2ACGA

Acanthamoeba castellanii profilin ii
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
SWQTYVDTNLVGTGAVTQAAIIGHDGNTWATSAGFAVSPANGAALANAFKDATAIRSNGFELAGTRYVTIRADDRSVYGKKGSAGVITVKTSKAILIGVYNEKIQPGTAANVVEKLADYLIGQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords PROFILIN II
publication title X-ray structures of isoforms of the actin-binding protein profilin that differ in their affinity for phosphatidylinositol phosphates.
pubmed doi rcsb
source organism Acanthamoeba castellanii
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1994-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2acgA00
4D60A 2V8FA 1YPRA 1Z09A 3U4LP 3T12B 4X1LA 2BTFP 2JKGA 1PFLA 1FIKA 1SZVA 3T1XA 5EM0A 1K0KA 1D1JA 1VEUA 2E8JA 3CHWP 3T1SA 2PAVP 5FDSA 2ZL1B 1G5UA 1VETA 3D9YA 5EV0A 3KYEA 5FEGA 1VEUB 1Y4OA 1PRQA 4X25A 3T1QB 4FTXA 3MS6A 5EM1A 1VETB 2B95A 2HZ5A 3L7HA 3UB5P 5FEFA 1F2KA 1FILA 1PNEA 1CF0A 3T1RA 2PBDP 3DAVA 4X1MA 3MSHA 1AWIA 2VK3A 2PRFA 4QWOA 1SKOA 1CJFA 3CPTA 5EVEA 3LEQA 1ACFA 4FUWA 2V8CA 1HLUP 3LGOA 1SKOB 4ESPA 3CPTB 1J3WA 3NECA 1A0KA 3L9KA 1CQAA 2ZL1A 3NULA 2ACGA 2JKFA
chains in the Genus database with same CATH superfamily
1PWCA 4D60A 3C4PA 2VGJA 1STZA 4K0XA 1MZUA 3TJZC 4DJ2A 1G6AA 2QPNA 1XKZA 3WWXA 4BL2A 2NUPC 3RFBA 4U0XA 1MWTA 4R1GA 4FCFA 2ZD8A 5DFXA 5GLAA 3TW8A 5GHXA 4P0MA 1ES5A 1FQGA 5D3OA 4Y15A 2WKQA 1MKIA 4P6ZM 3GQZA 3QP4A 3W4OA 5DFYA 2FZ0A 3KO6A 3OCLA 4BBTA 3Q82A 3VOLA 1PW1A 3G4PA 3FYZA 5IS1A 4IVIA 1YLTA 4LV3A 3T4KA 1T1BA 3NY4A 4LRYC 1EWZA 4UA9A 5M18A 3LUQA 1BLCA 3EEAA 4OPRA 4Y0UA 2ZC4B 3ZNTA 3M2JA 3P7NA 2M7UA 2X01A 1CEGA 2Y91A 3PBTA 2L4RA 3NDGA 2R9WA 2V2FF 4HBUA 1P97A 3DWKA 3OPRA 1PI5A 2W1TB 3T50A 4KG5A 4FUWA 5CX7A 4GHIB 1HLUP 1MY8A 3LGOA 1NWZA 4S2NC 3BYDA 1SKOB 4X69A 2W3EA 4HOIA 4Y2FA 4JKTA 4UAAA 2VV7A 3UB8A 4WLAA 3G30A 5KIZA 3O87A 3IXBA 3N8RA 5G4YA 4LPZA 2A24A 4YINA 1N9LA 3LIFA 3BWLA 1K55C 3H82B 1D7EA 2VLGA 2EXBA 3VP4A 1KE3A 1SZVA 1TS0A 4EETB 2E8JA 1HD8A 3VSLA 2Y2NA 3BLMA 3HREA 3KSIA 2J3TD 2ZQ8A 1RCJA 3T4SA 3LFVA 1LLBA 3CUEA 5CECA 3EQUA 2CC1A 5DTKA 3BJNA 3AGDA 2B95A 3BW6A 4UQIS 4Z9QA 5EOEA 3S1YA 3ISGA 2Q9MA 2Y2GA 3G35A 1S6RA 4GLQA 5TFQA 2ZBBA 4L0LA 1L0GA 2EA9A 3HJIA 4Y0OA 1NRFA 5AVFA 4HH3A 1H8MA 3W2ZA 4II7A 3H82A 3O86A 4NK3A 3BECA 2R9XA 5EVEA 5FQQA 4ETZA 5TGFA 1PIOA 2W1RA 3LY4A 1EI5A 4FSFA 1JWZA 3LICA 5AQ9A 4PM9A 1XFNA 4E6XA 4RVAA 5CHUA 3VSKA 2JKFA 1NJ4A 4I3JA 1IYPA 4R23A 3R7WA 2VGKA 4JXWA 4I39A 1Y28A 4UQIM 4F94A 2W27A 5AVEA 3WS4A 1FCOA 1LL8A 4KUOA 4QPRA 5J3WA 4MLLA 2EXAA 3LIBA 4JGOA 3W8KA 2O9BA 3PBRA 3DWZA 4EQ1A 3M6HA 4JLFA 4S2KA 2Y2IA 3MBZA 5EFWA 3W4QA 4H8RA 4G3KA 2P04A 4PM8A 1L0FA 1GSXA 4UHUA 1SKFA 4C6YA 1H8YA 1QMEA 1Y4OA 2PR6A 2PD8A 5FQ9A 4UA6A 2VX8A 4OPQA 3HLEA 4KZBA 2XQZA 1VETB 2JCHA 2QKPA 3UO9A 1IYSA 3HLGA 3RH8B 2Z2LB 1K25A 1ZC2A 5HAIA 4OOMA 3QNCA 4S2OA 3N7WA 2Y2LA 4HHDA 1RGYA 3MSHA 5EE8A 4LGWA 1YMSA 1GSWA 2ZMFA 1ESIA 1LSWA 4LV2A 3IXDA 4HP4A 3UDXA 3IT9A 3NHQA 4WELA 3LEQA 3D3OA 3UPOA 4S2MA 4HJ4A 1ESUA 3LR0A 3HBRA 3S4XA 1BLHA 3DBAA 1NRJA 3IWQA 3IHAA 2V8FA 5FQIA 2O9AA 5DKKA 2GNXA 1FCNA 3NC8A 2WKEA 3QP8A 1JTGA 3UE3A 3LYXA 3ZVTA 1YLYA 3HUOA 5F5YA 2Y79A 2Z6DA 3CITA 4Y5FA 4HBTA 1HTZA 3FPVA 4WYYA 5EVIC 4KZAA 2X02A 4JBFA 4KZ9A 3UY6A 4DXBA 5CHJA 3SOIA 5JYPA 3EGXC 4HNBA 2WZXA 1K4EA 3VFHA 1F5MA 2HZ5A 2K2NA 3FC7A 3Q07A 5FSRA 4DXCA 1MXOA 4WM9A 3N8LA 3K2NA 4I3IA 3UE6A 3JVVA 1IELA 1G28A 4CQHA 3BFFA 3SS4A 3U2AA 3HLWA 3UPPA 4DDYA 3VE4A 3WS2A 4XXRA 2JKRM 3CPTA 5DJTA 4PHTA 3PBNA 4B93A 3H9WA 4BENA 1L0EA 3MXRA 5FASA 2ZC6B 