2ACGA

Acanthamoeba castellanii profilin ii
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
SWQTYVDTNLVGTGAVTQAAIIGHDGNTWATSAGFAVSPANGAALANAFKDATAIRSNGFELAGTRYVTIRADDRSVYGKKGSAGVITVKTSKAILIGVYNEKIQPGTAANVVEKLADYLIGQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN II
publication title X-ray structures of isoforms of the actin-binding protein profilin that differ in their affinity for phosphatidylinositol phosphates.
pubmed doi rcsb
source organism Acanthamoeba castellanii
molecule tags Contractile protein
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1994-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2acgA00
3L7HA 2JKFA 1FILA 4X1LA 3CHWP 1VETA 3NULA 1SZVA 3LGOA 1J3WA 1Y4OA 1SKOB 1SKOA 3KYEA 1AWIA 3LEQA 4X25A 5EM1A 3NECA 3CPTB 1CF0A 3CPTA 5FDSA 3T12B 1PFLA 1YPRA 3L9KA 2E8JA 3MS6A 4D60A 2HZ5A 4ESPA 1PRQA 2B95A 2VK3A 3T1XA 1K0KA 2JKGA 1VETB 1ACFA 5FEFA 4FUWA 1G5UA 4QWOA 2PAVP 1A0KA 2V8FA 1FIKA 5FEGA 1Z09A 2V8CA 1PNEA 3U4LP 2ACGA 3T1SA 3D9YA 4X1MA 2ZL1B 1D1JA 2ZL1A 1VEUB 1VEUA 1CJFA 3MSHA 2BTFP 1HLUP 3T1QB 5EVEA 5EM0A 2PBDP 3DAVA 5EV0A 3UB5P 4FTXA 1CQAA 3T1RA 2PRFA 1F2KA
chains in the Genus database with same CATH superfamily
1IYPA 2XA7M 5JYPA 2WADA 3DBAA 1O7EA 5C5KA 1BLPA 3V67A 1TVFA 4EW7A 2O9CA 4Q0JA 5HW3A 2VV6A 3IXGA 3WS0A 2XROA 3ZHHA 3HLBA 5IU1A 2H5SA 3NECA 1K38A 4GB7A 1SKFA 4MNRA 2ZQ7A 4D60A 1ERMA 1HZOA 4ESPA 5EVIC 1DP8A 3BFCA 1JWVA 2QJ7A 5FEFA 3LR3A 3MZEA 2IWDA 3IBJA 2OOLA 4PMAA 3EQUA 4FH4A 1YLJA 4KZ5A 5FI7A 3DW0A 2HF6A 5M1AA 4QPRA 5FQKA 4UHUA 3FPVA 3O3VA 4JKTA 3D9YA 1CI9A 3OZHA 3DTIA 2VGLS 3C7VA 5CRFA 1ES4A 2ZL1A 4K0XA 2BASA 3R4KA 1YT4A 3TW8A 2WZZA 1S66L 2V9AA 3BLSA 4G3WA 1GHIA 3CAXA 3D72A 3BQAA 4JXSA 2KX6A 4DE1A 2O9AA 4FCFA 4FOFA 3V39A 1MXOA 3OCLA 2JBFA 2Y2PA 3GECA 4OONA 3H82B 4UQIS 4EEUA 5KSHA 4OP5A 3IS2B 4PPRA 5FQIA 2VGJA 3CUEA 5HD3A 5FQMA 3UB5P 3BFDA 4GJ4A 4LGWA 2W3HA 4IUHA 5M19A 5HPFA 2WK0A 3C5AA 1YQSA 2XA7S 2J8YA 3FG8A 4E6WA 2FFFB 4BENA 5L07A 4B93A 2ZC6B 5FDHA 5GHYA 1O07A 4G3VA 4PAUA 1Y4OA 4OPRA 4NXEA 3GRJA 3OLOA 3QP1A 3T4LA 1KOUA 3T12B 4GLQA 1IYSA 1Y54A 1BLCA 3IX8A 4P0MA 1W7FA 2K2NA 1W79A 2VK3A 4MLLA 5HFOA 5J8XA 3W4QA 5DJTA 1NXYA 4HP9A 3EGDC 3UDFA 2FH5A 1TS7A 3PBNA 3ZQ5A 5CEBA 1ONHA 5A93A 3NY4A 3T4SA 4X69A 2ACGA 3CG5A 4XT2A 4DDYA 1FCNA 2HDQA 5HDCA 1XFNA 5A91A 4F3LB 4O7DA 1WYCA 1F9IA 1XX2A 1LI0A 2Y4AA 4QB8A 1CJFA 4E04A 4WM9A 3ZCZA 3HVFA 3Q07A 1GHPA 2W3FA 1DJBA 4IBXA 5EM0A 3FYZA 5HAIA 2ZQDA 1ZTUA 3UN7A 1TDLA 4JXVA 5GLDA 2PBYA 3BY9A 4P6ZM 1DP6A 3WS4A 3P09A 2PD7A 3H7WB 4HOIA 4MN7A 1G68A 4EUVA 3QNBA 4EQIA 2INWA 2XFSA 5DF7A 2WYXA 2A49A 1HVBA 4YNRA 3KO6A 3VSLA 2O0YA 5CERA 1XKZA 2W1TB 4EERA 3B47A 3PBTA 1P97A 1BULA 4K91A 4JGPA 3UNWA 1XGJA 4S2PA 4DE2A 3S7PA 4NETA 2QZ6A 4I39A 4X56A 4OLDA 3TOIA 5CECA 4EUZA 2Z6DA 2R9XA 4IJGA 1OTIA 1JVJA 3KSHA 5F1GA 3CLOA 3UE3A 5FQQA 1J9MA 2XLNA 1FCMA 4N1XA 4S2NA 5EUAA 3UDIA 3IF6C 3LIBA 2WUQA 2V8CA 4MBFA 3C2WA 4IHQA 3ZVTA 4BD0A 5DF8A 2GDNA 3G4PA 4LRZE 2ZQAA 5AVEA 4S2IA 3OBFA 2RCXA 4CQHA 4ZTKA 4MDZA 3SH9A 3LY3A 3HLWA 3G30A 3PTEA 2GNXA 2XR0A 3F1NB 3BFEA 3PBOA 2PBDP 3H82A 4X53A 2VA0A 3IS2A 3FKWA 3DAVA 4Y0UA 2WKQA 1YLYA 5EV0A 1UWPX 4P6ZS 2P9VB 3NBLA 2PT7A 5E2GA 1H0MA 1F2KA 1K54C 1H8YA 2WGIA 5EVLA 3I7JA 1G28A 4KZ4A 1W8YA 3BLMA 1W63M 2Y55A 4LPZA 1KDSA 2WAFA 4M4XA 4JXGA 3LGOA 2DRWA 3BECA 1IKIA 3UE6A 1XP4A 2X71A 3G2YA 4EBNA 2HP6A 3B42A 2V1AA 4Q0HA 1XXMA 3KSGA 1FSYA 1N9BA 4WELA 1K6SA 4WEKA 3TSGA 4BQMA 2LB9A 1MWUA 2W3EA 4IEDA 4DJ3A 1NLZA 1ALQA 3IXDA 4QY5A 4HBUA 1BLHA 1NRJA 3WRZA 