5CTMA

Structure of bpu1 beta-lactamase
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
233
structure length
232
Chain Sequence
b'AIAWSVDEFFKNREGTFVIQEVKEKSPWVYNKKRAKERFAPQSTFVANALIGLQTGAVRDEYDIKYWDGVKREIDNWNRDHTLGSGMRDSVVWYYQAMARDIGEERMNHWVKAIHYGNKDISGGIDQFWLSSTLRISPIEQVRFLKQLYEETLPFDLKNMRTVKRMMVQEEEKHATLYGKTGSGSDIGWYVGFIKHEHKTYILATNIKGTGIEAKDITYRILKKYHLMEASV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Class D beta-lactamases do exist in Gram-positive bacteria.
pubmed doi rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
total genus 83
structure length 232
sequence length 233
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5ctmA00
3Q07A 4KZAA 1IYOA 4KG6A 3HLFA 1SKFA 4O7DA 1NYMA 1VQQA 3MKEA 2ZC4B 3NDEA 1KE3A 4OVDA 2OV5A 1KVLA 3WWXA 3E2KA 2IWCA 3ZGAB 3TSGA 4DKIA 3EQVA 3SH9A 5I94A 5HAPA 3UDIA 4ID4A 3SH8A 4GB7A 3V50A 1NRFA 5FATA 1AXBA 4UHUA 1K54C 1K55C 1Q2PA 1RGZA 4OKPA 4PPRA 4FD8A 3IXGA 4IVKA 3IT9A 1L0EA 1XKZA 4UA7A 1GA9A 1BZAA 3CZDA 2OLVA 1LL5A 2I72A 2DCFA 1ERMA 4WYYA 1GHIA 3GMWA 1MBLA 1FQGA 3E2LA 4ZTKA 2ZLYA 5EVIA 5FI7A 4RVAA 1ERQA 1PIOA 1L0GA 1PWDA 1Q2QA 3ITBA 4UA9A 2WYXA 3VMAA 4IVIA 1KDSA 1NYYA 4E3KA 2WZXA 4OP8A 2WK0A 2A3UA 2WKEA 2Y2NA 4GDNA 2IWBA 4MNRA 3ZG0A 4E3IA 3IXBA 4LV2A 5E2FA 3FYZA 3SH7A 1IYSA 4MBHA 3AGEA 4OPQA 2HDUA 5TGFA 1LLBA 4JF4A 4EV4A 3FV7A 1KE4A 3BECA 4EWFA 2HPBA 4DXCA 2EX2A 4Y7PA 2Y4AA 5TFQA 5FDHA 1C3BA 3WS4A 4DE3A 2Y2LA 3FWLA 2ZM2A 1U60A 3BLMA 1PW1A 2Y2GA 3BEBA 4HBTA 4IBXA 5BOHA 4YFMA 1FCOA 1YLWA 4MBFA 4R4RA 1EROA 3RJUA 3ZHHA 5FQ9A 3PBTA 3OCLA 1FOFA 4MLLA 4QY5A 3O87A 1BLHA 2Y91A 1HVBA 2Z2MB 5AQBA 2XR0A 2J7VA 5EUAA 2P74A 3M2KA 3TOIA 3OPRA 2WADA 3C4OA 5CEDA 3HLEA 3ZCZA 4DE1A 5KSHA 5DF8A 1NXYA 1MWTA 2ZC3B 4DDSA 2B5RA 3BFGA 4QU3A 2UWXA 3GRJA 4KQQA 4E3JA 3GV9A 4Y0TA 4N1HA 1ONHA 1XA7A 4GDBA 1RCJA 4FCFA 3M6HA 2RCXA 3A3IA 5FQMA 4QJGA 3BFDA 3A3DA 4LENA 1E25A 3OCNA 3HLWA 4S2PA 5CHMA 4HESA 4QB8A 1SDEA 5EVIB 5GLCA 5HW3A 3I7JA 4QD4A 3CMZA 2WGIA 5EE8A 3UPOA 3G32A 3MKFA 3WS0A 1FSYA 1CI8A 4U0TA 2GDNA 1XXMA 3ZFZA 1PZOA 1S0WA 3C5AA 3LO7A 4S2MA 3VOYA 1H8YA 1YQSA 3SOIA 4WMCA 1M40A 2ZC6B 4OQIA 4X68A 3ISGA 4OPRA 4ZBEA 1KGFA 4BQMA 5FA7A 1K54A 2C5WB 2XD1A 3IH9A 1LHYA 4WELA 3IF5A 2DRWA 4OQGA 1OMEA 5G18A 4DF6A 4JLFA 1YT4A 4NK3A 4X53A 3V3SA 2XLNA 4KZ3A 5CGSA 1J9MA 2R9WA 3GVBA 1MY8A 2J8YA 2XGNA 4XUXA 4L0LA 4ZAMA 3NIAA 4K0XA 1VM1A 4S2IA 1K57C 5FAOA 1L0FA 5FI2A 1IKGA 5M19A 2PU4A 2ZQAA 3PAGA 4JKTA 4S2LA 3P09A 3BFCA 2XEPA 2X01A 3HLGA 3N4IA 3OPLA 2VGKA 1IYPA 3V3RA 2EFUA 4UA6A 2ZJ9A 2H0YA 4KZ6A 5EVID 4BD1A 4FH2A 3PBQA 5GHYA 5DTKA 1PI5A 2V2FF 1XX2A 5AQAA 2H5SA 5F82A 3BFEA 1XGJA 2QPNA 2ZM8A 3W8KA 1JWVA 2WGWA 1YLPA 4PM5A 3V5MA 4JXSA 2R9XA 2WZZA 2Y2IA 4GKUA 5U47A 4HEFA 3UDXA 2ZQ7A 2HP6A 4KZ5A 2JC7A 1XA1A 3DWKA 4KENB 1EWZA 1K25A 1EI5A 3Q1FA 4P6BA 4S2NC 1L2SA 4XUZA 3HUMA 5GLAA 3CJMA 1IEMA 3OZHA 3A3EA 3TG9A 5KSCA 4RA7A 1DY6A 3G2ZA 4OLDA 3VFHA 3VP4A 2Y2OA 3UO9A 3SS5A 4Y0OA 1PWGA 1G68A 3UE3A 1SDNA 4EBPA 4R3JA 1ALQA 5F83A 4OOYA 2IWDA 1DJCA 2V1ZA 3IHAA 2ZC5B 1BULA 1NY0A 1ZG4A 4MEZA 3VSLA 5A90A 4HBUA 5F1FA 5E2EA 5EPHA 4CJNA 2XK1A 3BLSA 3ZDJA 1YLYA 1MWUA 3G35A 1PWCA 4GNUA 4OP5A 4X69A 1MKIA 4N9LA 1LL9A 2EXAA 2EX6A 2ZQ9A 3UN7A 4OPZA 4U3TA 1YMSA 5DF9A 3HBRA 1ES5A 4EBLA 3ZVWA 1FCMA 3BYDA 1GCEA 1L0DA 1IKIA 3WS2A 4BLMA 3A3JA 3VFFA 4C3QA 4OLGA 4GD6A 4R3BA 5TR7A 4WEJA 4BL2A 2XH9A 5HFOA 3UY6A 5GLBA 3DW0A 3PTEA 5CHJA 5EOEA 3ZNTA 2Z2LB 4JPMA 5E43A 4PM9A 1RGYA 5DF7A 3HUNA 4D2OA 5CEBA 1Z6FA 1JWZA 1FR6A 2XFSA 2J9OA 4WEKA 2WAEA 3IWIA 1E3UA 3NY4A 5HARA 3D4FA 1BLPA 2ZQCA 3HUOA 3N8LA 2CC1A 1ZC2A 3AGDA 1WE4A 4WMCD 2ZC7A 3O3VA 4C6YA 2WGWB 1K57A 3LCEA 3DTMA 4IBRA 1ES4A 3G2YA 5L2FA 3NI9A 3SS4A 4DE2A 4RX3A 5CGWA 4JF5A 1GHMA 2C6WB 2XQZA 4QHCA 1TVFA 2ZD8A 4LV3A 2WKIA 3ZG5A 2HP9A 2BG1A 1G6AA 3FKVA 1NJ4A 1H8ZA 1TDGA 2Y2MA 4FH4A 2XDMA 2H0TA 3IXHA 4GN2A 1XPBA 1YLZA 4KG5A 1KDWA 2Y55A 3NBLA 3PBSA 3UE1A 5CRFA 3BFFA 3UE0A 1Y54A 1BTLA 1BUEA 2RL3A 3OC2A 4GZBA 4WZ5A 1SCWA 1NZUA 4B4ZA 3MZEA 3QNCA 3GTCA 4KG2A 4X55A 3Q81A 1YM1A 4OQ0A 1MXOA 1HD8A 3C4PA 4Q8IA 1MPLA 5CHUA 4BENA 4EUZA 3BM6A 2HDQA 4S2NA 4DE0A 4E6XA 2JCHA 5CXWA 1CI9A 5F1GA 3HL9A 2ZQ8A 3V39A 4E3LA 1JWPA 2G2WA 4X6TA 1CK3A 3ZG9B 3IF6C 3IQAA 5J8XA 1KVMA 3G34A 3PBOA 4PM7A 4JXWA 2EX8A 1HTZA 3W4PA 5AQ9A 5A93A 2OSUA 2Q9MA 3Q7ZA 5FSRA 3WS1A 1KGEA 3G31A 5M1AA 5HAIA 3VOZA 1N9BA 3VP3A 2Y2KA 3N6IA 1FCNA 3NCKA 4S2KA 3ITAA 3WRZA 1S6RA 4Y0UA 1BT5A 5EECA 5EOOA 4OOMA 1K4EA 1JTGA 2V20A 3UPNA 1W5DA 4KZ4A 1WYBA 5DVAA 2XD5A 3FZCA 5E2GA 5CECA 4E3NA 4WZ5C 1K56D 4OQHA 4P0MA 5FAQA 1FR1A 5EVLA 3VP0A 2ZMAA 4OONA 1I2SA 3N8RA 4PM8A 3DWZA 5D3OA 1W7FA 3MXSA 2WAFA 3CG5A 4K0WA 3JYIA 5DTTA 5HAQA 4LV0A 3NC8A 4GOGA 4BD0A 1ONGA 2HDSA 4XXRA 1K38A 4KZBA 3S22A 3HLCA 3M6BA 3O86A 1JVJA 3QNBA 5FQJA 4ZJ1A 3RXWA 3MFDA 1LI9A 1GA0A 2FFFB 4X56A 1XP4A 3WRTA 3QHYA 4E3OA 1KE0A 1QMEA 4JXGA 3UPPA 3EQUA 2G2UA 2XFTA 5GL9A 4LCLA 4JXVA 4UAAA 2Y2HA 4K91A 4KZ8A 4EBNA 3MZDA 2HP5A 4Z9QA 1MWSA 4C75A 1IYQA 2Q9NA 4KQRA 4LCMA 1QMFA 3S4XA 1K56A 1BSGA 4R23A 4R0QA 1XGIA 1E3UD 1DJAA 1M6KA 3HLBA 1W8YA 3IWOA 4S2OA 1MWRA 3LY3A 4N92A 3VP1A 1PW8A 1N4OA 2BLSA 3MXRA 3VP2A 1ZKJA 2A49A 4N1XA 5CERA 3ZVTA 2JE5A 3LEZA 2OLUA 5FQQA 4CPKA 5KZHA 2WKHA 4U0XA 5HX9A 4ZJ3A 5CGXA 4RYEA 1H5XA 4PMAA 2DNSA 3IH8A 1TDLA 1K4FA 4DXBA 2X71A 3HREA 2PBYA 3Q7VA 3MZFA 4M3KA 2EX9A 1HZOA 5FI6A 5JYOA 3AGFA 4QY6A 4YINA 4JF6A 4E3MA 3IF6A 2WUQA 5E2HA 1E4DA 1TEMA 3N8SA 2H10A 3MBZA 3ZG8B 4E6WA 1W8QA 3NDGA 3PBRA 5HL1A 3UNWA 1IELA 1I2WA 5DTSA 4S2JA 2J9PA 1PYYA 2P9VA 3W4OA 5EVIC 4ZJ2A 1SHVA 4DRTA 5FQIA 4WZ4A 1PI4A 2WGVA 4EQIA 1YMXA 3OPHA 5KMWA 3B3XA 4WBGA 2EXBA 5A92A 3C7UA 3M2JA 5FQKA 3IXDA 1ES3A 3UDFA 1I5QA 1YLTA 1NZOA 1FSWA 4BL3A 3HLDA 4B4XA 4GD8A 3PAEA 4IEDA 4FSFA 4DDYA 4F94A 4KQOA 4H8RA 2QZ6A 3N7WA 3HVFA 3LY4A 2PU2A 2X02A 4R4SA 5GHZA 3IWQA 1YLJA 1JTDA 4B88A 3C7VA 4R1GA 5IHVA 1CEFA 5CTNA 1K6RA 2Y59A 3A3FA 3RXXA 2Y2JA 2E8IA 3GSGA 5GLDA 1O07A 3GR2A 2ZM0A 1CEGA 1ESUA 2XF3A 2Y2QA 4PM6A 3O88A 3G30A 1W79A 4OOLA 3W4QA 4A5RA 5FASA 2JBFA 5CTMA 4ZDXA 4OPYA 3SS3A 1K55A 4JBFA 3VSKA 1WYCA 1DJBA 1LI0A 2VGJA 1KGGA 1BLSA 4KZ7A 1ESIA 1O7EA 4KZ9A 5FAPA 3WS5A 3G4PA 1ES2A 1PZPA 3OPPA 3P98A 3Q7VB 5AQ7A 3ZNYA 4P87A 3S1YA 5GHXA 4N9KA 1BLCA 1ZG6A 4OH0A 3PBNA 1RP5A 1GHPA 3IF6B 2Y2PA 3BRMA 4MBKA 4LV1A 1K6SA 4WM9A 4RX2A 3FKWA 2ZQDA 3GQZA 3IHBA 5M18A 2QMIA 5JYPA 2HDRA 2FFYA 2P9VB 4NETA 3ZG7B 5A91A 4BJPA 3Q82A 4P85A 2EFXA
chains in the Genus database with same CATH superfamily
