4OPRA

Crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying g238s mutation
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TEM-94 ES-beta-lactamase
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
total genus 103
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oprA00
4UA9A 1FR1A 4EQIA 1J9MA 3HUOA 4C3QA 5FQIA 3MZDA 4R0QA 5AQ9A 3E2KA 2ZQ7A 4OVDA 4KZAA 4B88A 3MKFA 3G32A 4LCMA 3FWLA 4JF5A 4HBUA 5FA7A 4S2LA 4JXWA 3IHAA 1BLPA 1ES5A 1PWDA 3S4XA 3HUMA 4JXSA 5GL9A 1I2WA 5GLAA 5A92A 1HD8A 4OP5A 5CTMA 4ZJ3A 4LV1A 3QNCA 1Q2QA 1CI9A 4S2JA 1IKGA 4BJPA 4WEJA 4N9LA 1CEFA 3M6BA 5EE8A 4OOLA 1FSWA 1GHMA 3A3JA 3WS0A 4DXBA 3WS2A 1E3UA 1YMSA 1ESUA 3W4QA 3CJMA 3C4PA 4JF6A 1JVJA 1Z6FA 2Z2MB 4K0XA 2ZC7A 3DWZA 1S6RA 3OPPA 3NCKA 4S2IA 3MZEA 2WZZA 4R3BA 4JLFA 3OC2A 1ZG4A 4MEZA 5E2FA 4ZJ1A 4F94A 1JWPA 5GLBA 5J8XA 4OQHA 2VGKA 2OV5A 1W8QA 1K25A 1SKFA 3BLSA 4IVKA 1KVMA 1W8YA 1JTGA 3UDFA 1NJ4A 1LLBA 1RGYA 3UPPA 2Y4AA 2JE5A 3ZG8B 4DE1A 3N6IA 4Y0UA 3NBLA 4GB7A 3ZNTA 5HAQA 2XGNA 4LENA 1MKIA 2EFXA 2V1ZA 3G34A 1K6SA 3HLCA 4QY5A 5DTKA 3BYDA 5HAPA 4H8RA 1IYOA 3LCEA 4RYEA 3W4OA 4E3LA 2ZM8A 1FQGA 4N1XA 4S2PA 1GHPA 1LI0A 5EVIC 1ONHA 3OCLA 2Q9MA 4U3TA 3UPOA 4KQRA 4X6TA 1PWGA 2J9OA 2P9VB 5DTSA 3AGEA 4BLMA 4RA7A 1K56D 3OPLA 3ZCZA 1XP4A 5F1GA 3IH8A 4GKUA 2OLVA 4JBFA 4C6YA 1YQSA 2XDMA 3NI9A 5JYPA 1NRFA 4E3MA 2X71A 1K54A 2EFUA 2Y2HA 3C7UA 3RJUA 4YFMA 1H5XA 3N4IA 3M2KA 4M3KA 3M2JA 4PPRA 1BLHA 4FH2A 3PAGA 4WYYA 1PZPA 3MXRA 1U60A 3MXSA 5FI7A 3QHYA 3BEBA 4Q8IA 1PI4A 3A3FA 3IXHA 3PBQA 4WZ5A 4X56A 5FAQA 3BFEA 3RXXA 3TG9A 5JYOA 4FSFA 4OH0A 5DF8A 5DVAA 3CG5A 1FCNA 1KGGA 2V20A 5HAIA 2WZXA 4OP8A 4S2MA 4YINA 1TVFA 5FQ9A 3VP4A 4DE0A 4OPZA 2DNSA 3VP1A 4QU3A 3UNWA 3VSLA 1BLCA 5FQQA 3G4PA 5BOHA 3FV7A 1K6RA 3LO7A 3VSKA 3IXDA 2WGWB 3I7JA 4IEDA 1JTDA 1OMEA 5FSRA 1LHYA 3O3VA 4XUXA 3ZVTA 5HL1A 4KQOA 2WGWA 1H8ZA 2DRWA 3IWOA 2I72A 2IWCA 5IHVA 1G6AA 3Q7VB 1E25A 1MBLA 1ERQA 1ES4A 5HFOA 3V5MA 1JWZA 1WYCA 4QB8A 4PM8A 3PBOA 4E3IA 1K56A 5EVID 4WBGA 4OPRA 3WS4A 1XGJA 4GOGA 5FQKA 1KDSA 1PIOA 4KZ4A 3DTMA 1VQQA 4GD8A 1KE0A 1YLZA 1AXBA 1PWCA 4BL3A 4KZ8A 2Z2LB 4XXRA 4CPKA 3HBRA 1K55C 1NY0A 2P74A 3G2ZA 3V3RA 4R4RA 3VFHA 3MKEA 3HVFA 4MBFA 1FSYA 1MXOA 1RGZA 3GMWA 4DE3A 3HLEA 3BM6A 4E6WA 1KVLA 2J7VA 3OPHA 5EUAA 2Y91A 2OLUA 1M6KA 3G31A 1IYQA 1ES3A 1LL9A 2J9PA 3IWQA 3C5AA 2UWXA 3ISGA 3G2YA 3AGFA 4S2NC 2Y55A 3BFFA 3ZG7B 3S22A 3IXBA 1QMEA 3MFDA 5DF9A 3ZHHA 4X53A 4Y7PA 2EX2A 1DY6A 2JC7A 4MBHA 2QZ6A 1TDGA 1XPBA 5DF7A 4E6XA 1IKIA 2WGIA 5EVIB 3IHBA 5CRFA 3IT9A 2XR0A 2Y2IA 3UPNA 1MY8A 2JCHA 5KSCA 2C5WB 2ZD8A 2OSUA 3B3XA 3ZFZA 1BLSA 4S2KA 2XQZA 4Y0OA 3N8RA 4WELA 1GCEA 1MWTA 3PBSA 2A49A 4OOYA 1DJBA 5FQMA 3ZVWA 3GVBA 2HDSA 2ZM0A 4PM6A 4Y0TA 1HTZA 1NYYA 2WYXA 4JKTA 3NIAA 1E4DA 1BSGA 1XGIA 2ZC4B 3A3EA 4OQGA 5KZHA 2G2WA 2XFSA 1XXMA 2HDQA 3UO9A 3VMAA 1ALQA 5HARA 4MNRA 3BECA 1BT5A 3SH9A 1KDWA 2Y2LA 4KZ7A 3UE0A 4DXCA 4DE2A 3OZHA 2ZC3B 1RCJA 4Z9QA 3UY6A 4P85A 1N9BA 5CECA 4QD4A 1L0EA 3GR2A 3ZG9B 3EQUA 4OKPA 3UE3A 3IH9A 4UA7A 3C7VA 4RVAA 5FI2A 4OLGA 2WKEA 5KMWA 3IF6C 1Q2PA 2ZQ9A 1ES2A 3SS5A 2JBFA 5E43A 3WRTA 3GQZA 2P9VA 1BTLA 1ZC2A 4X68A 4BENA 2ZC6B 1GHIA 4EBLA 1DJAA 3HLWA 4S2OA 4R1GA 2FFFB 3TSGA 4NK3A 3OCNA 4R23A 1YMXA 5KSHA 1K57A 4X69A 2XD1A 2A3UA 1XKZA 2H5SA 4KQQA 4P6BA 4OOMA 3V3SA 2EX9A 2HP6A 3FYZA 3PBTA 3Q1FA 3WS5A 5A93A 5DTTA 2EX8A 4N1HA 5TFQA 4KZ3A 5CGXA 2Y2JA 4JPMA 2FFYA 1TEMA 1SDNA 2WADA 3HLBA 3IWIA 3NY4A 1PZOA 1K55A 4U0XA 1GA0A 1O07A 1W5DA 1Y54A 2HDUA 3DWKA 3GSGA 2B5RA 2HDRA 4K91A 3Q07A 3V50A 1FOFA 1EI5A 3WWXA 4KG6A 1NZOA 2Q9NA 1CK3A 3FZCA 4EBPA 4KZ5A 1PW8A 4BD1A 4KZ9A 2Y2NA 3N7WA 1NZUA 4WMCD 3IF5A 3RXWA 1KE3A 1IYSA 1C3BA 5U47A 5E2HA 1I2SA 4KENB 4QHCA 3AGDA 4GZBA 5E2GA 3UDIA 2XK1A 3BRMA 4S2NA 5FAOA 3ITBA 5FQJA 1BULA 3UN7A 1N4OA 3HLDA 3HLGA 5E2EA 5GHYA 3Q7VA 1FCMA 3VOYA 3VP3A 1YLWA 1S0WA 5CHUA 4N92A 2ZM2A 4DF6A 1SHVA 2XF3A 4JXGA 3NDGA 4N9KA 4GN2A 2R9WA 3HL9A 1YLPA 2J8YA 4MBKA 5CERA 4UA6A 4DDYA 4PM5A 1WE4A 5TR7A 4KZ6A 3A3IA 4WM9A 4HBTA 1E3UD 5CHJA 3SS4A 1YM1A 4JF4A 3G35A 5I94A 3HUNA 2WGVA 3N8SA 4U0TA 3UDXA 4KZBA 4O7DA 4PM7A 1PW1A 3UE1A 4OQ0A 5M1AA 1W79A 5FATA 4R3JA 5EPHA 1EWZA 1G68A 1PI5A 1LL5A 1M40A 3LEZA 2ZQAA 1YT4A 1IEMA 4X55A 3ZGAB 4BQMA 3NDEA 3WRZA 4QJGA 1RP5A 1IELA 5L2FA 2CC1A 1MPLA 2PU2A 1ERMA 1CEGA 4KG5A 4WMCA 1FR6A 3P09A 2Y2KA 2C6WB 3EQVA 3G30A 4B4XA 2XFTA 5F1FA 3O88A 1YLYA 3O87A 1YLJA 1NXYA 2ZQCA 5AQ7A 1K38A 5FDHA 5GHXA 3QNBA 5A90A 3ZDJA 3SS3A 3Q82A 1K4EA 2Y2QA 4FCFA 1O7EA 4RX2A 5EVIA 3HLFA 4GDBA 2BG1A 2PU4A 1DJCA 2Y59A 3IF6B 4OLDA 1ONGA 1XA1A 1ZG6A 3IXGA 1PYYA 5AQBA 3BFGA 4E3JA 3IF6A 4UAAA 3VFFA 3VP2A 5HX9A 2XH9A 2WAFA 3BFDA 1JWVA 4IBRA 1MWUA 5CTNA 4R4SA 1CI8A 5F82A 3W4PA 3GRJA 1NYMA 2ZQ8A 1L0DA 4B4ZA 4PMAA 3P98A 5CGSA 5FASA 5EOEA 2ZLYA 4L0LA 4ZAMA 3S1YA 3WS1A 4DKIA 1I5QA 4UHUA 2H0YA 5CGWA 4DRTA 4LV0A 2ZC5B 3GTCA 4FH4A 1SCWA 4EBNA 3ITAA 2G2UA 3SH8A 2H10A 5FI6A 4LCLA 4EUZA 3E2LA 3IQAA 1SDEA 2V2FF 3NC8A 4HEFA 1KGEA 4OONA 5M18A 1L0GA 4EV4A 3PAEA 5TGFA 3ZG5A 2ZMAA 1XA7A 1KGFA 2X02A 3W8KA 2EXBA 5GHZA 2RCXA 4E3OA 1TDLA 3PBRA 2Y2PA 3ZG0A 2Y2OA 1W7FA 5GLDA 1VM1A 4HESA 3OPRA 1MWSA 5CHMA 3ZNYA 4E3NA 4BL2A 2Y2MA 5GLCA 3A3DA 4FD8A 1EROA 3VOZA 1BZAA 2HP5A 3SH7A 4E3KA 4WZ4A 2PBYA 5CEDA 3PBNA 4ID4A 4KG2A 1HVBA 1L0FA 2IWBA 1LI9A 3FKVA 2WAEA 4CJNA 1L2SA 2XLNA 3GV9A 4P0MA 4XUZA 4K0WA 4DDSA 1ESIA 1BUEA 2WUQA 4OQIA 2QMIA 4BD0A 4ZDXA 5EOOA 2QPNA 1XX2A 4GDNA 5FAPA 1HZOA 3TOIA 2E8IA 5CXWA 4RX3A 1K4FA 4LV3A 2HP9A 2EX6A 2IWDA 4IBXA 4OPYA 3Q81A 4MLLA 5D3OA 3PTEA 3SOIA 5A91A 2X01A 5M19A 4GD6A 3DW0A 1ZKJA 5AQAA 4A5RA 4WEKA 1YLTA 4ZJ2A 1QMFA 3CMZA 3D4FA 5F83A 4ZBEA 4ZTKA 2XEPA 2BLSA 2RL3A 4JXVA 5CEBA 2HPBA 4PM9A 3M6HA 4QY6A 4OPQA 3JYIA 4NETA 3LY4A 3O86A 3V39A 3VP0A 2XD5A 3BLMA 4P87A 1IYPA 1KE4A 4LV2A 2ZQDA 4GNUA 5EVLA 3BFCA 3C4OA 2WKIA 2WKHA 3HREA 1MWRA 5G18A 2Y2GA 3LY3A 1GA9A 1H8YA 4EWFA 4D2OA 2GDNA 2ZJ9A 5EECA 3CZDA 1K54C 2DCFA 2VGJA 4IVIA 1K57C 2WK0A 3N8LA 3FKWA 3MZFA 4C75A 1WYBA 5HW3A 1FCOA 2EXAA 2R9XA 3Q7ZA 3MBZA 2H0TA 4WZ5C
chains in the Genus database with same CATH superfamily