3NCKA 4LV2A 1OJGA 4XUXA 2EXAA 4F3LA 4MN5A 1BTLA 4R38A 3BW6A 3TE8A 3GV9A 3NOPC 4EV4A 4U0TA 4NXBA 1ES2A 4O01A 1PI5A 2NUTC 2Y91A 3A3FA 4DN0A 2D02A 2JKTI 4PHTA 1OJ5A 4DE0A 3H7WA 4JF6A 2Y2KA 5G18A 5JYOA 1NZUA 5GL9A 2VV8A 4KG6A 4GNUA 2JCHA 2VLGA 2HJ9C 3NHQA 5J3WA 1FR6A 3KYZA 3A3DA 1OMEA 3CWFA 2W1TA 4N92A 1SKOB 3FC7A 3W2ZA 1GSVA 3MFXA 2ZJ9A 5HL1A 4GKUA 3LCEA 5AJGA 5KMWA 4HNBA 3O87A 4HJ6A 5CGSA 4HH2A 3IX4A 5EVIB 1IEMA 4PM8A 3K2NA 3UB8A 3V3SA 1KGGA 3IWQA 4QWOA 3LEZA 4OP8A 3MR0A 3UMDA 1H3QA 2FFYA 1CEGA 2XSSA 1PNEA 4WBGA 1S67L 5L8MA 3NOTC 2VKSA 2O99A 4EXOA 3MSHA 4S2MA 3QP8A 1RGZA 3F1NA 1CEFA 1GA0A 3OCNA 4ZJ2A 1ES3A 3MF0A 1YLTA 2JKTM 3MZDA 2P9VA 1ZG4A 1T18A 4ETXA 4EU0A 3HLEA 3C8CA 2QMIA 2W1RA 3LR5A 3N6IA 1D7EA 3UPOA 3JYIA 2Y2IA 3IWOA 4X1LA 1UGUA 5I5LA 3JVVA 4QJGA 4NXGA 5AQ9A 1J3WA 2HP9A 4EETB 3IQAA 3EGXC 1RGYA 4X25A 2ZM2A 3S7NA 4Z1WA 3W8KA 1PRQA 2ZQ9A 1PWCA 4LLOB 4EWFA 1K55C 3PBSA 1N4OA 4GN2A 2ZOHA 4PKYG 2UWXA 4I3JA 2QKPA 1L2SA 3VP3A 3WRTA 2V8FA 4Z9QA 4LV0A 4ZAMA 3OOVA 3Q1FA 3P01A 4OVDA 3O86A 5HWWA 2WZXA 3P7NA 5HX9A 3CUEC 3CITA 4IVIA 4R3BA 5AQAA 2Q0OA 3HCYA 4WL9A 1OTDA 2EX2A 5AVFA 4HIAA 1XJ2A 4JXWA 4E3OA 1XPBA 5M18A 1LL8A 1SDNA 5G4YA 1MWRA 3IHAA 2K31A 1ONGA 2ZC3B 4QY6A 4E3LA 1CK3A 4B4XA 3VE3A 4OH0A 3V50A 1K6RA 2PD8A 1NZOA 5CHUA 3RXWA 1XJ6A 3K3CA 4CPKA 3JPUA 3VOZA 2Y2MA 2VZWA 1OT6A 1BZAA 5D3OA 2J3TD 4E3KA 3LFVA 1I2WA 2XRNA 4IBRA 1L0GA 3L7HA 1PW8A 5HPIA 3QP2A 3T4OA 3R7WB 3CHWP 4GDBA 3VFHA 2D01A 2G2WA 5TJJA 1Z6FA 3ZG7B 4F94A 3MQQA 3VFFA 5DF9A 2JN7A 1SKOA 3EWKA 4AFIA 3KYEA 4Q8IA 4HEFA 5EM1A 1W8QA 4WZ4A 4KQRA 1CF0A 5FI2A 4HESA 5FDSA 1OPXA 3MXSA 4QU3A 2XD1A 1KGEA 5EPHA 2JE5A 3A3IA 3RH8B 1Q2PA 1ACFA 5EVIA 3ZDJA 3B33A 2L0WA 1M6KA 1YLZA 2PR6A 4KG5A 3ZFZA 1GSWA 3G35A 3MMHA 4P85A 3BJNA 3BY8A 2W0NA 4N9LA 5FEGA 3VV4A 5CHMA 4GS9B 1KE3A 5FI6A 3GSGA 4KENB 4WN5A 3F1OB 2ZOIA 3E2LA 3LIDA 2OLUA 3SW1A 3VE4A 3MBZA 3EQVA 4NEED 1GHMA 3ZG9B 1NWZA 3C4OA 4GZBA 4K08A 5E2FA 1MKIA 5HAPA 4Y2FA 4O8GA 2MJ6A 5FL3A 2YKFA 3VP1A 4IUKA 1CQAA 1MWSA 3N8RA 2PYPA 5CHJA 2EFXA 5BOHA 3CJMA 5HARA 2GX5A 2FZ0A 3FZCA 2JKFA 2WKEA 3HL9A 1LL9A 2W3DA 3DTMA 4R0QA 4UA6A 2B5RA 3MKEA 3RTYA 2RL3A 4OLGA 1TS8A 2HPBA 3LIFA 2QPNA 3OC2A 2C6WB 4S2NC 5GHZA 3W4PA 4ME4A 1DY6A 2IA2A 2I72A 1STZA 1WYBA 4KZ9A 5MC7A 5CTNA 5HDSA 2Z6CA 1PYYA 1YPRA 1KVLA 1XA1A 4HJ3A 5FAQA 4O0PA 2JKGA 3S22A 3IT9A 2WKRA 1V9ZA 4E3NA 1GA9A 3IF5A 1XJ4A 4WZ5A 1FIKA 5DTTA 4Y17A 3VOLA 2J9OA 2M1CA 1MKMA 2H28A 2OLVA 3M6BA 5EOOA 3SH7A 1NLYA 4KUOA 3A0RA 3HREA 1W63Q 3LI8A 5CGXA 3UPPA 3MZFA 5KIZA 3IWIA 1HLUP 4RVAA 3C38A 3CZDA 2WKHA 4P87A 3LYXA 1IYOA 2JC7A 5EVEA 2HDUA 3ITBA 4KZ6A 4PM5A 2G2UA 5CXWA 2OV5A 2R78A 4E3JA 1L0FA 3IX3A 3D3OA 1GSXA 1EI5A 5HDDA 1LSWA 4KZBA 4ZRRA 3OPRA 4UA7A 1YM1A 2EX6A 1K57C 4ZBEA 3IH8A 2Y2LA 3BQ8A 5GHXA 4N9KA 3E0YA 4CLCC 1D06A 5EVID 1LSXA 3OPPA 3R7WA 5AQBA 4HQAA 1S4SA 3H9WA 1T1BA 2C5WB 3UB9A 3VMAA 2CC1A 1LL5A 1XGIA 4K0WA 3A3EA 1DP9A 2WKPA 4OOLA 4GD6A 3PR6A 3LI9A 1HD8A 1XA7A 1PFLA 2PHYA 1KE0A 1YAXA 3L9KA 5U47A 4P6BA 3SZTA 4FUWA 3G6OA 1EWZA 2OSUA 4HH3A 2Y2HA 4CLCE 2VGKA 3E2KA 3N8LA 3MQOA 2EWVA 3ISGA 1VQQA 3FPWA 3MQ0A 2J7VA 3U4LP 3T1SA 1EW0A 4GS9A 2P08A 3RFBA 1DJAA 1Q2QA 3HUMA 5GLCA 4I5SA 3HLCA 3F1OA 5FAOA 3E4QA 4S2JA 2EWWA 4WEJA 3C7UA 4R3JA 5FAPA 3SOIA 4ZJ1A 4X6TA 3UDXA 3A0VA 2M7UA 3ZG5A 1H8MA 2B18A 1ZKJA 4WYYA 4EBLA 4JPMA 4L9FA 5F69A 1E3UA 4ETZA 3E4OA 1YLWA 4DE3A 1MBLA 4FH2A 2Y2OA 2J3TC 3A3JA 3QHYA 5EECA 3PAGA 5KSCA 4E3MA 1K54A 2Y79A 5A8BA 3VP0A 4R23A 4R4RA 4EEPA 4QHCA 1N9NA 2Y59A 4S2LA 4D2OA 2P04A 2OWJA 1SHVA 2ZQ8A 