4OPRA

Crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying g238s mutation
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEM-94 ES-beta-lactamase
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 103
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oprA00
2EXAA 3FKVA 3WS5A 1ES5A 3ZNYA 1I5QA 1XPBA 3TSGA 4OQHA 4OPZA 3N8LA 3LCEA 3GR2A 3PBQA 4E6WA 3UE0A 5F1GA 2EX8A 4MEZA 4OVDA 2Q9MA 1GA0A 3HUMA 3Q07A 2JCHA 3PAEA 5KSCA 3IWOA 5KSHA 3LY3A 3V39A 5E2FA 3WS1A 3VOZA 2WAFA 3TG9A 3NDEA 3N6IA 3ZVTA 2EFXA 1FR1A 3ISGA 1PZOA 5EVID 1XGJA 2XK1A 4B88A 3FZCA 3NBLA 1YMXA 3B3XA 5A90A 1KE4A 2Y2PA 3PBTA 3O86A 4IVIA 4OQGA 4WEJA 1H5XA 3W8KA 3IXGA 3IXBA 1TDLA 4OONA 1ZC2A 3N8RA 4UA9A 2ZMAA 4GNUA 1KGEA 1W79A 3WWXA 1IYQA 3BFEA 3D4FA 1SCWA 2A49A 2HDUA 1MY8A 3S4XA 3V5MA 4XUZA 4BL2A 3S1YA 4PM8A 1MWUA 1J9MA 1CI8A 3OPHA 3C7VA 5CECA 2JC7A 3QNCA 5EVIB 2XD5A 2UWXA 4MNRA 5FQKA 4WEKA 4YFMA 1KE3A 4P85A 1YLTA 3HLGA 5I94A 1DY6A 1RCJA 2Y2LA 3A3IA 1CEGA 3IF6C 1KVMA 2ZC7A 5AQBA 3G30A 5FQJA 2V2FF 4UA7A 1JTGA 1FCNA 2Z2MB 3SH7A 2ZC3B 3NC8A 3HREA 3GRJA 4ZJ1A 1ZG6A 1MBLA 1LLBA 3HBRA 3PBNA 1PI4A 4NETA 4K91A 1ESUA 2BLSA 4OPQA 2Y2GA 5M1AA 3VP4A 4F94A 1CEFA 1K38A 4OLDA 4JBFA 3WRTA 3IF6A 3RXWA 1XA1A 1C3BA 5EVLA 1YLJA 1GHIA 5CRFA 3SS5A 2Y2MA 2P9VA 3VP3A 4OQ0A 3OPPA 2Y2KA 5TR7A 1MKIA 2EX6A 5JYOA 3S22A 1RP5A 1KDWA 2GDNA 3AGEA 1OMEA 2P74A 1BSGA 1ONGA 4OLGA 4H8RA 4FH4A 2ZJ9A 4EWFA 2WGWB 1XXMA 1O7EA 4KQOA 1JTDA 1PW8A 4E3IA 2Y2QA 3M6BA 5CHUA 1WYCA 1K4EA 3G2YA 4HBTA 5CEBA 4E3KA 1CK3A 1ES2A 4S2NC 4KZ6A 5FASA 4EQIA 3MZFA 3P98A 3G4PA 3PBRA 5F1FA 3V3RA 4LV1A 1BZAA 3BM6A 3CJMA 1YLYA 4MBKA 3VP1A 5FAQA 3WS0A 4S2LA 5CHJA 2XFTA 1SHVA 2XF3A 2C6WB 1U60A 3GQZA 3PBSA 4QY5A 5FAOA 3VFFA 4GD6A 4S2JA 3WS4A 3MKEA 4ZJ3A 1WE4A 3G31A 3RJUA 1FCMA 1S6RA 3A3JA 2EX2A 2ZLYA 3E2LA 3FKWA 5U47A 2JE5A 4QHCA 3DWZA 3BFFA 4S2NA 5EECA 3UY6A 3VOYA 2B5RA 2Y4AA 4JPMA 1FR6A 5FQ9A 4QD4A 3UN7A 1HVBA 5AQ7A 1DJCA 3OPRA 4RYEA 4KZ7A 5JYPA 3MXRA 4EBPA 1G68A 1KGGA 3ITAA 5CGXA 3ZDJA 4WMCA 5HAQA 1SDEA 4KZ3A 4KG6A 5GHZA 3OCLA 1ES4A 3UDXA 3NDGA 3UDFA 2FFYA 4WZ4A 4KQQA 3HVFA 5KZHA 1TDGA 1MPLA 1K54A 4OOMA 4HEFA 1EWZA 3GTCA 5E2EA 3UPNA 4DDYA 2G2UA 3NIAA 5FQMA 2G2WA 3GMWA 1I2SA 3SS4A 4WZ5C 1M6KA 1L0EA 3RXXA 1NJ4A 1K6RA 5D3OA 4N1HA 1BTLA 4Y7PA 2PBYA 1PI5A 1TVFA 3IWQA 5DF7A 4ZDXA 1XP4A 5DF8A 4NK3A 2WKHA 5DF9A 4R4RA 1PWDA 5HFOA 4N1XA 1L0DA 2QZ6A 4N92A 3TOIA 4N9KA 5GL9A 3IWIA 4KQRA 1E3UD 4WZ5A 4X68A 3BECA 1YLPA 3CMZA 4DXCA 2QMIA 3LO7A 4MLLA 4UA6A 4A5RA 2WK0A 1DJBA 1RGYA 5FDHA 1HZOA 3DWKA 3VP0A 3N8SA 2RL3A 2WGVA 3LY4A 3WS2A 3W4QA 3Q82A 3EQVA 4JXSA 4KZBA 2E8IA 4E3OA 3HLFA 3ZG5A 2J7VA 3IQAA 4CPKA 5DTSA 1O07A 1L2SA 4LV3A 2JBFA 3UE3A 1MWSA 4C3QA 5E2GA 2WADA 2H5SA 4PPRA 4KG2A 3MZDA 1IEMA 1NYYA 1LL9A 3HLCA 1MWRA 4FSFA 4OOYA 5GLBA 2X01A 2X02A 4WYYA 4BL3A 3IF6B 2XD1A 4PM7A 4S2OA 4U0XA 4DE1A 4E6XA 3IHAA 3UPOA 5CGWA 3VSLA 1FOFA 1NYMA 4BD0A 1W5DA 2P9VB 5DVAA 2HP6A 1L0GA 4B4XA 3VP2A 4EUZA 4JXGA 4S2MA 4EV4A 3ZG8B 4E3LA 5FI2A 4P87A 1LL5A 4R3JA 5DTKA 3CG5A 3IF5A 3SOIA 4DF6A 2PU2A 4JXWA 1YLZA 3V50A 1JWVA 1GA9A 1M40A 4S2PA 1FSYA 5GLCA 4KENB 1EROA 1NZOA 1ONHA 4WM9A 5TFQA 5HL1A 2DRWA 3NI9A 5E2HA 5EVIC 1FQGA 1ZKJA 3M2KA 5CTMA 4K0XA 3ZG9B 2HDRA 1PIOA 1YQSA 3Q1FA 1Q2PA 5GHXA 1XA7A 4WMCD 2OSUA 4JF6A 3HUNA 2QPNA 2Y2OA 2Y2JA 3BLSA 3N7WA 1K55C 4M3KA 1N4OA 5FAPA 5FA7A 3GSGA 3M6HA 3C5AA 3MBZA 2FFFB 5HAPA 1JWZA 3BRMA 1YM1A 4Y0TA 1NZUA 2XEPA 2XGNA 3FYZA 4ZAMA 3ZVWA 1BLSA 1K4FA 3BFGA 3G32A 1ERMA 4X56A 1VM1A 1PWCA 3ITBA 1BT5A 4CJNA 2ZQAA 2EXBA 4DKIA 1KVLA 1ERQA 2PU4A 5FI7A 4QJGA 1MXOA 3QNBA 4GDNA 3IT9A 1ESIA 5HARA 2OLVA 1IKIA 2HP9A 1K25A 4L0LA 4R1GA 3ZHHA 3M2JA 3MZEA 2ZQDA 1K56A 1KGFA 2IWDA 3Q81A 4KZAA 3EQUA 2XQZA 3OC2A 2BG1A 3A3DA 3SS3A 3C4OA 4OKPA 4X53A 1RGZA 3UPPA 3ZG0A 2XR0A 2R9WA 4DE2A 1DJAA 5HAIA 4O7DA 2EFUA 5GHYA 3C4PA 3VFHA 4DDSA 2OV5A 5E43A 3UDIA 4OOLA 4E3JA 3BEBA 1KDSA 4K0WA 2DNSA 2Z2LB 4LCLA 4BENA 3Q7ZA 2WGWA 3BFDA 4RX3A 3BFCA 2WGIA 1FCOA 2WZXA 3HUOA 2ZQ8A 2WAEA 3MKFA 1HD8A 4LCMA 4FH2A 4Q8IA 1Q2QA 1K57C 1GHMA 3DW0A 4E3MA 3Q7VA 3W4PA 1W7FA 5EOEA 2A3UA 4BD1A 1BLCA 3NCKA 4Y0OA 3I7JA 4R0QA 1BULA 1YMSA 3AGDA 5FSRA 1SKFA 2ZQ9A 5GLAA 3V3SA 3CZDA 3ZCZA 2ZC6B 1I2WA 1XKZA 4BJPA 1CI9A 1K57A 1NRFA 3SH9A 5FATA 5CERA 1JVJA 2XDMA 1BLHA 1ALQA 1E25A 4WBGA 5J8XA 4IVKA 3UE1A 2H0TA 4KZ9A 2J8YA 5BOHA 4PM6A 1BLPA 4GZBA 4KZ5A 4Z9QA 3HLDA 4FCFA 2DCFA 3A3EA 2V1ZA 3P09A 2IWCA 4OQIA 3VSKA 2VGKA 1ZG4A 2Y91A 3A3FA 4EBLA 1IKGA 3HLEA 3FV7A 4KZ8A 4OH0A 5DTTA 5EE8A 1H8ZA 3IXDA 3ZG7B 3C7UA 5EUAA 5GLDA 5F83A 4P6BA 3DTMA 1KE0A 5CGSA 3BLMA 1PYYA 4MBFA 4LV2A 4JLFA 3ZNTA 1VQQA 3O3VA 3BYDA 4R4SA 4DE0A 2ZM2A 4X69A 3IH9A 3PTEA 4P0MA 2WKEA 1N9BA 1GHPA 1HTZA 2Y59A 1Z6FA 2C5WB 4BLMA 4QB8A 3UO9A 1LI0A 1K56D 4FD8A 4X6TA 4GB7A 4RVAA 2XLNA 4C6YA 4C75A 1NXYA 1PZPA 4GOGA 3SH8A 4YINA 3IH8A 3NY4A 1Y54A 4KG5A 3VMAA 4BQMA 1IELA 2V20A 3OCNA 1IYPA 2ZC5B 2ZM8A 4Y0UA 5HX9A 2HDSA 5EPHA 4GDBA 2Y2NA 4WELA 3W4OA 4JKTA 5HW3A 1LHYA 1EI5A 5G18A 4ZJ2A 2ZQ7A 4D2OA 1YT4A 1YLWA 5FQIA 1E3UA 2Y2HA 2RCXA 5EVIA 3FWLA 5TGFA 4S2IA 1AXBA 2J9OA 2Q9NA 1PWGA 2ZD8A 1QMEA 5F82A 2IWBA 5A93A 5CHMA 2WKIA 4OPYA 4JF5A 1GCEA 3G34A 1K55A 4OPRA 4U0TA 5M19A 1XX2A 3MXSA 3PAGA 1WYBA 3G35A 4LENA 4UHUA 2ZQCA 3AGFA 5IHVA 4GKUA 3MFDA 4UAAA 4QY6A 4IBXA 3E2KA 2WZZA 4MBHA 4QU3A 2HPBA 3HLBA 4X55A 1S0WA 1W8QA 4R3BA 1JWPA 4ID4A 1MWTA 2R9XA 3O87A 1ES3A 4OP8A 4U3TA 1LI9A 4JXVA 3GV9A 3WRZA 4PM5A 3Q7VB 1XGIA 2VGJA 4RA7A 2HP5A 4E3NA 2WUQA 4EBNA 4XUXA 4XXRA 1SDNA 2CC1A 5AQ9A 4HBUA 2OLUA 4B4ZA 1TEMA 1IYSA 4DE3A 2ZC4B 1IYOA 2Y2IA 5CTNA 2Y55A 5A91A 3ZGAB 3GVBA 4RX2A 2H10A 4HESA 4LV0A 1E4DA 5A92A 3G2ZA 5AQAA 4ZBEA 3HL9A 1QMFA 1K6SA 4R23A 1PW1A 1H8YA 4OP5A 2XH9A 4ZTKA 5FQQA 1K54C 3OZHA 4DXBA 2I72A 3OPLA 3QHYA 3N4IA 1BUEA 4PMAA 1G6AA 3PBOA 1W8YA 5KMWA 5EOOA 4IEDA 3JYIA 3UNWA 4S2KA 3O88A 4N9LA 2EX9A 4GN2A 4KZ4A 2XFSA 3IHBA 3HLWA 5M18A 1FSWA 5CXWA 4GD8A 3ZFZA 2H0YA 2ZM0A 3IXHA 2X71A 3LEZA 5FI6A 1NY0A 2WYXA 4JF4A 4PM9A 2J9PA 4DRTA 4IBRA 5L2FA 1L0FA 2HDQA 5CEDA
chains in the Genus database with same CATH superfamily
