VB 2Y55A 4DE3A 2UWXA 1XKZA 3BRMA 5F83A 1K55C 4KG5A 5EVIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4F A;  4KZ5 A;  3BM6 A;  4QHC A;  5KMW A;  1LI9 A;  2P74 A;  2Q9M A;  1ZG4 A;  5CGS A;  4X55 A;  3WWX A;  4Q8I A;  3UNW A;  2QPN A;  1AXB A;  1K54 A;  5CHM A;  1ERQ A;  3M6H A;  3E2K A;  1K25 A;  5GLD A;  4HBU A;  3LY3 A;  2P9V A;  2JCH A;  5A91 A;  3HLF A;  1JVJ A;  2ZMA A;  1I2W A;  3ZNT A;  4BL3 A;  2R9X A;  4PM8 A;  4LV3 A;  5TR7 A;  1NY0 A;  2WAD A;  1XGI A;  3OPP A;  1E3U A;  1NYY A;  3MZD A;  3UE1 A;  2V20 A;  3N8R A;  3N4I A;  1BUE A;  3LY4 A;  1G6A A;  1O7E A;  4RX3 A;  1Z6F A;  2G2W A;  1EI5 A;  1O07 A;  4L0L A;  4E3M A;  1Y54 A;  1KE3 A;  4KZB A;  5M1A A;  1GHP A;  4Z9Q A;  1XPB A;  1JWZ A;  3BFF A;  4Y0T A;  2WKI A;  4K91 A;  2H5S A;  4EBN A;  4FSF A;  4GN2 A;  3TG9 A;  5EOE A;  2WAE A;  4CJN A;  1BLC A;  5FI6 A;  1ZC2 A;  2HDQ A;  3MBZ A;  3HRE A;  3MZE A;  3O88 A;  4H8R A;  4DE2 A;  5DTS A;  3A3J A;  1NRF A;  1HZO A;  2CC1 A;  5EE8 A;  3VP3 A;  3M2J A;  5FDH A;  4BL2 A;  2JC7 A;  3GTC A;  3WRZ A;  2Y2I A;  3N8L A;  1CI8 A;  4A5R A;  5EEC A;  4GD6 A;  5KSC A;  4ZDX A;  1DJB A;  3HUN A;  4OPR A;  5EVL A;  5GLB A;  3VOZ A;  3ZFZ A;  3RXW A;  1BLS A;  1M6K A;  5M18 A;  2GDN A;  4U0T A;  1CI9 A;  4FH2 A;  2P9V B;  4QJG A;  4EQI A;  4EV4 A;  1XA1 A;  2Y2G A;  2Y2L A;  1IKI A;  4R4S A;  1GHI A;  4XUX A;  4R3J A;  4DDS A;  1XGJ A;  4S2K A;  1L2S A;  3IWO A;  5AQ9 A;  1NJ4 A;  1NXY A;  4S2P A;  4C75 A;  3G4P A;  2EFU A;  1K57 A;  1HTZ A;  4OKP A;  3PAG A;  4CPK A;  3PBS A;  1IEL A;  3HLB A;  4PPR A;  5HX9 A;  3GSG A;  1L0D A;  4KG2 A;  4HBT A;  2WGI A;  1KE0 A;  3HL9 A;  3LO7 A;  3CMZ A;  1XP4 A;  1LL9 A;  4O7D A;  2OV5 A;  4E6W A;  2ZM8 A;  3ISG A;  4JPM A;  3V3S A;  4DDY A;  3VP0 A;  3ITB A;  3BLM A;  1K56 A;  3O86 A;  4JF6 A;  4JXS A;  3G31 A;  5EVI A;  3V3R A;  2H0T A;  5F82 A;  3SH9 A;  1J9M A;  4JXW A;  4OP8 A;  1KVM A;  2EX8 A;  4E3L A;  2Y2Q A;  4GB7 A;  5L2F A;  4KQQ A;  3Q07 A;  1YLJ A;  2WZX A;  3S1Y A;  1VQQ A;  2J8Y A;  2DRW A;  5EVI D;  4JXG A;  1K55 A;  1TVF A;  4MNR A;  2IWB A;  5TGF A;  1ONH A;  4S2O A;  3NIA A;  3UDX A;  4BD1 A;  2A3U A;  5DTT A;  5JYP A;  1H8Z A;  3GVB A;  4KZ7 A;  2OLV A;  4WEJ A;  4KZA A;  2FFY A;  2H0Y A;  3PBQ A;  1XX2 A;  3UN7 A;  2VGK A;  3NDE A;  4OON A;  3MKF A;  5DF8 A;  4XXR A;  3HLD A;  2Y2M A;  2XFS A;  3OPL A;  3WS2 A;  1OME A;  4OLG A;  3SH7 A;  3TSG A;  2IWC A;  3IWI A;  2ZQ7 A;  4QY5 A;  4XUZ A;  5EPH A;  5HAR A;  3IXG A;  1SCW A;  2WAF A;  2XEP A;  2ZQ9 A;  4MEZ A;  4N9K A;  4OOY A;  4UAA A;  4WZ5 C;  3VP1 A;  3WS4 A;  2ZM2 A;  4M3K A;  1YMS A;  2R9W A;  2Y91 A;  4ZAM A;  2Y2H A;  3CZD A;  3MXR A;  4DE0 A;  3OPR A;  4FD8 A;  2HP6 A;  3VFH A;  3BFG A;  1U60 A;  1JWV A;  4OPZ A;  2EXB A;  4NK3 A;  1L0F A;  5FQK A;  4OH0 A;  5JYO A;  1MXO A;  4QD4 A;  5FAQ A;  3LEZ A;  3SOI A;  1I2S A;  3DWZ A;  3G2Z A;  4JF4 A;  4OOM A;  1RCJ A;  4GD8 A;  2WGV A;  3M6B A;  1KDS A;  4ZJ2 A;  4E6X A;  1K4E A;  1PZP A;  3IQA A;  1MWT A;  4QU3 A;  4LV2 A;  5CHU A;  3C4O A;  3BFC A;  5HAQ A;  2ZC5 B;  4KZ3 A;  2XD1 A;  5E2E A;  2XLN A;  4OQH A;  3MXS A;  2XD5 A;  2QMI A;  3C7V A;  3HBR A;  3ZGA B;  3MFD A;  3E2L A;  3IWQ A;  1PI5 A;  3FZC A;  3GRJ A;  3PBR A;  2ZC7 A;  3AGF A;  4X68 A;  4E3O A;  4R23 A;  4JKT A;  4C6Y A;  1KGF A;  3CJM A;  5CEB A;  3ZG5 A;  1H8Y A;  5A93 A;  1ESU A;  2X71 A;  5F1F A;  2V2F F;  4QB8 A;  1E3U D;  3HLC A;  3ZDJ A;  3UE0 A;  3S22 A;  3UY6 A;  1ES3 A;  5GLC A;  4S2N A;  3OPH A;  5EUA A;  2ZJ9 A;  4GOG A;  2OSU A;  1YLW A;  4OVD A;  2XQZ A;  1FCO A;  3N8S A;  4OP5 A;  3IF6 C;  4RA7 A;  4B4Z A;  5AQ7 A;  3RJU A;  3G2Y A;  3GQZ A;  5CTN A;  1FR6 A;  1NZU A;  4P0M A;  1W5D A;  3OC2 A;  2ZQA A;  4YIN A;  5E43 A;  5FQI A;  3ITA A;  1BTL A;  3IXB A;  1KVL A;  4EBL A;  1DJA A;  1ESI A;  3NBL A;  3BEC A;  5FAS A;  1ERO A;  4WMC A;  3B3X A;  3IHB A;  3G35 A;  3ZG7 B;  5DF7 A;  1NZO A;  3GR2 A;  4IED A;  1JWP A;  2HP5 A;  2EX9 A;  1YLT