4QPRA 3HLFA 1SKFA 4O01A 1KE3A 3D9YA 3EOIA 4Y5FA 3UDIA 1Q2PA 3T50A 1L0EA 1GA9A 1TF1A 2DCFA 1ERMA 1IFQA 2EA9A 1L0GA 5KSHA 1NYYA 1S4RA 4R38A 2B18A 4NEED 2WKEA 5L09A 1OTBA 3IX8A 4MNRA 5F69A 4E3IA 3IXBA 3CAXA 4OPQA 5TGFA 4JF4A 1KE4A 2HPBA 2EX2A 2Y4AA 1OTDA 5FDHA 3WS4A 4DE3A 3FWLA 4DJ3A 1PW1A 4JGRA 4HBTA 2PT7A 1UWPX 1YLWA 4MBFA 1EROA 4O8GA 5HSQA 4MCWA 3U2AA 2Z2MB 2J7VA 5EUAA 3R4KA 1OTIA 3HLEA 2WKRA 1MWTA 4E3JA 4KQQA 1STZA 1RCJA 2RCXA 2QJ7A 3F1PB 2VGLS 3A3DA 2ZOHA 1SDEA 4WLAA 1FSYA 1CI8A 1S0WA 4S2MA 3LEQA 3LUQA 4KQDA 1Y28A 4EUVA 2C5WB 2XD1A 3H9WA 1W63Q 4JLFA 4X53A 3V3SA 3C8CA 4Q0IA 4L0LA 3NIAA 5I5LA 4S2IA 1NWZA 5FI2A 4YNRA 4S2LA 4JKTA 2W3GA 2X01A 2Z6CA 3OPLA 2O9BA 2P08A 3TE8A 2EFUA 2W1RA 5HWVA 4UQIS 1PI5A 2VJWA 2V2FF 3KSIA 4ETXA 2H5SA 4XT2B 1TS0A 4E04A 3T4JA 3W8KA 1V9YA 2WGWA 1VETB 1YLPA 3CI6A 3NOTC 4JXSA 4DN0A 3S7PA 2BTFP 5U47A 3DBAA 2HP6A 3T1XA 1IOUA 1OJ5A 3RH8B 1XA1A 2MJ6A 1K25A 3Q1FA 4XUZA 5FEGA 3NJAA 3TG9A 3KX0X 3JPUA 4BMWA 3SS5A 1F2KA 4Y0OA 1PWGA 1SDNA 3L7HA 4R3JA 5K5BA 1ALQA 1F98A 2V1ZA 3IHAA 3VSLA 5A90A 5E2EA 2QKPA 3BLSA 4OP5A 1MKIA 2EXAA 4U3TA 1YMSA 3MXQA 2LB5A 3HBRA 1FCMA 1GSXA 1L0DA 3BYDA 4BLMA 3VFFA 4OLGA 4GD6A 5TR7A 2Y8HA 4WEJA 2XH9A 4B93A 3DW0A 2Z2LB 5E43A 4JGOA 2XFSA 4MN7A 1YSPA 2J9OA 2WAEA 3IWIA 1E3UA 3FPWA 2ZQCA 1ZC2A 4MDZA 1J3WA 2ZC7A 3P01A 1K57A 3DTMA 4IBRA 1ODVA 4HJ3A 5CGWA 1GHMA 3ZYTA 4D60A 2C6WB 1YPRA 2JKGA 2WKIA 1XJ3A 2BG1A 4G3VA 3FKVA 3B33A 1NJ4A 1H8ZA 2XDMA 2H0TA 2Y55A 3UE1A 2QYBA 1Y54A 3CUEC 4YOFA 5A8BA 4KG2A 4OQ0A 3LR5A 2JKRM 3K2NA 5DKLA 4Q8IA 4BENA 5IT5A 3BM6A 4S2NA 5F1GA 4E3LA 2ZQ8A 5EV0A 2HJEA 3NHQA 1GSWA 2KOIA 4PM7A 4HH3A 4HNBA 5AQ9A 5FSRA 3G31A 5HAIA 3N6IA 4S2KA 1FCNA 3WRZA 1BT5A 4OOMA 3MFXA 1K4EA 2ACGA 1W5DA 5DVAA 1P0ZA 5CECA 4Y17A 5FAQA 5EVLA 2D01A 4OONA 1G28A 5D3OA 3MXSA 5DTTA 3CG5A 1OT9A 4LV0A 3NC8A 1K38A 3O86A 3MFDA 2K7SA 3H7WA 1GA0A 3WRTA 3PHYA 5GL9A 4UAAA 4EBNA 4C75A 3DTKA 2W0NA 4LCMA 1QMFA 3DTIA 4L9GA 1K56A 1BSGA 4R23A 1XGIA 3PYPA 1W8YA 3IWOA 2JKTI 3LY3A 3LICA 1N4OA 3MXRA 3CPTA 2VEAA 1ZHHB 3A0RA 4GCZA 4PKYG 5KZHA 2H28A 3CLOA 2A2LA 2WKQA 1XJ6A 1TDLA 1K4FA 2KX6A 1XFQA 4NG2A 4NXGA 3Q7VA 4JGPA 3LIFA 4LGWA 1HZOA 5JYOA 3AGFA 4E3MA 5E2HA 3N8SA 1SKOA 3PBRA 3UNWA 1I2WA 5DTSA 5TBMB 2P9VA 2BASA 4ZJ2A 1SHVA 4CLCA 5HDSA 4DRTA 2DMWA 1SZVA 2WGVA 4ESPA 5IS1A 4BBVA 3U4LP 4WBGA 1ES3A 5HPFA 2LB9A 1NLYA 4DDYA 3N7WA 3HVFA 4R4SA 4B88A 1JTDA 4R1GA 3L9KA 2Y2JA 4F3LB 3GR2A 4PM6A 1A0KA 3W4QA 5FASA 4A5RA 3K3CA 5FL3A 5CTMA 3SS3A 3UE6A 1LI0A 2VGJA 1KGGA 4MN6A 1ESIA 4ETZA 3WS5A 3G4PA 2A24B 3ZNYA 4GHIB 2ZL1A 4WM9A 5DJTA 2JN7A 5HWTA 5TBMA 3VE4A 3ZQ5A 3ZG7B 3IS2B 3Q82A 2V1AA 3Q07A 3OLOA 3MQOA 3LIBA 4M4XA 3MKEA 3NDEA 4OVDA 2W3EA 3EQVA 4EERA 3V50A 5J3WA 5DKKA 1K55C 2VGLM 1RGZA 3BJNA 3C30A 4ARZB 4IVKA 1T1CA 4WYYA 2OLVA 1LL5A 1MBLA 2W3DA 2ZLYA 5EVIA 4I3JA 4RVAA 1PWDA 3ITBA 2WYXA 4IVIA 2HJ9C 2WZXA 3ICYA 4OP8A 2WK0A 3KSFA 3EEHA 3FYZA 3SH7A 1IYSA 2VK3A 1LLBA 3H82A 4Y7PA 4BBTA 2Y2LA 4Q0JA 3ZHHA 4O0PA 3OCLA 4UQIM 1BLHA 2Y91A 3TOIA 3ZCZA 4HJ6A 1NXYA 4DDSA 2J3WA 4QU3A 2UWXA 3S7QA 3T1SA 3GV9A 4Y0TA 1LSVA 4N1HA 3E4QA 4GDBA 2O9CA 2PBDP 3M6HA 3A3IA 4QJGA 5EM0A 1MKMA 1VB6A 5CHMA 4HESA 1T18A 4QB8A 3BWLA 3CMZA 3MKFA 4U0TA 4PAUA 1PZOA 3LO7A 1H8YA 1YQSA 1M40A 2YKHA 2ZC6B 4OQIA 4X68A 3ISGA 4BQMA 5FA7A 1K54A 1LHYA 4WELA 3IF5A 2JKRI 4OQGA 4I3AA 1VEUA 3MJQA 4KZ3A 5CGSA 4B9OA 2J8YA 2PR5A 2XGNA 4ZAMA 1K57C 1W63M 1L0FA 1IKGA 3BW6A 5M19A 2PU4A 3PAGA 3BFCA 3N4IA 2ZBBA 3EWKA 3A0SA 3PBQA 2GNXA 1X0OA 3VE3A 5DTKA 3VV4A 4PM5A 3V67A 2WZZA 2Y2IA 4HEFA 1K0KA 4X1LA 1ZTUA 2VX8A 4KENB 4P6BA 4S2NC 2JKTM 1L2SA 3CJMA 1IEMA 3A3EA 5LBRA 1DY6A 3W2ZA 3VP4A 3UO9A 4GW9A 4EBPA 1OT6A 4OOYA 2D02A 2ZC5B 3T1QB 3DTEA 5HD5A 5F1FA 5EPHA 1XJ2A 1MWUA 1YLYA 1PWCA 1S67L 3G35A 4GNUA 4X69A 2EX6A 3UN7A 1GCEA 1D06A 3A3JA 4CQHA 4C3QA 1Y4OA 3FG8A 5GLBA 3PTEA 5CHJA 5EOEA 5HZHA 4JPMA 2W1TA 4PM9A 4I5SA 3HUNA 3NY4A 5HARA 2CC1A 3AGDA 3R7WA 4WMCD 3O3VA 4C6YA 5C5KA 2WGWB 1V9ZA 3NI9A 4DE2A 4JF5A 2XQZA 1TVFA 2PAVP 3D3OA 3PXPA 2XROA 3ZG5A 2HP9A 5TJJA 5DFYA 4FH4A 3IXHA 3PBSA 3NBLA 2RL3A 3OC2A 3MZEA 3QNCA 3KSHA 3GTCA 4X55A 4ZRRA 1AWIA 1HD8A 5CHUA 2HDQA 4DE0A 3V39A 4X6TA 2G2WA 3KSGA 1H0MA 5J8XA 3PBOA 1XJ4A 3W4PA 5A93A 2OSUA 3Q7ZA 3IX3A 3WS1A 1N9BA 4CLCC 2Y2KA 3NCKA 4EQ1A 3TJZC 2P7JA 4KZ4A 1WYBA 2XD5A 3FZCA 5E2GA 4WZ5C 1K56D 1FR1A 2ZMAA 3GDIA 2L0WA 3QP8A 3UB8A 3F1NA 3JYIA 3LI9A 1LSWA 1Z09A 2HDSA 4PHTA 1JVJA 3RXWA 4X56A 3QHYA 3NOPC 4I39A 3EQUA 4L9EA 2XFTA 5L07A 1ACFA 4LCLA 2GX5A 2Y2HA 4GS9A 3MZDA 2XRNA 4ME4A 4LRZE 2V8FA 3S4XA 4H6JA 3CHWP 1M6KA 1DP6A 4S2OA 4N92A 3VP2A 4CPKA 3BQ8A 5F6AA 2WKHA 4U0XA 4RYEA 5AJGA 4PMAA 2DNSA 1YSQA 3IH8A 4HI4A 2X71A 2UV0E 2PBYA 5EVEA 2EX9A 4JF6A 1E4DA 3BY8A 5AVFA 2H10A 4E6WA 3ZG8B 3NDGA 2J3TC 1PYYA 5EVIC 3QP1A 3LIAA 4WL9A 4EQIA 3H7WB 3OPHA 5KMWA 3B3XA 4X1MA 3C7UA 3M2JA 3IXDA 3UDFA 3KO6A 4R6LA 1I5QA 1MC0A 2JHEA 4GD8A 4IEDA 4KQOA 2PU2A 4UEYA 3IWQA 1YLJA 3CPTB 1CEFA 5CTNA 1ESUA 2XF3A 3LGOA 3O88A 2JBFA 4ZDXA 2W27A 4JBFA 1DJBA 3P7NA 1JNUA 4KZ7A 3O5YA 4JGQA 1ES2A 3Q7VB 4N9KA 1ZG6A 2FH5A 4EXOA 3C38A 1RP5A 1GHPA 3BRMA 4LV1A 1K6SA 1SKOB 2J3TD 3T12B 2ZQDA 3GQZA 1YAXA 4NXBA 3SW1A 5M18A 2HDRA 2FFYA 2P9VB 5A91A 4MMNA 2QHKA 4CLCB 1N9OA 1TS7A 4KG6A 2W3HA 4O7DA 1NYMA 2Z6DA 2ZC4B 3WWXA 2OV5A 3ZGAB 1KVLA 2M7VA 3SH9A 5HAPA 4GB7A 2CMNA 1NRFA 5FATA 4UHUA 1K54C 3IXGA 3LIDA 3IT9A 2W3FA 1BZAA 3CZDA 2I72A 5MC7A 2GZAA 2O9AA 4ZTKA 5FI7A 1PIOA 3VMAA 4UA9A 1Q2QA 1KDSA 2VV7A 2A3UA 4IUKA 2Y2NA 2IWBA 3ZG0A 5E2FA 3BECA 2EWVA 1H3QA 4DXCA 1FILA 1C3BA 2ZM2A 1N9NA 2Y2GA 5BOHA 4YFMA 2ZL1B 3EGDC 3HJKA 4MLLA 4QY5A 3O87A 1HVBA 5AQBA 5EM1A 2P74A 3E4PA 5CEDA 1DP9A 1OJGA 4DE1A 5DF8A 2B5RA 3GRJA 1ONHA 1XA7A 3HJIA 3EEAA 3IX4A 4HIAA 2B95A 3BFDA 3OCNA 4HJ4A 3QP5A 2AVXA 2NUTC 5EVIB 3UB5P 2V1BA 1GSVA 2O0YA 4I3IA 2WGIA 4QD4A 5EE8A 3G32A 3WS0A 5KIZA 3C5AA 4ZBEA 1KGFA 4EETB 1LL8A 2DRWA 4DF6A 3KYQA 3H82B 2XLNA 1J9MA 3GVBA 3G6OA 3LI8A 4K0XA 1VM1A 5FDSA 2PYRA 1PFLA 2G7UA 3P09A 2I9VA 2XEPA 1DRMA 3V3RA 4KZ6A 3RFBA 4HY8A 4FH2A 3IBRA 3E4OA 2VKSA 3B42A 5AQAA 3BFEA 2QPNA 3OBFA 2VV6A 3V5MA 2R9XA 3MQQA 3UDXA 2ZQ7A 4G3WA 3UB9A 3DWKA 2J80A 2ZOIA 3T4QA 3LYXA 5KSCA 4EESA 1NRJA 3UE3A 2IWDA 3PR6A 1DJCA 1BULA 2OWJA 1ZG4A 3UMEA 1NLZA 2P04A 4QWOA 4DMZA 4CJNA 3RTYA 2XK1A 5IU1A 3ZDJA 4MN5A 3DAVA 4N9LA 1LL9A 2ZQ9A 1VEUB 4OPZA 5DF9A 4EBLA 1ES5A 2PD7A 3BQAA 1IKIA 3B47A 2HGVA 4KUOA 4BL2A 3MSHA 5HFOA 3CUEA 4NXEA 5DF7A 5F68A 1Z6FA 1JWZA 1FR6A 1PNEA 5G4YA 3D4FA 1BLPA 3HUOA 4HH2A 1WE4A 2O99A 3LCEA 3G2YA 3SS4A 2HF6A 4P6ZS 4HHDA 4QHCA 1TDGA 3T1RA 1XPBA 4KG5A 4HP4A 4PKYA 5CRFA 3BFFA 3UE0A 1H8MA 1BUEA 1KOUA 4GZBA 1SCWA 1NZUA 3ULFA 4B4ZA 2E8JA 3FC7A 1MXOA 3MMHA 5CXWA 1CI9A 3HL9A 3TRCA 1TS6A 3ZG9B 1KVMA 2EX8A 1HTZA 2Q9MA 1KGEA 2W1TB 3VOZA 3VP3A 3ITAA 3KYZA 1S6RA 4Y0UA 4EW7A 1JTGA 2V20A 3R7WB 5J7EA 4E3NA 4P0MA 5HD3A 1W7FA 3VOLA 4K0WA 4XXRA 4KZBA 4G3KA 3S22A 3M6BA 1P9WA 1S66L 1OTEA 1LSXA 1QMEA 4JXGA 1G6OA 2K31A 3UPPA 2G2UA 2V8CA 1MWSA 4KQRA 4NXFA 4R0QA 1E3UD 1DJAA 3HLBA 1BYWA 1PW8A 1UGUA 1ZKJA 4N1XA 5CERA 2GJ3A 5FQQA 2INWA 3GECA 5HX9A 4ZJ3A 1H5XA 1XFNA 4DXBA 3MZFA 2VZWA 4QY6A 5AVEA 3IF6A 2WUQA 2ZMVA 1TEMA 4RQ9A 3MBZA 3CWFA 1W8QA 3F1NB 2J9PA 3W4OA 