5CTMA

Structure of bpu1 beta-lactamase
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
233
structure length
232
Chain Sequence
AIAWSVDEFFKNREGTFVIQEVKEKSPWVYNKKRAKERFAPQSTFVANALIGLQTGAVRDEYDIKYWDGVKREIDNWNRDHTLGSGMRDSVVWYYQAMARDIGEERMNHWVKAIHYGNKDISGGIDQFWLSSTLRISPIEQVRFLKQLYEETLPFDLKNMRTVKRMMVQEEEKHATLYGKTGSGSDIGWYVGFIKHEHKTYILATNIKGTGIEAKDITYRILKKYHLMEASV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Class D beta-lactamases do exist in Gram-positive bacteria.
pubmed doi rcsb
source organism Bacillus pumilus
total genus 83
structure length 232
sequence length 233
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5ctmA00
1YM1A 3HVFA 1WYCA 3ZG7B 1E3UD 1ZKJA 2Y55A 3BFGA 3MZDA 3VSKA 1FSYA 2Y2GA 5CTNA 1YMXA 3W4QA 2WGVA 5M18A 3AGDA 1IKIA 5KSCA 4PM9A 2Y2KA 1CI8A 3AGEA 3BRMA 1KVMA 2Y2MA 5HW3A 1M6KA 4ZTKA 1ES3A 1YLTA 1RGZA 1GHMA 5CGSA 1KE3A 2QPNA 4PM6A 3C4OA 4R3JA 3IWIA 1FQGA 4LV2A 4B4ZA 4S2OA 2XGNA 3UDXA 4U0TA 2ZQ8A 1CEFA 1NY0A 1FSWA 2XD1A 3V50A 5DF9A 1C3BA 3OC2A 3BFFA 4RX2A 4WM9A 3WWXA 2Y2HA 4P6BA 1IYQA 2ZC7A 1SHVA 1TEMA 4QB8A 4QD4A 4WYYA 4NK3A 3GSGA 4OQHA 5GHYA 4QY5A 4OPYA 4WZ5C 1L0GA 3GQZA 3GRJA 3GVBA 5HAIA 2XK1A 3HLDA 5FATA 1PW1A 3D4FA 4R4SA 4DDSA 3IH8A 3VP1A 1LI0A 1K6SA 2XD5A 3MBZA 1EROA 2V20A 3G30A 5A92A 5E43A 2GDNA 1YLPA 5FQMA 3UNWA 3S22A 3VSLA 2Z2LB 5CEBA 3OPPA 3VOYA 4X69A 2ZC3B 2ZQCA 1NXYA 2A3UA 3ITBA 4S2KA 1SCWA 3LCEA 4GD6A 2WAFA 5TR7A 4R3BA 3GMWA 1LHYA 1NJ4A 1RP5A 4HBUA 3UE0A 5HL1A 4JXSA 3V3RA 3NDEA 2J9OA 3GV9A 2R9WA 5J8XA 1GA9A 4DXBA 5GLCA 4JPMA 3O88A 4QJGA 4RVAA 2EX9A 5FAPA 1N9BA 1KDWA 2A49A 3IXGA 3PBOA 2CC1A 2ZC4B 1EI5A 5FI6A 3SOIA 1K38A 3ZNYA 3Q7VB 3MZFA 4Y7PA 3PTEA 1BLHA 5GHXA 3V5MA 1JWZA 2H0YA 3Q7VA 1Z6FA 2OSUA 4ZJ2A 4KZ7A 3PAEA 1GHIA 4X55A 1LL5A 3WRZA 4OOLA 3N8LA 5FQJA 1XA1A 3VP0A 4KG5A 2BG1A 3G32A 2Y59A 3HLGA 1FCOA 2G2UA 1WYBA 2Y2QA 1DJAA 4KZ9A 4K91A 4UA9A 2R9XA 1K55C 2JC7A 1L2SA 3W4OA 3W4PA 2Y2JA 3PBRA 4KQQA 3RXWA 3CG5A 3OPRA 1K56D 3ZG5A 1NZOA 4BQMA 5JYOA 2QMIA 3UO9A 1ONHA 3VOZA 2XFTA 1BLSA 3OCNA 4EBNA 2ZD8A 1BZAA 5A93A 5E2GA 1K4EA 5M19A 1AXBA 4OPZA 4O7DA 3ITAA 4WZ5A 1E25A 3HL9A 5GLBA 3SH7A 4LCMA 5HARA 5EOEA 5KSHA 1SDNA 4E3OA 2Y91A 5EECA 5DTSA 4WBGA 3OZHA 4WEKA 2J8YA 1H8YA 3FV7A 3FYZA 1HZOA 4ZJ3A 2ZM2A 2XFSA 2ZQAA 2Y2IA 2EFXA 2PU2A 1HTZA 1K4FA 1ERQA 2OV5A 4MBHA 1TDGA 3NIAA 3IF5A 5U47A 1KVLA 4JKTA 