A;  3HUO A;  1ONG A;  2G2U A;  4LV0 A;  1GCE A;  1PI4 A;  5A92 A;  4OQI A;  3OZH A;  2XR0 A;  4QY6 A;  4IVI A;  1N4O A;  2WKH A;  4OOL A;  4WMC D;  1Q2Q A;  4S2J A;  1I5Q A;  3P98 A;  1BLP A;  1WYB A;  2J9O A;  1K54 C;  2Y2J A;  3HUM A;  3W4P A;  5D3O A;  4ZJ3 A;  1JTD A;  1RGY A;  4PM7 A;  2X01 A;  3G32 A;  1MWS A;  2X02 A;  3O3V A;  1RGZ A;  4WEK A;  1MPL A;  2IWD A;  2WGW A;  4PM5 A;  1CEG A;  4P87 A;  3DWK A;  3NI9 A;  3QNB A;  2XDM A;  4UA7 A;  1LI0 A;  3FKV A;  1TDG A;  3BFD A;  2H10 A;  2DNS A;  4GZB A;  3SS4 A;  4KEN B;  3UPP A;  5CGX A;  3A3I A;  3WS0 A;  4WEL A;  2RCX A;  1EWZ A;  5TFQ A;  5AQA A;  3UPO A;  2XH9 A;  5KSH A;  2ZM0 A;  5BOH A;  3BFE A;  4FCF A;  1BLH A;  4EWF A;  1BT5 A;  1H5X A;  1W7F A;  2ZD8 A;  4HEF A;  3SS3 A;  1RP5 A;  3FKW A;  4N9L A;  5E2F A;  5AQB A;  1K56 D;  3QNC A;  3P09 A;  1BUL A;  5CRF A;  3ZG9 B;  2PBY A;  3BLS A;  1GHM A;  4N1H A;  4WZ4 A;  5EOO A;  5FAT A;  1LHY A;  5HAP A;  5F1G A;  5G18 A;  1GA9 A;  4OQG A;  3ZHH A;  4BJP A;  3HVF A;  2Y2O A;  4X69 A;  1G68 A;  2I72 A;  4X6T A;  3C4P A;  3IXD A;  4JF5 A;  1YT4 A;  3O87 A;  3GV9 A;  5CXW A;  1ALQ A;  2Z2L B;  4KG6 A;  4KQR A;  1MWU A;  4R4R A;  3N6I A;  1PWC A;  4MBF A;  3WS5 A;  4R3B A;  4EUZ A;  4WM9 A;  4YFM A;  2C5W B;  4DXC A;  1IEM A;  2WGW B;  5FAO A;  4BQM A;  1N9B A;  1ES5 A;  1SDN A;  1YQS A;  2HDS A;  4EBP A;  3SS5 A;  3NY4 A;  1K6S A;  3IH8 A;  1K38 A;  2WZZ A;  1ES4 A;  1K57 C;  5FQ9 A;  3M2K A;  2WK0 A;  1HVB A;  2WUQ A;  2Y59 A;  3UDI A;  4LCM A;  1QME A;  1E25 A;  3VMA A;  5M19 A;  5FQM A;  1IYO A;  1KGE A;  3AGD A;  3DTM A;  2Y2N A;  3NCK A;  4B4X A;  2Y2K A;  4DE1 A;  3RXX A;  4ZBE A;  1FSW A;  4KZ8 A;  1PW1 A;  3FYZ A;  1SKF A;  2QZ6 A;  5EVI C;  2BLS A;  2JBF A;  4JLF A;  5FQJ A;  5FAP A;  1CEF A;  4LCL A;  4F94 A;  2ZQ8 A;  2FFF B;  4LV1 A;  1FCN A;  3PBN A;  4GDB A;  4BD0 A;  3PAE A;  1TDL A;  2EXA A;  1SDE A;  3C7U A;  3FWL A;  1WYC A;  3W4Q A;  3BEB A;  3FV7 A;  3Q81 A;  3GMW A;  4JBF A;  4MLL A;  2PU4 A;  1IYP A;  1E4D A;  4OPQ A;  2WKE A;  4DXB A;  3EQV A;  3WS1 A;  5KZH A;  3OCL A;  2ZC6 B;  2EFX A;  2HDR A;  3G34 A;  1FR1 A;  4GDN A;  3UE3 A;  2J7V A;  3UO9 A;  5CHJ A;  1S0W A;  3N7W A;  3ZG8 B;  3S4X A;  2ZLY A;  5FQQ A;  4ID4 A;  1MY8 A;  4BEN A;  1LLB A;  1DY6 A;  2Y4A A;  5CED A;  4UHU A;  4N1X A;  1SHV A;  4RYE A;  3UDF A;  4K0W A;  4D2O A;  3C5A A;  5FI7 A;  4PM9 A;  3V5M A;  4S2I A;  4GNU A;  4E3J A;  5HW3 A;  1GA0 A;  1MBL A;  4IBX A;  4RVA A;  4FH4 A;  2JE5 A;  2XFT A;  3IF6 B;  3VSL A;  1YLP A;  4X56 A;  5GL9 A;  1VM1 A;  3HLW A;  4ZJ1 A;  1MKI A;  3IHA A;  4S2M A;  5FA7 A;  5E2H A;  1YLZ A;  3ZG0 A;  2ZQC A;  4GKU A;  4N92 A;  2Z2M B;  3IH9 A;  3ZCZ A;  1MWR A;  1KDW A;  4B88 A;  3ZVW A;  5U47 A;  1IKG A;  3A3F A;  3A3D A;  4LEN A;  1ERM A;  3EQU A;  1PZO A;  1PYY A;  3Q1F A;  3VOY A;  2DCF A;  4NET A;  3VFF A;  4P85 A;  1S6R A;  4KZ9 A;  3G30 A;  5DF9 A;  5GHX A;  1FQG A;  1TEM A;  3LCE A;  4Y0U A;  5HL1 A;  2B5R A;  4KZ6 A;  3JYI A;  3W4O A;  4WZ5 A;  2ZQD A;  1FOF A;  5CTM A;  5CEC A;  1ZG6 A;  3NC8 A;  1YMX A;  3I7J A;  4Y7P A;  5GHY A;  1XXM A;  1W8Q A;  4DKI A;  1YM1 A;  3DW0 A;  4WYY A;  2ZC4 B;  1BSG A;  5DTK A;  4OQ0 A;  1W79 A;  2HPB A;  1YLY A;  3VP2 A;  1C3B A;  2A49 A;  1JTG A;  4S2N C;  1WE4 A;  2WYX A;  3MKE A;  5FI2 A;  1HD8 A;  2XK1 A;  2Q9N A;  2ZC3 B;  3VSK A;  4MBK A;  4R0Q A;  4E3N A;  3AGE A;  2XF3 A;  3UPN A;  4KQO A;  3QHY A;  1QMF A;  3VP4 A;  5DVA A;  1CK3 A;  4PMA A;  1PW8 A;  3PTE A;  4E3K A;  1NYM A;  4R1G A;  2EX2 A;  3Q7V A;  4BLM A;  1W8Y A;  1FCM A;  4ZTK A;  3IT9 A;  1PWD A;  3MZF A;  1FSY A;  2C6W B;  2OLU A;  1L0G A;  2E8I A;  3IXH A;  4MBH A;  5HAI A;  4IBR A;  4OPY A;  5GLA A;  1ZKJ A;  2VGJ A;  3HLG A;  3ZNY A;  4E3I A;  2BG1 A;  4IVK A;  5CGW A;  4OLD A;  1K4F A;  3V50 A;  3BYD A;  1KE4 A;  3Q7Z A;  3ZVT A;  2HDU A;  4JXV A;  4KZ4 A;  3CG5 A;  5I94 A;  1M40 A;  1PWG A;  4WBG A;  1ES2 A;  5A90 A;  2V1Z A;  3V39 A;  2HP9 A;  4S2L A;  3OCN A;  4U0X A;  5J8X A;  3HLE A;  4RX2 A;  1DJC A;  4Y0O A;  3SH8 A;  4C3Q A;  3PBO A;  3WRT A;  4U3T A;  1L0E A;  4PM6 A;  4X53 A;  1IYQ A;  4HES A;  1Q2P A;  2EX6 A;  1XA7 A;  5GHZ A;  3W8K A;  1BZA A;  3A3E A;  1KGG A;  2RL3 A;  3IF6 A;  3Q82 A;  5E2G A;  4K0X A;  5FSR A;  3IF5 A;  3TOI A;  4UA6 A;  5HFO A;  4DRT A;  4DF6 A;  2PU2 A;  1K6R A;  1LL5 A;  2XGN A;  2J9P A;  5IHV A;  5CER A;  2Y2P A;  4P6B A;  1PIO A;  3NDG A;  4UA9 A;  3PBT A;  1IYS A;  3Q7V B;  2Y55 A;  4DE3 A;  2UWX A;  1XKZ A;  3BRM A;  5F83 A;  1K55 C;  4KG5 A;  5EVI B; 