4C3QA 5FQIA 4ME4A 5AQ9A 3PYPA 3LYXA 4B88A 3P01A 1F9IA 3BY9A 4JF5A 4BMWA 4HBUA 1STZA 2A24A 1I2WA 2W1TB 3QP1A 4ZJ3A 3C2WA 3R7WB 5AVFA 1IKGA 4PKYG 1CEFA 3M6BA 1JNUA 5EE8A 4OOLA 4JGRA 3WS2A 1E3UA 1D06A 4KUOA 1ESUA 4K0XA 3NCKA 2WZZA 4JLFA 2W3HA 3QP6A 2GNXA 4MEZA 5GLBA 1W8QA 4WN5A 1T1AA 1W8YA 4X1LA 1P9WA 1RGYA 1XJ6A 2JE5A 4DE1A 3F1OB 3MMHA 3ZNTA 4LENA 2VGLM 2V1ZA 3G34A 3HLCA 5DTKA 5EVEA 4RYEA 4E3LA 1FQGA 4N1XA 2J80A 4BWIA 3OCLA 4U3TA 4KQRA 4X6TA 4B93A 2P9VB 5F68A 2OWHA 1K56D 1VHMA 3T4JA 3O5YA 5F1GA 4GKUA 3FG8A 4C6YA 5JYPA 2EFUA 3E98A 1BLHA 4FH2A 2VV6A 4EETB 3QHYA 1F2KA 3RXXA 4FSFA 4OH0A 5DF8A 4OP8A 4S2MA 3VP1A 4DJ3A 5EM1A 3RH8B 3VSLA 5BOHA 2VEAA 1T1BA 3LO7A 2WGWB 3FC7A 5FSRA 1JTDA 2V9AA 4EW7A 5HL1A 1CJFA 1G5UA 3PR6A 3IWOA 5IHVA 3Q7VB 2GJ3A 5HFOA 4WBGA 1IOUA 2LB5A 3WS4A 1XGJA 4KZ4A 4KZ8A 4ETXA 4G3WA 3MKEA 1DRMA 4DE3A 5EM0A 2PR5A 4E6WA 2Y91A 4ARZB 3G2YA 4LFUA 4R3AA 3BFFA 2VX8A 3S22A 1H0MA 1L3LA 3MSHA 1DY6A 2PD7A 1XPBA 4B9OA 4E6XA 5CRFA 2Y2IA 1MY8A 2P08A 1BLSA 4Y0OA 3N8RA 4LLOB 3PBSA 4ESPA 3ZVWA 1HTZA 1NYYA 3A3EA 1VETA 4OQGA 2XFSA 2I9VA 4MNRA 3BECA 3E0YA 2VV8A 1KDWA 4KZ7A 3UE0A 4DXCA 1S66L 5CECA 1H3QA 3KX0X 1L0EA 3C7VA 3U4LP 2WKEA 5KMWA 1ES2A 3C30A 1BTLA 1ZC2A 2ZC6B 4I3IA 4P6ZM 3OCNA 4X69A 1F5MA 2HJ9C 3T4QA 3WS5A 2EX8A 3LI8A 2PBDP 1OTBA 1SDNA 4BBTA 1K55A 1O07A 1W5DA 1Y54A 2HDUA 3GSGA 2B5RA 2HDRA 1FOFA 5HL6A 4KG6A 4HOIA 3H7WA 3T12B 1NZUA 5IS1A 1D7EA 2QJ5A 3B42A 4GZBA 3RTYA 3BRMA 5HD3A 3ITBA 2ZBBA 5CHUA 4N92A 1XFNA 4YWZA 5HWVA 3HL9A 2J8YA 4MBKA 1WE4A 3HCYA 4HBTA 4L9GA 5CHJA 3EGDC 1ODVA 4OQ0A 1PI5A 1LL5A 4X55A 4BQMA 2ACGA 1PFLA 1RP5A 3CITA 5L2FA 2Y2KA 4II7A 1OPXA 5FDHA 3ZDJA 1YSPA 1N9OA 2Y2QA 3LR4A 4RX2A 1ONGA 1XA1A 1ZG6A 5AQBA 4E3JA 3OBFA 2XH9A 2L1MA 5CTNA 4R4SA 1L0DA 3P98A 1I5QA 5CGWA 3UB5P 2EA9A 3S7QA 1CF0A 2YKHA 3ITAA 3SH8A 3E2LA 1GSXA 4FOFA 5F5YA 2VK3A 5M18A 1L0GA 3PAEA 4I5SA 2X02A 2V0UA 5GHZA 2Y2OA 5HZHA 5HWWA 5GLDA 1VM1A 3OPRA 3T1SA 3VOZA 3ULFA 5CEDA 2W0NA 4ID4A 4KG2A 3FKVA 2WAEA 4XUZA 4GHIA 1A0KA 4EERA 4NEED 1BUEA 2WUQA 1LSWA 2QPNA 3F1NB 2Z6CA 5CXWA 4LV3A 2IWDA 4IBXA 4OPYA 2O0YA 3Q81A 4MLLA 3PTEA 5AQAA 4ZRRA 4HH3A 3D4FA 4AFIA 2CMNA 4P6ZS 4QY6A 3O86A 5EVLA 2O99A 2WKIA 3T4SA 3MF0A 1YKDA 3LY3A 4D2OA 2GDNA 2JKRM 2ZJ9A 3PXPA 5IU1A 3D72A 2DCFA 1H8MA 3LIAA 2VGJA 3T1RA 5HW3A 4Q0JA 3MBZA 5K5BA 4EQIA 3CPTB 1J9MA 3HUOA 3BQAA 4R0QA 3IX4A 5EV0A 3E2KA 3MKFA 4DMZA 5FA7A 1BLPA 1ES5A 3HUMA 2D02A 4JXSA 5GL9A 5GLAA 3UB9A 1HD8A 1Q2QA 1CI9A 3OOVA 3E4QA 4NXBA 1YAXA 1FSWA 3A3JA 4PKYA 3WS0A 4DXBA 1YPRA 1YMSA 3CJMA 2ZOHA 1JVJA 2JKGA 3C38A 2IA2A 3OPPA 1PNEA 4ZJ1A 4F94A 1JWPA 2V8CA 4IVKA 1IFQA 2J3TD 2PAVP 4JGQA 3UPPA 2Y4AA 4X25A 3EEAA 4GB7A 3QP2A 3PHYA 3F1OA 3MQQA 2HF6A 4H8RA 3LCEA 3MR0A 4MDZA 5CX7A 5L8MA 3UPOA 2ZMFA 3IX3A 2K2NA 3LR0A 1PWGA 4LRYC 5DTSA 4RA7A 3OPLA 3ZCZA 1XP4A 3CUEA 2OLVA 3NI9A 2XDMA 5TBMB 1NRFA 2Y2HA 3C7UA 4EQ1A 4YFMA 3PAGA 1U60A 3MXSA 3BEBA 3A3FA 3PBQA 5FAQA 5HSQA 5JYOA 3BFEA 1NLYA 1OTDA 3CG5A 2FH5A 2V20A 1TVFA 4OPZA 1W63M 3T4LA 4QU3A 3UNWA 3KSHA 1BLCA 3I7JA 4HP9A 5FEGA 3IS2B 3VOLA 4Q0IA 2WGWA 1H8ZA 2J3WA 1E25A 3UB8A 1ES4A 4RQ9A 1WYCA 3PBOA 1K56A 5EVID 5FEFA 1SZVA 4GD8A 1KE0A 5HD5A 1AXBA 4CPKA 1K55C 1S1YA 4Y2FA 3SZTA 4PAUA 4WLAA 1FSYA 1MXOA 1RGZA 3GMWA 3T4TA 3HLEA 1KVLA 1M6KA 3T4KA 1IYQA 1W63Q 1LL9A 1OTEA 3A0SA 4O01A 3IWQA 3C5AA 2UWXA 4CLCD 4HY8A 3ZG7B 3IXBA 3U2AA 3G6OA 1TDGA 5DF7A 5EVIB 3IHBA 3IT9A 3ZFZA 2XQZA 5DJTA 1GCEA 4OOYA 5FQMA 3VV4A 5DKLA 4PM6A 4Y0TA 1E4DA 1BSGA 2ZC4B 5KZHA 2PYPA 1ALQA 5HARA 4CLCB 3H82B 1FILA 3OZHA 1RCJA 4Z9QA 3CI6A 4QD4A 3EQUA 4OKPA 3UE3A 2JKTI 3IH9A 4RVAA 4GCZA 1MZUA 4OLGA 3K3CA 1Q2PA 2ZQ9A 1SKOA 3SS5A 3TE8A 2PDRA 3WRTA 4BENA 2XA7S 1UWNX 4S2OA 3FPWA 3TSGA 4NK3A 1YMXA 3LR5A 2M7UA 3KYZA 4OOMA 3Q1FA 3PBTA 5A93A 1ACFA 2Y2JA 1D1JA 1P0ZA 1PZOA 1TD5A 4U0XA 1GA0A 3Q07A 2VKSA 3KO6A 1NZOA 1CK3A 3FZCA 1PW8A 5F69A 3GECA 4QHCA 1MC0A 5E2GA 3UDIA 2XK1A 4S2NA 2B18A 1BULA 1N4OA 4H6JB 3HLDA 3HLGA 1FCMA 3F1PB 2Y8HA 3VP3A 4DJ2A 2XF3A 4JXGA 4IHQA 4UA6A 5TR7A 2YKFA 4KZ6A 3JVUA 2P04A 1E3UD 3G35A 3DBAA 4KZBA 4PM7A 1PW1A 5M1AA 4MN7A 4R3JA 3EWKA 3LEZA 3NDEA 1XFQA 4QJGA 4L9FA 1IELA 1MPLA 2PU2A 1FR6A 3G30A 2C6WB 2XFTA 5F1FA 3O88A 2A24B 1YLYA 3O87A 1K38A 3VE3A 5MC7A 3UB7A 3HLFA 2PU4A 2Y59A 3IF6B 4OLDA 3KYQA 3IXGA 4PHTA 4UAAA 3VP2A 5HX9A 3BFDA 4IBRA 1JWVA 1Z09A 1CI8A 2QWSA 3W4PA 5DFYA 5CGSA 3D9YA 4NXGA 2A2LA 1SCWA 3LIEA 5FDSA 5FI6A 4EUZA 2OWJA 2V2FF 1T19A 4M4XA 1FIKA 3LGOA 4EV4A 5TGFA 3CLOA 3LICA 2VA0A 2Y2PA 1W7FA 3BY8A 2AVXA 4HESA 1MWSA 5AJGA 4E3NA 4KQDA 4E3KA 1BZAA 1VEUB 2VGLS 4Y17A 2VLGA 1MKMA 1L2SA 3TJZC 4DDSA 3CWFA 1XX2A 5FAPA 3TOIA 2E8IA 1K4FA 2EX6A 3T50A 2L0WA 5FL3A 5A91A 5M19A 2INWA 4GD6A 1ZKJA 2ZMVA 4ZTKA 2RL3A 4JXVA 3M6HA 3JVVA 4LRXC 4MN5A 2Y79A 4NETA 3LY4A 3V39A 4UQIM 5HPIA 4P87A 3C4OA 2WKHA 2PR6A 2Y2GA 3CUEC 3RFBA 4WL9A 1K57C 2WK0A 3MZFA 2HJEA 3GDIA 2EXAA 4LPZA 2V8FA 1X0OA 1FR1A 3L9KA 3LR3A 4OVDA 3CPTA 4LCMA 1F98A 2B02A 4S2LA 2LB9A 3IHAA 3HJKA 4OP5A 5CTMA 3QNCA 4BJPA 4N9LA 3ZQ5A 4IJGA 4NKPA 3IBJA 3T1QB 4I3JA 2D01A 2Z2MB 4XT2B 2ZC7A 3DWZA 4HNBA 2P7JA 3MZEA 4S2IA 2HV1A 5HWTA 4HQAA 1GSVA 4Y5FA 1S1ZA 1VETB 2V1BA 3V67A 2VGKA 1K25A 1SKFA 1KVMA 3UDFA 1NJ4A 4I39A 3N6IA 4Y0UA 4ETZA 5HAQA 2XGNA 1MKIA 1K6SA 3KSGA 5HAPA 2HZ5A 3K3DA 1LI0A 1ONHA 2Q9MA 4QPRA 2J9OA 3NOTC 3AGEA 1XJ2A 1G28A 3IH8A 4FUWA 3RJUA 2ZL1A 1H5XA 1HLUP 3N4IA 3M2KA 4M3KA 5TBMA 4PPRA 4WYYA 4EESA 1PZPA 3MXRA 2UV0E 5FI7A 4Q8IA 1PI4A 3IXHA 4WZ5A 1LSXA 1Y4OA 2O9AA 5DVAA 2FZ0A 1FCNA 3LEQA 3VP4A 4LRZE 4DE0A 2DNSA 3H7WB 3G4PA 1K6RA 3VSKA 1Y28A 4XUXA 1WA9A 2I72A 1G6AA 1MBLA 1ERQA 1JWZA 4PM8A 1KDSA 3DTMA 1VQQA 3EOIA 2Z2LB 2G7UA 3HBRA 5G4YA 1NY0A 2P74A 4R4RA 3VFHA 3HVFA 4MBFA 3BM6A 5J7EA 2J7VA 5AVEA 1ES3A 4GS9B 1YSQA 3ISGA 5L07A 4I3AA 4S2NC 3DAVA 2W1TA 2K7SA 3MFDA 2NUPC 3ZHHA 3R7WA 2EX2A 1V9YA 2Q0OA 2W27A 3UPNA 1KOUA 2JCHA 5KSCA 2WKRA 2C5WB 2ZD8A 2OSUA 2PYRA 1TF1A 2A49A 3GVBA 5HDSA 2HDSA 3LIFA 2ZM0A 3TRCA 3LI9A 2WYXA 4JKTA 3NIAA 1XGIA 2M7VA 2G2WA 3UO9A 4HH2A 1BT5A 3MFXA 4F3LB 2Y2LA 3H82A 4E04A 2ZC3B 4EEPA 1N9BA 2XROA 4YOFA 1LL8A 4Z1WA 5C5KA 4K08A 2W3DA 2JBFA 2P9VA 4YNRA 4EUVA 3HLWA 2FFFB 5KSHA 1K57A 2QJ7A 4BBUA 1XKZA 2H5SA 4P6BA 3V3SA 1N9NA 4MN6A 2EX9A 2HP6A 4GJ4A 5TFQA 4Y15A 3LFVA 4JPMA 2FFYA 1TEMA 3HLBA 3DWKA 3ICYA 4Y13A 1ZTUA 4Q0HA 4KZ5A 4BD1A 5L09A 4KZ9A 2Y2NA 3N7WA 4WMCD 3IF5A 1IYSA 3JPUA 1C3BA 5E2HA 1I2SA 4KENB 2O9BA 3AGDA 3A0VA 2B95A 5FQJA 1EW0A 5E2EA 5GHYA 3Q7VA 1YLWA 5F6AA 4H6JA 2ZM2A 3QP4A 4DF6A 1SHVA 3NDGA 4N9KA 2BASA 2R9WA 1YLPA 4PM5A 5IT5A 3BJNA 3BW6A 2VV7A 4WM9A 5I94A 3SS4A 4Y3IA 4U0TA 3N8SA 4O7DA 2W3FA 3LIBA 5FATA 5EPHA 1DP8A 1EWZA 1G68A 1M40A 2KLIA 4ARZA 1J3WA 3WRZA 2CC1A 1T1CA 4KG5A 1CEGA 1TS0A 4MMNA 3EQVA 2MJ6A 4B4XA 1NXYA 3UMEA 3QNBA 3Q82A 1K4EA 4FCFA 1TS6A 3C8CA 4GDBA 2BG1A 1DJCA 3BFGA 4JGOA 3IF6A 4LGWA 4WF0A 1TS7A 2WAFA 3T4OA 5HDCA 3S7OA 1T18A 1ZHHB 5F82A 3W2ZA 1NYMA 2ZQ8A 4B4ZA 5HPFA 4PMAA 3S1YA 2XRNA 3A0RA 4L0LA 3WS1A 2H0YA 4NG2A 4LV0A 3TW8A 2ZC5B 4EBNA 2G2UA 2PD8A 3IQAA 4CQHA 1KGEA 5HDDA 1XA7A 3W8KA 2VZWA 5G4ZA 2EXBA 2RCXA 4E3OA 3PBRA 1N9LA 1BYWA 1DP6A 2WKPA 3S7NA 2V1AA 4BL2A 2Y2MA 3R4KA 3A3DA 4FD8A 1EROA 5GLCA 3UMDA 3SH7A 4JGPA 3PBNA 1HVBA 1L0FA 2IWBA 1LI9A 4CJNA 4P0MA 1VEUA 4K0WA 4OQIA 5EOOA 4GDNA 1HZOA 4RX3A 2HP9A 2BTFP 3SOIA 2X01A 4WEKA 1YLTA 4ZJ2A 5F83A 4PM9A 1K0KA 2XD5A 3NHQA 1IYPA 4GNUA 3BFCA 3HREA 3DTIA 1MWRA 3NJAA 5G18A 1GA9A 5TJJA 3BWLA 1H8YA 5EECA 3CZDA 4HJ3A 3N8LA 3FKWA 5J3WA 4C75A 1WYBA 3KSFA 4DN0A 4WZ5C 