3IH9A 1AWIA 5DTKA 1YSQA 1ODVA 3T4KA 3AGEA 4BMWA 2J3WA 1RP5A 4R3AA 1T1AA 2H10A 1TS0A 4U3TA 5HAQA 2P7JA 4MCWA 4XUZA 2Z2MB 1NYMA 1FR1A 4LRYC 2PAVP 1OTEA 3ZG0A 1I2SA 1GCEA 2GZAA 3LR4A 4G3KA 2G7UA 1MC0A 3WWXA 2WGVA 3VP4A 1Z09A 4RQ9A 1WA9A 4UEYA 1YKDA 2ZQCA 3FV7A 4NG2A 5KZHA 3C30A 2HP5A 3BM6A 3EEHA 3ZGAB 3PAEA 3GTCA 1VHMA 2V0UA 4JLFA 1P9WA 3G2ZA 5FSRA 5FQJA 3T1QB 4BD1A 4C75A 3N7WA 3E4PA 4HP4A 3VOYA 1LT0A 2PDRA 1IYQA 3EEAA 3M6HA 4X55A 4OQGA 3UPNA 3WS5A 3LUQA 3FWLA 4B88A 5DKLA 3MJQA 5DVAA 4MN6A 1E25A 3V5MA 1KGFA 1P0ZA 3HJIA 4LV3A 4OPYA 5TBMB 4JGRA 2E8JA 3MS6A 2HZ5A 2WAEA 4NK3A 2HDSA 2JKRI 1K0KA 1FSWA 5IS1A 3UB7A 4HJ4A 2BG1A 5F6AA 4R1GA 4L9GA 3IXHA 1K56D 3C4PA 2PU4A 3A0SA 1E3UD 4R70A 1ESIA 5TR7A 1XFQA 4BWIA 2OAP1 4DF6A 2CMNA 1FOFA 2R9WA 5A90A 2VX8A 1IOUA 4BLMA 3BRMA 5HL6A 3AGFA 2O9BA 5CX7A 2HJEA 3NI9A 4KZ7A 2HDRA 4KQQA 4MMNA 3QP5A 2V1ZA 5A92A 1NYYA 1VB6A 3SS3A 2H0YA 2QJ5A 1LSVA 4DJ2A 1RCJA 4RYEA 1H5XA 2EFUA 4EBPA 2A3UA 2L4RA 2XK1A 4QD4A 1PIOA 2A24B 1FILA 2DMWA 3DTEA 2Y2QA 4ZJ3A 3HLDA 3Q82A 1PWDA 1KVMA 3KYQA 3Q81A 3KSFA 4KUKA 4JF5A 5L2FA 2J80A 5DKKA 5TFQA 1N9OA 3CPTB 5IHVA 1K4EA 1X0OA 3PHYA 1BUEA 3CMZA 1TDGA 4OOMA 2ZLYA 3T4TA 4LCLA 1IELA 3Q7ZA 2JKRM 4KQDA 1K55A 2W3GA 3GR2A 2UV0E 2OWHA 1A0KA 4BBUA 4EESA 3G34A 2ZMVA 2ZMFA 2ZC4B 4Y7PA 1LI9A 1L3LA 4H6JB 1MZUA 2EA9A 2DCFA 1T1CA 1KDWA 3M2KA 2E8IA 1IKGA 3LIAA 3JVUA 5E2EA 1ZC2A 3LO7A 4GHIB 1MY8A 4KQOA 2M7VA 3IF6B 2X02A 5F68A 1G6OA 3S7OA 1ESUA 1T19A 1M40A 4DXBA 1ES5A 5G4ZA 2HV1A 3ZG8B 2IWBA 3WS2A 4L0LA 4I3IA 2P74A 2V2FF 4DXCA 5I94A 4BL3A 4YWZA 2KOIA 3T50A 1YSPA 1LHYA 1UWNX 3ZNTA 3N4IA 4PM7A 1NY0A 1V9YA 5F82A 3F1PB 4CLCB 2JHEA 1VETA 1QMFA 2ZM0A 4BBVA 2KDKA 4OPZA 4WZ5C 3E98A 1MWTA 2XGNA 5F5YA 3S7QA 3MXQA 4RA7A 3ULFA 4KZ3A 4B4ZA 2XFTA 2XD5A 2QWSA 3K3DA 5TBMA 4Q0IA 3S4XA 2B95A 1TEMA 4ID4A 4WMCA 1JNUA 1G5UA 2KLIA 3DTKA 1E4DA 2LB5A 2ZMAA 3ICYA 3G31A 4IVKA 3DWKA 2XF3A 4FD8A 5DTSA 2QHKA 4U0XA 3NIAA 3P98A 4HHDA 2WGWB 3GVBA 3LICA 4R6LA 5K5BA 2NUPC 3ITAA 1OTAA 4WF0A 2XDMA 3G32A 1S0WA 5EE8A 1F98A 4MEZA 1PZOA 3WS1A 1EROA 2ZM8A 3Q7VB 4WUJA 3VP2A 2B02A 4BL2A 4S2KA 3BYDA 3GDIA 1YMXA 1S4RA 2X01A 1H8ZA 2L1MA 1L0EA 1HTZA 1FCOA 2Y8HA 3RXXA 4DKIA 5CEDA 4UAAA 3PBQA 4OOYA 2K7SA 3GQZA 2A24A 1VM1A 5HWTA 4E6XA 4GD8A 1SZVA 4E3IA 3QP6A 4MBKA 4M3KA 3NDGA 3LEQA 5EFWA 4LRXC 1L0DA 4L9EA 3TRCA 5F83A 3CPTA 3UE0A 3IBRA 1MPLA 3LR0A 5AQ7A 3NOUC 4PM6A 3BWLA 4LCMA 4Y13A 3PBRA 4C3QA 1BLSA 1SCWA 3HLFA 1F5MA 5EOEA 2ZD8A 4DRTA 5J4EA 4H6JA 3SH8A 2ZBBA 4OQIA 4NXFA 4ARZB 1XJ3A 5TGFA 2VEAA 5DFXA 1P9RA 4R4SA 4Y0OA 2V0WA 1VEUB 3CI6A 3AGDA 1PZPA 2Y2JA 5F1FA 4GHIA 4I3AA 4YFMA 3ZYTA 1OTBA 3IF6A 4Y5FA 1S1YA 5GLBA 3QP4A 5J7EA 3M2JA 2XEPA 4KZAA 1NRFA 2YKHA 3OPLA 2J9PA 2PRFA 1BSGA 4Y15A 1DRMA 3SS4A 1OT9A 1K57A 3TJZC 3UB6A 2Q9MA 2Z2LB 1K56A 3UMEA 2Q9NA 2WKIA 4WMCD 4Y3IA 1FQGA 4CLCA 3F1PA 3D4FA 3UO9A 2V1BA 3HUOA 3B3XA 3UE1A 1JWZA 1Y28A 4HI4A 4BJPA 5IT5A 2GJ3A 2H0TA 4N1HA 3FKVA 4KZ8A 1S1ZA 1U60A 2ZC7A 1S6RA 5CGWA 1JTGA 1K25A 4YOFA 3IHBA 5E43A 3T1XA 5DJUA 2PYRA 4OKPA 3W4OA 4OQHA 1TS6A 1YLPA 4A5RA 5FA7A 2OAQ1 2ZC5B 2V20A 5L09A 3EOIA 3LY4A 4FSFA 4JF4A 3HBRA 3S1YA 1DJCA 5FQ9A 3SS5A 4I38A 1ZHHB 1JTDA 2WGWA 3GMWA 1G6AA 3VSKA 4OQ0A 4X1MA 2ZL1B 2DNSA 1D1JA 1PI4A 4JGQA 4II7A 5LBRA 2VJWA 5E2HA 1QMEA 2BTFP 3O5YA 3T4QA 4H8RA 4S2OA 4GCZA 3Q7VA 2EXBA 4BBTA 2HGVA 1NJ4A 1C3BA 4C6YA 1I5QA 3KX0X 3TG9A 5HSQA 4B9OA 3NJAA 5GLAA 3ZVWA 4WLAA 2PR5A 3LIEA 4JGOA 4HY8A 3MFDA 4DDSA 3NULA 5L10A 1SDEA 4YINA 5HZHA 4X68A 3HUNA 1WE4A 1PW1A 4LENA 4MBHA 3NC8A 2VV7A 5FATA 1TF1A 4HBTA 