1Y4OA

Solution structure of a mouse cytoplasmic roadblock/lc7 dynein light chain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
GHHHHHHLEAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Dynein light chain 2A, cytoplasmic
publication title Solution structure of isoform 1 of Roadblock/LC7, a light chain in the dynein complex.
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1y4oA00
3MS6A 1A0KA 1PNEA 3U4LP 1J3WA 1K0KA 2E8JA 2ZL1A 2V8CA 2ZL1B 5FDSA 1SZVA 3UB5P 3T1SA 1HLUP 3T1QB 2JKGA 1AWIA 1CJFA 2B95A 2PRFA 3CPTA 5EM1A 1PFLA 1PRQA 5EM0A 3CPTB 4X1LA 2JKFA 1Y4OA 3LEQA 3KYEA 4X25A 2VK3A 3T12B 4FTXA 1D1JA 1ACFA 1YPRA 2ACGA 1VEUB 4X1MA 1G5UA 1VETA 4D60A 4ESPA 5FEFA 1VETB 3CHWP 3L7HA 1SKOA 1FILA 1Z09A 2PAVP 1SKOB 3LGOA 4FUWA 3L9KA 2V8FA 1FIKA 1VEUA 2PBDP 2HZ5A 1CF0A 2BTFP 3T1RA 1F2KA 4QWOA 3NECA 3T1XA 3DAVA 3D9YA 5EV0A 5EVEA 5FEGA 3NULA 3MSHA 1CQAA
chains in the Genus database with same CATH superfamily
4GB7A 4E3JA 4KQOA 3GMWA 3HLWA 2L0WA 2EFUA 3C7VA 2WADA 4JXWA 4KUKA 3SOIA 4EBPA 3FPWA 3H82B 3SH8A 4UQIS 3BYDA 3Q7ZA 1HVBA 3MR0A 4ID4A 5EPHA 2EXBA 2PR5A 3ZYTA 5D3OA 3MQ0A 2V20A 4OOYA 3LIBA 1JNUA 4LV2A 3NOPC 1X0OA 2X02A 3LUQA 3G2YA 5HDSA 3UPNA 4NXBA 3BFFA 4DF6A 2ZM0A 4EERA 1CI8A 4HQAA 2Y2IA 2QJ7A 3W2ZA 3L7HA 4Q0IA 3JVVA 2QMIA 2VJWA 5CHJA 1W5DA 2VZWA 2Y79A 3RXWA 1S67L 3JVUA 2Y8HA 2I9VA 5DVAA 4E04A 3K3CA 1M6KA 3T1RA 3ZDJA 1MKMA 4HHDA 5TBMB 5GHZA 3A0SA 3M2JA 3IX4A 4S2NC 3HLDA 4HH2A 1PZOA 4HBUA 3RXXA 1CQAA 4UA7A 2XFSA 3MS6A 2K2NA 4P6ZM 1Y54A 4X69A 5E43A 3LO7A 4Y17A 5M18A 3OCNA 4UEYA 4LRZE 5AQBA 3HLFA 3UPPA 1W8YA 1OT9A 3Q82A 4KZBA 3T4SA 4G3VA 4PKYA 3T4QA 3O86A 2WZZA 1K56D 2JCHA 2J3TC 5G4YA 2J9OA 1JWVA 1NRJA 4XXRA 1K4EA 2ZQCA 1LLBA 4FTXA 4EQIA 4QU3A 2VV8A 4JF6A 1L2SA 2JKRI 1RCJA 4OOMA 3IXHA 1MPLA 1FCOA 4IVIA 3FV7A 4C6YA 1MXOA 3ZG9B 5CGXA 2IA2A 1SKOB 3GQZA 4LLOB 4I39A 4MN5A 4EBNA 3BFCA 3M2KA 1ZG6A 3G2ZA 5HAIA 4X55A 2QPNA 2ZQDA 3ZNTA 1NYYA 4EUVA 4HP4A 2Y2NA 1YM1A 2ZD8A 4UA9A 2I72A 3AGDA 4JXGA 4OLDA 1LI0A 4KZ8A 3Q1FA 1JTDA 4Z1WA 2ZLYA 3NOUC 3TOIA 3KSHA 4Z9QA 1L0FA 3A0RA 5HAQA 3CMZA 1IEMA 4HJ4A 4X53A 3HLEA 3HBRA 3QP8A 4OONA 1OTEA 4RX3A 4N1XA 2XR0A 1GSXA 4E3KA 4K91A 1P9WA 3FWLA 4ZBEA 2HP6A 4GZBA 5HW3A 4IJGA 2JHEA 3IHAA 3A3DA 3TJZC 3DTIA 1OJGA 4HNBA 5FQ9A 1IOUA 4I5SA 1YSQA 5HD3A 2PBYA 4BLMA 3V3SA 2ACGA 4BENA 2DNSA 1GA0A 3CUEC 2W0NA 4YOFA 4ESPA 2X01A 5DKLA 1VETB 3BW6A 2VA0A 4B88A 4EETB 1BLSA 1DP6A 1PW1A 4LENA 3SH9A 1JTGA 1S1YA 3HVFA 3MF0A 4PM5A 5DKKA 1H8YA 5EVLA 1DP8A 5E2FA 4N1HA 3LIAA 4GNUA 2W1RA 4R6LA 2CMNA 2XA7M 4HESA 2Y2OA 4DJ2A 3UY6A 3Q07A 3NOTC 5DTTA 4S2MA 3UE0A 1DP9A 4DE2A 1YKDA 3HCYA 2GZAA 2Y2HA 3W4QA 1IKIA 3VFHA 4GW9A 3DWZA 4GS9A 3PR6A 2H28A 3OPRA 3PBSA 2V8CA 5F5YA 3QP4A 5TFQA 3T1SA 4HEFA 5L2FA 4MBHA 4U3TA 1AWIA 2Y4AA 3DTKA 1PFLA 3MBZA 1XGIA 2WKRA 3IBRA 1XKZA 3WRTA 1T18A 1BSGA 1O07A 2EFXA 1CEGA 4WZ4A 3LI8A 3PBNA 2K7SA 1L0GA 4OQGA 4HY8A 4FH4A 2PR6A 5U47A 1LL8A 2VGLS 1BULA 3R7WA 3IQAA 2Y91A 2ZMVA 4E3IA 3SS3A 3MKEA 2HV1A 1XJ6A 5DF9A 2V9AA 3P98A 2HZ5A 3I7JA 3IXBA 5F68A 3GTCA 2PT7A 3PAEA 1VHMA 2ZMAA 3BLMA 3DWKA 2M7UA 1S4RA 5FA7A 5TGFA 2WKQA 4ZAMA 5HPFA 3B47A 4P85A 3E4QA 3W8KA 1T1CA 3PYPA 4S2PA 3EGXC 4NETA 2BASA 2KOIA 1TEMA 3NULA 1FSWA 3IS2A 1S6RA 5CRFA 3IX3A 3TRCA 4MEZA 5IHVA 5IT5A 4CLCB 5M1AA 3KSIA 1FSYA 5DJUA 1ES3A 1XJ3A 2JC7A 4CLCE 1RGYA 4ARZB 5IS1A 2H0YA 1S4SA 2ZOIA 1MWRA 4G3KA 4GDNA 5GLCA 4LGWA 1YLJA 5EM0A 4D2OA 3CPTB 3D3OA 3TG9A 4GHIB 3ZVTA 5CX7A 4E3LA 1TDGA 4R23A 2D01A 3FZCA 4S2LA 1YPRA 1E3UD 