5CTMA

Structure of bpu1 beta-lactamase
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
233
structure length
232
Chain Sequence
AIAWSVDEFFKNREGTFVIQEVKEKSPWVYNKKRAKERFAPQSTFVANALIGLQTGAVRDEYDIKYWDGVKREIDNWNRDHTLGSGMRDSVVWYYQAMARDIGEERMNHWVKAIHYGNKDISGGIDQFWLSSTLRISPIEQVRFLKQLYEETLPFDLKNMRTVKRMMVQEEEKHATLYGKTGSGSDIGWYVGFIKHEHKTYILATNIKGTGIEAKDITYRILKKYHLMEASV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Class D beta-lactamases do exist in Gram-positive bacteria.
pubmed doi rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 83
structure length 232
sequence length 233
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5ctmA00
2Y2HA 2WGVA 4X53A 4M3KA 2ZC3B 1HD8A 3BFCA 4JKTA 3P09A 1BUEA 1K25A 4R1GA 3WS2A 1HTZA 5CGXA 4JBFA 2ZD8A 3IT9A 5CGSA 2ZJ9A 3IWQA 4OLGA 3BM6A 4IVIA 4PM8A 4UHUA 4ZTKA 2P9VB 4P87A 1Y54A 1FCMA 4E3OA 4RA7A 3W8KA 1C3BA 2R9WA 2X02A 5EVIA 4LENA 4GN2A 4BL3A 4OKPA 5HAIA 1JWZA 3M6BA 4DKIA 3C4PA 5FAQA 3PAGA 1XX2A 4ID4A 1E4DA 3BECA 1W8QA 4KQRA 3IXBA 4S2IA 1N9BA 1E3UD 4OPZA 2ZQCA 3HLDA 3LY4A 2QZ6A 4H8RA 4UA6A 1MWUA 2Y59A 4OPRA 1FCNA 3ZG0A 3HREA 3HLWA 3OPLA 3WRZA 1MKIA 1RP5A 2BLSA 4UA7A 2WKHA 2XFTA 3CG5A 3HUNA 4EQIA 2JBFA 3UE3A 4S2NA 2ZM2A 3WWXA 1VM1A 3M2JA 1NXYA 3C7UA 4NETA 2P9VA 4NK3A 4RVAA 3ZG5A 4P6BA 2J9OA 3ISGA 2J8YA 1S6RA 1XP4A 2ZQ7A 3S1YA 4C75A 2XF3A 2ZQ8A 4D2OA 4DF6A 1IYQA 5L2FA 4OPYA 1ALQA 4P85A 3UPOA 5HFOA 4HESA 2P74A 2WKEA 2HPBA 4EV4A 4RYEA 4GDBA 1CI9A 2Y4AA 4KZ5A 1PIOA 5G18A 4JXGA 2EX8A 4XXRA 3DW0A 3AGFA 3G2YA 4KG2A 2WZXA 2Y2KA 3S22A 3IH8A 2WADA 3VOZA 3SS5A 2V2FF 2J9PA 3VSKA 3UY6A 1O07A 2HDRA 4KG5A 3PBNA 3IWIA 3BYDA 2XEPA 1GHIA 3PBOA 2WGIA 2Q9MA 2EX6A 4OPQA 2WZZA 4PMAA 3ZCZA 1IKIA 1GA9A 1YLTA 3OPPA 5E2GA 3FWLA 1I5QA 1XGJA 3OCLA 2H0YA 1GA0A 1IELA 2OLUA 1EWZA 1SCWA 3SH8A 5EVLA 5HAPA 5CGWA 5AQAA 4KQOA 4ZBEA 3FYZA 3C7VA 2EFUA 1MWRA 4QY5A 4WZ5C 3UPNA 4EBLA 3A3FA 1FR1A 2XDMA 4QJGA 2VGKA 5FAOA 2HDSA 3ZG9B 4Y0TA 2V1ZA 1XA1A 1HZOA 5EECA 1XA7A 3OPRA 1ES5A 2VGJA 4GNUA 4EBNA 4KZ9A 5CEDA 4OQ0A 3Q81A 5CHJA 1L0EA 3N6IA 4F94A 3S4XA 3ZVTA 1IYOA 1ESIA 3TOIA 2HDUA 5FI2A 3FKVA 1YMXA 1Q2QA 4MEZA 1ZG4A 4S2NC 4OVDA 4N9LA 4E6XA 1MWSA 4Q8IA 1U60A 1NY0A 3ITBA 4DE0A 4LV1A 3A3EA 5FQIA 1L0GA 4BD1A 3G2ZA 1KGFA 2H10A 1M40A 4XUXA 3LEZA 3IH9A 4WEJA 4MBHA 4DXCA 2R9XA 2H0TA 2HP9A 1BT5A 1YT4A 2IWBA 1LHYA 3G30A 2CC1A 4YFMA 2V20A 3N8RA 3BEBA 2ZC4B 4K0WA 2Y2NA 4WELA 5HX9A 2GDNA 1K38A 3IXGA 1TEMA 2PBYA 3EQVA 1LI0A 3VP4A 5EOEA 1KDSA 3NIAA 4JF5A 3MFDA 3VFFA 4DDSA 1YLYA 5GLCA 4OLDA 4B4ZA 2ZM0A 1E25A 1JTGA 3IF5A 4QB8A 4JXVA 4DXBA 1K57A 5U47A 5M1AA 3W4OA 4WMCA 1MXOA 2I72A 2XLNA 4DRTA 1L2SA 4KZ6A 4E3KA 1PZPA 2PU2A 3HLGA 3Q07A 5CTMA 1LI9A 1RGZA 1ERMA 1GHPA 1JTDA 2Z2LB 3NDGA 4N1HA 4OQIA 4OQHA 5FI7A 2EX9A 2EX2A 5EVIB 5F83A 1G6AA 5FATA 3V5MA 3ITAA 1FOFA 4JXSA 4WZ5A 2Y2IA 5F82A 3HLEA 1NYMA 4N92A 4BL2A 1PW1A 5EE8A 1BLCA 1W8YA 4ZAMA 4ZJ2A 1KGEA 1K6SA 4MBKA 5KMWA 1GCEA 3HLFA 4O7DA 5DF7A 2WAFA 2ZMAA 4X55A 1SHVA 1MY8A 2ZQ9A 3O88A 3UDXA 4QU3A 4OOYA 4X6TA 2JCHA 3RXXA 5AQ9A 1LL9A 2Y2QA 5TGFA 1K6RA 5CXWA 2ZM8A 1O7EA 4OOMA 1PZOA 3ZG7B 4BENA 1BULA 4KZ7A 4ZJ1A 1ZG6A 4QD4A 5FDHA 3UN7A 1DY6A 4X56A 2Z2MB 3SOIA 5GHZA 1BLPA 4BLMA 1ZKJA 4XUZA 1DJCA 4KG6A 5J8XA 3HUOA 5HW3A 1Q2PA 2DNSA 5E2EA 3SH9A 1IKGA 1KE4A 5FSRA 3WS1A 3O87A 1BLSA 4PPRA 1XXMA 3NBLA 4JXWA 2WKIA 1NJ4A 3V50A 1NZOA 4FH4A 1BSGA 2J7VA 3NC8A 4OOLA 4R4SA 3UE1A 1IYPA 1ERQA 2Y91A 3A3JA 1K56D 3W4PA 2WUQA 4S2KA 4C6YA 1KE3A 3DWZA 4E3MA 3OZHA 1XGIA 1K57C 4E6WA 3IXHA 4WYYA 3IHBA 3LO7A 3UDFA 1MWTA 2Q9NA 2WGWA 4GD8A 5AQ7A 3DTMA 1FR6A 1XPBA 1CI8A 3Q7ZA 3VP0A 2PU4A 5FQKA 5TR7A 1NYYA 1DJBA 4DE2A 2Y2GA 1TDGA 3MKFA 1PYYA 1YM1A 3IWOA 1PWCA 3V3RA 4GOGA 5KZHA 3ZNTA 4R3JA 5M18A 4E3JA 3VOYA 3B3XA 4CPKA 4LCMA 4MNRA 3TG9A 4WZ4A 5GLBA 3CZDA 3IXDA 3VSLA 2X71A 3FZCA 4LV0A 1HVBA 1PI4A 3PTEA 3RJUA 3MZFA 3Q82A 1CK3A 3QNCA 4B88A 4S2LA 4DE3A 5CERA 4U3TA 3C4OA 4HBUA 1TDLA 4L0LA 1WYBA 4KZAA 5E2HA 4UAAA 3VMAA 5GHYA 4A5RA 1JVJA 3CMZA 1XKZA 1L0DA 3C5AA 4X69A 3V39A 3WRTA 3PBSA 1NZUA 1YMSA 3D4FA 3G31A 4MBFA 4EWFA 3HVFA 3LY3A 1PI5A 1G68A 4OQGA 4PM5A 1MBLA 3M6HA 4QHCA 3GTCA 1KVMA 1ES3A 1K55A 2XH9A 1OMEA 3MXRA 2RL3A 3GVBA 4WBGA 4B4XA 5A92A 4KZ8A 3HLCA 1H8ZA 3GR2A 4P0MA 5E2FA 1YLZA 4FD8A 3VP3A 4RX2A 5FASA 3ZVWA 2C6WB 3HL9A 4GD6A 3ZGAB 2QPNA 5F1GA 1KVLA 5DF9A 3A3IA 1ES2A 1YQSA 3P98A 2Y2MA 4IEDA 3BFFA 4Z9QA 1RGYA 2G2WA 5M19A 2JE5A 5FA7A 4K91A 1K56A 3OC2A 1IEMA 3MKEA 2OV5A 1DJAA 3IQAA 5DTKA 1VQQA 1ESUA 1M6KA 4OH0A 3AGDA 4IBXA 5D3OA 1MPLA 3O3VA 2HDQA 5E43A 5A90A 4R4RA 4S2OA 2WYXA 3GMWA 3WS0A 1PWDA 4KZ4A 4R0QA 1TVFA 4OONA 3ZDJA 4DDYA 1I2SA 3A3DA 4Y7PA 3NCKA 5FQJA 4RX3A 2HP5A 4E3NA 5BOHA 1W7FA 5JYOA 3UO9A 2H5SA 5KSCA 3O86A 2XGNA 3SS4A 5I94A 3BFDA 2ZC6B 2IWDA 3Q7VB 1H5XA 2OLVA 5IHVA 4JF6A 3IF6C 1SDNA 4IBRA 3ZG8B 4CJNA 5FQQA 5EOOA 5HARA 3E2LA 1YLPA 4PM7A 1CEFA 1FQGA 3NY4A 4EUZA 2WAEA 3BFEA 2X01A 1ZC2A 5EPHA 4OP5A 4Y0OA 5EUAA 4BD0A 3PBTA 3V3SA 4JF4A 4JLFA 4C3QA 3LCEA 5CEBA 4IVKA 4KENB 3WS4A 3BLSA 1PWGA 4FSFA 3G32A 3VP2A 3HUMA 1W5DA 1YLWA 2ZLYA 3BFGA 3OPHA 1LLBA 1N4OA 4YINA 4BQMA 1L0FA 1S0WA 3MZEA 5FQ9A 1K55C 2ZC5B 5CHUA 5CTNA 1EROA 4MLLA 3VFHA 3QHYA 1JWPA 2WGWB 5HL1A 2E8IA 4LV3A 3N8SA 4GB7A 4K0XA 2Y55A 4QY6A 3AGEA 3DWKA 3G4PA 3PBQA 3WS5A 3N4IA 5KSHA 2OSUA 1W79A 4FH2A 2RCXA 1GHMA 1AXBA 2WK0A 3SH7A 2XFSA 1E3UA 4S2JA 1IYSA 5TFQA 4KQQA 1BTLA 1WE4A 4KZ3A 3BRMA 5GHXA 2XR0A 4FCFA 3ZFZA 1K54A 4R23A 2FFFB 3N8LA 3EQUA 2EXBA 2Y2JA 4JPMA 3W4QA 1PW8A 3HLBA 3QNBA 4BJPA 3NI9A 2UWXA 3NDEA 4R3BA 4S2MA 5GLDA 1JWVA 1FSYA 4UA9A 1ONHA 1SDEA 1H8YA 5CRFA 1ONGA 4U0TA 1KGGA 2DCFA 2HP6A 4OP8A 4E3LA 3UE0A 5HAQA 2IWCA 3OCNA 2ZC7A 1SKFA 4E3IA 2QMIA 1BZAA 3IF6A 3GRJA 4WMCD 3MZDA 1QMEA 4HEFA 4N9KA 2XK1A 1CEGA 1BLHA 1LL5A 4U0XA 1EI5A 1J9MA 3JYIA 1I2WA 3PAEA 5A93A 2A3UA 1FSWA 3UNWA 3GV9A 5DVAA 2Y2PA 5CHMA 3BLMA 5A91A 5EVIC 5FQMA 5DTSA 2ZQDA 1ES4A 2BG1A 2JC7A 1KDWA 2B5RA 2FFYA 3M2KA 5DTTA 4S2PA 2ZQAA 3PBRA 4PM9A 4DE1A 1FCOA 4WEKA 3TSGA 1KE0A 4X68A 4ZJ3A 1NRFA 3CJMA 4ZDXA 3UDIA 4N1XA 5EVID 3UPPA 2DRWA 5AQBA 2Y2OA 5GL9A 3ZHHA 4HBTA 3IF6B 3IHAA 3E2KA 3Q7VA 5CECA 3SS3A 3GQZA 5GLAA 4GZBA 2C5WB 4LCLA 1K4FA 2G2UA 5FI6A 3N7WA 3FV7A 3FKWA 1YLJA 1Z6FA 2EFXA 3HBRA 3MBZA 3G35A 4GDNA 5F1FA 4LV2A 3ZNYA 5JYPA 2XD1A 5DF8A 4EBPA 3G34A 3MXSA 3GSGA 2XD5A 1K54C 2EXAA 4Y0UA 3RXWA 2XQZA 1QMFA 1WYCA 2Y2LA 2A49A 4PM6A 1RCJA 5FAPA 3Q1FA 4KZBA 4GKUA 1K4EA 3I7JA 3VP1A 4WM9A
chains in the Genus database with same CATH superfamily