2EX8A 2A2LA 1CI8A 2XQZA 1IFQA 1N9LA 3NDEA 2XH9A 3MKFA 3QNCA 5FASA 1VETB 4ZDXA 1PWGA 5HWVA 2BLSA 1KE4A 4DMZA 4RX3A 1BT5A 2Y2NA 4GW9A 2IWCA 3HJKA 4UA9A 1JWPA 3BFGA 3KSIA 2I9VA 4XXRA 3V3RA 3ZNYA 2AVXA 4XT2B 2VGLM 4ARZA 4OPQA 2W27A 3O88A 1W5DA 2PU2A 5DFYA 1TD5A 2EX9A 4PKYA 3BFFA 1BYWA 3U2AA 5CTMA 4PM9A 1VEUA 3PXPA 3PYPA 4Y0TA 4GOGA 4RX2A 1ZG6A 5HD5A 4CLCD 4GDNA 3OPHA 1LLBA 4JBFA 4UQIM 2Y2GA 3RJUA 3MXRA 3UY6A 3T4JA 4LFUA 3BEBA 4CJNA 3HLGA 4LV1A 4EQ1A 1YMSA 1ERQA 4FTXA 1K4FA 3IXBA 1AXBA 3T1RA 3N8SA 4NKPA 2QYBA 3DWZA 4KG2A
chains in the Genus database with same CATH topology
3L7HA 2JKFA 1FILA 4X1LA 3CHWP 1VETA 3NULA 1SZVA 3LGOA 1J3WA 1Y4OA 1SKOB 1SKOA 3KYEA 1AWIA 3LEQA 4X25A 5EM1A 3NECA 3CPTB 1CF0A 3CPTA 5FDSA 3T12B 1PFLA 1YPRA 3L9KA 2E8JA 3MS6A 4D60A 2HZ5A 4ESPA 1PRQA 2B95A 2VK3A 3T1XA 1K0KA 2JKGA 1VETB 1ACFA 5FEFA 4FUWA 1G5UA 4QWOA 2PAVP 1A0KA 2V8FA 1FIKA 5FEGA 1Z09A 2V8CA 1PNEA 3U4LP 2ACGA 3T1SA 3D9YA 4X1MA 2ZL1B 1D1JA 2ZL1A 1VEUB 1VEUA 1CJFA 3MSHA 2BTFP 1HLUP 3T1QB 5EVEA 5EM0A 2PBDP 3DAVA 5EV0A 3UB5P 4FTXA 1CQAA 3T1RA 2PRFA 1F2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L7H A;  2JKF A;  1FIL A;  4X1L A;  3CHW P;  1VET A;  3NUL A;  1SZV A;  3LGO A;  1J3W A;  1Y4O A;  1SKO B;  1SKO A;  3KYE A;  1AWI A;  3LEQ A;  4X25 A;  5EM1 A;  3NEC A;  3CPT B;  1CF0 A;  3CPT A;  5FDS A;  3T12 B;  1PFL A;  1YPR A;  3L9K A;  2E8J A;  3MS6 A;  4D60 A;  2HZ5 A;  4ESP A;  1PRQ A;  2B95 A;  2VK3 A;  3T1X A;  1K0K A;  2JKG A;  1VET B;  1ACF A;  5FEF A;  4FUW A;  1G5U A;  4QWO A;  2PAV P;  1A0K A;  2V8F A;  1FIK A;  5FEG A;  1Z09 A;  2V8C A;  1PNE A;  3U4L P;  2ACG A;  3T1S A;  3D9Y A;  4X1M A;  2ZL1 B;  1D1J A;  2ZL1 A;  1VEU B;  1VEU A;  1CJF A;  3MSH A;  2BTF P;  1HLU P;  3T1Q B;  5EVE A;  5EM0 A;  2PBD P;  3DAV A;  5EV0 A;  3UB5 P;  4FTX A;  1CQA A;  3T1R A;  2PRF A;  1F2K A; 
#chains in the Genus database with same CATH topology
 1IYP A;  2XA7 M;  5JYP A;  2WAD A;  3DBA A;  1O7E A;  5C5K A;  1BLP A;  3V67 A;  1TVF A;  4EW7 A;  2O9C A;  4Q0J A;  5HW3 A;  2VV6 A;  3IXG A;  3WS0 A;  2XRO A;  3ZHH A;  3HLB A;  5IU1 A;  2H5S A;  3NEC A;  1K38 A;  4GB7 A;  1SKF A;  4MNR A;  2ZQ7 A;  4D60 A;  1ERM A;  1HZO A;  4ESP A;  5EVI C;  1DP8 A;  3BFC A;  1JWV A;  2QJ7 A;  5FEF A;  3LR3 A;  3MZE A;  2IWD A;  3IBJ A;  2OOL A;  4PMA A;  3EQU A;  4FH4 A;  1YLJ A;  4KZ5 A;  5FI7 A;  3DW0 A;  2HF6 A;  5M1A A;  4QPR A;  5FQK A;  4UHU A;  3FPV A;  3O3V A;  4JKT A;  3D9Y A;  1CI9 A;  3OZH A;  3DTI A;  2VGL S;  3C7V A;  5CRF A;  1ES4 A;  2ZL1 A;  4K0X A;  2BAS A;  3R4K A;  1YT4 A;  3TW8 A;  2WZZ A;  1S66 L;  2V9A A;  3BLS A;  4G3W A;  1GHI A;  3CAX A;  3D72 A;  3BQA A;  4JXS A;  2KX6 A;  4DE1 A;  2O9A A;  4FCF A;  4FOF A;  3V39 A;  1MXO A;  3OCL A;  2JBF A;  2Y2P A;  3GEC A;  4OON A;  3H82 B;  4UQI S;  4EEU A;  5KSH A;  4OP5 A;  3IS2 B;  4PPR A;  5FQI A;  2VGJ A;  3CUE A;  5HD3 A;  5FQM A;  3UB5 P;  3BFD A;  4GJ4 A;  4LGW A;  2W3H A;  4IUH A;  5M19 A;  5HPF A;  2WK0 A;  3C5A A;  1YQS A;  2XA7 S;  2J8Y A;  3FG8 A;  4E6W A;  2FFF B;  4BEN A;  5L07 A;  4B93 A;  2ZC6 B;  5FDH A;  5GHY A;  1O07 A;  4G3V A;  4PAU A;  1Y4O A;  4OPR A;  4NXE A;  3GRJ A;  3OLO A;  3QP1 A;  3T4L A;  1KOU A;  3T12 B;  4GLQ A;  1IYS A;  1Y54 A;  1BLC A;  3IX8 A;  4P0M A;  1W7F A;  2K2N A;  1W79 A;  2VK3 A;  4MLL A;  5HFO A;  5J8X A;  3W4Q A;  5DJT A;  1NXY A;  4HP9 A;  3EGD C;  3UDF A;  2FH5 A;  1TS7 A;  3PBN A;  3ZQ5 A;  5CEB A;  1ONH A;  5A93 A;  3NY4 A;  3T4S A;  4X69 A;  2ACG A;  3CG5 