#chains in the Genus database with same CATH topology
 4KZ5 A;  3BM6 A;  5KMW A;  1LSX A;  4YNR A;  5L09 A;  3UMD A;  4IUH A;  1ERQ A;  4HBU A;  3BY8 A;  3LIB A;  3BQA A;  3ZNT A;  3F1N B;  3ZYT A;  4E04 A;  1XGI A;  3EEA A;  1F2K A;  3N4I A;  3LY4 A;  4G3K A;  1Y54 A;  1JWZ A;  4NG2 A;  5EOE A;  2WAE A;  4B9O A;  4CJN A;  3TW8 A;  2O0Y A;  3MZE A;  3ULF A;  3A3J A;  1NRF A;  3WRZ A;  3N8L A;  1IFQ A;  4A5R A;  4PHT A;  4ZDX A;  1DJB A;  2V9A A;  2VV6 A;  5EVL A;  3D72 A;  5M18 A;  1OT9 A;  4FUW A;  2PRF A;  2P9V B;  3MFX A;  5G4Z A;  2Q0O A;  4EQI A;  4EV4 A;  1F9I A;  4R4S A;  4XUX A;  4S2K A;  3IWO A;  4EU0 A;  5AQ9 A;  1NJ4 A;  3H7W B;  1K57 A;  4CPK A;  4I3I A;  3HLB A;  2L1M A;  5EM0 A;  3SZT A;  5HX9 A;  1UGU A;  2V8F A;  1XJ6 A;  4JGR A;  4KG2 A;  3HL9 A;  3LO7 A;  1XP4 A;  1LL9 A;  4BWI A;  4E6W A;  3LGO A;  2V0U A;  1S4R A;  4YOF A;  3V3S A;  1D7E A;  5DFX A;  1K56 A;  1MZU A;  3O86 A;  3V3R A;  3SH9 A;  4E3L A;  2ZL1 B;  3LFV A;  3S1Y A;  1NLY A;  1K55 A;  3DBA A;  3UDX A;  5TGF A;  2M7V A;  3H9W A;  2W3D A;  4WF0 A;  4F3L A;  2FFY A;  3ZQ5 A;  2Y2M A;  2YKF A;  2XFS A;  3WS2 A;  1OME A;  4OLG A;  2IWC A;  3F1O B;  2PYP A;  4WZ5 C;  1X0O A;  4HY8 A;  3E4O A;  2R9W A;  2HP6 A;  2LB5 A;  4OH0 A;  1CJF A;  3G2Z A;  4JF4 A;  1K4E A;  4JGQ A;  2W3G A;  3F1P B;  3LR4 A;  2J80 A;  4GS9 A;  1N9N A;  2XD1 A;  1SKO B;  2XLN A;  4OQH A;  2QMI A;  2QJ5 A;  3HBR A;  1OTB A;  3FZC A;  2VEA A;  4E3O A;  4R23 A;  1S4S A;  2X71 A;  5F1F A;  2BAS A;  3T4S A;  4QB8 A;  2V1A A;  3UE0 A;  5EUA A;  1YLW A;  1HLU P;  2J3W A;  3N8S A;  4RA7 A;  4B4Z A;  3KYZ A;  4LRX C;  2O9A A;  3GQZ A;  3KX0 X;  3BQ8 A;  1K0K A;  3OC2 A;  2ZQA A;  5E43 A;  2Z6C A;  3ITA A;  2M7U A;  1ESI A;  4G3V A;  3VE4 A;  3BEC A;  5F69 A;  4LRZ E;  2VA0 A;  3ZG7 B;  3G35 A;  5DF7 A;  1NZO A;  4IED A;  1JWP A;  2HP5 A;  2EX9 A;  1YLT A;  2G2U A;  1TS6 A;  2WKH A;  4WMC D;  1OTA A;  1I5Q A;  3P98 A;  1VHM A;  1JTD A;  1RGY A;  4I3A A;  2X02 A;  2HJE A;  1RGZ A;  3IBR A;  1OTE A;  3MQO A;  2KLI A;  3DWK A;  4UA7 A;  1LI0 A;  3R4K A;  2H10 A;  3NJA A;  3SS4 A;  2A24 A;  1EWZ A;  5KSH A;  4FCF A;  1BLH A;  3SS3 A;  3OBF A;  3FKW A;  1K56 D;  3CPT A;  3KSH A;  3GDI A;  1VEU B;  5HAP A;  5F1G A;  5G18 A;  2HF6 A;  3LIE A;  2HJ9 C;  4X6T A;  2I72 A;  3IXD A;  3O87 A;  5CXW A;  4H6J B;  2Z2L B;  4MDZ A;  1MWU A;  4R4R A;  3VV4 A;  1T18 A;  4II7 A;  4MBF A;  3JVV A;  2B18 A;  4WM9 A;  4YFM A;  4DXC A;  4BQM A;  3HCY A;  2HDS A;  3L7H A;  3SS5 A;  3NY4 A;  2D01 A;  4IJG A;  3D9Y A;  1K57 C;  3L9K A;  2Y59 A;  1E25 A;  2XSS A;  5FQM A;  2EWV A;  2J3T D;  1J3W A;  2BLS A;  4HP9 A;  5AJG A;  5FAP A;  5FL3 A;  2FFF B;  3PHY A;  3W4Q A;  4B93 A;  2PU4 A;  1IYP A;  2WKE A;  4DXB A;  5HL6 A;  3T4T A;  3E4P A;  1G5U A;  2WKR A;  2ZC6 B;  4GDN A;  3G34 A;  3N7W A;  3ZG8 B;  4PAU A;  1LLB A;  2QWS A;  5CED A;  4UHU A;  3UDF A;  4D2O A;  4R6L A;  4PM9 A;  3V5M A;  3MXQ A;  4CLC A;  1YLP A;  1VM1 A;  2O99 A;  3TJZ C;  3EGX C;  3EGD C;  3ZVW A;  1LL8 A;  3A3F A;  3EQU A;  4R70 A;  3Q1F A;  3U2A A;  2DCF A;  1P97 A;  2W27 A;  5TBM A;  4P85 A;  4GW9 A;  1FQG A;  1TEM A;  3W4O A;  5CTM A;  5CEC A;  1XXM A;  4DKI A;  1YM1 A;  3DW0 A;  4WYY A;  5DTK A;  2HPB A;  2A49 A;  3MKE A;  3VSK A;  4E3N A;  3UPN A;  3QHY A;  3VP4 A;  1XFQ A;  4MMN A;  5G4Y A;  1L3L A;  3Q7V A;  4ZTK A;  3MZF A;  2M1C A;  4YWZ A;  3UB7 