4M3KA 4JGRA 1K25A 2INWA 3C38A 5HWTA 1GSXA 2HZ5A 5CGSA 2ZJ9A 1A0KA 3BM6A 4GW9A 2PRFA 3W8KA 1C3BA 2X02A 4LENA 5HAIA 3LR4A 3C4PA 5FAQA 3PAGA 4ID4A 1E4DA 4KQRA 4S2IA 1N9BA 2ZQCA 3HLDA 4FUWA 1GSVA 4UA6A 2PYRA 3ZG0A 5F6AA 4UA7A 2EA9A 3CG5A 5G4ZA 3UE3A 3A0RA 4S2NA 5F68A 4Q0JA 3C7UA 5EFWA 4P6BA 1XP4A 4DF6A 1IYQA 2VLGA 4HESA 2HPBA 4EV4A 1CI9A 3H82B 5HDCA 4NEED 4XXRA 3DW0A 5DFXA 3G2YA 2WZXA 2Y2KA 3VOZA 3IWIA 1UGUA 1GHIA 5J7EA 1CJFA 4P6ZS 1YLTA 1I5QA 1XGJA 5EVLA 5AQAA 4QY5A 4UQIS 3A3FA 4I38A 2HDSA 5EECA 3OPRA 3BJNA 3BY9A 5CHJA 1L0EA 4Y15A 1IYOA 1ESIA 5FI2A 2W1RA 4EQ1A 2R78A 4Q8IA 1NY0A 3ITBA 4DXCA 1T1BA 2FH5A 3N8RA 5J3WA 2Y2NA 1CQAA 1ACFA 4IJGA 4ZRRA 4OLDA 4PAUA 3HJIA 1E25A 3TRCA 1K57A 5U47A 3F1NA 1MXOA 4DRTA 1PZPA 3HLGA 1GHPA 2Z2LB 3TW8A 2EX9A 2NUPC 4JXSA 2Y2IA 3IS2A 3HLEA 1NYMA 4ESPA 4K08A 5EE8A 4EU0A 1KGEA 3IBJA 4Y5FA 3CLOA 1GCEA 3HLFA 4O7DA 5EVEA 2WAFA 1G28A 3UDXA 4QU3A 4OOYA 2JCHA 1K6RA 2ZM8A 4OOMA 4ZJ1A 4KZ7A 1ZG6A 2LB9A 1DY6A 1BLPA 1ZKJA 4XUZA 1DJCA 3LIEA 1IKGA 1KE4A 3O87A 3NBLA 4JXWA 2XA7S 3UE1A 3NC8A 4R4SA 1ERQA 3UB9A 4C6YA 2V0WA 3D3OA 3FPWA 4E6WA 2ZOHA 3B33A 3LO7A 2ZOIA 3K3CA 3UB6A 1SKOA 3UDFA 2ZBBA 4GD8A 3C30A 2HV1A 4HJ4A 1XPBA 1CI8A 2K31A 3VP0A 2L4RA 2O9AA 1NYYA 3T1RA 1NRJA 3V3RA 5KZHA 3LEQA 2Y8HA 3LICA 3VSLA 2V8CA 2ZMFA 1OT9A 1PI4A 3EEAA 3PTEA 5KIZA 4H6JA 5CERA 3C4OA 1P9WA 3B47A 1TDLA 5E2HA 4QPRA 5GHYA 3CMZA 1NZUA 1YMSA 1PI5A 4O01A 4PM5A 1MBLA 1KVMA 2XH9A 1OMEA 1XFQA 5A92A 3GR2A 1LL8A 5E2FA 4FD8A 5CX7A 5FASA 3ZVWA 4UEYA 3RTYA 5F1GA 5DF9A 3P7NA 1YQSA 3P98A 3MQ0A 3TJZC 2J80A 3LR3A 2W3GA 5M19A 4K91A 3MKEA 4Q0HA 3UMDA 1TS8A 1NLYA 1D7EA 4OONA 5FQJA 4RX3A 1L3LA 1W7FA 4EESA 3UO9A 2XGNA 1G6OA 5G4YA 3G6OA 3Q7VB 4IBRA 5HARA 4EUZA 3PR6A 2WAEA 3BFEA 3T1XA 3KO6A 1ZC2A 5EPHA 5EUAA 3V3SA 4KENB 3G32A 2JHEA 1T19A 1YLWA 1LLBA 4BQMA 1S0WA 1EROA 4MLLA 4G3VA 5L10A 4K0XA 2Y55A 1XFNA 5KSHA 1S4RA 2D02A 4FH2A 2RCXA 2M7VA 1GHMA 2XSSA 2XFSA 5HSQA 1IYSA 4KQQA 5F69A 1YKDA 1K54A 2FFFB 4MDZA 3W4QA 1PW8A 3HLBA 4BJPA 2PT7A 3NDEA 4R3BA 5GLDA 1FSYA 1H8YA 2WKQA 3JVVA 3MSHA 5DFYA 2BASA 1KGGA 3OCNA 4DJ3A 1BZAA 3IF6A 3HJKA 1CEGA 4U0XA 1I2WA 2A3UA 2V1AA 2VZWA 2VGLM 5CHMA 1ES4A 2JC7A 3M2KA 4S2PA 3LR5A 3PBRA 4DE1A 1KE0A 4IHQA 3UPPA 2DRWA 2GNXA 4MN6A 4Q0IA 5GL9A 4HBTA 1IFQA 2QYBA 3DTEA 3Q7VA 4KUKA 3UB8A 3CITA 3GQZA 5GLAA 2C5WB 5FI6A 4H6JB 3FV7A 1YLJA 3MBZA 3F1PA 5HWVA 3Q1FA 3B42A 4L9GA 1K4EA 3O88A 3VP1A 4X6TA 4WM9A 2ZMVA 2ZC3B 3BFCA 3P09A 3TE8A 4CLCB 3KX0X 4R1GA 1HTZA 3QP6A 2JN7A 2P7JA 4OLGA 4NG2A 4ZTKA 3F1PB 2O9BA 2P9VB 3FPVA 4E3OA 1CF0A 4DJ2A 5EVIA 1D1JA 3P01A 4BL3A 1JWZA 4GS9B 2ZL1A 1XX2A 1W8QA 3IXBA 4OPZA 1DRMA 3BWLA 4R6LA 4CLCA 3LY4A 2B18A 4OPRA 4G3WA 3HLWA 3OPLA 4YOFA 2BLSA 2VJWA 4JGOA 2JBFA 2ZM2A 4EUVA 3M2JA 4NK3A 4RVAA 2ZQ7A 4C75A 2XF3A 1ALQA 3NOTC 1JNUA 3UPOA 2P74A 1PIOA 5G18A 2EX8A 2LB5A 4KG2A 3NULA 5TJJA 3S22A 1PRQA 2WADA 3IH8A 4Y3IA 2V2FF 3PBNA 3MF0A 2WGIA 2Q9MA 4OPQA 4PMAA 3ZCZA 1IKIA 5FAOA 5E2GA 2OLUA 1IELA 3SH8A 1SCWA 4ZBEA 1OTEA 5AVEA 2VA0A 3UPNA 1FR1A 3VE4A 4QJGA 2VGKA 2M7UA 3ZG9B 4Y0TA 2K2NA 1XA1A 1XA7A 1ES5A 2VGJA 4EBNA 3N6IA 3S4XA 3QP1A 3LI8A 4EW7A 1F9IA 1Q2QA 4MEZA 4OVDA 4N9LA 3CPTB 3A3EA 3G2ZA 1BT5A 1YT4A 4BBVA 5FEGA 3MS6A 3CUEA 2CC1A 2DMWA 3BEBA 2ZC4B 5I5LA 2GDNA 2GX5A 2PBYA 3EQVA 3R4KA 1LI0A 5EOEA 3NIAA 4JF5A 4DDSA 4B4ZA 3ICYA 4JGPA 3DBAA 3IF5A 4JXVA 1L2SA 4E3KA 1LI9A 3CWFA 1JTDA 4OQHA 3E4OA 5EVIB 5F83A 2O99A 1G6AA 4GLQA 4EETB 4LRZE 4QWOA 1W8YA 4ZAMA 3E4QA 3RH8B 3IX8A 4X55A 5L8MA 2ZQ9A 2O0YA 5AQ9A 2Y2QA 5DJUA 4NXEA 3ZG7B 3MXQA 4B93A 4ETZA 2MJ6A 5FDHA 3QP5A 3UN7A 2Z2MB 3SOIA 1V9YA 2HJEA 3VOLA 5HW3A 2DNSA 5E2EA 3WS1A 3H82A 1XXMA 3V50A 1NJ4A 3O5YA 4OOLA 1IYPA 3A3JA 1K56D 1KE3A 4E3MA 1XGIA 3T1QB 4MN7A 5IT5A 1MWTA 2Q9NA 3IBRA 2W3FA 1MKMA 3DTMA 4EEUA 4LGWA 3S7QA 4MN5A 3K2NA 2Y2GA 5DKKA 1UWPX 1TDGA 3MKFA 3PHYA 1PWCA 2W3EA 4X25A 4R3JA 2H28A 3B3XA 4LCMA 5GLBA 3IXDA 3S7PA 3EOIA 1YSQA 3Q82A 3QNCA 1VB6A 4S2LA 4DE3A 4HBUA 4NXGA 3MJQA 4LPZA 3MFXA 1PFLA 1JVJA 5HL1A 1VETA 4OQGA 5L07A 2PBDP 4QHCA 2UV0E 3GTCA 1ES3A 1K55A 2RL3A 4WBGA 4B4XA 1T1CA 1MC0A 4RX2A 2QPNA 3QP2A 1KVLA 2YKHA 2Y2MA 4Z9QA 1T1AA 2JE5A 5FA7A 3K3DA 1DJAA 3IQAA 5DTKA 3O3VA 1H3QA 3GDIA 1TVFA 4DDYA 5J4EA 1I2SA 4E3NA 3NCKA 2H5SA 2E8JA 5I94A 1ZTUA 4HI4A 2IWDA 3T4LA 2W1TA 2K7SA 5EOOA 1FQGA 1WA9A 4BD0A 3R7WB 5CEBA 3T4QA 3WS4A 3BLSA 4FSFA 2J3TD 1W5DA 2ZLYA 3BFGA 1N4OA 4F3LB 1L0FA 1TF1A 4I5SA 2ACGA 2ZC5B 5DJTA 3H7WB 3VFHA 4LV3A 4L9FA 2E8IA 1W79A 1XJ3A 3NJAA 3QP8A 1E3UA 1BTLA 4KZ3A 4HIAA 3BRMA 4WN5A 4FCFA 3U2AA 4R23A 2EXBA 2Y2JA 4JPMA 4S2MA 2UWXA 2IA2A 4UA9A 2VV7A 5CRFA 1ONGA 1TS0A 4U0TA 2HP6A 4HJ3A 2VGLS 3CI6A 2QMIA 4WMCD 4GHIB 1BLHA 3PAEA 3BLMA 5FDSA 1KDWA 2FFYA 1YAXA 5HDSA 3E4PA 1NRFA 1PNEA 4HOIA 4ZDXA 4N1XA 5AQBA 1N9NA 3E2KA 3C8CA 1SKOB 2VK3A 4GZBA 4LCLA 1K4FA 3N7WA 1Z6FA 3G35A 4LV2A 5DF8A 3MXSA 1FIKA 2XD5A 1J3WA 3CAXA 2EXAA 5HDDA 1QMFA 4PM6A 2J3WA 2KLIA 4LFUA 3I7JA 4X53A 1HD8A 4PHTA 4JKTA 1BUEA 3WS2A 2A24B 3IWQA 1XJ4A 4IVIA 4PM8A 4UHUA 3KSIA 1FCMA 2P04A 4NKPA 3LI9A 4OKPA 3M6BA 4BBUA 2JKTM 4HJ6A 1MWUA 4DMZA 4R70A 1RP5A 2WKHA 2XFTA 3HUNA 3WWXA 2JKGA 2P9VA 2J9OA 2J8YA 3DTIA 4D2OA 5HWWA 4OPYA 4P85A 1X0OA 4HP9A 5HFOA 3EEHA 2Y4AA 4JXGA 3EGXC 3AGFA 3GECA 4GJ4A 3LFVA 3SS5A 3UY6A 4KG5A 3PBOA 3JPUA 2D01A 2O9CA 1UWNX 3E98A 2B95A 2EX6A 3MQOA 2WZZA 3FWLA 3OCLA 2H0YA 1GA0A 1EWZA 5CGWA 3FYZA 1OTDA 2EFUA 3C7VA 4WZ5C 3UB5P 1S1ZA 2V1ZA 1F5MA 4HHDA 3A0VA 5CEDA 3L7HA 5AJGA 2W3DA 1VEUB 4F94A 2L1MA 2OWHA 3ZVTA 3TOIA 2HDUA 1AWIA 1YMXA 1OJGA 2B02A 4S2NC 5C5KA 1P9RA 4E6XA 4LV1A 1VHMA 1L0GA 3RFBA 1SZVA 1KGFA 2H10A 4XUXA 3LEZA 3IH9A 2M1CA 2HP9A 3S7OA 2V20A 4K0WA 5HX9A 4IUKA 1K38A 3VP4A 2VV6A 2YKFA 5HPIA 4Y13A 1YLYA 1TS6A 4I3AA 2OWJA 5IS1A 2I72A 5F5YA 3Q07A 5EM0A 1RGZA 4OQIA 4Y17A 5FI7A 3BQ8A 2EX2A 4EXOA 5FATA 4WZ5A 4BL2A 1PW1A 1BLCA 1HLUP 4MBKA 1SHVA 5TGFA 5CXWA 1O7EA 1BULA 4LRXC 3KSGA 4BLMA 1S67L 3HCYA 4WL9A 2W0NA 2XRNA 3VE3A 5FSRA 1BLSA 4D60A 1W63Q 1Y28A 1LSWA 1NZOA 2J7VA 3H7WA 3W4PA 4S2KA 3DWZA 3SZTA 3OZHA 3LYXA 1K57C 4WYYA 3IHBA 2WGWA 3DTKA 2QHKA 3Q7ZA 4FOFA 2JKFA 1DP9A 4DE2A 4R38A 4FTXA 1YM1A 3IWOA 3V67A 5FEFA 4GOGA 3C2WA 2QKPA 5M18A 4E3JA 2HGVA 3E0YA 4I3JA 4MNRA 3TG9A 4WZ4A 3FZCA 4LV0A 1OJ5A 3RJUA 1CK3A 4CLCE 4LRYC 4PKYG 4U3TA 3CPTA 3F1OB 4UAAA 3VMAA 4R3AA 4A5RA 2V9AA 2VX8A 3SW1A 3C5AA 4X69A 3PBSA 4MBFA 3D4FA 4EWFA 3HVFA 3LY3A 3M6HA 4KZ8A 1H8ZA 4P0MA 1YLZA 3LIAA 3H9WA 3VP3A 3ZGAB 4HP4A 1ES2A 4IEDA 3BFFA 3VV4A 2G2WA 1N9LA 1K56A 1IEMA 1S66L 1M6KA 5D3OA 1MPLA 1BYWA 5A90A 4R4RA 4S2OA 2GZAA 2OAQ1 3GMWA 1PWDA 4KZ4A 4R0QA 5AVFA 3ZDJA 5BOHA 2HP5A 4WF0A 1OTIA 3O86A 4AFIA 3SS4A 3PYPA 3MR0A 3BFDA 2ZC6B 2PYPA 3D9YA 3IF6C 1SDNA 4CJNA 3E2LA 2WKRA 1CEFA 1STZA 2X01A 2L0WA 3T4TA 4Y0OA 3T1SA 4JF4A 4JLFA 4IVKA 2ZL1B 3BQAA 1PWGA 3VP2A 3HUMA 1XJ2A 3OPHA 4DN0A 1TS7A 3MZEA 5CHUA 2AVXA 4LLOB 3OBFA 3QHYA 5HPFA 3LIDA 3N8SA 4GB7A 3PBQA 3WS5A 2Z6DA 1AXBA 1WE4A 1NLZA 5GHXA 3T12B 3IS2B 4HQAA 3EQUA 3QNBA 3OLOA 3KSHA 1EW0A 1JWVA 1ONHA 1SDEA 4NXFA 4EEPA 4HH2A 3D72A 5HAQA 4RQ9A 1SKFA 3FG8A 1W63M 3MZDA 5HD5A 4N9KA 4HEFA 2XK1A 1LL5A 3JYIA 5A93A 1P97A 5DVAA 2Y2PA 1OTBA 4Y2FA 1LT0A 5EVIC 5DTSA 4CLCD 3W2ZA 2BG1A 2B5RA 4CQHA 1MZUA 1YSPA 4HY8A 4PM9A 