2ACGA

Acanthamoeba castellanii profilin ii
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
SWQTYVDTNLVGTGAVTQAAIIGHDGNTWATSAGFAVSPANGAALANAFKDATAIRSNGFELAGTRYVTIRADDRSVYGKKGSAGVITVKTSKAILIGVYNEKIQPGTAANVVEKLADYLIGQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of isoforms of the actin-binding protein profilin that differ in their affinity for phosphatidylinositol phosphates.
pubmed doi rcsb
source organism Acanthamoeba castellanii
molecule tags Contractile protein
molecule keywords PROFILIN II
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1994-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2acgA00
1K0KA 2JKGA 1CQAA 1SKOA 2B95A 4X25A 4FUWA 2HZ5A 5FDSA 2VK3A 4ESPA 2E8JA 3MS6A 1A0KA 1G5UA 1PRQA 2JKFA 1VETA 4X1LA 4X1MA 4FTXA 2PRFA 1AWIA 2ZL1B 1Y4OA 3L9KA 5EV0A 3U4LP 3UB5P 2ZL1A 5FEFA 1ACFA 1HLUP 5EM0A 3T1XA 3KYEA 3LGOA 5EVEA 5EM1A 2PBDP 1CF0A 3DAVA 1D1JA 1FIKA 2ACGA 1VEUA 3CPTA 3NECA 1PNEA 1YPRA 4D60A 1VEUB 1SKOB 1CJFA 1F2KA 3LEQA 1FILA 3D9YA 1SZVA 1J3WA 2V8FA 3L7HA 3MSHA 3T1SA 1Z09A 2BTFP 2V8CA 3T1QB 3CHWP 1PFLA 4QWOA 3CPTB 1VETB 2PAVP 3T12B 3NULA 3T1RA 5FEGA
chains in the Genus database with same CATH superfamily
3MXQA 2GJ3A 2W27A 2RL3A 3KSGA 2R9WA 4IUHA 1ZHHB 3IF6C 4ARZA 5FAQA 1MBLA 5DKKA 3LEZA 1FILA 2ZLYA 4HOIA 3V5MA 5A91A 4OP5A 3A3EA 1DP8A 1S6RA 5GLCA 1KE4A 3LUQA 5EFWA 5DF9A 1H3QA 3U4LP 3B3XA 3DTKA 4MBHA 3H7WA 5HL6A 4R70A 4L9EA 3E4QA 2KX6A 1IFQA 3WRZA 4BENA 4JF4A 1NYYA 1PFLA 3JVUA 2GDNA 3FZCA 2HP5A 5CGSA 1M40A 4GKUA 3IBRA 1YQSA 4PM6A 3MZDA 2OLVA 2ZL1A 4QD4A 3UY6A 4EBNA 3IQAA 1S4SA 4R3JA 5I94A 4F3LA 4FD8A 1XFQA 3G2ZA 4PM8A 4Y5FA 4MMNA 2XK1A 3EGXC 1ESUA 5GHZA 5EUAA 4Z9QA 2J7VA 3WS0A 2EX6A 3EQVA 1BLPA 2WGWB 2ACGA 5DTSA 4KQQA 1K4EA 3B47A 3OZHA 4OPQA 2NUTC 4GHIB 1TS8A 2WKEA 4Q8IA 4MN5A 4WZ5C 4P87A 3JPUA 5DFYA 2XROA 5A93A 3ZHHA 3C30A 3BEBA 5I5LA 2PR6A 2VJWA 5EVLA 4X53A 3LR4A 4S2PA 1IEMA 4IVIA 4YFMA 1BULA 5GLAA 3RFBA 2ZMFA 5FQMA 1I5QA 3B42A 4S2KA 2KLIA 1IKGA 3T1XA 3E2LA 1XA1A 5FI6A 2Y2PA 5A8BA 3UMEA 1WYBA 5EVIB 3D72A 3OBFA 3MQOA 4GLQA 1YM1A 3QNCA 4X1MA 3HLWA 1N4OA 2Y2MA 3DWZA 1CK3A 2PBDP 3EOIA 1PWGA 5KIZA 4KG5A 1ERQA 2QJ5A 4KG2A 3ZG8B 3UB7A 3IF6A 4QPRA 4DJ2A 4P6BA 1NXYA 2VA0A 1K6RA 4MN7A 4GJ4A 4Q0IA 3N4IA 5F82A 4OOLA 4ZAMA 3S7QA 2Q0OA 5FL3A 4DRTA 3HUOA 4CLCA 1G6OA 1ES2A 3UE6A 1T18A 3G32A 3DAVA 4K08A 3SH9A 5FQKA 1VEUB 4E6WA 2XQZA 5E43A 3C2WA 4HY8A 2Y2QA 3C7UA 2H0YA 5KSHA 3HBRA 1I2SA 4DXBA 1XGJA 2V9AA 3RXWA 4HIAA 3NDGA 2HF6A 4II7A 5HAPA 4PKYG 2FFFB 1ONHA 4EERA 3UDFA 3S1YA 1NRFA 2XA7M 3MSHA 4N1XA 3WS4A 2Y2KA 2J3TD 3MQQA 2AVXA 1V9YA 5FA7A 2P9VA 1KGEA 2V1ZA 5L10A 3BFDA 1MKIA 2XEPA 3KSIA 5IHVA 2K7SA 5FDHA 4BD0A 3UE1A 4BLMA 4H6JA 1KOUA 3F1PB 3VP3A 1CI8A 2W3HA 3BJNA 1S1YA 3IH8A 3BW6A 3EEAA 4JXWA 3GECA 5L09A 3DWKA 2ZM2A 1PNEA 1YSQA 4HH2A 5GHXA 3UNWA 1OJGA 2VGJA 4MBKA 5HPIA 3A3JA 2EXAA 4R6LA 2RCXA 1JWPA 5IU1A 3RXXA 4ESPA 3G34A 1K6SA 3VFFA 4HNBA 4DJ3A 3QP5A 3S7OA 3CPTB 3WWXA 1SKOA 4DKIA 4M3KA 1XJ6A 4OPZA 3OPLA 3M2KA 3PBNA 3M6BA 1T1AA 1KE3A 4NK3A 4ETZA 5F69A 5C5KA 4FH4A 4GW9A 2B18A 3M6HA 4HQAA 2VV8A 3IWQA 5L8MA 1J3WA 5HD5A 5E2HA 4UHUA 3T4OA 4N9KA 2OWJA 3OC2A 3QHYA 3T4SA 2ZQAA 5A92A 1WA9A 4ETXA 2IWCA 1YLJA 4BL2A 3UN7A 2HJ9C 1YAXA 2JBFA 3TRCA 4BBVA 2D02A 3L7HA 5F1FA 2G2UA 2BTFP 1YLWA 4YWZA 1BYWA 1K54A 4UQIM 5D3OA 2P74A 5AQBA 1LI9A 1JWZA 4BQMA 3NOUC 1FCOA 4F94A 3G31A 1E4DA 1OTBA 4I39A 3PAGA 1OTIA 5F6AA 3T4JA 1HVBA 1TF1A 3A0RA 2XSSA 3GSGA 1H0MA 3CJMA 1K56D 4S2JA 1E25A 1PW1A 1IOUA 5FI7A 4S2MA 1TDGA 2VKSA 1IYSA 3ITAA 