4UA9A 3NOPC 2J3TC 3MZDA 4I38A 1OT6A 2ZQ7A 4KZAA 3G32A 4UEYA 2W3EA 1G6OA 3FWLA 4JXWA 1OTIA 1PWDA 3S4XA 5A92A 4LV1A 2EWVA 4IUKA 4S2JA 3B33A 1GSWA 4WEJA 2VJWA 1GHMA 3BQ8A 4HHDA 3E4PA 3W4QA 4NXFA 3C4PA 4JF6A 1Z6FA 1S6RA 4R3BA 4HI4A 4XT2A 3OC2A 1ZG4A 1VB6A 5E2FA 5J8XA 2GZAA 3QP5A 4OQHA 2OV5A 4O8GA 2QYBA 3BLSA 1JTGA 1LLBA 3ZG8B 3DTKA 3E4OA 2KOIA 3NBLA 3CHWP 2EFXA 2KX6A 4QY5A 3BYDA 4HP4A 1IYOA 4G3VA 3W4OA 2ZM8A 4S2PA 1GHPA 3NECA 5EVIC 1SKOB 4R70A 4BLMA 4JBFA 1YQSA 2GX5A 5DJUA 2OAP1 4G3KA 4E3MA 2X71A 2JKRI 1K54A 3F1NA 4GLQA 3M2JA 1PRQA 1S4RA 4X56A 3TG9A 4CLCC 1KGGA 5HAIA 2WZXA 4YINA 5FQ9A 5FQQA 2JKTM 3FV7A 3LUQA 3IXDA 4IEDA 1OMEA 4R38A 4EU0A 1LHYA 4WUJA 3O3VA 5I5LA 3ZVTA 4KQOA 2DRWA 2IWCA 2XSSA 3V5MA 4QB8A 4E3IA 4OPRA 4GOGA 5FQKA 1PIOA 4BL3A 1YLZA 1PWCA 3IX8A 4XXRA 3KSIA 5LBRA 1OJGA 3G2ZA 3V3RA 3ZYTA 2KDKA 3FPVA 3T1XA 3OPHA 5EUAA 2OLUA 3G31A 3MXQA 3MS6A 3S7PA 2J9PA 2M1CA 3AGFA 4GS9A 2Y55A 1QMEA 5DF9A 4X53A 4Y7PA 2JC7A 3NOUC 4MBHA 2QZ6A 1S4SA 1IKIA 2WGIA 3UB6A 2XR0A 3VE4A 3EEHA 1UWPX 3B3XA 2Z6DA 4S2KA 4NXEA 4WELA 1MWTA 1DJBA 4BBVA 3QP8A 5DKKA 2PT7A 3KYEA 1XXMA 2HDQA 3VMAA 2O9CA 3SH9A 4HJ6A 4X1MA 4DE2A 4FTXA 3UY6A 4P85A 4F3LA 4O0PA 3GR2A 3ZG9B 1NWZA 5FI2A 4UA7A 3OLOA 3IF6C 5E43A 3GQZA 4X68A 1GHIA 1V9ZA 3MQ0A 4EBLA 1DJAA 4R1GA 1NRJA 4R23A 2XD1A 2A3UA 2OAQ1 4KQQA 3FYZA 5DTTA 4N1HA 4KZ3A 5CGXA 2WADA 3IWIA 3NY4A 5DFXA 2ZOIA 2QKPA 1AWIA 4K91A 3V50A 1EI5A 3WWXA 4D60A 2Q9NA 3LIDA 4EBPA 3DTEA 3RXWA 1KE3A 2PRFA 5U47A 3IS2A 5FAOA 3UN7A 3L7HA 3K2NA 2HGVA 2H28A 4IUHA 3VOYA 1S0WA 4GN2A 5J4EA 5CERA 4DDYA 4R6LA 3MQOA 5A8BA 4UQIS 3A3IA 1LSVA 4HIAA 2WKQA 4GW9A 1YM1A 4JF4A 3HUNA 2WGVA 3UDXA 1LT0A 3UE1A 1W79A 2ZQAA 1YT4A 1IEMA 1DP9A 3ZGAB 4KUKA 1ERMA 4WMCA 3P09A 2DMWA 4L9EA 1YLJA 2ZQCA 5AQ7A 5GHXA 5A90A 3SS3A 4MCWA 4CLCE 1O7EA 5EVIA 1OTAA 1PYYA 3VFFA 4HJ4A 2JHEA 2NUTC 1MWUA 2W3GA 2JKFA 3GRJA 1UGUA 3MJQA 3H9WA 2W1RA 3SW1A 5FASA 5EOEA 2ZLYA 4ZAMA 1NLZA 4DKIA 4UHUA 5EFWA 4CLCA 4DRTA 3GTCA 4FH4A 2H10A 2L4RA 1S67L 4LCLA 2XA7M 3EGXC 1SDEA 2PHYA 3NC8A 2K31A 4HEFA 4OONA 1XJ4A 2EWWA 3ZG5A 2ZMAA 1KGFA 3HJIA 1TDLA 4EXOA 3ZG0A 1XJ3A 2JN7A 5CHMA 3ZNYA 3P7NA 4GHIB 2HP5A 5KIZA 4WZ4A 2PBYA 3IBRA 3NULA 2XLNA 3GV9A 1ESIA 2QMIA 4BD0A 4ZDXA 2V0WA 4QWOA 2ZL1B 5D3OA 3DW0A 4A5RA 1QMFA 3CMZA 4ZBEA 2XEPA 2BLSA 3D3OA 5CEBA 2HPBA 3B47A 4OPQA 3JYIA 3VP0A 3BLMA 2R78A 5L10A 1P97A 3F1PA 1KE4A 4EEUA 1OT9A 4LV2A 2ZQDA 1P9RA 4EWFA 3UE6A 1K54C 2OOLA 4IVIA 2E8JA 1FCOA 3CAXA 2R9XA 3Q7ZA 1CQAA 1TS8A 2QHKA 2H0TA 1OJ5A
chains in the Genus database with same CATH topology
4UA9A 1FR1A 4EQIA 1J9MA 3HUOA 4C3QA 5FQIA 3MZDA 4R0QA 5AQ9A 3E2KA 2ZQ7A 4OVDA 4KZAA 4B88A 3MKFA 3G32A 4LCMA 3FWLA 4JF5A 4HBUA 5FA7A 4S2LA 4JXWA 3IHAA 1BLPA 1ES5A 1PWDA 3S4XA 3HUMA 4JXSA 5GL9A 1I2WA 5GLAA 5A92A 1HD8A 4OP5A 5CTMA 4ZJ3A 4LV1A 3QNCA 1Q2QA 1CI9A 4S2JA 1IKGA 4BJPA 4WEJA 4N9LA 1CEFA 3M6BA 5EE8A 4OOLA 1FSWA 1GHMA 3A3JA 3WS0A 4DXBA 3WS2A 1E3UA 1YMSA 1ESUA 3W4QA 3CJMA 3C4PA 4JF6A 1JVJA 1Z6FA 2Z2MB 4K0XA 2ZC7A 3DWZA 1S6RA 3OPPA 3NCKA 4S2IA 3MZEA 2WZZA 4R3BA 4JLFA 3OC2A 1ZG4A 4MEZA 5E2FA 4ZJ1A 4F94A 1JWPA 5GLBA 5J8XA 4OQHA 2VGKA 2OV5A 1W8QA 1K25A 1SKFA 3BLSA 4IVKA 1KVMA 1W8YA 1JTGA 3UDFA 1NJ4A 1LLBA 1RGYA 3UPPA 2Y4AA 2JE5A 3ZG8B 4DE1A 3N6IA 4Y0UA 3NBLA 4GB7A 3ZNTA 5HAQA 2XGNA 4LENA 1MKIA 2EFXA 2V1ZA 3G34A 1K6SA 3HLCA 4QY5A 5DTKA 3BYDA 5HAPA 4H8RA 1IYOA 3LCEA 4RYEA 3W4OA 4E3LA 2ZM8A 1FQGA 4N1XA 4S2PA 1GHPA 1LI0A 5EVIC 1ONHA 3OCLA 2Q9MA 4U3TA 3UPOA 4KQRA 4X6TA 1PWGA 2J9OA 2P9VB 5DTSA 3AGEA 4BLMA 4RA7A 1K56D 3OPLA 3ZCZA 1XP4A 5F1GA 3IH8A 4GKUA 2OLVA 4JBFA 4C6YA 1YQSA 2XDMA 3NI9A 5JYPA 1NRFA 4E3MA 2X71A 1K54A 2EFUA 2Y2HA 3C7UA 3RJUA 4YFMA 1H5XA 3N4IA 3M2KA 4M3KA 3M2JA 4PPRA 1BLHA 4FH2A 3PAGA 4WYYA 1PZPA 3MXRA 1U60A 3MXSA 5FI7A 3QHYA 3BEBA 4Q8IA 1PI4A 3A3FA 3IXHA 3PBQA 4WZ5A 4X56A 5FAQA 3BFEA 3RXXA 3TG9A 5JYOA 4FSFA 4OH0A 5DF8A 5DVAA 3CG5A 1FCNA 1KGGA 2V20A 5HAIA 2WZXA 4OP8A 4S2MA 4YINA 1TVFA 5FQ9A 3VP4A 4DE0A 4OPZA 2DNSA 3VP1A 4QU3A 3UNWA 3VSLA 1BLCA 5FQQA 3G4PA 5BOHA 3FV7A 1K6RA 3LO7A 3VSKA 3IXDA 2WGWB 3I7JA 4IEDA 1JTDA 1OMEA 5FSRA 1LHYA 3O3VA 4XUXA 3ZVTA 5HL1A 4KQOA 2WGWA 1H8ZA 2DRWA 3IWOA 2I72A 2IWCA 5IHVA 1G6AA 3Q7VB 1E25A 1MBLA 1ERQA 1ES4A 5HFOA 3V5MA 1JWZA 1WYCA 4QB8A 4PM8A 3PBOA 4E3IA 1K56A 5EVID 4WBGA 4OPRA 3WS4A 1XGJA 4GOGA 5FQKA 1KDSA 1PIOA 4KZ4A 3DTMA 1VQQA 4GD8A 1KE0A 1YLZA 1AXBA 1PWCA 4BL3A 4KZ8A 2Z2LB 4XXRA 4CPKA 3HBRA 1K55C 1NY0A 2P74A 3G2ZA 3V3RA 4R4RA 3VFHA 3MKEA 3HVFA 4MBFA 1FSYA 1MXOA 1RGZA 3GMWA 4DE3A 3HLEA 3BM6A 4E6WA 1KVLA 2J7VA 3OPHA 5EUAA 2Y91A 2OLUA 1M6KA 3G31A 1IYQA 1ES3A 1LL9A 2J9PA 3IWQA 3C5AA 2UWXA 3ISGA 3G2YA 3AGFA 4S2NC 2Y55A 3BFFA 3ZG7B 3S22A 3IXBA 1QMEA 3MFDA 5DF9A 3ZHHA 4X53A 4Y7PA 2EX2A 1DY6A 2JC7A 4MBHA 2QZ6A 1TDGA 1XPBA 5DF7A 4E6XA 1IKIA 2WGIA 5EVIB 3IHBA 5CRFA 3IT9A 2XR0A 2Y2IA 3UPNA 1MY8A 2JCHA 5KSCA 2C5WB 2ZD8A 2OSUA 3B3XA 3ZFZA 1BLSA 4S2KA 2XQZA 4Y0OA 3N8RA 4WELA 1GCEA 1MWTA 3PBSA 2A49A 4OOYA 1DJBA 5FQMA 3ZVWA 3GVBA 2HDSA 2ZM0A 4PM6A 4Y0TA 1HTZA 1NYYA 2WYXA 4JKTA 3NIAA 1E4DA 1BSGA 1XGIA 2ZC4B 3A3EA 4OQGA 5KZHA 2G2WA 2XFSA 1XXMA 2HDQA 3UO9A 3VMAA 1ALQA 5HARA 4MNRA 3BECA 1BT5A 3SH9A 1KDWA 2Y2LA 4KZ7A 3UE0A 4DXCA 4DE2A 3OZHA 2ZC3B 1RCJA 4Z9QA 3UY6A 4P85A 1N9BA 5CECA 4QD4A 1L0EA 3GR2A 3ZG9B 3EQUA 4OKPA 3UE3A 3IH9A 4UA7A 3C7VA 4RVAA 5FI2A 4OLGA 2WKEA 5KMWA 3IF6C 1Q2PA 2ZQ9A 1ES2A 3SS5A 2JBFA 5E43A 3WRTA 3GQZA 2P9VA 1BTLA 1ZC2A 4X68A 4BENA 2ZC6B 1GHIA 4EBLA 1DJAA 3HLWA 4S2OA 4R1GA 2FFFB 3TSGA 4NK3A 3OCNA 4R23A 1YMXA 5KSHA 1K57A 4X69A 2XD1A 2A3UA 1XKZA 2H5SA 4KQQA 4P6BA 4OOMA 3V3SA 2EX9A 2HP6A 3FYZA 3PBTA 3Q1FA 3WS5A 5A93A 5DTTA 2EX8A 4N1HA 5TFQA 4KZ3A 5CGXA 2Y2JA 4JPMA 2FFYA 1TEMA 1SDNA 2WADA 3HLBA 3IWIA 3NY4A 1PZOA 1K55A 4U0XA 1GA0A 1O07A 1W5DA 1Y54A 2HDUA 3DWKA 3GSGA 2B5RA 2HDRA 4K91A 3Q07A 3V50A 1FOFA 1EI5A 3WWXA 4KG6A 1NZOA 2Q9NA 1CK3A 3FZCA 4EBPA 4KZ5A 1PW8A 4BD1A 4KZ9A 2Y2NA 3N7WA 1NZUA 4WMCD 3IF5A 3RXWA 1KE3A 1IYSA 1C3BA 5U47A 5E2HA 1I2SA 4KENB 4QHCA 3AGDA 4GZBA 5E2GA 3UDIA 2XK1A 3BRMA 4S2NA 5FAOA 3ITBA 5FQJA 1BULA 3UN7A 1N4OA 3HLDA 3HLGA 5E2EA 5GHYA 3Q7VA 1FCMA 3VOYA 3VP3A 1YLWA 1S0WA 5CHUA 4N92A 2ZM2A 4DF6A 1SHVA 2XF3A 4JXGA 3NDGA 4N9KA 4GN2A 2R9WA 3HL9A 1YLPA 2J8YA 4MBKA 5CERA 4UA6A 4DDYA 4PM5A 1WE4A 5TR7A 4KZ6A 3A3IA 4WM9A 4HBTA 1E3UD 5CHJA 3SS4A 1YM1A 4JF4A 3G35A 5I94A 3HUNA 2WGVA 3N8SA 4U0TA 3UDXA 4KZBA 4O7DA 4PM7A 1PW1A 3UE1A 4OQ0A 5M1AA 1W79A 5FATA 4R3JA 5EPHA 1EWZA 1G68A 1PI5A 1LL5A 1M40A 3LEZA 2ZQAA 1YT4A 1IEMA 4X55A 3ZGAB 4BQMA 3NDEA 3WRZA 4QJGA 1RP5A 1IELA 5L2FA 2CC1A 1MPLA 2PU2A 1ERMA 1CEGA 4KG5A 4WMCA 1FR6A 3P09A 2Y2KA 2C6WB 3EQVA 3G30A 4B4XA 2XFTA 5F1FA 3O88A 1YLYA 3O87A 1YLJA 1NXYA 2ZQCA 5AQ7A 1K38A 5FDHA 5GHXA 3QNBA 5A90A 3ZDJA 3SS3A 3Q82A 1K4EA 2Y2QA 4FCFA 1O7EA 4RX2A 5EVIA 