1N9OA 3KSFA 3TSGA 1G5UA 3UMEA 4ZJ3A 4CLCC 3CJMA 5EVID 3NOPC 3ZHHA 4I3IA 3IF6B 3IHAA 2Q0OA 2PHYA 3SS3A 5HZHA 5HL6A 3FKWA 5F1FA 4GDNA 3ZNYA 4IUHA 3G34A 3GSGA 4XT2B 1K54C 4Y0UA 2Y2LA 2PD7A 2A49A 4EERA 1RCJA 5FAPA 4KZBA 5EM1A 4GKUA 2Y2HA 2WGVA 4B9OA 2QWSA 5CGXA 4JBFA 2JKRI 2ZD8A 3IT9A 2I9VA 1K0KA 3PXPA 2W1TB 4P87A 1Y54A 4PKYA 4RA7A 4M4XA 2R9WA 4GN2A 2KOIA 4I39A 4DKIA 3DAVA 3BECA 2KDKA 1E3UD 2A2LA 1S1YA 2QZ6A 4H8RA 2P08A 2Y59A 1FCNA 1VEUA 3HREA 3KYEA 3WRZA 1MKIA 4EQIA 1IOUA 1GSWA 1VM1A 1NXYA 4NETA 3ZG5A 2G7UA 3ISGA 3S1YA 1S6RA 1S4SA 5L2FA 2ZQ8A 4ME4A 2WKEA 4RYEA 4GDBA 4KZ5A 3LIBA 3EWKA 4P6ZM 2J9PA 3VSKA 1O07A 2HDRA 3KYZA 3BYDA 2XEPA 1KOUA 1TD5A 1YPRA 2CMNA 3UB7A 1GA9A 3OPPA 5HAPA 4KQOA 3LR0A 1MWRA 2V1BA 4BMWA 4EBLA 4XT2A 2V8FA 2XDMA 1HZOA 2FZ0A 1NWZA 4HH3A 4GNUA 4UQIM 4KZ9A 4OQ0A 3Q81A 4NXBA 3F1NB 3FKVA 3MQQA 1ZG4A 1MWSA 1U60A 3BW6A 4DE0A 2VEAA 5FQIA 4BD1A 1M40A 4WEJA 4WUJA 4MBHA 2R9XA 1LSVA 2H0TA 2IWBA 2QJ5A 1LHYA 3G30A 4YFMA 4WELA 5TBMB 3IXGA 1TEMA 3BY8A 3NHQA 1KDSA 3MFDA 3VFFA 5GLCA 2ZM0A 2JKTI 2A24A 1JTGA 4QB8A 4DXBA 2W3HA 5M1AA 3W4OA 4WMCA 2XLNA 4KZ6A 2PU2A 4Z1WA 5CTMA 1ERMA 3NDGA 4N1HA 3T4OA 3V5MA 3ITAA 1FOFA 5F82A 4N92A 3NECA 1ODVA 2JKRM 4ZJ2A 5K5BA 1K6SA 3QP4A 2PDRA 4ARZA 5KMWA 2V0UA 5DF7A 2ZMAA 3LIFA 1LSXA 1MY8A 1H8MA 2HF6A 2OOLA 4MCWA 3RXXA 1LL9A 1PZOA 4BENA 3U4LP 4QD4A 1Z09A 4II7A 4X56A 5GHZA 4KG6A 2Z6CA 5J8XA 3CUEC 3HUOA 3T4SA 1Q2PA 4X1MA 3SH9A 4PPRA 1V9ZA 2WKIA 4FH4A 1BSGA 5MC7A 2Y91A 4X1LA 5HD3A 2WUQA 4G3KA 3IXHA 2VKSA 2BTFP 2XA7M 2PR6A 5AQ7A 1DP8A 1FR6A 2EWVA 5A8BA 3F1OA 4ETXA 2PU4A 5FQKA 5TR7A 4MMNA 1DJBA 4ARZB 1PYYA 3ULFA 2KX6A 5TBMA 3ZNTA 2EWWA 3VOYA 4BBTA 4CPKA 1D06A 3CZDA 3ZQ5A 2X71A 1Y4OA 2VV8A 1HVBA 3MZFA 4GHIA 4B88A 2QJ7A 2WKPA 4L0LA 1WYBA 4KZAA 4GS9A 1XKZA 1L0DA 3V39A 3WRTA 5IU1A 3G31A 1G68A 1ZHHB 3KYQA 3MXRA 3GVBA 3HLCA 2HJ9C 2C6WB 3A0SA 3HL9A 4GD6A 3IX3A 3A3IA 4YNRA 3OOVA 1RGYA 1P0ZA 2XROA 2Y79A 4BWIA 3OC2A 2OV5A 1F98A 1VQQA 1ESUA 4OH0A 3AGDA 4IBXA 1VETB 2HDQA 5L09A 3L9KA 5E43A 4HNBA 2WYXA 3WS0A 4KQDA 3T50A 3A3DA 4Y7PA 5LBRA 5JYOA 5KSCA 1H5XA 2OLVA 5IHVA 4JF6A 2PAVP 3T4JA 3ZG8B 1OTAA 5FQQA 4PM7A 1YLPA 1DP6A 3NY4A 3EGDC 4OP5A 3PBTA 4C3QA 3LCEA 3MMHA 4YINA 2J3TC 2PR5A 5FQ9A 1K55C 5CTNA 2W27A 4YWZA 1T18A 1JWPA 2WGWB 4QY6A 3AGEA 3DWKA 3G4PA 3N4IA 2OSUA 4WLAA 2WK0A 3SH7A 2NUTC 3JVUA 1OPXA 4S2JA 3IX4A 3LUQA 5TFQA 3R7WA 2XR0A 3ZFZA 3N8LA 3NI9A 4O0PA 4GCZA 2DCFA 5FL3A 2PD8A 4OP8A 4E3LA 3UE0A 1H0MA 2IWCA 2ZC7A 4E3IA 3GRJA 3FC7A 1QMEA 1EI5A 1J9MA 3UE6A 1FSWA 4L9EA 5DKLA 3UNWA 3GV9A 5A91A 5FQMA 2ZQDA 1F2KA 2OAP1 5DTTA 4JGQA 2ZQAA 4KUOA 1FCOA 4WEKA 2GJ3A 1OT6A 4X68A 3UDIA 2Y2OA 3NOUC 1XJ6A 5CECA 3ZYTA 2G2UA 4E04A 1FILA 2EFXA 3HBRA 3S7NA 3T4KA 5JYPA 3LGOA 2XD1A 4EBPA 3CHWP 3RXWA 2XQZA 1WYCA 4F3LA 4O8GA 5EV0A
chains in the Genus database with same CATH topology
2Y2HA 2WGVA 4X53A 4M3KA 2ZC3B 1HD8A 3BFCA 4JKTA 3P09A 1BUEA 1K25A 4R1GA 3WS2A 1HTZA 5CGXA 4JBFA 2ZD8A 3IT9A 5CGSA 2ZJ9A 3IWQA 4OLGA 3BM6A 4IVIA 4PM8A 4UHUA 4ZTKA 2P9VB 4P87A 1Y54A 1FCMA 4E3OA 4RA7A 3W8KA 1C3BA 2R9WA 2X02A 5EVIA 4LENA 4GN2A 4BL3A 4OKPA 5HAIA 1JWZA 3M6BA 4DKIA 3C4PA 5FAQA 3PAGA 1XX2A 4ID4A 1E4DA 3BECA 1W8QA 4KQRA 3IXBA 4S2IA 1N9BA 1E3UD 4OPZA 2ZQCA 3HLDA 3LY4A 2QZ6A 4H8RA 4UA6A 1MWUA 2Y59A 4OPRA 1FCNA 3ZG0A 3HREA 3HLWA 3OPLA 3WRZA 1MKIA 1RP5A 2BLSA 4UA7A 2WKHA 2XFTA 3CG5A 3HUNA 4EQIA 2JBFA 3UE3A 4S2NA 2ZM2A 3WWXA 1VM1A 3M2JA 1NXYA 3C7UA 4NETA 2P9VA 4NK3A 4RVAA 3ZG5A 4P6BA 2J9OA 3ISGA 2J8YA 1S6RA 1XP4A 2ZQ7A 3S1YA 4C75A 2XF3A 2ZQ8A 4D2OA 4DF6A 1IYQA 5L2FA 4OPYA 1ALQA 4P85A 3UPOA 5HFOA 4HESA 2P74A 2WKEA 2HPBA 4EV4A 4RYEA 4GDBA 1CI9A 2Y4AA 4KZ5A 1PIOA 5G18A 4JXGA 2EX8A 4XXRA 3DW0A 3AGFA 3G2YA 4KG2A 2WZXA 2Y2KA 3S22A 3IH8A 2WADA 3VOZA 3SS5A 2V2FF 2J9PA 3VSKA 3UY6A 1O07A 2HDRA 4KG5A 3PBNA 3IWIA 3BYDA 2XEPA 1GHIA 3PBOA 2WGIA 2Q9MA 2EX6A 4OPQA 2WZZA 4PMAA 3ZCZA 1IKIA 1GA9A 1YLTA 3OPPA 5E2GA 3FWLA 1I5QA 1XGJA 3OCLA 2H0YA 1GA0A 1IELA 2OLUA 1EWZA 1SCWA 3SH8A 5EVLA 5HAPA 5CGWA 5AQAA 4KQOA 4ZBEA 3FYZA 3C7VA 2EFUA 1MWRA 4QY5A 4WZ5C 3UPNA 4EBLA 3A3FA 1FR1A 2XDMA 4QJGA 2VGKA 5FAOA 2HDSA 3ZG9B 4Y0TA 2V1ZA 1XA1A 1HZOA 5EECA 1XA7A 3OPRA 1ES5A 2VGJA 4GNUA 4EBNA 4KZ9A 5CEDA 4OQ0A 3Q81A 5CHJA 1L0EA 3N6IA 4F94A 3S4XA 3ZVTA 1IYOA 1ESIA 3TOIA 2HDUA 5FI2A 3FKVA 1YMXA 1Q2QA 4MEZA 1ZG4A 4S2NC 4OVDA 4N9LA 4E6XA 1MWSA 4Q8IA 1U60A 1NY0A 3ITBA 4DE0A 4LV1A 3A3EA 5FQIA 1L0GA 4BD1A 3G2ZA 1KGFA 2H10A 1M40A 4XUXA 3LEZA 3IH9A 4WEJA 4MBHA 4DXCA 2R9XA 2H0TA 2HP9A 1BT5A 1YT4A 2IWBA 1LHYA 3G30A 2CC1A 4YFMA 2V20A 3N8RA 3BEBA 2ZC4B 4K0WA 2Y2NA 4WELA 5HX9A 2GDNA 1K38A 3IXGA 1TEMA 2PBYA 3EQVA 1LI0A 3VP4A 5EOEA 1KDSA 3NIAA 4JF5A 3MFDA 3VFFA 4DDSA 1YLYA 5GLCA 4OLDA 4B4ZA 2ZM0A 1E25A 1JTGA 3IF5A 4QB8A 4JXVA 4DXBA 1K57A 5U47A 5M1AA 3W4OA 4WMCA 1MXOA 2I72A 2XLNA 4DRTA 1L2SA 4KZ6A 4E3KA 1PZPA 2PU2A 3HLGA 3Q07A 5CTMA 1LI9A 1RGZA 1ERMA 1GHPA 1JTDA 2Z2LB 3NDGA 4N1HA 4OQIA 4OQHA 5FI7A 2EX9A 2EX2A 5EVIB 5F83A 1G6AA 5FATA 3V5MA 3ITAA 1FOFA 4JXSA 4WZ5A 2Y2IA 5F82A 3HLEA 1NYMA 4N92A 4BL2A 1PW1A 5EE8A 1BLCA 1W8YA 4ZAMA 4ZJ2A 1KGEA 1K6SA 4MBKA 5KMWA 1GCEA 3HLFA 4O7DA 5DF7A 2WAFA 2ZMAA 4X55A 1SHVA 1MY8A 2ZQ9A 3O88A 3UDXA 4QU3A 4OOYA 4X6TA 2JCHA 3RXXA 5AQ9A 1LL9A 2Y2QA 5TGFA 1K6RA 5CXWA 2ZM8A 1O7EA 4OOMA 1PZOA 3ZG7B 4BENA 1BULA 4KZ7A 4ZJ1A 1ZG6A 4QD4A 5FDHA 3UN7A 1DY6A 4X56A 2Z2MB 3SOIA 5GHZA 1BLPA 4BLMA 1ZKJA 4XUZA 1DJCA 4KG6A 5J8XA 3HUOA 5HW3A 1Q2PA 2DNSA 5E2EA 3SH9A 1IKGA 1KE4A 5FSRA 3WS1A 3O87A 1BLSA 4PPRA 1XXMA 3NBLA 4JXWA 2WKIA 1NJ4A 3V50A 1NZOA 4FH4A 1BSGA 2J7VA 3NC8A 4OOLA 4R4SA 3UE1A 1IYPA 1ERQA 2Y91A 3A3JA 1K56D 3W4PA 2WUQA 4S2KA 4C6YA 1KE3A 3DWZA 4E3MA 3OZHA 1XGIA 1K57C 4E6WA 3IXHA 4WYYA 3IHBA 3LO7A 3UDFA 1MWTA 2Q9NA 2WGWA 4GD8A 5AQ7A 3DTMA 1FR6A 1XPBA 1CI8A 3Q7ZA 3VP0A 2PU4A 5FQKA 5TR7A 1NYYA 1DJBA 4DE2A 2Y2GA 1TDGA 3MKFA 1PYYA 1YM1A 3IWOA 1PWCA 3V3RA 4GOGA 5KZHA 3ZNTA 4R3JA 5M18A 4E3JA 3VOYA 3B3XA 4CPKA 4LCMA 4MNRA 3TG9A 4WZ4A 5GLBA 3CZDA 3IXDA 3VSLA 2X71A 3FZCA 4LV0A 1HVBA 1PI4A 3PTEA 3RJUA 3MZFA 3Q82A 1CK3A 3QNCA 4B88A 4S2LA 4DE3A 5CERA 4U3TA 3C4OA 4HBUA 1TDLA 4L0LA 1WYBA 4KZAA 5E2HA 4UAAA 3VMAA 5GHYA 4A5RA 1JVJA 3CMZA 1XKZA 1L0DA 3C5AA 4X69A 3V39A 3WRTA 3PBSA 1NZUA 1YMSA 3D4FA 3G31A 4MBFA 4EWFA 3HVFA 3LY3A 1PI5A 1G68A 4OQGA 4PM5A 1MBLA 3M6HA 4QHCA 3GTCA 1KVMA 1ES3A 1K55A 2XH9A 1OMEA 3MXRA 2RL3A 3GVBA 4WBGA 4B4XA 5A92A 4KZ8A 3HLCA 1H8ZA 3GR2A 4P0MA 5E2FA 1YLZA 4FD8A 3VP3A 4RX2A 5FASA 3ZVWA 2C6WB 3HL9A 4GD6A 3ZGAB 2QPNA 5F1GA 1KVLA 5DF9A 3A3IA 1ES2A 1YQSA 3P98A 2Y2MA 4IEDA 3BFFA 4Z9QA 1RGYA 2G2WA 5M19A 2JE5A 5FA7A 4K91A 1K56A 3OC2A 1IEMA 3MKEA 2OV5A 1DJAA 3IQAA 5DTKA 1VQQA 1ESUA 1M6KA 4OH0A 3AGDA 4IBXA 5D3OA 1MPLA 3O3VA 2HDQA 5E43A 5A90A 4R4RA 4S2OA 2WYXA 3GMWA 3WS0A 1PWDA 4KZ4A 4R0QA 1TVFA 4OONA 3ZDJA 4DDYA 1I2SA 3A3DA 4Y7PA 3NCKA 5FQJA 4RX3A 