1PI4A 4KUKA 3F1OB 2EXBA 5HWWA 5FQKA 1D7EA 4GS9B 1NZOA 1FSWA 3EGXC 3HLDA 1PRQA 4H6JB 4FSFA 4F94A 4H8RA 3NULA 2X02A 4FTXA 3C7VA 5IHVA 1K6RA 3A3FA 2E8IA 5GLDA 1O07A 2ZM0A 5HL6A 2Y2QA 1W79A 4WF0A 4OPYA 1K55A 3S7OA 1D1JA 3QP2A 4KZ9A 5FAPA 3OPPA 3P98A 5AQ7A 2V9AA 1N9LA 4P87A 3K3DA 3S1YA 4OH0A 3JVUA 4RX2A 4LLOB 3FKWA 5JYPA 2M1CA 3LFVA 4NETA 2PD8A 4KZAA 3F1OA 1IYOA 5F5YA 1VQQA 5I94A 3E2KA 2IWCA 4DKIA 3TSGA 1UWNX 4ID4A 1S1YA 3SH8A 1S1ZA 1AXBA 3SZTA 4OKPA 3F1PA 4PPRA 4FD8A 1XKZA 4UA7A 5HPIA 4II7A 1GHIA 3GMWA 1FQGA 3E2LA 1ERQA 3D72A 5L8MA 4WN5A 5HDCA 4K08A 4E3KA 4GDNA 4LRYC 3MF0A 1VHMA 4LV2A 2OWHA 4MBHA 4CLCD 3AGEA 4EV4A 2HDUA 3FV7A 4EWFA 1F9IA 5TFQA 2Q0OA 1U60A 3BLMA 3BEBA 4IBXA 1FCOA 4R4RA 3RJUA 5FQ9A 3PBTA 4IJGA 1FOFA 2HV1A 4LFUA 2XR0A 3M2KA 4BBUA 3OPRA 2WADA 2L1MA 3C4OA 2EWWA 2ZC3B 4XT2A 4FUWA 3BFGA 1VETA 4Q0HA 4Z1WA 3KYEA 3MR0A 4FCFA 5FQMA 4LPZA 4LENA 1E25A 3HLWA 4S2PA 5GLCA 5HW3A 3I7JA 4BWIA 3C2WA 3UPOA 3BY9A 3ZFZA 2GDNA 1XXMA 3VOYA 3SOIA 4WMCA 3FPVA 4OPRA 3IH9A 1OMEA 5G18A 1YT4A 4NK3A 4Y15A 2R9WA 1MY8A 4YWZA 4XUXA 2HZ5A 4Y2FA 5FAOA 3LR0A 2ZQAA 3TW8A 3HLGA 4WUJA 2VA0A 2VGKA 1IYPA 2IA2A 4UA6A 2ZJ9A 2H0YA 5EVID 2R78A 1LT0A 4BD1A 5GHYA 1XX2A 5F82A 1XGJA 2ZM8A 1JWVA 4P6ZM 4GKUA 3T4KA 4KZ5A 2JC7A 1T19A 1EWZA 1EI5A 5G4ZA 1T1AA 3HUMA 5GLAA 3OZHA 4RA7A 3G2ZA 4OLDA 3VFHA 4LRXC 2Y2OA 2OAQ1 1G68A 4IUHA 5F83A 1OTAA 4Y13A 3MQ0A 1NY0A 4MEZA 2WKPA 5CX7A 4HBUA 4R70A 1T1BA 3LR4A 5J4EA 3ZVWA 3WS2A 4HOIA 2V0UA 1WA9A 2K2NA 4R3BA 4EU0A 3UY6A 5DJUA 3ZNTA 3T4SA 2VV8A 2XA7M 1RGYA 4D2OA 5CEBA 2YKFA 4WEKA 3A0VA 3N8LA 4CLCE 2QWSA 5L2FA 1ES4A 1F5MA 4RX3A 3E0YA 2OOLA 3JVVA 2ZD8A 4AFIA 4LV3A 1G6AA 2Y2MA 4GN2A 1YLZA 1KDWA 1BTLA 3OOVA 4WZ5A 4HQAA 1CQAA 3Q81A 1YM1A 3C4PA 1MPLA 4EUZA 5HDDA 1YKDA 4E6XA 5L10A 2JCHA 1JWPA 1CK3A 1FIKA 3IF6C 3IQAA 3G34A 4JXWA 4L9FA 1S4SA 3S7NA 5M1AA 3NECA 5EECA 1CJFA 5EOOA 1P9RA 3UPNA 2ZMFA 4GLQA 4OQHA 3VP0A 1I2SA 3N8RA 4PM8A 3DWZA 2VLGA 3UB6A 2WAFA 2PDRA 5HAQA 4GOGA 4BD0A 1ONGA 3HLCA 3QNBA 5FQJA 4ZJ1A 1HLUP 1LI9A 2FFFB 4E3OA 1XP4A 1KE0A 3UMDA 3QP6A 4JXVA 4K91A 4KZ8A 2NUPC 2HP5A 4Z9QA 1IYQA 2Q9NA 2Y79A 1P97A 2KLIA 2PYPA 1MWRA 2JKFA 3VP1A 2BLSA 1TS8A 2A49A 3ZVTA 4F3LA 2JE5A 2QJ5A 3LEZA 2OLUA 3T4LA 5CGXA 3E98A 3HCYA 2FZ0A 3HREA 4GJ4A 1MZUA 2XSSA 4DJ2A 2A24A 4M3KA 5EFWA 5FI6A 4GHIA 4YINA 3QP4A 1CF0A 5HL1A 5FEFA 1IELA 2PHYA 4FOFA 4S2JA 3T4OA 1G5UA 3IS2A 5FQIA 4WZ4A 4R3AA 1YMXA 5DFXA 1TD5A 5A92A 1DP8A 3LR3A 4X25A 1YLTA 4BL3A 4B4XA 4ARZA 2L4RA 3LIEA 3PAEA 3UB7A 2QZ6A 5GHZA 3LY4A 2PR6A 4I38A 2Y59A 3RXXA 3GSGA 3NOUC 1CEGA 3CITA 3T4TA 4OOLA 3G30A 2OAP1 1L3LA 2XA7S 2B02A 3IBJA 3VSKA 1WYCA 1BLSA 1O7EA 1PZPA 4Y3IA 2V0WA 2M7UA 4EEUA 2KDKA 5GHXA 1BLCA 3PBNA 4EEPA 3IF6B 2Y2PA 4HP9A 4MBKA 1OPXA 2PRFA 3IHBA 2QMIA 1EW0A 3MS6A 4NKPA 4BJPA 4IHQA 4P85A 2EFXA
chains in the Genus database with same CATH topology
3Q07A 4KZAA 1IYOA 4KG6A 3HLFA 1SKFA 4O7DA 1NYMA 1VQQA 3MKEA 2ZC4B 3NDEA 1KE3A 4OVDA 2OV5A 1KVLA 3WWXA 3E2KA 2IWCA 3ZGAB 3TSGA 4DKIA 3EQVA 3SH9A 5I94A 5HAPA 3UDIA 4ID4A 3SH8A 4GB7A 3V50A 1NRFA 5FATA 1AXBA 4UHUA 1K54C 1K55C 1Q2PA 1RGZA 4OKPA 4PPRA 4FD8A 3IXGA 4IVKA 3IT9A 1L0EA 1XKZA 4UA7A 1GA9A 1BZAA 3CZDA 2OLVA 1LL5A 2I72A 2DCFA 1ERMA 4WYYA 1GHIA 3GMWA 1MBLA 1FQGA 3E2LA 4ZTKA 2ZLYA 5EVIA 5FI7A 4RVAA 1ERQA 1PIOA 1L0GA 1PWDA 1Q2QA 3ITBA 4UA9A 2WYXA 3VMAA 4IVIA 1KDSA 1NYYA 4E3KA 2WZXA 4OP8A 2WK0A 2A3UA 2WKEA 2Y2NA 4GDNA 2IWBA 4MNRA 3ZG0A 4E3IA 3IXBA 4LV2A 5E2FA 3FYZA 3SH7A 1IYSA 4MBHA 3AGEA 4OPQA 2HDUA 5TGFA 1LLBA 4JF4A 4EV4A 3FV7A 1KE4A 3BECA 4EWFA 2HPBA 4DXCA 2EX2A 4Y7PA 2Y4AA 5TFQA 5FDHA 1C3BA 3WS4A 4DE3A 2Y2LA 3FWLA 2ZM2A 1U60A 3BLMA 1PW1A 2Y2GA 3BEBA 4HBTA 4IBXA 5BOHA 4YFMA 1FCOA 1YLWA 4MBFA 4R4RA 1EROA 3RJUA 3ZHHA 5FQ9A 3PBTA 3OCLA 1FOFA 4MLLA 4QY5A 3O87A 1BLHA 2Y91A 1HVBA 2Z2MB 5AQBA 2XR0A 2J7VA 5EUAA 2P74A 3M2KA 3TOIA 3OPRA 2WADA 3C4OA 5CEDA 3HLEA 3ZCZA 4DE1A 5KSHA 5DF8A 1NXYA 1MWTA 2ZC3B 4DDSA 2B5RA 3BFGA 4QU3A 2UWXA 3GRJA 4KQQA 4E3JA 3GV9A 4Y0TA 4N1HA 1ONHA 1XA7A 4GDBA 1RCJA 4FCFA 3M6HA 2RCXA 3A3IA 5FQMA 4QJGA 3BFDA 3A3DA 4LENA 1E25A 3OCNA 3HLWA 4S2PA 5CHMA 4HESA 4QB8A 1SDEA 5EVIB 5GLCA 5HW3A 3I7JA 4QD4A 3CMZA 2WGIA 5EE8A 3UPOA 3G32A 3MKFA 3WS0A 1FSYA 1CI8A 4U0TA 2GDNA 1XXMA 3ZFZA 1PZOA 1S0WA 3C5AA 3LO7A 4S2MA 3VOYA 1H8YA 1YQSA 3SOIA 4WMCA 1M40A 2ZC6B 4OQIA 4X68A 3ISGA 4OPRA 4ZBEA 1KGFA 4BQMA 5FA7A 1K54A 2C5WB 2XD1A 3IH9A 1LHYA 4WELA 3IF5A 2DRWA 4OQGA 1OMEA 5G18A 4DF6A 4JLFA 1YT4A 4NK3A 4X53A 3V3SA 2XLNA 4KZ3A 5CGSA 1J9MA 2R9WA 3GVBA 1MY8A 2J8YA 2XGNA 4XUXA 4L0LA 4ZAMA 3NIAA 4K0XA 1VM1A 4S2IA 1K57C 5FAOA 1L0FA 5FI2A 1IKGA 5M19A 2PU4A 2ZQAA 3PAGA 4JKTA 4S2LA 3P09A 3BFCA 2XEPA 2X01A 3HLGA 3N4IA 3OPLA 2VGKA 1IYPA 3V3RA 2EFUA 4UA6A 2ZJ9A 2H0YA 4KZ6A 5EVID 4BD1A 4FH2A 3PBQA 5GHYA 5DTKA 1PI5A 2V2FF 1XX2A 5AQAA 2H5SA 5F82A 3BFEA 1XGJA 2QPNA 2ZM8A 3W8KA 1JWVA 2WGWA 1YLPA 4PM5A 3V5MA 4JXSA 2R9XA 2WZZA 2Y2IA 4GKUA 5U47A 4HEFA 3UDXA 2ZQ7A 2HP6A 4KZ5A 2JC7A 1XA1A 3DWKA 4KENB 1EWZA 1K25A 1EI5A 3Q1FA 4P6BA 4S2NC 1L2SA 4XUZA 3HUMA 5GLAA 3CJMA 1IEMA 3OZHA 3A3EA 3TG9A 5KSCA 4RA7A 1DY6A 3G2ZA 4OLDA 3VFHA 3VP4A 2Y2OA 3UO9A 3SS5A 4Y0OA 1PWGA 1G68A 3UE3A 1SDNA 4EBPA 4R3JA 1ALQA 5F83A 4OOYA 2IWDA 1DJCA 2V1ZA 3IHAA 2ZC5B 1BULA 1NY0A 1ZG4A 4MEZA 3VSLA 5A90A 4HBUA 5F1FA 5E2EA 5EPHA 4CJNA 2XK1A 3BLSA 3ZDJA 1YLYA 1MWUA 3G35A 1PWCA 4GNUA 4OP5A 4X69A 1MKIA 4N9LA 1LL9A 2EXAA 2EX6A 2ZQ9A 3UN7A 4OPZA 4U3TA 1YMSA 5DF9A 3HBRA 1ES5A 4EBLA 3ZVWA 1FCMA 3BYDA 1GCEA 1L0DA 1IKIA 3WS2A 4BLMA 3A3JA 3VFFA 4C3QA 4OLGA 4GD6A 4R3BA 5TR7A 4WEJA 4BL2A 2XH9A 5HFOA 3UY6A 5GLBA 3DW0A 3PTEA 5CHJA 5EOEA 3ZNTA 2Z2LB 4JPMA 5E43A 4PM9A 1RGYA 5DF7A 3HUNA 4D2OA 5CEBA 1Z6FA 1JWZA 1FR6A 2XFSA 2J9OA 4WEKA 2WAEA 3IWIA 1E3UA 3NY4A 5HARA 3D4FA 1BLPA 2ZQCA 3HUOA 3N8LA 2CC1A 1ZC2A 3AGDA 1WE4A 4WMCD 2ZC7A 3O3VA 4C6YA 2WGWB 1K57A 3LCEA 3DTMA 4IBRA 1ES4A 3G2YA 5L2FA 3NI9A 3SS4A 4DE2A 4RX3A 5CGWA 4JF5A 1GHMA 2C6WB 2XQZA 4QHCA 1TVFA 2ZD8A 4LV3A 2WKIA 3ZG5A 2HP9A 2BG1A 1G6AA 3FKVA 1NJ4A 1H8ZA 1TDGA 2Y2MA 4FH4A 2XDMA 2H0TA 3IXHA 4GN2A 1XPBA 1YLZA 4KG5A 1KDWA 2Y55A 3NBLA 3PBSA 3UE1A 5CRFA 3BFFA 3UE0A 1Y54A 1BTLA 1BUEA 2RL3A 3OC2A 4GZBA 4WZ5A 1SCWA 1NZUA 4B4ZA 3MZEA 3QNCA 3GTCA 4KG2A 4X55A 3Q81A 1YM1A 4OQ0A 1MXOA 1HD8A 3C4PA 4Q8IA 1MPLA 5CHUA 4BENA 4EUZA 3BM6A 2HDQA 4S2NA 4DE0A 4E6XA 2JCHA 5CXWA 1CI9A 5F1GA 3HL9A 2ZQ8A 3V39A 4E3LA 1JWPA 2G2WA 4X6TA 1CK3A 3ZG9B 3IF6C 3IQAA 5J8XA 1KVMA 3G34A 3PBOA 4PM7A 4JXWA 2EX8A 1HTZA 3W4PA 5AQ9A 5A93A 2OSUA 2Q9MA 3Q7ZA 5FSRA 3WS1A 1KGEA 3G31A 5M1AA 5HAIA 3VOZA 1N9BA 3VP3A 2Y2KA 3N6IA 1FCNA 3NCKA 4S2KA 3ITAA 3WRZA 1S6RA 4Y0UA 1BT5A 5EECA 5EOOA 4OOMA 1K4EA 1JTGA 2V20A 3UPNA 1W5DA 4KZ4A 1WYBA 5DVAA 2XD5A 3FZCA 5E2GA 5CECA 4E3NA 4WZ5C 1K56D 4OQHA 4P0MA 5FAQA 1FR1A 5EVLA 3VP0A 2ZMAA 4OONA 1I2SA 3N8RA 4PM8A 3DWZA 5D3OA 1W7FA 3MXSA 2WAFA 3CG5A 