5CHMA 2E8IA 3BFCA 3MKEA 5DTTA 5EVIC 5IHVA 3BLSA 4R4RA 1TDLA 3MFDA 5AQ7A 3G35A 5AQAA 3GTCA 3A3EA 1NYMA 4OQIA 4Y0OA 2B5RA 3FWLA 1BULA 2EXAA 3IXDA 1LI9A 1O7EA 3LEZA 5GHZA 3ZDJA 3JYIA 3UPPA 1XP4A 2JE5A 4FH4A 2IWDA 4X6TA 4E3JA 5CGWA 1ONGA 3O3VA 3UN7A 3BFEA 4GKUA 4F94A 4MLLA 1H5XA 1QMFA 1YLZA 2OLVA 3ZVTA 4JXGA 4ZBEA 4BENA 5GL9A 3NCKA 5HFOA 4JXWA 5F1GA 3S1YA 4ID4A 1K54C 3HLFA 3MXRA 5CECA 1W5DA 5A90A 2HDQA 4DE1A 2P74A 5CEDA 3V3SA 3NY4A 2RCXA 4DXCA 2ZQ9A 2RL3A 1DJCA 4OOYA 1YQSA 4OONA 3PBNA 2EX2A 2H0TA 1HVBA 3Q81A 4KG2A 1RGYA 3FKWA 3CZDA 4X68A 2WKIA 4C3QA 3TG9A 1YT4A 4KQRA 4DE2A 2XH9A 1JTGA 1MBLA 1PI5A 2EX8A 4PPRA 4QHCA 4E3LA 2ZC6B 4JBFA 4K0XA 4GNUA 3UY6A 4EUZA 4P0MA 3VP3A 1K6RA 4P85A 4YINA 4B4XA 1GCEA 4GDBA 2VGJA 3RXXA 2IWBA 3UDIA 1ALQA 1W8QA 2HDRA 2WYXA 3TSGA 5F83A 1FOFA 1JTDA 1LL9A 1DY6A 3ZGAB 5EVIB 5DTKA 4ZDXA 2H5SA 1FCNA 5EVIA 5GLAA 3E2KA 1ZC2A 3V39A 4BL3A 4GD8A 1XXMA 4FSFA 5AQBA 5FQ9A 3G34A 3ZHHA 2ZC5B 2UWXA 4K0WA 1PI4A 2V1ZA 5JYPA 4JLFA 5A91A 3HUMA 1W7FA 3BFDA 1KE0A 2ZM8A 3RJUA 1HD8A 5F82A 2XQZA 3TOIA 3E2LA 3WS2A 2P9VB 1FR1A 4KENB 1ES5A 5CERA 1OMEA 4BD0A 4CPKA 4HBTA 4OPQA 5CHJA 3VP2A 5G18A 5FSRA 3P98A 3C7UA 4OH0A 4S2MA 4C6YA 4N1HA 3OPLA 1PWGA 3WS0A 1K54A 5FI2A 5HX9A 3IWQA 2WKHA 4E3MA 4N92A 3G2ZA 4KZAA 3QNBA 3WS5A 1GHPA 5EPHA 3BEBA 3A3IA 5EOOA 1XGJA 4M3KA 1EWZA 1O07A 4EBPA 1E4DA 1BLCA 3MXSA 4IBXA 3Q82A 3N4IA 4DE0A 2DNSA 3DTMA 2QZ6A 4R0QA 4LV3A 5L2FA 3S4XA 1IYPA 3UPOA 4FH2A 3ZVWA 2HDSA 3BLMA 2Z2MB 4OP5A 4OOMA 1IEMA 1PWDA 3C7VA 3Q7ZA 1CI9A 1XX2A 3HLEA 3G2YA 3NC8A 3HUOA 4RA7A 2IWCA 2XLNA 3BM6A 3HBRA 3ZG8B 1GA0A 3OCLA 2WGWB 2XF3A 4WMCD 4OLGA 4ZJ1A 4E6WA 4Q8IA 3A3JA 2HP6A 2WGWA 1ERMA 4MEZA 5M1AA 1L0FA 4XUZA 4A5RA 1SDEA 3ISGA 4RYEA 2HDUA 3PBQA 1MXOA 4GB7A 4DE3A 3M2KA 5EVLA 3SH8A 1ESIA 3IXHA 4BLMA 1I5QA 1E3UA 3EQUA 4IEDA 1ZG6A 3IT9A 5EUAA 4S2NC 5I94A 3LY3A 3VP4A 1N4OA 1S6RA 3N6IA 3B3XA 2Y2PA 4PM5A 1G68A 4OKPA 4EWFA 1KGGA 1JWVA 3N8RA 3PBTA 1K57C 3ZCZA 5AQ9A 1K25A 2EFUA 2X71A 3IHAA 1MWRA 2DRWA 1M40A 3A3FA 2OLUA 4HEFA 1Q2QA 4DRTA 3VMAA 2EXBA 4WELA 4N9KA 4OVDA 4HESA 1CEGA 1WE4A 3HUNA 5KZHA 5DF8A 2C5WB 1I2SA 3DWZA 3VFFA 1K55A 4KZ4A 1IKGA 4E3KA 4OLDA 3O86A 2X01A 3ZG9B 3AGFA 4U3TA 1J9MA 3GR2A 2FFFB 3ZG0A 3Q07A 3LY4A 2H10A 3M6HA 4E6XA 1H8ZA 4LV1A 4PM8A 4IBRA 1ES4A 4UA6A 3M2JA 4JF6A 2PBYA 1MY8A 4PMAA 2FFYA 1NRFA 4BD1A 4WEJA 1Y54A 3IH9A 1TVFA 