A;  4XT2 A;  4DDY A;  1FCN A;  2HDQ A;  5HDC A;  1XFN A;  5A91 A;  4F3L B;  4O7D A;  1WYC A;  1F9I A;  1XX2 A;  1LI0 A;  2Y4A A;  4QB8 A;  1CJF A;  4E04 A;  4WM9 A;  3ZCZ A;  3HVF A;  3Q07 A;  1GHP A;  2W3F A;  1DJB A;  4IBX A;  5EM0 A;  3FYZ A;  5HAI A;  2ZQD A;  1ZTU A;  3UN7 A;  1TDL A;  4JXV A;  5GLD A;  2PBY A;  3BY9 A;  4P6Z M;  1DP6 A;  3WS4 A;  3P09 A;  2PD7 A;  3H7W B;  4HOI A;  4MN7 A;  1G68 A;  4EUV A;  3QNB A;  4EQI A;  2INW A;  2XFS A;  5DF7 A;  2WYX A;  2A49 A;  1HVB A;  4YNR A;  3KO6 A;  3VSL A;  2O0Y A;  5CER A;  1XKZ A;  2W1T B;  4EER A;  3B47 A;  3PBT A;  1P97 A;  1BUL A;  4K91 A;  4JGP A;  3UNW A;  1XGJ A;  4S2P A;  4DE2 A;  3S7P A;  4NET A;  2QZ6 A;  4I39 A;  4X56 A;  4OLD A;  3TOI A;  5CEC A;  4EUZ A;  2Z6D A;  2R9X A;  4IJG A;  1OTI A;  1JVJ A;  3KSH A;  5F1G A;  3CLO A;  3UE3 A;  5FQQ A;  1J9M A;  2XLN A;  1FCM A;  4N1X A;  4S2N A;  5EUA A;  3UDI A;  3IF6 C;  3LIB A;  2WUQ A;  2V8C A;  4MBF A;  3C2W A;  4IHQ A;  3ZVT A;  4BD0 A;  5DF8 A;  2GDN A;  3G4P A;  4LRZ E;  2ZQA A;  5AVE A;  4S2I A;  3OBF A;  2RCX A;  4CQH A;  4ZTK A;  4MDZ A;  3SH9 A;  3LY3 A;  3HLW A;  3G30 A;  3PTE A;  2GNX A;  2XR0 A;  3F1N B;  3BFE A;  3PBO A;  2PBD P;  3H82 A;  4X53 A;  2VA0 A;  3IS2 A;  3FKW A;  3DAV A;  4Y0U A;  2WKQ A;  1YLY A;  5EV0 A;  1UWP X;  4P6Z S;  2P9V B;  3NBL A;  2PT7 A;  5E2G A;  1H0M A;  1F2K A;  1K54 C;  1H8Y A;  2WGI A;  5EVL A;  3I7J A;  1G28 A;  4KZ4 A;  1W8Y A;  3BLM A;  1W63 M;  2Y55 A;  4LPZ A;  1KDS A;  2WAF A;  4M4X A;  4JXG A;  3LGO A;  2DRW A;  3BEC A;  1IKI A;  3UE6 A;  1XP4 A;  2X71 A;  3G2Y A;  4EBN A;  2HP6 A;  3B42 A;  2V1A A;  4Q0H A;  1XXM A;  3KSG A;  1FSY A;  1N9B A;  4WEL A;  1K6S A;  4WEK A;  3TSG A;  4BQM A;  2LB9 A;  1MWU A;  2W3E A;  4IED A;  4DJ3 A;  1NLZ A;  1ALQ A;  3IXD A;  4QY5 A;  4HBU A;  1BLH A;  1NRJ A;  3WRZ A;  3NCK A;  4LV2 A;  1OJG A;  4XUX A;  2EXA A;  4F3L A;  4MN5 A;  1BTL A;  4R38 A;  3BW6 A;  3TE8 A;  3GV9 A;  3NOP C;  4EV4 A;  4U0T A;  4NXB A;  1ES2 A;  4O01 A;  1PI5 A;  2NUT C;  2Y91 A;  3A3F A;  4DN0 A;  2D02 A;  2JKT I;  4PHT A;  1OJ5 A;  4DE0 A;  3H7W A;  4JF6 A;  2Y2K A;  5G18 A;  5JYO A;  1NZU A;  5GL9 A;  2VV8 A;  4KG6 A;  4GNU A;  2JCH A;  2VLG A;  2HJ9 C;  3NHQ A;  5J3W A;  1FR6 A;  3KYZ A;  3A3D A;  1OME A;  3CWF A;  2W1T A;  4N92 A;  1SKO B;  3FC7 A;  3W2Z A;  1GSV A;  3MFX A;  2ZJ9 A;  5HL1 A;  4GKU A;  3LCE A;  5AJG A;  5KMW A;  4HNB A;  3O87 A;  4HJ6 A;  5CGS A;  4HH2 A;  3IX4 A;  5EVI B;  1IEM A;  4PM8 A;  3K2N A;  3UB8 A;  3V3S A;  1KGG A;  3IWQ A;  4QWO A;  3LEZ A;  4OP8 A;  3MR0 A;  3UMD A;  1H3Q A;  2FFY A;  1CEG A;  2XSS A;  1PNE A;  4WBG A;  1S67 L;  5L8M A;  3NOT C;  2VKS A;  2O99 A;  4EXO A;  3MSH A;  4S2M A;  3QP8 A;  1RGZ A;  3F1N A;  1CEF A;  1GA0 A;  3OCN A;  4ZJ2 A;  1ES3 A;  3MF0 A;  1YLT A;  2JKT M;  3MZD A;  2P9V A;  1ZG4 A;  1T18 A;  4ETX A;  4EU0 A;  3HLE A;  3C8C A;  2QMI A;  2W1R A;  3LR5 A;  3N6I A;  1D7E A;  3UPO A;  3JYI A;  2Y2I A;  3IWO A;  4X1L A;  1UGU A;  5I5L A;  3JVV A;  4QJG A;  4NXG A;  5AQ9 A;  1J3W A;  2HP9 A;  4EET B;  3IQA A;  3EGX C;  1RGY A;  4X25 A;  2ZM2 A;  3S7N A;  4Z1W A;  3W8K A;  1PRQ A;  2ZQ9 A;  1PWC A;  4LLO B;  4EWF A;  1K55 C;  3PBS A;  1N4O A;  4GN2 A;  2ZOH A;  4PKY G;  2UWX A;  4I3J A;  2QKP A;  1L2S A;  3VP3 A;  3WRT A;  2V8F A;  4Z9Q A;  4LV0 A;  4ZAM A;  3OOV A;  3Q1F A;  3P01 A;  4OVD A;  3O86 A;  5HWW A;  2WZX A;  3P7N A;  5HX9 A;  3CUE C;  3CIT A;  4IVI A;  4R3B A;  5AQA A;  2Q0O A;  3HCY