3FKVA 3PXPA 1LT0A 3N8LA 3UE0A 4OVDA 3LIBA 3HUMA 2JCHA 2JKTI 3LY3A 5DKKA 3ZVTA 3ISGA 3LGOA 2XK1A 4B88A 3NBLA 1G6OA 1YMXA 4PHTA 5A90A 2FH5A 2Y2PA 3LFVA 1H5XA 4HJ3A 1LSVA 1TDLA 1ZC2A 2JKFA 4GNUA 5J4EA 3T4JA 4PM8A 3OPHA 4MNRA 5FQKA 1YLTA 3HLGA 1DY6A 1RCJA 2Y2LA 4GS9B 1KVMA 3U4LP 4UA7A 1JTGA 4ME4A 1MBLA 4NETA 4HY8A 2BLSA 2W0NA 4F94A 3IF6A 1C3BA 3SS5A 2P9VA 3MMHA 4OQ0A 1MKIA 1GSWA 2OAQ1 5FEFA 2PRFA 1BSGA 5J7EA 1OT9A 3BW6A 4EWFA 2WGWB 1JTDA 3G2YA 2AVXA 3EEAA 3F1OA 4M4XA 4E3KA 3LIFA 5EM1A 5F1FA 5FEGA 5G4YA 3VP1A 3WS0A 1SHVA 2C6WB 1U60A 4GD6A 4HI4A 1WE4A 1F98A 3G31A 4GHIA 2ZMFA 2JE5A 3R7WB 5FQ9A 4WLAA 3UN7A 1HVBA 3CPTB 1DJCA 3OPRA 3QP6A 2P04A 5JYPA 1G68A 5HAQA 1SDEA 4HH2A 5GHZA 3UDXA 3NDGA 4EU0A 3HVFA 3QP4A 1K54A 1EWZA 3GTCA 4O01A 4BBTA 3SS4A 3RXXA 1DRMA 5D3OA 1BTLA 1TVFA 3IWQA 5DF7A 1XP4A 2JKGA 2QZ6A 1IOUA 2QKPA 1UWPX 1XJ4A 2QMIA 4A5RA 2WK0A 3HJIA 3IBRA 3BQ8A 3VP0A 3LY4A 4JXSA 4KZBA 2E8IA 2HGVA 2QYBA 4CPKA 1SZVA 1VEUA 2JBFA 2V0WA 1S66L 5E2GA 3LIAA 4KG2A 3MZDA 1FIKA 2Z6CA 4OOYA 1MWRA 2X01A 2X02A 3IF6B 4E6XA 3T1XA 3FG8A 5CGWA 1OTIA 3S7QA 1W5DA 2P9VB 4HOIA 3MS6A 4EV4A 3NOUC 5FI2A 2O0YA 3V50A 4S2PA 4KENB 1T19A 1PFLA 1NZOA 5TFQA 1ZKJA 3M2KA 1PIOA 5GHXA 2VV8A 4DN0A 3LR5A 2OSUA 3KX0X 4JF6A 2GJ3A 2Y2JA 4M3KA 1K55C 3OLOA 1N4OA 3CI6A 3M6HA 5HAPA 3DTKA 1NLYA 4CJNA 4DKIA 1KVLA 1LL8A 4MN7A 1TF1A 2ZMVA 3KSFA 1YAXA 1K25A 2INWA 4BMWA 3Q81A 1N9OA 3C4OA 4HJ4A 3CLOA 2XR0A 2EA9A 2R9WA 4NKPA 3RH8B 5E43A 2PR5A 3UDIA 4GLQA 4K0WA 1CF0A 3T4OA 4BENA 2PYRA 4EEPA 1FCOA 4UQIM 2ZQ8A 1HD8A 4LCMA 4FH2A 2R78A 2J3TC 2HJ9C 3DW0A 4E3MA 3W4PA 2XA7S 4Y3IA 2A3UA 3VE3A 1BLCA 2JKRM 3NCKA 3L9KA 5EV0A 3V67A 5FSRA 1SKFA 2ZC6B 1T1AA 3MQQA 1CI9A 3IS2A 1K57A 3SH9A 4D60A 2XDMA 2L4RA 4WBGA 1VEUB 1OJ5A 4IVKA 3UE1A 2V1ZA 4Y17A 1ZG4A 3A3FA 3CITA 4B9OA 5EUAA 4QWOA 3T50A 2O9CA 4Y15A 2JKRI 4MBFA 4DE0A 2ZM2A 1XJ6A 1LI0A 2VA0A 1K56D 3IX4A 4FD8A 4X6TA 2J80A 1NXYA 3T12B 5HX9A 2HDSA 5AJGA 4JKTA 4ZJ2A 3JVVA 4D2OA 2V8FA 2Y2HA 1S67L 5EVIA 3FWLA 5TGFA 2IWBA 2WKIA 1GCEA 4OPRA 2V8CA 3PAGA 2Z6DA 4XT2A 4QY6A 4DJ3A 1YKDA 4L9EA 3HLBA 1W8QA 4ID4A 3O87A 4U3TA 4EBNA 2HV1A 1SDNA 5TBMA 1TS7A 2OLUA 4B4ZA 1TEMA 3MXQA 5A91A 2Y2IA 5HL6A 1S4RA 4RX2A 3FPWA 2DMWA 5A92A 5AQAA 4ZBEA 3LR3A 4ZTKA 4P6ZM 5FQQA 1K54C 2W3HA 4PMAA 5KMWA 5EOOA 3LEQA 1KOUA 2VX8A 1OTBA 3NHQA 4YOFA 5M18A 5CXWA 1W63Q 2WYXA 4PM9A 4JF4A 1G28A 4IBRA 1L0FA 2HDQA 2FZ0A 2EXAA 2E8JA 1LSXA 2W3FA 3WS5A 3EGXC 4E6WA 2Q9MA 2JN7A 4NXFA 3PAEA 5KSCA 5KSHA 3VOZA 3NULA 4IHQA 3N6IA 2EFXA 4IVIA 5A8BA 4WEJA 1TS0A 4EERA 3N8RA 2GX5A 4UA9A 3CWFA 3NOTC 4MMNA 1IYQA 2HDUA 3S4XA 3EGDC 3BY9A 1NWZA 4XUZA 3V5MA 3H82A 2HJEA 3CAXA 4F3LB 1J9MA 3C7VA 5EVIB 5L10A 3DTIA 1H3QA 2ZC7A 5AQBA 5AVEA 4YWZA 3K3CA 3B47A 3NC8A 3HREA 1MKMA 3HBRA 1LLBA 3CUEA 1PI4A 4K91A 4XT2B 3VP4A 1DP9A 4X1MA 1K38A 4OLDA 4JBFA 5EVLA 3T4SA 2K7SA 5CRFA 3VP3A 3OPPA 5JYOA 3H7WA 4FUWA 2V9AA 5TBMB 1OMEA 2P74A 2WKPA 1D7EA 3C8CA 4BBUA 4E3IA 2Y2QA 1WYCA 1K4EA 5HSQA 5CEBA 1CK3A 4EQIA 3V3RA 4LV1A 3BM6A 3CJMA 4MBKA 2W1TB 5FAQA 5FAOA 3HCYA 4S2JA 3WS4A 1OJGA 3D9YA 2EX2A 2ZLYA 5U47A 3FKWA 4EESA 4G3WA 3DWZA 4S2NA 2B5RA 3VOLA 5AQ7A 3KO6A 4RYEA 4EBPA 1KGGA 3ITAA 4WMCA 4KG6A 3OCLA 1Y4OA 2FFYA 3PHYA 4KQQA 1MPLA 4HEFA 4KUOA 5E2EA 5HD3A 4DDYA 2B95A 2G2UA 3KSIA 2G2WA 4HP9A 3GMWA 1I2SA 4LLOB 4CLCA 4N1HA 1PI5A 1TD5A 4NK3A 5HFOA 4I38A 3LI8A 1E3UD 4WZ5A 4X68A 4HHDA 3CMZA 3LO7A 4I39A 4UA6A 1HZOA 3DWKA 3N8SA 2WGVA 3WS2A 3ZG5A 3IQAA 3G6OA 1L2SA 4LV3A 3D72A 4PKYG 2L0WA 1IEMA 2XROA 3E4PA 4BL3A 4U0XA 3IHAA 1VETA 3VSLA 1FOFA 4BD0A 1OTAA 4I5SA 5DVAA 3QP1A 4S2MA 4P87A 4R3JA 3H7WB 3IF5A 2PU2A 4JXWA 1YLZA 1GSVA 1GA9A 1M40A 3LR4A 1FSYA 4NG2A 5GLCA 5L07A 1EROA 4WM9A 5HL1A 3NI9A 2HZ5A 5EVIC 1FQGA 2PHYA 5CTMA 3ZG9B 4B93A 2HDRA 3Q1FA 5F69A 1Q2PA 4G3KA 3DAVA 1LSWA 1JWZA 5FDSA 3BRMA 1YM1A 5DKLA 1NZUA 2D01A 4KUKA 1K4FA 1ODVA 1PWCA 1A0KA 2PAVP 3LUQA 3QNBA 3LIEA 2ZOHA 4LRXC 5HARA 2HP9A 3U2AA 1ZHHB 3MZEA 4Q0JA 2ZQDA 2IWDA 3OC2A 2BG1A 2OAP1 4DE2A 3LICA 5GHYA 3C4PA 4CLCB 4E3JA 4L9FA 2Y8HA 4LCLA 4Q0HA 3FPVA 3LI9A 3EEHA 3HUOA 1OTDA 1TS6A 2V0UA 4Y2FA 2VEAA 2ACGA 2O9BA 2WKQA 2NUTC 4Y0OA 3I7JA 3TRCA 2ZQ9A 3UB5P 4DJ2A 5FATA 1JVJA 1P0ZA 2H0TA 4KZ9A 2J8YA 3TW8A 4PM6A 1BLPA 4Z9QA 2DCFA 2IWCA 4OQIA 1VETB 4EBLA 2Y91A 4KZ8A 4ARZA 4LFUA 5EE8A 2BTFP 2KOIA 1H8ZA 2VZWA 3C7UA 1K0KA 3DTMA 3BWLA 1KE0A 5CGSA 3BLMA 4H6JA 3ZNTA 4WL9A 3BYDA 4X69A 4BLMA 4QB8A 3LR0A 2XLNA 4C6YA 2EWWA 4YINA 3NY4A 3F1OB 3VMAA 1D1JA 1IYPA 2ZM8A 2Y2NA 3ULFA 1LHYA 1EI5A 2ZQ7A 4CLCE 1YLWA 1E3UA 4GW9A 1AXBA 2ZD8A 4GHIB 2I9VA 1DP6A 4OPYA 4JF5A 3UB7A 3G34A 5M19A 2OOLA 1WYBA 3NECA 4EUVA 4UAAA 5G4ZA 4QU3A 4BBVA 5K5BA 1MWTA 2R9XA 3GECA 1LI9A 3WRZA 4PM5A 1XGIA 4RA7A 4LPZA 4XXRA 2CC1A 4DE3A 2W3GA 3QP5A 2J3WA 2H10A 4LV0A 3P7NA 2W27A 3K3DA 4MDZA 4G3VA 2PDRA 1V9YA 2XH9A 4DXBA 3OZHA 3OPLA 2GZAA 2O9AA 4QPRA 1G6AA 1VHMA 1W8YA 4IEDA 1XFQA 3JYIA 5L8MA 4N9LA 2EX9A 4GN2A 4CLCC 4KZ4A 2XFSA 3IHBA 1FSWA 3ZFZA 4GD8A 5HPIA 4IUHA 4HIAA 4ARZB 5HWWA 1T18A 4II7A 1ES5A 3ZNYA 1I5QA 1XPBA 4OQHA 2W1RA 3KYEA 3GR2A 3PBQA 1T1BA 1MC0A 2Y79A 3K2NA 4H6JB 5F68A 3IWOA 4CQHA 4UQIS 3HJKA 3WS1A 4L9GA 2WAFA 3TG9A 3NDEA 2OWJA 3PBTA 4I3AA 3W8KA 3IXBA 4OONA 3C30A 2B18A 1KGEA 1W79A 3BFEA 3D4FA 1SCWA 5TJJA 2VGLM 1F2KA 3S1YA 4WF0A 1P9WA 1CI8A 2JC7A 2XD5A 2PD7A 1P97A 2UWXA 5I94A 3KSGA 3IF6C 1F5MA 5FQJA 1FCNA 3PBNA 2A2LA 1ESUA 4OPQA 1OTEA 2QJ7A 1CEFA 3WRTA 3RXWA 1GHIA 4MCWA 2Y2KA 3F1NA 5TR7A 2EX6A 1RP5A 1DP8A 3AGEA 2IA2A 2J3TD 2ZJ9A 1O7EA 5EVEA 5CHUA 2WKRA 5KIZA 4HBTA 1N9LA 1ES2A 5FASA 3PBRA 3BY8A 1BZAA 5CX7A 4WN5A 2B02A 4S2LA 3PBSA 3VFFA 2XF3A 1GSXA 2LB9A 3MKEA 4ZJ3A 1FCMA 5F6AA 4Z1WA 4IUKA 3A3JA 3IS2B 3BFFA 3VOYA 2Y4AA 4JPMA 1FR6A 3MF0A 3MXRA 3OOVA 2QHKA 2M7UA 3ZDJA 5CGXA 1ES4A 3UDFA 4WZ4A 3UB9A 5KZHA 4KQDA 5HDCA 3UPNA 5FQMA 1M6KA 1L0EA 1NJ4A 4Y7PA 2QJ5A 4ZDXA 5DF9A 1N9NA 1WA9A 1PWDA 3PR6A 1L0DA 3TOIA 4N9KA 2PBDP 4KQRA 5EFWA 1ZTUA 3BECA 4P6ZS 5DFXA 1OPXA 1DJBA 5FDHA 3MSHA 1P9RA 4O8GA 3MR0A 4E3OA 3C38A 1O07A 2KX6A 4C3QA 3CHWP 2WADA 3A0VA 3HLCA 1NYYA 3ZG8B 5GLBA 4FSFA 4S2OA 2XD1A 4DE1A 4FTXA 3TJZC 1NYMA 1UGUA 5C5KA 4B4XA 2ZOIA 4JXGA 3F1NB 4NXBA 1MZUA 4DF6A 3CG5A 4HP4A 5E2HA 5EM0A 2JHEA 2VJWA 1YQSA 4AFIA 3BJNA 4BWIA 3HUNA 2QPNA 3BLSA 3N7WA 3C5AA 3MBZA 2FFFB 5MC7A 4Y0TA 2XGNA 3FYZA 4ZAMA 1BLSA 4X56A 3BFGA 3G32A 4NXGA 1VM1A 3UE6A 4GS9A 3ITBA 2ZQAA 5IU1A 2W3DA 2EXBA 3EWKA 3A0SA 3UB8A 3IT9A 1ESIA 3RFBA 2OLVA 4R1GA 1YSPA 1K56A 1KGFA 2XQZA 4X53A 5DJUA 3VFHA 4DDSA 4EQ1A 4HJ6A 4OOLA 2VLGA 5LBRA 2DNSA 3FC7A 3Q7ZA 2WGWA 5I5LA 3BFDA 4JGQA 4FOFA 2WGIA 4E04A 2WAEA 4EXOA 1K57C 4PKYA 3Q7VA 5EOEA 4BD1A 4R0QA 1YMSA 5GLAA 3ZCZA 2ZBBA 1I2WA 4BJPA 4HNBA 5CERA 3S7NA 3R7WA 1Y28A 1BLHA 1ALQA 3H82B 3CPTA 5BOHA 4GZBA 3KYZA 4FCFA 3A3EA 4HQAA 2VGKA 1IKGA 3HLEA 1L3LA 5DTTA 2PYPA 3IXDA 3ZG7B 4EEUA 3DTEA 4Q0IA 1H0MA 3C2WA 4HH3A 3UMDA 5IT5A 1PYYA 4LV2A 1VQQA 3O3VA 4YNRA 3QP2A 3BQAA 1IFQA 3IH9A 3PTEA 2WKEA 4DMZA 1GHPA 1HTZA 2Y59A 1S1ZA 3UO9A 1T1CA 2OWHA 2UV0E 3IH8A 1Y54A 4KG5A 4BQMA 2ZC5B 4WELA 4RQ9A 1YT4A 4MN5A 2RCXA 2J9OA 4MN6A 5F82A 1FILA 4NXEA 5CHMA 3MJQA 4U0TA 1XX2A 1S4SA 5F5YA 4GKUA 4IBXA 3E2KA 4MBHA 3LYXA 4R3BA 2G7UA 4OP8A 3UMEA 1JNUA 5HD5A 3EOIA 3Q7VB 2VGJA 2HP5A 4XUXA 4HBUA 3T4QA 2XSSA 1IYOA 5DFYA 2Y55A 3R4KA 1BYWA 1S1YA 3GVBA 2O99A 4HESA 3G2ZA 3HL9A 1QMFA 3H9WA 1K6SA 4R23A 1PW1A 1H8YA 1G5UA 2I72A 3QHYA 2XRNA 3OBFA 3RTYA 4I3JA 2K31A 3UNWA 1J3WA 2PD8A 3IXHA 2X71A 3LEZA 1NY0A 2J9PA 3KSHA 5CEDA 1CJFA 3TSGA 4OPZA 4UEYA 4Y5FA 3LCEA 2MJ6A 5F1GA 