A;  4HOI A;  4OPY A;  4E3I A;  2VGJ A;  2BG1 A;  2NUT C;  4Y15 A;  4KZ4 A;  3NHQ A;  1PWG A;  4WBG A;  4U0X A;  3TE8 A;  1DJC A;  3PBO A;  3WRT A;  4EER A;  4PM6 A;  1STZ A;  4GJ4 A;  2EX6 A;  3W8K A;  1BZA A;  1KGG A;  2RL3 A;  3SW1 A;  5E2G A;  1OJ5 A;  4UA6 A;  4DF6 A;  2PU2 A;  1K6R A;  1LL5 A;  2GNX A;  2J9P A;  5FEF A;  4UA9 A;  4LPZ A;  1DRM A;  3D4F A;  2ZBB A;  4QHC A;  2P74 A;  2Q9M A;  1ZG4 A;  3WWX A;  4NEE D;  3UNW A;  3E2K A;  1K25 A;  3K3C A;  5GLD A;  1NRJ A;  4EXO A;  4L9G A;  2QKP A;  3HLF A;  3QP2 A;  2K2N A;  4PM8 A;  4LV3 A;  3OPP A;  3MZD A;  3UE1 A;  3H82 B;  4KUO A;  4Q0I A;  4ME4 A;  1KE3 A;  5M1A A;  3QP5 A;  4Z9Q A;  1XPB A;  4Y0T A;  2WKI A;  4K91 A;  5L8M A;  4FSF A;  5HD3 A;  3LYX A;  5FI6 A;  4UQI M;  3MBZ A;  3HRE A;  3O88 A;  2V0W A;  4H8R A;  4ETZ A;  2KOI A;  4DE2 A;  5DTS A;  2HGV A;  1HZO A;  2CC1 A;  3VP3 A;  3HUN A;  5GLB A;  3VOZ A;  4GS9 B;  1CI9 A;  4ARZ A;  4EUV A;  2Y2L A;  3CHW P;  2Y8H A;  4G3W A;  4S2P A;  1LSV A;  4PPR A;  2WGI A;  3HJI A;  3P01 A;  4JPM A;  3ITB A;  3BLM A;  3ICY A;  1KVM A;  2W3H A;  4HQA A;  4CLC C;  4KQQ A;  3Q07 A;  2WZX A;  3CLO A;  1TVF A;  1ONH A;  4BD1 A;  4EW7 A;  5DTT A;  1H8Z A;  2OLV A;  4KZA A;  2H0Y A;  3MKF A;  5IU1 A;  3UE6 A;  3OPL A;  3SH7 A;  2ZQ7 A;  4QY5 A;  4XUZ A;  5EPH A;  2WAF A;  2XEP A;  4OOY A;  4I3J A;  1YMS A;  3UB5 P;  2Y91 A;  3EWK A;  2NUP C;  3CZD A;  3UME A;  3MXR A;  4FD8 A;  3BFG A;  5EM1 A;  2EXB A;  1UWP X;  1A0K A;  3M6B A;  3MJQ A;  3IQA A;  4XT2 B;  1TS0 A;  1S67 L;  2ZC5 B;  4KZ3 A;  3EEH A;  4L9E A;  5A8B A;  3CPT B;  2XD5 A;  3KSI A;  3C7V A;  4QWO A;  3G6O A;  4JKT A;  1YSP A;  1KGF A;  5CEB A;  1P9W A;  3LR3 A;  1WA9 A;  4O8G A;  5KIZ A;  3HLC A;  3IX4 A;  3S22 A;  3UY6 A;  4S2N A;  3IX8 A;  3OPH A;  2ZJ9 A;  2OSU A;  1FCO A;  4LLO B;  3RJU A;  4P6Z S;  3FG8 A;  5CTN A;  1FR6 A;  1TD5 A;  4P0M A;  4YIN A;  3IXB A;  1KVL A;  1ERO A;  4WMC A;  3B3X A;  3NOU C;  3GR2 A;  4LV0 A;  5A92 A;  3OZH A;  1Q2Q A;  4S2J A;  3W4P A;  3R7W A;  4DJ3 A;  1MWS A;  1H8M A;  3O3V A;  2WGW A;  4PM5 A;  2XDM A;  3UPP A;  5CGX A;  4WEL A;  5AQA A;  3UPO A;  5BOH A;  4EWF A;  1W7F A;  2ZD8 A;  1RP5 A;  4N9L A;  5AQB A;  3B33 A;  1BUL A;  2PBY A;  2WKP A;  1GHM A;  4CLC B;  4WZ4 A;  3QP4 A;  5EOO A;  1OTI A;  1GA9 A;  4OQG A;  4BJP A;  3HVF A;  2Y2O A;  1ZTU A;  3BWL A;  1YAX A;  3GV9 A;  1YPR A;  2D02 A;  4KQR A;  3N6I A;  2V8C A;  2XA7 S;  4Y13 A;  2C5W B;  5FAO A;  1SDN A;  3E98 A;  3IH8 A;  1K38 A;  2WZZ A;  1ES4 A;  4Y3I A;  2WKQ A;  2VV7 A;  4NXB A;  4LGW A;  4PKY A;  1KGE A;  4BMW A;  2Y2N A;  3RXX A;  3IS2 A;  1FSW A;  4KZ8 A;  1PW1 A;  3E4Q A;  3FYZ A;  1CEF A;  2O9B A;  4LV1 A;  3PBN A;  4GDB A;  2PBD P;  3FPV A;  1T1C A;  3PAE A;  2EXA A;  3C7U A;  3T50 A;  2ZMF A;  3GMW A;  2JKT M;  4OPQ A;  3MMH A;  5FEG A;  3WS1 A;  1OT6 A;  2VK3 A;  4EET B;  1S0W A;  5F5Y A;  3DTI A;  4BEN A;  1MY8 A;  4RYE A;  3C5A A;  2JKT I;  5HWW A;  1VET B;  4GNU A;  5HW3 A;  4IBX A;  4RVA A;  4KUK A;  4FH4 A;  1FIK A;  5GL9 A;  4Y17 A;  5FA7 A;  4BBT A;  2PT7 A;  2Z2M B;  1S1Y A;  1V9Z A;  4B88 A;  5DKL A;  2INW A;  1ERM A;  4NET A;  3VFF A;  3CUE A;  2OAP 1;  3LCE A;  3JYI A;  2QHK A;  1YMX A;  3I7J A;  4OQ0 A;  3VP2 A;  1GSX A;  4S2N C;  5FI2 A;  1HD8 A;  4R0Q A;  3AGE A;  1GSW A;  1QMF A;  4PMA A;  4E3K A;  1NYM A;  3NEC A;  4R1G A;  4BLM A;  1FCM A;  1P0Z A;  3V67 A;  2C6W B;  1ZHH B;  2E8I A;  5HAI A;  1ZKJ A;  3HLG A;  4OLD A;  1K4F A;  4JXV A;  3CG5 A;  5I94 A;  1M40 A;  4FTX A;  2V1Z A;  4S2L A;  3LR5 A;  3PYP A;  5F68 A;  4RX2 A;  4Y0O A;  4ARZ B;  3JVU A;  4C3Q A;  5IT5 A;  3GEC A;  4X53 A;  1IYQ A;  1Q2P A;  5GHZ A;  3IF6 A;  2B02 A;  1H0M A;  1UWN X;  5HFO A;  1CF0 A;  1S1Z A;  4P6B A;  1PIO A;  1CQA A;  1XFN A;  1N9L A;  3PBT A;  2Y55 A;  5F6A A;  2UWX A;  5F83 A;  2V1B A;  1K55 C;  3VOL A;  1XJ2 A;  4X55 A;  4Q8I A;  1SZV A;  1AXB A;  4CLC E;  2P9V A;  5A91 A;  2I9V A;  2ZMA A;  1I2W A;  2R9X A;  1NY0 