2HP5A 4E3NA 5BOHA 1W7FA 5JYOA 3UO9A 2H5SA 5KSCA 3O86A 2XGNA 3SS4A 5I94A 3BFDA 2ZC6B 2IWDA 3Q7VB 1H5XA 2OLVA 5IHVA 4JF6A 3IF6C 1SDNA 4IBRA 3ZG8B 4CJNA 5FQQA 5EOOA 5HARA 3E2LA 1YLPA 4PM7A 1CEFA 1FQGA 3NY4A 4EUZA 2WAEA 3BFEA 2X01A 1ZC2A 5EPHA 4OP5A 4Y0OA 5EUAA 4BD0A 3PBTA 3V3SA 4JF4A 4JLFA 4C3QA 3LCEA 5CEBA 4IVKA 4KENB 3WS4A 3BLSA 1PWGA 4FSFA 3G32A 3VP2A 3HUMA 1W5DA 1YLWA 2ZLYA 3BFGA 3OPHA 1LLBA 1N4OA 4YINA 4BQMA 1L0FA 1S0WA 3MZEA 5FQ9A 1K55C 2ZC5B 5CHUA 5CTNA 1EROA 4MLLA 3VFHA 3QHYA 1JWPA 2WGWB 5HL1A 2E8IA 4LV3A 3N8SA 4GB7A 4K0XA 2Y55A 4QY6A 3AGEA 3DWKA 3G4PA 3PBQA 3WS5A 3N4IA 5KSHA 2OSUA 1W79A 4FH2A 2RCXA 1GHMA 1AXBA 2WK0A 3SH7A 2XFSA 1E3UA 4S2JA 1IYSA 5TFQA 4KQQA 1BTLA 1WE4A 4KZ3A 3BRMA 5GHXA 2XR0A 4FCFA 3ZFZA 1K54A 4R23A 2FFFB 3N8LA 3EQUA 2EXBA 2Y2JA 4JPMA 3W4QA 1PW8A 3HLBA 3QNBA 4BJPA 3NI9A 2UWXA 3NDEA 4R3BA 4S2MA 5GLDA 1JWVA 1FSYA 4UA9A 1ONHA 1SDEA 1H8YA 5CRFA 1ONGA 4U0TA 1KGGA 2DCFA 2HP6A 4OP8A 4E3LA 3UE0A 5HAQA 2IWCA 3OCNA 2ZC7A 1SKFA 4E3IA 2QMIA 1BZAA 3IF6A 3GRJA 4WMCD 3MZDA 1QMEA 4HEFA 4N9KA 2XK1A 1CEGA 1BLHA 1LL5A 4U0XA 1EI5A 1J9MA 3JYIA 1I2WA 3PAEA 5A93A 2A3UA 1FSWA 3UNWA 3GV9A 5DVAA 2Y2PA 5CHMA 3BLMA 5A91A 5EVIC 5FQMA 5DTSA 2ZQDA 1ES4A 2BG1A 2JC7A 1KDWA 2B5RA 2FFYA 3M2KA 5DTTA 4S2PA 2ZQAA 3PBRA 4PM9A 4DE1A 1FCOA 4WEKA 3TSGA 1KE0A 4X68A 4ZJ3A 1NRFA 3CJMA 4ZDXA 3UDIA 4N1XA 5EVID 3UPPA 2DRWA 5AQBA 2Y2OA 5GL9A 3ZHHA 4HBTA 3IF6B 3IHAA 3E2KA 3Q7VA 5CECA 3SS3A 3GQZA 5GLAA 4GZBA 2C5WB 4LCLA 1K4FA 2G2UA 5FI6A 3N7WA 3FV7A 3FKWA 1YLJA 1Z6FA 2EFXA 3HBRA 3MBZA 3G35A 4GDNA 5F1FA 4LV2A 3ZNYA 5JYPA 2XD1A 5DF8A 4EBPA 3G34A 3MXSA 3GSGA 2XD5A 1K54C 2EXAA 4Y0UA 3RXWA 2XQZA 1QMFA 1WYCA 2Y2LA 2A49A 4PM6A 1RCJA 5FAPA 3Q1FA 4KZBA 4GKUA 1K4EA 3I7JA 3VP1A 4WM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y2H A;  2WGV A;  4X53 A;  4M3K A;  2ZC3 B;  1HD8 A;  3BFC A;  4JKT A;  3P09 A;  1BUE A;  1K25 A;  4R1G A;  3WS2 A;  1HTZ A;  5CGX A;  4JBF A;  2ZD8 A;  3IT9 A;  5CGS A;  2ZJ9 A;  3IWQ A;  4OLG A;  3BM6 A;  4IVI A;  4PM8 A;  4UHU A;  4ZTK A;  2P9V B;  4P87 A;  1Y54 A;  1FCM A;  4E3O A;  4RA7 A;  3W8K A;  1C3B A;  2R9W A;  2X02 A;  5EVI A;  4LEN A;  4GN2 A;  4BL3 A;  4OKP A;  5HAI A;  1JWZ A;  3M6B A;  4DKI A;  3C4P A;  5FAQ A;  3PAG A;  1XX2 A;  4ID4 A;  1E4D A;  3BEC A;  1W8Q A;  4KQR A;  3IXB A;  4S2I A;  1N9B A;  1E3U D;  4OPZ A;  2ZQC A;  3HLD A;  3LY4 A;  2QZ6 A;  4H8R A;  4UA6 A;  1MWU A;  2Y59 A;  4OPR A;  1FCN A;  3ZG0 A;  3HRE A;  3HLW A;  3OPL A;  3WRZ A;  1MKI A;  1RP5 A;  2BLS A;  4UA7 A;  2WKH A;  2XFT A;  3CG5 A;  3HUN A;  4EQI A;  2JBF A;  3UE3 A;  4S2N A;  2ZM2 A;  3WWX A;  1VM1 A;  3M2J A;  1NXY A;  3C7U A;  4NET A;  2P9V A;  4NK3 A;  4RVA A;  3ZG5 A;  4P6B A;  2J9O A;  3ISG A;  2J8Y A;  1S6R A;  1XP4 A;  2ZQ7 A;  3S1Y A;  4C75 A;  2XF3 A;  2ZQ8 A;  4D2O A;  4DF6 A;  1IYQ A;  5L2F A;  4OPY A;  1ALQ A;  4P85 A;  3UPO A;  5HFO A;  4HES A;  2P74 A;  2WKE A;  2HPB A;  4EV4 A;  4RYE A;  4GDB A;  1CI9 A;  2Y4A A;  4KZ5 A;  1PIO A;  5G18 A;  4JXG A;  2EX8 A;  4XXR A;  3DW0 A;  3AGF A;  3G2Y A;  4KG2 A;  2WZX A;  2Y2K A;  3S22 A;  3IH8 A;  2WAD A;  3VOZ A;  3SS5 A;  2V2F F;  2J9P A;  3VSK A;  3UY6 A;  1O07 A;  2HDR A;  4KG5 A;  3PBN A;  3IWI A;  3BYD A;  2XEP A;  1GHI A;  3PBO A;  2WGI A;  2Q9M A;  2EX6 A;  4OPQ A;  2WZZ A;  4PMA A;  3ZCZ A;  1IKI A;  1GA9 A;  1YLT A;  3OPP A;  5E2G A;  3FWL A;  1I5Q A;  1XGJ A;  3OCL A;  2H0Y A;  1GA0 A;  1IEL A;  2OLU A;  1EWZ A;  1SCW A;  3SH8 A;  5EVL A;  5HAP A;  5CGW A;  5AQA A;  4KQO A;  4ZBE A;  3FYZ A;  3C7V A;  2EFU A;  1MWR A;  4QY5 A;  4WZ5 C;  3UPN A;  4EBL A;  3A3F A;  1FR1 A;  2XDM A;  4QJG A;  2VGK A;  5FAO A;  2HDS A;  3ZG9 B;  4Y0T A;  2V1Z A;  1XA1 A;  1HZO A;  5EEC A;  1XA7 A;  3OPR A;  1ES5 A;  2VGJ A;  4GNU A;  4EBN A;  4KZ9 A;  5CED A;  4OQ0 A;  3Q81 A;  5CHJ A;  1L0E A;  3N6I A;  4F94 A;  3S4X A;  3ZVT A;  1IYO A;  1ESI A;  3TOI A;  2HDU A;  5FI2 A;  3FKV A;  1YMX A;  1Q2Q A;  4MEZ A;  1ZG4 A;  4S2N C;  4OVD A;  4N9L A;  4E6X A;  1MWS A;  4Q8I A;  1U60 A;  1NY0 A;  3ITB A;  4DE0 A;  4LV1 A;  3A3E A;  5FQI A;  1L0G A;  4BD1 A;  3G2Z A;  1KGF A;  2H10 A;  1M40 A;  4XUX A;  3LEZ A;  3IH9 A;  4WEJ A;  4MBH A;  4DXC A;  2R9X A;  2H0T A;  2HP9 A;  1BT5 A;  1YT4 A;  2IWB A;  1LHY A;  3G30 A;  2CC1 A;  4YFM A;  2V20 A;  3N8R A;  3BEB A;  2ZC4 B;  4K0W A;  2Y2N A;  4WEL A;  5HX9 A;  2GDN A;  1K38 A;  3IXG A;  1TEM A;  2PBY A;  3EQV A;  1LI0 A;  3VP4 A;  5EOE A;  1KDS A;  3NIA A;  4JF5 A;  3MFD A;  3VFF A;  4DDS A;  1YLY A;  5GLC A;  4OLD A;  4B4Z A;  2ZM0 A;  1E25 A;  1JTG A;  3IF5 A;  4QB8 A;  4JXV A;  4DXB A;  1K57 A;  5U47 A;  5M1A A;  3W4O A;  4WMC A;  1MXO A;  2I72 A;  2XLN A;  4DRT A;  1L2S A;  4KZ6 A;  4E3K A;  1PZP A;  2PU2 A;  3HLG A;  3Q07 A;  5CTM A;  1LI9 A;  1RGZ A;  1ERM A;  1GHP A;  1JTD A;  2Z2L B;  3NDG A;  4N1H A;  4OQI A;  4OQH A;  5FI7 A;  2EX9 A;  2EX2 A;  5EVI B;  5F83 A;  1G6A A;  5FAT A;  3V5M A;  3ITA A;  1FOF A;  4JXS A;  4WZ5 A;  2Y2I A;  5F82 A;  3HLE A;  1NYM A;  4N92 A;  4BL2 A;  1PW1 A;  5EE8 A;  1BLC A;  1W8Y A;  4ZAM A;  4ZJ2 A;  1KGE A;  1K6S A;  4MBK A;  5KMW A;  1GCE A;  3HLF A;  4O7D A;  5DF7 A;  2WAF A;  2ZMA A;  4X55 A;  1SHV A;  1MY8 A;  2ZQ9 A;  3O88 A;  3UDX A;  4QU3 A;  4OOY A;  4X6T A;  2JCH A;  3RXX A;  5AQ9 A;  1LL9 A;  2Y2Q A;  5TGF A;  1K6R A;  5CXW A;  2ZM8 A;  1O7E A;  4OOM A;  1PZO A;  3ZG7 B;  4BEN A;  1BUL A;  4KZ7 A;  4ZJ1 A;  1ZG6 A;  4QD4 A;  5FDH A;  3UN7 A;  1DY6 A;  4X56 A;  2Z2M B;  3SOI A;  5GHZ A;  1BLP A;  4BLM A;  1ZKJ A;  4XUZ A;  1DJC A;  4KG6 A;  5J8X A;  3HUO A;  5HW3 A;  1Q2P A;  2DNS A;  5E2E A;  3SH9 A;  1IKG A;  1KE4 A;  5FSR A;  3WS1 A;  3O87 A;  1BLS A;  4PPR A;  1XXM A;  3NBL A;  4JXW A;  2WKI A;  1NJ4 A;  3V50 A;  1NZO A;  4FH4 A;  1BSG A;  2J7V A;  3NC8 A;  4OOL A;  4R4S A;  3UE1 A;  1IYP A;  1ERQ A;  2Y91 A;  3A3J A;  1K56 D;  3W4P A;  2WUQ A;  4S2K A;  4C6Y A;  1KE3 A;  3DWZ A;  4E3M A;  3OZH A;  1XGI A;  1K57 C;  4E6W A;  3IXH A;  4WYY A;  3IHB A;  3LO7 A;  3UDF A;  1MWT A;  2Q9N A;  2WGW A;  4GD8 A;  5AQ7 A;  3DTM A;  1FR6 A;  1XPB A;  1CI8 A;  3Q7Z A;  3VP0 A;  2PU4 A;  5FQK A;  5TR7 A;  1NYY A;  1DJB A;  4DE2 A;  2Y2G A;  1TDG A;  3MKF A;  1PYY A;  1YM1 A;  3IWO A;  1PWC A;  3V3R A;  4GOG A;  5KZH A;  3ZNT A;  4R3J A;  5M18 A;  4E3J A;  3VOY A;  3B3X A;  4CPK A;  4LCM A;  4MNR A;  3TG9 A;  4WZ4 A;  5GLB A;  3CZD A;  3IXD A;  3VSL A;  2X71 A;  3FZC A;  4LV0 A;  1HVB A;  1PI4 A;  3PTE A;  3RJU A;  3MZF A;  3Q82 A;  1CK3 A;  3QNC A;  4B88 A;  4S2L A;  4DE3 A;  5CER A;  4U3T A;  3C4O A;  4HBU A;  1TDL A;  4L0L A;  1WYB A;  4KZA A;  5E2H A;  4UAA A;  3VMA A;  5GHY A;  4A5R A;  1JVJ A;  3CMZ A;  1XKZ A;  1L0D A;  3C5A A;  4X69 A;  3V39 A;  3WRT A;  3PBS A;  