4K0WA 3JYIA 5DTTA 5HAQA 4LV0A 3NC8A 4GOGA 4BD0A 1ONGA 2HDSA 4XXRA 1K38A 4KZBA 3S22A 3HLCA 3M6BA 3O86A 1JVJA 3QNBA 5FQJA 4ZJ1A 3RXWA 3MFDA 1LI9A 1GA0A 2FFFB 4X56A 1XP4A 3WRTA 3QHYA 4E3OA 1KE0A 1QMEA 4JXGA 3UPPA 3EQUA 2G2UA 2XFTA 5GL9A 4LCLA 4JXVA 4UAAA 2Y2HA 4K91A 4KZ8A 4EBNA 3MZDA 2HP5A 4Z9QA 1MWSA 4C75A 1IYQA 2Q9NA 4KQRA 4LCMA 1QMFA 3S4XA 1K56A 1BSGA 4R23A 4R0QA 1XGIA 1E3UD 1DJAA 1M6KA 3HLBA 1W8YA 3IWOA 4S2OA 1MWRA 3LY3A 4N92A 3VP1A 1PW8A 1N4OA 2BLSA 3MXRA 3VP2A 1ZKJA 2A49A 4N1XA 5CERA 3ZVTA 2JE5A 3LEZA 2OLUA 5FQQA 4CPKA 5KZHA 2WKHA 4U0XA 5HX9A 4ZJ3A 5CGXA 4RYEA 1H5XA 4PMAA 2DNSA 3IH8A 1TDLA 1K4FA 4DXBA 2X71A 3HREA 2PBYA 3Q7VA 3MZFA 4M3KA 2EX9A 1HZOA 5FI6A 5JYOA 3AGFA 4QY6A 4YINA 4JF6A 4E3MA 3IF6A 2WUQA 5E2HA 1E4DA 1TEMA 3N8SA 2H10A 3MBZA 3ZG8B 4E6WA 1W8QA 3NDGA 3PBRA 5HL1A 3UNWA 1IELA 1I2WA 5DTSA 4S2JA 2J9PA 1PYYA 2P9VA 3W4OA 5EVIC 4ZJ2A 1SHVA 4DRTA 5FQIA 4WZ4A 1PI4A 2WGVA 4EQIA 1YMXA 3OPHA 5KMWA 3B3XA 4WBGA 2EXBA 5A92A 3C7UA 3M2JA 5FQKA 3IXDA 1ES3A 3UDFA 1I5QA 1YLTA 1NZOA 1FSWA 4BL3A 3HLDA 4B4XA 4GD8A 3PAEA 4IEDA 4FSFA 4DDYA 4F94A 4KQOA 4H8RA 2QZ6A 3N7WA 3HVFA 3LY4A 2PU2A 2X02A 4R4SA 5GHZA 3IWQA 1YLJA 1JTDA 4B88A 3C7VA 4R1GA 5IHVA 1CEFA 5CTNA 1K6RA 2Y59A 3A3FA 3RXXA 2Y2JA 2E8IA 3GSGA 5GLDA 1O07A 3GR2A 2ZM0A 1CEGA 1ESUA 2XF3A 2Y2QA 4PM6A 3O88A 3G30A 1W79A 4OOLA 3W4QA 4A5RA 5FASA 2JBFA 5CTMA 4ZDXA 4OPYA 3SS3A 1K55A 4JBFA 3VSKA 1WYCA 1DJBA 1LI0A 2VGJA 1KGGA 1BLSA 4KZ7A 1ESIA 1O7EA 4KZ9A 5FAPA 3WS5A 3G4PA 1ES2A 1PZPA 3OPPA 3P98A 3Q7VB 5AQ7A 3ZNYA 4P87A 3S1YA 5GHXA 4N9KA 1BLCA 1ZG6A 4OH0A 3PBNA 1RP5A 1GHPA 3IF6B 2Y2PA 3BRMA 4MBKA 4LV1A 1K6SA 4WM9A 4RX2A 3FKWA 2ZQDA 3GQZA 3IHBA 5M18A 2QMIA 5JYPA 2HDRA 2FFYA 2P9VB 4NETA 3ZG7B 5A91A 4BJPA 3Q82A 4P85A 2EFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q07 A;  4KZA A;  1IYO A;  4KG6 A;  3HLF A;  1SKF A;  4O7D A;  1NYM A;  1VQQ A;  3MKE A;  2ZC4 B;  3NDE A;  1KE3 A;  4OVD A;  2OV5 A;  1KVL A;  3WWX A;  3E2K A;  2IWC A;  3ZGA B;  3TSG A;  4DKI A;  3EQV A;  3SH9 A;  5I94 A;  5HAP A;  3UDI A;  4ID4 A;  3SH8 A;  4GB7 A;  3V50 A;  1NRF A;  5FAT A;  1AXB A;  4UHU A;  1K54 C;  1K55 C;  1Q2P A;  1RGZ A;  4OKP A;  4PPR A;  4FD8 A;  3IXG A;  4IVK A;  3IT9 A;  1L0E A;  1XKZ A;  4UA7 A;  1GA9 A;  1BZA A;  3CZD A;  2OLV A;  1LL5 A;  2I72 A;  2DCF A;  1ERM A;  4WYY A;  1GHI A;  3GMW A;  1MBL A;  1FQG A;  3E2L A;  4ZTK A;  2ZLY A;  5EVI A;  5FI7 A;  4RVA A;  1ERQ A;  1PIO A;  1L0G A;  1PWD A;  1Q2Q A;  3ITB A;  4UA9 A;  2WYX A;  3VMA A;  4IVI A;  1KDS A;  1NYY A;  4E3K A;  2WZX A;  4OP8 A;  2WK0 A;  2A3U A;  2WKE A;  2Y2N A;  4GDN A;  2IWB A;  4MNR A;  3ZG0 A;  4E3I A;  3IXB A;  4LV2 A;  5E2F A;  3FYZ A;  3SH7 A;  1IYS A;  4MBH A;  3AGE A;  4OPQ A;  2HDU A;  5TGF A;  1LLB A;  4JF4 A;  4EV4 A;  3FV7 A;  1KE4 A;  3BEC A;  4EWF A;  2HPB A;  4DXC A;  2EX2 A;  4Y7P A;  2Y4A A;  5TFQ A;  5FDH A;  1C3B A;  3WS4 A;  4DE3 A;  2Y2L A;  3FWL A;  2ZM2 A;  1U60 A;  3BLM A;  1PW1 A;  2Y2G A;  3BEB A;  4HBT A;  4IBX A;  5BOH A;  4YFM A;  1FCO A;  1YLW A;  4MBF A;  4R4R A;  1ERO A;  3RJU A;  3ZHH A;  5FQ9 A;  3PBT A;  3OCL A;  1FOF A;  4MLL A;  4QY5 A;  3O87 A;  1BLH A;  2Y91 A;  1HVB A;  2Z2M B;  5AQB A;  2XR0 A;  2J7V A;  5EUA A;  2P74 A;  3M2K A;  3TOI A;  3OPR A;  2WAD A;  3C4O A;  5CED A;  3HLE A;  3ZCZ A;  4DE1 A;  5KSH A;  5DF8 A;  1NXY A;  1MWT A;  2ZC3 B;  4DDS A;  2B5R A;  3BFG A;  4QU3 A;  2UWX A;  3GRJ A;  4KQQ A;  4E3J A;  3GV9 A;  4Y0T A;  4N1H A;  1ONH A;  1XA7 A;  4GDB A;  1RCJ A;  4FCF A;  3M6H A;  2RCX A;  3A3I A;  5FQM A;  4QJG A;  3BFD A;  3A3D A;  4LEN A;  1E25 A;  3OCN A;  3HLW A;  4S2P A;  5CHM A;  4HES A;  4QB8 A;  1SDE A;  5EVI B;  5GLC A;  5HW3 A;  3I7J A;  4QD4 A;  3CMZ A;  2WGI A;  5EE8 A;  3UPO A;  3G32 A;  3MKF A;  3WS0 A;  1FSY A;  1CI8 A;  4U0T A;  2GDN A;  1XXM A;  3ZFZ A;  1PZO A;  1S0W A;  3C5A A;  3LO7 A;  4S2M A;  3VOY A;  1H8Y A;  1YQS A;  3SOI A;  4WMC A;  1M40 A;  2ZC6 B;  4OQI A;  4X68 A;  3ISG A;  4OPR A;  4ZBE A;  1KGF A;  4BQM A;  5FA7 A;  1K54 A;  2C5W B;  2XD1 A;  3IH9 A;  1LHY A;  4WEL A;  3IF5 A;  2DRW A;  4OQG A;  1OME A;  5G18 A;  4DF6 A;  4JLF A;  1YT4 A;  4NK3 A;  4X53 A;  3V3S A;  2XLN A;  4KZ3 A;  5CGS A;  1J9M A;  2R9W A;  3GVB A;  1MY8 A;  2J8Y A;  2XGN A;  4XUX A;  4L0L A;  4ZAM A;  3NIA A;  4K0X A;  1VM1 A;  4S2I A;  1K57 C;  5FAO A;  1L0F A;  5FI2 A;  1IKG A;  5M19 A;  2PU4 A;  2ZQA A;  3PAG A;  4JKT A;  4S2L A;  3P09 A;  3BFC A;  2XEP A;  2X01 A;  3HLG A;  3N4I A;  3OPL A;  2VGK A;  1IYP A;  3V3R A;  2EFU A;  4UA6 A;  2ZJ9 A;  2H0Y A;  4KZ6 A;  5EVI D;  4BD1 A;  4FH2 A;  3PBQ A;  5GHY A;  5DTK A;  1PI5 A;  2V2F F;  1XX2 A;  5AQA A;  2H5S A;  5F82 A;  3BFE A;  1XGJ A;  2QPN A;  2ZM8 A;  3W8K A;  1JWV A;  2WGW A;  1YLP A;  4PM5 A;  3V5M A;  4JXS A;  2R9X A;  2WZZ A;  2Y2I A;  4GKU A;  5U47 A;  4HEF A;  3UDX A;  2ZQ7 A;  2HP6 A;  4KZ5 A;  2JC7 A;  1XA1 A;  3DWK A;  4KEN B;  1EWZ A;  1K25 A;  1EI5 A;  3Q1F A;  4P6B A;  4S2N C;  1L2S A;  4XUZ A;  3HUM A;  5GLA A;  3CJM A;  1IEM A;  3OZH A;  3A3E A;  3TG9 A;  5KSC A;  4RA7 A;  1DY6 A;  3G2Z A;  4OLD A;  3VFH A;  3VP4 A;  2Y2O A;  3UO9 A;  3SS5 A;  4Y0O A;  1PWG A;  1G68 A;  3UE3 A;  1SDN A;  4EBP A;  4R3J A;  1ALQ A;  5F83 A;  4OOY A;  2IWD A;  1DJC A;  2V1Z A;  3IHA A;  2ZC5 B;  1BUL A;  1NY0 A;  1ZG4 A;  4MEZ A;  3VSL A;  5A90 A;  4HBU A;  5F1F A;  5E2E A;  5EPH A;  4CJN A;  2XK1 A;  3BLS A;  3ZDJ A;  1YLY A;  1MWU A;  3G35 A;  1PWC A;  4GNU A;  4OP5 A;  4X69 A;  1MKI A;  4N9L A;  1LL9 A;  2EXA A;  2EX6 A;  2ZQ9 A;  3UN7 A;  4OPZ A;  4U3T A;  1YMS A;  5DF9 A;  3HBR A;  1ES5 A;  4EBL A;  3ZVW A;  1FCM A;  3BYD A;  1GCE A;  1L0D A;  1IKI A;  3WS2 A;  4BLM A;  3A3J A;  3VFF A;  4C3Q A;  4OLG A;  4GD6 A;  4R3B A;  5TR7 A;  4WEJ A;  4BL2 A;  2XH9 A;  5HFO A;  3UY6 A;  5GLB A;  3DW0 A;  3PTE A;  5CHJ A;  5EOE A;  3ZNT A;  2Z2L B;  4JPM A;  5E43 A;  4PM9 A;  1RGY A;  5DF7 A;  3HUN A;  4D2O A;  5CEB A;  1Z6F A;  1JWZ A;  1FR6 A;  2XFS A;  2J9O A;  4WEK A;  2WAE A;  3IWI A;  1E3U A;  3NY4 A;  5HAR A;  3D4F A;  1BLP A;  2ZQC A;  3HUO A;  3N8L A;  2CC1 A;  1ZC2 A;  3AGD A;  1WE4 A;  4WMC D;  2ZC7 A;  3O3V A;  4C6Y A;  2WGW B;  1K57 A;  3LCE A;  3DTM A;  4IBR A;  1ES4 A;  3G2Y A;  5L2F A;  3NI9 A;  3SS4 A;  4DE2 A;  4RX3 A;  5CGW A;  4JF5 A;  1GHM A;  2C6W B;  2XQZ A;  4QHC A;  1TVF A;  2ZD8 A;  4LV3 A;  2WKI A;  3ZG5 A;  2HP9 A;  2BG1 A;  1G6A A;  3FKV A;  1NJ4 A;  1H8Z A;  1TDG A;  2Y2M A;  4FH4 A;  2XDM A;  2H0T A;  3IXH A;  4GN2 A;  1XPB A;  1YLZ A;  4KG5 A;  1KDW A;  2Y55 A;  3NBL A;  3PBS A;  3UE1 A;  5CRF A;  3BFF A;  3UE0 A;  1Y54 A;  1BTL A;  1BUE A;  2RL3 A;  3OC2 A;  4GZB A;  4WZ5 A;  1SCW A;  1NZU A;  4B4Z A;  3MZE A;  3QNC A;  3GTC A;  4KG2 A;  4X55 A;  3Q81 