A;  4WL9 A;  1OTD A;  2EX2 A;  5AVF A;  4HIA A;  1XJ2 A;  4JXW A;  4E3O A;  1XPB A;  5M18 A;  1LL8 A;  1SDN A;  5G4Y A;  1MWR A;  3IHA A;  2K31 A;  1ONG A;  2ZC3 B;  4QY6 A;  4E3L A;  1CK3 A;  4B4X A;  3VE3 A;  4OH0 A;  3V50 A;  1K6R A;  2PD8 A;  1NZO A;  5CHU A;  3RXW A;  1XJ6 A;  3K3C A;  4CPK A;  3JPU A;  3VOZ A;  2Y2M A;  2VZW A;  1OT6 A;  1BZA A;  5D3O A;  2J3T D;  4E3K A;  3LFV A;  1I2W A;  2XRN A;  4IBR A;  1L0G A;  3L7H A;  1PW8 A;  5HPI A;  3QP2 A;  3T4O A;  3R7W B;  3CHW P;  4GDB A;  3VFH A;  2D01 A;  2G2W A;  5TJJ A;  1Z6F A;  3ZG7 B;  4F94 A;  3MQQ A;  3VFF A;  5DF9 A;  2JN7 A;  1SKO A;  3EWK A;  4AFI A;  3KYE A;  4Q8I A;  4HEF A;  5EM1 A;  1W8Q A;  4WZ4 A;  4KQR A;  1CF0 A;  5FI2 A;  4HES A;  5FDS A;  1OPX A;  3MXS A;  4QU3 A;  2XD1 A;  1KGE A;  5EPH A;  2JE5 A;  3A3I A;  3RH8 B;  1Q2P A;  1ACF A;  5EVI A;  3ZDJ A;  3B33 A;  2L0W A;  1M6K A;  1YLZ A;  2PR6 A;  4KG5 A;  3ZFZ A;  1GSW A;  3G35 A;  3MMH A;  4P85 A;  3BJN A;  3BY8 A;  2W0N A;  4N9L A;  5FEG A;  3VV4 A;  5CHM A;  4GS9 B;  1KE3 A;  5FI6 A;  3GSG A;  4KEN B;  4WN5 A;  3F1O B;  2ZOI A;  3E2L A;  3LID A;  2OLU A;  3SW1 A;  3VE4 A;  3MBZ A;  3EQV A;  4NEE D;  1GHM A;  3ZG9 B;  1NWZ A;  3C4O A;  4GZB A;  4K08 A;  5E2F A;  1MKI A;  5HAP A;  4Y2F A;  4O8G A;  2MJ6 A;  5FL3 A;  2YKF A;  3VP1 A;  4IUK A;  1CQA A;  1MWS A;  3N8R A;  2PYP A;  5CHJ A;  2EFX A;  5BOH A;  3CJM A;  5HAR A;  2GX5 A;  2FZ0 A;  3FZC A;  2JKF A;  2WKE A;  3HL9 A;  1LL9 A;  2W3D A;  3DTM A;  4R0Q A;  4UA6 A;  2B5R A;  3MKE A;  3RTY A;  2RL3 A;  4OLG A;  1TS8 A;  2HPB A;  3LIF A;  2QPN A;  3OC2 A;  2C6W B;  4S2N C;  5GHZ A;  3W4P A;  4ME4 A;  1DY6 A;  2IA2 A;  2I72 A;  1STZ A;  1WYB A;  4KZ9 A;  5MC7 A;  5CTN A;  5HDS A;  2Z6C A;  1PYY A;  1YPR A;  1KVL A;  1XA1 A;  4HJ3 A;  5FAQ A;  4O0P A;  2JKG A;  3S22 A;  3IT9 A;  2WKR A;  1V9Z A;  4E3N A;  1GA9 A;  3IF5 A;  1XJ4 A;  4WZ5 A;  1FIK A;  5DTT A;  4Y17 A;  3VOL A;  2J9O A;  2M1C A;  1MKM A;  2H28 A;  2OLV A;  3M6B A;  5EOO A;  3SH7 A;  1NLY A;  4KUO A;  3A0R A;  3HRE A;  1W63 Q;  3LI8 A;  5CGX A;  3UPP A;  3MZF A;  5KIZ A;  3IWI A;  1HLU P;  4RVA A;  3C38 A;  3CZD A;  2WKH A;  4P87 A;  3LYX A;  1IYO A;  2JC7 A;  5EVE A;  2HDU A;  3ITB A;  4KZ6 A;  4PM5 A;  2G2U A;  5CXW A;  2OV5 A;  2R78 A;  4E3J A;  1L0F A;  3IX3 A;  3D3O A;  1GSX A;  1EI5 A;  5HDD A;  1LSW A;  4KZB A;  4ZRR A;  3OPR A;  4UA7 A;  1YM1 A;  2EX6 A;  1K57 C;  4ZBE A;  3IH8 A;  2Y2L A;  3BQ8 A;  5GHX A;  4N9K A;  3E0Y A;  4CLC C;  1D06 A;  5EVI D;  1LSX A;  3OPP A;  3R7W A;  5AQB A;  4HQA A;  1S4S A;  3H9W A;  1T1B A;  2C5W B;  3UB9 A;  3VMA A;  2CC1 A;  1LL5 A;  1XGI A;  4K0W A;  3A3E A;  1DP9 A;  2WKP A;  4OOL A;  4GD6 A;  3PR6 A;  3LI9 A;  1HD8 A;  1XA7 A;  1PFL A;  2PHY A;  1KE0 A;  1YAX A;  3L9K A;  5U47 A;  4P6B A;  3SZT A;  4FUW A;  3G6O A;  1EWZ A;  2OSU A;  4HH3 A;  2Y2H A;  4CLC E;  2VGK A;  3E2K A;  3N8L A;  3MQO A;  2EWV A;  3ISG A;  1VQQ A;  3FPW A;  3MQ0 A;  2J7V A;  3U4L P;  3T1S A;  1EW0 A;  4GS9 A;  2P08 A;  3RFB A;  1DJA A;  1Q2Q A;  3HUM A;  5GLC A;  4I5S A;  3HLC A;  3F1O A;  5FAO A;  3E4Q A;  4S2J A;  2EWW A;  4WEJ A;  3C7U A;  4R3J A;  5FAP A;  3SOI A;  4ZJ1 A;  4X6T A;  3UDX A;  3A0V A;  2M7U A;  3ZG5 A;  1H8M A;  2B18 A;  1ZKJ A;  4WYY A;  4EBL A;  4JPM A;  4L9F A;  5F69 A;  1E3U A;  4ETZ A;  3E4O A;  1YLW A;  4DE3 A;  1MBL A;  4FH2 A;  2Y2O A;  2J3T C;  3A3J A;  3QHY A;  5EEC A;  3PAG A;  5KSC A;  4E3M A;  1K54 A;  2Y79 A;  5A8B A;  3VP0 A;  4R23 