1NZU A;  1YMS A;  3D4F A;  3G31 A;  4MBF A;  4EWF A;  3HVF A;  3LY3 A;  1PI5 A;  1G68 A;  4OQG A;  4PM5 A;  1MBL A;  3M6H A;  4QHC A;  3GTC A;  1KVM A;  1ES3 A;  1K55 A;  2XH9 A;  1OME A;  3MXR A;  2RL3 A;  3GVB A;  4WBG A;  4B4X A;  5A92 A;  4KZ8 A;  3HLC A;  1H8Z A;  3GR2 A;  4P0M A;  5E2F A;  1YLZ A;  4FD8 A;  3VP3 A;  4RX2 A;  5FAS A;  3ZVW A;  2C6W B;  3HL9 A;  4GD6 A;  3ZGA B;  2QPN A;  5F1G A;  1KVL A;  5DF9 A;  3A3I A;  1ES2 A;  1YQS A;  3P98 A;  2Y2M A;  4IED A;  3BFF A;  4Z9Q A;  1RGY A;  2G2W A;  5M19 A;  2JE5 A;  5FA7 A;  4K91 A;  1K56 A;  3OC2 A;  1IEM A;  3MKE A;  2OV5 A;  1DJA A;  3IQA A;  5DTK A;  1VQQ A;  1ESU A;  1M6K A;  4OH0 A;  3AGD A;  4IBX A;  5D3O A;  1MPL A;  3O3V A;  2HDQ A;  5E43 A;  5A90 A;  4R4R A;  4S2O A;  2WYX A;  3GMW A;  3WS0 A;  1PWD A;  4KZ4 A;  4R0Q A;  1TVF A;  4OON A;  3ZDJ A;  4DDY A;  1I2S A;  3A3D A;  4Y7P A;  3NCK A;  5FQJ A;  4RX3 A;  2HP5 A;  4E3N A;  5BOH A;  1W7F A;  5JYO A;  3UO9 A;  2H5S A;  5KSC A;  3O86 A;  2XGN A;  3SS4 A;  5I94 A;  3BFD A;  2ZC6 B;  2IWD A;  3Q7V B;  1H5X A;  2OLV A;  5IHV A;  4JF6 A;  3IF6 C;  1SDN A;  4IBR A;  3ZG8 B;  4CJN A;  5FQQ A;  5EOO A;  5HAR A;  3E2L A;  1YLP A;  4PM7 A;  1CEF A;  1FQG A;  3NY4 A;  4EUZ A;  2WAE A;  3BFE A;  2X01 A;  1ZC2 A;  5EPH A;  4OP5 A;  4Y0O A;  5EUA A;  4BD0 A;  3PBT A;  3V3S A;  4JF4 A;  4JLF A;  4C3Q A;  3LCE A;  5CEB A;  4IVK A;  4KEN B;  3WS4 A;  3BLS A;  1PWG A;  4FSF A;  3G32 A;  3VP2 A;  3HUM A;  1W5D A;  1YLW A;  2ZLY A;  3BFG A;  3OPH A;  1LLB A;  1N4O A;  4YIN A;  4BQM A;  1L0F A;  1S0W A;  3MZE A;  5FQ9 A;  1K55 C;  2ZC5 B;  5CHU A;  5CTN A;  1ERO A;  4MLL A;  3VFH A;  3QHY A;  1JWP A;  2WGW B;  5HL1 A;  2E8I A;  4LV3 A;  3N8S A;  4GB7 A;  4K0X A;  2Y55 A;  4QY6 A;  3AGE A;  3DWK A;  3G4P A;  3PBQ A;  3WS5 A;  3N4I A;  5KSH A;  2OSU A;  1W79 A;  4FH2 A;  2RCX A;  1GHM A;  1AXB A;  2WK0 A;  3SH7 A;  2XFS A;  1E3U A;  4S2J A;  1IYS A;  5TFQ A;  4KQQ A;  1BTL A;  1WE4 A;  4KZ3 A;  3BRM A;  5GHX A;  2XR0 A;  4FCF A;  3ZFZ A;  1K54 A;  4R23 A;  2FFF B;  3N8L A;  3EQU A;  2EXB A;  2Y2J A;  4JPM A;  3W4Q A;  1PW8 A;  3HLB A;  3QNB A;  4BJP A;  3NI9 A;  2UWX A;  3NDE A;  4R3B A;  4S2M A;  5GLD A;  1JWV A;  1FSY A;  4UA9 A;  1ONH A;  1SDE A;  1H8Y A;  5CRF A;  1ONG A;  4U0T A;  1KGG A;  2DCF A;  2HP6 A;  4OP8 A;  4E3L A;  3UE0 A;  5HAQ A;  2IWC A;  3OCN A;  2ZC7 A;  1SKF A;  4E3I A;  2QMI A;  1BZA A;  3IF6 A;  3GRJ A;  4WMC D;  3MZD A;  1QME A;  4HEF A;  4N9K A;  2XK1 A;  1CEG A;  1BLH A;  1LL5 A;  4U0X A;  1EI5 A;  1J9M A;  3JYI A;  1I2W A;  3PAE A;  5A93 A;  2A3U A;  1FSW A;  3UNW A;  3GV9 A;  5DVA A;  2Y2P A;  5CHM A;  3BLM A;  5A91 A;  5EVI C;  5FQM A;  5DTS A;  2ZQD A;  1ES4 A;  2BG1 A;  2JC7 A;  1KDW A;  2B5R A;  2FFY A;  3M2K A;  5DTT A;  4S2P A;  2ZQA A;  3PBR A;  4PM9 A;  4DE1 A;  1FCO A;  4WEK A;  3TSG A;  1KE0 A;  4X68 A;  4ZJ3 A;  1NRF A;  3CJM A;  4ZDX A;  3UDI A;  4N1X A;  5EVI D;  3UPP A;  2DRW A;  5AQB A;  2Y2O A;  5GL9 A;  3ZHH A;  4HBT A;  3IF6 B;  3IHA A;  3E2K A;  3Q7V A;  5CEC A;  3SS3 A;  3GQZ A;  5GLA A;  4GZB A;  2C5W B;  4LCL A;  1K4F A;  2G2U A;  5FI6 A;  3N7W A;  3FV7 A;  3FKW A;  1YLJ A;  1Z6F A;  2EFX A;  3HBR A;  3MBZ A;  3G35 A;  4GDN A;  5F1F A;  4LV2 A;  3ZNY A;  5JYP A;  2XD1 A;  5DF8 A;  4EBP A;  3G34 A;  3MXS A;  3GSG A;  2XD5 A;  1K54 C;  2EXA A;  4Y0U A;  3RXW A;  2XQZ A;  1QMF A;  1WYC A;  2Y2L A;  2A49 A;  4PM6 A;  1RCJ A;  5FAP A;  3Q1F A;  4KZB A;  4GKU A;  1K4E A;  3I7J A;  3VP1 A;  4WM9 A; 
#chains in the Genus database with same CATH topology
 4M3K A;  4JGR A;  1K25 A;  2INW A;  3C38 A;  5HWT A;  1GSX A;  2HZ5 A;  5CGS A;  2ZJ9 A;  1A0K A;  3BM6 A;  4GW9 A;  2PRF A;  3W8K A;  1C3B A;  2X02 A;  4LEN A;  5HAI A;  3LR4 A;  3C4P A;  5FAQ A;  3PAG A;  4ID4 A;  1E4D A;  4KQR A;  4S2I A;  1N9B A;  2ZQC A;  3HLD A;  4FUW A;  1GSV A;  4UA6 A;  2PYR A;  3ZG0 A;  5F6A A;  4UA7 A;  2EA9 A;  3CG5 A;  5G4Z A;  3UE3 A;  3A0R A;  4S2N A;  5F68 A;  4Q0J A;  3C7U A;  5EFW A;  4P6B A;  1XP4 A;  4DF6 A;  1IYQ A;  2VLG A;  4HES A;  2HPB A;  4EV4 A;  1CI9 A;  3H82 B;  5HDC A;  4NEE D;  4XXR A;  3DW0 A;  5DFX A;  3G2Y A;  2WZX A;  2Y2K A;  3VOZ A;  3IWI A;  1UGU A;  1GHI A;  5J7E A;  1CJF A;  4P6Z S;  1YLT A;  1I5Q A;  1XGJ A;  5EVL A;  5AQA A;  4QY5 A;  4UQI S;  3A3F A;  4I38 A;  2HDS A;  5EEC A;  3OPR A;  3BJN A;  3BY9 A;  5CHJ A;  1L0E A;  4Y15 A;  1IYO A;  1ESI A;  5FI2 A;  2W1R A;  4EQ1 A;  2R78 A;  4Q8I A;  1NY0 A;  3ITB A;  4DXC A;  1T1B A;  2FH5 A;  3N8R A;  5J3W A;  2Y2N A;  1CQA A;  1ACF A;  4IJG A;  4ZRR A;  4OLD A;  4PAU A;  3HJI A;  1E25 A;  3TRC A;  1K57 A;  5U47 A;  3F1N A;  1MXO A;  4DRT A;  1PZP A;  3HLG A;  1GHP A;  2Z2L B;  3TW8 A;  2EX9 A;  2NUP C;  4JXS A;  2Y2I A;  3IS2 A;  3HLE A;  1NYM A;  4ESP A;  4K08 A;  5EE8 A;  4EU0 A;  1KGE A;  3IBJ A;  4Y5F A;  3CLO A;  1GCE A;  3HLF A;  4O7D A;  5EVE A;  2WAF A;  1G28 A;  3UDX A;  4QU3 A;  4OOY A;  2JCH A;  1K6R A;  2ZM8 A;  4OOM A;  4ZJ1 A;  4KZ7 A;  1ZG6 A;  2LB9 A;  1DY6 A;  1BLP A;  1ZKJ A;  4XUZ A;  1DJC A;  3LIE A;  1IKG A;  1KE4 A;  3O87 A;  3NBL A;  4JXW A;  2XA7 S;  3UE1 A;  3NC8 A;  4R4S A;  1ERQ A;  3UB9 A;  4C6Y A;  2V0W A;  3D3O A;  3FPW A;  4E6W A;  2ZOH A;  3B33 A;  3LO7 A;  2ZOI A;  3K3C A;  3UB6 A;  1SKO A;  3UDF A;  2ZBB A;  4GD8 A;  3C30 A;  2HV1 A;  4HJ4 A;  1XPB A;  1CI8 A;  2K31 A;  3VP0 A;  2L4R A;  2O9A A;  1NYY A;  3T1R A;  1NRJ A;  3V3R A;  5KZH A;  3LEQ A;  2Y8H A;  3LIC A;  3VSL A;  2V8C A;  2ZMF A;  1OT9 A;  1PI4 A;  3EEA A;  3PTE A;  5KIZ A;  4H6J A;  5CER A;  3C4O A;  1P9W A;  3B47 A;  1TDL A;  5E2H A;  4QPR A;  5GHY A;  3CMZ A;  1NZU A;  1YMS A;  1PI5 A;  4O01 A;  4PM5 A;  1MBL A;  1KVM A;  2XH9 A;  1OME A;  1XFQ A;  5A92 A;  3GR2 A;  1LL8 A;  5E2F A;  4FD8 A;  5CX7 A;  5FAS A;  3ZVW A;  4UEY A;  3RTY A;  5F1G A;  5DF9 A;  3P7N A;  1YQS A;  3P98 A;  3MQ0 A;  3TJZ C;  2J80 A;  3LR3 A;  2W3G A;  5M19 A;  4K91 A;  3MKE A;  4Q0H A;  3UMD A;  1TS8 A;  1NLY A;  1D7E A;  4OON A;  5FQJ A;  4RX3 A;  1L3L A;  1W7F A;  4EES A;  3UO9 A;  2XGN A;  1G6O A;  5G4Y A;  3G6O A;  3Q7V B;  4IBR A;  5HAR A;  4EUZ A;  3PR6 A;  2WAE A;  3BFE A;  3T1X A;  3KO6 A;  1ZC2 A;  5EPH A;  5EUA A;  3V3S A;  4KEN B;  3G32 A;  2JHE A;  1T19 A;  1YLW A;  1LLB A;  4BQM A;  1S0W A;  1ERO A;  4MLL A;  4G3V A;  5L10 A;  4K0X A;  2Y55 A;  1XFN A;  5KSH A;  1S4R A;  2D02 A;  4FH2 A;  2RCX A;  2M7V A;  1GHM A;  2XSS A;  2XFS A;  5HSQ A;  1IYS A;  4KQQ A;  5F69 A;  1YKD A;  1K54 A;  2FFF B;  4MDZ A;  3W4Q A;  1PW8 A;  3HLB A;  4BJP A;  2PT7 A;  3NDE A;  4R3B A;  5GLD A;  1FSY A;  1H8Y A;  2WKQ A;  3JVV A;  3MSH A;  5DFY A;  2BAS A;  1KGG A;  3OCN A;  4DJ3 A;  1BZA A;  3IF6 A;  3HJK A;  1CEG A;  4U0X