A;  1YM1 A;  4OQ0 A;  1MXO A;  1HD8 A;  3C4P A;  4Q8I A;  1MPL A;  5CHU A;  4BEN A;  4EUZ A;  3BM6 A;  2HDQ A;  4S2N A;  4DE0 A;  4E6X A;  2JCH A;  5CXW A;  1CI9 A;  5F1G A;  3HL9 A;  2ZQ8 A;  3V39 A;  4E3L A;  1JWP A;  2G2W A;  4X6T A;  1CK3 A;  3ZG9 B;  3IF6 C;  3IQA A;  5J8X A;  1KVM A;  3G34 A;  3PBO A;  4PM7 A;  4JXW A;  2EX8 A;  1HTZ A;  3W4P A;  5AQ9 A;  5A93 A;  2OSU A;  2Q9M A;  3Q7Z A;  5FSR A;  3WS1 A;  1KGE A;  3G31 A;  5M1A A;  5HAI A;  3VOZ A;  1N9B A;  3VP3 A;  2Y2K A;  3N6I A;  1FCN A;  3NCK A;  4S2K A;  3ITA A;  3WRZ A;  1S6R A;  4Y0U A;  1BT5 A;  5EEC A;  5EOO A;  4OOM A;  1K4E A;  1JTG A;  2V20 A;  3UPN A;  1W5D A;  4KZ4 A;  1WYB A;  5DVA A;  2XD5 A;  3FZC A;  5E2G A;  5CEC A;  4E3N A;  4WZ5 C;  1K56 D;  4OQH A;  4P0M A;  5FAQ A;  1FR1 A;  5EVL A;  3VP0 A;  2ZMA A;  4OON A;  1I2S A;  3N8R A;  4PM8 A;  3DWZ A;  5D3O A;  1W7F A;  3MXS A;  2WAF A;  3CG5 A;  4K0W A;  3JYI A;  5DTT A;  5HAQ A;  4LV0 A;  3NC8 A;  4GOG A;  4BD0 A;  1ONG A;  2HDS A;  4XXR A;  1K38 A;  4KZB A;  3S22 A;  3HLC A;  3M6B A;  3O86 A;  1JVJ A;  3QNB A;  5FQJ A;  4ZJ1 A;  3RXW A;  3MFD A;  1LI9 A;  1GA0 A;  2FFF B;  4X56 A;  1XP4 A;  3WRT A;  3QHY A;  4E3O A;  1KE0 A;  1QME A;  4JXG A;  3UPP A;  3EQU A;  2G2U A;  2XFT A;  5GL9 A;  4LCL A;  4JXV A;  4UAA A;  2Y2H A;  4K91 A;  4KZ8 A;  4EBN A;  3MZD A;  2HP5 A;  4Z9Q A;  1MWS A;  4C75 A;  1IYQ A;  2Q9N A;  4KQR A;  4LCM A;  1QMF A;  3S4X A;  1K56 A;  1BSG A;  4R23 A;  4R0Q A;  1XGI A;  1E3U D;  1DJA A;  1M6K A;  3HLB A;  1W8Y A;  3IWO A;  4S2O A;  1MWR A;  3LY3 A;  4N92 A;  3VP1 A;  1PW8 A;  1N4O A;  2BLS A;  3MXR A;  3VP2 A;  1ZKJ A;  2A49 A;  4N1X A;  5CER A;  3ZVT A;  2JE5 A;  3LEZ A;  2OLU A;  5FQQ A;  4CPK A;  5KZH A;  2WKH A;  4U0X A;  5HX9 A;  4ZJ3 A;  5CGX A;  4RYE A;  1H5X A;  4PMA A;  2DNS A;  3IH8 A;  1TDL A;  1K4F A;  4DXB A;  2X71 A;  3HRE A;  2PBY A;  3Q7V A;  3MZF A;  4M3K A;  2EX9 A;  1HZO A;  5FI6 A;  5JYO A;  3AGF A;  4QY6 A;  4YIN A;  4JF6 A;  4E3M A;  3IF6 A;  2WUQ A;  5E2H A;  1E4D A;  1TEM A;  3N8S A;  2H10 A;  3MBZ A;  3ZG8 B;  4E6W A;  1W8Q A;  3NDG A;  3PBR A;  5HL1 A;  3UNW A;  1IEL A;  1I2W A;  5DTS A;  4S2J A;  2J9P A;  1PYY A;  2P9V A;  3W4O A;  5EVI C;  4ZJ2 A;  1SHV A;  4DRT A;  5FQI A;  4WZ4 A;  1PI4 A;  2WGV A;  4EQI A;  1YMX A;  3OPH A;  5KMW A;  3B3X A;  4WBG A;  2EXB A;  5A92 A;  3C7U A;  3M2J A;  5FQK A;  3IXD A;  1ES3 A;  3UDF A;  1I5Q A;  1YLT A;  1NZO A;  1FSW A;  4BL3 A;  3HLD A;  4B4X A;  4GD8 A;  3PAE A;  4IED A;  4FSF A;  4DDY A;  4F94 A;  4KQO A;  4H8R A;  2QZ6 A;  3N7W A;  3HVF A;  3LY4 A;  2PU2 A;  2X02 A;  4R4S A;  5GHZ A;  3IWQ A;  1YLJ A;  1JTD A;  4B88 A;  3C7V A;  4R1G A;  5IHV A;  1CEF A;  5CTN A;  1K6R A;  2Y59 A;  3A3F A;  3RXX A;  2Y2J A;  2E8I A;  3GSG A;  5GLD A;  1O07 A;  3GR2 A;  2ZM0 A;  1CEG A;  1ESU A;  2XF3 A;  2Y2Q A;  4PM6 A;  3O88 A;  3G30 A;  1W79 A;  4OOL A;  3W4Q A;  4A5R A;  5FAS A;  2JBF A;  5CTM A;  4ZDX A;  4OPY A;  3SS3 A;  1K55 A;  4JBF A;  3VSK A;  1WYC A;  1DJB A;  1LI0 A;  2VGJ A;  1KGG A;  1BLS A;  4KZ7 A;  1ESI A;  1O7E A;  4KZ9 A;  5FAP A;  3WS5 A;  3G4P A;  1ES2 A;  1PZP A;  3OPP A;  3P98 A;  3Q7V B;  5AQ7 A;  3ZNY A;  4P87 A;  3S1Y A;  5GHX A;  4N9K A;  1BLC A;  1ZG6 A;  4OH0 A;  3PBN A;  1RP5 A;  1GHP A;  3IF6 B;  2Y2P A;  3BRM A;  4MBK A;  4LV1 A;  1K6S A;  4WM9 A;  4RX2 A;  3FKW A;  2ZQD A;  3GQZ A;  3IHB A;  5M18 A;  2QMI A;  5JYP A;  2HDR A;  2FFY A;  2P9V B;  4NET A;  3ZG7 B;  5A91 A;  4BJP A;  3Q82 A;  4P85 A;  2EFX A; 
#chains in the Genus database with same CATH topology
 4QPR A;  3HLF A;  1SKF A;  4O01 A;  1KE3 A;  3D9Y A;  3EOI A;  4Y5F A;  3UDI A;  1Q2P A;  3T50 A;  1L0E A;  1GA9 A;  1TF1 A;  2DCF A;  1ERM A;  1IFQ A;  2EA9 A;  1L0G A;  5KSH A;  1NYY A;  1S4R A;  4R38 A;  2B18 A;  4NEE D;  2WKE A;  5L09 A;  1OTB A;  3IX8 A;  4MNR A;  5F69 A;  4E3I A;  3IXB A;  3CAX A;  4OPQ A;  5TGF A;  4JF4 A;  1KE4 A;  2HPB A;  2EX2 A;  2Y4A A;  1OTD A;  5FDH A;  3WS4 A;  4DE3 A;  3FWL A;  4DJ3 A;  1PW1 A;  4JGR A;  4HBT A;  2PT7 A;  1UWP X;  1YLW A;  4MBF A;  1ERO A;  4O8G A;  5HSQ A;  4MCW A;  3U2A A;  2Z2M B;  2J7V A;  5EUA A;  3R4K A;  1OTI A;  3HLE A;  2WKR A;  1MWT A;  4E3J A;  4KQQ A;  1STZ A;  1RCJ A;  2RCX A;  2QJ7 A;  3F1P B;  2VGL S;  3A3D A;  2ZOH A;  1SDE A;  4WLA A;  1FSY A;  1CI8 A;  1S0W A;  4S2M A;  3LEQ A;  3LUQ A;  4KQD A;  1Y28 A;  4EUV A;  2C5W B;  2XD1 A;  3H9W A;  1W63 Q;  4JLF A;  4X53 A;  3V3S A;  3C8C A;  4Q0I A;  4L0L A;  3NIA A;  5I5L A;  4S2I A;  1NWZ A;  5FI2 A;  4YNR A;  4S2L A;  4JKT A;  2W3G A;  2X01 A;  2Z6C A;  3OPL A;  2O9B A;  2P08 A;  3TE8 A;  2EFU A;  2W1R A;  5HWV A;  4UQI S;  1PI5 A;  2VJW A;  2V2F F;  3KSI A;  4ETX A;  2H5S A;  4XT2 B;  1TS0 A;  4E04 A;  3T4J A;  3W8K A;  1V9Y A;  2WGW A;  1VET B;  1YLP A;  3CI6 A;  3NOT C;  4JXS A;  4DN0 A;  3S7P A;  2BTF P;  5U47 A;  3DBA A;  2HP6 A;  3T1X A;  1IOU A;  1OJ5 A;  3RH8 B;  1XA1 A;  2MJ6 A;  1K25 A;  3Q1F A;  4XUZ A;  5FEG A;  3NJA A;  3TG9 A;  3KX0 X;  3JPU A;  4BMW A;  3SS5 A;  1F2K A;  4Y0O A;  1PWG A;  1SDN A;  3L7H A;  4R3J A;  5K5B A;  1ALQ A;  1F98 A;  2V1Z A;  3IHA A;  3VSL A;  5A90 A;  5E2E A;  2QKP A;  3BLS A;  4OP5 A;  1MKI A;  2EXA A;  4U3T A;  1YMS A;  3MXQ A;  2LB5 A;  3HBR A;  1FCM A;  1GSX A;  1L0D A;  3BYD A;  4BLM A;  3VFF A;  4OLG A;  4GD6 A;  5TR7 A;  2Y8H A;  4WEJ A;  2XH9 A;  4B93 A;  3DW0 A;  2Z2L B;  5E43 A;  4JGO A;  2XFS A;  4MN7 A;  1YSP A;  2J9O A;  2WAE A;  3IWI A;  1E3U A;  3FPW A;  2ZQC A;  1ZC2 A;  4MDZ A;  1J3W A;  2ZC7 A;  3P01 A;  1K57 A;  3DTM A;  4IBR A;  1ODV A;  4HJ3 A;  5CGW A;  1GHM A;  3ZYT A;  4D60 A;  2C6W B;  1YPR A;  2JKG A;  2WKI A;  1XJ3 A;  2BG1 A;  4G3V A;  3FKV A;  3B33 A;  1NJ4 A;  1H8Z A;  2XDM A;  2H0T A;  2Y55 A;  3UE1 A;  2QYB A;  1Y54 A;  3CUE C;  4YOF A;  5A8B A;  4KG2 A;  4OQ0 A;  3LR5 A;  2JKR M;  3K2N A;  5DKL A;  4Q8I A;  4BEN A;  5IT5 A;  3BM6 A;  4S2N A;  5F1G A;  4E3L A;  2ZQ8 A;  5EV0 A;  2HJE A;  3NHQ A;  1GSW A;  2KOI A;  4PM7 A;  4HH3 A;  4HNB A;  5AQ9 A;  5FSR A;  3G31 A;  5HAI A;  3N6I A;  4S2K A;  1FCN A;  3WRZ A;  1BT5 A;  4OOM A;  3MFX A;  1K4E A;  2ACG A;  1W5D A;  5DVA A;  1P0Z A;  5CEC A;  4Y17 A;  5FAQ A;  5EVL A;  2D01 A;  4OON A;  1G28 A;  5D3O A;  3MXS A;  5DTT A;  3CG5 A;  1OT9 A;  4LV0 A;  3NC8 A;  1K38 A;  3O86 A;  3MFD A;  2K7S A;  3H7W A;  1GA0 A;  3WRT A;  3PHY A;  5GL9 A;  4UAA A;  4EBN A;  4C75 A;  3DTK A;  2W0N A;  4LCM A;  1QMF A;  3DTI A;  4L9G A;  1K56 A;  1BSG A;  4R23 A;  1XGI A;  3PYP A;  1W8Y A;  3IWO A;  2JKT I;  3LY3 A;  3LIC A;  1N4O A;  3MXR A;  3CPT A;  2VEA A;  1ZHH B;  3A0R A;  4GCZ A;  4PKY G;  5KZH A;  2H28 A;  3CLO A;  2A2L A;  2WKQ A;  1XJ6 A;  1TDL A;  1K4F A;  2KX6 A;  