A;  4R4R A;  4EEP A;  4QHC A;  1N9N A;  2Y59 A;  4S2L A;  4D2O A;  2P04 A;  2OWJ A;  1SHV A;  2ZQ8 A;  3IH9 A;  1AWI A;  5DTK A;  1YSQ A;  1ODV A;  3T4K A;  3AGE A;  4BMW A;  2J3W A;  1RP5 A;  4R3A A;  1T1A A;  2H10 A;  1TS0 A;  4U3T A;  5HAQ A;  2P7J A;  4MCW A;  4XUZ A;  2Z2M B;  1NYM A;  1FR1 A;  4LRY C;  2PAV P;  1OTE A;  3ZG0 A;  1I2S A;  1GCE A;  2GZA A;  3LR4 A;  4G3K A;  2G7U A;  1MC0 A;  3WWX A;  2WGV A;  3VP4 A;  1Z09 A;  4RQ9 A;  1WA9 A;  4UEY A;  1YKD A;  2ZQC A;  3FV7 A;  4NG2 A;  5KZH A;  3C30 A;  2HP5 A;  3BM6 A;  3EEH A;  3ZGA B;  3PAE A;  3GTC A;  1VHM A;  2V0U A;  4JLF A;  1P9W A;  3G2Z A;  5FSR A;  5FQJ A;  3T1Q B;  4BD1 A;  4C75 A;  3N7W A;  3E4P A;  4HP4 A;  3VOY A;  1LT0 A;  2PDR A;  1IYQ A;  3EEA A;  3M6H A;  4X55 A;  4OQG A;  3UPN A;  3WS5 A;  3LUQ A;  3FWL A;  4B88 A;  5DKL A;  3MJQ A;  5DVA A;  4MN6 A;  1E25 A;  3V5M A;  1KGF A;  1P0Z A;  3HJI A;  4LV3 A;  4OPY A;  5TBM B;  4JGR A;  2E8J A;  3MS6 A;  2HZ5 A;  2WAE A;  4NK3 A;  2HDS A;  2JKR I;  1K0K A;  1FSW A;  5IS1 A;  3UB7 A;  4HJ4 A;  2BG1 A;  5F6A A;  4R1G A;  4L9G A;  3IXH A;  1K56 D;  3C4P A;  2PU4 A;  3A0S A;  1E3U D;  4R70 A;  1ESI A;  5TR7 A;  1XFQ A;  4BWI A;  2OAP 1;  4DF6 A;  2CMN A;  1FOF A;  2R9W A;  5A90 A;  2VX8 A;  1IOU A;  4BLM A;  3BRM A;  5HL6 A;  3AGF A;  2O9B A;  5CX7 A;  2HJE A;  3NI9 A;  4KZ7 A;  2HDR A;  4KQQ A;  4MMN A;  3QP5 A;  2V1Z A;  5A92 A;  1NYY A;  1VB6 A;  3SS3 A;  2H0Y A;  2QJ5 A;  1LSV A;  4DJ2 A;  1RCJ A;  4RYE A;  1H5X A;  2EFU A;  4EBP A;  2A3U A;  2L4R A;  2XK1 A;  4QD4 A;  1PIO A;  2A24 B;  1FIL A;  2DMW A;  3DTE A;  2Y2Q A;  4ZJ3 A;  3HLD A;  3Q82 A;  1PWD A;  1KVM A;  3KYQ A;  3Q81 A;  3KSF A;  4KUK A;  4JF5 A;  5L2F A;  2J80 A;  5DKK A;  5TFQ A;  1N9O A;  3CPT B;  5IHV A;  1K4E A;  1X0O A;  3PHY A;  1BUE A;  3CMZ A;  1TDG A;  4OOM A;  2ZLY A;  3T4T A;  4LCL A;  1IEL A;  3Q7Z A;  2JKR M;  4KQD A;  1K55 A;  2W3G A;  3GR2 A;  2UV0 E;  2OWH A;  1A0K A;  4BBU A;  4EES A;  3G34 A;  2ZMV A;  2ZMF A;  2ZC4 B;  4Y7P A;  1LI9 A;  1L3L A;  4H6J B;  1MZU A;  2EA9 A;  2DCF A;  1T1C A;  1KDW A;  3M2K A;  2E8I A;  1IKG A;  3LIA A;  3JVU A;  5E2E A;  1ZC2 A;  3LO7 A;  4GHI B;  1MY8 A;  4KQO A;  2M7V A;  3IF6 B;  2X02 A;  5F68 A;  1G6O A;  3S7O A;  1ESU A;  1T19 A;  1M40 A;  4DXB A;  1ES5 A;  5G4Z A;  2HV1 A;  3ZG8 B;  2IWB A;  3WS2 A;  4L0L A;  4I3I A;  2P74 A;  2V2F F;  4DXC A;  5I94 A;  4BL3 A;  4YWZ A;  2KOI A;  3T50 A;  1YSP A;  1LHY A;  1UWN X;  3ZNT A;  3N4I A;  4PM7 A;  1NY0 A;  1V9Y A;  5F82 A;  3F1P B;  4CLC B;  2JHE A;  1VET A;  1QMF A;  2ZM0 A;  4BBV A;  2KDK A;  4OPZ A;  4WZ5 C;  3E98 A;  1MWT A;  2XGN A;  5F5Y A;  3S7Q A;  3MXQ A;  4RA7 A;  3ULF A;  4KZ3 A;  4B4Z A;  2XFT A;  2XD5 A;  2QWS A;  3K3D A;  5TBM A;  4Q0I A;  3S4X A;  2B95 A;  1TEM A;  4ID4 A;  4WMC A;  1JNU A;  1G5U A;  2KLI A;  3DTK A;  1E4D A;  2LB5 A;  2ZMA A;  3ICY A;  3G31 A;  4IVK A;  3DWK A;  2XF3 A;  4FD8 A;  5DTS A;  2QHK A;  4U0X A;  3NIA A;  3P98 A;  4HHD A;  2WGW B;  3GVB A;  3LIC A;  4R6L A;  5K5B A;  2NUP C;  3ITA A;  1OTA A;  4WF0 A;  2XDM A;  3G32 A;  1S0W A;  5EE8 A;  1F98 A;  4MEZ A;  1PZO A;  3WS1 A;  1ERO A;  2ZM8 A;  3Q7V B;  4WUJ A;  3VP2 A;  2B02 A;  4BL2 A;  4S2K A;  3BYD A;  3GDI A;  1YMX A;  1S4R A;  2X01 A;  1H8Z A;  2L1M A;  1L0E A;  1HTZ A;  1FCO A;  2Y8H A;  3RXX A;  4DKI A;  5CED A;  4UAA A;  3PBQ A;  4OOY A;  2K7S A;  3GQZ A;  2A24 A;  1VM1 A;  5HWT A;  4E6X A;  4GD8 A;  1SZV A;  4E3I A;  3QP6 A;  4MBK A;  4M3K