A;  1I2W A;  2A3U A;  2V1A A;  2VZW A;  2VGL M;  5CHM A;  1ES4 A;  2JC7 A;  3M2K A;  4S2P A;  3LR5 A;  3PBR A;  4DE1 A;  1KE0 A;  4IHQ A;  3UPP A;  2DRW A;  2GNX A;  4MN6 A;  4Q0I A;  5GL9 A;  4HBT A;  1IFQ A;  2QYB A;  3DTE A;  3Q7V A;  4KUK A;  3UB8 A;  3CIT A;  3GQZ A;  5GLA A;  2C5W B;  5FI6 A;  4H6J B;  3FV7 A;  1YLJ A;  3MBZ A;  3F1P A;  5HWV A;  3Q1F A;  3B42 A;  4L9G A;  1K4E A;  3O88 A;  3VP1 A;  4X6T A;  4WM9 A;  2ZMV A;  2ZC3 B;  3BFC A;  3P09 A;  3TE8 A;  4CLC B;  3KX0 X;  4R1G A;  1HTZ A;  3QP6 A;  2JN7 A;  2P7J A;  4OLG A;  4NG2 A;  4ZTK A;  3F1P B;  2O9B A;  2P9V B;  3FPV A;  4E3O A;  1CF0 A;  4DJ2 A;  5EVI A;  1D1J A;  3P01 A;  4BL3 A;  1JWZ A;  4GS9 B;  2ZL1 A;  1XX2 A;  1W8Q A;  3IXB A;  4OPZ A;  1DRM A;  3BWL A;  4R6L A;  4CLC A;  3LY4 A;  2B18 A;  4OPR A;  4G3W A;  3HLW A;  3OPL A;  4YOF A;  2BLS A;  2VJW A;  4JGO A;  2JBF A;  2ZM2 A;  4EUV A;  3M2J A;  4NK3 A;  4RVA A;  2ZQ7 A;  4C75 A;  2XF3 A;  1ALQ A;  3NOT C;  1JNU A;  3UPO A;  2P74 A;  1PIO A;  5G18 A;  2EX8 A;  2LB5 A;  4KG2 A;  3NUL A;  5TJJ A;  3S22 A;  1PRQ A;  2WAD A;  3IH8 A;  4Y3I A;  2V2F F;  3PBN A;  3MF0 A;  2WGI A;  2Q9M A;  4OPQ A;  4PMA A;  3ZCZ A;  1IKI A;  5FAO A;  5E2G A;  2OLU A;  1IEL A;  3SH8 A;  1SCW A;  4ZBE A;  1OTE A;  5AVE A;  2VA0 A;  3UPN A;  1FR1 A;  3VE4 A;  4QJG A;  2VGK A;  2M7U A;  3ZG9 B;  4Y0T A;  2K2N A;  1XA1 A;  1XA7 A;  1ES5 A;  2VGJ A;  4EBN A;  3N6I A;  3S4X A;  3QP1 A;  3LI8 A;  4EW7 A;  1F9I A;  1Q2Q A;  4MEZ A;  4OVD A;  4N9L A;  3CPT B;  3A3E A;  3G2Z A;  1BT5 A;  1YT4 A;  4BBV A;  5FEG A;  3MS6 A;  3CUE A;  2CC1 A;  2DMW A;  3BEB A;  2ZC4 B;  5I5L A;  2GDN A;  2GX5 A;  2PBY A;  3EQV A;  3R4K A;  1LI0 A;  5EOE A;  3NIA A;  4JF5 A;  4DDS A;  4B4Z A;  3ICY A;  4JGP A;  3DBA A;  3IF5 A;  4JXV A;  1L2S A;  4E3K A;  1LI9 A;  3CWF A;  1JTD A;  4OQH A;  3E4O A;  5EVI B;  5F83 A;  2O99 A;  1G6A A;  4GLQ A;  4EET B;  4LRZ E;  4QWO A;  1W8Y A;  4ZAM A;  3E4Q A;  3RH8 B;  3IX8 A;  4X55 A;  5L8M A;  2ZQ9 A;  2O0Y A;  5AQ9 A;  2Y2Q A;  5DJU A;  4NXE A;  3ZG7 B;  3MXQ A;  4B93 A;  4ETZ A;  2MJ6 A;  5FDH A;  3QP5 A;  3UN7 A;  2Z2M B;  3SOI A;  1V9Y A;  2HJE A;  3VOL A;  5HW3 A;  2DNS A;  5E2E A;  3WS1 A;  3H82 A;  1XXM A;  3V50 A;  1NJ4 A;  3O5Y A;  4OOL A;  1IYP A;  3A3J A;  1K56 D;  1KE3 A;  4E3M A;  1XGI A;  3T1Q B;  4MN7 A;  5IT5 A;  1MWT A;  2Q9N A;  3IBR A;  2W3F A;  1MKM A;  3DTM A;  4EEU A;  4LGW A;  3S7Q A;  4MN5 A;  3K2N A;  2Y2G A;  5DKK A;  1UWP X;  1TDG A;  3MKF A;  3PHY A;  1PWC A;  2W3E A;  4X25 A;  4R3J A;  2H28 A;  3B3X A;  4LCM A;  5GLB A;  3IXD A;  3S7P A;  3EOI A;  1YSQ A;  3Q82 A;  3QNC A;  1VB6 A;  4S2L A;  4DE3 A;  4HBU A;  4NXG A;  3MJQ A;  4LPZ A;  3MFX A;  1PFL A;  1JVJ A;  5HL1 A;  1VET A;  4OQG A;  5L07 A;  2PBD P;  4QHC A;  2UV0 E;  3GTC A;  1ES3 A;  1K55 A;  2RL3 A;  4WBG A;  4B4X A;  1T1C A;  1MC0 A;  4RX2 A;  2QPN A;  3QP2 A;  1KVL A;  2YKH A;  2Y2M A;  4Z9Q A;  1T1A A;  2JE5 A;  5FA7 A;  3K3D A;  1DJA A;  3IQA A;  5DTK A;  3O3V A;  1H3Q A;  3GDI A;  1TVF A;  4DDY A;  5J4E A;  1I2S A;  4E3N A;  3NCK A;  2H5S A;  2E8J A;  5I94 A;  1ZTU A;  4HI4 A;  2IWD A;  3T4L A;  2W1T A;  2K7S A;  5EOO A;  1FQG A;  1WA9 A;  4BD0 A;  3R7W B;  5CEB A;  3T4Q A;  3WS4 A;  3BLS A;  4FSF A;  2J3T D;  1W5D A;  2ZLY A;  3BFG A;  1N4O A;  4F3L B;  1L0F A;  1TF1 A;  4I5S A;  2ACG A;  2ZC5 B;  5DJT A;  3H7W B;  3VFH A;  4LV3 A;  4L9F A;  2E8I A;  1W79 A;  1XJ3 A;  3NJA A;  3QP8 A;  1E3U A;  1BTL A;  4KZ3 A;  4HIA A;  3BRM A;  4WN5 A;  4FCF A;  3U2A A;  4R23 A;  2EXB A;  2Y2J A;  4JPM A;  4S2M A;  2UWX A;  2IA2 A;  4UA9 A;  2VV7 A;  5CRF A;  1ONG A;  1TS0 A;  4U0T A;  2HP6 A;  4HJ3 A;  2VGL S;  3CI6 A;  2QMI A;  4WMC D;  4GHI B;  1BLH A;  3PAE A;  3BLM A;  5FDS A;  1KDW A;  2FFY A;  1YAX A;  5HDS A;  3E4P A;  1NRF A;  1PNE A;  4HOI A;  4ZDX A;  4N1X A;  5AQB A;  1N9N A;  3E2K A;  3C8C A;  1SKO B;  2VK3 A;  4GZB A;  4LCL A;  1K4F A;  3N7W A;  1Z6F A;  3G35 A;  4LV2 A;  5DF8 A;  3MXS A;  1FIK A;  2XD5 A;  1J3W A;  3CAX A;  2EXA A;  5HDD A;  1QMF A;  4PM6 A;  2J3W A;  2KLI A;  4LFU A;  3I7J A;  4X53 A;  1HD8 A;  4PHT A;  4JKT A;  1BUE A;  3WS2 A;  2A24 B;  3IWQ A;  1XJ4 A;  4IVI A;  4PM8 A;  4UHU A;  3KSI A;  1FCM A;  2P04 A;  4NKP A;  3LI9 A;  4OKP A;  3M6B A;  4BBU A;  2JKT M;  4HJ6 A;  1MWU A;  4DMZ A;  4R70 A;  1RP5 A;  2WKH A;  2XFT A;  3HUN A;  3WWX A;  2JKG A;  2P9V A;  2J9O A;  2J8Y A;  3DTI A;  4D2O A;  5HWW A;  4OPY A;  4P85 A;  1X0O A;  4HP9 A;  5HFO A;  3EEH A;  2Y4A A;  4JXG A;  3EGX C;  3AGF A;  3GEC A;  4GJ4 A;  3LFV A;  3SS5 A;  3UY6 A;  4KG5 A;  3PBO A;  3JPU A;  2D01 A;  2O9C A;  1UWN X;  3E98 A;  2B95 A;  2EX6 A;  3MQO A;  2WZZ A;  3FWL A;  3OCL A;  2H0Y A;  1GA0 A;  1EWZ A;  5CGW A;  3FYZ A;  1OTD A;  2EFU A;  3C7V A;  4WZ5 C;  3UB5 P;  1S1Z A;  2V1Z A;  1F5M A;  4HHD A;  3A0V A;  5CED A;  3L7H A;  5AJG A;  2W3D A;  1VEU B;  4F94 A;  2L1M A;  2OWH A;  3ZVT A;  3TOI A;  2HDU A;  1AWI A;  1YMX A;  1OJG A;  2B02 A;  4S2N C;  5C5K A;  1P9R A;  4E6X A;  4LV1 A;  1VHM A;  1L0G A;  3RFB A;  1SZV A;  1KGF A;  2H10 A;  4XUX A;  3LEZ A;  3IH9 A;  2M1C A;  2HP9 A;  3S7O A;  2V20 A;  4K0W A;  5HX9 A;  4IUK A;  1K38 A;  3VP4 A;  2VV6 A;  2YKF A;  5HPI A;  4Y13 A;  1YLY A;  1TS6 A;  4I3A A;  2OWJ A;  5IS1 A;  2I72 A;  5F5Y A;  3Q07 A;  5EM0 A;  1RGZ A;  4OQI A;  4Y17 A;  5FI7 A;  3BQ8 A;  2EX2 A;  4EXO A;  5FAT A;  4WZ5 A;  4BL2 A;  1PW1 A;  1BLC A;  1HLU P;  4MBK A;  1SHV A;  5TGF A;  5CXW A;  1O7E A;  1BUL A;  4LRX C;  3KSG A;  4BLM A;  1S67 L;  3HCY A;  4WL9 A;  2W0N A;  2XRN A;  3VE3 A;  5FSR A;  1BLS A;  4D60 A;  1W63 Q;  1Y28 A;  1LSW A;  1NZO A;  2J7V A;  3H7W A;  3W4P A;  4S2K A;  3DWZ A;  3SZT A;  3OZH A;  3LYX A;  1K57 C;  4WYY A;  3IHB A;  2WGW A;  3DTK A;  2QHK A;  3Q7Z A;  4FOF A;  2JKF A;  1DP9 A;  4DE2 A;  4R38 A;  4FTX A;  1YM1 A;  3IWO A;  3V67 A;  5FEF A;  4GOG A;  3C2W A;  2QKP A;  5M18 A;  4E3J A;  2HGV A;  3E0Y A;  4I3J A;  4MNR A;  3TG9 A;  4WZ4 A;  3FZC A;  4LV0 A;  1OJ5 A;  3RJU A;  1CK3 A;  4CLC E;  4LRY C;  4PKY G;  4U3T A;  3CPT A;  3F1O B;  4UAA A;  3VMA A;  4R3A A;  4A5R A;  2V9A A;  2VX8 A;  3SW1 A;  3C5A A;  4X69 A;  3PBS A;  4MBF A;  3D4F A;  4EWF A;  3HVF A;  3LY3 A;  3M6H A;  4KZ8 A;  1H8Z A;  4P0M A;  1YLZ A;  3LIA A;  3H9W A;  3VP3 A;  3ZGA B;  4HP4 A;  1ES2 A;  4IED A;  3BFF A;  3VV4 A;  2G2W A;  1N9L A;  1K56 A;  1IEM A;  1S66 L;  1M6K A;  5D3O A;  1MPL A;  1BYW A;  5A90 A;  4R4R A;  4S2O A;  2GZA A;  2OAQ 1;  3GMW A;  1PWD A;  4KZ4 A;  4R0Q A;  5AVF A;  3ZDJ A;  5BOH A;  2HP5 A;  4WF0 A;  1OTI A;  3O86 A;  4AFI A;  3SS4 A;  3PYP A;  3MR0 A;  3BFD A;  2ZC6 B;  2PYP A;  3D9Y A;  3IF6 C;  1SDN A;  4CJN A;  3E2L A;  2WKR A;  1CEF A;  