4MDZA 1NLZA 2JE5A 4HP4A 2KDKA 5CECA 4X69A 3D3OA 2VV6A 1RGYA 1UGUA 1IKIA 2PU4A 5AVFA 3O87A 5AVEA 3BLMA 4CLCB 2QJ7A 3L9KA 5HWWA 5DJTA 1DY6A 3MJQA 1LHYA 4KG6A 1VEUA 3CPTA 4BD1A 4EU0A 3V3RA 5CEDA 1OPXA 4DE3A 2B95A 2OSUA 4Y2FA 1YLYA 2A24A 4H8RA 1T1CA 3TJZC 1YMSA 4Y0UA 3VOLA 2HDQA 3IWIA 3IHAA 2H5SA 1XX2A 4LV0A 2V2FF 2BG1A 4LENA 2XRNA 4LLOB 4WF0A 1DRMA 1X0OA 4KQOA 4LPZA 4GOGA 5G4ZA 4UEYA 4R3BA 3IH9A 3PHYA 1ONGA 1DJCA 1YKDA 5CGWA 1BLSA 2WGWA 1OTDA 2WK0A 3LIDA 4UQIS 2Y59A 1GCEA 3D4FA 4CLCC 5F83A 2PDRA 1H8MA 4FUWA 4HP9A 3IF5A 4AFIA 5CGXA 2JCHA 5DVAA 3UB5P 4IBXA 3RH8B 1PWDA 3E2KA 2H28A 2WUQA 3K3DA 3NOTC 1GHMA 4JBFA 2QYBA 4JLFA 2GNXA 4EQIA 1K0KA 3FKWA 1G28A 2YKFA 4B9OA 4N9LA 3JVVA 2JKFA 3EGDC 3R7WB 3HL9A 4YNRA 3LICA 3KSFA 1PZPA 5HWVA 1SHVA 1H8ZA 3G6OA 4R1GA 2ZJ9A 3T4LA 2XFSA 1XXMA 4OVDA 2VK3A 4M4XA 1VETA 5EE8A 2Y2LA 2R9XA 4E3OA 4U0TA 2A2LA 1FSYA 4ZRRA 5HD3A 1PYYA 2W1TA 2HP6A 4WMCA 1W7FA 5AQAA 3NC8A 5KMWA 5M19A 3GDIA 5DF7A 1W63Q 2JKTM 2BLSA 1N9NA 1W5DA 3E4PA 4L0LA 2WGIA 2WAEA 1MKMA 5KZHA 5TJJA 4KZ8A 1LL9A 2EWWA 4NXFA 3EWKA 3Q82A 5DTKA 1L3LA 3G4PA 1D7EA 5F1GA 4DN0A 5HAIA 2Y4AA 3DTMA 1SKOB 2FH5A 3PBOA 4DXCA 3OOVA 2K31A 5CHMA 1K56A 3KYZA 1W8QA 5LBRA 3EEHA 1AWIA 1O7EA 2PD7A 3VSKA 2WKHA 5HDDA 4Z1WA 2ZQ7A 2Y2JA 5HSQA 1ZC2A 2EFXA 3V3SA 1K25A 3P98A 4CLCD 5HDSA 4UA7A 5CERA 2W0NA 4DE0A 2XF3A 5EPHA 2B02A 3Q1FA 1NZOA 3VE4A 2Y2HA 4OQGA 1PI4A 1TD5A 1JVJA 1K55A 3O88A 3F1OB 3F1PA 3R7WA 1OT6A 2P08A 4R23A 3T4QA 1GHIA 3H9WA 4FSFA 4KQDA 2ZOIA 4UAAA 2B5RA 4R3AA 2VGLS 5BOHA 4KZ9A 3UPOA 3NHQA 5EOEA 4OOYA 3ZGAB 2XA7S 3ZG9B 2V8FA 4K0XA 4LRYC 3RJUA 5FEGA 1GSVA 5FQJA 2V1BA 1JNUA 3IXDA 3PBQA 1TVFA 4EETB 3HUNA 5JYPA 4RX3A 1FIKA 3BM6A 1KVMA 3NBLA 3PYPA 3T4TA 3ZVTA 3C4OA 2OV5A 5FQQA 2W3EA 4PKYA 1RGZA 5IT5A 4GZBA 4HHDA 4XUZA 3ULFA 5HARA 4FH2A 2Y55A 4U0XA 3CAXA 1ACFA 1M6KA 2PR5A 4XT2A 2OAQ1 1F2KA 3Q7VA 2IA2A 3F1NA 2ZC6B 3SOIA 3SZTA 4K91A 2R78A 2EX8A 2VV7A 5EVIC 3G35A 1W63M 1LI0A 4LV2A 1MC0A 4OQ0A 4P6ZM 1SCWA 4Q0JA 3K2NA 3VSLA 4HEFA 5CRFA 1FR1A 2HP9A 2V8CA 3DBAA 4DDSA 3IHBA 1W79A 3BY8A 2WZXA 3C8CA 4KQRA 3RTYA 2XGNA 4HJ4A 1A0KA 3WS5A 3OCLA 1S4RA 4Y7PA 2L0WA 4DF6A 4D2OA 1HLUP 5J8XA 5EVEA 2HV1A 1XGIA 1F9IA 4P6ZS 5DFXA 3CMZA 3CG5A 4HH3A 1XJ3A 1PZOA 4L9FA 3BFCA 4U3TA 3LGOA 4NXEA 2ZBBA 4DE2A 2H0TA 1P9RA 4O0PA 4EXOA 3ZFZA 2WKQA 3SS4A 5G18A 3AGEA 2JKGA 3IWOA 2G2WA 4X25A 4WUJA 2EFUA 5F68A 4JXGA 3AGFA 2W3DA 2JKTI 3MMHA 2CC1A 3H82A 1G68A 3HLEA 3MZEA 4CJNA 3B33A 3PR6A 1OMEA 5CTNA 2A49A 1EI5A 3T1SA 4E04A 2LB5A 4Y3IA 1VETB 4YOFA 1KDSA 2IWBA 3F1NB 1FCMA 4Y0OA 3S4XA 3UE0A 2P04A 1LL8A 1L0FA 4IVKA 2JHEA 2V0UA 1OT9A 4IEDA 5HW3A 1O07A 1PIOA 1H8YA 4KZ7A 3GVBA 5FAPA 1BUEA 1N9LA 1XJ4A 5FSRA 1E3UA 3ICYA 1T19A 3NY4A 3IX3A 3QP2A 4BJPA 4JGRA 4XXRA 4HESA 1BZAA 5F5YA 1Z6FA 2IWDA 1TEMA 4LGWA 1HD8A 3QP1A 1ZKJA 1VM1A 2HJEA 3QNBA 1Y54A 4JPMA 1YSPA 2C5WB 4FCFA 5E2FA 3SW1A 4BBTA 1S1ZA 4X1LA 2XD5A 2WAFA 2INWA 1ZTUA 4GS9A 3IBJA 1IELA 3BQAA 3CI6A 1D06A 2CMNA 3VP0A 4MNRA 4JF6A 2WYXA 5A90A 5HX9A 4PPRA 2W3GA 4Y13A 4OPYA 4EEPA 4OQHA 1PRQA 2VX8A 4DE1A 1I2WA 1CI9A 1FR6A 2M7UA 3GRJA 3OPPA 5EM0A 3F1OA 2JN7A 2OLUA 4GDNA 4WYYA 5L2FA 1K57A 4E3MA 4OKPA 4WZ5A 2L4RA 2Y2NA 1P9WA 2PAVP 3NDEA 3PBTA 5FDSA 1IYPA 5FAOA 4ZJ3A 3PAEA 3OCNA 4PMAA 3HJKA 4IHQA 4GB7A 4KZ5A 2ZMVA 4DMZA 3VV4A 2EX9A 2J80A 1Z09A 4WL9A 2KOIA 4S2NA 4KZBA 3MFDA 1FSWA 3PXPA 3W8KA 3N7WA 3LY3A 1UWPX 3IXGA 4GCZA 1L0GA 1MXOA 3O3VA 2J9PA 5HPFA 3TW8A 4JKTA 1GA9A 2ZC4B 4LRXC 4EBPA 1XJ2A 3ZDJA 4KUOA 2VGLM 3ITBA 1K54C 5TBMA 2X71A 4Y15A 5HL1A 1GSXA 3BFGA 5CHUA 3BY9A 