3HLFA 4GDBA 2BG1A 2PU4A 1DJCA 2Y59A 3IF6B 4OLDA 1ONGA 1XA1A 1ZG6A 3IXGA 1PYYA 5AQBA 3BFGA 4E3JA 3IF6A 4UAAA 3VFFA 3VP2A 5HX9A 2XH9A 2WAFA 3BFDA 1JWVA 4IBRA 1MWUA 5CTNA 4R4SA 1CI8A 5F82A 3W4PA 3GRJA 1NYMA 2ZQ8A 1L0DA 4B4ZA 4PMAA 3P98A 5CGSA 5FASA 5EOEA 2ZLYA 4L0LA 4ZAMA 3S1YA 3WS1A 4DKIA 1I5QA 4UHUA 2H0YA 5CGWA 4DRTA 4LV0A 2ZC5B 3GTCA 4FH4A 1SCWA 4EBNA 3ITAA 2G2UA 3SH8A 2H10A 5FI6A 4LCLA 4EUZA 3E2LA 3IQAA 1SDEA 2V2FF 3NC8A 4HEFA 1KGEA 4OONA 5M18A 1L0GA 4EV4A 3PAEA 5TGFA 3ZG5A 2ZMAA 1XA7A 1KGFA 2X02A 3W8KA 2EXBA 5GHZA 2RCXA 4E3OA 1TDLA 3PBRA 2Y2PA 3ZG0A 2Y2OA 1W7FA 5GLDA 1VM1A 4HESA 3OPRA 1MWSA 5CHMA 3ZNYA 4E3NA 4BL2A 2Y2MA 5GLCA 3A3DA 4FD8A 1EROA 3VOZA 1BZAA 2HP5A 3SH7A 4E3KA 4WZ4A 2PBYA 5CEDA 3PBNA 4ID4A 4KG2A 1HVBA 1L0FA 2IWBA 1LI9A 3FKVA 2WAEA 4CJNA 1L2SA 2XLNA 3GV9A 4P0MA 4XUZA 4K0WA 4DDSA 1ESIA 1BUEA 2WUQA 4OQIA 2QMIA 4BD0A 4ZDXA 5EOOA 2QPNA 1XX2A 4GDNA 5FAPA 1HZOA 3TOIA 2E8IA 5CXWA 4RX3A 1K4FA 4LV3A 2HP9A 2EX6A 2IWDA 4IBXA 4OPYA 3Q81A 4MLLA 5D3OA 3PTEA 3SOIA 5A91A 2X01A 5M19A 4GD6A 3DW0A 1ZKJA 5AQAA 4A5RA 4WEKA 1YLTA 4ZJ2A 1QMFA 3CMZA 3D4FA 5F83A 4ZBEA 4ZTKA 2XEPA 2BLSA 2RL3A 4JXVA 5CEBA 2HPBA 4PM9A 3M6HA 4QY6A 4OPQA 3JYIA 4NETA 3LY4A 3O86A 3V39A 3VP0A 2XD5A 3BLMA 4P87A 1IYPA 1KE4A 4LV2A 2ZQDA 4GNUA 5EVLA 3BFCA 3C4OA 2WKIA 2WKHA 3HREA 1MWRA 5G18A 2Y2GA 3LY3A 1GA9A 1H8YA 4EWFA 4D2OA 2GDNA 2ZJ9A 5EECA 3CZDA 1K54C 2DCFA 2VGJA 4IVIA 1K57C 2WK0A 3N8LA 3FKWA 3MZFA 4C75A 1WYBA 5HW3A 1FCOA 2EXAA 2R9XA 3Q7ZA 3MBZA 2H0TA 4WZ5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UA9 A;  1FR1 A;  4EQI A;  1J9M A;  3HUO A;  4C3Q A;  5FQI A;  3MZD A;  4R0Q A;  5AQ9 A;  3E2K A;  2ZQ7 A;  4OVD A;  4KZA A;  4B88 A;  3MKF A;  3G32 A;  4LCM A;  3FWL A;  4JF5 A;  4HBU A;  5FA7 A;  4S2L A;  4JXW A;  3IHA A;  1BLP A;  1ES5 A;  1PWD A;  3S4X A;  3HUM A;  4JXS A;  5GL9 A;  1I2W A;  5GLA A;  5A92 A;  1HD8 A;  4OP5 A;  5CTM A;  4ZJ3 A;  4LV1 A;  3QNC A;  1Q2Q A;  1CI9 A;  4S2J A;  1IKG A;  4BJP A;  4WEJ A;  4N9L A;  1CEF A;  3M6B A;  5EE8 A;  4OOL A;  1FSW A;  1GHM A;  3A3J A;  3WS0 A;  4DXB A;  3WS2 A;  1E3U A;  1YMS A;  1ESU A;  3W4Q A;  3CJM A;  3C4P A;  4JF6 A;  1JVJ A;  1Z6F A;  2Z2M B;  4K0X A;  2ZC7 A;  3DWZ A;  1S6R A;  3OPP A;  3NCK A;  4S2I A;  3MZE A;  2WZZ A;  4R3B A;  4JLF A;  3OC2 A;  1ZG4 A;  4MEZ A;  5E2F A;  4ZJ1 A;  4F94 A;  1JWP A;  5GLB A;  5J8X A;  4OQH A;  2VGK A;  2OV5 A;  1W8Q A;  1K25 A;  1SKF A;  3BLS A;  4IVK A;  1KVM A;  1W8Y A;  1JTG A;  3UDF A;  1NJ4 A;  1LLB A;  1RGY A;  3UPP A;  2Y4A A;  2JE5 A;  3ZG8 B;  4DE1 A;  3N6I A;  4Y0U A;  3NBL A;  4GB7 A;  3ZNT A;  5HAQ A;  2XGN A;  4LEN A;  1MKI A;  2EFX A;  2V1Z A;  3G34 A;  1K6S A;  3HLC A;  4QY5 A;  5DTK A;  3BYD A;  5HAP A;  4H8R A;  1IYO A;  3LCE A;  4RYE A;  3W4O A;  4E3L A;  2ZM8 A;  1FQG A;  4N1X A;  4S2P A;  1GHP A;  1LI0 A;  5EVI C;  1ONH A;  3OCL A;  2Q9M A;  4U3T A;  3UPO A;  4KQR A;  4X6T A;  1PWG A;  2J9O A;  2P9V B;  5DTS A;  3AGE A;  4BLM A;  4RA7 A;  1K56 D;  3OPL A;  3ZCZ A;  1XP4 A;  5F1G A;  3IH8 A;  4GKU A;  2OLV A;  4JBF A;  4C6Y A;  1YQS A;  2XDM A;  3NI9 A;  5JYP A;  1NRF A;  4E3M A;  2X71 A;  1K54 A;  2EFU A;  2Y2H A;  3C7U A;  3RJU A;  4YFM A;  1H5X A;  3N4I A;  3M2K A;  4M3K A;  3M2J A;  4PPR A;  1BLH A;  4FH2 A;  3PAG A;  4WYY A;  1PZP A;  3MXR A;  1U60 A;  3MXS A;  5FI7 A;  3QHY A;  3BEB A;  4Q8I A;  1PI4 A;  3A3F A;  3IXH A;  3PBQ A;  4WZ5 A;  4X56 A;  5FAQ A;  3BFE A;  3RXX A;  3TG9 A;  5JYO A;  4FSF A;  4OH0 A;  5DF8 A;  5DVA A;  3CG5 A;  1FCN A;  1KGG A;  2V20 A;  5HAI A;  2WZX A;  4OP8 A;  4S2M A;  4YIN A;  1TVF A;  5FQ9 A;  3VP4 A;  4DE0 A;  4OPZ A;  2DNS A;  3VP1 A;  4QU3 A;  3UNW A;  3VSL A;  1BLC A;  5FQQ A;  3G4P A;  5BOH A;  3FV7 A;  1K6R A;  3LO7 A;  3VSK A;  3IXD A;  2WGW B;  3I7J A;  4IED A;  1JTD A;  1OME A;  5FSR A;  1LHY A;  3O3V A;  4XUX A;  3ZVT A;  5HL1 A;  4KQO A;  2WGW A;  1H8Z A;  2DRW A;  3IWO A;  2I72 A;  2IWC A;  5IHV A;  1G6A A;  3Q7V B;  1E25 A;  1MBL A;  1ERQ A;  1ES4 A;  5HFO A;  3V5M A;  1JWZ A;  1WYC A;  4QB8 A;  4PM8 A;  3PBO A;  4E3I A;  1K56 A;  5EVI D;  4WBG A;  4OPR A;  3WS4 A;  1XGJ A;  4GOG A;  5FQK A;  1KDS A;  1PIO A;  4KZ4 A;  3DTM A;  1VQQ A;  4GD8 A;  1KE0 A;  1YLZ A;  1AXB A;  1PWC A;  4BL3 A;  4KZ8 A;  2Z2L B;  4XXR A;  4CPK A;  3HBR A;  1K55 C;  1NY0 A;  2P74 A;  3G2Z A;  3V3R A;  4R4R A;  3VFH A;  3MKE A;  3HVF A;  4MBF A;  1FSY A;  1MXO A;  1RGZ A;  3GMW A;  4DE3 A;  3HLE A;  3BM6 A;  4E6W A;  1KVL A;  2J7V A;  3OPH A;  5EUA A;  2Y91 A;  2OLU A;  1M6K A;  3G31 A;  1IYQ A;  1ES3 A;  1LL9 A;  2J9P A;  3IWQ A;  3C5A A;  2UWX A;  3ISG A;  3G2Y A;  3AGF A;  4S2N C;  2Y55 A;  3BFF A;  3ZG7 B;  3S22 A;  3IXB A;  1QME A;  3MFD A;  5DF9 A;  3ZHH A;  4X53 A;  4Y7P A;  2EX2 A;  1DY6 A;  2JC7 A;  4MBH A;  2QZ6 A;  1TDG A;  1XPB A;  5DF7 A;  4E6X A;  1IKI A;  2WGI A;  5EVI B;  3IHB A;  5CRF A;  3IT9 A;  2XR0 A;  2Y2I A;  3UPN A;  1MY8 A;  2JCH A;  5KSC A;  2C5W B;  2ZD8 A;  2OSU A;  3B3X A;  3ZFZ A;  1BLS A;  4S2K A;  2XQZ A;  4Y0O A;  3N8R A;  4WEL A;  1GCE A;  1MWT A;  3PBS A;  2A49 A;  4OOY A;  1DJB A;  5FQM A;  3ZVW A;  3GVB A;  2HDS A;  2ZM0 A;  4PM6 A;  4Y0T A;  1HTZ A;  1NYY A;  2WYX A;  4JKT A;  3NIA A;  1E4D A;  1BSG A;  1XGI A;  2ZC4 B;  3A3E A;  4OQG A;  5KZH A;  2G2W A;  2XFS A;  1XXM A;  2HDQ A;  3UO9 A;  3VMA A;  1ALQ A;  5HAR A;  4MNR A;  3BEC A;  1BT5 A;  3SH9 A;  1KDW A;  2Y2L A;  4KZ7 A;  3UE0 A;  4DXC A;  4DE2 A;  3OZH A;  2ZC3 B;  1RCJ A;  4Z9Q A;  3UY6 A;  4P85 A;  1N9B A;  5CEC A;  4QD4 A;  1L0E A;  3GR2 A;  3ZG9 B;  3EQU A;  4OKP A;  3UE3 A;  3IH9 A;  4UA7 A;  3C7V A;  4RVA A;  5FI2 A;  4OLG A;  2WKE A;  5KMW A;  3IF6 C;  1Q2P A;  2ZQ9 A;  1ES2 A;  3SS5 A;  2JBF A;  5E43 A;  3WRT A;  3GQZ A;  2P9V A;  1BTL A;  1ZC2 A;  4X68 A;  4BEN A;  2ZC6 B;  1GHI A;  4EBL A;  1DJA A;  3HLW A;  4S2O A;  4R1G A;  2FFF B;  3TSG A;  4NK3 A;  3OCN A;  4R23 A;  1YMX A;  5KSH A;  1K57 A;  4X69 A;  2XD1 A;  2A3U A;  1XKZ A;  2H5S A;  4KQQ A;  4P6B A;  4OOM A;  3V3S A;  2EX9 A;  2HP6 A;  3FYZ A;  3PBT A;  3Q1F A;  3WS5 A;  5A93 A;  5DTT A;  2EX8 A;  4N1H A;  5TFQ A;  4KZ3 A;  5CGX A;  2Y2J A;  4JPM A;  2FFY A;  1TEM A;  1SDN A;  2WAD A;  3HLB A;  3IWI A;  3NY4 A;  1PZO A;  1K55 A;  4U0X A;  1GA0 A;  1O07 A;  1W5D A;  1Y54 A;  2HDU A;  3DWK A;  3GSG A;  2B5R A;  2HDR A;  4K91 A;  3Q07 A;  3V50 A;  1FOF A;  1EI5 A;  3WWX A;  4KG6 A;  1NZO A;  2Q9N A;  1CK3 A;  3FZC A;  4EBP A;  4KZ5 A;  1PW8 A;  4BD1 A;  4KZ9 A;  2Y2N A;  3N7W A;  1NZU A;  4WMC D;  3IF5 A;  3RXW A;  1KE3 A;  1IYS A;  1C3B A;  5U47 A;  5E2H A;  1I2S A;  4KEN B;  4QHC A;  3AGD A;  4GZB A;  5E2G A;  3UDI A;  2XK1 A;  3BRM A;  4S2N A;  5FAO A;  3ITB A;  