1STZ A;  2X01 A;  2L0W A;  3T4T A;  4Y0O A;  3T1S A;  4JF4 A;  4JLF A;  4IVK A;  2ZL1 B;  3BQA A;  1PWG A;  3VP2 A;  3HUM A;  1XJ2 A;  3OPH A;  4DN0 A;  1TS7 A;  3MZE A;  5CHU A;  2AVX A;  4LLO B;  3OBF A;  3QHY A;  5HPF A;  3LID A;  3N8S A;  4GB7 A;  3PBQ A;  3WS5 A;  2Z6D A;  1AXB A;  1WE4 A;  1NLZ A;  5GHX A;  3T12 B;  3IS2 B;  4HQA A;  3EQU A;  3QNB A;  3OLO A;  3KSH A;  1EW0 A;  1JWV A;  1ONH A;  1SDE A;  4NXF A;  4EEP A;  4HH2 A;  3D72 A;  5HAQ A;  4RQ9 A;  1SKF A;  3FG8 A;  1W63 M;  3MZD A;  5HD5 A;  4N9K A;  4HEF A;  2XK1 A;  1LL5 A;  3JYI A;  5A93 A;  1P97 A;  5DVA A;  2Y2P A;  1OTB A;  4Y2F A;  1LT0 A;  5EVI C;  5DTS A;  4CLC D;  3W2Z A;  2BG1 A;  2B5R A;  4CQH A;  1MZU A;  1YSP A;  4HY8 A;  4PM9 A;  1N9O A;  3KSF A;  3TSG A;  1G5U A;  3UME A;  4ZJ3 A;  4CLC C;  3CJM A;  5EVI D;  3NOP C;  3ZHH A;  4I3I A;  3IF6 B;  3IHA A;  2Q0O A;  2PHY A;  3SS3 A;  5HZH A;  5HL6 A;  3FKW A;  5F1F A;  4GDN A;  3ZNY A;  4IUH A;  3G34 A;  3GSG A;  4XT2 B;  1K54 C;  4Y0U A;  2Y2L A;  2PD7 A;  2A49 A;  4EER A;  1RCJ A;  5FAP A;  4KZB A;  5EM1 A;  4GKU A;  2Y2H A;  2WGV A;  4B9O A;  2QWS A;  5CGX A;  4JBF A;  2JKR I;  2ZD8 A;  3IT9 A;  2I9V A;  1K0K A;  3PXP A;  2W1T B;  4P87 A;  1Y54 A;  4PKY A;  4RA7 A;  4M4X A;  2R9W A;  4GN2 A;  2KOI A;  4I39 A;  4DKI A;  3DAV A;  3BEC A;  2KDK A;  1E3U D;  2A2L A;  1S1Y A;  2QZ6 A;  4H8R A;  2P08 A;  2Y59 A;  1FCN A;  1VEU A;  3HRE A;  3KYE A;  3WRZ A;  1MKI A;  4EQI A;  1IOU A;  1GSW A;  1VM1 A;  1NXY A;  4NET A;  3ZG5 A;  2G7U A;  3ISG A;  3S1Y A;  1S6R A;  1S4S A;  5L2F A;  2ZQ8 A;  4ME4 A;  2WKE A;  4RYE A;  4GDB A;  4KZ5 A;  3LIB A;  3EWK A;  4P6Z M;  2J9P A;  3VSK A;  1O07 A;  2HDR A;  3KYZ A;  3BYD A;  2XEP A;  1KOU A;  1TD5 A;  1YPR A;  2CMN A;  3UB7 A;  1GA9 A;  3OPP A;  5HAP A;  4KQO A;  3LR0 A;  1MWR A;  2V1B A;  4BMW A;  4EBL A;  4XT2 A;  2V8F A;  2XDM A;  1HZO A;  2FZ0 A;  1NWZ A;  4HH3 A;  4GNU A;  4UQI M;  4KZ9 A;  4OQ0 A;  3Q81 A;  4NXB A;  3F1N B;  3FKV A;  3MQQ A;  1ZG4 A;  1MWS A;  1U60 A;  3BW6 A;  4DE0 A;  2VEA A;  5FQI A;  4BD1 A;  1M40 A;  4WEJ A;  4WUJ A;  4MBH A;  2R9X A;  1LSV A;  2H0T A;  2IWB A;  2QJ5 A;  1LHY A;  3G30 A;  4YFM A;  4WEL A;  5TBM B;  3IXG A;  1TEM A;  3BY8 A;  3NHQ A;  1KDS A;  3MFD A;  3VFF A;  5GLC A;  2ZM0 A;  2JKT I;  2A24 A;  1JTG A;  4QB8 A;  4DXB A;  2W3H A;  5M1A A;  3W4O A;  4WMC A;  2XLN A;  4KZ6 A;  2PU2 A;  4Z1W A;  5CTM A;  1ERM A;  3NDG A;  4N1H A;  3T4O A;  3V5M A;  3ITA A;  1FOF A;  5F82 A;  4N92 A;  3NEC A;  1ODV A;  2JKR M;  4ZJ2 A;  5K5B A;  1K6S A;  3QP4 A;  2PDR A;  4ARZ A;  5KMW A;  2V0U A;  5DF7 A;  2ZMA A;  3LIF A;  1LSX A;  1MY8 A;  1H8M A;  2HF6 A;  2OOL A;  4MCW A;  3RXX A;  1LL9 A;  1PZO A;  4BEN A;  3U4L P;  4QD4 A;  1Z09 A;  4II7 A;  4X56 A;  5GHZ A;  4KG6 A;  2Z6C A;  5J8X A;  3CUE C;  3HUO A;  3T4S A;  1Q2P A;  4X1M A;  3SH9 A;  4PPR A;  1V9Z A;  2WKI A;  4FH4 A;  1BSG A;  5MC7 A;  2Y91 A;  4X1L A;  5HD3 A;  2WUQ A;  4G3K A;  3IXH A;  2VKS A;  2BTF P;  2XA7 M;  2PR6 A;  5AQ7 A;  1DP8 A;  1FR6 A;  2EWV A;  5A8B A;  3F1O A;  4ETX A;  2PU4 A;  5FQK A;  5TR7 A;  4MMN A;  1DJB A;  4ARZ B;  1PYY A;  3ULF A;  2KX6 A;  5TBM A;  3ZNT A;  2EWW A;  3VOY A;  4BBT A;  4CPK A;  1D06 A;  3CZD A;  3ZQ5 A;  2X71 A;  1Y4O A;  2VV8 A;  1HVB A;  3MZF A;  4GHI A;  4B88 A;  2QJ7 A;  2WKP A;  4L0L A;  1WYB A;  4KZA A;  4GS9 A;  1XKZ A;  1L0D A;  3V39 A;  3WRT A;  5IU1 A;  3G31 A;  1G68 A;  1ZHH B;  3KYQ A;  3MXR A;  3GVB A;  3HLC A;  2HJ9 C;  2C6W B;  3A0S A;  3HL9 A;  4GD6 A;  3IX3 A;  3A3I A;  4YNR A;  3OOV A;  1RGY A;  1P0Z A;  2XRO A;  2Y79 A;  4BWI A;  3OC2 A;  2OV5 A;  1F98 A;  1VQQ A;  1ESU A;  4OH0 A;  3AGD A;  4IBX A;  1VET B;  2HDQ A;  5L09 A;  3L9K A;  5E43 A;  4HNB A;  2WYX A;  3WS0 A;  4KQD A;  3T50 A;  3A3D A;  4Y7P A;  5LBR A;  5JYO A;  5KSC A;  1H5X A;  2OLV A;  5IHV A;  4JF6 A;  2PAV P;  3T4J A;  3ZG8 B;  1OTA A;  5FQQ A;  4PM7 A;  1YLP A;  1DP6 A;  3NY4 A;  3EGD C;  4OP5 A;  3PBT A;  4C3Q A;  3LCE A;  3MMH A;  4YIN A;  2J3T C;  2PR5 A;  5FQ9 A;  1K55 C;  5CTN A;  2W27 A;  4YWZ A;  1T18 A;  1JWP A;  2WGW B;  4QY6 A;  3AGE A;  3DWK A;  3G4P A;  3N4I A;  2OSU A;  4WLA A;  2WK0 A;  3SH7 A;  2NUT C;  3JVU A;  1OPX A;  4S2J A;  3IX4 A;  3LUQ A;  5TFQ A;  3R7W A;  2XR0 A;  3ZFZ A;  3N8L A;  3NI9 A;  4O0P A;  4GCZ A;  2DCF A;  5FL3 A;  2PD8 A;  4OP8 A;  4E3L A;  3UE0 A;  1H0M A;  2IWC A;  2ZC7 A;  4E3I A;  3GRJ A;  3FC7 A;  1QME A;  1EI5 A;  1J9M A;  3UE6 A;  1FSW A;  4L9E A;  5DKL A;  3UNW A;  3GV9 A;  5A91 A;  5FQM A;  2ZQD A;  1F2K A;  2OAP 1;  5DTT A;  4JGQ A;  2ZQA A;  4KUO A;  1FCO A;  4WEK A;  2GJ3 A;  1OT6 A;  4X68 A;  3UDI A;  2Y2O A;  3NOU C;  1XJ6 A;  5CEC A;  3ZYT A;  2G2U A;  4E04 A;  1FIL A;  2EFX A;  3HBR A;  3S7N A;  3T4K A;  5JYP A;  3LGO A;  2XD1 A;  4EBP A;  3CHW P;  3RXW A;  2XQZ A;  1WYC A;  4F3L A;  4O8G A;  5EV0 A; 
#chains in the Genus database with same CATH homology
 2Y2H A;  2WGV A;  4X53 A;  4M3K A;  2ZC3 B;  1HD8 A;  3BFC A;  4JKT A;  3P09 A;  1BUE A;  1K25 A;  4R1G A;  3WS2 A;  1HTZ A;  5CGX A;  4JBF A;  2ZD8 A;  3IT9 A;  5CGS A;  2ZJ9 A;  3IWQ A;  4OLG A;  3BM6 A;  4IVI A;  4PM8 A;  4UHU A;  4ZTK A;  2P9V B;  4P87 A;  1Y54 A;  1FCM A;  4E3O A;  4RA7 A;  3W8K A;  1C3B A;  2R9W A;  2X02 A;  5EVI A;  4LEN A;  4GN2 A;  4BL3 A;  4OKP A;  5HAI A;  1JWZ A;  3M6B A;  4DKI A;  3C4P A;  5FAQ A;  3PAG A;  1XX2 A;  4ID4 A;  1E4D A;  3BEC A;  1W8Q A;  4KQR A;  3IXB A;  4S2I A;  1N9B A;  1E3U D;  4OPZ A;  2ZQC A;  3HLD A;  3LY4 A;  2QZ6 A;  4H8R A;  4UA6 A;  1MWU A;  2Y59 A;  4OPR A;  1FCN A;  3ZG0 A;  3HRE A;  3HLW A;  3OPL A;  3WRZ A;  1MKI A;  1RP5 A;  2BLS A;  4UA7 A;  2WKH A;  2XFT A;  3CG5 A;  3HUN A;  4EQI A;  2JBF A;  3UE3 A;  4S2N A;  2ZM2 A;  3WWX A;  1VM1 A;  3M2J A;  1NXY A;  3C7U A;  4NET A;  2P9V A;  4NK3 A;  4RVA A;  3ZG5 A;  4P6B A;  2J9O A;  3ISG A;  2J8Y A;  1S6R A;  1XP4 A;  2ZQ7 A;  3S1Y A;  4C75 A;  2XF3 A;  2ZQ8 A;  4D2O A;  4DF6 A;  1IYQ A;  5L2F A;  4OPY A;  1ALQ A;  4P85 A;  3UPO A;  5HFO A;  4HES A;  2P74 A;  2WKE A;  2HPB A;  4EV4 A;  4RYE A;  4GDB A;  1CI9 A;  2Y4A A;  4KZ5 A;  1PIO A;  5G18 A;  4JXG A;  2EX8 A;  4XXR A;  3DW0 A;  3AGF A;  3G2Y A;  4KG2 A;  2WZX A;  2Y2K A;  3S22 A;  3IH8 A;  2WAD A;  3VOZ A;  3SS5 A;  2V2F F;  2J9P A;  3VSK A;  3UY6 A;  1O07 A;  2HDR A;  4KG5 A;  3PBN A;  3IWI A;  3BYD A;  2XEP A;  1GHI A;  3PBO A;  2WGI A;  2Q9M A;  2EX6 A;  4OPQ A;  2WZZ A;  4PMA A;  3ZCZ A;  1IKI A;  1GA9 A;  1YLT A;  3OPP A;  5E2G A;  3FWL A;  1I5Q A;  1XGJ A;  3OCL A;  2H0Y A;  1GA0 A;  1IEL A;  2OLU A;  1EWZ A;  1SCW A;  3SH8 A;  5EVL A;  5HAP A;  5CGW A;  5AQA A;  4KQO A;  4ZBE A;  3FYZ A;  3C7V A;  2EFU A;  1MWR A;  4QY5 A;  4WZ5 C;  