4S2PA 4KQOA 3N8SA 3O87A 1YLWA 1L0EA 2J9PA 3WRTA 4KZBA 3LO7A 1CK3A 4R1GA 5FAOA 4BJPA 3DWKA 1KGEA 2Y2NA 1PIOA 4LV0A 2WZZA 5FASA 1BT5A 3QNCA 4KZ3A 4UAAA 5CRFA 4D2OA 1MWSA 5FQKA 5HAPA 2Y2OA 2WUQA 4Y0TA 2XEPA 3NBLA 5BOHA 4X53A 4MBFA 1KE4A 4IVIA 3IQAA 1Q2PA 4S2NA 3P09A 5KMWA 2Y2LA 2HP9A 5DF7A 4KZ6A 5D3OA 3C5AA 4GZBA 4FCFA 4GOGA 3VFHA 3OPHA 1FCMA 3Q1FA 4KG6A 1MWTA 4MNRA 5FAQA 3N7WA 5FQIA 3SH9A 4N9LA 1K57A 1XPBA 5F1FA 1NZUA 2P9VA 4S2IA 5CGXA 2ZQ7A 1JVJA 4X56A 1K56A 2C6WB 1VQQA 2ZJ9A 4LENA 2EX6A 5GLDA 3UE3A 1VM1A 5CTMA 4H8RA 1PZPA 3SS4A 4XXRA 1KDSA 3M6BA 2ZLYA 3IF6C 2X02A 4MBKA 2Q9NA 4DF6A 1W79A 4Y0UA 4DDYA 3IHBA 1BSGA 2JCHA 4BL2A 4NETA 4EQIA 1YLYA 3BECA 5EVID 3ZNTA 4WMCA 3FZCA 4UA7A 3DW0A 4OQGA 3UDFA 3IXBA 1QMEA 4IVKA 4Z9QA 5FI7A 3A3DA 2WZXA 2WK0A 2ZMAA 4YFMA 2J7VA 1FR6A 1DJBA 5FA7A 1BLPA 2ZQDA 3G31A 4OPRA 3QHYA 2Y4AA 3BYDA 4JXVA 3G4PA 5FDHA 3NDGA 4R23A 1JWPA 1L0DA 3HLWA 1W8YA 2VGKA 2WGIA 5CHUA 1IYOA 2PU4A 3HREA 3CJMA 4UHUA 4ZAMA 4DKIA 4PM7A 4QY6A 1MWUA 4S2JA 3MZEA 2DCFA 1YMSA 5HAQA 4EV4A 1XGIA 4GDNA 2ZM0A 5TFQA 1ES2A 3EQVA 5TGFA 1MKIA 1PWCA 5E2FA 4XUXA 3I7JA 3WS4A 1ZG4A 3CMZA 1U60A 2Q9MA 1YLJA 4L0LA 1S0WA 1ESUA 3IWOA 4JF5A 4LCLA 4OQ0A 5E2HA 1I2WA 1KGFA 2XR0A 3HLCA 4FD8A 1XA7A 4KZ8A 4GN2A 4OP8A 4RX3A 3UE1A 1PYYA 1NYYA 4JF4A 5DVAA 5EE8A 2BLSA 2I72A 1LLBA 4WZ4A 2HP5A 2HPBA 1G6AA 4S2LA 2JBFA 3SS3A 2G2WA 1PW8A 3NI9A 3IF6B 2XDMA 1BUEA 5CXWA 4EBLA 3IF6A 4C75A 1IELA 1BTLA 1MPLA 4QU3A 5E2EA 1RCJA 4N1XA 3PBSA 2V2FF 2WADA 3SS5A 3UPNA 3C4PA 3FKVA 4KZ5A 4E3NA 4E3IA 1SKFA 3HLBA 4U0XA 4B88A 3MKFA 1XKZA 3W8KA 1IYSA 3ZFZA 1PZOA 5FQQA 4CJNA 3PAGA 4P87A 3WS1A 2WKEA 2WAEA
chains in the Genus database with same CATH superfamily
1YM1A 1WYCA 1NLYA 3W4QA 1BYWA 5CTNA 3AGDA 4PM9A 2Y2KA 3AGEA 1KVMA 2Y2MA 2B18A 5CGSA 1KE3A 4R3JA 3IWIA 1IOUA 1OTIA 2ZQ8A 4Y15A 2XD1A 4BBTA 2XRNA 3OC2A 4RX2A 4NXFA 4WM9A 4P6BA 4WYYA 1IYQA 1TEMA 4NK3A 3GSGA 2KX6A 4WZ5C 3GRJA 3UMDA 2XK1A 3HLDA 5FATA 3E4PA 3D4FA 4DDSA 4HQAA 4I3AA 5A92A 2PD8A 3G30A 2GDNA 5FQMA 3S22A 3VSLA 5CEBA 1W63Q 2PHYA 4MN6A 2ZC3B 3ITBA 5TR7A 3GMWA 1NJ4A 2INWA 3V3RA 3F1PB 5J8XA 5GLCA 5TBMB 3O88A 3GDIA 5FAPA 1N9BA 2FH5A 2HJ9C 3PBOA 3UMEA 3H82A 1K38A 3MZFA 2PYPA 3LFVA 5AVFA 2OSUA 4X55A 1LL5A 2A24A 4OOLA 5FQJA 4KG5A 2Y59A 2W3HA 2G2UA 1WYBA 1SZVA 2Y2QA 2L1MA 4KZ9A 4UA9A 1K55C 2JC7A 4NEED 3CG5A 3KSHA 2J3TD 5DJUA 