5FQJ A;  1BUL A;  3UN7 A;  1N4O A;  3HLD A;  3HLG A;  5E2E A;  5GHY A;  3Q7V A;  1FCM A;  3VOY A;  3VP3 A;  1YLW A;  1S0W A;  5CHU A;  4N92 A;  2ZM2 A;  4DF6 A;  1SHV A;  2XF3 A;  4JXG A;  3NDG A;  4N9K A;  4GN2 A;  2R9W A;  3HL9 A;  1YLP A;  2J8Y A;  4MBK A;  5CER A;  4UA6 A;  4DDY A;  4PM5 A;  1WE4 A;  5TR7 A;  4KZ6 A;  3A3I A;  4WM9 A;  4HBT A;  1E3U D;  5CHJ A;  3SS4 A;  1YM1 A;  4JF4 A;  3G35 A;  5I94 A;  3HUN A;  2WGV A;  3N8S A;  4U0T A;  3UDX A;  4KZB A;  4O7D A;  4PM7 A;  1PW1 A;  3UE1 A;  4OQ0 A;  5M1A A;  1W79 A;  5FAT A;  4R3J A;  5EPH A;  1EWZ A;  1G68 A;  1PI5 A;  1LL5 A;  1M40 A;  3LEZ A;  2ZQA A;  1YT4 A;  1IEM A;  4X55 A;  3ZGA B;  4BQM A;  3NDE A;  3WRZ A;  4QJG A;  1RP5 A;  1IEL A;  5L2F A;  2CC1 A;  1MPL A;  2PU2 A;  1ERM A;  1CEG A;  4KG5 A;  4WMC A;  1FR6 A;  3P09 A;  2Y2K A;  2C6W B;  3EQV A;  3G30 A;  4B4X A;  2XFT A;  5F1F A;  3O88 A;  1YLY A;  3O87 A;  1YLJ A;  1NXY A;  2ZQC A;  5AQ7 A;  1K38 A;  5FDH A;  5GHX A;  3QNB A;  5A90 A;  3ZDJ A;  3SS3 A;  3Q82 A;  1K4E A;  2Y2Q A;  4FCF A;  1O7E A;  4RX2 A;  5EVI A;  3HLF A;  4GDB A;  2BG1 A;  2PU4 A;  1DJC A;  2Y59 A;  3IF6 B;  4OLD A;  1ONG A;  1XA1 A;  1ZG6 A;  3IXG A;  1PYY A;  5AQB A;  3BFG A;  4E3J A;  3IF6 A;  4UAA A;  3VFF A;  3VP2 A;  5HX9 A;  2XH9 A;  2WAF A;  3BFD A;  1JWV A;  4IBR A;  1MWU A;  5CTN A;  4R4S A;  1CI8 A;  5F82 A;  3W4P A;  3GRJ A;  1NYM A;  2ZQ8 A;  1L0D A;  4B4Z A;  4PMA A;  3P98 A;  5CGS A;  5FAS A;  5EOE A;  2ZLY A;  4L0L A;  4ZAM A;  3S1Y A;  3WS1 A;  4DKI A;  1I5Q A;  4UHU A;  2H0Y A;  5CGW A;  4DRT A;  4LV0 A;  2ZC5 B;  3GTC A;  4FH4 A;  1SCW A;  4EBN A;  3ITA A;  2G2U A;  3SH8 A;  2H10 A;  5FI6 A;  4LCL A;  4EUZ A;  3E2L A;  3IQA A;  1SDE A;  2V2F F;  3NC8 A;  4HEF A;  1KGE A;  4OON A;  5M18 A;  1L0G A;  4EV4 A;  3PAE A;  5TGF A;  3ZG5 A;  2ZMA A;  1XA7 A;  1KGF A;  2X02 A;  3W8K A;  2EXB A;  5GHZ A;  2RCX A;  4E3O A;  1TDL A;  3PBR A;  2Y2P A;  3ZG0 A;  2Y2O A;  1W7F A;  5GLD A;  1VM1 A;  4HES A;  3OPR A;  1MWS A;  5CHM A;  3ZNY A;  4E3N A;  4BL2 A;  2Y2M A;  5GLC A;  3A3D A;  4FD8 A;  1ERO A;  3VOZ A;  1BZA A;  2HP5 A;  3SH7 A;  4E3K A;  4WZ4 A;  2PBY A;  5CED A;  3PBN A;  4ID4 A;  4KG2 A;  1HVB A;  1L0F A;  2IWB A;  1LI9 A;  3FKV A;  2WAE A;  4CJN A;  1L2S A;  2XLN A;  3GV9 A;  4P0M A;  4XUZ A;  4K0W A;  4DDS A;  1ESI A;  1BUE A;  2WUQ A;  4OQI A;  2QMI A;  4BD0 A;  4ZDX A;  5EOO A;  2QPN A;  1XX2 A;  4GDN A;  5FAP A;  1HZO A;  3TOI A;  2E8I A;  5CXW A;  4RX3 A;  1K4F A;  4LV3 A;  2HP9 A;  2EX6 A;  2IWD A;  4IBX A;  4OPY A;  3Q81 A;  4MLL A;  5D3O A;  3PTE A;  3SOI A;  5A91 A;  2X01 A;  5M19 A;  4GD6 A;  3DW0 A;  1ZKJ A;  5AQA A;  4A5R A;  4WEK A;  1YLT A;  4ZJ2 A;  1QMF A;  3CMZ A;  3D4F A;  5F83 A;  4ZBE A;  4ZTK A;  2XEP A;  2BLS A;  2RL3 A;  4JXV A;  5CEB A;  2HPB A;  4PM9 A;  3M6H A;  4QY6 A;  4OPQ A;  3JYI A;  4NET A;  3LY4 A;  3O86 A;  3V39 A;  3VP0 A;  2XD5 A;  3BLM A;  4P87 A;  1IYP A;  1KE4 A;  4LV2 A;  2ZQD A;  4GNU A;  5EVL A;  3BFC A;  3C4O A;  2WKI A;  2WKH A;  3HRE A;  1MWR A;  5G18 A;  2Y2G A;  3LY3 A;  1GA9 A;  1H8Y A;  4EWF A;  4D2O A;  2GDN A;  2ZJ9 A;  5EEC A;  3CZD A;  1K54 C;  2DCF A;  2VGJ A;  4IVI A;  1K57 C;  2WK0 A;  3N8L A;  3FKW A;  3MZF A;  4C75 A;  1WYB A;  5HW3 A;  1FCO A;  2EXA A;  2R9X A;  3Q7Z A;  3MBZ A;  2H0T A;  4WZ5 C; 
#chains in the Genus database with same CATH topology
 4C3Q A;  5FQI A;  4ME4 A;  5AQ9 A;  3PYP A;  3LYX A;  4B88 A;  3P01 A;  1F9I A;  3BY9 A;  4JF5 A;  4BMW A;  4HBU A;  1STZ A;  2A24 A;  1I2W A;  2W1T B;  3QP1 A;  4ZJ3 A;  3C2W A;  3R7W B;  5AVF A;  1IKG A;  4PKY G;  1CEF A;  3M6B A;  1JNU A;  5EE8 A;  4OOL A;  4JGR A;  3WS2 A;  1E3U A;  1D06 A;  4KUO A;  1ESU A;  4K0X A;  3NCK A;  2WZZ A;  4JLF A;  2W3H A;  3QP6 A;  2GNX A;  4MEZ A;  5GLB A;  1W8Q A;  4WN5 A;  1T1A A;  1W8Y A;  4X1L A;  1P9W A;  1RGY A;  1XJ6 A;  2JE5 A;  4DE1 A;  3F1O B;  3MMH A;  3ZNT A;  4LEN A;  2VGL M;  2V1Z A;  3G34 A;  3HLC A;  5DTK A;  5EVE A;  4RYE A;  4E3L A;  1FQG A;  4N1X A;  2J80 A;  4BWI A;  3OCL A;  4U3T A;  4KQR A;  4X6T A;  4B93 A;  2P9V B;  5F68 A;  2OWH A;  1K56 D;  1VHM A;  3T4J A;  3O5Y A;  5F1G A;  4GKU A;  3FG8 A;  4C6Y A;  5JYP A;  2EFU A;  3E98 A;  1BLH A;  4FH2 A;  2VV6 A;  4EET B;  3QHY A;  1F2K A;  3RXX A;  4FSF A;  4OH0 A;  5DF8 A;  4OP8 A;  4S2M A;  3VP1 A;  4DJ3 A;  5EM1 A;  3RH8 B;  3VSL A;  5BOH A;  2VEA A;  1T1B A;  3LO7 A;  2WGW B;  3FC7 A;  5FSR A;  1JTD A;  2V9A A;  4EW7 A;  5HL1 A;  1CJF A;  1G5U A;  3PR6 A;  3IWO A;  5IHV A;  3Q7V B;  2GJ3 A;  5HFO A;  4WBG A;  1IOU A;  2LB5 A;  3WS4 A;  1XGJ A;  4KZ4 A;  4KZ8 A;  4ETX A;  4G3W A;  3MKE A;  1DRM A;  4DE3 A;  5EM0 A;  2PR5 A;  4E6W A;  2Y91 A;  4ARZ B;  3G2Y A;  4LFU A;  4R3A A;  3BFF A;  2VX8 A;  3S22 A;  1H0M A;  1L3L A;  3MSH A;  1DY6 A;  2PD7 A;  1XPB A;  4B9O A;  4E6X A;  5CRF A;  2Y2I A;  1MY8 A;  2P08 A;  1BLS A;  4Y0O A;  3N8R A;  4LLO B;  3PBS A;  4ESP A;  3ZVW A;  1HTZ A;  1NYY A;  3A3E A;  1VET A;  4OQG A;  2XFS A;  2I9V A;  4MNR A;  3BEC A;  3E0Y A;  2VV8 A;  1KDW A;  4KZ7 A;  3UE0 A;  4DXC A;  1S66 L;  5CEC A;  1H3Q A;  3KX0 X;  1L0E A;  3C7V A;  3U4L P;  2WKE A;  5KMW A;  1ES2 A;  3C30 A;  1BTL A;  1ZC2 A;  2ZC6 B;  4I3I A;  4P6Z M;  3OCN A;  4X69 A;  1F5M A;  2HJ9 C;  3T4Q A;  3WS5 A;  2EX8 A;  3LI8 A;  2PBD P;  1OTB A;  1SDN A;  4BBT A;  1K55 A;  1O07 A;  1W5D A;  1Y54 A;  2HDU A;  3GSG A;  2B5R A;  2HDR A;  1FOF A;  5HL6 A;  4KG6 A;  4HOI A;  3H7W A;  3T12 B;  1NZU A;  5IS1 A;  1D7E A;  2QJ5 A;  3B42 A;  4GZB A;  3RTY A;  3BRM A;  5HD3 A;  3ITB A;  2ZBB A;  5CHU A;  4N92 A;  1XFN A;  4YWZ A;  5HWV A;  3HL9 A;  2J8Y A;  4MBK A;  1WE4 A;  3HCY A;  4HBT A;  4L9G A;  5CHJ A;  3EGD C;  1ODV A;  4OQ0 A;  1PI5 A;  1LL5 A;  4X55 A;  4BQM A;  2ACG A;  1PFL A;  1RP5 A;  3CIT A;  5L2F A;  2Y2K A;  4II7 A;  1OPX A;  5FDH A;  3ZDJ A;  1YSP A;  1N9O A;  2Y2Q A;  3LR4 A;  4RX2 A;  1ONG A;  1XA1 A;  1ZG6 A;  5AQB A;  4E3J A;  3OBF A;  2XH9 A;  2L1M A;  5CTN A;  4R4S A;  1L0D A;  3P98 A;  1I5Q A;  5CGW A;  3UB5 P;  2EA9 A;  3S7Q A;  1CF0 A;  2YKH A;  3ITA A;  3SH8 A;  3E2L A;  1GSX A;  4FOF A;  5F5Y A;  2VK3 A;  5M18 A;  1L0G A;  3PAE A;  4I5S A;  2X02 A;  2V0U A;  5GHZ A;  2Y2O A;  5HZH A;  5HWW A;  5GLD A;  1VM1 A;  3OPR A;  3T1S A;  3VOZ A;  3ULF A;  5CED A;  2W0N A;  4ID4 A;  4KG2 A;  3FKV A;  2WAE A;  4XUZ A;  4GHI A;  1A0K A;  4EER A;  4NEE D;  1BUE A;  2WUQ A;  1LSW A;  2QPN A;  3F1N B;  2Z6C A;  5CXW A;  4LV3 A;  2IWD A;  4IBX A;  4OPY A;  2O0Y A;  3Q81 A;  4MLL A;  3PTE A;  5AQA A;  4ZRR A;  4HH3 A;  3D4F A;  4AFI A;  2CMN A;  4P6Z S;  4QY6 A;  3O86 A;  5EVL A;  2O99 A;  2WKI A;  3T4S A;  3MF0 A;  1YKD A;  3LY3 