1XFQ A;  4NG2 A;  4NXG A;  3Q7V A;  4JGP A;  3LIF A;  4LGW A;  1HZO A;  5JYO A;  3AGF A;  4E3M A;  5E2H A;  3N8S A;  1SKO A;  3PBR A;  3UNW A;  1I2W A;  5DTS A;  5TBM B;  2P9V A;  2BAS A;  4ZJ2 A;  1SHV A;  4CLC A;  5HDS A;  4DRT A;  2DMW A;  1SZV A;  2WGV A;  4ESP A;  5IS1 A;  4BBV A;  3U4L P;  4WBG A;  1ES3 A;  5HPF A;  2LB9 A;  1NLY A;  4DDY A;  3N7W A;  3HVF A;  4R4S A;  4B88 A;  1JTD A;  4R1G A;  3L9K A;  2Y2J A;  4F3L B;  3GR2 A;  4PM6 A;  1A0K A;  3W4Q A;  5FAS A;  4A5R A;  3K3C A;  5FL3 A;  5CTM A;  3SS3 A;  3UE6 A;  1LI0 A;  2VGJ A;  1KGG A;  4MN6 A;  1ESI A;  4ETZ A;  3WS5 A;  3G4P A;  2A24 B;  3ZNY A;  4GHI B;  2ZL1 A;  4WM9 A;  5DJT A;  2JN7 A;  5HWT A;  5TBM A;  3VE4 A;  3ZQ5 A;  3ZG7 B;  3IS2 B;  3Q82 A;  2V1A A;  3Q07 A;  3OLO A;  3MQO A;  3LIB A;  4M4X A;  3MKE A;  3NDE A;  4OVD A;  2W3E A;  3EQV A;  4EER A;  3V50 A;  5J3W A;  5DKK A;  1K55 C;  2VGL M;  1RGZ A;  3BJN A;  3C30 A;  4ARZ B;  4IVK A;  1T1C A;  4WYY A;  2OLV A;  1LL5 A;  1MBL A;  2W3D A;  2ZLY A;  5EVI A;  4I3J A;  4RVA A;  1PWD A;  3ITB A;  2WYX A;  4IVI A;  2HJ9 C;  2WZX A;  3ICY A;  4OP8 A;  2WK0 A;  3KSF A;  3EEH A;  3FYZ A;  3SH7 A;  1IYS A;  2VK3 A;  1LLB A;  3H82 A;  4Y7P A;  4BBT A;  2Y2L A;  4Q0J A;  3ZHH A;  4O0P A;  3OCL A;  4UQI M;  1BLH A;  2Y91 A;  3TOI A;  3ZCZ A;  4HJ6 A;  1NXY A;  4DDS A;  2J3W A;  4QU3 A;  2UWX A;  3S7Q A;  3T1S A;  3GV9 A;  4Y0T A;  1LSV A;  4N1H A;  3E4Q A;  4GDB A;  2O9C A;  2PBD P;  3M6H A;  3A3I A;  4QJG A;  5EM0 A;  1MKM A;  1VB6 A;  5CHM A;  4HES A;  1T18 A;  4QB8 A;  3BWL A;  3CMZ A;  3MKF A;  4U0T A;  4PAU A;  1PZO A;  3LO7 A;  1H8Y A;  1YQS A;  1M40 A;  2YKH A;  2ZC6 B;  4OQI A;  4X68 A;  3ISG A;  4BQM A;  5FA7 A;  1K54 A;  1LHY A;  4WEL A;  3IF5 A;  2JKR I;  4OQG A;  4I3A A;  1VEU A;  3MJQ A;  4KZ3 A;  5CGS A;  4B9O A;  2J8Y A;  2PR5 A;  2XGN A;  4ZAM A;  1K57 C;  1W63 M;  1L0F A;  1IKG A;  3BW6 A;  5M19 A;  2PU4 A;  3PAG A;  3BFC A;  3N4I A;  2ZBB A;  3EWK A;  3A0S A;  3PBQ A;  2GNX A;  1X0O A;  3VE3 A;  5DTK A;  3VV4 A;  4PM5 A;  3V67 A;  2WZZ A;  2Y2I A;  4HEF A;  1K0K A;  4X1L A;  1ZTU A;  2VX8 A;  4KEN B;  4P6B A;  4S2N C;  2JKT M;  1L2S A;  3CJM A;  1IEM A;  3A3E A;  5LBR A;  1DY6 A;  3W2Z A;  3VP4 A;  3UO9 A;  4GW9 A;  4EBP A;  1OT6 A;  4OOY A;  2D02 A;  2ZC5 B;  3T1Q B;  3DTE A;  5HD5 A;  5F1F A;  5EPH A;  1XJ2 A;  1MWU A;  1YLY A;  1PWC A;  1S67 L;  3G35 A;  4GNU A;  4X69 A;  2EX6 A;  3UN7 A;  1GCE A;  1D06 A;  3A3J A;  4CQH A;  4C3Q A;  1Y4O A;  3FG8 A;  5GLB A;  3PTE A;  5CHJ A;  5EOE A;  5HZH A;  4JPM A;  2W1T A;  4PM9 A;  4I5S A;  3HUN A;  3NY4 A;  5HAR A;  2CC1 A;  3AGD A;  3R7W A;  4WMC D;  3O3V A;  4C6Y A;  5C5K A;  2WGW B;  1V9Z A;  3NI9 A;  4DE2 A;  4JF5 A;  2XQZ A;  1TVF A;  2PAV P;  3D3O A;  3PXP A;  2XRO A;  3ZG5 A;  2HP9 A;  5TJJ A;  5DFY A;  4FH4 A;  3IXH A;  3PBS A;  3NBL A;  2RL3 A;  3OC2 A;  3MZE A;  3QNC A;  3KSH A;  3GTC A;  4X55 A;  4ZRR A;  1AWI A;  1HD8 A;  5CHU A;  2HDQ A;  4DE0 A;  3V39 A;  4X6T A;  2G2W A;  3KSG A;  1H0M A;  5J8X A;  3PBO A;  1XJ4 A;  3W4P A;  5A93 A;  2OSU A;  3Q7Z A;  3IX3 A;  3WS1 A;  1N9B A;  4CLC C;  2Y2K A;  3NCK A;  4EQ1 A;  3TJZ C;  2P7J A;  4KZ4 A;  1WYB A;  2XD5 A;  3FZC A;  5E2G A;  4WZ5 C;  1K56 D;  1FR1 A;  2ZMA A;  3GDI A;  2L0W A;  3QP8 A;  3UB8 A;  3F1N A;  3JYI A;  3LI9 A;  1LSW A;  1Z09 A;  2HDS A;  4PHT A;  1JVJ A;  3RXW A;  4X56 A;  3QHY A;  3NOP C;  4I39 A;  3EQU A;  4L9E A;  2XFT A;  5L07 A;  1ACF A;  4LCL A;  2GX5 A;  2Y2H A;  4GS9 A;  3MZD A;  2XRN A;  4ME4 A;  4LRZ E;  2V8F A;  3S4X A;  4H6J A;  3CHW P;  1M6K A;  1DP6 A;  4S2O A;  4N92 A;  3VP2 A;  4CPK A;  3BQ8 A;  5F6A A;  2WKH A;  4U0X A;  4RYE A;  5AJG A;  4PMA A;  2DNS A;  1YSQ A;  3IH8 A;  4HI4 A;  2X71 A;  2UV0 E;  2PBY A;  5EVE A;  2EX9 A;  4JF6 A;  1E4D A;  3BY8 A;  5AVF A;  2H10 A;  4E6W A;  3ZG8 B;  3NDG A;  2J3T C;  1PYY A;  5EVI C;  3QP1 A;  3LIA A;  4WL9 A;  4EQI A;  3H7W B;  3OPH A;  5KMW A;  3B3X A;  4X1M A;  3C7U A;  3M2J A;  3IXD A;  3UDF A;  3KO6 A;  4R6L A;  1I5Q A;  1MC0 A;  2JHE A;  4GD8 A;  4IED A;  4KQO A;  2PU2 A;  4UEY A;  3IWQ A;  1YLJ A;  3CPT B;  1CEF A;  5CTN A;  1ESU A;  2XF3 A;  3LGO A;  3O88 A;  2JBF A;  4ZDX A;  2W27 A;  4JBF A;  1DJB A;  3P7N A;  1JNU A;  4KZ7 A;  3O5Y A;  4JGQ A;  1ES2 A;  3Q7V B;  4N9K A;  1ZG6 A;  2FH5 A;  4EXO A;  3C38 A;  1RP5 A;  1GHP A;  3BRM A;  4LV1 A;  1K6S A;  1SKO B;  2J3T D;  3T12 B;  2ZQD A;  3GQZ A;  1YAX A;  4NXB A;  3SW1 A;  5M18 A;  2HDR A;  2FFY A;  2P9V B;  5A91 A;  4MMN A;  2QHK A;  4CLC B;  1N9O A;  1TS7 A;  4KG6 A;  2W3H A;  4O7D A;  1NYM A;  2Z6D A;  2ZC4 B;  3WWX A;  2OV5 A;  3ZGA B;  1KVL A;  2M7V A;  3SH9 A;  5HAP A;  4GB7 A;  2CMN A;  1NRF A;  5FAT A;  4UHU A;  1K54 C;  3IXG A;  3LID A;  3IT9 A;  2W3F A;  1BZA A;  3CZD A;  2I72 A;  5MC7 A;  2GZA A;  2O9A A;  4ZTK A;  5FI7 A;  1PIO A;  3VMA A;  4UA9 A;  1Q2Q A;  1KDS A;  2VV7 A;  2A3U A;  4IUK A;  2Y2N A;  2IWB A;  3ZG0 A;  5E2F A;  3BEC A;  2EWV A;  1H3Q A;  4DXC A;  1FIL A;  1C3B A;  2ZM2 A;  1N9N A;  2Y2G A;  5BOH A;  4YFM A;  2ZL1 B;  3EGD C;  3HJK A;  4MLL A;  4QY5 A;  3O87 A;  1HVB A;  5AQB A;  5EM1 A;  2P74 A;  3E4P A;  5CED A;  1DP9 A;  1OJG A;  4DE1 A;  5DF8 A;  2B5R A;  3GRJ A;  1ONH A;  1XA7 A;  3HJI A;  3EEA A;  3IX4 A;  4HIA A;  2B95 A;  3BFD A;  3OCN A;  4HJ4 A;  3QP5 A;  2AVX A;  2NUT C;  5EVI B;  3UB5 P;  2V1B A;  1GSV A;  2O0Y A;  4I3I A;  2WGI A;  4QD4 A;  5EE8 A;  3G32 A;  3WS0 A;  5KIZ A;  3C5A A;  4ZBE A;  1KGF A;  4EET B;  1LL8 A;  2DRW A;  4DF6 A;  3KYQ A;  3H82 B;  2XLN A;  1J9M A;  3GVB A;  3G6O A;  3LI8 A;  4K0X A;  1VM1 A;  5FDS A;  2PYR A;  1PFL A;  2G7U A;  3P09 A;  2I9V A;  2XEP A;  1DRM A;  3V3R A;  4KZ6 A;  3RFB A;  4HY8 A;  4FH2 A;  3IBR A;  3E4O A;  2VKS A;  3B42 A;  5AQA A;  3BFE A;  2QPN A;  3OBF A;  2VV6 A;  3V5M A;  2R9X A;  3MQQ A;  3UDX A;  2ZQ7 A;  4G3W A;  3UB9 A;  3DWK A;  2J80 A;  2ZOI A;  3T4Q A;  3LYX A;  5KSC A;  4EES A;  1NRJ A;  3UE3 A;  2IWD A;  3PR6 A;  1DJC A;  1BUL A;  2OWJ A;  1ZG4 A;  3UME A;  1NLZ A;  2P04 A;  4QWO A;  4DMZ A;  4CJN A;  3RTY A;  2XK1 A;  5IU1 A;  3ZDJ A;  4MN5 A;  3DAV A;  4N9L A;  1LL9 A;  2ZQ9 A;  1VEU B;  4OPZ A;  5DF9 A;  4EBL A;  1ES5 A;  2PD7 A;  3BQA A;  1IKI A;  3B47 A;  2HGV A;  4KUO A;  4BL2 A;  3MSH A;  5HFO A;  3CUE A;  4NXE A;  5DF7 A;  5F68 A;  1Z6F A;  1JWZ A;  1FR6 A;  1PNE A;  5G4Y A;  3D4F A;  1BLP A;  3HUO A;  4HH2 A;  1WE4 A;  2O99 A;  3LCE A;  3G2Y A;  3SS4 A;  2HF6 A;  4P6Z S;  4HHD A;  4QHC A;  1TDG A;  3T1R A;  1XPB A;  4KG5 A;  4HP4 A;  4PKY A;  5CRF A;  3BFF A;  3UE0 A;  1H8M A;  1BUE A;  1KOU A;  4GZB A;  1SCW A;  1NZU A;  3ULF A;  4B4Z A;  2E8J A;  3FC7 A;  1MXO A;  3MMH A;  5CXW A;  1CI9 A;  3HL9 A;  3TRC