2EX8A 4MEZA 1GA0A 3MFXA 3Q07A 3V39A 5E2FA 1FR1A 1PZOA 5EVID 3JPUA 1XGJA 4R38A 3FZCA 1TS8A 3B3XA 1KE4A 1XJ3A 3O86A 4OQGA 3S7OA 3IXGA 3GDIA 2ZMAA 3WWXA 2A49A 4LGWA 1MY8A 4BL2A 1AWIA 5L09A 1MWUA 3PYPA 5CECA 4WUJA 3QNCA 3CUEC 3LIDA 4WEKA 4YFMA 1KE3A 4P85A 2K2NA 1CEGA 3A3IA 3G30A 2V2FF 2Z2MB 3SH7A 1H8MA 1XFNA 1STZA 2ZC3B 3GRJA 4ZJ1A 1ZG6A 5HZHA 3NOPC 2Y2GA 5M1AA 2BASA 1XA1A 1YLJA 1PRQA 2Y2MA 1HLUP 3S22A 3T1SA 1KDWA 1YSQA 2GDNA 3IX3A 3T1RA 2KDKA 1ONGA 4OLGA 4H8RA 4FH4A 4KQOA 1XXMA 1PW8A 3M6BA 4R70A 3DBAA 2XA7M 1NLZA 4KZ6A 4S2NC 3MZFA 3P98A 3G4PA 3T4TA 4GJ4A 4GCZA 1YLYA 4I3IA 5CHJA 2XFTA 3GQZA 3NJAA 4QY5A 3O5YA 3RJUA 1S6RA 3E2LA 4QHCA 2VKSA 5EECA 3UY6A 3E4QA 4QD4A 4KZ7A 4KZ3A 3VE4A 3E98A 5HDDA 1TDGA 4OOMA 2GNXA 3E0YA 3NIAA 4WZ5C 5FL3A 1K6RA 2PBYA 4X1LA 4ZRRA 2L1MA 3ZQ5A 5DF8A 2WKHA 4R4RA 4N1XA 4N92A 2HF6A 5GL9A 3IWIA 3IBJA 1YLPA 2NUPC 4DXCA 4MLLA 1F9IA 1Z09A 1RGYA 4ETZA 2RL3A 3TE8A 3W4QA 3Q82A 3EQVA 1YPRA 3HLFA 2J7VA 3JVUA 5DTSA 1NRJA 3UE3A 1MWSA 3MQOA 4PPRA 2H5SA 3F1PA 1LL9A 4WYYA 2V1BA 4PM7A 5IS1A 3UPOA 4Y13A 2M1CA 1L0GA 2HP6A 3VP2A 4EUZA 4E3LA 4JGPA 1LL5A 5DTKA 3SOIA 1JWVA 2PR6A 1ONHA 2DRWA 2D02A 3L7HA 4K0XA 1XA7A 4WMCD 3UB6A 2Y2OA 2LB5A 5FAPA 5FA7A 3ICYA 3GSGA 2VGLS 4F3LA 2XEPA 3ZVWA 5DJTA 3MQ0A 1ERMA 1EW0A 2M7VA 1BT5A 2A24A 1ERQA 2PU4A 5FI7A 4CLCD 4QJGA 1MXOA 2YKHA 4GDNA 1SKOA 4NEED 1D06A 1IKIA 3T1QB 4L0LA 3ZHHA 3M2JA 1OT6A 3QP8A 3W2ZA 4KZAA 1X0OA 3EQUA 3A3DA 3SS3A 4OKPA 1RGZA 3UPPA 3ZG0A 4PAUA 1DJAA 5HAIA 4O7DA 2EFUA 4JGRA 2OV5A 4JGOA 1XJ2A 3BEBA 1KDSA 2Z2LB 2EWVA 4RX3A 2VK3A 3BFCA 2QWSA 2WZXA 1ACFA 3MKFA 2VV6A 5AVFA 1W63M 4Q8IA 1Q2QA 3A0RA 4R3AA 1GHMA 4LRYC 1W7FA 4LRZE 1PNEA 2W1TA 1BULA 2P7JA 3AGDA 3V3SA 3CZDA 1XKZA 3B33A 1NRFA 2W3EA 1E25A 5J8XA 4KZ5A 1UWNX 3F1PB 3HLDA 2ZL1A 3P09A 3VSKA 4ESPA 3FV7A 4OH0A 3KYQA 3SW1A 5GLDA 5F83A 4P6BA 4ETXA 5J3WA 2KLIA 2V1AA 4JLFA 4R4SA 4EETB 4P0MA 1N9BA 5HDSA 1Z6FA 2C5WB 4R6LA 4GB7A 4RVAA 4C75A 1PZPA 3ZYTA 4GOGA 3SH8A 2A24B 1IELA 4Y0UA 2V20A 3OCNA 4O0PA 2P08A 5EPHA 4GDBA 3T4LA 1V9ZA 3E4OA 3IX8A 1VB6A 3W4OA 5HW3A 2PT7A 5G18A 1SKOB 5FQIA 4EW7A 4S2IA 2YKFA 2Q9NA 1PWGA 1QMEA 3P01A 2Q0OA 5A93A 2VV7A 1CQAA 1K55A 4IJGA 3MXSA 4LENA 3G35A 4UHUA 2ZQCA 3AGFA 5HWVA 5IHVA 3T4KA 3MFDA 2WZZA 2HPBA 4X55A 1S0WA 1JWPA 3D3OA 1ES3A 4JXVA 3GV9A 4E3NA 2WUQA 5AQ9A 2JKTM 1IYSA 2ZC4B 5CTNA 4X25A 3ZGAB 1E4DA 4OP5A 3N4IA 1BUEA 3PBOA 3B42A 3VV4A 5HPFA 2H28A 4S2KA 2ZL1B 3O88A 2CMNA 3HLWA 5HWTA 2H0YA 3SZTA 2ZM0A 4K08A 5FI6A 3S7PA 4DRTA 5L2FA
chains in the Genus database with same CATH topology
2EXAA 3FKVA 3WS5A 1ES5A 3ZNYA 1I5QA 1XPBA 3TSGA 4OQHA 4OPZA 3N8LA 3LCEA 3GR2A 3PBQA 4E6WA 3UE0A 5F1GA 2EX8A 4MEZA 4OVDA 2Q9MA 1GA0A 3HUMA 3Q07A 2JCHA 3PAEA 5KSCA 3IWOA 5KSHA 3LY3A 3V39A 5E2FA 3WS1A 3VOZA 2WAFA 3TG9A 3NDEA 3N6IA 3ZVTA 2EFXA 1FR1A 3ISGA 1PZOA 5EVID 1XGJA 2XK1A 4B88A 3FZCA 3NBLA 1YMXA 3B3XA 5A90A 1KE4A 2Y2PA 3PBTA 3O86A 4IVIA 4OQGA 4WEJA 1H5XA 3W8KA 3IXGA 3IXBA 1TDLA 4OONA 1ZC2A 3N8RA 4UA9A 2ZMAA 4GNUA 1KGEA 1W79A 3WWXA 1IYQA 3BFEA 3D4FA 1SCWA 2A49A 2HDUA 1MY8A 3S4XA 3V5MA 4XUZA 4BL2A 3S1YA 4PM8A 1MWUA 1J9MA 1CI8A 3OPHA 3C7VA 5CECA 2JC7A 3QNCA 5EVIB 2XD5A 2UWXA 4MNRA 5FQKA 4WEKA 4YFMA 1KE3A 4P85A 1YLTA 3HLGA 5I94A 1DY6A 1RCJA 2Y2LA 3A3IA 1CEGA 3IF6C 1KVMA 2ZC7A 5AQBA 3G30A 5FQJA 2V2FF 4UA7A 1JTGA 1FCNA 2Z2MB 3SH7A 2ZC3B 3NC8A 3HREA 3GRJA 4ZJ1A 1ZG6A 1MBLA 1LLBA 3HBRA 3PBNA 1PI4A 4NETA 4K91A 1ESUA 2BLSA 4OPQA 2Y2GA 5M1AA 3VP4A 4F94A 1CEFA 1K38A 4OLDA 4JBFA 3WRTA 3IF6A 3RXWA 1XA1A 1C3BA 5EVLA 1YLJA 1GHIA 5CRFA 3SS5A 2Y2MA 2P9VA 3VP3A 4OQ0A 3OPPA 2Y2KA 5TR7A 1MKIA 2EX6A 5JYOA 3S22A 1RP5A 1KDWA 2GDNA 3AGEA 1OMEA 2P74A 1BSGA 1ONGA 4OLGA 4H8RA 4FH4A 2ZJ9A 4EWFA 2WGWB 1XXMA 1O7EA 4KQOA 1JTDA 1PW8A 4E3IA 2Y2QA 3M6BA 5CHUA 1WYCA 1K4EA 3G2YA 4HBTA 5CEBA 4E3KA 1CK3A 1ES2A 4S2NC 4KZ6A 5FASA 4EQIA 3MZFA 3P98A 3G4PA 3PBRA 5F1FA 3V3RA 4LV1A 1BZAA 3BM6A 3CJMA 1YLYA 4MBKA 3VP1A 5FAQA 3WS0A 4S2LA 5CHJA 2XFTA 1SHVA 2XF3A 2C6WB 1U60A 3GQZA 3PBSA 4QY5A 5FAOA 3VFFA 4GD6A 4S2JA 3WS4A 3MKEA 4ZJ3A 1WE4A 3G31A 3RJUA 1FCMA 1S6RA 3A3JA 2EX2A 2ZLYA 3E2LA 3FKWA 5U47A 2JE5A 4QHCA 3DWZA 3BFFA 4S2NA 5EECA 3UY6A 3VOYA 2B5RA 2Y4AA 4JPMA 1FR6A 5FQ9A 4QD4A 3UN7A 1HVBA 5AQ7A 1DJCA 3OPRA 4RYEA 4KZ7A 5JYPA 3MXRA 4EBPA 1G68A 1KGGA 3ITAA 5CGXA 3ZDJA 4WMCA 5HAQA 1SDEA 4KZ3A 4KG6A 5GHZA 3OCLA 1ES4A 3UDXA 3NDGA 3UDFA 2FFYA 4WZ4A 4KQQA 3HVFA 5KZHA 1TDGA 1MPLA 1K54A 4OOMA 4HEFA 1EWZA 3GTCA 5E2EA 3UPNA 4DDYA 2G2UA 3NIAA 5FQMA 2G2WA 3GMWA 1I2SA 3SS4A 4WZ5C 1M6KA 1L0EA 3RXXA 1NJ4A 1K6RA 5D3OA 4N1HA 1BTLA 4Y7PA 2PBYA 1PI5A 1TVFA 3IWQA 5DF7A 4ZDXA 1XP4A 5DF8A 4NK3A 2WKHA 5DF9A 4R4RA 1PWDA 5HFOA 4N1XA 1L0DA 2QZ6A 4N92A 3TOIA 4N9KA 5GL9A 3IWIA 4KQRA 1E3UD 4WZ5A 4X68A 3BECA 1YLPA 3CMZA 4DXCA 2QMIA 3LO7A 4MLLA 4UA6A 4A5RA 2WK0A 1DJBA 1RGYA 5FDHA 1HZOA 3DWKA 3VP0A 3N8SA 2RL3A 2WGVA 3LY4A 3WS2A 3W4QA 3Q82A 3EQVA 4JXSA 4KZBA 2E8IA 4E3OA 3HLFA 3ZG5A 2J7VA 3IQAA 4CPKA 5DTSA 1O07A 1L2SA 4LV3A 2JBFA 3UE3A 1MWSA 4C3QA 5E2GA 2WADA 2H5SA 4PPRA 4KG2A 3MZDA 1IEMA 1NYYA 1LL9A 3HLCA 1MWRA 4FSFA 4OOYA 5GLBA 2X01A 2X02A 4WYYA 4BL3A 3IF6B 2XD1A 4PM7A 4S2OA 4U0XA 4DE1A 4E6XA 3IHAA 3UPOA 5CGWA 3VSLA 1FOFA 1NYMA 4BD0A 1W5DA 2P9VB 5DVAA 2HP6A 1L0GA 4B4XA 3VP2A 4EUZA 4JXGA 4S2MA 4EV4A 3ZG8B 4E3LA 5FI2A 4P87A 1LL5A 4R3JA 5DTKA 3CG5A 3IF5A 3SOIA 4DF6A 2PU2A 4JXWA 1YLZA 3V50A 1JWVA 1GA9A 1M40A 4S2PA 1FSYA 5GLCA 4KENB 1EROA 1NZOA 1ONHA 4WM9A 5TFQA 5HL1A 2DRWA 3NI9A 5E2HA 5EVIC 1FQGA 1ZKJA 3M2KA 5CTMA 4K0XA 3ZG9B 2HDRA 1PIOA 1YQSA 3Q1FA 1Q2PA 5GHXA 1XA7A 4WMCD 2OSUA 4JF6A 3HUNA 2QPNA 2Y2OA 2Y2JA 3BLSA 3N7WA 1K55C 4M3KA 1N4OA 5FAPA 5FA7A 3GSGA 3M6HA 3C5AA 3MBZA 2FFFB 5HAPA 1JWZA 3BRMA 1YM1A 4Y0TA 1NZUA 2XEPA 2XGNA 3FYZA 4ZAMA 3ZVWA 1BLSA 1K4FA 3BFGA 3G32A 1ERMA 4X56A 1VM1A 1PWCA 3ITBA 1BT5A 4CJNA 2ZQAA 2EXBA 4DKIA 1KVLA 1ERQA 2PU4A 5FI7A 4QJGA 1MXOA 3QNBA 4GDNA 3IT9A 1ESIA 5HARA 2OLVA 1IKIA 2HP9A 1K25A 4L0LA 4R1GA 3ZHHA 3M2JA 3MZEA 2ZQDA 1K56A 1KGFA 2IWDA 3Q81A 4KZAA 3EQUA 2XQZA 3OC2A 2BG1A 3A3DA 3SS3A 3C4OA 4OKPA 4X53A 1RGZA 3UPPA 3ZG0A 2XR0A 2R9WA 4DE2A 1DJAA 5HAIA 4O7DA 2EFUA 5GHYA 3C4PA 3VFHA 4DDSA 2OV5A 5E43A 3UDIA 4OOLA 4E3JA 3BEBA 1KDSA 4K0WA 2DNSA 2Z2LB 4LCLA 4BENA 3Q7ZA 2WGWA 3BFDA 4RX3A 3BFCA 2WGIA 1FCOA 2WZXA 3HUOA 2ZQ8A 2WAEA 3MKFA 1HD8A 4LCMA 4FH2A 4Q8IA 1Q2QA 1K57C 1GHMA 3DW0A 4E3MA 3Q7VA 3W4PA 1W7FA 5EOEA 2A3UA 4BD1A 1BLCA 3NCKA 4Y0OA 3I7JA 4R0QA 1BULA 1YMSA 3AGDA 5FSRA 1SKFA 2ZQ9A 5GLAA 3V3SA 3CZDA 3ZCZA 2ZC6B 1I2WA 1XKZA 4BJPA 1CI9A 1K57A 1NRFA 3SH9A 5FATA 5CERA 1JVJA 2XDMA 1BLHA 1ALQA 1E25A 4WBGA 5J8XA 4IVKA 3UE1A 2H0TA 4KZ9A 2J8YA 5BOHA 4PM6A 1BLPA 4GZBA 4KZ5A 4Z9QA 3HLDA 4FCFA 2DCFA 3A3EA 2V1ZA 3P09A 2IWCA 4OQIA 3VSKA 2VGKA 1ZG4A 2Y91A 3A3FA 4EBLA 1IKGA 3HLEA 3FV7A 4KZ8A 4OH0A 5DTTA 5EE8A 