3BRMA 2HDUA 2NUPC 5HDCA 1ZG4A 3CUEA 2EXBA 3T50A 4C75A 3CWFA 4QY6A 1G6AA 2QWSA 1YPRA 3JYIA 3VE3A 4GN2A 1YLZA 3LIFA 3W4OA 3VFHA 4R4RA 2X02A 2WKRA 3T4KA 1LSXA 2O99A 4E6XA 3MS6A 1DJBA 3V50A 1ESIA 1KE0A 1Y4OA 1CEFA 4KZ4A 2PHYA 3BFEA 3PTEA 2QMIA 3LO7A 4OH0A 1EROA 4EBLA 1JTGA 3ZCZA 3A3FA 1PW8A 3T1QB 2M1CA 2XDMA 3HLCA 4OOMA 1XP4A 5AJGA 4I3IA 4QB8A 1YLTA 1G5UA 1KVLA 1SDEA 2PRFA 3TG9A 3HVFA 5L07A 1F5MA 3GMWA 1HTZA 2X01A 3OPHA 4HJ3A 2V0WA 4PM9A 5CX7A 5J4EA 5KSCA 5MC7A 2G7UA 4RYEA 3MZFA 5E2GA 4B4ZA 5CEBA 3CZDA 4B88A 4UA9A 3UDIA 4CPKA 1ALQA 4QHCA 1ES3A 1WE4A 3WS1A 1EWZA 3MXRA 4RQ9A 4O01A 3C5AA 4EESA 1DP9A 1YLPA 2Y2IA 3IT9A 5J3WA 3IXBA 4WZ4A 2Z6CA 1QMFA 3TOIA 2ZQCA 4B93A 5CTMA 2FZ0A 1TS6A 3MKEA 4HBUA 3FYZA 5G4YA 4O8GA 4E3IA 2D01A 4OLDA 3S7NA 2O9CA 1KDWA 4B4XA 2VGKA 1E3UD 4OONA 4MCWA 2WGVA 5CHJA 1J9MA 3SS5A 2DMWA 1ERMA 3HCYA 2L1MA 3FC7A 1XPBA 2GX5A 4I3AA 1NRJA 5U47A 3NOPC 1ES4A 4BL3A 3PBRA 3GTCA 2P7JA 1STZA 1XFNA 3CLOA 3DTIA 1KGGA 1P97A 4FOFA 3Q81A 3LR5A 2W1RA 1CJFA 4ME4A 5AQ9A 2OOLA 4OQIA 4JF5A 3FG8A 5FQIA 1Q2PA 3HLGA 2W3FA 4NXBA 3NULA 3NI9A 2VLGA 4X56A 5FASA 5EECA 5EOOA 3IS2A 3KO6A 3H82B 2ZD8A 3LFVA 4E3LA 3N6IA 3P7NA 4GDBA 4IJGA 2ZM8A 3FPWA 5EVIA 1ODVA 2V20A 3GR2A 2O9BA 1OTEA 1MWSA 4I3JA 4LV1A 3M2JA 1L0EA 1MY8A 1IYOA 4R4SA 1V9ZA 2WZZA 4I38A 3G30A 2FFYA 3R4KA 3VMAA 4EV4A 2WADA 3LIBA 2EX2A 3ISGA 3HREA 3BQ8A 4CLCE 5IS1A 4JGQA 4NG2A 2QHKA 3UPPA 2HZ5A 5TGFA 4OP8A 5DKLA 1L2SA 5FEFA 5M18A 3CUEC 4X6TA 2I9VA 3SS3A 1HZOA 4ZBEA 4XT2B 2VZWA 3W4QA 3BECA 1S66L 2WKIA 1BT5A 3MKFA 2E8JA 2JKRM 3LIAA 4QU3A 3HUMA 3TSGA 5TBMB 4DDYA 5TR7A 3QP4A 1MWUA 1D1JA 1S0WA 3I7JA 4WM9A 1WYCA 4QWOA 1NZUA 3LR0A 1K55C 3A0SA 3OLOA 4BMWA 4GS9B 3ZG5A 1NY0A 2ZC3B 2K2NA 2VEAA 1VQQA 3P09A 4KUKA 4HJ6A 5FQ9A 5FATA 4E3NA 2E8IA 3CHWP 4Q0HA 4KZAA 2HPBA 3ZNYA 4LCMA 3KX0X 4N92A 1K57C 4PAUA 3OPRA 2HDSA 4KZ3A 1MWRA 4ARZB 5EV0A 5TFQA 3E0YA 3LY4A 4O7DA 3WRTA 5EM1A 1W8YA 3VP1A 4P0MA 1GSWA 4NXGA 4E3JA 4WEJA 2XLNA 2ZOHA 2Q9MA 2O0YA 3DW0A 4OLGA 2QPNA 2Z6DA 3ZG7B 2GZAA 4GD8A 5GL9A 4PM5A 1BTLA 5HWTA 4E3KA 3FKVA 4GD6A 1DP6A 3G2YA 3MBZA 3BFFA 4KENB 1BLHA 3C38A 2XH9A 4JGPA 4ZDXA 1N9BA 1LL5A 3UB8A 2O9AA 3W2ZA 2UV0E 4MEZA 1UWNX 2ZL1B 4WBGA 2I72A 1SKFA 1BSGA 2Z2MB 5HFOA 3UE3A 2OAP1 4K0WA 4R38A 3C4PA 5K5BA 3P01A 2ZQ8A 4WLAA 3WS2A 2JKRI 3U2AA 4MBFA 4LFUA 4Y0TA 2P9VB 3FWLA 3VOYA 4NEED 4XUXA 1NWZA 3ZQ5A 3IXHA 1EW0A 5CXWA 3N8LA 3Q7ZA 1FCNA 3TE8A 3HLBA 4QY5A 3ZVWA 4MLLA 5HZHA 4CQHA 4WELA 1PWCA 1T1BA 2J3WA 5M1AA 1QMEA 2Q9NA 5EVID 4RX2A 2ZMAA 3H7WB 2Y2OA 4X68A 1U60A 3MXSA 3S7PA 3T12B 1CQAA 3VP2A 4JXVA 3DTEA 2W1TB 3S22A 2PD8A 4QJGA 1RCJA 1H5XA 4JGOA 4NKPA 4R0QA 3VP4A 3UDXA 3O86A 1NYMA 3MR0A 2ZC5B 1IYQA 2PU2A 3BWLA 4RA7A 5JYOA 3GQZA 4EUVA 4PM7A 3MQ0A 3UO9A 4WEKA 3W4PA 1ES5A 4IUKA 4I5SA 3V67A 4L9GA 2Y2GA 1F98A 1RP5A 4MN6A 3UB9A 3FV7A 1TDLA 1FOFA 3D9YA 1OJ5A 3V39A 4C3QA 2A24B 2XFTA 4BWIA 2C6WB 1CEGA 2QZ6A 4X55A 1VHMA 4GHIA 2ZQ9A 4WN5A 3HLFA 3KYQA 1MWTA 4IBRA 3MFXA 1S67L 3EQUA 3NECA 4N1HA 2WKPA 5J7EA 4ZJ1A 3IX8A 3LIEA 1K4FA 4WMCD 2HGVA 4GNUA 4UA6A 1Y28A 3BYDA 4KZ6A 3LR3A 3E98A 1FQGA 4S2IA 3C7VA 2MJ6A 4P85A 1NJ4A 2XD1A 3VOZA 3LCEA 3Q07A 1JWVA 3KSHA 2Y79A 4OPRA 3N8SA 4S2OA 1AXBA 2UWXA 4C6YA 5AQ7A 3NJAA 3NCKA 5E2EA 2Y91A 3LI8A 3NIAA 3ZNTA 5GLBA 4JXSA 2J8YA 1LLBA 1MPLA 3GV9A 1YMXA 4G3VA 4ZJ2A 4LV3A 1KGFA 1LSVA 3A0VA 4EUZA 4LRZE 4ZTKA 5GLDA 1N9OA 2XR0A 1GHPA 4HBTA 5DTTA 1OTAA 3HLDA 3IS2B 3AGDA 2EWVA 3E4OA 1NLYA 1TS7A 2PBYA 3QP8A 4HI4A 2QKPA 3LEQA 4S2NC 3PBSA 2EA9A 4LCLA 1Q2QA 2ZC7A 3ZG0A 2H10A 3A3IA 4G3KA 4EW7A 4BBUA 