3AGEA 3NOTC 3C8CA 4ZAMA 3G2YA 5IT5A 2XA7S 4DE1A 2ZC3B 3S22A 3HLCA 1TS8A 1OJGA 3C7VA 3SH7A 2JE5A 1Z09A 1T19A 2DMWA 4EEUA 2A3UA 2DNSA 2OWJA 2JC7A 2UV0E 4U3TA 1NYMA 4R3AA 4UA7A 2Z2MB 3T1XA 4E3MA 5DJUA 2PD7A 3ITBA 4OOYA 1MPLA 3OC2A 4EV4A 1K38A 4IUHA 5HW3A 3RXWA 2J3TC 2ZL1B 1JWVA 1KOUA 4G3VA 3Q1FA 4OQ0A 3ZQ5A 3UB6A 5U47A 4MCWA 5G18A 3OCNA 2HF6A 3M2KA 2CMNA 2J8YA 3C4OA 3T1RA 4DJ3A 3PXPA 3S7OA 1FOFA 1RP5A 1DP8A 1BUEA 4BD0A 2XFTA 2K31A 4CLCD 2QWSA 4EBNA 1S4RA 1PYYA 1H0MA 4HJ6A 3UE0A 2ZOIA 3V3RA 3G2ZA 1CI9A 1W7FA 4R70A 1K6SA 1H5XA 1W5DA 4Q8IA 1KGGA 1CQAA 2ZL1A 5EVIB 2BG1A 2HP6A 2WUQA 3C5AA 4DE2A 1KDSA 4N1HA 4GCZA 4LCLA 5F69A 3UB7A 4XUZA 1LSXA 3C38A 4PM6A 2PYPA 4YNRA 1V9ZA 4X55A 5L8MA 1PZPA 2A49A 2Y2MA 3NCKA 4X1LA 2RCXA 5A93A 2KX6A 5E2GA 4RQ9A 1O7EA 1SDEA 1EROA 3IF6A 4X53A 2HJ9C 1TVFA 2Y4AA 5DTTA 5EM0A 3KSGA 4KZ3A 1F9IA 2Q0OA 4IJGA 5HDDA 3T1SA 4NKPA 5FDSA 3BFCA 1BT5A 3KYEA 4MN6A 4XT2B 5LBRA 1KGFA 3MJQA 4MEZA 3SH9A 5FL3A 4MBKA 3BFDA 4OONA 3S7PA 4N92A 3TE8A 4M4XA 1F2KA 2JBFA 4I5SA 3IS2B 3EGDC 1XP4A 4KQRA 4PMAA 3HLBA 4EBLA 2D02A 4GNUA 2EX9A 3SH8A 2HPBA 3E4OA 3HJKA 1ZKJA 5DF9A 4JF4A 1K6RA 1KVLA 3LCEA 1I5QA 3GSGA 5J7EA 5HDSA 4RYEA 3DTKA 1A0KA 4ARZB 4ZJ2A 3RXXA 2OWHA 4ID4A 4XT2A 1K57A 1KVMA 2QYBA 2ZC7A 4KZ6A 1VHMA 5HARA 1L2SA 5FA7A 2IWBA 1XXMA 2Y2JA 3V5MA 3Q7ZA 4C75A 5G4ZA 2BTFP 1ERQA 2WAEA 3MZDA 1K0KA 1IOUA 1HVBA 3TSGA 2PAVP 4QHCA 4B9OA 1OTEA 4MDZA 4E3LA 3W4PA 2WGIA 3ULFA 2Y8HA 4OH0A 4N9KA 1PRQA 4X25A 4FTXA 4MBFA 4NG2A 3MS6A 3BQAA 2V0WA 3VV4A 2JHEA 3F1NB 4BBVA 1LI0A 3SZTA 3LY3A 4GW9A 2PBDP 4WBGA 2W1TA 4ZJ3A 1FR6A 3CJMA 3QNBA 1EW0A 4GHIA 4MN7A 1FR1A 3UNWA 3K3DA 1SKOA 4JGQA 4L9EA 2QJ7A 3Q81A 5HPFA 3T4LA 2PR5A 4U0TA 3E0YA 5DKLA 4NXGA 4WEJA 1ZTUA 3C30A 4KQDA 2B18A 2LB5A 4K91A 4ZJ1A 1YLZA 1ES2A 1GA0A 3LR4A 1PW8A 2FFFB 4O01A 3LEZA 4ZDXA 4AFIA 2JN7A 4S2JA 5CHMA 2GJ3A 3D4FA 3K3CA 1OTAA 2GZAA 4DKIA 2XDMA 5FI6A 5HD3A 4R38A 5F83A 3N6IA 3GDIA 2ZMAA 2XRNA 1T18A 4JXGA 4KQQA 3CZDA 3A3EA 1N9OA 3V50A 5L09A 1DJAA 2HDUA 4LRXC 4D2OA 5A91A 1S1YA 1S1ZA 1E3UA 3ZCZA 5JYOA 5CTNA 2ZQ9A 3JPUA 5FQKA 3UDFA 2EWVA 4OLGA 3NJAA 3F1OB 5FEGA 3MKEA 3VE3A 1E3UD 3VMAA 2WGWB 1ERMA 1TDLA 1W63M 2HDRA 4EBPA 1H8ZA 2UWXA 4O7DA 2IWDA 1I2SA 3ZG0A 5FQMA 5E2HA 3OPHA 5GLBA 5IHVA 3IBRA 2V1BA 5GLDA 4CPKA 1AWIA 2W3DA 1G6OA 5CRFA 5CXWA 5E2FA 4CLCC 4JGRA 2P08A 4CLCE 1LSVA 4WZ4A 5HWVA 4Y13A 4ESPA 5M1AA 2J3WA 1U60A 2VA0A 4LRZE 3T4TA 4FH2A 2OSUA 3L9KA 4R4SA 3OLOA 3EOIA 4HI4A 1BLPA 3E2KA 3GECA 4RA7A 4PPRA 4OPZA 4F3LB 4NETA 5TBMB 4KQOA 4MMNA 3EEHA 4PM7A 5KMWA 2O0YA 1BLSA 3T4QA 2X71A 4K08A 3HCYA 5F68A 1KE0A 4C3QA 4L9FA 5HL6A 2OAP1 2ZMVA 1K54A 3FPWA 3CHWP 1CEFA 1TDGA 4S2NA 1BSGA 1YT4A 5M19A 2EX8A 1VETA 4NXBA 3WRTA 3LR5A 5FQJA 3GVBA 2H5SA 1VEUB 2XR0A 2VV6A 5F6AA 3ICYA 4EEPA 2DCFA 4OKPA 4S2PA 5HDCA 4P6BA 3IF6C 2ZQCA 3FKVA 4IBRA 3VOZA 1CF0A 1K55A 4E3KA 2JKTM 1YSPA 1ES3A 2WADA 4BQMA 3DAVA 3P09A 4F3LA 2WKHA 5TBMA 2VK3A 4K0WA 3LI9A 4X6TA 4WF0A 5HWWA 2RL3A 3ZFZA 3NIAA 2Y2PA 4EWFA 3VP1A 5F1FA 1NXYA 3OPPA 4KZ5A 4KUKA 2Y2KA 4EERA 1NYYA 3QP1A 2ZC5B 3QP6A 4B88A 2XD1A 2ZM0A 4DF6A 1S0WA 2ZJ9A 4E3OA 3S7NA 4YWZA 4EU0A 4MBHA 3UDIA 2W3GA 1K56A 1LI9A 3B42A 4HESA 1W63Q 3UPNA 3C7UA 3IH9A 4IEDA 3T12B 4LV0A 3A3IA 3DTMA 3IBJA 4OQIA 2ZQAA 3H7WB 2QMIA 3C2WA 2J9PA 2PT7A 3BM6A 1ES4A 2EFXA 3IWIA 4CJNA 3VOYA 3P98A 1D1JA 5KSHA 3IF5A 1JWPA 3A3DA 3NOPC 4OQGA 1K56D 4GN2A 3T4JA 4BBUA 2Y55A 1MBLA 1G5UA 3ZVWA 3F1PB 2V1ZA 5AQ7A 1OTDA 3RTYA 3ITAA 2GX5A 1P0ZA 2G2UA 4WZ5A 3L7HA 4BMWA 3Q7VB 4JF6A 1L0DA 5DF7A 1OPXA 3DTEA 3LO7A 1NZUA 4QD4A 