3KYZA 1BLSA 3OCNA 5G4ZA 3EOIA 2ZD8A 5E2GA 5M19A 4HP4A 4DJ2A 5KSHA 3KSFA 1H8YA 4ZJ3A 3HCYA 3HJKA 3IF5A 3IX8A 5DTTA 5IHVA 5AQ7A 1IFQA 2W3GA 2PAVP 3GTCA 1NYMA 4Y0OA 3FWLA 4X1LA 1T1BA 2GX5A 2IWDA 3B47A 2VKSA 2XSSA 5CGWA 3UN7A 1OT6A 4GKUA 3ZVTA 3W2ZA 4ZBEA 4BENA 1TF1A 5HFOA 4WUJA 4ID4A 3MR0A 4DXCA 2EWWA 3RTYA 2JKFA 3BY9A 1HVBA 1D1JA 3FKWA 3CZDA 2OOLA 1UGUA 4WLAA 4QHCA 1MBLA 2PT7A 2ZMVA 4JBFA 4P0MA 3PHYA 2PBDP 2VGJA 4CLCB 2KDKA 1ALQA 1W8QA 2HDRA 3TSGA 3K3DA 3FG8A 3KX0X 2W0NA 5DTKA 5EVIA 3D9YA 1P9WA 3E2KA 3LI9A 5A91A 3HUMA 1W7FA 3BFDA 1PRQA 1HD8A 3TOIA 5DKKA 3TW8A 3WS2A 1FR1A 4HBTA 5C5KA 3VP2A 3T4SA 4OH0A 1XFNA 3OPLA 3WS0A 1OJ5A 2MJ6A 3A0RA 4E3MA 4N92A 4KZAA 1AWIA 1SKOB 3CLOA 3MF0A 2I9VA 4L9GA 3Q82A 1VB6A 1YAXA 3T12B 2DNSA 3EWKA 4GLQA 4R0QA 4LV3A 3KYEA 3ZQ5A 1IYPA 2V8CA 2HDSA 4OOMA 1CI9A 1XX2A 3HLEA 2XLNA 3BM6A 3HBRA 3OCLA 2XF3A 3S7QA 4OLGA 2M7VA 1ERMA 4MEZA 2VGLS 1DP9A 4LFUA 5M1AA 3ISGA 4RYEA 2HDUA 1MXOA 2ZOHA 5EFWA 2V0UA 3LIAA 4BLMA 3K3CA 4NXEA 2QJ7A 1ZG6A 3IT9A 4WL9A 2M1CA 3L7HA 3N6IA 3B3XA 2Y2PA 5DJTA 2JKRI 1K57C 1K25A 1MWRA 1M40A 2J3TC 4WELA 3NOUC 2C5WB 1N9NA 1K55A 4HJ3A 2KLIA 2VLGA 2LB9A 3F1NB 3ZG9B 3AGFA 4U3TA 1J9MA 3MXQA 3SZTA 1H8ZA 4LV1A 4PM8A 4EUVA 1X0OA 1NRJA 2PDRA 5L09A 4PMAA 1L3LA 2WKQA 4WEJA 1XJ6A 4S2PA 1YLWA 4UQIS 3UB7A 1CK3A 3E4QA 3E98A 3DWKA 4LV0A 4UAAA 2Z6CA 1CQAA 5FDSA 5HAPA 3QP5A 2XEPA 5BOHA 4X53A 4MBFA 4IVIA 1S1YA 3C5AA 3VFHA 3OPHA 4MNRA 5FAQA 5FQIA 4ESPA 4N9LA 2O9BA 4G3KA 3LR4A 4CLCE 5F1FA 4S2IA 2ZQ7A 4GCZA 2PR5A 2ZJ9A 2BTFP 2EX6A 3VE3A 5J4EA 4H8RA 1S67L 5HPFA 4XXRA 1F2KA 3IF6C 4HIAA 4P6ZS 3LUQA 1VHMA 2PD7A 4EQIA 5EVID 3UDFA 3IXBA 4IVKA 4BWIA 3PYPA 2J7VA 1FR6A 1F98A 2Y4AA 3QHYA 4BMWA 1OTBA 3NDGA 4GS9A 2VGKA 3T4LA 4UHUA 4DKIA 1MWUA 3NECA 5HL6A 5HAQA 2VK3A 1W63M 2OAQ1 5E2FA 5DFYA 1ZG4A 3CMZA 3KSGA 3DAVA 3IX4A 4JF5A 3IWOA 5E2HA 4OP8A 1OTEA 4FD8A 1NYYA 3U4LP 2VV7A 1G6AA 5AJGA 3LR5A 4EBLA 4YWZA 1BTLA 1MPLA 1ZHHB 1RCJA 3PBSA 1DP8A 4D60A 4F3LA 3UPNA 1SKFA 4U0XA 3MKFA 3W8KA 5HWTA 1IYSA 1EW0A 3ZFZA 5FQQA 4GHIA 1NLZA 1J3WA 3RFBA 2Y55A 2V9AA 3BFGA 3MZDA 4Q0JA 2WGVA 5KSCA 1FIKA 4ZTKA 1GHMA 1Y28A 1S4RA 4PM6A 3C4OA 3G6OA 3OBFA 4I38A 2XGNA 3H7WA 3UDXA 4P6ZM 1C3BA 2VX8A 4WN5A 2HJEA 2Y2HA 4QB8A 4PKYG 4OPYA 5HAIA 4Y3IA 2ZOIA 3MQOA 3VP1A 3KO6A 1K6SA 1EROA 2Z6DA 5E43A 2Z2LB 4X69A 3EEHA 2GZAA 1NXYA 1SCWA 3LCEA 2WAFA 3UE0A 1LHYA 