2DRWA 4ID4A 4FTXA 3Q7VB 2Y8HA 1MZUA 1TS0A 1LT0A 2PYPA 3IX4A 1L0DA 2V1AA 1ZG6A 2JC7A 2J3TC 4A5RA 2YKHA 1SZVA 1PI5A 2Z2LB 4RVAA 5HAQA 4F3LB 3IF6B 2M7VA 3UPNA 2DNSA 1JTDA 5DJUA 3K3CA 1XKZA 1SDNA 1LSWA 4G3WA 5DF8A 3MF0A 3KYEA 1CF0A 4S2LA 4D60A 2PYRA 2ZQDA 1XA7A 3FPVA 1GA0A 2ZM0A 4EQ1A 3HJIA 1DJAA 4EWFA 4YINA 5FI2A 4EEUA 3UMDA 3CITA 4H6JB 2J9OA 3BLSA 4NETA 3A3DA 1K38A 2PT7A 2A3UA 4Y17A 3N8RA 3LYXA 1VB6A 3ZYTA 3UB6A 2BASA 2OWHA 3LI9A 2HDRA 1YT4A 3SH8A 4PHTA 3QP6A 1BLCA 1P0ZA 5GHYA 3O5YA 2LB9A 3SH7A 2DCFA 3T1RA 1C3BA
chains in the Genus database with same CATH topology
1K0KA 2JKGA 1CQAA 1SKOA 2B95A 4X25A 4FUWA 2HZ5A 5FDSA 2VK3A 4ESPA 2E8JA 3MS6A 1A0KA 1G5UA 1PRQA 2JKFA 1VETA 4X1LA 4X1MA 4FTXA 2PRFA 1AWIA 2ZL1B 1Y4OA 3L9KA 5EV0A 3U4LP 3UB5P 2ZL1A 5FEFA 1ACFA 1HLUP 5EM0A 3T1XA 3KYEA 3LGOA 5EVEA 5EM1A 2PBDP 1CF0A 3DAVA 1D1JA 1FIKA 2ACGA 1VEUA 3CPTA 3NECA 1PNEA 1YPRA 4D60A 1VEUB 1SKOB 1CJFA 1F2KA 3LEQA 1FILA 3D9YA 1SZVA 1J3WA 2V8FA 3L7HA 3MSHA 3T1SA 1Z09A 2BTFP 2V8CA 3T1QB 3CHWP 1PFLA 4QWOA 3CPTB 1VETB 2PAVP 3T12B 3NULA 3T1RA 5FEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0K A;  2JKG A;  1CQA A;  1SKO A;  2B95 A;  4X25 A;  4FUW A;  2HZ5 A;  5FDS A;  2VK3 A;  4ESP A;  2E8J A;  3MS6 A;  1A0K A;  1G5U A;  1PRQ A;  2JKF A;  1VET A;  4X1L A;  4X1M A;  4FTX A;  2PRF A;  1AWI A;  2ZL1 B;  1Y4O A;  3L9K A;  5EV0 A;  3U4L P;  3UB5 P;  2ZL1 A;  5FEF A;  1ACF A;  1HLU P;  5EM0 A;  3T1X A;  3KYE A;  3LGO A;  5EVE A;  5EM1 A;  2PBD P;  1CF0 A;  3DAV A;  1D1J A;  1FIK A;  2ACG A;  1VEU A;  3CPT A;  3NEC A;  1PNE A;  1YPR A;  4D60 A;  1VEU B;  1SKO B;  1CJF A;  1F2K A;  3LEQ A;  1FIL A;  3D9Y A;  1SZV A;  1J3W A;  2V8F A;  3L7H A;  3MSH A;  3T1S A;  1Z09 A;  2BTF P;  2V8C A;  3T1Q B;  3CHW P;  1PFL A;  4QWO A;  3CPT B;  1VET B;  2PAV P;  3T12 B;  3NUL A;  3T1R A;  5FEG A; 
#chains in the Genus database with same CATH topology
 3MXQ A;  2GJ3 A;  2W27 A;  2RL3 A;  3KSG A;  2R9W A;  4IUH A;  1ZHH B;  3IF6 C;  4ARZ A;  5FAQ A;  1MBL A;  5DKK A;  3LEZ A;  1FIL A;  2ZLY A;  4HOI A;  3V5M A;  5A91 A;  4OP5 A;  3A3E A;  1DP8 A;  1S6R A;  5GLC A;  1KE4 A;  3LUQ A;  5EFW A;  5DF9 A;  1H3Q A;  3U4L P;  3B3X A;  3DTK A;  4MBH A;  3H7W A;  5HL6 A;  4R70 A;  4L9E A;  3E4Q A;  2KX6 A;  1IFQ A;  3WRZ A;  4BEN A;  4JF4 A;  1NYY A;  1PFL A;  3JVU A;  2GDN A;  3FZC A;  2HP5 A;  5CGS A;  1M40 A;  4GKU A;  3IBR A;  1YQS A;  4PM6 A;  3MZD A;  2OLV A;  2ZL1 A;  4QD4 A;  3UY6 A;  4EBN A;  3IQA A;  1S4S A;  4R3J A;  5I94 A;  4F3L A;  4FD8 A;  1XFQ A;  3G2Z A;  4PM8 A;  4Y5F A;  4MMN A;  2XK1 A;  3EGX C;  1ESU A;  5GHZ A;  5EUA A;  4Z9Q A;  2J7V A;  3WS0 A;  2EX6 A;  3EQV A;  1BLP A;  2WGW B;  2ACG A;  5DTS A;  4KQQ A;  1K4E A;  3B47 A;  3OZH A;  4OPQ A;  2NUT C;  4GHI B;  1TS8 A;  2WKE A;  4Q8I A;  4MN5 A;  4WZ5 C;  4P87 A;  3JPU A;  5DFY A;  2XRO A;  5A93 A;  3ZHH A;  3C30 A;  3BEB A;  5I5L A;  2PR6 A;  2VJW A;  5EVL A;  4X53 A;  3LR4 A;  4S2P A;  1IEM A;  4IVI A;  4YFM A;  1BUL A;  5GLA A;  3RFB A;  2ZMF A;  5FQM A;  1I5Q A;  3B42 A;  4S2K A;  2KLI A;  1IKG A;  3T1X A;  3E2L A;  1XA1 A;  5FI6 A;  2Y2P A;  5A8B A;  3UME A;  1WYB A;  5EVI B;  3D72 A;  3OBF A;  3MQO A;  4GLQ A;  1YM1 A;  3QNC A;  4X1M A;  3HLW A;  1N4O A;  2Y2M A;  3DWZ A;  1CK3 A;  2PBD P;  3EOI A;  1PWG A;  5KIZ A;  4KG5 A;  1ERQ A;  2QJ5 A;  4KG2 A;  3ZG8 B;  3UB7 A;  3IF6 A;  4QPR A;  4DJ2 A;  4P6B A;  1NXY A;  2VA0 A;  1K6R A;  4MN7 A;  4GJ4 A;  4Q0I A;  3N4I A;  5F82 A;  4OOL A;  4ZAM A;  