A;  4D2O A;  2GDN A;  2JKR M;  2ZJ9 A;  3PXP A;  5IU1 A;  3D72 A;  2DCF A;  1H8M A;  3LIA A;  2VGJ A;  3T1R A;  5HW3 A;  4Q0J A;  3MBZ A;  5K5B A;  4EQI A;  3CPT B;  1J9M A;  3HUO A;  3BQA A;  4R0Q A;  3IX4 A;  5EV0 A;  3E2K A;  3MKF A;  4DMZ A;  5FA7 A;  1BLP A;  1ES5 A;  3HUM A;  2D02 A;  4JXS A;  5GL9 A;  5GLA A;  3UB9 A;  1HD8 A;  1Q2Q A;  1CI9 A;  3OOV A;  3E4Q A;  4NXB A;  1YAX A;  1FSW A;  3A3J A;  4PKY A;  3WS0 A;  4DXB A;  1YPR A;  1YMS A;  3CJM A;  2ZOH A;  1JVJ A;  2JKG A;  3C38 A;  2IA2 A;  3OPP A;  1PNE A;  4ZJ1 A;  4F94 A;  1JWP A;  2V8C A;  4IVK A;  1IFQ A;  2J3T D;  2PAV P;  4JGQ A;  3UPP A;  2Y4A A;  4X25 A;  3EEA A;  4GB7 A;  3QP2 A;  3PHY A;  3F1O A;  3MQQ A;  2HF6 A;  4H8R A;  3LCE A;  3MR0 A;  4MDZ A;  5CX7 A;  5L8M A;  3UPO A;  2ZMF A;  3IX3 A;  2K2N A;  3LR0 A;  1PWG A;  4LRY C;  5DTS A;  4RA7 A;  3OPL A;  3ZCZ A;  1XP4 A;  3CUE A;  2OLV A;  3NI9 A;  2XDM A;  5TBM B;  1NRF A;  2Y2H A;  3C7U A;  4EQ1 A;  4YFM A;  3PAG A;  1U60 A;  3MXS A;  3BEB A;  3A3F A;  3PBQ A;  5FAQ A;  5HSQ A;  5JYO A;  3BFE A;  1NLY A;  1OTD A;  3CG5 A;  2FH5 A;  2V20 A;  1TVF A;  4OPZ A;  1W63 M;  3T4L A;  4QU3 A;  3UNW A;  3KSH A;  1BLC A;  3I7J A;  4HP9 A;  5FEG A;  3IS2 B;  3VOL A;  4Q0I A;  2WGW A;  1H8Z A;  2J3W A;  1E25 A;  3UB8 A;  1ES4 A;  4RQ9 A;  1WYC A;  3PBO A;  1K56 A;  5EVI D;  5FEF A;  1SZV A;  4GD8 A;  1KE0 A;  5HD5 A;  1AXB A;  4CPK A;  1K55 C;  1S1Y A;  4Y2F A;  3SZT A;  4PAU A;  4WLA A;  1FSY A;  1MXO A;  1RGZ A;  3GMW A;  3T4T A;  3HLE A;  1KVL A;  1M6K A;  3T4K A;  1IYQ A;  1W63 Q;  1LL9 A;  1OTE A;  3A0S A;  4O01 A;  3IWQ A;  3C5A A;  2UWX A;  4CLC D;  4HY8 A;  3ZG7 B;  3IXB A;  3U2A A;  3G6O A;  1TDG A;  5DF7 A;  5EVI B;  3IHB A;  3IT9 A;  3ZFZ A;  2XQZ A;  5DJT A;  1GCE A;  4OOY A;  5FQM A;  3VV4 A;  5DKL A;  4PM6 A;  4Y0T A;  1E4D A;  1BSG A;  2ZC4 B;  5KZH A;  2PYP A;  1ALQ A;  5HAR A;  4CLC B;  3H82 B;  1FIL A;  3OZH A;  1RCJ A;  4Z9Q A;  3CI6 A;  4QD4 A;  3EQU A;  4OKP A;  3UE3 A;  2JKT I;  3IH9 A;  4RVA A;  4GCZ A;  1MZU A;  4OLG A;  3K3C A;  1Q2P A;  2ZQ9 A;  1SKO A;  3SS5 A;  3TE8 A;  2PDR A;  3WRT A;  4BEN A;  2XA7 S;  1UWN X;  4S2O A;  3FPW A;  3TSG A;  4NK3 A;  1YMX A;  3LR5 A;  2M7U A;  3KYZ A;  4OOM A;  3Q1F A;  3PBT A;  5A93 A;  1ACF A;  2Y2J A;  1D1J A;  1P0Z A;  1PZO A;  1TD5 A;  4U0X A;  1GA0 A;  3Q07 A;  2VKS A;  3KO6 A;  1NZO A;  1CK3 A;  3FZC A;  1PW8 A;  5F69 A;  3GEC A;  4QHC A;  1MC0 A;  5E2G A;  3UDI A;  2XK1 A;  4S2N A;  2B18 A;  1BUL A;  1N4O A;  4H6J B;  3HLD A;  3HLG A;  1FCM A;  3F1P B;  2Y8H A;  3VP3 A;  4DJ2 A;  2XF3 A;  4JXG A;  4IHQ A;  4UA6 A;  5TR7 A;  2YKF A;  4KZ6 A;  3JVU A;  2P04 A;  1E3U D;  3G35 A;  3DBA A;  4KZB A;  4PM7 A;  1PW1 A;  5M1A A;  4MN7 A;  4R3J A;  3EWK A;  3LEZ A;  3NDE A;  1XFQ A;  4QJG A;  4L9F A;  1IEL A;  1MPL A;  2PU2 A;  1FR6 A;  3G30 A;  2C6W B;  2XFT A;  5F1F A;  3O88 A;  2A24 B;  1YLY A;  3O87 A;  1K38 A;  3VE3 A;  5MC7 A;  3UB7 A;  3HLF A;  2PU4 A;  2Y59 A;  3IF6 B;  4OLD A;  3KYQ A;  3IXG A;  4PHT A;  4UAA A;  3VP2 A;  5HX9 A;  3BFD A;  4IBR A;  1JWV A;  1Z09 A;  1CI8 A;  2QWS A;  3W4P A;  5DFY A;  5CGS A;  3D9Y A;  4NXG A;  2A2L A;  1SCW A;  3LIE A;  5FDS A;  5FI6 A;  4EUZ A;  2OWJ A;  2V2F F;  1T19 A;  4M4X A;  1FIK A;  3LGO A;  4EV4 A;  5TGF A;  3CLO A;  3LIC A;  2VA0 A;  2Y2P A;  1W7F A;  3BY8 A;  2AVX A;  4HES A;  1MWS A;  5AJG A;  4E3N A;  4KQD A;  4E3K A;  1BZA A;  1VEU B;  2VGL S;  4Y17 A;  2VLG A;  1MKM A;  1L2S A;  3TJZ C;  4DDS A;  3CWF A;  1XX2 A;  5FAP A;  3TOI A;  2E8I A;  1K4F A;  2EX6 A;  3T50 A;  2L0W A;  5FL3 A;  5A91 A;  5M19 A;  2INW A;  4GD6 A;  1ZKJ A;  2ZMV A;  4ZTK A;  2RL3 A;  4JXV A;  3M6H A;  3JVV A;  4LRX C;  4MN5 A;  2Y79 A;  4NET A;  3LY4 A;  3V39 A;  4UQI M;  5HPI A;  4P87 A;  3C4O A;  2WKH A;  2PR6 A;  2Y2G A;  3CUE C;  3RFB A;  4WL9 A;  1K57 C;  2WK0 A;  3MZF A;  2HJE A;  3GDI A;  2EXA A;  4LPZ A;  2V8F A;  1X0O A;  1FR1 A;  3L9K A;  3LR3 A;  4OVD A;  3CPT A;  4LCM A;  1F98 A;  2B02 A;  4S2L A;  2LB9 A;  3IHA A;  3HJK A;  4OP5 A;  5CTM A;  3QNC A;  4BJP A;  4N9L A;  3ZQ5 A;  4IJG A;  4NKP A;  3IBJ A;  3T1Q B;  4I3J A;  2D01 A;  2Z2M B;  4XT2 B;  2ZC7 A;  3DWZ A;  4HNB A;  2P7J A;  3MZE A;  4S2I A;  2HV1 A;  5HWT A;  4HQA A;  1GSV A;  4Y5F A;  1S1Z A;  1VET B;  2V1B A;  3V67 A;  2VGK A;  1K25 A;  1SKF A;  1KVM A;  3UDF A;  1NJ4 A;  4I39 A;  3N6I A;  4Y0U A;  4ETZ A;  5HAQ A;  2XGN A;  1MKI A;  1K6S A;  3KSG A;  5HAP A;  2HZ5 A;  3K3D A;  1LI0 A;  1ONH A;  2Q9M A;  4QPR A;  2J9O A;  3NOT C;  3AGE A;  1XJ2 A;  1G28 A;  3IH8 A;  4FUW A;  3RJU A;  2ZL1 A;  1H5X A;  1HLU P;  3N4I A;  3M2K A;  4M3K A;  5TBM A;  4PPR A;  4WYY A;  4EES A;  1PZP A;  3MXR A;  2UV0 E;  5FI7 A;  4Q8I A;  1PI4 A;  3IXH A;  4WZ5 A;  1LSX A;  1Y4O A;  2O9A A;  5DVA A;  2FZ0 A;  1FCN A;  3LEQ A;  3VP4 A;  4LRZ E;  4DE0 A;  2DNS A;  3H7W B;  3G4P A;  1K6R A;  3VSK A;  1Y28 A;  4XUX A;  1WA9 A;  2I72 A;  1G6A A;  1MBL A;  1ERQ A;  1JWZ A;  4PM8 A;  1KDS A;  3DTM A;  1VQQ A;  3EOI A;  2Z2L B;  2G7U A;  3HBR A;  5G4Y A;  1NY0 A;  2P74 A;  4R4R A;  3VFH A;  3HVF A;  4MBF A;  3BM6 A;  5J7E A;  2J7V A;  5AVE A;  1ES3 A;  4GS9 B;  1YSQ A;  3ISG A;  5L07 A;  4I3A A;  4S2N C;  3DAV A;  2W1T A;  2K7S A;  3MFD A;  2NUP C;  3ZHH A;  3R7W A;  2EX2 A;  1V9Y A;  2Q0O A;  2W27 A;  3UPN A;  1KOU A;  2JCH A;  5KSC A;  2WKR A;  2C5W B;  2ZD8 A;  2OSU A;  2PYR A;  1TF1 A;  2A49 A;  3GVB A;  5HDS A;  2HDS A;  3LIF A;  2ZM0 A;  3TRC A;  3LI9 A;  2WYX A;  4JKT A;  3NIA A;  1XGI A;  2M7V A;  2G2W A;  3UO9 A;  4HH2 A;  1BT5 A;  3MFX A;  4F3L B;  2Y2L A;  3H82 A;  4E04 A;  2ZC3 B;  4EEP A;  1N9B A;  2XRO A;  4YOF A;  1LL8 A;  4Z1W A;  5C5K A;  4K08 A;  2W3D A;  2JBF A;  2P9V A;  4YNR A;  4EUV A;  3HLW A;  2FFF B;  5KSH A;  1K57 A;  2QJ7 A;  4BBU A;  1XKZ A;  2H5S A;  4P6B A;  3V3S A;  1N9N A;  4MN6 A;  2EX9 A;  2HP6 A;  4GJ4 A;  5TFQ A;  4Y15 A;  3LFV A;  4JPM A;  2FFY A;  1TEM A;  3HLB A;  3DWK A;  3ICY A;  4Y13 A;  1ZTU A;  4Q0H A;  4KZ5 A;  4BD1 A;  5L09 A;  4KZ9 A;  2Y2N A;  3N7W A;  4WMC D;  3IF5 A;  1IYS A;  3JPU A;  1C3B A;  5E2H A;  1I2S A;  4KEN B;  2O9B A;  3AGD A;  3A0V A;  2B95 A;  5FQJ A;  1EW0 A;  5E2E A;  5GHY A;  3Q7V A;  1YLW A;  5F6A A;  4H6J A;  2ZM2 A;  3QP4 A;  4DF6 A;  1SHV A;  3NDG A;  4N9K A;  2BAS A;  2R9W A;  1YLP A;  4PM5 A;  5IT5 A;  3BJN A;  3BW6 A;  2VV7 A;  4WM9 A;  5I94 A;  3SS4 A;  4Y3I A;  4U0T A;  3N8S A;  4O7D A;  2W3F A;  3LIB A;  5FAT A;  5EPH A;  1DP8 A;  1EWZ A;  1G68 A;  1M40 A;  2KLI A;  4ARZ A;  1J3W A;  3WRZ A;  2CC1 A;  1T1C A;  4KG5 A;  1CEG A;  1TS0 A;  4MMN A;  3EQV A;  2MJ6 A;  4B4X A;  1NXY A;  3UME A;  3QNB A;  3Q82 A;  1K4E A;  