A;  2WAD A;  2EA9 A;  2MJ6 A;  4HHD A;  1NYY A;  2V20 A;  2LB9 A;  3N8R A;  2W1T A;  1G6A A;  3H7W A;  1Z6F A;  2G2W A;  4KZB A;  4QPR A;  5HD5 A;  4GN2 A;  2J3T C;  4X1L A;  3DAV A;  3LI9 A;  3LI8 A;  5EE8 A;  5EFW A;  1TF1 A;  2JC7 A;  5HPI A;  5KSC A;  5EEC A;  3LR0 A;  4OPR A;  3ZFZ A;  1BLS A;  4U0T A;  4FH2 A;  1YSQ A;  1AWI A;  4BBV A;  4X25 A;  1H3Q A;  1L2S A;  3K3D A;  3DTK A;  3G4P A;  4OKP A;  1IEL A;  3GSG A;  1L0D A;  4NXG A;  4MN7 A;  3IX3 A;  2Y79 A;  4DJ2 A;  1PRQ A;  4O7D A;  3ISG A;  5EVE A;  3A0R A;  4DDY A;  3VP0 A;  3G31 A;  4NKP A;  3B47 A;  4Q0H A;  4GB7 A;  5L2F A;  1YLJ A;  2IA2 A;  3F1P A;  2DRW A;  5EVI D;  4JXG A;  3UB6 A;  1SKO A;  2IWB A;  2VZW A;  4S2O A;  3NIA A;  5JYP A;  4WEJ A;  4GHI A;  3QP1 A;  3JPU A;  5HWV A;  1P9R A;  4OON A;  4WUJ A;  5DF8 A;  4XXR A;  3HLD A;  3CUE C;  2P7J A;  3IWI A;  2ACG A;  3IXG A;  2JN7 A;  4MEZ A;  3WS4 A;  5HDC A;  2ZOI A;  2Y2H A;  1VB6 A;  3S7P A;  3VFH A;  1U60 A;  5CX7 A;  4NK3 A;  5FQK A;  2PDR A;  2R78 A;  1MXO A;  3LEZ A;  3SOI A;  4WN5 A;  1RCJ A;  2KX6 A;  4GD8 A;  2WGV A;  4ZJ2 A;  4QU3 A;  3C4O A;  3BFC A;  5HAQ A;  5E2E A;  3MXS A;  1XJ4 A;  3ZGA B;  3MFD A;  3E2L A;  3IWQ A;  4F3L B;  1PI5 A;  2KDK A;  3PBR A;  2ZC7 A;  3LIC A;  3CJM A;  2K31 A;  3ZG5 A;  1H8Y A;  4LRY C;  1ESU A;  3U4L P;  2V2F F;  2PYR A;  1FIL A;  3O5Y A;  5DFY A;  3TRC A;  3RFB A;  4GOG A;  1GSV A;  1G28 A;  4OP5 A;  3IF6 C;  5AQ7 A;  3G2Y A;  1NZU A;  3KYE A;  1W5D A;  5FQI A;  1BTL A;  1DJA A;  3NBL A;  1OPX A;  5HZH A;  1NLZ A;  3IHB A;  1VEU A;  5DJU A;  3HUO A;  1ONG A;  3LID A;  5TJJ A;  1DP6 A;  4HNB A;  4OQI A;  4QY6 A;  2XR0 A;  4OOL A;  2UV0 E;  4PKY G;  4H6J A;  1WYB A;  2J9O A;  2Y2J A;  3HUM A;  1N9O A;  5FDS A;  4PM7 A;  1V9Y A;  2JKR M;  3G32 A;  3LIF A;  2X01 A;  4KQD A;  2IWD A;  4R3A A;  1CEG A;  4P87 A;  3NI9 A;  3KO6 A;  3QNB A;  3OOV A;  5L10 A;  2DNS A;  3CAX A;  4KEN B;  2HZ5 A;  2RCX A;  2XH9 A;  1ODV A;  3T12 B;  2JKR I;  1BT5 A;  1MC0 A;  5E2F A;  5J7E A;  3ZG9 B;  4BBU A;  4EEP A;  3BLS A;  4N1H A;  5FAT A;  3CI6 A;  4X69 A;  1G68 A;  2VKS A;  3C4P A;  4JF5 A;  2PHY A;  1ALQ A;  2XRN A;  4KG6 A;  3VE3 A;  3WS5 A;  4EUZ A;  1ACF A;  3UB8 A;  1N9B A;  1ES5 A;  1D06 A;  4P6Z M;  3NOT C;  3M2K A;  2WK0 A;  2WUQ A;  5IS1 A;  3UDI A;  2A24 B;  5M19 A;  5HWT A;  2PR6 A;  1IYO A;  3DTM A;  3NCK A;  4B4X A;  2W3F A;  4DE1 A;  4ZBE A;  2Z6D A;  1DP9 A;  2O9C A;  1SKF A;  4JLF A;  1Y4O A;  4LCL A;  2GZA A;  1FCN A;  5J4E A;  1TDL A;  2VGL S;  3T1R A;  1PFL A;  3FWL A;  3BEB A;  3MF0 A;  2G7U A;  3FV7 A;  2P04 A;  3Q81 A;  3T4J A;  1D1J A;  4HJ4 A;  4O0P A;  4EES A;  1XJ3 A;  3OCL A;  1W63 Q;  2J7V A;  3T1S A;  5EV0 A;  3LUQ A;  5CHJ A;  5FQQ A;  2E8J A;  3C30 A;  1DY6 A;  4N1X A;  1SHV A;  4K0W A;  4NXF A;  4E3J A;  1GA0 A;  1MBL A;  1EW0 A;  3IF6 B;  4JGO A;  1MKI A;  3MQQ A;  4GKU A;  3BJN A;  4N92 A;  3ZCZ A;  1MWR A;  1KDW A;  2OAQ 1;  1LT0 A;  5U47 A;  3A3D A;  2XA7 M;  1PYY A;  5HDS A;  1S6R A;  4Y2F A;  4KZ9 A;  5GHX A;  5HL1 A;  5I5L A;  1Z09 A;  5GHY A;  1OJG A;  3CWF A;  2ZC4 B;  1YLY A;  1C3B A;  1JTG A;  1WE4 A;  2W1T B;  2WYX A;  2VJW A;  2Q9N A;  4MBK A;  4KQO A;  3C8C A;  3T4L A;  1PW8 A;  4I39 A;  2W1R A;  2EX2 A;  3KYQ A;  4D60 A;  3IT9 A;  2OOL A;  2H28 A;  1FSY A;  5DJT A;  1L0G A;  4IBR A;  2YKH A;  3V50 A;  3BYD A;  1KE4 A;  3Q7Z A;  5TBM B;  4HJ3 A;  3T1X A;  4Q0J A;  3P7N A;  2HP9 A;  1T19 A;  3HLE A;  2PD7 A;  2CMN A;  3H82 A;  4ZRR A;  4U3T A;  1L0E A;  4HES A;  1XA7 A;  3Q82 A;  5FSR A;  4K0X A;  3T1Q B;  3IF5 A;  2XGN A;  3FPW A;  4UEY A;  5IHV A;  3NDG A;  1IYS A;  3Q7V B;  2FH5 A;  4DE3 A;  1XKZ A;  1IOU A;  4KG5 A;  1LI9 A;  5CGS A;  2QPN A;  1K54 A;  5CHM A;  3M6H A;  4EEU A;  4GLQ A;  3LY3 A;  2JCH A;  1JVJ A;  1Y28 A;  3DTE A;  4BL3 A;  4GHI B;  5TR7 A;  1E3U A;  5HPF A;  2ZMV A;  4HJ6 A;  1BUE A;  4HH3 A;  1O7E A;  4RX3 A;  1EI5 A;  1O07 A;  4L0L A;  4E3M A;  3C2W A;  1GHP A;  3BFF A;  4EBN