3S7Q A;  2Q0O A;  5FL3 A;  4DRT A;  3HUO A;  4CLC A;  1G6O A;  1ES2 A;  3UE6 A;  1T18 A;  3G32 A;  3DAV A;  4K08 A;  3SH9 A;  5FQK A;  1VEU B;  4E6W A;  2XQZ A;  5E43 A;  3C2W A;  4HY8 A;  2Y2Q A;  3C7U A;  2H0Y A;  5KSH A;  3HBR A;  1I2S A;  4DXB A;  1XGJ A;  2V9A A;  3RXW A;  4HIA A;  3NDG A;  2HF6 A;  4II7 A;  5HAP A;  4PKY G;  2FFF B;  1ONH A;  4EER A;  3UDF A;  3S1Y A;  1NRF A;  2XA7 M;  3MSH A;  4N1X A;  3WS4 A;  2Y2K A;  2J3T D;  3MQQ A;  2AVX A;  1V9Y A;  5FA7 A;  2P9V A;  1KGE A;  2V1Z A;  5L10 A;  3BFD A;  1MKI A;  2XEP A;  3KSI A;  5IHV A;  2K7S A;  5FDH A;  4BD0 A;  3UE1 A;  4BLM A;  4H6J A;  1KOU A;  3F1P B;  3VP3 A;  1CI8 A;  2W3H A;  3BJN A;  1S1Y A;  3IH8 A;  3BW6 A;  3EEA A;  4JXW A;  3GEC A;  5L09 A;  3DWK A;  2ZM2 A;  1PNE A;  1YSQ A;  4HH2 A;  5GHX A;  3UNW A;  1OJG A;  2VGJ A;  4MBK A;  5HPI A;  3A3J A;  2EXA A;  4R6L A;  2RCX A;  1JWP A;  5IU1 A;  3RXX A;  4ESP A;  3G34 A;  1K6S A;  3VFF A;  4HNB A;  4DJ3 A;  3QP5 A;  3S7O A;  3CPT B;  3WWX A;  1SKO A;  4DKI A;  4M3K A;  1XJ6 A;  4OPZ A;  3OPL A;  3M2K A;  3PBN A;  3M6B A;  1T1A A;  1KE3 A;  4NK3 A;  4ETZ A;  5F69 A;  5C5K A;  4FH4 A;  4GW9 A;  2B18 A;  3M6H A;  4HQA A;  2VV8 A;  3IWQ A;  5L8M A;  1J3W A;  5HD5 A;  5E2H A;  4UHU A;  3T4O A;  4N9K A;  2OWJ A;  3OC2 A;  3QHY A;  3T4S A;  2ZQA A;  5A92 A;  1WA9 A;  4ETX A;  2IWC A;  1YLJ A;  4BL2 A;  3UN7 A;  2HJ9 C;  1YAX A;  2JBF A;  3TRC A;  4BBV A;  2D02 A;  3L7H A;  5F1F A;  2G2U A;  2BTF P;  1YLW A;  4YWZ A;  1BYW A;  1K54 A;  4UQI M;  5D3O A;  2P74 A;  5AQB A;  1LI9 A;  1JWZ A;  4BQM A;  3NOU C;  1FCO A;  4F94 A;  3G31 A;  1E4D A;  1OTB A;  4I39 A;  3PAG A;  1OTI A;  5F6A A;  3T4J A;  1HVB A;  1TF1 A;  3A0R A;  2XSS A;  3GSG A;  1H0M A;  3CJM A;  1K56 D;  4S2J A;  1E25 A;  1PW1 A;  1IOU A;  5FI7 A;  4S2M A;  1TDG A;  2VKS A;  1IYS A;  3ITA A;  4MDZ A;  1NLZ A;  2JE5 A;  4HP4 A;  2KDK A;  5CEC A;  4X69 A;  3D3O A;  2VV6 A;  1RGY A;  1UGU A;  1IKI A;  2PU4 A;  5AVF A;  3O87 A;  5AVE A;  3BLM A;  4CLC B;  2QJ7 A;  3L9K A;  5HWW A;  5DJT A;  1DY6 A;  3MJQ A;  1LHY A;  4KG6 A;  1VEU A;  3CPT A;  4BD1 A;  4EU0 A;  3V3R A;  5CED A;  1OPX A;  4DE3 A;  2B95 A;  2OSU A;  4Y2F A;  1YLY A;  2A24 A;  4H8R A;  1T1C A;  3TJZ C;  1YMS A;  4Y0U A;  3VOL A;  2HDQ A;  3IWI A;  3IHA A;  2H5S A;  1XX2 A;  4LV0 A;  2V2F F;  2BG1 A;  4LEN A;  2XRN A;  4LLO B;  4WF0 A;  1DRM A;  1X0O A;  4KQO A;  4LPZ A;  4GOG A;  5G4Z A;  4UEY A;  4R3B A;  3IH9 A;  3PHY A;  1ONG A;  1DJC A;  1YKD A;  5CGW A;  1BLS A;  2WGW A;  1OTD A;  2WK0 A;  3LID A;  4UQI S;  2Y59 A;  1GCE A;  3D4F A;  4CLC C;  5F83 A;  2PDR A;  1H8M A;  4FUW A;  4HP9 A;  3IF5 A;  4AFI A;  5CGX A;  2JCH A;  5DVA A;  3UB5 P;  4IBX A;  3RH8 B;  1PWD A;  3E2K A;  2H28 A;  2WUQ A;  3K3D A;  3NOT C;  1GHM A;  4JBF A;  2QYB A;  4JLF A;  2GNX A;  4EQI A;  1K0K A;  3FKW A;  1G28 A;  2YKF A;  4B9O A;  4N9L A;  3JVV A;  2JKF A;  3EGD C;  3R7W B;  3HL9 A;  4YNR A;  3LIC A;  3KSF A;  1PZP A;  5HWV A;  1SHV A;  1H8Z A;  3G6O A;  4R1G A;  2ZJ9 A;  3T4L A;  2XFS A;  1XXM A;  4OVD A;  2VK3 A;  4M4X A;  1VET A;  5EE8 A;  2Y2L A;  2R9X A;  4E3O A;  4U0T A;  2A2L A;  1FSY A;  4ZRR A;  5HD3 A;  1PYY A;  2W1T A;  2HP6 A;  4WMC A;  1W7F A;  5AQA A;  3NC8 A;  5KMW A;  5M19 A;  3GDI A;  5DF7 A;  1W63 Q;  2JKT M;  2BLS A;  1N9N A;  1W5D A;  3E4P A;  4L0L A;  2WGI A;  2WAE A;  1MKM A;  5KZH A;  5TJJ A;  4KZ8 A;  1LL9 A;  2EWW A;  4NXF A;  3EWK A;  3Q82 A;  5DTK A;  1L3L A;  3G4P A;  1D7E A;  