1H8ZA 3IXDA 3ZG7B 3C7UA 5EUAA 5GLDA 5F83A 4P6BA 3DTMA 1KE0A 5CGSA 3BLMA 1PYYA 4MBFA 4LV2A 4JLFA 3ZNTA 1VQQA 3O3VA 3BYDA 4R4SA 4DE0A 2ZM2A 4X69A 3IH9A 3PTEA 4P0MA 2WKEA 1N9BA 1GHPA 1HTZA 2Y59A 1Z6FA 2C5WB 4BLMA 4QB8A 3UO9A 1LI0A 1K56D 4FD8A 4X6TA 4GB7A 4RVAA 2XLNA 4C6YA 4C75A 1NXYA 1PZPA 4GOGA 3SH8A 4YINA 3IH8A 3NY4A 1Y54A 4KG5A 3VMAA 4BQMA 1IELA 2V20A 3OCNA 1IYPA 2ZC5B 2ZM8A 4Y0UA 5HX9A 2HDSA 5EPHA 4GDBA 2Y2NA 4WELA 3W4OA 4JKTA 5HW3A 1LHYA 1EI5A 5G18A 4ZJ2A 2ZQ7A 4D2OA 1YT4A 1YLWA 5FQIA 1E3UA 2Y2HA 2RCXA 5EVIA 3FWLA 5TGFA 4S2IA 1AXBA 2J9OA 2Q9NA 1PWGA 2ZD8A 1QMEA 5F82A 2IWBA 5A93A 5CHMA 2WKIA 4OPYA 4JF5A 1GCEA 3G34A 1K55A 4OPRA 4U0TA 5M19A 1XX2A 3MXSA 3PAGA 1WYBA 3G35A 4LENA 4UHUA 2ZQCA 3AGFA 5IHVA 4GKUA 3MFDA 4UAAA 4QY6A 4IBXA 3E2KA 2WZZA 4MBHA 4QU3A 2HPBA 3HLBA 4X55A 1S0WA 1W8QA 4R3BA 1JWPA 4ID4A 1MWTA 2R9XA 3O87A 1ES3A 4OP8A 4U3TA 1LI9A 4JXVA 3GV9A 3WRZA 4PM5A 3Q7VB 1XGIA 2VGJA 4RA7A 2HP5A 4E3NA 2WUQA 4EBNA 4XUXA 4XXRA 1SDNA 2CC1A 5AQ9A 4HBUA 2OLUA 4B4ZA 1TEMA 1IYSA 4DE3A 2ZC4B 1IYOA 2Y2IA 5CTNA 2Y55A 5A91A 3ZGAB 3GVBA 4RX2A 2H10A 4HESA 4LV0A 1E4DA 5A92A 3G2ZA 5AQAA 4ZBEA 3HL9A 1QMFA 1K6SA 4R23A 1PW1A 1H8YA 4OP5A 2XH9A 4ZTKA 5FQQA 1K54C 3OZHA 4DXBA 2I72A 3OPLA 3QHYA 3N4IA 1BUEA 4PMAA 1G6AA 3PBOA 1W8YA 5KMWA 5EOOA 4IEDA 3JYIA 3UNWA 4S2KA 3O88A 4N9LA 2EX9A 4GN2A 4KZ4A 2XFSA 3IHBA 3HLWA 5M18A 1FSWA 5CXWA 4GD8A 3ZFZA 2H0YA 2ZM0A 3IXHA 2X71A 3LEZA 5FI6A 1NY0A 2WYXA 4JF4A 4PM9A 2J9PA 4DRTA 4IBRA 5L2FA 1L0FA 2HDQA 5CEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EXA A;  3FKV A;  3WS5 A;  1ES5 A;  3ZNY A;  1I5Q A;  1XPB A;  3TSG A;  4OQH A;  4OPZ A;  3N8L A;  3LCE A;  3GR2 A;  3PBQ A;  4E6W A;  3UE0 A;  5F1G A;  2EX8 A;  4MEZ A;  4OVD A;  2Q9M A;  1GA0 A;  3HUM A;  3Q07 A;  2JCH A;  3PAE A;  5KSC A;  3IWO A;  5KSH A;  3LY3 A;  3V39 A;  5E2F A;  3WS1 A;  3VOZ A;  2WAF A;  3TG9 A;  3NDE A;  3N6I A;  3ZVT A;  2EFX A;  1FR1 A;  3ISG A;  1PZO A;  5EVI D;  1XGJ A;  2XK1 A;  4B88 A;  3FZC A;  3NBL A;  1YMX A;  3B3X A;  5A90 A;  1KE4 A;  2Y2P A;  3PBT A;  3O86 A;  4IVI A;  4OQG A;  4WEJ A;  1H5X A;  3W8K A;  3IXG A;  3IXB A;  1TDL A;  4OON A;  1ZC2 A;  3N8R A;  4UA9 A;  2ZMA A;  4GNU A;  1KGE A;  1W79 A;  3WWX A;  1IYQ A;  3BFE A;  3D4F A;  1SCW A;  2A49 A;  2HDU A;  1MY8 A;  3S4X A;  3V5M A;  4XUZ A;  4BL2 A;  3S1Y A;  4PM8 A;  1MWU A;  1J9M A;  1CI8 A;  3OPH A;  3C7V A;  5CEC A;  2JC7 A;  3QNC A;  5EVI B;  2XD5 A;  2UWX A;  4MNR A;  5FQK A;  4WEK A;  4YFM A;  1KE3 A;  4P85 A;  1YLT A;  3HLG A;  5I94 A;  1DY6 A;  1RCJ A;  2Y2L A;  3A3I A;  1CEG A;  3IF6 C;  1KVM A;  2ZC7 A;  5AQB A;  3G30 A;  5FQJ A;  2V2F F;  4UA7 A;  1JTG A;  1FCN A;  2Z2M B;  3SH7 A;  2ZC3 B;  3NC8 A;  3HRE A;  3GRJ A;  4ZJ1 A;  1ZG6 A;  1MBL A;  1LLB A;  3HBR A;  3PBN A;  1PI4 A;  4NET A;  4K91 A;  1ESU A;  2BLS A;  4OPQ A;  2Y2G A;  5M1A A;  3VP4 A;  4F94 A;  1CEF A;  1K38 A;  4OLD A;  4JBF A;  3WRT A;  3IF6 A;  3RXW A;  1XA1 A;  1C3B A;  5EVL A;  1YLJ A;  1GHI A;  5CRF A;  3SS5 A;  2Y2M A;  2P9V A;  3VP3 A;  4OQ0 A;  3OPP A;  2Y2K A;  5TR7 A;  1MKI A;  2EX6 A;  5JYO A;  3S22 A;  1RP5 A;  1KDW A;  2GDN A;  3AGE A;  1OME A;  2P74 A;  1BSG A;  1ONG A;  4OLG A;  4H8R A;  4FH4 A;  2ZJ9 A;  4EWF A;  2WGW B;  1XXM A;  1O7E A;  4KQO A;  1JTD A;  1PW8 A;  4E3I A;  2Y2Q A;  3M6B A;  5CHU A;  1WYC A;  1K4E A;  3G2Y A;  4HBT A;  5CEB A;  4E3K A;  1CK3 A;  1ES2 A;  4S2N C;  4KZ6 A;  5FAS A;  4EQI A;  3MZF A;  3P98 A;  3G4P A;  3PBR A;  5F1F A;  3V3R A;  4LV1 A;  1BZA A;  3BM6 A;  3CJM A;  1YLY A;  4MBK A;  3VP1 A;  5FAQ A;  3WS0 A;  4S2L A;  5CHJ A;  2XFT A;  1SHV A;  2XF3 A;  2C6W B;  1U60 A;  3GQZ A;  3PBS A;  4QY5 A;  5FAO A;  3VFF A;  4GD6 A;  4S2J A;  3WS4 A;  3MKE A;  4ZJ3 A;  1WE4 A;  3G31 A;  3RJU A;  1FCM A;  1S6R A;  3A3J A;  2EX2 A;  2ZLY A;  3E2L A;  3FKW A;  5U47 A;  2JE5 A;  4QHC A;  3DWZ A;  3BFF A;  4S2N A;  5EEC A;  3UY6 A;  3VOY A;  2B5R A;  2Y4A A;  4JPM A;  1FR6 A;  5FQ9 A;  4QD4 A;  3UN7 A;  1HVB A;  5AQ7 A;  1DJC A;  3OPR A;  4RYE A;  4KZ7 A;  5JYP A;  3MXR A;  4EBP A;  1G68 A;  1KGG A;  3ITA A;  5CGX A;  3ZDJ A;  4WMC A;  5HAQ A;  1SDE A;  4KZ3 A;  4KG6 A;  5GHZ A;  3OCL A;  1ES4 A;  3UDX A;  3NDG A;  3UDF A;  2FFY A;  4WZ4 A;  4KQQ A;  3HVF A;  5KZH A;  1TDG A;  1MPL A;  1K54 A;  4OOM A;  4HEF A;  1EWZ A;  3GTC A;  5E2E A;  3UPN A;  4DDY A;  2G2U A;  3NIA A;  5FQM A;  2G2W A;  3GMW A;  1I2S A;  3SS4 A;  4WZ5 C;  1M6K A;  1L0E A;  3RXX A;  1NJ4 A;  1K6R A;  5D3O A;  4N1H A;  1BTL A;  4Y7P A;  2PBY A;  1PI5 A;  1TVF A;  3IWQ A;  5DF7 A;  4ZDX A;  1XP4 A;  5DF8 A;  4NK3 A;  2WKH A;  5DF9 A;  4R4R A;  1PWD A;  5HFO A;  4N1X A;  1L0D A;  2QZ6 A;  4N92 A;  3TOI A;  4N9K A;  5GL9 A;  3IWI A;  4KQR A;  1E3U D;  4WZ5 A;  4X68 A;  3BEC A;  1YLP A;  3CMZ A;  4DXC A;  2QMI A;  3LO7 A;  4MLL A;  4UA6 A;  4A5R A;  2WK0 A;  1DJB A;  1RGY A;  5FDH A;  1HZO A;  3DWK A;  3VP0 A;  3N8S A;  2RL3 A;  2WGV A;  3LY4 A;  3WS2 A;  3W4Q A;  3Q82 A;  3EQV A;  4JXS A;  4KZB A;  2E8I A;  4E3O A;  3HLF A;  3ZG5 A;  2J7V A;  3IQA A;  4CPK A;  5DTS A;  1O07 A;  1L2S A;  4LV3 A;  2JBF A;  3UE3 A;  1MWS A;  4C3Q A;  5E2G A;  2WAD A;  2H5S A;  4PPR A;  4KG2 A;  3MZD A;  1IEM A;  1NYY A;  1LL9 A;  3HLC A;  1MWR A;  4FSF A;  4OOY A;  5GLB A;  2X01 A;  2X02 A;  4WYY A;  4BL3 A;  3IF6 B;  2XD1 A;  4PM7 A;  4S2O A;  4U0X A;  4DE1 A;  4E6X A;  3IHA A;  3UPO A;  5CGW A;  3VSL A;  1FOF A;  1NYM A;  4BD0 A;  1W5D A;  2P9V B;  5DVA A;  2HP6 A;  1L0G A;  4B4X A;  3VP2 A;  4EUZ A;  4JXG A;  4S2M A;  4EV4 A;  3ZG8 B;  4E3L A;  5FI2 A;  4P87 A;  1LL5 A;  4R3J A;  5DTK A;  3CG5 A;  3IF5 A;  3SOI A;  4DF6 A;  2PU2 A;  4JXW A;  1YLZ A;  3V50 A;  1JWV A;  1GA9 A;  1M40 A;  4S2P A;  1FSY A;  5GLC A;  4KEN B;  1ERO A;  1NZO A;  1ONH A;  4WM9 A;  5TFQ A;  5HL1 A;  2DRW A;  3NI9 A;  5E2H A;  5EVI C;  1FQG A;  1ZKJ A;  3M2K A;  5CTM A;  4K0X A;  3ZG9 B;  2HDR A;  1PIO A;  1YQS A;  3Q1F A;  1Q2P A;  5GHX A;  1XA7 A;  4WMC D;  2OSU A;  4JF6 A;  3HUN A;  2QPN A;  2Y2O A;  2Y2J A;  3BLS A;  3N7W A;  1K55 C;  4M3K A;  1N4O A;  5FAP A;  5FA7 A;  3GSG A;  3M6H A;  3C5A A;  3MBZ A;  2FFF B;  5HAP A;  1JWZ A;  3BRM A;  1YM1 A;  4Y0T A;  1NZU A;  2XEP A;  2XGN A;  3FYZ A;  4ZAM A;  3ZVW A;  1BLS A;  1K4F A;  3BFG A;  3G32 A;  1ERM A;  4X56 A;  1VM1 A;  1PWC A;  3ITB A;  1BT5 A;  4CJN A;  2ZQA A;  2EXB A;  4DKI A;  1KVL A;  1ERQ A;  2PU4 A;  5FI7 A;  4QJG A;  1MXO A;  3QNB A;  4GDN A;  3IT9 A;  1ESI A;  5HAR A;  2OLV A;  1IKI A;  2HP9 A;  1K25 A;  4L0L A;  4R1G A;  3ZHH A;  3M2J A;  3MZE A;  2ZQD A;  1K56 A;  1KGF A;  2IWD A;  3Q81 A;  4KZA A;  3EQU A;  2XQZ A;  3OC2 A;  2BG1 A;  3A3D A;  3SS3 A;  3C4O A;  4OKP A;  4X53 A;  