A;  2H5S A;  3TG9 A;  3KSG A;  4CQH A;  1BLC A;  1F5M A;  1ZC2 A;  5DKK A;  2HDQ A;  5HSQ A;  3M2J A;  5FDH A;  3UB9 A;  4BL2 A;  3GTC A;  2Y2I A;  1CI8 A;  4GD6 A;  3RXW A;  1M6K A;  3MS6 A;  1YKD A;  2GDN A;  4FOF A;  3D3O A;  2JKG A;  4QJG A;  1XA1 A;  2Y2G A;  3RTY A;  1IKI A;  1GHI A;  4R3J A;  4DDS A;  1XGJ A;  2VLG A;  4DMZ A;  1NXY A;  5L07 A;  4C75 A;  2EFU A;  1HTZ A;  3PAG A;  3PBS A;  2L4R A;  2K7S A;  5HDD A;  4HBT A;  4HI4 A;  1KE0 A;  4MCW A;  3CMZ A;  2OV5 A;  4M4X A;  3BY9 A;  2ZM8 A;  4EQ1 A;  4JF6 A;  4JXS A;  5EVI A;  2H0T A;  5F82 A;  1J9M A;  4JXW A;  4OP8 A;  2EX8 A;  2Y2Q A;  4XT2 A;  2AVX A;  2B95 A;  4MN6 A;  2DMW A;  1VQQ A;  2J8Y A;  2BTF P;  4MNR A;  2A3U A;  3F1N A;  1JNU A;  3GVB A;  4KZ7 A;  3PBQ A;  1XX2 A;  3UN7 A;  2VGK A;  3NDE A;  4Y5F A;  3IBJ A;  3TSG A;  5HAR A;  4ESP A;  1SCW A;  4UAA A;  2ZQ9 A;  4GCZ A;  4N9K A;  3VP1 A;  4AFI A;  2ZM2 A;  4M3K A;  4ZAM A;  4DE0 A;  3OPR A;  3MQ0 A;  4LFU A;  3S7O A;  1JWV A;  4OPZ A;  1L0F A;  3RH8 B;  5JYO A;  4QD4 A;  5FAQ A;  1I2S A;  3DWZ A;  4OOM A;  1KDS A;  4E6X A;  1PZP A;  1MWT A;  4LV2 A;  5CHU A;  2OWH A;  3B42 A;  3GRJ A;  3AGF A;  4X68 A;  4C6Y A;  2QYB A;  5A93 A;  2XRO A;  3QP6 A;  4HH2 A;  1E3U D;  3ZDJ A;  4IHQ A;  1ES3 A;  5GLC A;  4K08 A;  1MKM A;  3MR0 A;  4OVD A;  2XQZ A;  4R38 A;  4HP4 A;  2ZL1 A;  4ETX A;  5AVF A;  2P08 A;  4EBL A;  5FAS A;  2JKF A;  1GCE A;  1PI4 A;  3C38 A;  4IVI A;  1N4O A;  1BLP A;  3S7Q A;  3F1O A;  1K54 C;  2JHE A;  2HV1 A;  5D3O A;  1T1A A;  4ZJ3 A;  3NUL A;  1T1B A;  3BW6 A;  4IUK A;  4WEK A;  1MPL A;  1KOU A;  5K5B A;  3FKV A;  1TDG A;  3BFD A;  4GZB A;  3NOP C;  5MC7 A;  3A0V A;  3A3I A;  3WS0 A;  3MSH A;  5TFQ A;  2A2L A;  3LEQ A;  2ZM0 A;  3BFE A;  5C5K A;  1H5X A;  4HEF A;  2GX5 A;  3KSF A;  3QNC A;  3P09 A;  5CRF A;  2L0W A;  1LHY A;  3ZHH A;  4X1M A;  4RQ9 A;  1YT4 A;  1PWC A;  4I38 A;  3R7W B;  4R3B A;  1G6O A;  4MN5 A;  1IEM A;  2WGW B;  1PNE A;  1YQS A;  4JGP A;  4EBP A;  1K6S A;  1F98 A;  5FQ9 A;  1HVB A;  1VET A;  4LCM A;  1QME A;  1S66 L;  3VMA A;  2OWJ A;  3LIA A;  3AGD A;  2GJ3 A;  2Y2K A;  4O01 A;  3CIT A;  5EVI C;  2QZ6 A;  2JBF A;  5FQJ A;  4F94 A;  2ZQ8 A;  4BD0 A;  3S7N A;  1SDE A;  1WYC A;  4JBF A;  4MLL A;  1E4D A;  2VV8 A;  3EQV A;  3T4K A;  5KZH A;  4I5S A;  5LBR A;  2EFX A;  2HDR A;  1FR1 A;  3UE3 A;  3UO9 A;  3S4X A;  3T4O A;  2ZLY A;  4ID4 A;  1NWZ A;  2Y4A A;  3A0S A;  3T4Q A;  5FI7 A;  4S2I A;  1BYW A;  2JE5 A;  2XFT A;  2QJ7 A;  3W2Z A;  3VSL A;  2W0N A;  4X56 A;  3HLW A;  4ZJ1 A;  3IS2 B;  3IHA A;  4S2M A;  3PR6 A;  5E2H A;  1YLZ A;  3ZG0 A;  2ZQC A;  3IH9 A;  4CLC D;  4Z1W A;  1IKG A;  4LEN A;  1PZO A;  4L9F A;  1TS8 A;  3VOY A;  3E0Y A;  3G30 A;  5DF9 A;  1LSW A;  4Y0U A;  2B5R A;  3OLO A;  4KZ6 A;  4WZ5 A;  2ZQD A;  1FOF A;  2PAV P;  1TS7 A;  1ZG6 A;  3NC8 A;  4Y7P A;  1W8Q A;  1BSG A;  2W3E A;  1W79 A;  2VX8 A;  2XK1 A;  2ZC3 B;  2PR5 A;  2XF3 A;  5DVA A;  1CK3 A;  3PTE A;  1W8Y A;  4DN0 A;  1PWD A;  2VGL M;  3EOI A;  4UQI S;  1DP8 A;  2OLU A;  3IXH A;  4MBH A;  5GLA A;  4WL9 A;  2EWW A;  3ZNY A;  5J3W A;  4IVK A;  5CGW A;  2ZOH A;  4WLA A;  3ZVT A;  2HDU A;  1ES2 A;  5A90 A;  3V39 A;  5J8X A;  3OCN A;  3FC7 A;  1W63 M;  3QP8 A;  3PXP A;  2FZ0 A;  5AVE A;  3SH8 A;  2PD8 A;  3A3E A;  3TOI A;  4DRT A;  1OTD A;  3K2N A;  4NXE A;  2Y2P A;  3HJK A;  5CER A;  3BRM A;  4HIA A;  5EVI B; 
#chains in the Genus database with same CATH homology