1RP5A 3NDEA 2J9OA 2R9WA 2JKGA 3F1PA 3IXGA 2A49A 2CC1A 1G6OA 2ZC4B 3SOIA 3LYXA 2ZL1B 3RH8B 1BLHA 5GHXA 1DRMA 3PAEA 4MDZA 4MN5A 3VP0A 2BG1A 2JHEA 3G32A 3LI8A 1DJAA 4K91A 1L2SA 3W4OA 2Y2JA 4KQQA 3ZG5A 3F1OB 4RQ9A 3VOZA 4O7DA 3NULA 4LCMA 3CUEA 5HARA 5EOEA 3T1SA 4DJ3A 5DTSA 3OZHA 3FV7A 3FYZA 2ZM2A 1HLUP 2EFXA 1K4FA 4O01A 1LSWA 3FC7A 1H8MA 1KVLA 5CHMA 2E8IA 3BFCA 1T19A 5EVIC 3MFDA 4LRYC 1D06A 5AQAA 2K31A 2B5RA 3IXDA 1O7EA 2XROA 3JYIA 5HDCA 4X6TA 3MMHA 2R78A 3O3VA 1QMFA 4JXGA 4PKYA 2JN7A 3NCKA 4Y5FA 4JXWA 3S1YA 2WKPA 1W5DA 4DE1A 3V3SA 2ZQ9A 2RL3A 1DJCA 1YQSA 4OONA 2B02A 4X68A 4C3QA 1YT4A 4KQRA 2EX8A 4E3LA 4EETB 4K0XA 3VP3A 1K6RA 4P85A 4B4XA 1GCEA 3T1QB 5F83A 1GSWA 1JTDA 1DY6A 4ZDXA 5KIZA 4GD8A 2PYRA 1XXMA 2JKTM 5AQBA 4L9EA 4B9OA 3UB8A 4K0WA 2V1ZA 5F82A 2XQZA 3GECA 3E2LA 2P9VB 1ES5A 4CPKA 2Y8HA 1KOUA 3C7UA 4C6YA 1PWGA 4NG2A 3ZYTA 1TS0A 1K54A 3BJNA 5HX9A 2WKHA 1GHPA 1SKOA 1Z09A 4HP9A 3MXSA 4DE0A 3R7WB 3ICYA 1WA9A 3S4XA 3UPOA 1LL8A 3BLMA 3Q7ZA 3NC8A 3MJQA 3G2YA 4RA7A 1GA0A 4WMCD 2WGWB 3A3JA 3IBRA 3LIFA 4A5RA 2M7UA 3E4OA 4DE3A 4O0PA 5AVEA 5EVLA 2VJWA 3EGXC 3EEAA 1I5QA 2K2NA 5EUAA 1XFQA 5I94A 3QP4A 1N4OA 4EWFA 1JWVA 3N8RA 1JNUA 3PBTA 5AQ9A 2X71A 4NKPA 4HEFA 1Q2QA 2EXBA 4N9KA 4HESA 1CEGA 1WE4A 5KZHA 4KZ4A 3T4TA 3DTKA 1IKGA 3F1NA 3Q07A 2H10A 3M6HA 4IBRA 3E0YA 4UA6A 3B33A 5EV0A 3M2JA 2EA9A 2FFYA 1NRFA 4KUKA 4BD1A 5HPIA 1F9IA 4NXGA 1TVFA 4KQOA 4R70A 2L0WA 2J9PA 3WRTA 5G4YA 1F5MA 1S4SA 1VEUB 1BT5A 4KZ3A 5CRFA 4D2OA 5FQKA 1OJGA 3S7NA 4E04A 2WUQA 3EGDC 3NBLA 1KE4A 3IQAA 1Q2PA 4S2NA 3P09A 3L9KA 5DF7A 2B95A 4GOGA 3UE6A 1V9ZA 3SH9A 1NZUA 2C6WB 3T50A 4JGPA 1OTDA 3SS4A 1D7EA 3D3OA 3M6BA 2ACGA 2Q9NA 3FPVA 4DF6A 4Y0UA 5IS1A 2JCHA 1YSPA 1ACFA 2DMWA 2A24B 2WK0A 3SW1A 4YFMA 1H0MA 1BLPA 2ZQDA 4JXVA 3G4PA 3JPUA 3KSIA 3HREA 3CJMA 2J3WA 2E8JA 4PM7A 4QY6A 4YNRA 3LIBA 2ZM0A 5TFQA 1ES2A 4I39A 5TGFA 1MKIA 5DFXA 1OT9A 3I7JA 1XJ2A 3HJIA 1U60A 2Q9MA 1S0WA 1ESUA 5EVEA 1KGFA 4KZ8A 3HLCA 5IU1A 3UE1A 3LR0A 2BLSA 3C38A 1K0KA 4B93A 2HPBA 2JBFA 3NI9A 2XDMA 1BUEA 4C75A 5E2EA 5HWWA 1N9LA 2WADA 4II7A 4HJ6A 3T4JA 4CQHA 1XKZA 3PAGA 2WKEA 3JVUA 3HVFA 1VETB 3ZG7B 1ZKJA 2A2LA 1FSYA 2Y2GA 5M18A 1IKIA 1CI8A 5HW3A 1STZA 1MC0A 4JGOA 1ES3A 1LSXA 1RGZA 3S7PA 4PHTA 3H9WA 2GJ3A 4LV2A 4S2OA 4U0TA 1NY0A 1FSWA 3V50A 5DF9A 5GHYA 2W3DA 5EM1A 3GQZA 3GVBA 5L8MA 3CUEC 4R4SA 1LI0A 1YLPA 5FEGA 