5DTKA 1T1AA 3BM6A 3PBRA 1MBLA 2A2LA 4PM8A 3VP4A 5L8MA 3SH7A 3DW0A 1PI4A 5LBRA 1ALQA 1K55C 2EX6A 4KZ6A 3ITBA 1YT4A 4I3AA 3EQVA 4B9OA 2ZC4B 5A91A 1BTLA 4I3JA 3BLSA 4WEKA 3PTEA 4Q8IA 2WGVA 4OP5A 4RQ9A 1N4OA 1DRMA 1KGFA 2OWJA 4GD8A 2PU4A 3ZGAB 1H8ZA 2PYRA 3NBLA 5EV0A 4IVKA 4NXFA 1Q2PA 1IYSA 3GR2A 2XDMA 3WRZA 4EUZA 2LB9A 2XLNA 4E3MA 1ES5A 1XA7A 3IX8A 2PHYA 4K0WA 1U60A 3EQUA 1P0ZA 5EVIA 3T4OA 4BBUA 4PKYG 5G4ZA 3O3VA 2EX2A 3ISGA 1PWCA 3PXPA 4HI4A 5EUAA 5E2HA 2Q0OA 4ZDXA 1S1ZA 5DFYA 3MJQA 3LICA 2CC1A 4MNRA 1H8MA 1LSVA 1I2WA 4II7A 1D1JA 5AQAA 1K6RA 4WYYA 3IBJA 1JWZA 2OWHA 3C8CA 4CLCC 5J3WA 2IWCA 1DJAA 2W3FA 3LCEA 4ETZA 2QYBA 1Z09A 3VP2A 4UQIM 2EXAA 5I5LA 4FUWA 4EQ1A 1EROA 2PD8A 5HSQA 2QJ5A 3P01A 3C4OA 3S7QA 3SZTA 2B18A 5EVID 3HUMA 4XUXA 3F1PB 3B33A 1L3LA 4JBFA 3LIEA 3WS4A 2WGIA 1PI5A 1MWSA 1GSWA 4KZ4A 4QWOA 5DTSA 1XX2A 2J7VA 2P9VB 2ZM8A 4DN0A 5HPIA 3BRMA 4PM6A 1K56A 3DAVA 2Y2GA 4QHCA 1ZTUA 4GOGA 4Y15A 3H7WA 4R0QA 5FEGA 3T4KA 3PAGA 3IF6B 3FPVA 3EEAA 3OCLA 4B4ZA 5AQ9A 2FH5A 1J3WA 5CTNA 2XK1A 2VX8A 1MY8A 4NK3A 3W4OA 2ZL1B 1W79A 2GX5A 5AQ7A 4I38A 5KSHA 3LR3A 3PBTA 3S22A 1M40A 5MC7A 3HL9A 4O7DA 5EECA 1VQQA 1ERMA 3GV9A 1NY0A 1RGZA 4P0MA 2Y2QA 3QP5A 1MZUA 3UB6A 1HZOA 1XPBA 2OSUA 3LEQA 1XXMA 2WUQA 3AGFA 4HIAA 3NHQA 4P6ZS 5KMWA 5CTMA 4LRXC 4DXCA 1YAXA 1G5UA 3HJIA 3GSGA 5EOOA 5KIZA 4WMCD 3LEZA 2UV0E 4S2KA 1F5MA 1NRFA 3CHWP 4GJ4A 3LY3A 3PBQA 3CLOA 3FG8A 1NLZA 1E25A 2O0YA 4B93A 3GDIA 1NJ4A 2G7UA 4MN6A 1VEUA 2O9AA 4WZ5C 3ZHHA 3IHBA 4RVAA 3TSGA 4F3LA 4S2OA 3BWLA 3MKFA 1DJCA 1Q2QA 2ZQ9A 4DJ3A 2XEPA 3UNWA 5FAPA 1BLPA 2L1MA 1LL5A 1PYYA 3NI9A 5TR7A 1ZC2A 2Z2LB 3H9WA 3DBAA 2XD1A 3A3EA 5C5KA 3FKWA 4HH3A 1KE0A 4QJGA 1F9IA 5FDSA 1NLYA 4F94A 2XSSA 4MBKA 3G31A 1OTBA 4YNRA 4G3WA 4KG5A 2ZBBA 1PW8A 2AVXA 1V9ZA 4OPYA 1KGGA 2P74A 4EV4A 2A24A 2JKFA 4N92A 2Q9NA 4Y0TA 4JLFA 3MZFA 5FI7A 3IF6C 3V39A 3ULFA 2QHKA 4Y0UA 4D60A 2WKIA 3IXGA 3VFFA 4S2JA 4WEJA 2HDQA 2A49A 5FAOA 1KDSA 4QY6A 5IU1A 2YKHA 2RCXA 2WKPA 4DE3A 3LGOA 2KLIA 3LR4A 3SW1A 2FFYA 3P09A 1ONGA 3LIFA 2VKSA 4HJ3A 1FR6A 3B42A 4ZJ3A 3KO6A 4BBVA 2OV5A 1GCEA 4KG6A 4L9EA 1G6AA 3MQOA 5CEDA 2M1CA 3E2KA 1F2KA 4OQIA 1LHYA 3G30A 3T1XA 3D9YA 1FR1A 3F1NA 4OPRA 1YLTA 4R4SA 3LR0A 4S2IA 3MSHA 3S7PA 3F1OA 3KYZA 2J9PA 2GJ3A 1BYWA 5F82A 3IWQA 4EU0A 1QMFA 3D72A 2XH9A 4LV0A 3G6OA 4Y13A 4MBFA 3E98A 3FYZA 2FZ0A 1L0EA 1OTAA 1TS6A 2XA7S 3T4TA 4ETXA 4DXBA 1IYPA 1XA1A 2PRFA 4FD8A 4IUHA 1K54C 3HUOA 5L09A 2EWVA 1Y4OA 5TJJA 5J4EA 1IELA 3O88A 2VK3A 4K0XA 4L9FA 3VP0A 3ZCZA 1ES2A 1SDEA 3ZG5A 1VEUB 2V0UA 3ZFZA 5FEFA 2M7VA 3UE6A 1G68A 3OC2A 5I94A 1AXBA 4X6TA 1FQGA 4B4XA 1SKFA 4DMZA 1YQSA 2JN7A 3T4JA 5FASA 3HREA 4N9LA 1F98A 2O99A 3V5MA 2JKTI 5FI2A 3QHYA 1PIOA 3WS1A 3WS0A 1GHMA 2BTFP 1LSXA 1N9NA 5DFXA 4LPZA 3B3XA 4NKPA 4PM7A 3IXDA 5GL9A 2HJEA 3VE4A 4Q0HA 3EGDC 3S7OA 4P87A 2L4RA 1TDLA 1OTDA 2VGLM 4LV1A 3ZNYA 3UB9A 5HFOA 2EA9A 3NJAA 4JXVA 1KVLA 1E3UA 4NEED 1H5XA 3Q7VA 1IYOA 3VSLA 2Z6CA 4JGOA 3RH8B 2E8JA 4JGRA 2A24B 4R38A 1P97A 3H82A 3E4OA 5CERA 2A3UA 2V1AA 3NDEA 1TF1A 3E4PA 4OPZA 1TS7A 1K6SA 1ONHA 4OVDA 4AFIA 5EM1A 4M3KA 1XJ2A 3NY4A 4P6BA 3MXRA 4DE1A 2B02A 5L10A 4OKPA 4EEPA 4L0LA 3N4IA 2RL3A 4WUJA 3HLCA 5HDCA 3JPUA 4X1MA 4UHUA 2J3TD 4UAAA 2Y2MA 2NUPC 4PAUA 1Y28A 2JKRM 1FCNA 5CHMA 1L0DA 2DMWA 1FILA 4BWIA 2WAFA 1PWDA 3VP3A 2HDSA 5EOEA 2W3DA 3LY4A 1K4FA 2W1TA 1PWGA 3CG5A 4OOLA 4KUOA 3N7WA 4EXOA 3BQAA 3F1OB 3S4XA 3T4LA 1W8QA 3OPLA 4YWZA 1NWZA 1XGJA 4M4XA 2EX9A 2H5SA 5FQIA 3UE3A 4E6WA 5TBMA 2W3EA 5DJTA 3JYIA 3CITA 4GDBA 