 3D4F A;  4KZ5 A;  3BM6 A;  4QHC A;  5KMW A;  1LI9 A;  2P74 A;  2Q9M A;  1ZG4 A;  5CGS A;  4X55 A;  3WWX A;  4Q8I A;  3UNW A;  2QPN A;  1AXB A;  1K54 A;  5CHM A;  1ERQ A;  3M6H A;  3E2K A;  1K25 A;  5GLD A;  4HBU A;  3LY3 A;  2P9V A;  2JCH A;  5A91 A;  3HLF A;  1JVJ A;  2ZMA A;  1I2W A;  3ZNT A;  4BL3 A;  2R9X A;  4PM8 A;  4LV3 A;  5TR7 A;  1NY0 A;  2WAD A;  1XGI A;  3OPP A;  1E3U A;  1NYY A;  3MZD A;  3UE1 A;  2V20 A;  3N8R A;  3N4I A;  1BUE A;  3LY4 A;  1G6A A;  1O7E A;  4RX3 A;  1Z6F A;  2G2W A;  1EI5 A;  1O07 A;  4L0L A;  4E3M A;  1Y54 A;  1KE3 A;  4KZB A;  5M1A A;  1GHP A;  4Z9Q A;  1XPB A;  1JWZ A;  3BFF A;  4Y0T A;  2WKI A;  4K91 A;  2H5S A;  4EBN A;  4FSF A;  4GN2 A;  3TG9 A;  5EOE A;  2WAE A;  4CJN A;  1BLC A;  5FI6 A;  1ZC2 A;  2HDQ A;  3MBZ A;  3HRE A;  3MZE A;  3O88 A;  4H8R A;  4DE2 A;  5DTS A;  3A3J A;  1NRF A;  1HZO A;  2CC1 A;  5EE8 A;  3VP3 A;  3M2J A;  5FDH A;  4BL2 A;  2JC7 A;  3GTC A;  3WRZ A;  2Y2I A;  3N8L A;  1CI8 A;  4A5R A;  5EEC A;  4GD6 A;  5KSC A;  4ZDX A;  1DJB A;  3HUN A;  4OPR A;  5EVL A;  5GLB A;  3VOZ A;  3ZFZ A;  3RXW A;  1BLS A;  1M6K A;  5M18 A;  2GDN A;  4U0T A;  1CI9 A;  4FH2 A;  2P9V B;  4QJG A;  4EQI A;  4EV4 A;  1XA1 A;  2Y2G A;  2Y2L A;  1IKI A;  4R4S A;  1GHI A;  4XUX A;  4R3J A;  4DDS A;  1XGJ A;  4S2K A;  1L2S A;  3IWO A;  5AQ9 A;  1NJ4 A;  1NXY A;  4S2P A;  4C75 A;  3G4P A;  2EFU A;  1K57 A;  1HTZ A;  4OKP A;  3PAG A;  4CPK A;  3PBS A;  1IEL A;  3HLB A;  4PPR A;  5HX9 A;  3GSG A;  1L0D A;  4KG2 A;  4HBT A;  2WGI A;  1KE0 A;  3HL9 A;  3LO7 A;  3CMZ A;  1XP4 A;  1LL9 A;  4O7D A;  2OV5 A;  4E6W A;  2ZM8 A;  3ISG A;  4JPM A;  3V3S A;  4DDY A;  3VP0 A;  3ITB A;  3BLM A;  1K56 A;  3O86 A;  4JF6 A;  4JXS A;  3G31 A;  5EVI A;  3V3R A;  2H0T A;  5F82 A;  3SH9 A;  1J9M A;  4JXW A;  4OP8 A;  1KVM A;  2EX8 A;  4E3L A;  2Y2Q A;  4GB7 A;  5L2F A;  4KQQ A;  3Q07 A;  1YLJ A;  2WZX A;  3S1Y A;  1VQQ A;  2J8Y A;  2DRW A;  5EVI D;  4JXG A;  1K55 A;  1TVF A;  4MNR A;  2IWB A;  5TGF A;  1ONH A;  4S2O A;  3NIA A;  3UDX A;  4BD1 A;  2A3U A;  5DTT A;  5JYP A;  1H8Z A;  3GVB A;  4KZ7 A;  2OLV A;  4WEJ A;  4KZA A;  2FFY A;  2H0Y A;  3PBQ A;  1XX2 A;  3UN7 A;  2VGK A;  3NDE A;  4OON A;  3MKF A;  5DF8 A;  4XXR A;  3HLD A;  2Y2M A;  2XFS A;  3OPL A;  3WS2 A;  1OME A;  4OLG A;  3SH7 A;  3TSG A;  2IWC A;  3IWI A;  2ZQ7 A;  4QY5 A;  4XUZ A;  5EPH A;  5HAR A;  3IXG A;  1SCW A;  2WAF A;  2XEP A;  2ZQ9 A;  4MEZ A;  4N9K A;  4OOY A;  4UAA A;  4WZ5 C;  3VP1 A;  3WS4 A;  2ZM2 A;  4M3K A;  1YMS A;  2R9W A;  2Y91 A;  4ZAM A;  2Y2H A;  3CZD A;  3MXR A;  4DE0 A;  3OPR A;  4FD8 A;  2HP6 A;  3VFH A;  3BFG A;  1U60 A;  1JWV A;  4OPZ A;  2EXB A;  4NK3 A;  1L0F A;  5FQK A;  4OH0 A;  5JYO A;  1MXO A;  4QD4 A;  5FAQ A;  3LEZ A;  3SOI A;  1I2S A;  3DWZ A;  3G2Z A;  4JF4 A;  4OOM A;  1RCJ A;  4GD8 A;  2WGV A;  3M6B A;  1KDS A;  4ZJ2 A;  4E6X A;  1K4E A;  1PZP A;  3IQA A;  1MWT A;  4QU3 A;  4LV2 A;  5CHU A;  3C4O A;  3BFC A;  5HAQ A;  2ZC5 B;  4KZ3 A;  2XD1 A;  5E2E A;  2XLN A;  4OQH A;  3MXS A;  2XD5 A;  2QMI A;  3C7V A;  3HBR A;  3ZGA B;  3MFD A;  3E2L A;  3IWQ A;  1PI5 A;  3FZC A;  3GRJ A;  3PBR A;  2ZC7 A;  3AGF A;  4X68 A;  4E3O A;  4R23 A;  4JKT A;  4C6Y A;  1KGF A;  3CJM A;  5CEB A;  3ZG5 A;  1H8Y A;  5A93 A;  1ESU A;  2X71 A;  5F1F A;  2V2F F;  4QB8 A;  1E3U D;  3HLC A;  3ZDJ A;  3UE0 A;  3S22 A;  3UY6 A;  1ES3 A;  5GLC A;  4S2N A;  3OPH A;  5EUA A;  2ZJ9 A;  4GOG A;  2OSU A;  1YLW A;  4OVD A;  2XQZ A;  1FCO A;  3N8S A;  4OP5 A;  3IF6 C;  4RA7 A;  4B4Z A;  5AQ7 A;  3RJU A;  3G2Y A;  3GQZ A;  5CTN A;  1FR6 A;  1NZU A;  4P0M A;  1W5D A;  3OC2 A;  2ZQA A;  4YIN A;  5E43 A;  5FQI A;  3ITA A;  1BTL A;  3IXB A;  1KVL A;  4EBL A;  1DJA A;  1ESI A;  3NBL A;  3BEC A;  5FAS A;  1ERO A;  4WMC A;  3B3X A;  3IHB A;  3G35 A;  3ZG7 B;  5DF7 A;  1NZO A;  3GR2 A;  4IED A;  1JWP A;  2HP5 A;  2EX9 A;  1YLT A;  3HUO A;  1ONG A;  2G2U A;  4LV0 A;  1GCE A;  1PI4 A;  5A92 A;  4OQI A;  3OZH A;  2XR0 A;  4QY6 A;  4IVI A;  1N4O A;  2WKH A;  4OOL A;  4WMC D;  1Q2Q A;  4S2J A;  1I5Q A;  3P98 A;  1BLP A;  1WYB A;  2J9O A;  1K54 C;  2Y2J A;  3HUM A;  3W4P A;  5D3O A;  4ZJ3 A;  1JTD A;  1RGY A;  4PM7 A;  2X01 A;  3G32 A;  1MWS A;  2X02 A;  3O3V A;  1RGZ A;  4WEK A;  1MPL A;  2IWD A;  2WGW A;  4PM5 A;  1CEG A;  4P87 A;  3DWK A;  3NI9 A;  3QNB A;  2XDM A;  4UA7 A;  1LI0 A;  3FKV A;  1TDG A;  3BFD A;  2H10 A;  2DNS A;  4GZB A;  3SS4 A;  4KEN B;  3UPP A;  5CGX A;  3A3I A;  3WS0 A;  4WEL A;  2RCX A;  1EWZ A;  5TFQ A;  5AQA