4QWOA 3VV4A 3OPPA 4S2KA 4GD6A 3MFXA 4HBUA 5MC7A 4JPMA 4QJGA 4RVAA 4MMNA 4JGQA 1S66L 3LIEA 5FI6A 1A0KA 3R4KA 3ZNYA 4EW7A 3Q7VB 4Y7PA 3PTEA 2ZL1A 2H0YA 1Z6FA 4IUHA 2V1BA 3A0SA 4JGRA 2R9XA 4Y17A 3T4OA 3W4PA 3RXWA 3OPRA 4BQMA 3CI6A 5JYOA 2QMIA 1ONHA 4R38A 4EBNA 1K4EA 1AXBA 3ITAA 3SH7A 5F6AA 2Y91A 4WBGA 2ZQAA 2XFSA 3DTIA 4H6JB 2PU2A 3QP6A 4CLCC 1V9YA 1ERQA 2OV5A 3FPWA 1TDGA 3NOPC 4ARZB 2HGVA 3MQ0A 4JKTA 3MKEA 1XJ4A 4R4RA 3MS6A 1TDLA 2OAP1 3G35A 3A3EA 4OQIA 1BULA 5GHZA 1LI9A 2FZ0A 3LEZA 1XP4A 2JE5A 2JKTI 4FH4A 5HDSA 4F94A 3IS2A 3BFEA 1H5XA 3LICA 5GL9A 5F1GA 2V1AA 1K54C 3HLFA 3MXRA 5FL3A 5A90A 4I3IA 2HDQA 5CEDA 2RCXA 4OOYA 1H3QA 2H0TA 4KG2A 4Z1WA 2WKIA 1S1ZA 5HDDA 2XH9A 1PI5A 4O8GA 3UY6A 4GNUA 4EUZA 5HSQA 2IWBA 3UDIA 2O0YA 1LL9A 3ZGAB 3MQQA 2H5SA 4YOFA 4BL3A 4FOFA 4FSFA 3G34A 5IT5A 5JYPA 4JLFA 5TBMA 4PAUA 4AFIA 4BD0A 1ZTUA 4OPQA 5CHJA 3DBAA 5G18A 4KQDA 4S2MA 2HF6A 5L10A 2QKPA 4N1HA 4L9FA 3CPTB 4LRZE 3IWQA 5L07A 3G2ZA 3PR6A 1P97A 1LSVA 3WS5A 5EPHA 3BEBA 3A3IA 5EOOA 4IHQA 4EBPA 2H28A 4IBXA 3N4IA 3DTMA 2IA2A 2QZ6A 3BWLA 3R7WA 2VEAA 3ZVWA 4OP5A 2Z2MB 1PWDA 3HUOA 2P08A 3ZG8B 4Q8IA 4IJGA 2WGWA 4G3VA 5J3WA 2XA7M 5J7EA 4ETXA 4GB7A 1GSVA 3SH8A 1ESIA 3IXHA 2QYBA 4IEDA 1E3UA 3EQUA 5DKLA 4S2NC 3VP4A 1ODVA 1S6RA 4PM5A 1G68A 1KGGA 4FUWA 4R3AA 3IX3A 2EFUA 3IHAA 2DRWA 3A3FA 2OLUA 3CITA 1NWZA 3MSHA 5HD3A 4OVDA 3C8CA 2VA0A 1YKDA 1MZUA 4OLDA 4NXBA 2X01A 2HV1A 5HWVA 4HNBA 2W1TB 3LY4A 4E6XA 4JF6A 2PBYA 1MY8A 1CJFA 3IH9A 5LBRA 3O87A 4KZBA 4CLCA 1PIOA 2WZZA 5FASA 3QNCA 3H7WB 1VEUA 2D01A 3PXPA 1T18A 3NOTC 4BBVA 4M4XA 4Y0TA 4WF0A 2QHKA 3UB9A 2HP9A 2L4RA 4IUKA 4FCFA 3Q1FA 1FCMA 1MWTA 4XT2B 4X25A 5CGXA 1K56A 4LENA 5GLDA 1VM1A 5CTMA 2ZLYA 2X02A 4MBKA 4DDYA 2CMNA 4BL2A 3BQ8A 1YLYA 3ZNTA 3FZCA 3DW0A 4OQGA 2VZWA 4Z9QA 3A3DA 2WZXA 5HZHA 2ZMAA 1DJBA 5FA7A 3BYDA 5FDHA 4R23A 1JWPA 4X1MA 2WGIA 2PU4A 4ZAMA 1T1AA 2ZMFA 1YMSA 4EV4A 4GDNA 1PWCA 3WS4A 1G5UA 4KUOA 1YLJA 4LCLA 1P0ZA 1I2WA 1XA7A 4Q0HA 4RX3A 1TS6A 1PYYA 2W3EA 4K08A 3OLOA 4JF4A 4EQ1A 5EE8A 1LLBA 4WZ4A 4MN7A 4S2LA 4MCWA 3SS3A 2G2WA 2J80A 1PW8A 1YPRA 3IF6B 2NUTC 3ULFA 5CXWA 2PRFA 3CWFA 2V2FF 3SS5A 3C4PA 2QJ5A 4E3IA 4B88A 4EEUA 2WAEA 2LB5A 4FTXA 1PNEA 1E3UD 5EM0A 1VETA 1DP6A 3VSKA 1YMXA 3BRMA 1M6KA 1YLTA 3UB5P 2QPNA 1FQGA 4B4ZA 4Y13A 4EESA 2YKFA 1CEFA 4QPRA 3BFFA 3WWXA 4QD4A 2ZC7A 1SHVA 4OQHA 4QY5A 1L0GA 2VV6A 