A;  1TS6 A;  3ZG9 B;  1KVM A;  2EX8 A;  1HTZ A;  2Q9M A;  1KGE A;  2W1T B;  3VOZ A;  3VP3 A;  3ITA A;  3KYZ A;  1S6R A;  4Y0U A;  4EW7 A;  1JTG A;  2V20 A;  3R7W B;  5J7E A;  4E3N A;  4P0M A;  5HD3 A;  1W7F A;  3VOL A;  4K0W A;  4XXR A;  4KZB A;  4G3K A;  3S22 A;  3M6B A;  1P9W A;  1S66 L;  1OTE A;  1LSX A;  1QME A;  4JXG A;  1G6O A;  2K31 A;  3UPP A;  2G2U A;  2V8C A;  1MWS A;  4KQR A;  4NXF A;  4R0Q A;  1E3U D;  1DJA A;  3HLB A;  1BYW A;  1PW8 A;  1UGU A;  1ZKJ A;  4N1X A;  5CER A;  2GJ3 A;  5FQQ A;  2INW A;  3GEC A;  5HX9 A;  4ZJ3 A;  1H5X A;  1XFN A;  4DXB A;  3MZF A;  2VZW A;  4QY6 A;  5AVE A;  3IF6 A;  2WUQ A;  2ZMV A;  1TEM A;  4RQ9 A;  3MBZ A;  3CWF A;  1W8Q A;  3F1N B;  2J9P A;  3W4O A;  1PI4 A;  4KUK A;  3F1O B;  2EXB A;  5HWW A;  5FQK A;  1D7E A;  4GS9 B;  1NZO A;  1FSW A;  3EGX C;  3HLD A;  1PRQ A;  4H6J B;  4FSF A;  4F94 A;  4H8R A;  3NUL A;  2X02 A;  4FTX A;  3C7V A;  5IHV A;  1K6R A;  3A3F A;  2E8I A;  5GLD A;  1O07 A;  2ZM0 A;  5HL6 A;  2Y2Q A;  1W79 A;  4WF0 A;  4OPY A;  1K55 A;  3S7O A;  1D1J A;  3QP2 A;  4KZ9 A;  5FAP A;  3OPP A;  3P98 A;  5AQ7 A;  2V9A A;  1N9L A;  4P87 A;  3K3D A;  3S1Y A;  4OH0 A;  3JVU A;  4RX2 A;  4LLO B;  3FKW A;  5JYP A;  2M1C A;  3LFV A;  4NET A;  2PD8 A;  4KZA A;  3F1O A;  1IYO A;  5F5Y A;  1VQQ A;  5I94 A;  3E2K A;  2IWC A;  4DKI A;  3TSG A;  1UWN X;  4ID4 A;  1S1Y A;  3SH8 A;  1S1Z A;  1AXB A;  3SZT A;  4OKP A;  3F1P A;  4PPR A;  4FD8 A;  1XKZ A;  4UA7 A;  5HPI A;  4II7 A;  1GHI A;  3GMW A;  1FQG A;  3E2L A;  1ERQ A;  3D72 A;  5L8M A;  4WN5 A;  5HDC A;  4K08 A;  4E3K A;  4GDN A;  4LRY C;  3MF0 A;  1VHM A;  4LV2 A;  2OWH A;  4MBH A;  4CLC D;  3AGE A;  4EV4 A;  2HDU A;  3FV7 A;  4EWF A;  1F9I A;  5TFQ A;  2Q0O A;  1U60 A;  3BLM A;  3BEB A;  4IBX A;  1FCO A;  4R4R A;  3RJU A;  5FQ9 A;  3PBT A;  4IJG A;  1FOF A;  2HV1 A;  4LFU A;  2XR0 A;  3M2K A;  4BBU A;  3OPR A;  2WAD A;  2L1M A;  3C4O A;  2EWW A;  2ZC3 B;  4XT2 A;  4FUW A;  3BFG A;  1VET A;  4Q0H A;  4Z1W A;  3KYE A;  3MR0 A;  4FCF A;  5FQM A;  4LPZ A;  4LEN A;  1E25 A;  3HLW A;  4S2P A;  5GLC A;  5HW3 A;  3I7J A;  4BWI A;  3C2W A;  3UPO A;  3BY9 A;  3ZFZ A;  2GDN A;  1XXM A;  3VOY A;  3SOI A;  4WMC A;  3FPV A;  4OPR A;  3IH9 A;  1OME A;  5G18 A;  1YT4 A;  4NK3 A;  4Y15 A;  2R9W A;  1MY8 A;  4YWZ A;  4XUX A;  2HZ5 A;  4Y2F A;  5FAO A;  3LR0 A;  2ZQA A;  3TW8 A;  3HLG A;  4WUJ A;  2VA0 A;  2VGK A;  1IYP A;  2IA2 A;  4UA6 A;  2ZJ9 A;  2H0Y A;  5EVI D;  2R78 A;  1LT0 A;  4BD1 A;  5GHY A;  1XX2 A;  5F82 A;  1XGJ A;  2ZM8 A;  1JWV A;  4P6Z M;  4GKU A;  3T4K A;  4KZ5 A;  2JC7 A;  1T19 A;  1EWZ A;  1EI5 A;  5G4Z A;  1T1A A;  3HUM A;  5GLA A;  3OZH A;  4RA7 A;  3G2Z A;  4OLD A;  3VFH A;  4LRX C;  2Y2O A;  2OAQ 1;  1G68 A;  4IUH A;  5F83 A;  1OTA A;  4Y13 A;  3MQ0 A;  1NY0 A;  4MEZ A;  2WKP A;  5CX7 A;  4HBU A;  4R70 A;  1T1B A;  3LR4 A;  5J4E A;  3ZVW A;  3WS2 A;  4HOI A;  2V0U A;  1WA9 A;  2K2N A;  4R3B A;  4EU0 A;  3UY6 A;  5DJU A;  3ZNT A;  3T4S A;  2VV8 A;  2XA7 M;  1RGY A;  4D2O A;  5CEB A;  2YKF A;  4WEK A;  3A0V A;  3N8L A;  4CLC E;  2QWS A;  5L2F A;  1ES4 A;  1F5M A;  4RX3 A;  3E0Y A;  2OOL A;  3JVV A;  2ZD8 A;  4AFI A;  4LV3 A;  1G6A A;  2Y2M A;  4GN2 A;  1YLZ A;  1KDW A;  1BTL A;  3OOV A;  4WZ5 A;  4HQA A;  1CQA A;  3Q81 A;  1YM1 A;  3C4P A;  1MPL A;  4EUZ A;  5HDD A;  1YKD A;  4E6X A;  5L10 A;  2JCH A;  1JWP A;  1CK3 A;  1FIK A;  3IF6 C;  3IQA A;  3G34 A;  4JXW A;  4L9F A;  1S4S A;  3S7N A;  5M1A A;  3NEC A;  5EEC A;  1CJF A;  5EOO A;  1P9R A;  3UPN A;  2ZMF A;  4GLQ A;  4OQH A;  3VP0 A;  1I2S A;  3N8R A;  4PM8 A;  3DWZ A;  2VLG A;  3UB6 A;  2WAF A;  2PDR A;  5HAQ A;  4GOG A;  4BD0 A;  1ONG A;  3HLC A;  3QNB A;  5FQJ A;  4ZJ1 A;  1HLU P;  1LI9 A;  2FFF B;  4E3O A;  1XP4 A;  1KE0 A;  3UMD A;  3QP6 A;  4JXV A;  4K91 A;  4KZ8 A;  2NUP C;  2HP5 A;  4Z9Q A;  1IYQ A;  2Q9N A;  2Y79 A;  1P97 A;  2KLI A;  2PYP A;  1MWR A;  2JKF A;  3VP1 A;  2BLS A;  1TS8 A;  2A49 A;  3ZVT A;  4F3L A;  2JE5 A;  2QJ5 A;  3LEZ A;  2OLU A;  3T4L A;  5CGX A;  3E98 A;  3HCY A;  2FZ0 A;  3HRE A;  4GJ4 A;  1MZU A;  2XSS A;  4DJ2 A;  2A24 A;  4M3K A;  5EFW A;  5FI6 A;  4GHI A;  4YIN A;  3QP4 A;  1CF0 A;  5HL1 A;  5FEF A;  1IEL A;  2PHY A;  4FOF A;  4S2J A;  3T4O A;  1G5U A;  3IS2 A;  5FQI A;  4WZ4 A;  4R3A A;  1YMX A;  5DFX A;  1TD5 A;  5A92 A;  1DP8 A;  3LR3 A;  4X25 A;  1YLT A;  4BL3 A;  4B4X A;  4ARZ A;  2L4R A;  3LIE A;  3PAE A;  3UB7 A;  2QZ6 A;  5GHZ A;  3LY4 A;  2PR6 A;  4I38 A;  2Y59 A;  3RXX A;  3GSG A;  3NOU C;  1CEG A;  3CIT A;  3T4T A;  4OOL A;  3G30 A;  2OAP 1;  1L3L A;  2XA7 S;  2B02 A;  3IBJ A;  3VSK A;  1WYC A;  1BLS A;  1O7E A;  1PZP A;  4Y3I A;  2V0W A;  2M7U A;  4EEU A;  2KDK A;  5GHX A;  1BLC A;  3PBN A;  4EEP A;  3IF6 B;  2Y2P A;  4HP9 A;  4MBK A;  1OPX A;  2PRF A;  3IHB A;  2QMI A;  1EW0 A;  3MS6 A;  4NKP A;  4BJP A;  4IHQ A;  4P85 A;  2EFX A; 
#chains in the Genus database with same CATH homology
 3Q07 A;  4KZA A;  1IYO A;  4KG6 A;  3HLF A;  1SKF A;  4O7D A;  1NYM A;  1VQQ A;  3MKE A;  2ZC4 B;  3NDE A;  1KE3 A;  4OVD A;  2OV5 A;  1KVL A;  3WWX A;  3E2K A;  2IWC A;  3ZGA B;  3TSG A;  4DKI A;  3EQV A;  3SH9 A;  5I94 A;  5HAP A;  3UDI A;  4ID4 A;  3SH8 A;  4GB7 A;  3V50 A;  1NRF A;  5FAT A;  1AXB A;  4UHU A;  1K54 C;  1K55 C;  1Q2P A;  1RGZ A;  4OKP A;  4PPR A;  4FD8 A;  3IXG A;  4IVK A;  3IT9 A;  1L0E A;  1XKZ A;  4UA7 A;  1GA9 A;  1BZA A;  3CZD A;  2OLV A;  1LL5 A;  2I72 A;  2DCF A;  1ERM A;  4WYY A;  1GHI A;  3GMW A;  1MBL A;  1FQG A;  3E2L A;  4ZTK A;  2ZLY A;  5EVI A;  5FI7 A;  4RVA A;  1ERQ A;  1PIO A;  1L0G A;  1PWD A;  1Q2Q A;  3ITB A;  4UA9 A;  2WYX A;  3VMA A;  4IVI A;  1KDS A;  1NYY A;  4E3K A;  2WZX A;  4OP8 A;  2WK0 A;  2A3U A;  2WKE A;  2Y2N A;  4GDN A;  2IWB A;  4MNR A;  3ZG0 A;  4E3I A;  3IXB A;  4LV2 A;  5E2F A;  3FYZ A;  3SH7 A;  1IYS A;  4MBH A;  3AGE A;  4OPQ A;  2HDU A;  5TGF A;  1LLB A;  4JF4 A;  4EV4 A;  3FV7 A;  1KE4 A;  3BEC A;  4EWF A;  2HPB A;  4DXC A;  2EX2 A;  4Y7P A;  2Y4A A;  5TFQ A;  5FDH A;  1C3B A;  3WS4 A;  4DE3 A;  2Y2L A;  3FWL A;  2ZM2 A;  1U60 A;  3BLM A;  1PW1 A;  2Y2G A;  3BEB A;  4HBT A;  4IBX A;  5BOH A;  4YFM A;  1FCO A;  1YLW A;  4MBF A;  4R4R A;  1ERO A;  3RJU A;  3ZHH A;  5FQ9 A;  3PBT A;  3OCL A;  1FOF A;  4MLL A;  4QY5 A;  3O87 A;  1BLH A;  2Y91 A;  1HVB A;  2Z2M B;  5AQB A;  2XR0 A;  2J7V A;  5EUA A;  2P74 A;  3M2K A;  3TOI A;  3OPR A;  2WAD A;  3C4O A;  5CED A;  3HLE A;  3ZCZ A;  4DE1 A;  5KSH A;  5DF8 A;  1NXY A;  1MWT A;  2ZC3 B;  4DDS A;  2B5R A;  3BFG A;  4QU3 A;  2UWX A;  3GRJ A;  4KQQ A;  4E3J A;  3GV9 A;  4Y0T A;  4N1H A;  1ONH A;  1XA7 A;  4GDB A;  1RCJ A;  4FCF A;  3M6H A;  2RCX A;  3A3I A;  5FQM A;  4QJG A;  3BFD A;  3A3D A;  4LEN A;  