3IXGA 4KZ4A 3WS0A 3IWOA 1N4OA 2J9OA 3KSFA 1M40A 1G68A 2A2LA 2W3HA 4O8GA 2IWCA 4GKUA 5EVLA 4DRTA 2KDKA 5HZHA 1E4DA 2XA7M 4DDSA 4NXEA 2VEAA 1MWUA 1H3QA 2J7VA 2PDRA 4PAUA 4I3AA 5K5BA 5FAPA 4Y7PA 4DE3A 3M6BA 3VP0A 3PAGA 3NECA 1NZOA 4WN5A 4N9LA 3CUEC 3SS5A 2ACGA 2IA2A 5FI7A 3NI9A 1NY0A 2C6WB 1XPBA 2ZM8A 1LL9A 2E8IA 5J8XA 2WKIA 2Q9NA 1YKDA 2B5RA 5HAPA 3R4KA 1N9NA 2HDQA 1GHPA 3V3SA 1T1AA 1ZG4A 1XJ4A 4HJ3A 4P87A 4BD1A 2INWA 3VFFA 3PAEA 2OAQ1 5EECA 5I5LA 5FDHA 1ONHA 5J4EA 1OT9A 3D9YA 1UWNX 1RGZA 1XJ2A 3CLOA 5TJJA 4IUKA 3IX8A 3PHYA 1MWRA 1WE4A 2V9AA 3PBOA 2WKPA 3ZDJA 2HJEA 5BOHA 4Q0JA 3MF0A 4DN0A 4X56A 1GHMA 1D06A 1E25A 1PI4A 2V20A 3DW0A 5FAQA 3BRMA 1OTIA 3IH8A 5HPIA 5CGWA 3PYPA 1Z6FA 2VZWA 1ACFA 4HY8A 5EVIA 3A0SA 4OP5A 3ZYTA 5CEBA 1YQSA 2ZLYA 1J3WA 1QMFA 3GTCA 3ZG9B 3RJUA 3FG8A 3I7JA 3BLSA 1DY6A 2XGNA 3IQAA 4EUZA 5EVID 1YPRA 1PZOA 5FI2A 2WAFA 4E3IA 3KX0X 1S4SA 3LIEA 4LFUA 3G6OA 2VGLS 5FAOA 3MZEA 2A24B 3P01A 3CAXA 3BY8A 3A0VA 2QJ5A 2L0WA 3MQOA 2FFYA 2P9VB 2BASA 1P9WA 3DTIA 1TS6A 3NBLA 4OPYA 2J80A 2I9VA 5EV0A 5L07A 5AJGA 2FH5A 5A8BA 4GJ4A 2KLIA 3IS2A 4MN5A 3T1QB 1JNUA 4OVDA 4Y0TA 4E3JA 4E6WA 5DTSA 5EM1A 3TOIA 1XA1A 1IYOA 1K54C 1FILA 2QHKA 4P85A 4GB7A 4FH4A 2L1MA 3HUMA 3MR0A 4JGPA 2ZM2A 1KE4A 2XEPA 1XGIA 1V9YA 1FSWA 4JF5A 1XJ3A 1LL5A 2ZQ7A 3QHYA 4X1MA 4GZBA 1MWSA 1L3LA 1ZG6A 1TF1A 2VGLM 3ZNYA 1OMEA 5HX9A 5F82A 3EWKA 4ARZA 3WS1A 3G34A 1YLWA 3UB9A 2P9VA 3PTEA 4QY5A 4KZ7A 2XH9A 4XUXA 1WYCA 4O0PA 3NDEA 3B3XA 5HAQA 2EX6A 1IEMA 2XFSA 3GRJA 1YMXA 4E3NA 4IHQA 2OLVA 3R7WB 5L2FA 3CI6A 3MKFA 4GOGA 4I38A 1I2WA 1ALQA 2OLUA 3KSHA 2XROA 3TRCA 1F98A 5CTMA 3ZHHA 2C5WB 4GD8A 4Y3IA 3D72A 1W8QA 4PKYA 2O99A 3AGFA 3BY9A 5AQBA 3GV9A 3OZHA 3EQVA 3QP5A 3F1NA 4HH2A 4MNRA 2GDNA 1KDWA 3MXSA 4YFMA 2XLNA 4QU3A 1CI8A 1YLJA 3UB5P 4OP8A 5HSQA 3A3FA 4EESA 1MC0A 4HP9A 1IYQA 4JXVA 5EOOA 5CEDA 4S2LA 3QP2A 4ZBEA 3HLDA 1BULA 3CG5A 4B4ZA 3HUNA 2G7UA 2ZQDA 2MJ6A 3E4QA 3SW1A 3UE1A 1N9BA 2EFUA 4WZ5C 3ZG8B 3MMHA 4IBXA 3OPLA 4M3KA 5GLCA 2H0YA 1TD5A 4RX2A 2Y2QA 2JKTI 2XF3A 3VP3A 2H10A 4RX3A 5E43A 2Y59A 3NULA 4Y17A 4GDBA 1DP6A 4UEYA 4WEKA 1IKGA 1GCEA 2EWWA 3ZGAB 3U4LP 2VJWA 1VB6A 4FD8A 1NLYA 2OOLA 2JKGA 3F1OA 3E98A 3MFXA 1P9RA 5HFOA 2JKRI 3FZCA 4X68A 2WGWA 4L9GA 3VP2A 1MKMA 1O07A 1OTBA 3PBQA 2HV1A 1AXBA 1JVJA 4OLDA 5I94A 4R3BA 5EPHA 2OV5A 2PU4A 4NXFA 4B4XA 1SCWA 4S2IA 4G3WA 2Z6CA 3S7QA 3MZFA 2G2WA 3NOUC 5HWTA 3LI8A 4BL3A 2H28A 4FOFA 1YAXA 4A5RA 4EUVA 5AQAA 2QZ6A 2AVXA 2KOIA 4HEFA 1W8YA 3G31A 1CJFA 4R6LA 4GDNA 1GHIA 5A90A 1LHYA 1GSVA 5CGXA 4GS9B 5TR7A 3BFGA 3LR3A 2V8CA 5KSCA 4LCMA 3CPTB 4EXOA 1TS7A 5CGSA 3UMEA 4H6JB 2PBYA 1DRMA 1JTDA 4Z1WA 5MC7A 1WYBA 5L10A 1W79A 3JYIA 3O3VA 4R4RA 4BJPA 3HL9A 4KG2A 5DVAA 1DP9A 1IKIA 1XA7A 5KZHA 4DMZA 2DRWA 2PHYA 5CERA 1ONGA 1VM1A 1Y54A 1CK3A 2NUTC 2V1AA 1VQQA 2R78A 3E4PA 4BWIA 3KYQA 1PFLA 1Q2QA 4HQAA 1KGEA 3WRZA 1VEUA 1S66L 3MQ0A 3T4OA 1PWGA 1OJ5A 1SDNA 5IU1A 1XFQA 2VKSA 2I72A 3CWFA 1C3BA 3B47A 4JXSA 4GS9A 3MFDA 2H0TA 3IXHA 3E2LA 3FWLA 3FV7A 3PR6A 3GR2A 3BFEA 3GMWA 1GA9A 4DE0A 4PKYG 4WL9A 2K7SA 5HD5A 2M1CA 1T1CA 2M7VA 4H6JA 3O5YA 5C5KA 1K57C 5FEFA 4QJGA 4BLMA 2W0NA 5EUAA 4KENB 3OBFA 3UN7A 4ZTKA 4Q0IA 4CLCB 2W3FA 4ME4A 1OT6A 3IHBA 2PRFA 4QWOA 3IX4A 4IVKA 4EQIA 4EW7A 4WMCA 1XJ6A 4LENA 1BTLA 2YKFA 1WA9A 4OQHA 5FATA 2WGVA 4KG6A 3KYZA 2V0UA 3BEBA 2WYXA 3IX3A 3WS5A 1UGUA 5E2EA 4NEED 2O9CA 4WMCD 4ETXA 5DF8A 1XGJA 3BQ8A 3H7WA 5HL1A 3N8SA 1TEMA 1Q2PA 5A92A 1M6KA 3MXQA 1ODVA 2HGVA 2ZOHA 1BZAA 4LV1A 2XK1A 5GHZA 1S67L 1K4FA 3V67A 3CMZA 1DJBA 4PM5A 5GHYA 