1PW1A 3JVVA 3IH8A 2XD5A 3MBZA 2V20A 3CHWP 2V0WA 4LGWA 2GNXA 3UNWA 3VOYA 2ZQCA 1OTAA 2A3UA 4R3BA 5HL1A 4Y2FA 3V67A 3LGOA 4JXSA 3GV9A 2EWVA 4HHDA 1GA9A 2P04A 4DXBA 4CLCD 2EX9A 5A8BA 1KDWA 3H82B 3T1XA 1EI5A 3P01A 2W1RA 3V5MA 1JWZA 3Q7VA 4ZJ2A 4KZ7A 1GHIA 3WRZA 5CX7A 3N8LA 1XA1A 1MKMA 3HLGA 1FCOA 3QP1A 4BBUA 3KYQA 1CF0A 4ETZA 3PBRA 2QWSA 1K56D 4G3WA 1NZOA 4EXOA 3UO9A 4Q0IA 2XFTA 3C2WA 1BZAA 5A93A 4OPZA 4WZ5A 2Y79A 1E25A 2W3FA 3HL9A 5GLBA 3K2NA 3BY8A 4ME4A 1SDNA 4GJ4A 4E3OA 5EECA 4EU0A 4WEKA 2J8YA 1TS7A 1HZOA 2Y2IA 4DN0A 1HTZA 3B42A 4H6JA 4MBHA 3NIAA 3O5YA 2D02A 4ZRRA 5U47A 3U2AA 4ARZA 3BLSA 4HJ4A 2EXAA 3ZDJA 3UPPA 2UV0E 3LR3A 4E3JA 1ONGA 5F68A 4MLLA 2OLVA 1YLZA 4LLOB 3TJZC 1P9RA 3S7OA 4HH3A 5CECA 2P74A 3NY4A 3PBNA 2EX2A 3Q81A 1RGYA 3TG9A 2AVXA 3VE4A 5I5LA 4DE2A 4UEYA 3P7NA 3NHQA 1JTGA 4PPRA 2OWHA 2ZC6B 4YINA 4GDBA 2OWJA 2W27A 1UWPX 3RXXA 2WYXA 1FOFA 1XJ3A 1PFLA 5EVIB 1FCNA 5GLAA 1ZC2A 3V39A 1UWNX 5FQ9A 2O9CA 3ZHHA 2ZC5B 2UWXA 1PI4A 5K5BA 2WKRA 2HZ5A 1KE0A 2ZM8A 3RJUA 2KOIA 4LPZA 2ZBBA 4KENB 5CERA 1OMEA 3BQAA 5FSRA 3P98A 2G7UA 5FI2A 3CPTA 3QNBA 2VGLM 1XGJA 4M3KA 1EWZA 1O07A 1E4DA 1BLCA 3T4KA 3T4QA 1T1CA 3BW6A 5FEFA 3TE8A 5L2FA 3F1OA 4FH2A 1IEMA 3C7VA 2IWCA 4ZJ1A 4E6WA 2HP6A 2NUPC 1L0FA 4XUZA 1SDEA 3T1RA 4HI4A 3PBQA 3M2KA 4I3JA 3LY3A 4OKPA 3ZCZA 4HH2A 5F5YA 4EERA 3DTEA 2K7SA 4DRTA 1GSXA 3C30A 4HOIA 3VMAA 4UQIM 2XA7S 3LIDA 2P7JA 3IBJA 3HUNA 5DF8A 3DWZA 1I2SA 3VFFA 4E3KA 3O86A 3OOVA 3GR2A 2FFFB 3ZG0A 2W1TA 3NJAA 1ES4A 3LEQA 5TJJA 1Y54A 3CAXA 3N8SA 1L0EA 3LO7A 4R1GA 5FAOA 4BJPA 1KGEA 2Y2NA 4R6LA 1MWSA 2O99A 2BASA 2Y2OA 1TS8A 2JKRM 5KMWA 2Y2LA 4KZ6A 5D3OA 4GZBA 4GW9A 4KG6A 4EEPA 3N7WA 1K57A 4XT2A 1XPBA 1TD5A 2P9VA 2Q0OA 1JVJA 4X56A 1VQQA 3TRCA 3UE3A 1FILA 1PZPA 3D72A 1KDSA 2O9AA 1W79A 3IHBA 5HD5A 4HY8A 1BSGA 1Y4OA 1N9OA 4NETA 3BECA 4WMCA 4LRXC 4UA7A 3UB6A 1QMEA 2PR6A 1G28A 5FI7A 3G31A 4OPRA 3VOLA 4GS9B 1L0DA 3HLWA 1W8YA 5CHUA 1IYOA 3A0VA 4S2JA 3MZEA 2DCFA 2V8FA 1XGIA 3EQVA 1OPXA 4XUXA 3QP2A 4DMZA 3QP8A 4L0LA 4OQ0A 1LT0A 2XR0A 4GN2A 4I5SA 5DVAA 2I72A 2HP5A 5F69A 3IF6A 1IELA 1YSQA 4QU3A 4F3LB 4N1XA 3FKVA 4KZ5A 2VV8A 4E3NA 3HLBA 4GHIB 3IS2B 1PZOA 4CJNA 4P87A 2YKHA 3WS1A
chains in the Genus database with same CATH topology