4BQMA 1EI5A 3MZDA 4N9KA 3C2WA 3C38A 3K2NA 4H8RA 2QWSA 2DCFA 2OAP1 4GS9B 5CGSA 4KZAA 4CQHA 3PBOA 3V3RA 4GD6A 1XJ4A 2Z6DA 4DRTA 1HLUP 4XUZA 3T1QB 3VV4A 4I3IA 4O8GA 1WA9A 3CAXA 4KQQA 3E2LA 4RYEA 3BFGA 1ZKJA 2ZC7A 4KENB 1GA9A 3IF5A 1PRQA 1D06A 5HWTA 5HWVA 2HJ9C 4R70A 3QNBA 2WAEA 5J7EA 2V1BA 1XFNA 3IWOA 1H3QA 2ZQ7A 4BMWA 2PDRA 1OTIA 5HZHA 2HPBA 3ITAA 2EWWA 5DF7A 3A0VA 1KDWA 3VMAA 2ZM2A 1SKOA 4QD4A 1LI9A 2WGWA 3UB7A 3R7WB 1Z6FA 4QY5A 3UMEA 4R4RA 1SDNA 1STZA 4IBRA 4MN7A 4KZ7A 2ZC5B 2ZQ8A 2Z2MB 1CF0A 1CK3A 3Q7VB 4RA7A 4LRYC 3EOIA 1D7EA 4JGPA 1J9MA 3SS5A 2EX8A 4WF0A 5HL1A 2Q9MA 2R9WA 4FH2A 4WL9A 2J3WA 2XFTA 4JF5A 3IS2B 4ZJ2A 1PZPA 4X68A 1N9OA 3DTMA 2K31A 3LIDA 4WMCA 3UE1A 4C75A 2VGJA 3GECA 2BG1A 5A90A 2HDRA 3G34A 4X56A 4U0XA 4MMNA 3IWIA 4O0PA 1W63M 1CJFA 2B95A 2XD5A 1ESIA 1S0WA 3WWXA 4X1LA 3HLBA 5BOHA 1ESUA 3A3IA 3Q81A 3NIAA 4LFUA 3RJUA 1TS8A 4WBGA 3IH8A 3V67A 2W1TB 4ZRRA 1VETA 5A8BA 2ZC6B 2PYPA 3A3JA 4H6JA 4ME4A 2JKTM 4WM9A 3BEBA 2YKFA 5AVEA 1VB6A 3KSFA 5F6AA 5CGWA 4PMAA 2P04A 3P7NA 2PBDP 3HJKA 3UDXA 5FQJA 1DJBA 2X71A 2GDNA 4IBXA 1O7EA 1I2SA 4E3NA 1YMSA 5HWWA 3ZG7B 4Y7PA 2HP9A 2INWA 2LB5A 5HARA 1S66L 3KSGA 1T1BA 3LI9A 2ZJ9A 2VEAA 1CI9A 1FCMA 4DDSA 3UB8A 2KX6A 3VP1A 1YMXA 3EEHA 1WYCA 3K3DA 2Y2LA 2O9CA 4WN5A 1PNEA 1BLCA 1DY6A 3CWFA 4NXGA 4LCMA 1K55A 3S1YA 2OAQ1 4KG2A 5EVIB 1SZVA 3UB5P 3OOVA 4CJNA 5M19A 3OZHA 2V2FF 3IT9A 3CJMA 1KGEA 4ZJ1A 4IEDA 3KX0X 3D4FA 5GHYA 2XF3A 4E6XA 4EW7A 1JVJA 4KZ9A 3M6BA 1YLYA 2QZ6A 4JXSA 2WGWB 1WE4A 3G32A 2WYXA 1OJ5A 1BT5A 1HD8A 3FKVA 5CXWA 5GHXA 5FI6A 1K38A 3NDGA 5HD5A 4Y5FA 4YINA 2GNXA 2PAVP 3MMHA 4HJ6A 4XT2A 2P08A 5HAPA 2HP5A 2R78A 3VOYA 4WLAA 3GRJA 1K57A 2E8IA 4EBLA 2NUTC 3N6IA 4BL2A 2OLUA 2R9XA 4HP9A 2OLVA 4GKUA 5F1GA 3BFDA 1UWNX 2IWDA 4OP8A 2Y2KA 1LT0A 4HBTA 2H0TA 2O9BA 1SHVA 1VM1A 5G18A 3PHYA 1LL9A 4O01A 4OH0A 4FSFA 3H7WB 2DRWA 4R3JA 4R3AA 4GCZA 4CLCA 4QPRA 4DKIA 4L9GA 4UA6A 5GLBA 3OPPA 4ARZA 1GHPA 4PPRA 3UMDA 2G2WA 1ES4A 4FCFA 1V9YA 4NG2A 1NYMA 2WKEA 5KSCA 3R4KA 3CPTA 4H6JB 3C30A 1TD5A 5JYPA 3W4PA 1FOFA 4GHIA 3IH9A 2WKHA 4Y3IA 4BL3A 2ZOHA 2XRNA 3MXSA 4IUKA 3LR5A 3ZG0A 5JYOA 3FC7A 1OT6A 4KQRA 2C5WB 2HF6A 4KZ3A 2B5RA 1JWPA 3UN7A 5KZHA 1TS0A 5EVIC 3ZG8B 4LV3A 3O87A 3BJNA 4WELA 3UO9A 1FIKA 5FDHA 4CLCD 4PHTA 3GVBA 1OMEA 1TVFA 2PD7A 1IKGA 3AGEA 1ZG4A 2QKPA 2Y59A 1MKIA 5J8XA 1GHIA 4S2NA 4FOFA 4RX2A 3ZQ5A 4EESA 4F3LB 5FSRA 4YFMA 2HGVA 3VE3A 5A92A 5FQKA 3HLGA 3NECA 4JGQA 4E3OA 3N8LA 1ODVA 3C7UA 5CEBA 4LCLA 5E2GA 2J8YA 2Y2PA 5DF8A 4A5RA 1XP4A 4BD1A 1SCWA 2D02A 4KQDA 2C6WB 1K25A 1BUEA 1GSVA 1W7FA 1A0KA 3U4LP 4BBTA 3DTEA 1QMEA 2ZQAA 1UWPX 3N8SA 2Y55A 4JF4A 2XQZA 2G2UA 1YSPA 3TE8A 3MFXA 4WZ5A 1NZOA 1MWUA 3G4PA 3M6HA 1G6OA 3BY9A 1H0MA 3G35A 3LYXA 5F69A 4XT2B 3KYQA 3MZEA 4X25A 5FAQA 4R1GA 3V50A 3QNCA 1YLWA 2ZC3B 3MFDA 1KE3A 2JBFA 5FATA 4QB8A 3CI6A 4GN2A 1I5QA 4Y0OA 3MQQA 3ZVWA 3MXQA 4GLQA 4OQHA 4MLLA 5L07A 2V0WA 1N9LA 5HDDA 3RFBA 4C3QA 1IFQA 2MJ6A 4KZ5A 2V8FA 2VGKA 1MC0A 3UDIA 2XROA 3BY8A 1NZUA 2Y2JA 1KE4A 3C4PA 1OPXA 1CEFA 3N8RA 1C3BA 3F1PA 3BFEA 4NXEA 2ZMFA 3HUNA 4R3BA 5F83A 1BZAA 5HX9A 2V1ZA 2KDKA 1WYBA 5FL3A 2VV6A 3WS5A 2PU2A 2P9VA 3VOLA 5F1FA 3OBFA 5EE8A 4DDYA 1YLPA 1NXYA 5AJGA 3LFVA 4PM9A 1KOUA 2W27A 3IF6A 3F1NB 3NC8A 1HTZA 1G28A 2HDUA 2H10A 2FFFB 1W63Q 4JPMA 5EFWA 1YLZA 1K0KA 2OOLA 3QP1A 2ZL1A 3SS4A 2XGNA 3BECA 1IYQA 3BQ8A 4U0TA 1EW0A 2WZXA 4K08A 5HL6A 2JKGA 3OPHA 3CUEA 4OQ0A 3S7NA 2W3GA 4MCWA 4CPKA 3KYEA 3EWKA 2JE5A 3T12B 1LSWA 3TW8A 1EWZA 5FQMA 1ACFA 3O5YA 1RP5A 1KVMA 5CHUA 4ZTKA 5A93A 5E2EA 5GLDA 3RTYA 2IWBA 3VOZA 2BLSA 3OLOA 4BJPA 4Y2FA 2VV7A 1E4DA 2W3HA 5GLAA 1N9BA 3L9KA 4DE0A 3U2AA 3T50A 5AVFA 3UDFA 3E0YA 4BD0A 5CECA 3QP2A 3WS2A 1T19A 2J80A 3A3FA 3NCKA 5K5BA 3UPOA 4IHQA 4Q0JA 1ERQA 1P9RA 3C5AA 3CZDA 4HOIA 1K54A 1BLHA 3QP6A 3ICYA 5FQQA 4EEUA 1ZHHB 4OLGA 2WK0A 1K57C 2VLGA 4EWFA 1XFQA 2UWXA 3VSKA 4JKTA 4OPQA 1MWTA 5EVEA 4MDZA 1UGUA 2P7JA