3ZG5A 4R0QA 3ZG7B 3G32A 3F1PA 3HVFA 1FIKA 1NLZA 4CLCA 4N1XA 2B02A 1YM1A 1X0OA 3TG9A 3PBSA 1ZHHB 5GL9A 4HIAA 2WK0A 2Y2OA 1FCMA 2YKHA 2PU2A 3IF6B 4QY6A 3LIAA 3Q7VA 1YSQA 2BLSA 2P7JA 4GD6A 4ZRRA 1PWDA 3UMDA 1UWPX 1LT0A 3JVUA 4JPMA 1XX2A 2VV8A 1J9MA 1PNEA 3MQQA 2WZZA 3OOVA 1FSYA 3A3JA 3LIDA 1YLPA 2HP9A 4KZ8A 4LLOB 2XD5A 2XSSA 2PYRA 4Q0HA 4OOLA 4P6ZS 2P74A 2HP5A 3FKWA 3O88A 2D01A 3SS3A 3V39A 1IFQA 2WKRA 4E04A 5F1GA 1DJCA 4YOFA 3B33A 2EX2A 3N4IA 4WUJA 1BYWA 4R3JA 1SHVA 1HZOA 3A0RA 3HLFA 2LB9A 2Y2HA 2HDSA 4QB8A
chains in the Genus database with same CATH topology
4D60A 2V8FA 1YPRA 1Z09A 3U4LP 3T12B 4X1LA 2BTFP 2JKGA 1PFLA 1FIKA 1SZVA 3T1XA 5EM0A 1K0KA 1D1JA 1VEUA 2E8JA 3CHWP 3T1SA 2PAVP 5FDSA 2ZL1B 1G5UA 1VETA 3D9YA 5EV0A 3KYEA 5FEGA 1VEUB 1Y4OA 1PRQA 4X25A 3T1QB 4FTXA 3MS6A 5EM1A 1VETB 2B95A 2HZ5A 3L7HA 3UB5P 5FEFA 1F2KA 1FILA 1PNEA 1CF0A 3T1RA 2PBDP 3DAVA 4X1MA 3MSHA 1AWIA 2VK3A 2PRFA 4QWOA 1SKOA 1CJFA 3CPTA 5EVEA 3LEQA 1ACFA 4FUWA 2V8CA 1HLUP 3LGOA 1SKOB 4ESPA 3CPTB 1J3WA 3NECA 1A0KA 3L9KA 1CQAA 2ZL1A 3NULA 2ACGA 2JKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D60 A;  2V8F A;  1YPR A;  1Z09 A;  3U4L P;  3T12 B;  4X1L A;  2BTF P;  2JKG A;  1PFL A;  1FIK A;  1SZV A;  3T1X A;  5EM0 A;  1K0K A;  1D1J A;  1VEU A;  2E8J A;  3CHW P;  3T1S A;  2PAV P;  5FDS A;  2ZL1 B;  1G5U A;  1VET A;  3D9Y A;  5EV0 A;  3KYE A;  5FEG A;  1VEU B;  1Y4O A;  1PRQ A;  4X25 A;  3T1Q B;  4FTX A;  3MS6 A;  5EM1 A;  1VET B;  2B95 A;  2HZ5 A;  3L7H A;  3UB5 P;  5FEF A;  1F2K A;  1FIL A;  1PNE A;  1CF0 A;  3T1R A;  2PBD P;  3DAV A;  4X1M A;  3MSH A;  1AWI A;  2VK3 A;  2PRF A;  4QWO A;  1SKO A;  1CJF A;  3CPT A;  5EVE A;  3LEQ A;  1ACF A;  4FUW A;  2V8C A;  1HLU P;  3LGO A;  1SKO B;  4ESP A;  3CPT B;  1J3W A;  3NEC A;  1A0K A;  3L9K A;  1CQA A;  2ZL1 A;  3NUL A;  2ACG A;  2JKF A; 
#chains in the Genus database with same CATH topology
 1PWC A;  4D60 A;  3C4P A;  2VGJ A;  1STZ A;  4K0X A;  1MZU A;  3TJZ C;  4DJ2 A;  1G6A A;  2QPN A;  1XKZ A;  3WWX A;  4BL2 A;  2NUP C;  3RFB A;  4U0X A;  1MWT A;  4R1G A;  4FCF A;  2ZD8 A;  5DFX A;  5GLA A;  3TW8 A;  5GHX A;  4P0M A;  1ES5 A;  1FQG A;  5D3O A;  4Y15 A;  2WKQ A;  1MKI A;  4P6Z M;  3GQZ A;  3QP4 A;  3W4O A;  5DFY A;  2FZ0 A;  3KO6 A;  3OCL A;  4BBT A;  3Q82 A;  3VOL A;  1PW1 A;  3G4P A;  3FYZ A;  5IS1 A;  4IVI A;  1YLT A;  4LV3 A;  3T4K A;  1T1B A;  3NY4 A;  4LRY C;  1EWZ A;  4UA9 A;  5M18 A;  3LUQ A;  1BLC A;  3EEA A;  4OPR A;  4Y0U A;  2ZC4 B;  3ZNT A;  3M2J A;  3P7N A;  2M7U A;  2X01 A;  1CEG A;  2Y91 A;  3PBT A;  2L4R A;  3NDG A;  2R9W A;  2V2F F;  4HBU A;  1P97 A;  3DWK A;  3OPR A;  1PI5 A;  2W1T B;  3T50 A;  4KG5 A;  4FUW A;  5CX7 A;  4GHI B;  1HLU P;  1MY8 A;  3LGO A;  1NWZ A;  4S2N C;  3BYD A;  1SKO B;  4X69 A;  2W3E A;  4HOI A;  4Y2F A;  4JKT A;  4UAA A;  2VV7 A;  3UB8 A;  4WLA A;  3G30 A;  5KIZ A;  3O87 A;  3IXB A;  3N8R A;  5G4Y A;  4LPZ A;  2A24 A;  4YIN A;  1N9L A;  3LIF A;  3BWL A;  1K55 C;  3H82 B;  1D7E A;  2VLG A;  2EXB A;  3VP4 A;  1KE3 A;  1SZV A;  1TS0 A;  4EET B;  2E8J A;  1HD8 A;  3VSL A;  2Y2N A;  3BLM A;  3HRE A;  3KSI A;  2J3T D;  2ZQ8 A;  1RCJ A;  3T4S A;  3LFV A;  1LLB A;  3CUE A;  5CEC A;  3EQU A;  2CC1 A;  5DTK A;  3BJN A;  3AGD A;  2B95 A;  3BW6 A;  4UQI S;  4Z9Q A;  5EOE A;  3S1Y A;  3ISG A;  2Q9M A;  2Y2G A;  3G35 A;  1S6R A;  4GLQ A;  5TFQ A;  2ZBB A;  4L0L A;  1L0G A;  2EA9 A;  3HJI A;  4Y0O A;  1NRF A;  5AVF A;  4HH3 A;  1H8M A;  3W2Z A;  4II7 A;  3H82 A;  3O86 A;  4NK3 