4FCF A;  1TS6 A;  3C8C A;  4GDB A;  2BG1 A;  1DJC A;  3BFG A;  4JGO A;  3IF6 A;  4LGW A;  4WF0 A;  1TS7 A;  2WAF A;  3T4O A;  5HDC A;  3S7O A;  1T18 A;  1ZHH B;  5F82 A;  3W2Z A;  1NYM A;  2ZQ8 A;  4B4Z A;  5HPF A;  4PMA A;  3S1Y A;  2XRN A;  3A0R A;  4L0L A;  3WS1 A;  2H0Y A;  4NG2 A;  4LV0 A;  3TW8 A;  2ZC5 B;  4EBN A;  2G2U A;  2PD8 A;  3IQA A;  4CQH A;  1KGE A;  5HDD A;  1XA7 A;  3W8K A;  2VZW A;  5G4Z A;  2EXB A;  2RCX A;  4E3O A;  3PBR A;  1N9L A;  1BYW A;  1DP6 A;  2WKP A;  3S7N A;  2V1A A;  4BL2 A;  2Y2M A;  3R4K A;  3A3D A;  4FD8 A;  1ERO A;  5GLC A;  3UMD A;  3SH7 A;  4JGP A;  3PBN A;  1HVB A;  1L0F A;  2IWB A;  1LI9 A;  4CJN A;  4P0M A;  1VEU A;  4K0W A;  4OQI A;  5EOO A;  4GDN A;  1HZO A;  4RX3 A;  2HP9 A;  2BTF P;  3SOI A;  2X01 A;  4WEK A;  1YLT A;  4ZJ2 A;  5F83 A;  4PM9 A;  1K0K A;  2XD5 A;  3NHQ A;  1IYP A;  4GNU A;  3BFC A;  3HRE A;  3DTI A;  1MWR A;  3NJA A;  5G18 A;  1GA9 A;  5TJJ A;  3BWL A;  1H8Y A;  5EEC A;  3CZD A;  4HJ3 A;  3N8L A;  3FKW A;  5J3W A;  4C75 A;  1WYB A;  3KSF A;  4DN0 A;  4WZ5 C;  4UA9 A;  3NOP C;  2J3T C;  3MZD A;  4I38 A;  1OT6 A;  2ZQ7 A;  4KZA A;  3G32 A;  4UEY A;  2W3E A;  1G6O A;  3FWL A;  4JXW A;  1OTI A;  1PWD A;  3S4X A;  5A92 A;  4LV1 A;  2EWV A;  4IUK A;  4S2J A;  3B33 A;  1GSW A;  4WEJ A;  2VJW A;  1GHM A;  3BQ8 A;  4HHD A;  3E4P A;  3W4Q A;  4NXF A;  3C4P A;  4JF6 A;  1Z6F A;  1S6R A;  4R3B A;  4HI4 A;  4XT2 A;  3OC2 A;  1ZG4 A;  1VB6 A;  5E2F A;  5J8X A;  2GZA A;  3QP5 A;  4OQH A;  2OV5 A;  4O8G A;  2QYB A;  3BLS A;  1JTG A;  1LLB A;  3ZG8 B;  3DTK A;  3E4O A;  2KOI A;  3NBL A;  3CHW P;  2EFX A;  2KX6 A;  4QY5 A;  3BYD A;  4HP4 A;  1IYO A;  4G3V A;  3W4O A;  2ZM8 A;  4S2P A;  1GHP A;  3NEC A;  5EVI C;  1SKO B;  4R70 A;  4BLM A;  4JBF A;  1YQS A;  2GX5 A;  5DJU A;  2OAP 1;  4G3K A;  4E3M A;  2X71 A;  2JKR I;  1K54 A;  3F1N A;  4GLQ A;  3M2J A;  1PRQ A;  1S4R A;  4X56 A;  3TG9 A;  4CLC C;  1KGG A;  5HAI A;  2WZX A;  4YIN A;  5FQ9 A;  5FQQ A;  2JKT M;  3FV7 A;  3LUQ A;  3IXD A;  4IED A;  1OME A;  4R38 A;  4EU0 A;  1LHY A;  4WUJ A;  3O3V A;  5I5L A;  3ZVT A;  4KQO A;  2DRW A;  2IWC A;  2XSS A;  3V5M A;  4QB8 A;  4E3I A;  4OPR A;  4GOG A;  5FQK A;  1PIO A;  4BL3 A;  1YLZ A;  1PWC A;  3IX8 A;  4XXR A;  3KSI A;  5LBR A;  1OJG A;  3G2Z A;  3V3R A;  3ZYT A;  2KDK A;  3FPV A;  3T1X A;  3OPH A;  5EUA A;  2OLU A;  3G31 A;  3MXQ A;  3MS6 A;  3S7P A;  2J9P A;  2M1C A;  3AGF A;  4GS9 A;  2Y55 A;  1QME A;  5DF9 A;  4X53 A;  4Y7P A;  2JC7 A;  3NOU C;  4MBH A;  2QZ6 A;  1S4S A;  1IKI A;  2WGI A;  3UB6 A;  2XR0 A;  3VE4 A;  3EEH A;  1UWP X;  3B3X A;  2Z6D A;  4S2K A;  4NXE A;  4WEL A;  1MWT A;  1DJB A;  4BBV A;  3QP8 A;  5DKK A;  2PT7 A;  3KYE A;  1XXM A;  2HDQ A;  3VMA A;  2O9C A;  3SH9 A;  4HJ6 A;  4X1M A;  4DE2 A;  4FTX A;  3UY6 A;  4P85 A;  4F3L A;  4O0P A;  3GR2 A;  3ZG9 B;  1NWZ A;  5FI2 A;  4UA7 A;  3OLO A;  3IF6 C;  5E43 A;  3GQZ A;  4X68 A;  1GHI A;  1V9Z A;  3MQ0 A;  4EBL A;  1DJA A;  4R1G A;  1NRJ A;  4R23 A;  2XD1 A;  2A3U A;  2OAQ 1;  4KQQ A;  3FYZ A;  5DTT A;  4N1H A;  4KZ3 A;  5CGX A;  2WAD A;  3IWI A;  3NY4 A;  5DFX A;  2ZOI A;  2QKP A;  1AWI A;  4K91 A;  3V50 A;  1EI5 A;  3WWX A;  4D60 A;  2Q9N A;  3LID A;  4EBP A;  3DTE A;  3RXW A;  1KE3 A;  2PRF A;  5U47 A;  3IS2 A;  5FAO A;  3UN7 A;  3L7H A;  3K2N A;  2HGV A;  2H28 A;  4IUH A;  3VOY A;  1S0W A;  4GN2 A;  5J4E A;  5CER A;  4DDY A;  4R6L A;  3MQO A;  5A8B A;  4UQI S;  3A3I A;  1LSV A;  4HIA A;  2WKQ A;  4GW9 A;  1YM1 A;  4JF4 A;  3HUN A;  2WGV A;  3UDX A;  1LT0 A;  3UE1 A;  1W79 A;  2ZQA A;  1YT4 A;  1IEM A;  1DP9 A;  3ZGA B;  4KUK A;  1ERM A;  4WMC A;  3P09 A;  2DMW A;  4L9E A;  1YLJ A;  2ZQC A;  5AQ7 A;  5GHX A;  5A90 A;  3SS3 A;  4MCW A;  4CLC E;  1O7E A;  5EVI A;  1OTA A;  1PYY A;  3VFF A;  4HJ4 A;  2JHE A;  2NUT C;  1MWU A;  2W3G A;  2JKF A;  3GRJ A;  1UGU A;  3MJQ A;  3H9W A;  2W1R A;  3SW1 A;  5FAS A;  5EOE A;  2ZLY A;  4ZAM A;  1NLZ A;  4DKI A;  4UHU A;  5EFW A;  4CLC A;  4DRT A;  3GTC A;  4FH4 A;  2H10 A;  2L4R A;  1S67 L;  4LCL A;  2XA7 M;  3EGX C;  1SDE A;  2PHY A;  3NC8 A;  2K31 A;  4HEF A;  4OON A;  1XJ4 A;  2EWW A;  3ZG5 A;  2ZMA A;  1KGF A;  3HJI A;  1TDL A;  4EXO A;  3ZG0 A;  1XJ3 A;  2JN7 A;  5CHM A;  3ZNY A;  3P7N A;  4GHI B;  2HP5 A;  5KIZ A;  4WZ4 A;  2PBY A;  3IBR A;  3NUL A;  2XLN A;  3GV9 A;  1ESI A;  2QMI A;  4BD0 A;  4ZDX A;  2V0W A;  4QWO A;  2ZL1 B;  5D3O A;  3DW0 A;  4A5R A;  1QMF A;  3CMZ A;  4ZBE A;  2XEP A;  2BLS A;  3D3O A;  5CEB A;  2HPB A;  3B47 A;  4OPQ A;  3JYI A;  3VP0 A;  3BLM A;  2R78 A;  5L10 A;  1P97 A;  3F1P A;  1KE4 A;  4EEU A;  1OT9 A;  4LV2 A;  2ZQD A;  1P9R A;  4EWF A;  3UE6 A;  1K54 C;  2OOL A;  4IVI A;  2E8J A;  1FCO A;  3CAX A;  2R9X A;  3Q7Z A;  1CQA A;  1TS8 A;  2QHK A;  2H0T A;  1OJ5 A; 
#chains in the Genus database with same CATH homology
 4UA9 A;  1FR1 A;  4EQI A;  1J9M A;  3HUO A;  4C3Q A;  5FQI A;  3MZD A;  4R0Q A;  5AQ9 A;  3E2K A;  2ZQ7 A;  4OVD A;  4KZA A;  4B88 A;  3MKF A;  3G32 A;  4LCM A;  3FWL A;  4JF5 A;  4HBU A;  5FA7 A;  4S2L A;  4JXW A;  3IHA A;  1BLP A;  1ES5 A;  1PWD A;  3S4X A;  3HUM A;  4JXS A;  5GL9 A;  1I2W A;  5GLA A;  5A92 A;  1HD8 A;  4OP5 A;  5CTM A;  4ZJ3 A;  4LV1 A;  3QNC A;  1Q2Q A;  1CI9 A;  4S2J A;  1IKG A;  4BJP A;  4WEJ A;  4N9L A;  1CEF A;  3M6B A;  5EE8 A;  4OOL A;  1FSW A;  1GHM A;  3A3J A;  3WS0 A;  4DXB A;  3WS2 A;  1E3U A;  1YMS A;  1ESU A;  3W4Q A;  3CJM A;  3C4P A;  4JF6 A;  1JVJ A;  1Z6F A;  2Z2M B;  4K0X A;  2ZC7 A;  3DWZ A;  1S6R A;  3OPP A;  3NCK A;  4S2I A;  3MZE A;  2WZZ A;  4R3B A;  4JLF A;  3OC2 A;  1ZG4 A;  4MEZ A;  5E2F A;  4ZJ1 A;  4F94 A;  1JWP A;  5GLB A;  5J8X A;  4OQH A;  2VGK A;  2OV5 A;  1W8Q A;  1K25 A;  1SKF A;  3BLS A;  4IVK A;  1KVM A;  1W8Y A;  1JTG A;  3UDF A;  1NJ4 A;  1LLB A;  1RGY A;  3UPP A;  2Y4A A;  2JE5 A;  3ZG8 B;  4DE1 A;  3N6I A;  4Y0U A;  3NBL A;  4GB7 A;  3ZNT A;  5HAQ A;  2XGN A;  4LEN A;  1MKI A;  2EFX A;  2V1Z A;  3G34 A;  1K6S A;  3HLC A;  4QY5 A;  5DTK A;  3BYD A;  5HAP A;  4H8R A;  1IYO A;  3LCE A;  4RYE A;  3W4O A;  4E3L A;  2ZM8 A;  1FQG A;  4N1X A;  4S2P A;  1GHP A;  1LI0 A;  5EVI C;  1ONH A;  3OCL A;  2Q9M A;  4U3T A;  3UPO A;  4KQR A;  4X6T A;  1PWG A;  2J9O A;  2P9V B;  5DTS A;  3AGE A;  4BLM A;  4RA7 A;  1K56 D;  3OPL A;  3ZCZ A;  1XP4 A;  5F1G A;  3IH8 A;  4GKU A;  2OLV A;  4JBF A;  4C6Y A;  1YQS A;  2XDM A;  3NI9 A;  5JYP A;  1NRF A;  4E3M A;  2X71 A;  1K54 A;  2EFU A;  2Y2H A;  3C7U A;  3RJU A;  4YFM A;  1H5X A;  3N4I A;  3M2K A;  4M3K A;  3M2J A;  4PPR A;  1BLH A;  4FH2 A;  3PAG A;  4WYY A;  1PZP A;  3MXR A;  1U60 A;  3MXS A;  5FI7 A;  3QHY A;  3BEB A;  4Q8I A;  1PI4 A;  3A3F A;  3IXH A;  