1RGZ A;  3UPP A;  3ZG0 A;  2XR0 A;  2R9W A;  4DE2 A;  1DJA A;  5HAI A;  4O7D A;  2EFU A;  5GHY A;  3C4P A;  3VFH A;  4DDS A;  2OV5 A;  5E43 A;  3UDI A;  4OOL A;  4E3J A;  3BEB A;  1KDS A;  4K0W A;  2DNS A;  2Z2L B;  4LCL A;  4BEN A;  3Q7Z A;  2WGW A;  3BFD A;  4RX3 A;  3BFC A;  2WGI A;  1FCO A;  2WZX A;  3HUO A;  2ZQ8 A;  2WAE A;  3MKF A;  1HD8 A;  4LCM A;  4FH2 A;  4Q8I A;  1Q2Q A;  1K57 C;  1GHM A;  3DW0 A;  4E3M A;  3Q7V A;  3W4P A;  1W7F A;  5EOE A;  2A3U A;  4BD1 A;  1BLC A;  3NCK A;  4Y0O A;  3I7J A;  4R0Q A;  1BUL A;  1YMS A;  3AGD A;  5FSR A;  1SKF A;  2ZQ9 A;  5GLA A;  3V3S A;  3CZD A;  3ZCZ A;  2ZC6 B;  1I2W A;  1XKZ A;  4BJP A;  1CI9 A;  1K57 A;  1NRF A;  3SH9 A;  5FAT A;  5CER A;  1JVJ A;  2XDM A;  1BLH A;  1ALQ A;  1E25 A;  4WBG A;  5J8X A;  4IVK A;  3UE1 A;  2H0T A;  4KZ9 A;  2J8Y A;  5BOH A;  4PM6 A;  1BLP A;  4GZB A;  4KZ5 A;  4Z9Q A;  3HLD A;  4FCF A;  2DCF A;  3A3E A;  2V1Z A;  3P09 A;  2IWC A;  4OQI A;  3VSK A;  2VGK A;  1ZG4 A;  2Y91 A;  3A3F A;  4EBL A;  1IKG A;  3HLE A;  3FV7 A;  4KZ8 A;  4OH0 A;  5DTT A;  5EE8 A;  1H8Z A;  3IXD A;  3ZG7 B;  3C7U A;  5EUA A;  5GLD A;  5F83 A;  4P6B A;  3DTM A;  1KE0 A;  5CGS A;  3BLM A;  1PYY A;  4MBF A;  4LV2 A;  4JLF A;  3ZNT A;  1VQQ A;  3O3V A;  3BYD A;  4R4S A;  4DE0 A;  2ZM2 A;  4X69 A;  3IH9 A;  3PTE A;  4P0M A;  2WKE A;  1N9B A;  1GHP A;  1HTZ A;  2Y59 A;  1Z6F A;  2C5W B;  4BLM A;  4QB8 A;  3UO9 A;  1LI0 A;  1K56 D;  4FD8 A;  4X6T A;  4GB7 A;  4RVA A;  2XLN A;  4C6Y A;  4C75 A;  1NXY A;  1PZP A;  4GOG A;  3SH8 A;  4YIN A;  3IH8 A;  3NY4 A;  1Y54 A;  4KG5 A;  3VMA A;  4BQM A;  1IEL A;  2V20 A;  3OCN A;  1IYP A;  2ZC5 B;  2ZM8 A;  4Y0U A;  5HX9 A;  2HDS A;  5EPH A;  4GDB A;  2Y2N A;  4WEL A;  3W4O A;  4JKT A;  5HW3 A;  1LHY A;  1EI5 A;  5G18 A;  4ZJ2 A;  2ZQ7 A;  4D2O A;  1YT4 A;  1YLW A;  5FQI A;  1E3U A;  2Y2H A;  2RCX A;  5EVI A;  3FWL A;  5TGF A;  4S2I A;  1AXB A;  2J9O A;  2Q9N A;  1PWG A;  2ZD8 A;  1QME A;  5F82 A;  2IWB A;  5A93 A;  5CHM A;  2WKI A;  4OPY A;  4JF5 A;  1GCE A;  3G34 A;  1K55 A;  4OPR A;  4U0T A;  5M19 A;  1XX2 A;  3MXS A;  3PAG A;  1WYB A;  3G35 A;  4LEN A;  4UHU A;  2ZQC A;  3AGF A;  5IHV A;  4GKU A;  3MFD A;  4UAA A;  4QY6 A;  4IBX A;  3E2K A;  2WZZ A;  4MBH A;  4QU3 A;  2HPB A;  3HLB A;  4X55 A;  1S0W A;  1W8Q A;  4R3B A;  1JWP A;  4ID4 A;  1MWT A;  2R9X A;  3O87 A;  1ES3 A;  4OP8 A;  4U3T A;  1LI9 A;  4JXV A;  3GV9 A;  3WRZ A;  4PM5 A;  3Q7V B;  1XGI A;  2VGJ A;  4RA7 A;  2HP5 A;  4E3N A;  2WUQ A;  4EBN A;  4XUX A;  4XXR A;  1SDN A;  2CC1 A;  5AQ9 A;  4HBU A;  2OLU A;  4B4Z A;  1TEM A;  1IYS A;  4DE3 A;  2ZC4 B;  1IYO A;  2Y2I A;  5CTN A;  2Y55 A;  5A91 A;  3ZGA B;  3GVB A;  4RX2 A;  2H10 A;  4HES A;  4LV0 A;  1E4D A;  5A92 A;  3G2Z A;  5AQA A;  4ZBE A;  3HL9 A;  1QMF A;  1K6S A;  4R23 A;  1PW1 A;  1H8Y A;  4OP5 A;  2XH9 A;  4ZTK A;  5FQQ A;  1K54 C;  3OZH A;  4DXB A;  2I72 A;  3OPL A;  3QHY A;  3N4I A;  1BUE A;  4PMA A;  1G6A A;  3PBO A;  1W8Y A;  5KMW A;  5EOO A;  4IED A;  3JYI A;  3UNW A;  4S2K A;  3O88 A;  4N9L A;  2EX9 A;  4GN2 A;  4KZ4 A;  2XFS A;  3IHB A;  3HLW A;  5M18 A;  1FSW A;  5CXW A;  4GD8 A;  3ZFZ A;  2H0Y A;  2ZM0 A;  3IXH A;  2X71 A;  3LEZ A;  5FI6 A;  1NY0 A;  2WYX A;  4JF4 A;  4PM9 A;  2J9P A;  4DRT A;  4IBR A;  5L2F A;  1L0F A;  2HDQ A;  5CED A; 
#chains in the Genus database with same CATH topology
 3FKV A;  3PXP A;  1LT0 A;  3N8L A;  3UE0 A;  4OVD A;  3LIB A;  3HUM A;  2JCH A;  2JKT I;  3LY3 A;  5DKK A;  3ZVT A;  3ISG A;  3LGO A;  2XK1 A;  4B88 A;  3NBL A;  1G6O A;  1YMX A;  4PHT A;  5A90 A;  2FH5 A;  2Y2P A;  3LFV A;  1H5X A;  4HJ3 A;  1LSV A;  1TDL A;  1ZC2 A;  2JKF A;  4GNU A;  5J4E A;  3T4J A;  4PM8 A;  3OPH A;  4MNR A;  5FQK A;  1YLT A;  3HLG A;  1DY6 A;  1RCJ A;  2Y2L A;  4GS9 B;  1KVM A;  3U4L P;  4UA7 A;  1JTG A;  4ME4 A;  1MBL A;  4NET A;  4HY8 A;  2BLS A;  2W0N A;  4F94 A;  3IF6 A;  1C3B A;  3SS5 A;  2P9V A;  3MMH A;  4OQ0 A;  1MKI A;  1GSW A;  2OAQ 1;  5FEF A;  2PRF A;  1BSG A;  5J7E A;  1OT9 A;  3BW6 A;  4EWF A;  2WGW B;  1JTD A;  3G2Y A;  2AVX A;  3EEA A;  3F1O A;  4M4X A;  4E3K A;  3LIF A;  5EM1 A;  5F1F A;  5FEG A;  5G4Y A;  3VP1 A;  3WS0 A;  1SHV A;  2C6W B;  1U60 A;  4GD6 A;  4HI4 A;  1WE4 A;  1F98 A;  3G31 A;  4GHI A;  2ZMF A;  2JE5 A;  3R7W B;  5FQ9 A;  4WLA A;  3UN7 A;  1HVB A;  3CPT B;  1DJC A;  3OPR A;  3QP6 A;  2P04 A;  5JYP A;  1G68 A;  5HAQ A;  1SDE A;  4HH2 A;  5GHZ A;  3UDX A;  3NDG A;  4EU0 A;  3HVF A;  3QP4 A;  1K54 A;  1EWZ A;  3GTC A;  4O01 A;  4BBT A;  3SS4 A;  3RXX A;  1DRM A;  5D3O A;  1BTL A;  1TVF A;  3IWQ A;  5DF7 A;  1XP4 A;  2JKG A;  2QZ6 A;  1IOU A;  2QKP A;  1UWP X;  1XJ4 A;  2QMI A;  4A5R A;  2WK0 A;  3HJI A;  3IBR A;  3BQ8 A;  3VP0 A;  3LY4 A;  4JXS A;  4KZB A;  2E8I A;  2HGV A;  2QYB A;  4CPK A;  1SZV A;  1VEU A;  2JBF A;  2V0W A;  1S66 L;  5E2G A;  3LIA A;  4KG2 A;  3MZD A;  1FIK A;  2Z6C A;  4OOY A;  1MWR A;  2X01 A;  2X02 A;  3IF6 B;  4E6X A;  3T1X A;  3FG8 A;  5CGW A;  1OTI A;  3S7Q A;  1W5D A;  2P9V B;  4HOI A;  3MS6 A;  4EV4 A;  3NOU C;  5FI2 A;  2O0Y A;  3V50 A;  4S2P A;  4KEN B;  1T19 A;  1PFL A;  1NZO A;  5TFQ A;  1ZKJ A;  3M2K A;  1PIO A;  5GHX A;  2VV8 A;  4DN0 A;  3LR5 A;  2OSU A;  3KX0 X;  4JF6 A;  2GJ3 A;  2Y2J A;  4M3K A;  1K55 C;  3OLO A;  1N4O A;  3CI6 A;  3M6H A;  5HAP A;  3DTK A;  1NLY A;  4CJN A;  4DKI A;  1KVL A;  1LL8 A;  4MN7 A;  1TF1 A;  2ZMV A;  3KSF A;  1YAX A;  1K25 A;  2INW A;  4BMW A;  3Q81 A;  1N9O A;  3C4O A;  4HJ4 A;  3CLO A;  2XR0 A;  2EA9 A;  2R9W A;  4NKP A;  3RH8 B;  5E43 A;  2PR5 A;  3UDI A;  4GLQ A;  4K0W A;  1CF0 A;  3T4O A;  4BEN A;  2PYR A;  4EEP A;  1FCO A;  4UQI M;  2ZQ8 A;  1HD8 A;  4LCM A;  4FH2 A;  2R78 A;  2J3T C;  2HJ9 C;  3DW0 A;  4E3M A;  3W4P A;  2XA7 S;  4Y3I A;  2A3U A;  3VE3 A;  1BLC A;  2JKR M;  3NCK A;  3L9K A;  5EV0 A;  3V67 A;  5FSR A;  1SKF A;  2ZC6 B;  1T1A A;  3MQQ A;  1CI9 A;  3IS2 A;  1K57 A;  3SH9 A;  4D60 A;  2XDM A;  2L4R A;  4WBG A;  1VEU B;  1OJ5 A;  4IVK A;  3UE1 A;  2V1Z A;  4Y17 A;  1ZG4 A;  3A3F A;  3CIT A;  4B9O A;  5EUA A;  4QWO A;  3T50 A;  2O9C A;  4Y15 A;  2JKR I;  4MBF A;  4DE0 A;  2ZM2 A;  1XJ6 A;  1LI0 A;  2VA0 A;  1K56 D;  3IX4 A;  4FD8 A;  4X6T A;  2J80 A;  1NXY A;  3T12 B;  5HX9 A;  2HDS A;  5AJG A;  4JKT A;  4ZJ2 A;  3JVV A;  4D2O A;  2V8F A;  2Y2H A;  1S67 L;  5EVI A;  3FWL A;  5TGF A;  2IWB A;  2WKI A;  1GCE A;  4OPR A;  2V8C A;  3PAG A;  2Z6D A;  4XT2 A;  4QY6 A;  4DJ3 A;  1YKD A;  4L9E A;  3HLB A;  1W8Q A;  4ID4 A;  3O87 A;  4U3T A;  4EBN A;  2HV1 A;  1SDN A;  5TBM A;  1TS7 A;  2OLU A;  4B4Z A;  1TEM A;  3MXQ A;  5A91 A;  2Y2I A;  5HL6 A;  1S4R A;  4RX2 A;  3FPW A;  2DMW A;  5A92 A;  5AQA A;  