A;  3BEC A;  2R9X A;  5EVE A;  5FQQ A;  4ETZ A;  5TGF A;  1PIO A;  2W1R A;  3LY4 A;  1EI5 A;  4FSF A;  1JWZ A;  3LIC A;  5AQ9 A;  4PM9 A;  1XFN A;  4E6X A;  4RVA A;  5CHU A;  3VSK A;  2JKF A;  1NJ4 A;  4I3J A;  1IYP A;  4R23 A;  3R7W A;  2VGK A;  4JXW A;  4I39 A;  1Y28 A;  4UQI M;  4F94 A;  2W27 A;  5AVE A;  3WS4 A;  1FCO A;  1LL8 A;  4KUO A;  4QPR A;  5J3W A;  4MLL A;  2EXA A;  3LIB A;  4JGO A;  3W8K A;  2O9B A;  3PBR A;  3DWZ A;  4EQ1 A;  3M6H A;  4JLF A;  4S2K A;  2Y2I A;  3MBZ A;  5EFW A;  3W4Q A;  4H8R A;  4G3K A;  2P04 A;  4PM8 A;  1L0F A;  1GSX A;  4UHU A;  1SKF A;  4C6Y A;  1H8Y A;  1QME A;  1Y4O A;  2PR6 A;  2PD8 A;  5FQ9 A;  4UA6 A;  2VX8 A;  4OPQ A;  3HLE A;  4KZB A;  2XQZ A;  1VET B;  2JCH A;  2QKP A;  3UO9 A;  1IYS A;  3HLG A;  3RH8 B;  2Z2L B;  1K25 A;  1ZC2 A;  5HAI A;  4OOM A;  3QNC A;  4S2O A;  3N7W A;  2Y2L A;  4HHD A;  1RGY A;  3MSH A;  5EE8 A;  4LGW A;  1YMS A;  1GSW A;  2ZMF A;  1ESI A;  1LSW A;  4LV2 A;  3IXD A;  4HP4 A;  3UDX A;  3IT9 A;  3NHQ A;  4WEL A;  3LEQ A;  3D3O A;  3UPO A;  4S2M A;  4HJ4 A;  1ESU A;  3LR0 A;  3HBR A;  3S4X A;  1BLH A;  3DBA A;  1NRJ A;  3IWQ A;  3IHA A;  2V8F A;  5FQI A;  2O9A A;  5DKK A;  2GNX A;  1FCN A;  3NC8 A;  2WKE A;  3QP8 A;  1JTG A;  3UE3 A;  3LYX A;  3ZVT A;  1YLY A;  3HUO A;  5F5Y A;  2Y79 A;  2Z6D A;  3CIT A;  4Y5F A;  4HBT A;  1HTZ A;  3FPV A;  4WYY A;  5EVI C;  4KZA A;  2X02 A;  4JBF A;  4KZ9 A;  3UY6 A;  4DXB A;  5CHJ A;  3SOI A;  5JYP A;  3EGX C;  4HNB A;  2WZX A;  1K4E A;  3VFH A;  1F5M A;  2HZ5 A;  2K2N A;  3FC7 A;  3Q07 A;  5FSR A;  4DXC A;  1MXO A;  4WM9 A;  3N8L A;  3K2N A;  4I3I A;  3UE6 A;  3JVV A;  1IEL A;  1G28 A;  4CQH A;  3BFF A;  3SS4 A;  3U2A A;  3HLW A;  3UPP A;  4DDY A;  3VE4 A;  3WS2 A;  4XXR A;  2JKR M;  3CPT A;  5DJT A;  4PHT A;  3PBN A;  4B93 A;  3H9W A;  4BEN A;  1L0E A;  3MXR A;  5FAS A;  2ZC6 B;  3AGE A;  3NOT C;  3C8C A;  4ZAM A;  3G2Y A;  5IT5 A;  2XA7 S;  4DE1 A;  2ZC3 B;  3S22 A;  3HLC A;  1TS8 A;  1OJG A;  3C7V A;  3SH7 A;  2JE5 A;  1Z09 A;  1T19 A;  2DMW A;  4EEU A;  2A3U A;  2DNS A;  2OWJ A;  2JC7 A;  2UV0 E;  4U3T A;  1NYM A;  4R3A A;  4UA7 A;  2Z2M B;  3T1X A;  4E3M A;  5DJU A;  2PD7 A;  3ITB A;  4OOY A;  1MPL A;  3OC2 A;  4EV4 A;  1K38 A;  4IUH A;  5HW3 A;  3RXW A;  2J3T C;  2ZL1 B;  1JWV A;  1KOU A;  4G3V A;  3Q1F A;  4OQ0 A;  3ZQ5 A;  3UB6 A;  5U47 A;  4MCW A;  5G18 A;  3OCN A;  2HF6 A;  3M2K A;  2CMN A;  2J8Y A;  3C4O A;  3T1R A;  4DJ3 A;  3PXP A;  3S7O A;  1FOF A;  1RP5 A;  1DP8 A;  1BUE A;  4BD0 A;  2XFT A;  2K31 A;  4CLC D;  2QWS A;  4EBN A;  1S4R A;  1PYY A;  1H0M A;  4HJ6 A;  3UE0 A;  2ZOI A;  3V3R A;  3G2Z A;  1CI9 A;  1W7F A;  4R70 A;  1K6S A;  1H5X A;  1W5D A;  4Q8I A;  1KGG A;  1CQA A;  2ZL1 A;  5EVI B;  2BG1 A;  2HP6 A;  2WUQ A;  3C5A A;  4DE2 A;  1KDS A;  4N1H A;  4GCZ A;  4LCL A;  5F69 A;  3UB7 A;  4XUZ A;  1LSX A;  3C38 A;  4PM6 A;  2PYP A;  4YNR A;  1V9Z A;  4X55 A;  5L8M A;  1PZP A;  2A49 A;  2Y2M A;  3NCK A;  4X1L A;  2RCX A;  5A93 A;  2KX6 A;  5E2G A;  4RQ9 A;  1O7E A;  1SDE A;  1ERO A;  3IF6 A;  4X53 A;  2HJ9 C;  1TVF A;  2Y4A A;  5DTT A;  5EM0 A;  3KSG A;  4KZ3 A;  1F9I A;  2Q0O A;  4IJG A;  5HDD A;  3T1S A;  4NKP A;  5FDS A;  3BFC A;  1BT5 A;  3KYE A;  4MN6 A;  4XT2 B;  5LBR A;  1KGF A;  3MJQ A;  4MEZ A;  3SH9 A;  5FL3 A;  4MBK A;  3BFD A;  4OON A;  3S7P A;  4N92 A;  3TE8 A;  4M4X A;  1F2K A;  2JBF A;  4I5S A;  3IS2 B;  3EGD C;  1XP4 A;  4KQR A;  4PMA A;  3HLB A;  4EBL A;  2D02 A;  4GNU A;  2EX9 A;  3SH8 