chains in the Genus database with same CATH topology
3MS6A 1A0KA 1PNEA 3U4LP 1J3WA 1K0KA 2E8JA 2ZL1A 2V8CA 2ZL1B 5FDSA 1SZVA 3UB5P 3T1SA 1HLUP 3T1QB 2JKGA 1AWIA 1CJFA 2B95A 2PRFA 3CPTA 5EM1A 1PFLA 1PRQA 5EM0A 3CPTB 4X1LA 2JKFA 1Y4OA 3LEQA 3KYEA 4X25A 2VK3A 3T12B 4FTXA 1D1JA 1ACFA 1YPRA 2ACGA 1VEUB 4X1MA 1G5UA 1VETA 4D60A 4ESPA 5FEFA 1VETB 3CHWP 3L7HA 1SKOA 1FILA 1Z09A 2PAVP 1SKOB 3LGOA 4FUWA 3L9KA 2V8FA 1FIKA 1VEUA 2PBDP 2HZ5A 1CF0A 2BTFP 3T1RA 1F2KA 4QWOA 3NECA 3T1XA 3DAVA 3D9YA 5EV0A 5EVEA 5FEGA 3NULA 3MSHA 1CQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MS6 A;  1A0K A;  1PNE A;  3U4L P;  1J3W A;  1K0K A;  2E8J A;  2ZL1 A;  2V8C A;  2ZL1 B;  5FDS A;  1SZV A;  3UB5 P;  3T1S A;  1HLU P;  3T1Q B;  2JKG A;  1AWI A;  1CJF A;  2B95 A;  2PRF A;  3CPT A;  5EM1 A;  1PFL A;  1PRQ A;  5EM0 A;  3CPT B;  4X1L A;  2JKF A;  1Y4O A;  3LEQ A;  3KYE A;  4X25 A;  2VK3 A;  3T12 B;  4FTX A;  1D1J A;  1ACF A;  1YPR A;  2ACG A;  1VEU B;  4X1M A;  1G5U A;  1VET A;  4D60 A;  4ESP A;  5FEF A;  1VET B;  3CHW P;  3L7H A;  1SKO A;  1FIL A;  1Z09 A;  2PAV P;  1SKO B;  3LGO A;  4FUW A;  3L9K A;  2V8F A;  1FIK A;  1VEU A;  2PBD P;  2HZ5 A;  1CF0 A;  2BTF P;  3T1R A;  1F2K A;  4QWO A;  3NEC A;  3T1X A;  3DAV A;  3D9Y A;  5EV0 A;  5EVE A;  5FEG A;  3NUL A;  3MSH A;  1CQA A; 
#chains in the Genus database with same CATH topology
 4GB7 A;  4E3J A;  4KQO A;  3GMW A;  3HLW A;  2L0W A;  2EFU A;  3C7V A;  2WAD A;  4JXW A;  4KUK A;  3SOI A;  4EBP A;  3FPW A;  3H82 B;  3SH8 A;  4UQI S;  3BYD A;  3Q7Z A;  1HVB A;  3MR0 A;  4ID4 A;  5EPH A;  2EXB A;  2PR5 A;  3ZYT A;  5D3O A;  3MQ0 A;  2V20 A;  4OOY A;  3LIB A;  1JNU A;  4LV2 A;  3NOP C;  1X0O A;  2X02 A;  3LUQ A;  3G2Y A;  5HDS A;  3UPN A;  4NXB A;  3BFF A;  4DF6 A;  2ZM0 A;  4EER A;  1CI8 A;  4HQA A;  2Y2I A;  2QJ7 A;  3W2Z A;  3L7H A;  4Q0I A;  3JVV A;  2QMI A;  2VJW A;  5CHJ A;  1W5D A;  2VZW A;  2Y79 A;  3RXW A;  1S67 L;  3JVU A;  2Y8H A;  2I9V A;  5DVA A;  4E04 A;  3K3C A;  1M6K A;  3T1R A;  3ZDJ A;  1MKM A;  4HHD A;  5TBM B;  5GHZ A;  3A0S A;  3M2J A;  3IX4 A;  4S2N C;  3HLD A;  4HH2 A;  1PZO A;  4HBU A;  3RXX A;  1CQA A;  4UA7 A;  2XFS A;  3MS6 A;  2K2N A;  4P6Z M;  1Y54 A;  4X69 A;  5E43 A;  3LO7 A;  4Y17 A;  5M18 A;  3OCN A;  4UEY A;  4LRZ E;  5AQB A;  3HLF A;  3UPP A;  1W8Y A;  1OT9 A;  3Q82 A;  4KZB A;  3T4S A;  4G3V A;  4PKY A;  3T4Q A;  3O86 A;  2WZZ A;  1K56 D;  2JCH A;  2J3T C;  5G4Y A;  2J9O A;  1JWV A;  1NRJ A;  4XXR A;  1K4E A;  2ZQC A;  1LLB A;  4FTX A;  4EQI A;  4QU3 A;  2VV8 A;  4JF6 A;  1L2S A;  2JKR I;  1RCJ A;  4OOM A;  3IXH A;  1MPL A;  1FCO A;  4IVI A;  3FV7 A;  4C6Y A;  1MXO A;  3ZG9 B;  5CGX A;  2IA2 A;  1SKO B;  3GQZ A;  4LLO B;  4I39 A;  4MN5 A;  4EBN A;  3BFC A;  3M2K A;  1ZG6 A;  3G2Z A;  5HAI A;  4X55 A;  2QPN A;  2ZQD A;  3ZNT A;  1NYY A;  4EUV A;  4HP4 A;  2Y2N A;  1YM1 A;  2ZD8 A;  4UA9 A;  2I72 A;  3AGD A;  4JXG A;  4OLD A;  1LI0 A;  4KZ8 A;  3Q1F A;  1JTD A;  4Z1W A;  2ZLY A;  3NOU C;  3TOI A;  3KSH A;  4Z9Q A;  1L0F A;  3A0R A;  5HAQ A;  3CMZ A;  1IEM A;  4HJ4 A;  4X53 A;  