4ZBE A;  3LR3 A;  4ZTK A;  4P6Z M;  5FQQ A;  1K54 C;  2W3H A;  4PMA A;  5KMW A;  5EOO A;  3LEQ A;  1KOU A;  2VX8 A;  1OTB A;  3NHQ A;  4YOF A;  5M18 A;  5CXW A;  1W63 Q;  2WYX A;  4PM9 A;  4JF4 A;  1G28 A;  4IBR A;  1L0F A;  2HDQ A;  2FZ0 A;  2EXA A;  2E8J A;  1LSX A;  2W3F A;  3WS5 A;  3EGX C;  4E6W A;  2Q9M A;  2JN7 A;  4NXF A;  3PAE A;  5KSC A;  5KSH A;  3VOZ A;  3NUL A;  4IHQ A;  3N6I A;  2EFX A;  4IVI A;  5A8B A;  4WEJ A;  1TS0 A;  4EER A;  3N8R A;  2GX5 A;  4UA9 A;  3CWF A;  3NOT C;  4MMN A;  1IYQ A;  2HDU A;  3S4X A;  3EGD C;  3BY9 A;  1NWZ A;  4XUZ A;  3V5M A;  3H82 A;  2HJE A;  3CAX A;  4F3L B;  1J9M A;  3C7V A;  5EVI B;  5L10 A;  3DTI A;  1H3Q A;  2ZC7 A;  5AQB A;  5AVE A;  4YWZ A;  3K3C A;  3B47 A;  3NC8 A;  3HRE A;  1MKM A;  3HBR A;  1LLB A;  3CUE A;  1PI4 A;  4K91 A;  4XT2 B;  3VP4 A;  1DP9 A;  4X1M A;  1K38 A;  4OLD A;  4JBF A;  5EVL A;  3T4S A;  2K7S A;  5CRF A;  3VP3 A;  3OPP A;  5JYO A;  3H7W A;  4FUW A;  2V9A A;  5TBM B;  1OME A;  2P74 A;  2WKP A;  1D7E A;  3C8C A;  4BBU A;  4E3I A;  2Y2Q A;  1WYC A;  1K4E A;  5HSQ A;  5CEB A;  1CK3 A;  4EQI A;  3V3R A;  4LV1 A;  3BM6 A;  3CJM A;  4MBK A;  2W1T B;  5FAQ A;  5FAO A;  3HCY A;  4S2J A;  3WS4 A;  1OJG A;  3D9Y A;  2EX2 A;  2ZLY A;  5U47 A;  3FKW A;  4EES A;  4G3W A;  3DWZ A;  4S2N A;  2B5R A;  3VOL A;  5AQ7 A;  3KO6 A;  4RYE A;  4EBP A;  1KGG A;  3ITA A;  4WMC A;  4KG6 A;  3OCL A;  1Y4O A;  2FFY A;  3PHY A;  4KQQ A;  1MPL A;  4HEF A;  4KUO A;  5E2E A;  5HD3 A;  4DDY A;  2B95 A;  2G2U A;  3KSI A;  2G2W A;  4HP9 A;  3GMW A;  1I2S A;  4LLO B;  4CLC A;  4N1H A;  1PI5 A;  1TD5 A;  4NK3 A;  5HFO A;  4I38 A;  3LI8 A;  1E3U D;  4WZ5 A;  4X68 A;  4HHD A;  3CMZ A;  3LO7 A;  4I39 A;  4UA6 A;  1HZO A;  3DWK A;  3N8S A;  2WGV A;  3WS2 A;  3ZG5 A;  3IQA A;  3G6O A;  1L2S A;  4LV3 A;  3D72 A;  4PKY G;  2L0W A;  1IEM A;  2XRO A;  3E4P A;  4BL3 A;  4U0X A;  3IHA A;  1VET A;  3VSL A;  1FOF A;  4BD0 A;  1OTA A;  4I5S A;  5DVA A;  3QP1 A;  4S2M A;  4P87 A;  4R3J A;  3H7W B;  3IF5 A;  2PU2 A;  4JXW A;  1YLZ A;  1GSV A;  1GA9 A;  1M40 A;  3LR4 A;  1FSY A;  4NG2 A;  5GLC A;  5L07 A;  1ERO A;  4WM9 A;  5HL1 A;  3NI9 A;  2HZ5 A;  5EVI C;  1FQG A;  2PHY A;  5CTM A;  3ZG9 B;  4B93 A;  2HDR A;  3Q1F A;  5F69 A;  1Q2P A;  4G3K A;  3DAV A;  1LSW A;  1JWZ A;  5FDS A;  3BRM A;  1YM1 A;  5DKL A;  1NZU A;  2D01 A;  4KUK A;  1K4F A;  1ODV A;  1PWC A;  1A0K A;  2PAV P;  3LUQ A;  3QNB A;  3LIE A;  2ZOH A;  4LRX C;  5HAR A;  2HP9 A;  3U2A A;  1ZHH B;  3MZE A;  4Q0J A;  2ZQD A;  2IWD A;  3OC2 A;  2BG1 A;  2OAP 1;  4DE2 A;  3LIC A;  5GHY A;  3C4P A;  4CLC B;  4E3J A;  4L9F A;  2Y8H A;  4LCL A;  4Q0H A;  3FPV A;  3LI9 A;  3EEH A;  3HUO A;  1OTD A;  1TS6 A;  2V0U A;  4Y2F A;  2VEA A;  2ACG A;  2O9B A;  2WKQ A;  2NUT C;  4Y0O A;  3I7J A;  3TRC A;  2ZQ9 A;  3UB5 P;  4DJ2 A;  5FAT A;  1JVJ A;  1P0Z A;  2H0T A;  4KZ9 A;  2J8Y A;  3TW8 A;  4PM6 A;  1BLP A;  4Z9Q A;  2DCF A;  2IWC A;  4OQI A;  1VET B;  4EBL A;  2Y91 A;  4KZ8 A;  4ARZ A;  4LFU A;  5EE8 A;  2BTF P;  2KOI A;  1H8Z A;  2VZW A;  3C7U A;  1K0K A;  3DTM A;  3BWL A;  1KE0 A;  5CGS A;  3BLM A;  4H6J A;  3ZNT A;  4WL9 A;  3BYD A;  4X69 A;  4BLM A;  4QB8 A;  3LR0 A;  2XLN A;  4C6Y A;  2EWW A;  4YIN A;  3NY4 A;  3F1O B;  3VMA A;  1D1J A;  1IYP A;  2ZM8 A;  2Y2N A;  3ULF A;  1LHY A;  1EI5 A;  2ZQ7 A;  4CLC E;  1YLW A;  1E3U A;  4GW9 A;  1AXB A;  2ZD8 A;  4GHI B;  2I9V A;  1DP6 A;  4OPY A;  4JF5 A;  3UB7 A;  3G34 A;  5M19 A;  2OOL A;  1WYB A;  3NEC A;  4EUV A;  4UAA A;  5G4Z A;  4QU3 A;  4BBV A;  5K5B A;  1MWT A;  2R9X A;  3GEC A;  1LI9 A;  3WRZ A;  4PM5 A;  1XGI A;  4RA7 A;  4LPZ A;  4XXR A;  2CC1 A;  4DE3 A;  2W3G A;  3QP5 A;  2J3W A;  2H10 A;  4LV0 A;  3P7N A;  2W27 A;  3K3D A;  4MDZ A;  4G3V A;  2PDR A;  1V9Y A;  2XH9 A;  4DXB A;  3OZH A;  3OPL A;  2GZA A;  2O9A A;  4QPR A;  1G6A A;  1VHM A;  1W8Y A;  4IED A;  1XFQ A;  3JYI A;  5L8M A;  4N9L A;  2EX9 A;  4GN2 A;  4CLC C;  4KZ4 A;  2XFS A;  3IHB A;  1FSW A;  3ZFZ A;  4GD8 A;  5HPI A;  4IUH A;  4HIA A;  4ARZ B;  5HWW A;  1T18 A;  4II7 A;  1ES5 A;  3ZNY A;  1I5Q A;  1XPB A;  4OQH A;  2W1R A;  3KYE A;  3GR2 A;  3PBQ A;  1T1B A;  1MC0 A;  2Y79 A;  3K2N A;  4H6J B;  5F68 A;  3IWO A;  4CQH A;  4UQI S;  3HJK A;  3WS1 A;  4L9G A;  2WAF A;  3TG9 A;  3NDE A;  2OWJ A;  3PBT A;  4I3A A;  3W8K A;  3IXB A;  4OON A;  3C30 A;  2B18 A;  1KGE A;  1W79 A;  3BFE A;  3D4F A;  1SCW A;  5TJJ A;  2VGL M;  1F2K A;  3S1Y A;  4WF0 A;  1P9W A;  1CI8 A;  2JC7 A;  2XD5 A;  2PD7 A;  1P97 A;  2UWX A;  5I94 A;  3KSG A;  3IF6 C;  1F5M A;  5FQJ A;  1FCN A;  3PBN A;  2A2L A;  1ESU A;  4OPQ A;  1OTE A;  2QJ7 A;  1CEF A;  3WRT A;  3RXW A;  1GHI A;  4MCW A;  2Y2K A;  3F1N A;  5TR7 A;  2EX6 A;  1RP5 A;  1DP8 A;  3AGE A;  2IA2 A;  2J3T D;  2ZJ9 A;  1O7E A;  5EVE A;  5CHU A;  2WKR A;  5KIZ A;  4HBT A;  1N9L A;  1ES2 A;  5FAS A;  3PBR A;  3BY8 A;  1BZA A;  5CX7 A;  4WN5 A;  2B02 A;  4S2L A;  3PBS A;  3VFF A;  2XF3 A;  1GSX A;  2LB9 A;  3MKE A;  4ZJ3 A;  1FCM A;  5F6A A;  4Z1W A;  4IUK A;  3A3J A;  3IS2 B;  3BFF A;  3VOY A;  2Y4A A;  4JPM A;  1FR6 A;  3MF0 A;  3MXR A;  3OOV A;  2QHK A;  2M7U A;  3ZDJ A;  5CGX A;  1ES4 A;  3UDF A;  4WZ4 A;  3UB9 A;  5KZH A;  4KQD A;  5HDC A;  3UPN A;  5FQM A;  1M6K A;  1L0E A;  1NJ4 A;  4Y7P A;  2QJ5 A;  4ZDX A;  5DF9 A;  1N9N A;  1WA9 A;  1PWD A;  3PR6 A;  1L0D A;  3TOI A;  4N9K A;  2PBD P;  4KQR A;  5EFW A;  1ZTU A;  3BEC A;  4P6Z S;  5DFX A;  1OPX A;  1DJB A;  5FDH A;  3MSH A;  1P9R A;  4O8G A;  3MR0 A;  4E3O A;  3C38 A;  1O07 A;  2KX6 A;  4C3Q A;  3CHW P;  2WAD A;  3A0V A;  3HLC A;  1NYY A;  3ZG8 B;  5GLB A;  4FSF A;  4S2O A;  2XD1 A;  4DE1 A;  4FTX A;  3TJZ C;  1NYM A;  1UGU A;  5C5K A;  4B4X A;  2ZOI A;  4JXG A;  3F1N B;  4NXB A;  1MZU A;  4DF6 A;  3CG5 A;  4HP4 A;  5E2H A;  5EM0 A;  2JHE A;  2VJW A;  1YQS A;  4AFI A;  3BJN A;  4BWI A;  3HUN A;  2QPN A;  3BLS A;  3N7W A;  3C5A A;  3MBZ A;  2FFF B;  5MC7 A;  4Y0T A;  2XGN A;  3FYZ A;  4ZAM A;  1BLS A;  4X56 A;  3BFG A;  3G32 A;  4NXG A;  1VM1 A;  3UE6 A;  4GS9 A;  3ITB A;  2ZQA A;  5IU1 A;  2W3D A;  2EXB A;  3EWK A;  3A0S A;  3UB8 A;  3IT9 A;  1ESI A;  3RFB A;  2OLV A;  4R1G A;  1YSP A;  1K56 A;  1KGF A;  2XQZ A;  4X53 A;  5DJU A;  3VFH A;  4DDS A;  4EQ1 A;  4HJ6 A;  4OOL A;  2VLG A;  5LBR A;  2DNS A;  3FC7 A;  3Q7Z A;  2WGW A;  5I5L A;  3BFD A;  4JGQ A;  4FOF A;  2WGI A;  4E04 A;  2WAE A;  4EXO A;  1K57 C;  4PKY A;  3Q7V A;  5EOE A;  4BD1 A;  4R0Q A;  1YMS A;  5GLA A;  3ZCZ A;  2ZBB A;  1I2W A;  4BJP A;  4HNB A;  5CER A;  3S7N A;  3R7W A;  1Y28 A;  1BLH A;  1ALQ A;  3H82 B;  3CPT A;  5BOH A;  4GZB A;  3KYZ A;  4FCF A;  3A3E A;  4HQA A;  2VGK A;  1IKG A;  3HLE A;  1L3L