A;  3UPO A;  2XH9 A;  5KSH A;  2ZM0 A;  5BOH A;  3BFE A;  4FCF A;  1BLH A;  4EWF A;  1BT5 A;  1H5X A;  1W7F A;  2ZD8 A;  4HEF A;  3SS3 A;  1RP5 A;  3FKW A;  4N9L A;  5E2F A;  5AQB A;  1K56 D;  3QNC A;  3P09 A;  1BUL A;  5CRF A;  3ZG9 B;  2PBY A;  3BLS A;  1GHM A;  4N1H A;  4WZ4 A;  5EOO A;  5FAT A;  1LHY A;  5HAP A;  5F1G A;  5G18 A;  1GA9 A;  4OQG A;  3ZHH A;  4BJP A;  3HVF A;  2Y2O A;  4X69 A;  1G68 A;  2I72 A;  4X6T A;  3C4P A;  3IXD A;  4JF5 A;  1YT4 A;  3O87 A;  3GV9 A;  5CXW A;  1ALQ A;  2Z2L B;  4KG6 A;  4KQR A;  1MWU A;  4R4R A;  3N6I A;  1PWC A;  4MBF A;  3WS5 A;  4R3B A;  4EUZ A;  4WM9 A;  4YFM A;  2C5W B;  4DXC A;  1IEM A;  2WGW B;  5FAO A;  4BQM A;  1N9B A;  1ES5 A;  1SDN A;  1YQS A;  2HDS A;  4EBP A;  3SS5 A;  3NY4 A;  1K6S A;  3IH8 A;  1K38 A;  2WZZ A;  1ES4 A;  1K57 C;  5FQ9 A;  3M2K A;  2WK0 A;  1HVB A;  2WUQ A;  2Y59 A;  3UDI A;  4LCM A;  1QME A;  1E25 A;  3VMA A;  5M19 A;  5FQM A;  1IYO A;  1KGE A;  3AGD A;  3DTM A;  2Y2N A;  3NCK A;  4B4X A;  2Y2K A;  4DE1 A;  3RXX A;  4ZBE A;  1FSW A;  4KZ8 A;  1PW1 A;  3FYZ A;  1SKF A;  2QZ6 A;  5EVI C;  2BLS A;  2JBF A;  4JLF A;  5FQJ A;  5FAP A;  1CEF A;  4LCL A;  4F94 A;  2ZQ8 A;  2FFF B;  4LV1 A;  1FCN A;  3PBN A;  4GDB A;  4BD0 A;  3PAE A;  1TDL A;  2EXA A;  1SDE A;  3C7U A;  3FWL A;  1WYC A;  3W4Q A;  3BEB A;  3FV7 A;  3Q81 A;  3GMW A;  4JBF A;  4MLL A;  2PU4 A;  1IYP A;  1E4D A;  4OPQ A;  2WKE A;  4DXB A;  3EQV A;  3WS1 A;  5KZH A;  3OCL A;  2ZC6 B;  2EFX A;  2HDR A;  3G34 A;  1FR1 A;  4GDN A;  3UE3 A;  2J7V A;  3UO9 A;  5CHJ A;  1S0W A;  3N7W A;  3ZG8 B;  3S4X A;  2ZLY A;  5FQQ A;  4ID4 A;  1MY8 A;  4BEN A;  1LLB A;  1DY6 A;  2Y4A A;  5CED A;  4UHU A;  4N1X A;  1SHV A;  4RYE A;  3UDF A;  4K0W A;  4D2O A;  3C5A A;  5FI7 A;  4PM9 A;  3V5M A;  4S2I A;  4GNU A;  4E3J A;  5HW3 A;  1GA0 A;  1MBL A;  4IBX A;  4RVA A;  4FH4 A;  2JE5 A;  2XFT A;  3IF6 B;  3VSL A;  1YLP A;  4X56 A;  5GL9 A;  1VM1 A;  3HLW A;  4ZJ1 A;  1MKI A;  3IHA A;  4S2M A;  5FA7 A;  5E2H A;  1YLZ A;  3ZG0 A;  2ZQC A;  4GKU A;  4N92 A;  2Z2M B;  3IH9 A;  3ZCZ A;  1MWR A;  1KDW A;  4B88 A;  3ZVW A;  5U47 A;  1IKG A;  3A3F A;  3A3D A;  4LEN A;  1ERM A;  3EQU A;  1PZO A;  1PYY A;  3Q1F A;  3VOY A;  2DCF A;  4NET A;  3VFF A;  4P85 A;  1S6R A;  4KZ9 A;  3G30 A;  5DF9 A;  5GHX A;  1FQG A;  1TEM A;  3LCE A;  4Y0U A;  5HL1 A;  2B5R A;  4KZ6 A;  3JYI A;  3W4O A;  4WZ5 A;  2ZQD A;  1FOF A;  5CTM A;  5CEC A;  1ZG6 A;  3NC8 A;  1YMX A;  3I7J A;  4Y7P A;  5GHY A;  1XXM A;  1W8Q A;  4DKI A;  1YM1 A;  3DW0 A;  4WYY A;  2ZC4 B;  1BSG A;  5DTK A;  4OQ0 A;  1W79 A;  2HPB A;  1YLY A;  3VP2 A;  1C3B A;  2A49 A;  1JTG A;  4S2N C;  1WE4 A;  2WYX A;  3MKE A;  5FI2 A;  1HD8 A;  2XK1 A;  2Q9N A;  2ZC3 B;  3VSK A;  4MBK A;  4R0Q A;  4E3N A;  3AGE A;  2XF3 A;  3UPN A;  4KQO A;  3QHY A;  1QMF A;  3VP4 A;  5DVA A;  1CK3 A;  4PMA A;  1PW8 A;  3PTE A;  4E3K A;  1NYM A;  4R1G A;  2EX2 A;  3Q7V A;  4BLM A;  1W8Y A;  1FCM A;  4ZTK A;  3IT9 A;  1PWD A;  3MZF A;  1FSY A;  2C6W B;  2OLU A;  1L0G A;  2E8I A;  3IXH A;  4MBH A;  5HAI A;  4IBR A;  4OPY A;  5GLA A;  1ZKJ A;  2VGJ A;  3HLG A;  3ZNY A;  4E3I A;  2BG1 A;  4IVK A;  5CGW A;  4OLD A;  1K4F A;  3V50 A;  3BYD A;  1KE4 A;  3Q7Z A;  3ZVT A;  2HDU A;  4JXV A;  4KZ4 A;  3CG5 A;  5I94 A;  1M40 A;  1PWG A;  4WBG A;  1ES2 A;  5A90 A;  2V1Z A;  3V39 A;  2HP9 A;  4S2L A;  3OCN A;  4U0X A;  5J8X A;  3HLE A;  4RX2 A;  1DJC A;  4Y0O A;  3SH8 A;  4C3Q A;  3PBO A;  3WRT A;  4U3T A;  1L0E A;  4PM6 A;  4X53 A;  1IYQ A;  4HES A;  1Q2P A;  2EX6 A;  1XA7 A;  5GHZ A;  3W8K A;  1BZA A;  3A3E A;  1KGG A;  2RL3 A;  3IF6 A;  3Q82 A;  5E2G A;  4K0X A;  5FSR A;  3IF5 A;  3TOI A;  4UA6 A;  5HFO A;  4DRT A;  4DF6 A;  2PU2 A;  1K6R A;  1LL5 A;  2XGN A;  2J9P A;  5IHV A;  5CER A;  2Y2P A;  4P6B A;  1PIO A;  3NDG A;  4UA9 A;  3PBT A;  1IYS A;  3Q7V B;  2Y55 A;  4DE3 A;  2UWX A;  1XKZ A;  3BRM A;  5F83 A;  1K55 C;  4KG5 A;  5EVI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...