3PBQ A;  4WZ5 A;  4X56 A;  5FAQ A;  3BFE A;  3RXX A;  3TG9 A;  5JYO A;  4FSF A;  4OH0 A;  5DF8 A;  5DVA A;  3CG5 A;  1FCN A;  1KGG A;  2V20 A;  5HAI A;  2WZX A;  4OP8 A;  4S2M A;  4YIN A;  1TVF A;  5FQ9 A;  3VP4 A;  4DE0 A;  4OPZ A;  2DNS A;  3VP1 A;  4QU3 A;  3UNW A;  3VSL A;  1BLC A;  5FQQ A;  3G4P A;  5BOH A;  3FV7 A;  1K6R A;  3LO7 A;  3VSK A;  3IXD A;  2WGW B;  3I7J A;  4IED A;  1JTD A;  1OME A;  5FSR A;  1LHY A;  3O3V A;  4XUX A;  3ZVT A;  5HL1 A;  4KQO A;  2WGW A;  1H8Z A;  2DRW A;  3IWO A;  2I72 A;  2IWC A;  5IHV A;  1G6A A;  3Q7V B;  1E25 A;  1MBL A;  1ERQ A;  1ES4 A;  5HFO A;  3V5M A;  1JWZ A;  1WYC A;  4QB8 A;  4PM8 A;  3PBO A;  4E3I A;  1K56 A;  5EVI D;  4WBG A;  4OPR A;  3WS4 A;  1XGJ A;  4GOG A;  5FQK A;  1KDS A;  1PIO A;  4KZ4 A;  3DTM A;  1VQQ A;  4GD8 A;  1KE0 A;  1YLZ A;  1AXB A;  1PWC A;  4BL3 A;  4KZ8 A;  2Z2L B;  4XXR A;  4CPK A;  3HBR A;  1K55 C;  1NY0 A;  2P74 A;  3G2Z A;  3V3R A;  4R4R A;  3VFH A;  3MKE A;  3HVF A;  4MBF A;  1FSY A;  1MXO A;  1RGZ A;  3GMW A;  4DE3 A;  3HLE A;  3BM6 A;  4E6W A;  1KVL A;  2J7V A;  3OPH A;  5EUA A;  2Y91 A;  2OLU A;  1M6K A;  3G31 A;  1IYQ A;  1ES3 A;  1LL9 A;  2J9P A;  3IWQ A;  3C5A A;  2UWX A;  3ISG A;  3G2Y A;  3AGF A;  4S2N C;  2Y55 A;  3BFF A;  3ZG7 B;  3S22 A;  3IXB A;  1QME A;  3MFD A;  5DF9 A;  3ZHH A;  4X53 A;  4Y7P A;  2EX2 A;  1DY6 A;  2JC7 A;  4MBH A;  2QZ6 A;  1TDG A;  1XPB A;  5DF7 A;  4E6X A;  1IKI A;  2WGI A;  5EVI B;  3IHB A;  5CRF A;  3IT9 A;  2XR0 A;  2Y2I A;  3UPN A;  1MY8 A;  2JCH A;  5KSC A;  2C5W B;  2ZD8 A;  2OSU A;  3B3X A;  3ZFZ A;  1BLS A;  4S2K A;  2XQZ A;  4Y0O A;  3N8R A;  4WEL A;  1GCE A;  1MWT A;  3PBS A;  2A49 A;  4OOY A;  1DJB A;  5FQM A;  3ZVW A;  3GVB A;  2HDS A;  2ZM0 A;  4PM6 A;  4Y0T A;  1HTZ A;  1NYY A;  2WYX A;  4JKT A;  3NIA A;  1E4D A;  1BSG A;  1XGI A;  2ZC4 B;  3A3E A;  4OQG A;  5KZH A;  2G2W A;  2XFS A;  1XXM A;  2HDQ A;  3UO9 A;  3VMA A;  1ALQ A;  5HAR A;  4MNR A;  3BEC A;  1BT5 A;  3SH9 A;  1KDW A;  2Y2L A;  4KZ7 A;  3UE0 A;  4DXC A;  4DE2 A;  3OZH A;  2ZC3 B;  1RCJ A;  4Z9Q A;  3UY6 A;  4P85 A;  1N9B A;  5CEC A;  4QD4 A;  1L0E A;  3GR2 A;  3ZG9 B;  3EQU A;  4OKP A;  3UE3 A;  3IH9 A;  4UA7 A;  3C7V A;  4RVA A;  5FI2 A;  4OLG A;  2WKE A;  5KMW A;  3IF6 C;  1Q2P A;  2ZQ9 A;  1ES2 A;  3SS5 A;  2JBF A;  5E43 A;  3WRT A;  3GQZ A;  2P9V A;  1BTL A;  1ZC2 A;  4X68 A;  4BEN A;  2ZC6 B;  1GHI A;  4EBL A;  1DJA A;  3HLW A;  4S2O A;  4R1G A;  2FFF B;  3TSG A;  4NK3 A;  3OCN A;  4R23 A;  1YMX A;  5KSH A;  1K57 A;  4X69 A;  2XD1 A;  2A3U A;  1XKZ A;  2H5S A;  4KQQ A;  4P6B A;  4OOM A;  3V3S A;  2EX9 A;  2HP6 A;  3FYZ A;  3PBT A;  3Q1F A;  3WS5 A;  5A93 A;  5DTT A;  2EX8 A;  4N1H A;  5TFQ A;  4KZ3 A;  5CGX A;  2Y2J A;  4JPM A;  2FFY A;  1TEM A;  1SDN A;  2WAD A;  3HLB A;  3IWI A;  3NY4 A;  1PZO A;  1K55 A;  4U0X A;  1GA0 A;  1O07 A;  1W5D A;  1Y54 A;  2HDU A;  3DWK A;  3GSG A;  2B5R A;  2HDR A;  4K91 A;  3Q07 A;  3V50 A;  1FOF A;  1EI5 A;  3WWX A;  4KG6 A;  1NZO A;  2Q9N A;  1CK3 A;  3FZC A;  4EBP A;  4KZ5 A;  1PW8 A;  4BD1 A;  4KZ9 A;  2Y2N A;  3N7W A;  1NZU A;  4WMC D;  3IF5 A;  3RXW A;  1KE3 A;  1IYS A;  1C3B A;  5U47 A;  5E2H A;  1I2S A;  4KEN B;  4QHC A;  3AGD A;  4GZB A;  5E2G A;  3UDI A;  2XK1 A;  3BRM A;  4S2N A;  5FAO A;  3ITB A;  5FQJ A;  1BUL A;  3UN7 A;  1N4O A;  3HLD A;  3HLG A;  5E2E A;  5GHY A;  3Q7V A;  1FCM A;  3VOY A;  3VP3 A;  1YLW A;  1S0W A;  5CHU A;  4N92 A;  2ZM2 A;  4DF6 A;  1SHV A;  2XF3 A;  4JXG A;  3NDG A;  4N9K A;  4GN2 A;  2R9W A;  3HL9 A;  1YLP A;  2J8Y A;  4MBK A;  5CER A;  4UA6 A;  4DDY A;  4PM5 A;  1WE4 A;  5TR7 A;  4KZ6 A;  3A3I A;  4WM9 A;  4HBT A;  1E3U D;  5CHJ A;  3SS4 A;  1YM1 A;  4JF4 A;  3G35 A;  5I94 A;  3HUN A;  2WGV A;  3N8S A;  4U0T A;  3UDX A;  4KZB A;  4O7D A;  4PM7 A;  1PW1 A;  3UE1 A;  4OQ0 A;  5M1A A;  1W79 A;  5FAT A;  4R3J A;  5EPH A;  1EWZ A;  1G68 A;  1PI5 A;  1LL5 A;  1M40 A;  3LEZ A;  2ZQA A;  1YT4 A;  1IEM A;  4X55 A;  3ZGA B;  4BQM A;  3NDE A;  3WRZ A;  4QJG A;  1RP5 A;  1IEL A;  5L2F A;  2CC1 A;  1MPL A;  2PU2 A;  1ERM A;  1CEG A;  4KG5 A;  4WMC A;  1FR6 A;  3P09 A;  2Y2K A;  2C6W B;  3EQV A;  3G30 A;  4B4X A;  2XFT A;  5F1F A;  3O88 A;  1YLY A;  3O87 A;  1YLJ A;  1NXY A;  2ZQC A;  5AQ7 A;  1K38 A;  5FDH A;  5GHX A;  3QNB A;  5A90 A;  3ZDJ A;  3SS3 A;  3Q82 A;  1K4E A;  2Y2Q A;  4FCF A;  1O7E A;  4RX2 A;  5EVI A;  3HLF A;  4GDB A;  2BG1 A;  2PU4 A;  1DJC A;  2Y59 A;  3IF6 B;  4OLD A;  1ONG A;  1XA1 A;  1ZG6 A;  3IXG A;  1PYY A;  5AQB A;  3BFG A;  4E3J A;  3IF6 A;  4UAA A;  3VFF A;  3VP2 A;  5HX9 A;  2XH9 A;  2WAF A;  3BFD A;  1JWV A;  4IBR A;  1MWU A;  5CTN A;  4R4S A;  1CI8 A;  5F82 A;  3W4P A;  3GRJ A;  1NYM A;  2ZQ8 A;  1L0D A;  4B4Z A;  4PMA A;  3P98 A;  5CGS A;  5FAS A;  5EOE A;  2ZLY A;  4L0L A;  4ZAM A;  3S1Y A;  3WS1 A;  4DKI A;  1I5Q A;  4UHU A;  2H0Y A;  5CGW A;  4DRT A;  4LV0 A;  2ZC5 B;  3GTC A;  4FH4 A;  1SCW A;  4EBN A;  3ITA A;  2G2U A;  3SH8 A;  2H10 A;  5FI6 A;  4LCL A;  4EUZ A;  3E2L A;  3IQA A;  1SDE A;  2V2F F;  3NC8 A;  4HEF A;  1KGE A;  4OON A;  5M18 A;  1L0G A;  4EV4 A;  3PAE A;  5TGF A;  3ZG5 A;  2ZMA A;  1XA7 A;  1KGF A;  2X02 A;  3W8K A;  2EXB A;  5GHZ A;  2RCX A;  4E3O A;  1TDL A;  3PBR A;  2Y2P A;  3ZG0 A;  2Y2O A;  1W7F A;  5GLD A;  1VM1 A;  4HES A;  3OPR A;  1MWS A;  5CHM A;  3ZNY A;  4E3N A;  4BL2 A;  2Y2M A;  5GLC A;  3A3D A;  4FD8 A;  1ERO A;  3VOZ A;  1BZA A;  2HP5 A;  3SH7 A;  4E3K A;  4WZ4 A;  2PBY A;  5CED A;  3PBN A;  4ID4 A;  4KG2 A;  1HVB A;  1L0F A;  2IWB A;  1LI9 A;  3FKV A;  2WAE A;  4CJN A;  1L2S A;  2XLN A;  3GV9 A;  4P0M A;  4XUZ A;  4K0W A;  4DDS A;  1ESI A;  1BUE A;  2WUQ A;  4OQI A;  2QMI A;  4BD0 A;  4ZDX A;  5EOO A;  2QPN A;  1XX2 A;  4GDN A;  5FAP A;  1HZO A;  3TOI A;  2E8I A;  5CXW A;  4RX3 A;  1K4F A;  4LV3 A;  2HP9 A;  2EX6 A;  2IWD A;  4IBX A;  4OPY A;  3Q81 A;  4MLL A;  5D3O A;  3PTE A;  3SOI A;  5A91 A;  2X01 A;  5M19 A;  4GD6 A;  3DW0 A;  1ZKJ A;  5AQA A;  4A5R A;  4WEK A;  1YLT A;  4ZJ2 A;  1QMF A;  3CMZ A;  3D4F A;  5F83 A;  4ZBE A;  4ZTK A;  2XEP A;  2BLS A;  2RL3 A;  4JXV A;  5CEB A;  2HPB A;  4PM9 A;  3M6H A;  4QY6 A;  4OPQ A;  3JYI A;  4NET A;  3LY4 A;  3O86 A;  3V39 A;  3VP0 A;  2XD5 A;  3BLM A;  4P87 A;  1IYP A;  1KE4 A;  4LV2 A;  2ZQD A;  4GNU A;  5EVL A;  3BFC A;  3C4O A;  2WKI A;  2WKH A;  3HRE A;  1MWR A;  5G18 A;  2Y2G A;  3LY3 A;  1GA9 A;  1H8Y A;  4EWF A;  4D2O A;  2GDN A;  2ZJ9 A;  5EEC A;  3CZD A;  1K54 C;  2DCF A;  2VGJ A;  4IVI A;  1K57 C;  2WK0 A;  3N8L A;  3FKW A;  3MZF A;  4C75 A;  1WYB A;  5HW3 A;  1FCO A;  2EXA A;  2R9X A;  3Q7Z A;  3MBZ A;  2H0T A;  4WZ5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...