A;  5DTT A;  2PYP A;  3IXD A;  3ZG7 B;  4EEU A;  3DTE A;  4Q0I A;  1H0M A;  3C2W A;  4HH3 A;  3UMD A;  5IT5 A;  1PYY A;  4LV2 A;  1VQQ A;  3O3V A;  4YNR A;  3QP2 A;  3BQA A;  1IFQ A;  3IH9 A;  3PTE A;  2WKE A;  4DMZ A;  1GHP A;  1HTZ A;  2Y59 A;  1S1Z A;  3UO9 A;  1T1C A;  2OWH A;  2UV0 E;  3IH8 A;  1Y54 A;  4KG5 A;  4BQM A;  2ZC5 B;  4WEL A;  4RQ9 A;  1YT4 A;  4MN5 A;  2RCX A;  2J9O A;  4MN6 A;  5F82 A;  1FIL A;  4NXE A;  5CHM A;  3MJQ A;  4U0T A;  1XX2 A;  1S4S A;  5F5Y A;  4GKU A;  4IBX A;  3E2K A;  4MBH A;  3LYX A;  4R3B A;  2G7U A;  4OP8 A;  3UME A;  1JNU A;  5HD5 A;  3EOI A;  3Q7V B;  2VGJ A;  2HP5 A;  4XUX A;  4HBU A;  3T4Q A;  2XSS A;  1IYO A;  5DFY A;  2Y55 A;  3R4K A;  1BYW A;  1S1Y A;  3GVB A;  2O99 A;  4HES A;  3G2Z A;  3HL9 A;  1QMF A;  3H9W A;  1K6S A;  4R23 A;  1PW1 A;  1H8Y A;  1G5U A;  2I72 A;  3QHY A;  2XRN A;  3OBF A;  3RTY A;  4I3J A;  2K31 A;  3UNW A;  1J3W A;  2PD8 A;  3IXH A;  2X71 A;  3LEZ A;  1NY0 A;  2J9P A;  3KSH A;  5CED A;  1CJF A;  3TSG A;  4OPZ A;  4UEY A;  4Y5F A;  3LCE A;  2MJ6 A;  5F1G A;  2EX8 A;  4MEZ A;  1GA0 A;  3MFX A;  3Q07 A;  3V39 A;  5E2F A;  1FR1 A;  1PZO A;  5EVI D;  3JPU A;  1XGJ A;  4R38 A;  3FZC A;  1TS8 A;  3B3X A;  1KE4 A;  1XJ3 A;  3O86 A;  4OQG A;  3S7O A;  3IXG A;  3GDI A;  2ZMA A;  3WWX A;  2A49 A;  4LGW A;  1MY8 A;  4BL2 A;  1AWI A;  5L09 A;  1MWU A;  3PYP A;  5CEC A;  4WUJ A;  3QNC A;  3CUE C;  3LID A;  4WEK A;  4YFM A;  1KE3 A;  4P85 A;  2K2N A;  1CEG A;  3A3I A;  3G30 A;  2V2F F;  2Z2M B;  3SH7 A;  1H8M A;  1XFN A;  1STZ A;  2ZC3 B;  3GRJ A;  4ZJ1 A;  1ZG6 A;  5HZH A;  3NOP C;  2Y2G A;  5M1A A;  2BAS A;  1XA1 A;  1YLJ A;  1PRQ A;  2Y2M A;  1HLU P;  3S22 A;  3T1S A;  1KDW A;  1YSQ A;  2GDN A;  3IX3 A;  3T1R A;  2KDK A;  1ONG A;  4OLG A;  4H8R A;  4FH4 A;  4KQO A;  1XXM A;  1PW8 A;  3M6B A;  4R70 A;  3DBA A;  2XA7 M;  1NLZ A;  4KZ6 A;  4S2N C;  3MZF A;  3P98 A;  3G4P A;  3T4T A;  4GJ4 A;  4GCZ A;  1YLY A;  4I3I A;  5CHJ A;  2XFT A;  3GQZ A;  3NJA A;  4QY5 A;  3O5Y A;  3RJU A;  1S6R A;  3E2L A;  4QHC A;  2VKS A;  5EEC A;  3UY6 A;  3E4Q A;  4QD4 A;  4KZ7 A;  4KZ3 A;  3VE4 A;  3E98 A;  5HDD A;  1TDG A;  4OOM A;  2GNX A;  3E0Y A;  3NIA A;  4WZ5 C;  5FL3 A;  1K6R A;  2PBY A;  4X1L A;  4ZRR A;  2L1M A;  3ZQ5 A;  5DF8 A;  2WKH A;  4R4R A;  4N1X A;  4N92 A;  2HF6 A;  5GL9 A;  3IWI A;  3IBJ A;  1YLP A;  2NUP C;  4DXC A;  4MLL A;  1F9I A;  1Z09 A;  1RGY A;  4ETZ A;  2RL3 A;  3TE8 A;  3W4Q A;  3Q82 A;  3EQV A;  1YPR A;  3HLF A;  2J7V A;  3JVU A;  5DTS A;  1NRJ A;  3UE3 A;  1MWS A;  3MQO A;  4PPR A;  2H5S A;  3F1P A;  1LL9 A;  4WYY A;  2V1B A;  4PM7 A;  5IS1 A;  3UPO A;  4Y13 A;  2M1C A;  1L0G A;  2HP6 A;  3VP2 A;  4EUZ A;  4E3L A;  4JGP A;  1LL5 A;  5DTK A;  3SOI A;  1JWV A;  2PR6 A;  1ONH A;  2DRW A;  2D02 A;  3L7H A;  4K0X A;  1XA7 A;  4WMC D;  3UB6 A;  2Y2O A;  2LB5 A;  5FAP A;  5FA7 A;  3ICY A;  3GSG A;  2VGL S;  4F3L A;  2XEP A;  3ZVW A;  5DJT A;  3MQ0 A;  1ERM A;  1EW0 A;  2M7V A;  1BT5 A;  2A24 A;  1ERQ A;  2PU4 A;  5FI7 A;  4CLC D;  4QJG A;  1MXO A;  2YKH A;  4GDN A;  1SKO A;  4NEE D;  1D06 A;  1IKI A;  3T1Q B;  4L0L A;  3ZHH A;  3M2J A;  1OT6 A;  3QP8 A;  3W2Z A;  4KZA A;  1X0O A;  3EQU A;  3A3D A;  3SS3 A;  4OKP A;  1RGZ A;  3UPP A;  3ZG0 A;  4PAU A;  1DJA A;  5HAI A;  4O7D A;  2EFU A;  4JGR A;  2OV5 A;  4JGO A;  1XJ2 A;  3BEB A;  1KDS A;  2Z2L B;  2EWV A;  4RX3 A;  2VK3 A;  3BFC A;  2QWS A;  2WZX A;  1ACF A;  3MKF A;  2VV6 A;  5AVF A;  1W63 M;  4Q8I A;  1Q2Q A;  3A0R A;  4R3A A;  1GHM A;  4LRY C;  1W7F A;  4LRZ E;  1PNE A;  2W1T A;  1BUL A;  2P7J A;  3AGD A;  3V3S A;  3CZD A;  1XKZ A;  3B33 A;  1NRF A;  2W3E A;  1E25 A;  5J8X A;  4KZ5 A;  1UWN X;  3F1P B;  3HLD A;  2ZL1 A;  3P09 A;  3VSK A;  4ESP A;  3FV7 A;  4OH0 A;  3KYQ A;  3SW1 A;  5GLD A;  5F83 A;  4P6B A;  4ETX A;  5J3W A;  2KLI A;  2V1A A;  4JLF A;  4R4S A;  4EET B;  4P0M A;  1N9B A;  5HDS A;  1Z6F A;  2C5W B;  4R6L A;  4GB7 A;  4RVA A;  4C75 A;  1PZP A;  3ZYT A;  4GOG A;  3SH8 A;  2A24 B;  1IEL A;  4Y0U A;  2V20 A;  3OCN A;  4O0P A;  2P08 A;  5EPH A;  4GDB A;  3T4L A;  1V9Z A;  3E4O A;  3IX8 A;  1VB6 A;  3W4O A;  5HW3 A;  2PT7 A;  5G18 A;  1SKO B;  5FQI A;  4EW7 A;  4S2I A;  2YKF A;  2Q9N A;  1PWG A;  1QME A;  3P01 A;  2Q0O A;  5A93 A;  2VV7 A;  1CQA A;  1K55 A;  4IJG A;  3MXS A;  4LEN A;  3G35 A;  4UHU A;  2ZQC A;  3AGF A;  5HWV A;  5IHV A;  3T4K A;  3MFD A;  2WZZ A;  2HPB A;  4X55 A;  1S0W A;  1JWP A;  3D3O A;  1ES3 A;  4JXV A;  3GV9 A;  4E3N A;  2WUQ A;  5AQ9 A;  2JKT M;  1IYS A;  2ZC4 B;  5CTN A;  4X25 A;  3ZGA B;  1E4D A;  4OP5 A;  3N4I A;  1BUE A;  3PBO A;  3B42 A;  3VV4 A;  5HPF A;  2H28 A;  4S2K A;  2ZL1 B;  3O88 A;  2CMN A;  3HLW A;  5HWT A;  2H0Y A;  3SZT A;  2ZM0 A;  4K08 A;  5FI6 A;  3S7P A;  4DRT A;  5L2F A; 
#chains in the Genus database with same CATH homology
 2EXA A;  3FKV A;  3WS5 A;  1ES5 A;  3ZNY A;  1I5Q A;  1XPB A;  3TSG A;  4OQH A;  4OPZ A;  3N8L A;  3LCE A;  3GR2 A;  3PBQ A;  4E6W A;  3UE0 A;  5F1G A;  2EX8 A;  4MEZ A;  4OVD A;  2Q9M A;  1GA0 A;  3HUM A;  3Q07 A;  2JCH A;  3PAE A;  5KSC A;  3IWO A;  5KSH A;  3LY3 A;  3V39 A;  5E2F A;  3WS1 A;  3VOZ A;  2WAF A;  3TG9 A;  3NDE A;  3N6I A;  3ZVT A;  2EFX A;  1FR1 A;  3ISG A;  1PZO A;  5EVI D;  1XGJ A;  2XK1 A;  4B88 A;  3FZC A;  3NBL A;  1YMX A;  3B3X A;  5A90 A;  1KE4 A;  2Y2P A;  3PBT A;  3O86 A;  4IVI A;  4OQG A;  4WEJ A;  1H5X A;  3W8K A;  3IXG A;  3IXB A;  1TDL A;  4OON A;  1ZC2 A;  3N8R A;  4UA9 A;  2ZMA A;  4GNU A;  1KGE A;  1W79 A;  3WWX A;  1IYQ A;  3BFE A;  3D4F A;  1SCW A;  2A49 A;  2HDU A;  1MY8 A;  3S4X A;  3V5M A;  4XUZ A;  4BL2 A;  3S1Y A;  4PM8 A;  1MWU A;  1J9M A;  1CI8 A;  3OPH A;  3C7V A;  5CEC A;  2JC7 A;  3QNC A;  5EVI B;  2XD5 A;  2UWX A;  4MNR A;  5FQK A;  4WEK A;  4YFM A;  1KE3 A;  4P85 A;  1YLT A;  3HLG A;  5I94 A;  1DY6 A;  1RCJ A;  2Y2L A;  3A3I A;  1CEG A;  3IF6 C;  1KVM A;  2ZC7 A;  5AQB A;  3G30 A;  5FQJ A;  2V2F F;  4UA7 A;  1JTG A;  1FCN A;  2Z2M B;  3SH7 A;  2ZC3 B;  3NC8 A;  3HRE A;  3GRJ A;  4ZJ1 A;  1ZG6 A;  1MBL A;  1LLB A;  3HBR A;  3PBN A;  1PI4 A;  4NET A;  4K91 A;  1ESU A;  2BLS A;  4OPQ A;  2Y2G A;  5M1A A;  3VP4 A;  4F94 A;  1CEF A;  1K38 A;  4OLD A;  4JBF A;  3WRT A;  3IF6 A;  3RXW A;  1XA1 A;  1C3B A;  5EVL A;  1YLJ A;  1GHI A;  5CRF A;  3SS5 A;  2Y2M A;  2P9V A;  3VP3 A;  4OQ0 A;  3OPP A;  2Y2K A;  5TR7 A;  1MKI A;  2EX6 A;  5JYO A;  3S22 A;  1RP5 A;  1KDW A;  2GDN A;  3AGE A;  1OME A;  2P74 A;  1BSG A;  1ONG A;  4OLG A;  4H8R A;  4FH4 A;  2ZJ9 A;  4EWF A;  2WGW B;  1XXM A;  1O7E A;  4KQO A;  1JTD A;  1PW8 A;  4E3I A;  2Y2Q A;  3M6B A;  5CHU A;  1WYC A;  1K4E A;  3G2Y A;  4HBT A;  5CEB A;  4E3K A;  1CK3 