3UPN A;  4EBL A;  3A3F A;  1FR1 A;  2XDM A;  4QJG A;  2VGK A;  5FAO A;  2HDS A;  3ZG9 B;  4Y0T A;  2V1Z A;  1XA1 A;  1HZO A;  5EEC A;  1XA7 A;  3OPR A;  1ES5 A;  2VGJ A;  4GNU A;  4EBN A;  4KZ9 A;  5CED A;  4OQ0 A;  3Q81 A;  5CHJ A;  1L0E A;  3N6I A;  4F94 A;  3S4X A;  3ZVT A;  1IYO A;  1ESI A;  3TOI A;  2HDU A;  5FI2 A;  3FKV A;  1YMX A;  1Q2Q A;  4MEZ A;  1ZG4 A;  4S2N C;  4OVD A;  4N9L A;  4E6X A;  1MWS A;  4Q8I A;  1U60 A;  1NY0 A;  3ITB A;  4DE0 A;  4LV1 A;  3A3E A;  5FQI A;  1L0G A;  4BD1 A;  3G2Z A;  1KGF A;  2H10 A;  1M40 A;  4XUX A;  3LEZ A;  3IH9 A;  4WEJ A;  4MBH A;  4DXC A;  2R9X A;  2H0T A;  2HP9 A;  1BT5 A;  1YT4 A;  2IWB A;  1LHY A;  3G30 A;  2CC1 A;  4YFM A;  2V20 A;  3N8R A;  3BEB A;  2ZC4 B;  4K0W A;  2Y2N A;  4WEL A;  5HX9 A;  2GDN A;  1K38 A;  3IXG A;  1TEM A;  2PBY A;  3EQV A;  1LI0 A;  3VP4 A;  5EOE A;  1KDS A;  3NIA A;  4JF5 A;  3MFD A;  3VFF A;  4DDS A;  1YLY A;  5GLC A;  4OLD A;  4B4Z A;  2ZM0 A;  1E25 A;  1JTG A;  3IF5 A;  4QB8 A;  4JXV A;  4DXB A;  1K57 A;  5U47 A;  5M1A A;  3W4O A;  4WMC A;  1MXO A;  2I72 A;  2XLN A;  4DRT A;  1L2S A;  4KZ6 A;  4E3K A;  1PZP A;  2PU2 A;  3HLG A;  3Q07 A;  5CTM A;  1LI9 A;  1RGZ A;  1ERM A;  1GHP A;  1JTD A;  2Z2L B;  3NDG A;  4N1H A;  4OQI A;  4OQH A;  5FI7 A;  2EX9 A;  2EX2 A;  5EVI B;  5F83 A;  1G6A A;  5FAT A;  3V5M A;  3ITA A;  1FOF A;  4JXS A;  4WZ5 A;  2Y2I A;  5F82 A;  3HLE A;  1NYM A;  4N92 A;  4BL2 A;  1PW1 A;  5EE8 A;  1BLC A;  1W8Y A;  4ZAM A;  4ZJ2 A;  1KGE A;  1K6S A;  4MBK A;  5KMW A;  1GCE A;  3HLF A;  4O7D A;  5DF7 A;  2WAF A;  2ZMA A;  4X55 A;  1SHV A;  1MY8 A;  2ZQ9 A;  3O88 A;  3UDX A;  4QU3 A;  4OOY A;  4X6T A;  2JCH A;  3RXX A;  5AQ9 A;  1LL9 A;  2Y2Q A;  5TGF A;  1K6R A;  5CXW A;  2ZM8 A;  1O7E A;  4OOM A;  1PZO A;  3ZG7 B;  4BEN A;  1BUL A;  4KZ7 A;  4ZJ1 A;  1ZG6 A;  4QD4 A;  5FDH A;  3UN7 A;  1DY6 A;  4X56 A;  2Z2M B;  3SOI A;  5GHZ A;  1BLP A;  4BLM A;  1ZKJ A;  4XUZ A;  1DJC A;  4KG6 A;  5J8X A;  3HUO A;  5HW3 A;  1Q2P A;  2DNS A;  5E2E A;  3SH9 A;  1IKG A;  1KE4 A;  5FSR A;  3WS1 A;  3O87 A;  1BLS A;  4PPR A;  1XXM A;  3NBL A;  4JXW A;  2WKI A;  1NJ4 A;  3V50 A;  1NZO A;  4FH4 A;  1BSG A;  2J7V A;  3NC8 A;  4OOL A;  4R4S A;  3UE1 A;  1IYP A;  1ERQ A;  2Y91 A;  3A3J A;  1K56 D;  3W4P A;  2WUQ A;  4S2K A;  4C6Y A;  1KE3 A;  3DWZ A;  4E3M A;  3OZH A;  1XGI A;  1K57 C;  4E6W A;  3IXH A;  4WYY A;  3IHB A;  3LO7 A;  3UDF A;  1MWT A;  2Q9N A;  2WGW A;  4GD8 A;  5AQ7 A;  3DTM A;  1FR6 A;  1XPB A;  1CI8 A;  3Q7Z A;  3VP0 A;  2PU4 A;  5FQK A;  5TR7 A;  1NYY A;  1DJB A;  4DE2 A;  2Y2G A;  1TDG A;  3MKF A;  1PYY A;  1YM1 A;  3IWO A;  1PWC A;  3V3R A;  4GOG A;  5KZH A;  3ZNT A;  4R3J A;  5M18 A;  4E3J A;  3VOY A;  3B3X A;  4CPK A;  4LCM A;  4MNR A;  3TG9 A;  4WZ4 A;  5GLB A;  3CZD A;  3IXD A;  3VSL A;  2X71 A;  3FZC A;  4LV0 A;  1HVB A;  1PI4 A;  3PTE A;  3RJU A;  3MZF A;  3Q82 A;  1CK3 A;  3QNC A;  4B88 A;  4S2L A;  4DE3 A;  5CER A;  4U3T A;  3C4O A;  4HBU A;  1TDL A;  4L0L A;  1WYB A;  4KZA A;  5E2H A;  4UAA A;  3VMA A;  5GHY A;  4A5R A;  1JVJ A;  3CMZ A;  1XKZ A;  1L0D A;  3C5A A;  4X69 A;  3V39 A;  3WRT A;  3PBS A;  1NZU A;  1YMS A;  3D4F A;  3G31 A;  4MBF A;  4EWF A;  3HVF A;  3LY3 A;  1PI5 A;  1G68 A;  4OQG A;  4PM5 A;  1MBL A;  3M6H A;  4QHC A;  3GTC A;  1KVM A;  1ES3 A;  1K55 A;  2XH9 A;  1OME A;  3MXR A;  2RL3 A;  3GVB A;  4WBG A;  4B4X A;  5A92 A;  4KZ8 A;  3HLC A;  1H8Z A;  3GR2 A;  4P0M A;  5E2F A;  1YLZ A;  4FD8 A;  3VP3 A;  4RX2 A;  5FAS A;  3ZVW A;  2C6W B;  3HL9 A;  4GD6 A;  3ZGA B;  2QPN A;  5F1G A;  1KVL A;  5DF9 A;  3A3I A;  1ES2 A;  1YQS A;  3P98 A;  2Y2M A;  4IED A;  3BFF A;  4Z9Q A;  1RGY A;  2G2W A;  5M19 A;  2JE5 A;  5FA7 A;  4K91 A;  1K56 A;  3OC2 A;  1IEM A;  3MKE A;  2OV5 A;  1DJA A;  3IQA A;  5DTK A;  1VQQ A;  1ESU A;  1M6K A;  4OH0 A;  3AGD A;  4IBX A;  5D3O A;  1MPL A;  3O3V A;  2HDQ A;  5E43 A;  5A90 A;  4R4R A;  4S2O A;  2WYX A;  3GMW A;  3WS0 A;  1PWD A;  4KZ4 A;  4R0Q A;  1TVF A;  4OON A;  3ZDJ A;  4DDY A;  1I2S A;  3A3D A;  4Y7P A;  3NCK A;  5FQJ A;  4RX3 A;  2HP5 A;  4E3N A;  5BOH A;  1W7F A;  5JYO A;  3UO9 A;  2H5S A;  5KSC A;  3O86 A;  2XGN A;  3SS4 A;  5I94 A;  3BFD A;  2ZC6 B;  2IWD A;  3Q7V B;  1H5X A;  2OLV A;  5IHV A;  4JF6 A;  3IF6 C;  1SDN A;  4IBR A;  3ZG8 B;  4CJN A;  5FQQ A;  5EOO A;  5HAR A;  3E2L A;  1YLP A;  4PM7 A;  1CEF A;  1FQG A;  3NY4 A;  4EUZ A;  2WAE A;  3BFE A;  2X01 A;  1ZC2 A;  5EPH A;  4OP5 A;  4Y0O A;  5EUA A;  4BD0 A;  3PBT A;  3V3S A;  4JF4 A;  4JLF A;  4C3Q A;  3LCE A;  5CEB A;  4IVK A;  4KEN B;  3WS4 A;  3BLS A;  1PWG A;  4FSF A;  3G32 A;  3VP2 A;  3HUM A;  1W5D A;  1YLW A;  2ZLY A;  3BFG A;  3OPH A;  1LLB A;  1N4O A;  4YIN A;  4BQM A;  1L0F A;  1S0W A;  3MZE A;  5FQ9 A;  1K55 C;  2ZC5 B;  5CHU A;  5CTN A;  1ERO A;  4MLL A;  3VFH A;  3QHY A;  1JWP A;  2WGW B;  5HL1 A;  2E8I A;  4LV3 A;  3N8S A;  4GB7 A;  4K0X A;  2Y55 A;  4QY6 A;  3AGE A;  3DWK A;  3G4P A;  3PBQ A;  3WS5 A;  3N4I A;  5KSH A;  2OSU A;  1W79 A;  4FH2 A;  2RCX A;  1GHM A;  1AXB A;  2WK0 A;  3SH7 A;  2XFS A;  1E3U A;  4S2J A;  1IYS A;  5TFQ A;  4KQQ A;  1BTL A;  1WE4 A;  4KZ3 A;  3BRM A;  5GHX A;  2XR0 A;  4FCF A;  3ZFZ A;  1K54 A;  4R23 A;  2FFF B;  3N8L A;  3EQU A;  2EXB A;  2Y2J A;  4JPM A;  3W4Q A;  1PW8 A;  3HLB A;  3QNB A;  4BJP A;  3NI9 A;  2UWX A;  3NDE A;  4R3B A;  4S2M A;  5GLD A;  1JWV A;  1FSY A;  4UA9 A;  1ONH A;  1SDE A;  1H8Y A;  5CRF A;  1ONG A;  4U0T A;  1KGG A;  2DCF A;  2HP6 A;  4OP8 A;  4E3L A;  3UE0 A;  5HAQ A;  2IWC A;  3OCN A;  2ZC7 A;  1SKF A;  4E3I A;  2QMI A;  1BZA A;  3IF6 A;  3GRJ A;  4WMC D;  3MZD A;  1QME A;  4HEF A;  4N9K A;  2XK1 A;  1CEG A;  1BLH A;  1LL5 A;  4U0X A;  1EI5 A;  1J9M A;  3JYI A;  1I2W A;  3PAE A;  5A93 A;  2A3U A;  1FSW A;  3UNW A;  3GV9 A;  5DVA A;  2Y2P A;  5CHM A;  3BLM A;  5A91 A;  5EVI C;  5FQM A;  5DTS A;  2ZQD A;  1ES4 A;  2BG1 A;  2JC7 A;  1KDW A;  2B5R A;  2FFY A;  3M2K A;  5DTT A;  4S2P A;  2ZQA A;  3PBR A;  4PM9 A;  4DE1 A;  1FCO A;  4WEK A;  3TSG A;  1KE0 A;  4X68 A;  4ZJ3 A;  1NRF A;  3CJM A;  4ZDX A;  3UDI A;  4N1X A;  5EVI D;  3UPP A;  2DRW A;  5AQB A;  2Y2O A;  5GL9 A;  3ZHH A;  4HBT A;  3IF6 B;  3IHA A;  3E2K A;  3Q7V A;  5CEC A;  3SS3 A;  3GQZ A;  5GLA A;  4GZB A;  2C5W B;  4LCL A;  1K4F A;  2G2U A;  5FI6 A;  3N7W A;  3FV7 A;  3FKW A;  1YLJ A;  1Z6F A;  2EFX A;  3HBR A;  3MBZ A;  3G35 A;  4GDN A;  5F1F A;  4LV2 A;  3ZNY A;  5JYP A;  2XD1 A;  5DF8 A;  4EBP A;  3G34 A;  3MXS A;  3GSG A;  2XD5 A;  1K54 C;  2EXA A;  4Y0U A;  3RXW A;  2XQZ A;  1QMF A;  1WYC A;  2Y2L A;  2A49 A;  4PM6 A;  1RCJ A;  5FAP A;  3Q1F A;  4KZB A;  4GKU A;  1K4E A;  3I7J A;  3VP1 A;  4WM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...