5F1G A;  4DN0 A;  5HAI A;  2Y4A A;  3DTM A;  1SKO B;  2FH5 A;  3PBO A;  4DXC A;  3OOV A;  2K31 A;  5CHM A;  1K56 A;  3KYZ A;  1W8Q A;  5LBR A;  3EEH A;  1AWI A;  1O7E A;  2PD7 A;  3VSK A;  2WKH A;  5HDD A;  4Z1W A;  2ZQ7 A;  2Y2J A;  5HSQ A;  1ZC2 A;  2EFX A;  3V3S A;  1K25 A;  3P98 A;  4CLC D;  5HDS A;  4UA7 A;  5CER A;  2W0N A;  4DE0 A;  2XF3 A;  5EPH A;  2B02 A;  3Q1F A;  1NZO A;  3VE4 A;  2Y2H A;  4OQG A;  1PI4 A;  1TD5 A;  1JVJ A;  1K55 A;  3O88 A;  3F1O B;  3F1P A;  3R7W A;  1OT6 A;  2P08 A;  4R23 A;  3T4Q A;  1GHI A;  3H9W A;  4FSF A;  4KQD A;  2ZOI A;  4UAA A;  2B5R A;  4R3A A;  2VGL S;  5BOH A;  4KZ9 A;  3UPO A;  3NHQ A;  5EOE A;  4OOY A;  3ZGA B;  2XA7 S;  3ZG9 B;  2V8F A;  4K0X A;  4LRY C;  3RJU A;  5FEG A;  1GSV A;  5FQJ A;  2V1B A;  1JNU A;  3IXD A;  3PBQ A;  1TVF A;  4EET B;  3HUN A;  5JYP A;  4RX3 A;  1FIK A;  3BM6 A;  1KVM A;  3NBL A;  3PYP A;  3T4T A;  3ZVT A;  3C4O A;  2OV5 A;  5FQQ A;  2W3E A;  4PKY A;  1RGZ A;  5IT5 A;  4GZB A;  4HHD A;  4XUZ A;  3ULF A;  5HAR A;  4FH2 A;  2Y55 A;  4U0X A;  3CAX A;  1ACF A;  1M6K A;  2PR5 A;  4XT2 A;  2OAQ 1;  1F2K A;  3Q7V A;  2IA2 A;  3F1N A;  2ZC6 B;  3SOI A;  3SZT A;  4K91 A;  2R78 A;  2EX8 A;  2VV7 A;  5EVI C;  3G35 A;  1W63 M;  1LI0 A;  4LV2 A;  1MC0 A;  4OQ0 A;  4P6Z M;  1SCW A;  4Q0J A;  3K2N A;  3VSL A;  4HEF A;  5CRF A;  1FR1 A;  2HP9 A;  2V8C A;  3DBA A;  4DDS A;  3IHB A;  1W79 A;  3BY8 A;  2WZX A;  3C8C A;  4KQR A;  3RTY A;  2XGN A;  4HJ4 A;  1A0K A;  3WS5 A;  3OCL A;  1S4R A;  4Y7P A;  2L0W A;  4DF6 A;  4D2O A;  1HLU P;  5J8X A;  5EVE A;  2HV1 A;  1XGI A;  1F9I A;  4P6Z S;  5DFX A;  3CMZ A;  3CG5 A;  4HH3 A;  1XJ3 A;  1PZO A;  4L9F A;  3BFC A;  4U3T A;  3LGO A;  4NXE A;  2ZBB A;  4DE2 A;  2H0T A;  1P9R A;  4O0P A;  4EXO A;  3ZFZ A;  2WKQ A;  3SS4 A;  5G18 A;  3AGE A;  2JKG A;  3IWO A;  2G2W A;  4X25 A;  4WUJ A;  2EFU A;  5F68 A;  4JXG A;  3AGF A;  2W3D A;  2JKT I;  3MMH A;  2CC1 A;  3H82 A;  1G68 A;  3HLE A;  3MZE A;  4CJN A;  3B33 A;  3PR6 A;  1OME A;  5CTN A;  2A49 A;  1EI5 A;  3T1S A;  4E04 A;  2LB5 A;  4Y3I A;  1VET B;  4YOF A;  1KDS A;  2IWB A;  3F1N B;  1FCM A;  4Y0O A;  3S4X A;  3UE0 A;  2P04 A;  1LL8 A;  1L0F A;  4IVK A;  2JHE A;  2V0U A;  1OT9 A;  4IED A;  5HW3 A;  1O07 A;  1PIO A;  1H8Y A;  4KZ7 A;  3GVB A;  5FAP A;  1BUE A;  1N9L A;  1XJ4 A;  5FSR A;  1E3U A;  3ICY A;  1T19 A;  3NY4 A;  3IX3 A;  3QP2 A;  4BJP A;  4JGR A;  4XXR A;  4HES A;  1BZA A;  5F5Y A;  1Z6F A;  2IWD A;  1TEM A;  4LGW A;  1HD8 A;  3QP1 A;  1ZKJ A;  1VM1 A;  2HJE A;  3QNB A;  1Y54 A;  4JPM A;  1YSP A;  2C5W B;  4FCF A;  5E2F A;  3SW1 A;  4BBT A;  1S1Z A;  4X1L A;  2XD5 A;  2WAF A;  2INW A;  1ZTU A;  4GS9 A;  3IBJ A;  1IEL A;  3BQA A;  3CI6 A;  1D06 A;  2CMN A;  3VP0 A;  4MNR A;  4JF6 A;  2WYX A;  5A90 A;  5HX9 A;  4PPR A;  2W3G A;  4Y13 A;  4OPY A;  4EEP A;  4OQH A;  1PRQ A;  2VX8 A;  4DE1 A;  1I2W A;  1CI9 A;  1FR6 A;  2M7U A;  3GRJ A;  3OPP A;  5EM0 A;  3F1O A;  2JN7 A;  2OLU A;  4GDN A;  4WYY A;  5L2F A;  1K57 A;  4E3M A;  4OKP A;  4WZ5 A;  2L4R A;  2Y2N A;  1P9W A;  2PAV P;  3NDE A;  3PBT A;  5FDS A;  1IYP A;  5FAO A;  4ZJ3 A;  3PAE A;  3OCN A;  4PMA A;  3HJK A;  4IHQ A;  4GB7 A;  4KZ5 A;  2ZMV A;  4DMZ A;  3VV4 A;  2EX9 A;  2J80 A;  1Z09 A;  4WL9 A;  2KOI A;  4S2N A;  4KZB A;  3MFD A;  1FSW A;  3PXP A;  3W8K A;  3N7W A;  3LY3 A;  1UWP X;  3IXG A;  4GCZ A;  1L0G A;  1MXO A;  3O3V A;  2J9P A;  5HPF A;  3TW8 A;  4JKT A;  1GA9 A;  2ZC4 B;  4LRX C;  4EBP A;  1XJ2 A;  3ZDJ A;  