1E25 A;  3OCN A;  3HLW A;  4S2P A;  5CHM A;  4HES A;  4QB8 A;  1SDE A;  5EVI B;  5GLC A;  5HW3 A;  3I7J A;  4QD4 A;  3CMZ A;  2WGI A;  5EE8 A;  3UPO A;  3G32 A;  3MKF A;  3WS0 A;  1FSY A;  1CI8 A;  4U0T A;  2GDN A;  1XXM A;  3ZFZ A;  1PZO A;  1S0W A;  3C5A A;  3LO7 A;  4S2M A;  3VOY A;  1H8Y A;  1YQS A;  3SOI A;  4WMC A;  1M40 A;  2ZC6 B;  4OQI A;  4X68 A;  3ISG A;  4OPR A;  4ZBE A;  1KGF A;  4BQM A;  5FA7 A;  1K54 A;  2C5W B;  2XD1 A;  3IH9 A;  1LHY A;  4WEL A;  3IF5 A;  2DRW A;  4OQG A;  1OME A;  5G18 A;  4DF6 A;  4JLF A;  1YT4 A;  4NK3 A;  4X53 A;  3V3S A;  2XLN A;  4KZ3 A;  5CGS A;  1J9M A;  2R9W A;  3GVB A;  1MY8 A;  2J8Y A;  2XGN A;  4XUX A;  4L0L A;  4ZAM A;  3NIA A;  4K0X A;  1VM1 A;  4S2I A;  1K57 C;  5FAO A;  1L0F A;  5FI2 A;  1IKG A;  5M19 A;  2PU4 A;  2ZQA A;  3PAG A;  4JKT A;  4S2L A;  3P09 A;  3BFC A;  2XEP A;  2X01 A;  3HLG A;  3N4I A;  3OPL A;  2VGK A;  1IYP A;  3V3R A;  2EFU A;  4UA6 A;  2ZJ9 A;  2H0Y A;  4KZ6 A;  5EVI D;  4BD1 A;  4FH2 A;  3PBQ A;  5GHY A;  5DTK A;  1PI5 A;  2V2F F;  1XX2 A;  5AQA A;  2H5S A;  5F82 A;  3BFE A;  1XGJ A;  2QPN A;  2ZM8 A;  3W8K A;  1JWV A;  2WGW A;  1YLP A;  4PM5 A;  3V5M A;  4JXS A;  2R9X A;  2WZZ A;  2Y2I A;  4GKU A;  5U47 A;  4HEF A;  3UDX A;  2ZQ7 A;  2HP6 A;  4KZ5 A;  2JC7 A;  1XA1 A;  3DWK A;  4KEN B;  1EWZ A;  1K25 A;  1EI5 A;  3Q1F A;  4P6B A;  4S2N C;  1L2S A;  4XUZ A;  3HUM A;  5GLA A;  3CJM A;  1IEM A;  3OZH A;  3A3E A;  3TG9 A;  5KSC A;  4RA7 A;  1DY6 A;  3G2Z A;  4OLD A;  3VFH A;  3VP4 A;  2Y2O A;  3UO9 A;  3SS5 A;  4Y0O A;  1PWG A;  1G68 A;  3UE3 A;  1SDN A;  4EBP A;  4R3J A;  1ALQ A;  5F83 A;  4OOY A;  2IWD A;  1DJC A;  2V1Z A;  3IHA A;  2ZC5 B;  1BUL A;  1NY0 A;  1ZG4 A;  4MEZ A;  3VSL A;  5A90 A;  4HBU A;  5F1F A;  5E2E A;  5EPH A;  4CJN A;  2XK1 A;  3BLS A;  3ZDJ A;  1YLY A;  1MWU A;  3G35 A;  1PWC A;  4GNU A;  4OP5 A;  4X69 A;  1MKI A;  4N9L A;  1LL9 A;  2EXA A;  2EX6 A;  2ZQ9 A;  3UN7 A;  4OPZ A;  4U3T A;  1YMS A;  5DF9 A;  3HBR A;  1ES5 A;  4EBL A;  3ZVW A;  1FCM A;  3BYD A;  1GCE A;  1L0D A;  1IKI A;  3WS2 A;  4BLM A;  3A3J A;  3VFF A;  4C3Q A;  4OLG A;  4GD6 A;  4R3B A;  5TR7 A;  4WEJ A;  4BL2 A;  2XH9 A;  5HFO A;  3UY6 A;  5GLB A;  3DW0 A;  3PTE A;  5CHJ A;  5EOE A;  3ZNT A;  2Z2L B;  4JPM A;  5E43 A;  4PM9 A;  1RGY A;  5DF7 A;  3HUN A;  4D2O A;  5CEB A;  1Z6F A;  1JWZ A;  1FR6 A;  2XFS A;  2J9O A;  4WEK A;  2WAE A;  3IWI A;  1E3U A;  3NY4 A;  5HAR A;  3D4F A;  1BLP A;  2ZQC A;  3HUO A;  3N8L A;  2CC1 A;  1ZC2 A;  3AGD A;  1WE4 A;  4WMC D;  2ZC7 A;  3O3V A;  4C6Y A;  2WGW B;  1K57 A;  3LCE A;  3DTM A;  4IBR A;  1ES4 A;  3G2Y A;  5L2F A;  3NI9 A;  3SS4 A;  4DE2 A;  4RX3 A;  5CGW A;  4JF5 A;  1GHM A;  2C6W B;  2XQZ A;  4QHC A;  1TVF A;  2ZD8 A;  4LV3 A;  2WKI A;  3ZG5 A;  2HP9 A;  2BG1 A;  1G6A A;  3FKV A;  1NJ4 A;  1H8Z A;  1TDG A;  2Y2M A;  4FH4 A;  2XDM A;  2H0T A;  3IXH A;  4GN2 A;  1XPB A;  1YLZ A;  4KG5 A;  1KDW A;  2Y55 A;  3NBL A;  3PBS A;  3UE1 A;  5CRF A;  3BFF A;  3UE0 A;  1Y54 A;  1BTL A;  1BUE A;  2RL3 A;  3OC2 A;  4GZB A;  4WZ5 A;  1SCW A;  1NZU A;  4B4Z A;  3MZE A;  3QNC A;  3GTC A;  4KG2 A;  4X55 A;  3Q81 A;  1YM1 A;  4OQ0 A;  1MXO A;  1HD8 A;  3C4P A;  4Q8I A;  1MPL A;  5CHU A;  4BEN A;  4EUZ A;  3BM6 A;  2HDQ A;  4S2N A;  4DE0 A;  4E6X A;  2JCH A;  5CXW A;  1CI9 A;  5F1G A;  3HL9 A;  2ZQ8 A;  3V39 A;  4E3L A;  1JWP A;  2G2W A;  4X6T A;  1CK3 A;  3ZG9 B;  3IF6 C;  3IQA A;  5J8X A;  1KVM A;  3G34 A;  3PBO A;  4PM7 A;  4JXW A;  2EX8 A;  1HTZ A;  3W4P A;  5AQ9 A;  5A93 A;  2OSU A;  2Q9M A;  3Q7Z A;  5FSR A;  3WS1 A;  1KGE A;  3G31 A;  5M1A A;  5HAI A;  3VOZ A;  1N9B A;  3VP3 A;  2Y2K A;  3N6I A;  1FCN A;  3NCK A;  4S2K A;  3ITA A;  3WRZ A;  1S6R A;  4Y0U A;  1BT5 A;  5EEC A;  5EOO A;  4OOM A;  1K4E A;  1JTG A;  2V20 A;  3UPN A;  1W5D A;  4KZ4 A;  1WYB A;  5DVA A;  2XD5 A;  3FZC A;  5E2G A;  5CEC A;  4E3N A;  4WZ5 C;  1K56 D;  4OQH A;  4P0M A;  5FAQ A;  1FR1 A;  5EVL A;  3VP0 A;  2ZMA A;  4OON A;  1I2S A;  3N8R A;  4PM8 A;  3DWZ A;  5D3O A;  1W7F A;  3MXS A;  2WAF A;  3CG5 A;  4K0W A;  3JYI A;  5DTT A;  5HAQ A;  4LV0 A;  3NC8 A;  4GOG A;  4BD0 A;  1ONG A;  2HDS A;  4XXR A;  1K38 A;  4KZB A;  3S22 A;  3HLC A;  3M6B A;  3O86 A;  1JVJ A;  3QNB A;  5FQJ A;  4ZJ1 A;  3RXW A;  3MFD A;  1LI9 A;  1GA0 A;  2FFF B;  4X56 A;  1XP4 A;  3WRT A;  3QHY A;  4E3O A;  1KE0 A;  1QME A;  4JXG A;  3UPP A;  3EQU A;  2G2U A;  2XFT A;  5GL9 A;  4LCL A;  4JXV A;  4UAA A;  2Y2H A;  4K91 A;  4KZ8 A;  4EBN A;  3MZD A;  2HP5 A;  4Z9Q A;  1MWS A;  4C75 A;  1IYQ A;  2Q9N A;  4KQR A;  4LCM A;  1QMF A;  3S4X A;  1K56 A;  1BSG A;  4R23 A;  4R0Q A;  1XGI A;  1E3U D;  1DJA A;  1M6K A;  3HLB A;  1W8Y A;  3IWO A;  4S2O A;  1MWR A;  3LY3 A;  4N92 A;  3VP1 A;  1PW8 A;  1N4O A;  2BLS A;  3MXR A;  3VP2 A;  1ZKJ A;  2A49 A;  4N1X A;  5CER A;  3ZVT A;  2JE5 A;  3LEZ A;  2OLU A;  5FQQ A;  4CPK A;  5KZH A;  2WKH A;  4U0X A;  5HX9 A;  4ZJ3 A;  5CGX A;  4RYE A;  1H5X A;  4PMA A;  2DNS A;  3IH8 A;  1TDL A;  1K4F A;  4DXB A;  2X71 A;  3HRE A;  2PBY A;  3Q7V A;  3MZF A;  4M3K A;  2EX9 A;  1HZO A;  5FI6 A;  5JYO A;  3AGF A;  4QY6 A;  4YIN A;  4JF6 A;  4E3M A;  3IF6 A;  2WUQ A;  5E2H A;  1E4D A;  1TEM A;  3N8S A;  2H10 A;  3MBZ A;  3ZG8 B;  4E6W A;  1W8Q A;  3NDG A;  3PBR A;  5HL1 A;  3UNW A;  1IEL A;  1I2W A;  5DTS A;  4S2J A;  2J9P A;  1PYY A;  2P9V A;  3W4O A;  5EVI C;  4ZJ2 A;  1SHV A;  4DRT A;  5FQI A;  4WZ4 A;  1PI4 A;  2WGV A;  4EQI A;  1YMX A;  3OPH A;  5KMW A;  3B3X A;  4WBG A;  2EXB A;  5A92 A;  3C7U A;  3M2J A;  5FQK A;  3IXD A;  1ES3 A;  3UDF A;  1I5Q A;  1YLT A;  1NZO A;  1FSW A;  4BL3 A;  3HLD A;  4B4X A;  4GD8 A;  3PAE A;  4IED A;  4FSF A;  4DDY A;  4F94 A;  4KQO A;  4H8R A;  2QZ6 A;  3N7W A;  3HVF A;  3LY4 A;  2PU2 A;  2X02 A;  4R4S A;  5GHZ A;  3IWQ A;  1YLJ A;  1JTD A;  4B88 A;  3C7V A;  4R1G A;  5IHV A;  1CEF A;  5CTN A;  1K6R A;  2Y59 A;  3A3F A;  3RXX A;  2Y2J A;  2E8I A;  3GSG A;  5GLD A;  1O07 A;  3GR2 A;  2ZM0 A;  1CEG A;  1ESU A;  2XF3 A;  2Y2Q A;  4PM6 A;  3O88 A;  3G30 A;  1W79 A;  4OOL A;  3W4Q A;  4A5R A;  5FAS A;  2JBF A;  5CTM A;  4ZDX A;  4OPY A;  3SS3 A;  1K55 A;  4JBF A;  3VSK A;  1WYC A;  1DJB A;  1LI0 A;  2VGJ A;  1KGG A;  1BLS A;  4KZ7 A;  1ESI A;  1O7E A;  4KZ9 A;  5FAP A;  3WS5 A;  3G4P A;  1ES2 A;  1PZP A;  3OPP A;  3P98 A;  3Q7V B;  5AQ7 A;  3ZNY A;  4P87 A;  3S1Y A;  5GHX A;  4N9K A;  1BLC A;  1ZG6 A;  4OH0 A;  3PBN A;  1RP5 A;  1GHP A;  3IF6 B;  2Y2P A;  3BRM A;  4MBK A;  4LV1 A;  1K6S A;  4WM9 A;  4RX2 A;  3FKW A;  2ZQD A;  3GQZ A;  3IHB A;  5M18 A;  2QMI A;  5JYP A;  2HDR A;  2FFY A;  2P9V B;  4NET A;  3ZG7 B;  5A91 A;  4BJP A;  3Q82 A;  4P85 A;  2EFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...