A;  3NDG A;  3LEQ A;  5EFW A;  4LRX C;  1L0D A;  4L9E A;  3TRC A;  5F83 A;  3CPT A;  3UE0 A;  3IBR A;  1MPL A;  3LR0 A;  5AQ7 A;  3NOU C;  4PM6 A;  3BWL A;  4LCM A;  4Y13 A;  3PBR A;  4C3Q A;  1BLS A;  1SCW A;  3HLF A;  1F5M A;  5EOE A;  2ZD8 A;  4DRT A;  5J4E A;  4H6J A;  3SH8 A;  2ZBB A;  4OQI A;  4NXF A;  4ARZ B;  1XJ3 A;  5TGF A;  2VEA A;  5DFX A;  1P9R A;  4R4S A;  4Y0O A;  2V0W A;  1VEU B;  3CI6 A;  3AGD A;  1PZP A;  2Y2J A;  5F1F A;  4GHI A;  4I3A A;  4YFM A;  3ZYT A;  1OTB A;  3IF6 A;  4Y5F A;  1S1Y A;  5GLB A;  3QP4 A;  5J7E A;  3M2J A;  2XEP A;  4KZA A;  1NRF A;  2YKH A;  3OPL A;  2J9P A;  2PRF A;  1BSG A;  4Y15 A;  1DRM A;  3SS4 A;  1OT9 A;  1K57 A;  3TJZ C;  3UB6 A;  2Q9M A;  2Z2L B;  1K56 A;  3UME A;  2Q9N A;  2WKI A;  4WMC D;  4Y3I A;  1FQG A;  4CLC A;  3F1P A;  3D4F A;  3UO9 A;  2V1B A;  3HUO A;  3B3X A;  3UE1 A;  1JWZ A;  1Y28 A;  4HI4 A;  4BJP A;  5IT5 A;  2GJ3 A;  2H0T A;  4N1H A;  3FKV A;  4KZ8 A;  1S1Z A;  1U60 A;  2ZC7 A;  1S6R A;  5CGW A;  1JTG A;  1K25 A;  4YOF A;  3IHB A;  5E43 A;  3T1X A;  5DJU A;  2PYR A;  4OKP A;  3W4O A;  4OQH A;  1TS6 A;  1YLP A;  4A5R A;  5FA7 A;  2OAQ 1;  2ZC5 B;  2V20 A;  5L09 A;  3EOI A;  3LY4 A;  4FSF A;  4JF4 A;  3HBR A;  3S1Y A;  1DJC A;  5FQ9 A;  3SS5 A;  4I38 A;  1ZHH B;  1JTD A;  2WGW A;  3GMW A;  1G6A A;  3VSK A;  4OQ0 A;  4X1M A;  2ZL1 B;  2DNS A;  1D1J A;  1PI4 A;  4JGQ A;  4II7 A;  5LBR A;  2VJW A;  5E2H A;  1QME A;  2BTF P;  3O5Y A;  3T4Q A;  4H8R A;  4S2O A;  4GCZ A;  3Q7V A;  2EXB A;  4BBT A;  2HGV A;  1NJ4 A;  1C3B A;  4C6Y A;  1I5Q A;  3KX0 X;  3TG9 A;  5HSQ A;  4B9O A;  3NJA A;  5GLA A;  3ZVW A;  4WLA A;  2PR5 A;  3LIE A;  4JGO A;  4HY8 A;  3MFD A;  4DDS A;  3NUL A;  5L10 A;  1SDE A;  4YIN A;  5HZH A;  4X68 A;  3HUN A;  1WE4 A;  1PW1 A;  4LEN A;  4MBH A;  3NC8 A;  2VV7 A;  5FAT A;  1TF1 A;  4HBT A;  2EX8 A;  2A2L A;  1CI8 A;  2XQZ A;  1IFQ A;  1N9L A;  3NDE A;  2XH9 A;  3MKF A;  3QNC A;  5FAS A;  1VET B;  4ZDX A;  1PWG A;  5HWV A;  2BLS A;  1KE4 A;  4DMZ A;  4RX3 A;  1BT5 A;  2Y2N A;  4GW9 A;  2IWC A;  3HJK A;  4UA9 A;  1JWP A;  3BFG A;  3KSI A;  2I9V A;  4XXR A;  3V3R A;  3ZNY A;  2AVX A;  4XT2 B;  2VGL M;  4ARZ A;  4OPQ A;  2W27 A;  3O88 A;  1W5D A;  2PU2 A;  5DFY A;  1TD5 A;  2EX9 A;  4PKY A;  3BFF A;  1BYW A;  3U2A A;  5CTM A;  4PM9 A;  1VEU A;  3PXP A;  3PYP A;  4Y0T A;  4GOG A;  4RX2 A;  1ZG6 A;  5HD5 A;  4CLC D;  4GDN A;  3OPH A;  1LLB A;  4JBF A;  4UQI M;  2Y2G A;  3RJU A;  3MXR A;  3UY6 A;  3T4J A;  4LFU A;  3BEB A;  4CJN A;  3HLG A;  4LV1 A;  4EQ1 A;  1YMS A;  1ERQ A;  4FTX A;  1K4F A;  3IXB A;  1AXB A;  3T1R A;  3N8S A;  4NKP A;  2QYB A;  3DWZ A;  4KG2 A; 
#chains in the Genus database with same CATH homology
 3L7H A;  2JKF A;  1FIL A;  4X1L A;  3CHW P;  1VET A;  3NUL A;  1SZV A;  3LGO A;  1J3W A;  1Y4O A;  1SKO B;  1SKO A;  3KYE A;  1AWI A;  3LEQ A;  4X25 A;  5EM1 A;  3NEC A;  3CPT B;  1CF0 A;  3CPT A;  5FDS A;  3T12 B;  1PFL A;  1YPR A;  3L9K A;  2E8J A;  3MS6 A;  4D60 A;  2HZ5 A;  4ESP A;  1PRQ A;  2B95 A;  2VK3 A;  3T1X A;  1K0K A;  2JKG A;  1VET B;  1ACF A;  5FEF A;  4FUW A;  1G5U A;  4QWO A;  2PAV P;  1A0K A;  2V8F A;  1FIK A;  5FEG A;  1Z09 A;  2V8C A;  1PNE A;  3U4L P;  2ACG A;  3T1S A;  3D9Y A;  4X1M A;  2ZL1 B;  1D1J A;  2ZL1 A;  1VEU B;  1VEU A;  1CJF A;  3MSH A;  2BTF P;  1HLU P;  3T1Q B;  5EVE A;  5EM0 A;  2PBD P;  3DAV A;  5EV0 A;  3UB5 P;  4FTX A;  1CQA A;  3T1R A;  2PRF A;  1F2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...