A;  2HPB A;  3E4O A;  3HJK A;  1ZKJ A;  5DF9 A;  4JF4 A;  1K6R A;  1KVL A;  3LCE A;  1I5Q A;  3GSG A;  5J7E A;  5HDS A;  4RYE A;  3DTK A;  1A0K A;  4ARZ B;  4ZJ2 A;  3RXX A;  2OWH A;  4ID4 A;  4XT2 A;  1K57 A;  1KVM A;  2QYB A;  2ZC7 A;  4KZ6 A;  1VHM A;  5HAR A;  1L2S A;  5FA7 A;  2IWB A;  1XXM A;  2Y2J A;  3V5M A;  3Q7Z A;  4C75 A;  5G4Z A;  2BTF P;  1ERQ A;  2WAE A;  3MZD A;  1K0K A;  1IOU A;  1HVB A;  3TSG A;  2PAV P;  4QHC A;  4B9O A;  1OTE A;  4MDZ A;  4E3L A;  3W4P A;  2WGI A;  3ULF A;  2Y8H A;  4OH0 A;  4N9K A;  1PRQ A;  4X25 A;  4FTX A;  4MBF A;  4NG2 A;  3MS6 A;  3BQA A;  2V0W A;  3VV4 A;  2JHE A;  3F1N B;  4BBV A;  1LI0 A;  3SZT A;  3LY3 A;  4GW9 A;  2PBD P;  4WBG A;  2W1T A;  4ZJ3 A;  1FR6 A;  3CJM A;  3QNB A;  1EW0 A;  4GHI A;  4MN7 A;  1FR1 A;  3UNW A;  3K3D A;  1SKO A;  4JGQ A;  4L9E A;  2QJ7 A;  3Q81 A;  5HPF A;  3T4L A;  2PR5 A;  4U0T A;  3E0Y A;  5DKL A;  4NXG A;  4WEJ A;  1ZTU A;  3C30 A;  4KQD A;  2B18 A;  2LB5 A;  4K91 A;  4ZJ1 A;  1YLZ A;  1ES2 A;  1GA0 A;  3LR4 A;  1PW8 A;  2FFF B;  4O01 A;  3LEZ A;  4ZDX A;  4AFI A;  2JN7 A;  4S2J A;  5CHM A;  2GJ3 A;  3D4F A;  3K3C A;  1OTA A;  2GZA A;  4DKI A;  2XDM A;  5FI6 A;  5HD3 A;  4R38 A;  5F83 A;  3N6I A;  3GDI A;  2ZMA A;  2XRN A;  1T18 A;  4JXG A;  4KQQ A;  3CZD A;  3A3E A;  1N9O A;  3V50 A;  5L09 A;  1DJA A;  2HDU A;  4LRX C;  4D2O A;  5A91 A;  1S1Y A;  1S1Z A;  1E3U A;  3ZCZ A;  5JYO A;  5CTN A;  2ZQ9 A;  3JPU A;  5FQK A;  3UDF A;  2EWV A;  4OLG A;  3NJA A;  3F1O B;  5FEG A;  3MKE A;  3VE3 A;  1E3U D;  3VMA A;  2WGW B;  1ERM A;  1TDL A;  1W63 M;  2HDR A;  4EBP A;  1H8Z A;  2UWX A;  4O7D A;  2IWD A;  1I2S A;  3ZG0 A;  5FQM A;  5E2H A;  3OPH A;  5GLB A;  5IHV A;  3IBR A;  2V1B A;  5GLD A;  4CPK A;  1AWI A;  2W3D A;  1G6O A;  5CRF A;  5CXW A;  5E2F A;  4CLC C;  4JGR A;  2P08 A;  4CLC E;  1LSV A;  4WZ4 A;  5HWV A;  4Y13 A;  4ESP A;  5M1A A;  2J3W A;  1U60 A;  2VA0 A;  4LRZ E;  3T4T A;  4FH2 A;  2OSU A;  3L9K A;  4R4S A;  3OLO A;  3EOI A;  4HI4 A;  1BLP A;  3E2K A;  3GEC A;  4RA7 A;  4PPR A;  4OPZ A;  4F3L B;  4NET A;  5TBM B;  4KQO A;  4MMN A;  3EEH A;  4PM7 A;  5KMW A;  2O0Y A;  1BLS A;  3T4Q A;  2X71 A;  4K08 A;  3HCY A;  5F68 A;  1KE0 A;  4C3Q A;  4L9F A;  5HL6 A;  2OAP 1;  2ZMV A;  1K54 A;  3FPW A;  3CHW P;  1CEF A;  1TDG A;  4S2N A;  1BSG A;  1YT4 A;  5M19 A;  2EX8 A;  1VET A;  4NXB A;  3WRT A;  3LR5 A;  5FQJ A;  3GVB A;  2H5S A;  1VEU B;  2XR0 A;  2VV6 A;  5F6A A;  3ICY A;  4EEP A;  2DCF A;  4OKP A;  4S2P A;  5HDC A;  4P6B A;  3IF6 C;  2ZQC A;  3FKV A;  4IBR A;  3VOZ A;  1CF0 A;  1K55 A;  4E3K A;  2JKT M;  1YSP A;  1ES3 A;  2WAD A;  4BQM A;  3DAV A;  3P09 A;  4F3L A;  2WKH A;  5TBM A;  2VK3 A;  4K0W A;  3LI9 A;  4X6T A;  4WF0 A;  5HWW A;  2RL3 A;  3ZFZ A;  3NIA A;  2Y2P A;  4EWF A;  3VP1 A;  5F1F A;  1NXY A;  3OPP A;  4KZ5 A;  4KUK A;  2Y2K A;  4EER A;  1NYY A;  3QP1 A;  2ZC5 B;  3QP6 A;  4B88 A;  2XD1 A;  2ZM0 A;  4DF6 A;  1S0W A;  2ZJ9 A;  4E3O A;  3S7N A;  4YWZ A;  4EU0 A;  4MBH A;  3UDI A;  2W3G A;  1K56 A;  1LI9 A;  3B42 A;  4HES A;  1W63 Q;  3UPN A;  3C7U A;  3IH9 A;  4IED A;  3T12 B;  4LV0 A;  3A3I A;  3DTM A;  3IBJ A;  4OQI A;  2ZQA A;  3H7W B;  2QMI A;  3C2W A;  2J9P A;  2PT7 A;  3BM6 A;  1ES4 A;  2EFX A;  3IWI A;  4CJN A;  3VOY A;  3P98 A;  1D1J A;  5KSH A;  3IF5 A;  1JWP A;  3A3D A;  3NOP C;  4OQG A;  1K56 D;  4GN2 A;  3T4J A;  4BBU A;  2Y55 A;  1MBL A;  1G5U A;  3ZVW A;  3F1P B;  2V1Z A;  5AQ7 A;  1OTD A;  3RTY A;  3ITA A;  2GX5 A;  