4KUO A;  2VGL M;  3ITB A;  1K54 C;  5TBM A;  2X71 A;  4Y15 A;  5HL1 A;  1GSX A;  3BFG A;  5CHU A;  3BY9 A;  3BRM A;  2HDU A;  2NUP C;  5HDC A;  1ZG4 A;  3CUE A;  2EXB A;  3T50 A;  4C75 A;  3CWF A;  4QY6 A;  1G6A A;  2QWS A;  1YPR A;  3JYI A;  3VE3 A;  4GN2 A;  1YLZ A;  3LIF A;  3W4O A;  3VFH A;  4R4R A;  2X02 A;  2WKR A;  3T4K A;  1LSX A;  2O99 A;  4E6X A;  3MS6 A;  1DJB A;  3V50 A;  1ESI A;  1KE0 A;  1Y4O A;  1CEF A;  4KZ4 A;  2PHY A;  3BFE A;  3PTE A;  2QMI A;  3LO7 A;  4OH0 A;  1ERO A;  4EBL A;  1JTG A;  3ZCZ A;  3A3F A;  1PW8 A;  3T1Q B;  2M1C A;  2XDM A;  3HLC A;  4OOM A;  1XP4 A;  5AJG A;  4I3I A;  4QB8 A;  1YLT A;  1G5U A;  1KVL A;  1SDE A;  2PRF A;  3TG9 A;  3HVF A;  5L07 A;  1F5M A;  3GMW A;  1HTZ A;  2X01 A;  3OPH A;  4HJ3 A;  2V0W A;  4PM9 A;  5CX7 A;  5J4E A;  5KSC A;  5MC7 A;  2G7U A;  4RYE A;  3MZF A;  5E2G A;  4B4Z A;  5CEB A;  3CZD A;  4B88 A;  4UA9 A;  3UDI A;  4CPK A;  1ALQ A;  4QHC A;  1ES3 A;  1WE4 A;  3WS1 A;  1EWZ A;  3MXR A;  4RQ9 A;  4O01 A;  3C5A A;  4EES A;  1DP9 A;  1YLP A;  2Y2I A;  3IT9 A;  5J3W A;  3IXB A;  4WZ4 A;  2Z6C A;  1QMF A;  3TOI A;  2ZQC A;  4B93 A;  5CTM A;  2FZ0 A;  1TS6 A;  3MKE A;  4HBU A;  3FYZ A;  5G4Y A;  4O8G A;  4E3I A;  2D01 A;  4OLD A;  3S7N A;  2O9C A;  1KDW A;  4B4X A;  2VGK A;  1E3U D;  4OON A;  4MCW A;  2WGV A;  5CHJ A;  1J9M A;  3SS5 A;  2DMW A;  1ERM A;  3HCY A;  2L1M A;  3FC7 A;  1XPB A;  2GX5 A;  4I3A A;  1NRJ A;  5U47 A;  3NOP C;  1ES4 A;  4BL3 A;  3PBR A;  3GTC A;  2P7J A;  1STZ A;  1XFN A;  3CLO A;  3DTI A;  1KGG A;  1P97 A;  4FOF A;  3Q81 A;  3LR5 A;  2W1R A;  1CJF A;  4ME4 A;  5AQ9 A;  2OOL A;  4OQI A;  4JF5 A;  3FG8 A;  5FQI A;  1Q2P A;  3HLG A;  2W3F A;  4NXB A;  3NUL A;  3NI9 A;  2VLG A;  4X56 A;  5FAS A;  5EEC A;  5EOO A;  3IS2 A;  3KO6 A;  3H82 B;  2ZD8 A;  3LFV A;  4E3L A;  3N6I A;  3P7N A;  4GDB A;  4IJG A;  2ZM8 A;  3FPW A;  5EVI A;  1ODV A;  2V20 A;  3GR2 A;  2O9B A;  1OTE A;  1MWS A;  4I3J A;  4LV1 A;  3M2J A;  1L0E A;  1MY8 A;  1IYO A;  4R4S A;  1V9Z A;  2WZZ A;  4I38 A;  3G30 A;  2FFY A;  3R4K A;  3VMA A;  4EV4 A;  2WAD A;  3LIB A;  2EX2 A;  3ISG A;  3HRE A;  3BQ8 A;  4CLC E;  5IS1 A;  4JGQ A;  4NG2 A;  2QHK A;  3UPP A;  2HZ5 A;  5TGF A;  4OP8 A;  5DKL A;  1L2S A;  5FEF A;  5M18 A;  3CUE C;  4X6T A;  2I9V A;  3SS3 A;  1HZO A;  4ZBE A;  4XT2 B;  2VZW A;  3W4Q A;  3BEC A;  1S66 L;  2WKI A;  1BT5 A;  3MKF A;  2E8J A;  2JKR M;  3LIA A;  4QU3 A;  3HUM A;  3TSG A;  5TBM B;  4DDY A;  5TR7 A;  3QP4 A;  1MWU A;  1D1J A;  1S0W A;  3I7J A;  4WM9 A;  1WYC A;  4QWO A;  1NZU A;  3LR0 A;  1K55 C;  3A0S A;  3OLO A;  4BMW A;  4GS9 B;  3ZG5 A;  1NY0 A;  2ZC3 B;  2K2N A;  2VEA A;  1VQQ A;  3P09 A;  4KUK A;  4HJ6 A;  5FQ9 A;  5FAT A;  4E3N A;  2E8I A;  3CHW P;  4Q0H A;  4KZA A;  2HPB A;  3ZNY A;  4LCM A;  3KX0 X;  4N92 A;  1K57 C;  4PAU A;  3OPR A;  2HDS A;  4KZ3 A;  1MWR A;  4ARZ B;  5EV0 A;  5TFQ A;  3E0Y A;  3LY4 A;  4O7D A;  3WRT A;  5EM1 A;  1W8Y A;  3VP1 A;  4P0M A;  1GSW A;  4NXG A;  4E3J A;  4WEJ A;  2XLN A;  2ZOH A;  2Q9M A;  2O0Y A;  3DW0 A;  4OLG A;  2QPN A;  2Z6D A;  3ZG7 B;  2GZA A;  4GD8 A;  5GL9 A;  4PM5 A;  1BTL A;  5HWT A;  4E3K A;  3FKV A;  4GD6 A;  1DP6 A;  3G2Y A;  3MBZ A;  3BFF A;  4KEN B;  1BLH A;  3C38 A;  2XH9 A;  4JGP A;  4ZDX A;  1N9B A;  1LL5 A;  3UB8 A;  2O9A A;  3W2Z A;  2UV0 E;  4MEZ A;  1UWN X;  2ZL1 B;  4WBG A;  2I72 A;  1SKF A;  1BSG A;  2Z2M B;  5HFO A;  3UE3 A;  2OAP 1;  4K0W A;  4R38 A;  3C4P A;  5K5B A;  3P01 A;  2ZQ8 A;  4WLA A;  