3HLE A;  3HBR A;  3QP8 A;  4OON A;  1OTE A;  4RX3 A;  4N1X A;  2XR0 A;  1GSX A;  4E3K A;  4K91 A;  1P9W A;  3FWL A;  4ZBE A;  2HP6 A;  4GZB A;  5HW3 A;  4IJG A;  2JHE A;  3IHA A;  3A3D A;  3TJZ C;  3DTI A;  1OJG A;  4HNB A;  5FQ9 A;  1IOU A;  4I5S A;  1YSQ A;  5HD3 A;  2PBY A;  4BLM A;  3V3S A;  2ACG A;  4BEN A;  2DNS A;  1GA0 A;  3CUE C;  2W0N A;  4YOF A;  4ESP A;  2X01 A;  5DKL A;  1VET B;  3BW6 A;  2VA0 A;  4B88 A;  4EET B;  1BLS A;  1DP6 A;  1PW1 A;  4LEN A;  3SH9 A;  1JTG A;  1S1Y A;  3HVF A;  3MF0 A;  4PM5 A;  5DKK A;  1H8Y A;  5EVL A;  1DP8 A;  5E2F A;  4N1H A;  3LIA A;  4GNU A;  2W1R A;  4R6L A;  2CMN A;  2XA7 M;  4HES A;  2Y2O A;  4DJ2 A;  3UY6 A;  3Q07 A;  3NOT C;  5DTT A;  4S2M A;  3UE0 A;  1DP9 A;  4DE2 A;  1YKD A;  3HCY A;  2GZA A;  2Y2H A;  3W4Q A;  1IKI A;  3VFH A;  4GW9 A;  3DWZ A;  4GS9 A;  3PR6 A;  2H28 A;  3OPR A;  3PBS A;  2V8C A;  5F5Y A;  3QP4 A;  5TFQ A;  3T1S A;  4HEF A;  5L2F A;  4MBH A;  4U3T A;  1AWI A;  2Y4A A;  3DTK A;  1PFL A;  3MBZ A;  1XGI A;  2WKR A;  3IBR A;  1XKZ A;  3WRT A;  1T18 A;  1BSG A;  1O07 A;  2EFX A;  1CEG A;  4WZ4 A;  3LI8 A;  3PBN A;  2K7S A;  1L0G A;  4OQG A;  4HY8 A;  4FH4 A;  2PR6 A;  5U47 A;  1LL8 A;  2VGL S;  1BUL A;  3R7W A;  3IQA A;  2Y91 A;  2ZMV A;  4E3I A;  3SS3 A;  3MKE A;  2HV1 A;  1XJ6 A;  5DF9 A;  2V9A A;  3P98 A;  2HZ5 A;  3I7J A;  3IXB A;  5F68 A;  3GTC A;  2PT7 A;  3PAE A;  1VHM A;  2ZMA A;  3BLM A;  3DWK A;  2M7U A;  1S4R A;  5FA7 A;  5TGF A;  2WKQ A;  4ZAM A;  5HPF A;  3B47 A;  4P85 A;  3E4Q A;  3W8K A;  1T1C A;  3PYP A;  4S2P A;  3EGX C;  4NET A;  2BAS A;  2KOI A;  1TEM A;  3NUL A;  1FSW A;  3IS2 A;  1S6R A;  5CRF A;  3IX3 A;  3TRC A;  4MEZ A;  5IHV A;  5IT5 A;  4CLC B;  5M1A A;  3KSI A;  1FSY A;  5DJU A;  1ES3 A;  1XJ3 A;  2JC7 A;  4CLC E;  1RGY A;  4ARZ B;  5IS1 A;  2H0Y A;  1S4S A;  2ZOI A;  1MWR A;  4G3K A;  4GDN A;  5GLC A;  4LGW A;  1YLJ A;  5EM0 A;  4D2O A;  3CPT B;  3D3O A;  3TG9 A;  4GHI B;  3ZVT A;  5CX7 A;  4E3L A;  1TDG A;  4R23 A;  2D01 A;  3FZC A;  4S2L A;  1YPR A;  1E3U D;  5DTK A;  1T1A A;  3BM6 A;  3PBR A;  1MBL A;  2A2L A;  4PM8 A;  3VP4 A;  5L8M A;  3SH7 A;  3DW0 A;  1PI4 A;  5LBR A;  1ALQ A;  1K55 C;  2EX6 A;  4KZ6 A;  3ITB A;  1YT4 A;  4I3A A;  3EQV A;  4B9O A;  2ZC4 B;  5A91 A;  1BTL A;  4I3J A;  3BLS A;  4WEK A;  3PTE A;  4Q8I A;  2WGV A;  4OP5 A;  4RQ9 A;  1N4O A;  1DRM A;  1KGF A;  2OWJ A;  4GD8 A;  2PU4 A;  3ZGA B;  1H8Z A;  2PYR A;  3NBL A;  5EV0 A;  4IVK A;  4NXF A;  1Q2P A;  1IYS A;  3GR2 A;  2XDM A;  3WRZ A;  4EUZ A;  2LB9 A;  2XLN A;  4E3M A;  1ES5 A;  1XA7 A;  3IX8 A;  2PHY A;  4K0W A;  1U60 A;  3EQU A;  1P0Z A;  5EVI A;  3T4O A;  4BBU A;  4PKY G;  5G4Z A;  3O3V A;  2EX2 A;  3ISG A;  1PWC A;  3PXP A;  4HI4 A;  5EUA A;  5E2H A;  2Q0O A;  4ZDX A;  1S1Z A;  5DFY A;  3MJQ A;  3LIC A;  2CC1 A;  4MNR A;  1H8M A;  1LSV A;  1I2W A;  4II7 A;  1D1J A;  5AQA A;  1K6R A;  4WYY A;  3IBJ A;  1JWZ A;  2OWH A;  3C8C A;  4CLC C;  5J3W A;  2IWC A;  1DJA A;  2W3F A;  3LCE A;  4ETZ A;  2QYB A;  1Z09 A;  3VP2 A;  4UQI M;  2EXA A;  5I5L A;  4FUW A;  4EQ1 A;  1ERO A;  2PD8 A;  5HSQ A;  2QJ5 A;  3P01 A;  3C4O A;  3S7Q A;  3SZT A;  2B18 A;  5EVI D;  3HUM A;  4XUX A;  3F1P B;  3B33 A;  1L3L A;  4JBF A;  3LIE A;  3WS4 A;  2WGI A;  1PI5 A;  1MWS A;  1GSW A;  4KZ4 A;  4QWO A;  5DTS A;  1XX2 A;  2J7V A;  2P9V B;  2ZM8 A;  4DN0 A;  5HPI A;  3BRM A;  4PM6 A;  1K56 A;  3DAV A;  2Y2G A;  4QHC A;  1ZTU A;  4GOG A;  4Y15 A;  3H7W