1P0Z A;  2G2U A;  4WZ5 A;  3L7H A;  4BMW A;  3Q7V B;  4JF6 A;  1L0D A;  5DF7 A;  1OPX A;  3DTE A;  3LO7 A;  1NZU A;  4QD4 A;  3IXG A;  4KZ4 A;  3WS0 A;  3IWO A;  1N4O A;  2J9O A;  3KSF A;  1M40 A;  1G68 A;  2A2L A;  2W3H A;  4O8G A;  2IWC A;  4GKU A;  5EVL A;  4DRT A;  2KDK A;  5HZH A;  1E4D A;  2XA7 M;  4DDS A;  4NXE A;  2VEA A;  1MWU A;  1H3Q A;  2J7V A;  2PDR A;  4PAU A;  4I3A A;  5K5B A;  5FAP A;  4Y7P A;  4DE3 A;  3M6B A;  3VP0 A;  3PAG A;  3NEC A;  1NZO A;  4WN5 A;  4N9L A;  3CUE C;  3SS5 A;  2ACG A;  2IA2 A;  5FI7 A;  3NI9 A;  1NY0 A;  2C6W B;  1XPB A;  2ZM8 A;  1LL9 A;  2E8I A;  5J8X A;  2WKI A;  2Q9N A;  1YKD A;  2B5R A;  5HAP A;  3R4K A;  1N9N A;  2HDQ A;  1GHP A;  3V3S A;  1T1A A;  1ZG4 A;  1XJ4 A;  4HJ3 A;  4P87 A;  4BD1 A;  2INW A;  3VFF A;  3PAE A;  2OAQ 1;  5EEC A;  5I5L A;  5FDH A;  1ONH A;  5J4E A;  1OT9 A;  3D9Y A;  1UWN X;  1RGZ A;  1XJ2 A;  3CLO A;  5TJJ A;  4IUK A;  3IX8 A;  3PHY A;  1MWR A;  1WE4 A;  2V9A A;  3PBO A;  2WKP A;  3ZDJ A;  2HJE A;  5BOH A;  4Q0J A;  3MF0 A;  4DN0 A;  4X56 A;  1GHM A;  1D06 A;  1E25 A;  1PI4 A;  2V20 A;  3DW0 A;  5FAQ A;  3BRM A;  1OTI A;  3IH8 A;  5HPI A;  5CGW A;  3PYP A;  1Z6F A;  2VZW A;  1ACF A;  4HY8 A;  5EVI A;  3A0S A;  4OP5 A;  3ZYT A;  5CEB A;  1YQS A;  2ZLY A;  1J3W A;  1QMF A;  3GTC A;  3ZG9 B;  3RJU A;  3FG8 A;  3I7J A;  3BLS A;  1DY6 A;  2XGN A;  3IQA A;  4EUZ A;  5EVI D;  1YPR A;  1PZO A;  5FI2 A;  2WAF A;  4E3I A;  3KX0 X;  1S4S A;  3LIE A;  4LFU A;  3G6O A;  2VGL S;  5FAO A;  3MZE A;  2A24 B;  3P01 A;  3CAX A;  3BY8 A;  3A0V A;  2QJ5 A;  2L0W A;  3MQO A;  2FFY A;  2P9V B;  2BAS A;  1P9W A;  3DTI A;  1TS6 A;  3NBL A;  4OPY A;  2J80 A;  2I9V A;  5EV0 A;  5L07 A;  5AJG A;  2FH5 A;  5A8B A;  4GJ4 A;  2KLI A;  3IS2 A;  4MN5 A;  3T1Q B;  1JNU A;  4OVD A;  4Y0T A;  4E3J A;  4E6W A;  5DTS A;  5EM1 A;  3TOI A;  1XA1 A;  1IYO A;  1K54 C;  1FIL A;  2QHK A;  4P85 A;  4GB7 A;  4FH4 A;  2L1M A;  3HUM A;  3MR0 A;  4JGP A;  2ZM2 A;  1KE4 A;  2XEP A;  1XGI A;  1V9Y A;  1FSW A;  4JF5 A;  1XJ3 A;  1LL5 A;  2ZQ7 A;  3QHY A;  4X1M A;  4GZB A;  1MWS A;  1L3L A;  1ZG6 A;  1TF1 A;  2VGL M;  3ZNY A;  1OME A;  5HX9 A;  5F82 A;  3EWK A;  4ARZ A;  3WS1 A;  3G34 A;  1YLW A;  3UB9 A;  2P9V A;  3PTE A;  4QY5 A;  4KZ7 A;  2XH9 A;  4XUX A;  1WYC A;  4O0P A;  3NDE A;  3B3X A;  5HAQ A;  2EX6 A;  1IEM A;  2XFS A;  3GRJ A;  1YMX A;  4E3N A;  4IHQ A;  2OLV A;  3R7W B;  5L2F A;  3CI6 A;  3MKF A;  4GOG A;  4I38 A;  1I2W A;  1ALQ A;  2OLU A;  3KSH A;  2XRO A;  3TRC A;  1F98 A;  5CTM A;  3ZHH A;  2C5W B;  4GD8 A;  4Y3I A;  3D72 A;  1W8Q A;  4PKY A;  2O99 A;  3AGF A;  3BY9 A;  5AQB A;  3GV9 A;  3OZH A;  3EQV A;  3QP5 A;  3F1N A;  4HH2 A;  4MNR A;  2GDN A;  1KDW A;  3MXS A;  4YFM A;  2XLN A;  4QU3 A;  1CI8 A;  1YLJ A;  3UB5 P;  4OP8 A;  5HSQ A;  3A3F A;  4EES A;  1MC0 A;  4HP9 A;  1IYQ A;  4JXV A;  5EOO A;  5CED A;  4S2L A;  3QP2 A;  4ZBE A;  3HLD A;  1BUL A;  3CG5 A;  4B4Z A;  3HUN A;  2G7U A;  2ZQD A;  2MJ6 A;  3E4Q A;  3SW1 A;  3UE1 A;  1N9B A;  2EFU A;  4WZ5 C;  3ZG8 B;  3MMH A;  4IBX A;  3OPL A;  4M3K A;  5GLC A;  2H0Y A;  1TD5 A;  4RX2 A;  2Y2Q A;  2JKT I;  2XF3 A;  3VP3 A;  2H10 A;  4RX3 A;  5E43 A;  2Y59 A;  3NUL A;  4Y17 A;  4GDB A;  1DP6 A;  4UEY A;  4WEK A;  1IKG A;  1GCE A;  2EWW A;  3ZGA B;  3U4L P;  2VJW A;  1VB6 A;  4FD8 A;  1NLY A;  2OOL A;  2JKG A;  3F1O A;  3E98 A;  3MFX A;  1P9R A;  5HFO A;  2JKR I;  3FZC A;  4X68 A;  2WGW A;  4L9G A;  3VP2 A;  1MKM A;  1O07 A;  1OTB A;  3PBQ A;  