A;  1ES2 A;  4S2N C;  4KZ6 A;  5FAS A;  4EQI A;  3MZF A;  3P98 A;  3G4P A;  3PBR A;  5F1F A;  3V3R A;  4LV1 A;  1BZA A;  3BM6 A;  3CJM A;  1YLY A;  4MBK A;  3VP1 A;  5FAQ A;  3WS0 A;  4S2L A;  5CHJ A;  2XFT A;  1SHV A;  2XF3 A;  2C6W B;  1U60 A;  3GQZ A;  3PBS A;  4QY5 A;  5FAO A;  3VFF A;  4GD6 A;  4S2J A;  3WS4 A;  3MKE A;  4ZJ3 A;  1WE4 A;  3G31 A;  3RJU A;  1FCM A;  1S6R A;  3A3J A;  2EX2 A;  2ZLY A;  3E2L A;  3FKW A;  5U47 A;  2JE5 A;  4QHC A;  3DWZ A;  3BFF A;  4S2N A;  5EEC A;  3UY6 A;  3VOY A;  2B5R A;  2Y4A A;  4JPM A;  1FR6 A;  5FQ9 A;  4QD4 A;  3UN7 A;  1HVB A;  5AQ7 A;  1DJC A;  3OPR A;  4RYE A;  4KZ7 A;  5JYP A;  3MXR A;  4EBP A;  1G68 A;  1KGG A;  3ITA A;  5CGX A;  3ZDJ A;  4WMC A;  5HAQ A;  1SDE A;  4KZ3 A;  4KG6 A;  5GHZ A;  3OCL A;  1ES4 A;  3UDX A;  3NDG A;  3UDF A;  2FFY A;  4WZ4 A;  4KQQ A;  3HVF A;  5KZH A;  1TDG A;  1MPL A;  1K54 A;  4OOM A;  4HEF A;  1EWZ A;  3GTC A;  5E2E A;  3UPN A;  4DDY A;  2G2U A;  3NIA A;  5FQM A;  2G2W A;  3GMW A;  1I2S A;  3SS4 A;  4WZ5 C;  1M6K A;  1L0E A;  3RXX A;  1NJ4 A;  1K6R A;  5D3O A;  4N1H A;  1BTL A;  4Y7P A;  2PBY A;  1PI5 A;  1TVF A;  3IWQ A;  5DF7 A;  4ZDX A;  1XP4 A;  5DF8 A;  4NK3 A;  2WKH A;  5DF9 A;  4R4R A;  1PWD A;  5HFO A;  4N1X A;  1L0D A;  2QZ6 A;  4N92 A;  3TOI A;  4N9K A;  5GL9 A;  3IWI A;  4KQR A;  1E3U D;  4WZ5 A;  4X68 A;  3BEC A;  1YLP A;  3CMZ A;  4DXC A;  2QMI A;  3LO7 A;  4MLL A;  4UA6 A;  4A5R A;  2WK0 A;  1DJB A;  1RGY A;  5FDH A;  1HZO A;  3DWK A;  3VP0 A;  3N8S A;  2RL3 A;  2WGV A;  3LY4 A;  3WS2 A;  3W4Q A;  3Q82 A;  3EQV A;  4JXS A;  4KZB A;  2E8I A;  4E3O A;  3HLF A;  3ZG5 A;  2J7V A;  3IQA A;  4CPK A;  5DTS A;  1O07 A;  1L2S A;  4LV3 A;  2JBF A;  3UE3 A;  1MWS A;  4C3Q A;  5E2G A;  2WAD A;  2H5S A;  4PPR A;  4KG2 A;  3MZD A;  1IEM A;  1NYY A;  1LL9 A;  3HLC A;  1MWR A;  4FSF A;  4OOY A;  5GLB A;  2X01 A;  2X02 A;  4WYY A;  4BL3 A;  3IF6 B;  2XD1 A;  4PM7 A;  4S2O A;  4U0X A;  4DE1 A;  4E6X A;  3IHA A;  3UPO A;  5CGW A;  3VSL A;  1FOF A;  1NYM A;  4BD0 A;  1W5D A;  2P9V B;  5DVA A;  2HP6 A;  1L0G A;  4B4X A;  3VP2 A;  4EUZ A;  4JXG A;  4S2M A;  4EV4 A;  3ZG8 B;  4E3L A;  5FI2 A;  4P87 A;  1LL5 A;  4R3J A;  5DTK A;  3CG5 A;  3IF5 A;  3SOI A;  4DF6 A;  2PU2 A;  4JXW A;  1YLZ A;  3V50 A;  1JWV A;  1GA9 A;  1M40 A;  4S2P A;  1FSY A;  5GLC A;  4KEN B;  1ERO A;  1NZO A;  1ONH A;  4WM9 A;  5TFQ A;  5HL1 A;  2DRW A;  3NI9 A;  5E2H A;  5EVI C;  1FQG A;  1ZKJ A;  3M2K A;  5CTM A;  4K0X A;  3ZG9 B;  2HDR A;  1PIO A;  1YQS A;  3Q1F A;  1Q2P A;  5GHX A;  1XA7 A;  4WMC D;  2OSU A;  4JF6 A;  3HUN A;  2QPN A;  2Y2O A;  2Y2J A;  3BLS A;  3N7W A;  1K55 C;  4M3K A;  1N4O A;  5FAP A;  5FA7 A;  3GSG A;  3M6H A;  3C5A A;  3MBZ A;  2FFF B;  5HAP A;  1JWZ A;  3BRM A;  1YM1 A;  4Y0T A;  1NZU A;  2XEP A;  2XGN A;  3FYZ A;  4ZAM A;  3ZVW A;  1BLS A;  1K4F A;  3BFG A;  3G32 A;  1ERM A;  4X56 A;  1VM1 A;  1PWC A;  3ITB A;  1BT5 A;  4CJN A;  2ZQA A;  2EXB A;  4DKI A;  1KVL A;  1ERQ A;  2PU4 A;  5FI7 A;  4QJG A;  1MXO A;  3QNB A;  4GDN A;  3IT9 A;  1ESI A;  5HAR A;  2OLV A;  1IKI A;  2HP9 A;  1K25 A;  4L0L A;  4R1G A;  3ZHH A;  3M2J A;  3MZE A;  2ZQD A;  1K56 A;  1KGF A;  2IWD A;  3Q81 A;  4KZA A;  3EQU A;  2XQZ A;  3OC2 A;  2BG1 A;  3A3D A;  3SS3 A;  3C4O A;  4OKP A;  4X53 A;  1RGZ A;  3UPP A;  3ZG0 A;  2XR0 A;  2R9W A;  4DE2 A;  1DJA A;  5HAI A;  4O7D A;  2EFU A;  5GHY A;  3C4P A;  3VFH A;  4DDS A;  2OV5 A;  5E43 A;  3UDI A;  4OOL A;  4E3J A;  3BEB A;  1KDS A;  4K0W A;  2DNS A;  2Z2L B;  4LCL A;  4BEN A;  3Q7Z A;  2WGW A;  3BFD A;  4RX3 A;  3BFC A;  2WGI A;  1FCO A;  2WZX A;  3HUO A;  2ZQ8 A;  2WAE A;  3MKF A;  1HD8 A;  4LCM A;  4FH2 A;  4Q8I A;  1Q2Q A;  1K57 C;  1GHM A;  3DW0 A;  4E3M A;  3Q7V A;  3W4P A;  1W7F A;  5EOE A;  2A3U A;  4BD1 A;  1BLC A;  3NCK A;  4Y0O A;  3I7J A;  4R0Q A;  1BUL A;  1YMS A;  3AGD A;  5FSR A;  1SKF A;  2ZQ9 A;  5GLA A;  3V3S A;  3CZD A;  3ZCZ A;  2ZC6 B;  1I2W A;  1XKZ A;  4BJP A;  1CI9 A;  1K57 A;  1NRF A;  3SH9 A;  5FAT A;  5CER A;  1JVJ A;  2XDM A;  1BLH A;  1ALQ A;  1E25 A;  4WBG A;  5J8X A;  4IVK A;  3UE1 A;  2H0T A;  4KZ9 A;  2J8Y A;  5BOH A;  4PM6 A;  1BLP A;  4GZB A;  4KZ5 A;  4Z9Q A;  3HLD A;  4FCF A;  2DCF A;  3A3E A;  2V1Z A;  3P09 A;  2IWC A;  4OQI A;  3VSK A;  2VGK A;  1ZG4 A;  2Y91 A;  3A3F A;  4EBL A;  1IKG A;  3HLE A;  3FV7 A;  4KZ8 A;  4OH0 A;  5DTT A;  5EE8 A;  1H8Z A;  3IXD A;  3ZG7 B;  3C7U A;  5EUA A;  5GLD A;  5F83 A;  4P6B A;  3DTM A;  1KE0 A;  5CGS A;  3BLM A;  1PYY A;  4MBF A;  4LV2 A;  4JLF A;  3ZNT A;  1VQQ A;  3O3V A;  3BYD A;  4R4S A;  4DE0 A;  2ZM2 A;  4X69 A;  3IH9 A;  3PTE A;  4P0M A;  2WKE A;  1N9B A;  1GHP A;  1HTZ A;  2Y59 A;  1Z6F A;  2C5W B;  4BLM A;  4QB8 A;  3UO9 A;  1LI0 A;  1K56 D;  4FD8 A;  4X6T A;  4GB7 A;  4RVA A;  2XLN A;  4C6Y A;  4C75 A;  1NXY A;  1PZP A;  4GOG A;  3SH8 A;  4YIN A;  3IH8 A;  3NY4 A;  1Y54 A;  4KG5 A;  3VMA A;  4BQM A;  1IEL A;  2V20 A;  3OCN A;  1IYP A;  2ZC5 B;  2ZM8 A;  4Y0U A;  5HX9 A;  2HDS A;  5EPH A;  4GDB A;  2Y2N A;  4WEL A;  3W4O A;  4JKT A;  5HW3 A;  1LHY A;  1EI5 A;  5G18 A;  4ZJ2 A;  2ZQ7 A;  4D2O A;  1YT4 A;  1YLW A;  5FQI A;  1E3U A;  2Y2H A;  2RCX A;  5EVI A;  3FWL A;  5TGF A;  4S2I A;  1AXB A;  2J9O A;  2Q9N A;  1PWG A;  2ZD8 A;  1QME A;  5F82 A;  2IWB A;  5A93 A;  5CHM A;  2WKI A;  4OPY A;  4JF5 A;  1GCE A;  3G34 A;  1K55 A;  4OPR A;  4U0T A;  5M19 A;  1XX2 A;  3MXS A;  3PAG A;  1WYB A;  3G35 A;  4LEN A;  4UHU A;  2ZQC A;  3AGF A;  5IHV A;  4GKU A;  3MFD A;  4UAA A;  4QY6 A;  4IBX A;  3E2K A;  2WZZ A;  4MBH A;  4QU3 A;  2HPB A;  3HLB A;  4X55 A;  1S0W A;  1W8Q A;  4R3B A;  1JWP A;  4ID4 A;  1MWT A;  2R9X A;  3O87 A;  1ES3 A;  4OP8 A;  4U3T A;  1LI9 A;  4JXV A;  3GV9 A;  3WRZ A;  4PM5 A;  3Q7V B;  1XGI A;  2VGJ A;  4RA7 A;  2HP5 A;  4E3N A;  2WUQ A;  4EBN A;  4XUX A;  4XXR A;  1SDN A;  2CC1 A;  5AQ9 A;  4HBU A;  2OLU A;  4B4Z A;  1TEM A;  1IYS A;  4DE3 A;  2ZC4 B;  1IYO A;  2Y2I A;  5CTN A;  2Y55 A;  5A91 A;  3ZGA B;  3GVB A;  4RX2 A;  2H10 A;  4HES A;  4LV0 A;  1E4D A;  5A92 A;  3G2Z A;  5AQA A;  4ZBE A;  3HL9 A;  1QMF A;  1K6S A;  4R23 A;  1PW1 A;  1H8Y A;  4OP5 A;  2XH9 A;  4ZTK A;  5FQQ A;  1K54 C;  3OZH A;  4DXB A;  2I72 A;  3OPL A;  3QHY A;  3N4I A;  1BUE A;  4PMA A;  1G6A A;  3PBO A;  1W8Y A;  5KMW A;  5EOO A;  4IED A;  3JYI A;  3UNW A;  4S2K A;  3O88 A;  4N9L A;  2EX9 A;  4GN2 A;  4KZ4 A;  2XFS A;  3IHB A;  3HLW A;  5M18 A;  1FSW A;  5CXW A;  4GD8 A;  3ZFZ A;  2H0Y A;  2ZM0 A;  3IXH A;  2X71 A;  3LEZ A;  5FI6 A;  1NY0 A;  2WYX A;  4JF4 A;  4PM9 A;  2J9P A;  4DRT A;  4IBR A;  5L2F A;  1L0F A;  2HDQ A;  5CED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...