A;  4R0Q A;  5FEG A;  3T4K A;  3PAG A;  3IF6 B;  3FPV A;  3EEA A;  3OCL A;  4B4Z A;  5AQ9 A;  2FH5 A;  1J3W A;  5CTN A;  2XK1 A;  2VX8 A;  1MY8 A;  4NK3 A;  3W4O A;  2ZL1 B;  1W79 A;  2GX5 A;  5AQ7 A;  4I38 A;  5KSH A;  3LR3 A;  3PBT A;  3S22 A;  1M40 A;  5MC7 A;  3HL9 A;  4O7D A;  5EEC A;  1VQQ A;  1ERM A;  3GV9 A;  1NY0 A;  1RGZ A;  4P0M A;  2Y2Q A;  3QP5 A;  1MZU A;  3UB6 A;  1HZO A;  1XPB A;  2OSU A;  3LEQ A;  1XXM A;  2WUQ A;  3AGF A;  4HIA A;  3NHQ A;  4P6Z S;  5KMW A;  5CTM A;  4LRX C;  4DXC A;  1YAX A;  1G5U A;  3HJI A;  3GSG A;  5EOO A;  5KIZ A;  4WMC D;  3LEZ A;  2UV0 E;  4S2K A;  1F5M A;  1NRF A;  3CHW P;  4GJ4 A;  3LY3 A;  3PBQ A;  3CLO A;  3FG8 A;  1NLZ A;  1E25 A;  2O0Y A;  4B93 A;  3GDI A;  1NJ4 A;  2G7U A;  4MN6 A;  1VEU A;  2O9A A;  4WZ5 C;  3ZHH A;  3IHB A;  4RVA A;  3TSG A;  4F3L A;  4S2O A;  3BWL A;  3MKF A;  1DJC A;  1Q2Q A;  2ZQ9 A;  4DJ3 A;  2XEP A;  3UNW A;  5FAP A;  1BLP A;  2L1M A;  1LL5 A;  1PYY A;  3NI9 A;  5TR7 A;  1ZC2 A;  2Z2L B;  3H9W A;  3DBA A;  2XD1 A;  3A3E A;  5C5K A;  3FKW A;  4HH3 A;  1KE0 A;  4QJG A;  1F9I A;  5FDS A;  1NLY A;  4F94 A;  2XSS A;  4MBK A;  3G31 A;  1OTB A;  4YNR A;  4G3W A;  4KG5 A;  2ZBB A;  1PW8 A;  2AVX A;  1V9Z A;  4OPY A;  1KGG A;  2P74 A;  4EV4 A;  2A24 A;  2JKF A;  4N92 A;  2Q9N A;  4Y0T A;  4JLF A;  3MZF A;  5FI7 A;  3IF6 C;  3V39 A;  3ULF A;  2QHK A;  4Y0U A;  4D60 A;  2WKI A;  3IXG A;  3VFF A;  4S2J A;  4WEJ A;  2HDQ A;  2A49 A;  5FAO A;  1KDS A;  4QY6 A;  5IU1 A;  2YKH A;  2RCX A;  2WKP A;  4DE3 A;  3LGO A;  2KLI A;  3LR4 A;  3SW1 A;  2FFY A;  3P09 A;  1ONG A;  3LIF A;  2VKS A;  4HJ3 A;  1FR6 A;  3B42 A;  4ZJ3 A;  3KO6 A;  4BBV A;  2OV5 A;  1GCE A;  4KG6 A;  4L9E A;  1G6A A;  3MQO A;  5CED A;  2M1C A;  3E2K A;  1F2K A;  4OQI A;  1LHY A;  3G30 A;  3T1X A;  3D9Y A;  1FR1 A;  3F1N A;  4OPR A;  1YLT A;  4R4S A;  3LR0 A;  4S2I A;  3MSH A;  3S7P A;  3F1O A;  3KYZ A;  2J9P A;  2GJ3 A;  1BYW A;  5F82 A;  3IWQ A;  4EU0 A;  1QMF A;  3D72 A;  2XH9 A;  4LV0 A;  3G6O A;  4Y13 A;  4MBF A;  3E98 A;  3FYZ A;  2FZ0 A;  1L0E A;  1OTA A;  1TS6 A;  2XA7 S;  3T4T A;  4ETX A;  4DXB A;  1IYP A;  1XA1 A;  2PRF A;  4FD8 A;  4IUH A;  1K54 C;  3HUO A;  5L09 A;  2EWV A;  1Y4O A;  5TJJ A;  5J4E A;  1IEL A;  3O88 A;  2VK3 A;  4K0X A;  4L9F A;  3VP0 A;  3ZCZ A;  1ES2 A;  1SDE A;  3ZG5 A;  1VEU B;  2V0U A;  3ZFZ A;  5FEF A;  2M7V A;  3UE6 A;  1G68 A;  3OC2 A;  5I94 A;  1AXB A;  4X6T A;  1FQG A;  4B4X A;  1SKF A;  4DMZ A;  1YQS A;  2JN7 A;  3T4J A;  5FAS A;  3HRE A;  4N9L A;  1F98 A;  2O99 A;  3V5M A;  2JKT I;  5FI2 A;  3QHY A;  1PIO A;  3WS1 A;  3WS0 A;  1GHM A;  2BTF P;  1LSX A;  1N9N A;  5DFX A;  4LPZ A;  3B3X A;  4NKP A;  4PM7 A;  3IXD A;  5GL9 A;  2HJE A;  3VE4 A;  4Q0H A;  3EGD C;  3S7O A;  4P87 A;  2L4R A;  1TDL A;  1OTD A;  2VGL M;  4LV1 A;  3ZNY A;  3UB9 A;  5HFO A;  2EA9 A;  3NJA A;  4JXV A;  1KVL A;  1E3U A;  4NEE D;  1H5X A;  3Q7V A;  1IYO A;  3VSL A;  2Z6C A;  4JGO A;  3RH8 B;  2E8J A;  4JGR A;  2A24 B;  4R38 A;  1P97 A;  3H82 A;  3E4O A;  5CER A;  2A3U A;  2V1A A;  3NDE A;  1TF1 A;  3E4P A;  4OPZ A;  1TS7 A;  1K6S A;  1ONH A;  4OVD A;  4AFI A;  5EM1 A;  4M3K A;  1XJ2 A;  3NY4 A;  4P6B A;  3MXR A;  4DE1 A;  2B02 A;  5L10 A;  4OKP A;  4EEP A;  4L0L A;  3N4I A;  2RL3 A;  4WUJ A;  3HLC A;  5HDC A;  3JPU A;  4X1M A;  4UHU A;  2J3T D;  4UAA A;  2Y2M A;  2NUP C;  4PAU A;  1Y28 A;  2JKR M;  1FCN A;  5CHM A;  1L0D A;  2DMW A;  1FIL A;  4BWI A;  2WAF A;  1PWD