2HV1 A;  1AXB A;  1JVJ A;  4OLD A;  5I94 A;  4R3B A;  5EPH A;  2OV5 A;  2PU4 A;  4NXF A;  4B4X A;  1SCW A;  4S2I A;  4G3W A;  2Z6C A;  3S7Q A;  3MZF A;  2G2W A;  3NOU C;  5HWT A;  3LI8 A;  4BL3 A;  2H28 A;  4FOF A;  1YAX A;  4A5R A;  4EUV A;  5AQA A;  2QZ6 A;  2AVX A;  2KOI A;  4HEF A;  1W8Y A;  3G31 A;  1CJF A;  4R6L A;  4GDN A;  1GHI A;  5A90 A;  1LHY A;  1GSV A;  5CGX A;  4GS9 B;  5TR7 A;  3BFG A;  3LR3 A;  2V8C A;  5KSC A;  4LCM A;  3CPT B;  4EXO A;  1TS7 A;  5CGS A;  3UME A;  4H6J B;  2PBY A;  1DRM A;  1JTD A;  4Z1W A;  5MC7 A;  1WYB A;  5L10 A;  1W79 A;  3JYI A;  3O3V A;  4R4R A;  4BJP A;  3HL9 A;  4KG2 A;  5DVA A;  1DP9 A;  1IKI A;  1XA7 A;  5KZH A;  4DMZ A;  2DRW A;  2PHY A;  5CER A;  1ONG A;  1VM1 A;  1Y54 A;  1CK3 A;  2NUT C;  2V1A A;  1VQQ A;  2R78 A;  3E4P A;  4BWI A;  3KYQ A;  1PFL A;  1Q2Q A;  4HQA A;  1KGE A;  3WRZ A;  1VEU A;  1S66 L;  3MQ0 A;  3T4O A;  1PWG A;  1OJ5 A;  1SDN A;  5IU1 A;  1XFQ A;  2VKS A;  2I72 A;  3CWF A;  1C3B A;  3B47 A;  4JXS A;  4GS9 A;  3MFD A;  2H0T A;  3IXH A;  3E2L A;  3FWL A;  3FV7 A;  3PR6 A;  3GR2 A;  3BFE A;  3GMW A;  1GA9 A;  4DE0 A;  4PKY G;  4WL9 A;  2K7S A;  5HD5 A;  2M1C A;  1T1C A;  2M7V A;  4H6J A;  3O5Y A;  5C5K A;  1K57 C;  5FEF A;  4QJG A;  4BLM A;  2W0N A;  5EUA A;  4KEN B;  3OBF A;  3UN7 A;  4ZTK A;  4Q0I A;  4CLC B;  2W3F A;  4ME4 A;  1OT6 A;  3IHB A;  2PRF A;  4QWO A;  3IX4 A;  4IVK A;  4EQI A;  4EW7 A;  4WMC A;  1XJ6 A;  4LEN A;  1BTL A;  2YKF A;  1WA9 A;  4OQH A;  5FAT A;  2WGV A;  4KG6 A;  3KYZ A;  2V0U A;  3BEB A;  2WYX A;  3IX3 A;  3WS5 A;  1UGU A;  5E2E A;  4NEE D;  2O9C A;  4WMC D;  4ETX A;  5DF8 A;  1XGJ A;  3BQ8 A;  3H7W A;  5HL1 A;  3N8S A;  1TEM A;  1Q2P A;  5A92 A;  1M6K A;  3MXQ A;  1ODV A;  2HGV A;  2ZOH A;  1BZA A;  4LV1 A;  2XK1 A;  5GHZ A;  1S67 L;  1K4F A;  3V67 A;  3CMZ A;  1DJB A;  4PM5 A;  5GHY A;  3ZG5 A;  4R0Q A;  3ZG7 B;  3G32 A;  3F1P A;  3HVF A;  1FIK A;  1NLZ A;  4CLC A;  4N1X A;  2B02 A;  1YM1 A;  1X0O A;  3TG9 A;  3PBS A;  1ZHH B;  5GL9 A;  4HIA A;  2WK0 A;  2Y2O A;  1FCM A;  2YKH A;  2PU2 A;  3IF6 B;  4QY6 A;  3LIA A;  3Q7V A;  1YSQ A;  2BLS A;  2P7J A;  4GD6 A;  4ZRR A;  1PWD A;  3UMD A;  1UWP X;  1LT0 A;  3JVU A;  4JPM A;  1XX2 A;  2VV8 A;  1J9M A;  1PNE A;  3MQQ A;  2WZZ A;  3OOV A;  1FSY A;  3A3J A;  3LID A;  1YLP A;  2HP9 A;  4KZ8 A;  4LLO B;  2XD5 A;  2XSS A;  2PYR A;  4Q0H A;  4OOL A;  4P6Z S;  2P74 A;  2HP5 A;  3FKW A;  3O88 A;  2D01 A;  3SS3 A;  3V39 A;  1IFQ A;  2WKR A;  4E04 A;  5F1G A;  1DJC A;  4YOF A;  3B33 A;  2EX2 A;  3N4I A;  4WUJ A;  1BYW A;  4R3J A;  1SHV A;  1HZO A;  3A0R A;  3HLF A;  2LB9 A;  2Y2H A;  2HDS A;  4QB8 A; 
#chains in the Genus database with same CATH homology
 4D60 A;  2V8F A;  1YPR A;  1Z09 A;  3U4L P;  3T12 B;  4X1L A;  2BTF P;  2JKG A;  1PFL A;  1FIK A;  1SZV A;  3T1X A;  5EM0 A;  1K0K A;  1D1J A;  1VEU A;  2E8J A;  3CHW P;  3T1S A;  2PAV P;  5FDS A;  2ZL1 B;  1G5U A;  1VET A;  3D9Y A;  5EV0 A;  3KYE A;  5FEG A;  1VEU B;  1Y4O A;  1PRQ A;  4X25 A;  3T1Q B;  4FTX A;  3MS6 A;  5EM1 A;  1VET B;  2B95 A;  2HZ5 A;  3L7H A;  3UB5 P;  5FEF A;  1F2K A;  1FIL A;  1PNE A;  1CF0 A;  3T1R A;  2PBD P;  3DAV A;  4X1M A;  3MSH A;  1AWI A;  2VK3 A;  2PRF A;  4QWO A;  1SKO A;  1CJF A;  3CPT A;  5EVE A;  3LEQ A;  1ACF A;  4FUW A;  2V8C A;  1HLU P;  3LGO A;  1SKO B;  4ESP A;  3CPT B;  1J3W A;  3NEC A;  1A0K A;  3L9K A;  1CQA A;  2ZL1 A;  3NUL A;  2ACG A;  2JKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...