3WS2 A;  2JKR I;  3U2A A;  4MBF A;  4LFU A;  4Y0T A;  2P9V B;  3FWL A;  3VOY A;  4NEE D;  4XUX A;  1NWZ A;  3ZQ5 A;  3IXH A;  1EW0 A;  5CXW A;  3N8L A;  3Q7Z A;  1FCN A;  3TE8 A;  3HLB A;  4QY5 A;  3ZVW A;  4MLL A;  5HZH A;  4CQH A;  4WEL A;  1PWC A;  1T1B A;  2J3W A;  5M1A A;  1QME A;  2Q9N A;  5EVI D;  4RX2 A;  2ZMA A;  3H7W B;  2Y2O A;  4X68 A;  1U60 A;  3MXS A;  3S7P A;  3T12 B;  1CQA A;  3VP2 A;  4JXV A;  3DTE A;  2W1T B;  3S22 A;  2PD8 A;  4QJG A;  1RCJ A;  1H5X A;  4JGO A;  4NKP A;  4R0Q A;  3VP4 A;  3UDX A;  3O86 A;  1NYM A;  3MR0 A;  2ZC5 B;  1IYQ A;  2PU2 A;  3BWL A;  4RA7 A;  5JYO A;  3GQZ A;  4EUV A;  4PM7 A;  3MQ0 A;  3UO9 A;  4WEK A;  3W4P A;  1ES5 A;  4IUK A;  4I5S A;  3V67 A;  4L9G A;  2Y2G A;  1F98 A;  1RP5 A;  4MN6 A;  3UB9 A;  3FV7 A;  1TDL A;  1FOF A;  3D9Y A;  1OJ5 A;  3V39 A;  4C3Q A;  2A24 B;  2XFT A;  4BWI A;  2C6W B;  1CEG A;  2QZ6 A;  4X55 A;  1VHM A;  4GHI A;  2ZQ9 A;  4WN5 A;  3HLF A;  3KYQ A;  1MWT A;  4IBR A;  3MFX A;  1S67 L;  3EQU A;  3NEC A;  4N1H A;  2WKP A;  5J7E A;  4ZJ1 A;  3IX8 A;  3LIE A;  1K4F A;  4WMC D;  2HGV A;  4GNU A;  4UA6 A;  1Y28 A;  3BYD A;  4KZ6 A;  3LR3 A;  3E98 A;  1FQG A;  4S2I A;  3C7V A;  2MJ6 A;  4P85 A;  1NJ4 A;  2XD1 A;  3VOZ A;  3LCE A;  3Q07 A;  1JWV A;  3KSH A;  2Y79 A;  4OPR A;  3N8S A;  4S2O A;  1AXB A;  2UWX A;  4C6Y A;  5AQ7 A;  3NJA A;  3NCK A;  5E2E A;  2Y91 A;  3LI8 A;  3NIA A;  3ZNT A;  5GLB A;  4JXS A;  2J8Y A;  1LLB A;  1MPL A;  3GV9 A;  1YMX A;  4G3V A;  4ZJ2 A;  4LV3 A;  1KGF A;  1LSV A;  3A0V A;  4EUZ A;  4LRZ E;  4ZTK A;  5GLD A;  1N9O A;  2XR0 A;  1GHP A;  4HBT A;  5DTT A;  1OTA A;  3HLD A;  3IS2 B;  3AGD A;  2EWV A;  3E4O A;  1NLY A;  1TS7 A;  2PBY A;  3QP8 A;  4HI4 A;  2QKP A;  3LEQ A;  4S2N C;  3PBS A;  2EA9 A;  4LCL A;  1Q2Q A;  2ZC7 A;  3ZG0 A;  2H10 A;  3A3I A;  4G3K A;  4EW7 A;  4BBU A;  2DRW A;  4ID4 A;  4FTX A;  3Q7V B;  2Y8H A;  1MZU A;  1TS0 A;  1LT0 A;  2PYP A;  3IX4 A;  1L0D A;  2V1A A;  1ZG6 A;  2JC7 A;  2J3T C;  4A5R A;  2YKH A;  1SZV A;  1PI5 A;  2Z2L B;  4RVA A;  5HAQ A;  4F3L B;  3IF6 B;  2M7V A;  3UPN A;  2DNS A;  1JTD A;  5DJU A;  3K3C A;  1XKZ A;  1SDN A;  1LSW A;  4G3W A;  5DF8 A;  3MF0 A;  3KYE A;  1CF0 A;  4S2L A;  4D60 A;  2PYR A;  2ZQD A;  1XA7 A;  3FPV A;  1GA0 A;  2ZM0 A;  4EQ1 A;  3HJI A;  1DJA A;  4EWF A;  4YIN A;  5FI2 A;  4EEU A;  3UMD A;  3CIT A;  4H6J B;  2J9O A;  3BLS A;  4NET A;  3A3D A;  1K38 A;  2PT7 A;  2A3U A;  4Y17 A;  3N8R A;  3LYX A;  1VB6 A;  3ZYT A;  3UB6 A;  2BAS A;  2OWH A;  3LI9 A;  2HDR A;  1YT4 A;  3SH8 A;  4PHT A;  3QP6 A;  1BLC A;  1P0Z A;  5GHY A;  3O5Y A;  2LB9 A;  3SH7 A;  2DCF A;  3T1R A;  1C3B A; 
#chains in the Genus database with same CATH homology
 1K0K A;  2JKG A;  1CQA A;  1SKO A;  2B95 A;  4X25 A;  4FUW A;  2HZ5 A;  5FDS A;  2VK3 A;  4ESP A;  2E8J A;  3MS6 A;  1A0K A;  1G5U A;  1PRQ A;  2JKF A;  1VET A;  4X1L A;  4X1M A;  4FTX A;  2PRF A;  1AWI A;  2ZL1 B;  1Y4O A;  3L9K A;  5EV0 A;  3U4L P;  3UB5 P;  2ZL1 A;  5FEF A;  1ACF A;  1HLU P;  5EM0 A;  3T1X A;  3KYE A;  3LGO A;  5EVE A;  5EM1 A;  2PBD P;  1CF0 A;  3DAV A;  1D1J A;  1FIK A;  2ACG A;  1VEU A;  3CPT A;  3NEC A;  1PNE A;  1YPR A;  4D60 A;  1VEU B;  1SKO B;  1CJF A;  1F2K A;  3LEQ A;  1FIL A;  3D9Y A;  1SZV A;  1J3W A;  2V8F A;  3L7H A;  3MSH A;  3T1S A;  1Z09 A;  2BTF P;  2V8C A;  3T1Q B;  3CHW P;  1PFL A;  4QWO A;  3CPT B;  1VET B;  2PAV P;  3T12 B;  3NUL A;  3T1R A;  5FEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...