A;  3VP3 A;  2HDS A;  5EOE A;  2W3D A;  3LY4 A;  1K4F A;  2W1T A;  1PWG A;  3CG5 A;  4OOL A;  4KUO A;  3N7W A;  4EXO A;  3BQA A;  3F1O B;  3S4X A;  3T4L A;  1W8Q A;  3OPL A;  4YWZ A;  1NWZ A;  1XGJ A;  4M4X A;  2EX9 A;  2H5S A;  5FQI A;  3UE3 A;  4E6W A;  5TBM A;  2W3E A;  5DJT A;  3JYI A;  3CIT A;  4GDB A;  4BQM A;  1EI5 A;  3MZD A;  4N9K A;  3C2W A;  3C38 A;  3K2N A;  4H8R A;  2QWS A;  2DCF A;  2OAP 1;  4GS9 B;  5CGS A;  4KZA A;  4CQH A;  3PBO A;  3V3R A;  4GD6 A;  1XJ4 A;  2Z6D A;  4DRT A;  1HLU P;  4XUZ A;  3T1Q B;  3VV4 A;  4I3I A;  4O8G A;  1WA9 A;  3CAX A;  4KQQ A;  3E2L A;  4RYE A;  3BFG A;  1ZKJ A;  2ZC7 A;  4KEN B;  1GA9 A;  3IF5 A;  1PRQ A;  1D06 A;  5HWT A;  5HWV A;  2HJ9 C;  4R70 A;  3QNB A;  2WAE A;  5J7E A;  2V1B A;  1XFN A;  3IWO A;  1H3Q A;  2ZQ7 A;  4BMW A;  2PDR A;  1OTI A;  5HZH A;  2HPB A;  3ITA A;  2EWW A;  5DF7 A;  3A0V A;  1KDW A;  3VMA A;  2ZM2 A;  1SKO A;  4QD4 A;  1LI9 A;  2WGW A;  3UB7 A;  3R7W B;  1Z6F A;  4QY5 A;  3UME A;  4R4R A;  1SDN A;  1STZ A;  4IBR A;  4MN7 A;  4KZ7 A;  2ZC5 B;  2ZQ8 A;  2Z2M B;  1CF0 A;  1CK3 A;  3Q7V B;  4RA7 A;  4LRY C;  3EOI A;  1D7E A;  4JGP A;  1J9M A;  3SS5 A;  2EX8 A;  4WF0 A;  5HL1 A;  2Q9M A;  2R9W A;  4FH2 A;  4WL9 A;  2J3W A;  2XFT A;  4JF5 A;  3IS2 B;  4ZJ2 A;  1PZP A;  4X68 A;  1N9O A;  3DTM A;  2K31 A;  3LID A;  4WMC A;  3UE1 A;  4C75 A;  2VGJ A;  3GEC A;  2BG1 A;  5A90 A;  2HDR A;  3G34 A;  4X56 A;  4U0X A;  4MMN A;  3IWI A;  4O0P A;  1W63 M;  1CJF A;  2B95 A;  2XD5 A;  1ESI A;  1S0W A;  3WWX A;  4X1L A;  3HLB A;  5BOH A;  1ESU A;  3A3I A;  3Q81 A;  3NIA A;  4LFU A;  3RJU A;  1TS8 A;  4WBG A;  3IH8 A;  3V67 A;  2W1T B;  4ZRR A;  1VET A;  5A8B A;  2ZC6 B;  2PYP A;  3A3J A;  4H6J A;  4ME4 A;  2JKT M;  4WM9 A;  3BEB A;  2YKF A;  5AVE A;  1VB6 A;  3KSF A;  5F6A A;  5CGW A;  4PMA A;  2P04 A;  3P7N A;  2PBD P;  3HJK A;  3UDX A;  5FQJ A;  1DJB A;  2X71 A;  2GDN A;  4IBX A;  1O7E A;  1I2S A;  4E3N A;  1YMS A;  5HWW A;  3ZG7 B;  4Y7P A;  2HP9 A;  2INW A;  2LB5 A;  5HAR A;  1S66 L;  3KSG A;  1T1B A;  3LI9 A;  2ZJ9 A;  2VEA A;  1CI9 A;  1FCM A;  4DDS A;  3UB8 A;  2KX6 A;  3VP1 A;  1YMX A;  3EEH A;  1WYC A;  3K3D A;  2Y2L A;  2O9C A;  4WN5 A;  1PNE A;  1BLC A;  1DY6 A;  3CWF A;  4NXG A;  4LCM A;  1K55 A;  3S1Y A;  2OAQ 1;  4KG2 A;  5EVI B;  1SZV A;  3UB5 P;  3OOV A;  4CJN A;  5M19 A;  3OZH A;  2V2F F;  3IT9 A;  3CJM A;  1KGE A;  4ZJ1 A;  4IED A;  3KX0 X;  3D4F A;  5GHY A;  2XF3 A;  4E6X A;  4EW7 A;  1JVJ A;  4KZ9 A;  3M6B A;  1YLY A;  2QZ6 A;  4JXS A;  2WGW B;  1WE4 A;  3G32 A;  2WYX A;  1OJ5 A;  1BT5 A;  1HD8 A;  3FKV A;  5CXW A;  5GHX A;  5FI6 A;  1K38 A;  3NDG A;  5HD5 A;  4Y5F A;  4YIN A;  2GNX A;  2PAV P;  3MMH A;  4HJ6 A;  4XT2 A;  2P08 A;  5HAP A;  2HP5 A;  2R78 A;  3VOY A;  4WLA A;  3GRJ A;  1K57 A;  2E8I A;  4EBL A;  2NUT C;  3N6I A;  4BL2 A;  2OLU A;  2R9X A;  4HP9 A;  2OLV A;  4GKU A;  5F1G A;  3BFD A;  1UWN X;  2IWD A;  4OP8 A;  2Y2K A;  1LT0 A;  4HBT A;  2H0T A;  2O9B A;  1SHV A;  1VM1 A;  5G18 A;  3PHY A;  1LL9 A;  4O01 A;  4OH0 A;  4FSF A;  3H7W B;  2DRW A;  4R3J A;  4R3A A;  4GCZ A;  4CLC A;  4QPR A;  4DKI A;  4L9G A;  4UA6 A;  5GLB A;  3OPP A;  4ARZ A;  1GHP A;  4PPR A;  3UMD A;  2G2W A;  1ES4 A;  4FCF A;  1V9Y A;  4NG2 A;  1NYM A;  2WKE A;  5KSC A;  3R4K A;  3CPT A;  4H6J B;  3C30 A;  1TD5 A;  5JYP A;  3W4P A;  1FOF A;  4GHI A;  3IH9 A;  2WKH A;  4Y3I A;  4BL3 A;  2ZOH A;  2XRN A;  3MXS A;  4IUK A;  3LR5 A;  3ZG0 A;  5JYO A;  3FC7 A;  1OT6 A;  4KQR A;  2C5W B;  2HF6 A;  4KZ3 A;  2B5R A;  1JWP A;  3UN7 A;  5KZH A;  1TS0 A;  5EVI C;  3ZG8 B;  4LV3 A;  3O87 A;  3BJN A;  4WEL A;  3UO9 A;  1FIK A;  5FDH A;  4CLC D;  4PHT A;  3GVB A;  1OME A;  1TVF A;  2PD7 A;  1IKG A;  3AGE A;  1ZG4 A;  2QKP A;  2Y59 A;  1MKI A;  5J8X A;  1GHI A;  4S2N A;  4FOF A;  4RX2 A;  3ZQ5 A;  4EES A;  4F3L B;  5FSR A;  4YFM A;  2HGV A;  3VE3 A;  5A92 A;  5FQK A;  3HLG A;  3NEC A;  4JGQ A;  4E3O A;  3N8L A;  1ODV A;  3C7U A;  5CEB A;  4LCL A;  5E2G A;  2J8Y A;  2Y2P A;  5DF8 A;  4A5R A;  1XP4 A;  4BD1 A;  1SCW A;  2D02 A;  4KQD A;  2C6W B;  1K25 A;  1BUE A;  1GSV A;  1W7F A;  1A0K A;  3U4L P;  4BBT A;  3DTE A;  1QME A;  2ZQA A;  1UWP X;  3N8S A;  2Y55 A;  4JF4 A;  2XQZ A;  2G2U A;  1YSP A;  3TE8 A;  3MFX A;  4WZ5 A;  1NZO A;  1MWU A;  3G4P A;  3M6H A;  1G6O A;  3BY9 A;  1H0M A;  3G35 A;  3LYX A;  5F69 A;  4XT2 B;  3KYQ A;  3MZE A;  4X25 A;  5FAQ A;  4R1G A;  3V50 A;  3QNC A;  1YLW A;  2ZC3 B;  3MFD A;  1KE3 A;  2JBF A;  5FAT A;  4QB8 A;  3CI6 A;  4GN2 A;  1I5Q A;  4Y0O A;  3MQQ A;  3ZVW A;  3MXQ A;  4GLQ A;  4OQH A;  4MLL A;  5L07 A;  2V0W A;  1N9L A;  5HDD A;  3RFB A;  4C3Q A;  1IFQ A;  2MJ6 A;  4KZ5 A;  2V8F A;  2VGK A;  1MC0 A;  3UDI A;  2XRO A;  3BY8 A;  1NZU A;  2Y2J A;  1KE4 A;  3C4P A;  1OPX A;  1CEF A;  3N8R A;  1C3B A;  3F1P A;  3BFE A;  4NXE A;  2ZMF A;  3HUN A;  4R3B A;  5F83 A;  1BZA A;  5HX9 A;  2V1Z A;  2KDK A;  1WYB A;  5FL3 A;  2VV6 A;  3WS5 A;  2PU2 A;  2P9V A;  3VOL A;  5F1F A;  3OBF A;  5EE8 A;  4DDY A;  1YLP A;  1NXY A;  5AJG A;  3LFV A;  4PM9 A;  1KOU A;  2W27 A;  3IF6 A;  3F1N B;  3NC8 A;  1HTZ A;  1G28 A;  2HDU A;  2H10 A;  2FFF B;  1W63 Q;  4JPM A;  5EFW A;  1YLZ A;  1K0K A;  2OOL A;  3QP1 A;  2ZL1 A;  3SS4 A;  2XGN A;  3BEC A;  1IYQ A;  3BQ8 A;  4U0T A;  1EW0 A;  2WZX A;  4K08 A;  5HL6 A;  2JKG A;  3OPH A;  3CUE A;  4OQ0 A;  3S7N A;  2W3G A;  4MCW A;  4CPK A;  3KYE A;  3EWK A;  2JE5 A;  3T12 B;  1LSW A;  3TW8 A;  1EWZ A;  5FQM A;  1ACF A;  3O5Y A;  1RP5 A;  1KVM A;  5CHU A;  4ZTK A;  5A93 A;  5E2E A;  5GLD A;  3RTY A;  2IWB A;  3VOZ A;  2BLS A;  3OLO A;  4BJP A;  4Y2F A;  2VV7 A;  1E4D A;  2W3H A;  5GLA A;  1N9B A;  3L9K A;  4DE0 A;  3U2A A;  3T50 A;  5AVF A;  3UDF A;  3E0Y A;  4BD0 A;  5CEC A;  3QP2 A;  3WS2 A;  1T19 A;  2J80 A;  3A3F A;  3NCK A;  5K5B A;  3UPO A;  4IHQ A;  4Q0J A;  1ERQ A;  1P9R A;  3C5A A;  3CZD A;  4HOI A;  1K54 A;  1BLH A;  3QP6 A;  3ICY A;  5FQQ A;  4EEU A;  1ZHH B;  4OLG A;  2WK0 A;  1K57 C;  2VLG A;  4EWF A;  1XFQ A;  2UWX A;  3VSK A;  4JKT A;  4OPQ A;  1MWT A;  5EVE A;  4MDZ A;  1UGU A;  2P7J A; 
#chains in the Genus database with same CATH homology
 3MS6 A;  1A0K A;  1PNE A;  3U4L P;  1J3W A;  1K0K A;  2E8J A;  2ZL1 A;  2V8C A;  2ZL1 B;  5FDS A;  1SZV A;  3UB5 P;  3T1S A;  1HLU P;  3T1Q B;  2JKG A;  1AWI A;  1CJF A;  2B95 A;  2PRF A;  3CPT A;  5EM1 A;  1PFL A;  1PRQ A;  5EM0 A;  3CPT B;  4X1L A;  2JKF A;  1Y4O A;  3LEQ A;  3KYE A;  4X25 A;  2VK3 A;  3T12 B;  4FTX A;  1D1J A;  1ACF A;  1YPR A;  2ACG A;  1VEU B;  4X1M A;  1G5U A;  1VET A;  4D60 A;  4ESP A;  5FEF A;  1VET B;  3CHW P;  3L7H A;  1SKO A;  1FIL A;  1Z09 A;  2PAV P;  1SKO B;  3LGO A;  4FUW A;  3L9K A;  2V8F A;  1FIK A;  1VEU A;  2PBD P;  2HZ5 A;  1CF0 A;  2BTF P;  3T1R A;  1F2K A;  4QWO A;  3NEC A;  3T1X A;  3DAV A;  3D9Y A;  5EV0 A;  5EVE A;  5FEG A;  3NUL A;  3MSH A;  1CQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...