1YM1A 3HVFA 1WYCA 3ZG7B 1E3UD 1ZKJA 2Y55A 3BFGA 3MZDA 3VSKA 1FSYA 2Y2GA 5CTNA 1YMXA 3W4QA 2WGVA 5M18A 3AGDA 1IKIA 5KSCA 4PM9A 2Y2KA 1CI8A 3AGEA 3BRMA 1KVMA 2Y2MA 5HW3A 1M6KA 4ZTKA 1ES3A 1YLTA 1RGZA 1GHMA 5CGSA 1KE3A 2QPNA 4PM6A 3C4OA 4R3JA 3IWIA 1FQGA 4LV2A 4B4ZA 4S2OA 2XGNA 3UDXA 4U0TA 2ZQ8A 1CEFA 1NY0A 1FSWA 2XD1A 3V50A 5DF9A 1C3BA 3OC2A 3BFFA 4RX2A 4WM9A 3WWXA 2Y2HA 4P6BA 1IYQA 2ZC7A 1SHVA 1TEMA 4QB8A 4QD4A 4WYYA 4NK3A 3GSGA 4OQHA 5GHYA 4QY5A 4OPYA 4WZ5C 1L0GA 3GQZA 3GRJA 3GVBA 5HAIA 2XK1A 3HLDA 5FATA 1PW1A 3D4FA 4R4SA 4DDSA 3IH8A 3VP1A 1LI0A 1K6SA 2XD5A 3MBZA 1EROA 2V20A 3G30A 5A92A 5E43A 2GDNA 1YLPA 5FQMA 3UNWA 3S22A 3VSLA 2Z2LB 5CEBA 3OPPA 3VOYA 4X69A 2ZC3B 2ZQCA 1NXYA 2A3UA 3ITBA 4S2KA 1SCWA 3LCEA 4GD6A 2WAFA 5TR7A 4R3BA 3GMWA 1LHYA 1NJ4A 1RP5A 4HBUA 3UE0A 5HL1A 4JXSA 3V3RA 3NDEA 2J9OA 3GV9A 2R9WA 5J8XA 1GA9A 4DXBA 5GLCA 4JPMA 3O88A 4QJGA 4RVAA 2EX9A 5FAPA 1N9BA 1KDWA 2A49A 3IXGA 3PBOA 2CC1A 2ZC4B 1EI5A 5FI6A 3SOIA 1K38A 3ZNYA 3Q7VB 3MZFA 4Y7PA 3PTEA 1BLHA 5GHXA 3V5MA 1JWZA 2H0YA 3Q7VA 1Z6FA 2OSUA 4ZJ2A 4KZ7A 3PAEA 1GHIA 4X55A 1LL5A 3WRZA 4OOLA 3N8LA 5FQJA 1XA1A 3VP0A 4KG5A 2BG1A 3G32A 2Y59A 3HLGA 1FCOA 2G2UA 1WYBA 2Y2QA 1DJAA 4KZ9A 4K91A 4UA9A 2R9XA 1K55C 2JC7A 1L2SA 3W4OA 3W4PA 2Y2JA 3PBRA 4KQQA 3RXWA 3CG5A 3OPRA 1K56D 3ZG5A 1NZOA 4BQMA 5JYOA 2QMIA 3UO9A 1ONHA 3VOZA 2XFTA 1BLSA 3OCNA 4EBNA 2ZD8A 1BZAA 5A93A 5E2GA 1K4EA 5M19A 1AXBA 4OPZA 4O7DA 3ITAA 4WZ5A 1E25A 3HL9A 5GLBA 3SH7A 4LCMA 5HARA 5EOEA 5KSHA 1SDNA 4E3OA 2Y91A 5EECA 5DTSA 4WBGA 3OZHA 4WEKA 2J8YA 1H8YA 3FV7A 3FYZA 1HZOA 4ZJ3A 2ZM2A 2XFSA 2ZQAA 2Y2IA 2EFXA 2PU2A 1HTZA 1K4FA 1ERQA 2OV5A 4MBHA 1TDGA 3NIAA 3IF5A 5U47A 1KVLA 4JKTA 5CHMA 2E8IA 3BFCA 3MKEA 5DTTA 5EVIC 5IHVA 3BLSA 4R4RA 1TDLA 3MFDA 5AQ7A 3G35A 5AQAA 3GTCA 3A3EA 1NYMA 4OQIA 4Y0OA 2B5RA 3FWLA 1BULA 2EXAA 3IXDA 1LI9A 1O7EA 3LEZA 5GHZA 3ZDJA 3JYIA 3UPPA 1XP4A 2JE5A 4FH4A 2IWDA 4X6TA 4E3JA 5CGWA 1ONGA 3O3VA 3UN7A 3BFEA 4GKUA 4F94A 4MLLA 1H5XA 1QMFA 1YLZA 2OLVA 3ZVTA 4JXGA 4ZBEA 4BENA 5GL9A 3NCKA 5HFOA 4JXWA 5F1GA 3S1YA 4ID4A 1K54C 3HLFA 3MXRA 5CECA 1W5DA 5A90A 2HDQA 4DE1A 2P74A 5CEDA 3V3SA 3NY4A 2RCXA 4DXCA 2ZQ9A 2RL3A 1DJCA 4OOYA 1YQSA 4OONA 3PBNA 2EX2A 2H0TA 1HVBA 3Q81A 4KG2A 1RGYA 3FKWA 3CZDA 4X68A 2WKIA 4C3QA 3TG9A 1YT4A 4KQRA 4DE2A 2XH9A 1JTGA 1MBLA 1PI5A 2EX8A 4PPRA 4QHCA 4E3LA 2ZC6B 4JBFA 4K0XA 4GNUA 3UY6A 4EUZA 4P0MA 3VP3A 1K6RA 4P85A 4YINA 4B4XA 1GCEA 4GDBA 2VGJA 3RXXA 2IWBA 3UDIA 1ALQA 1W8QA 2HDRA 2WYXA 3TSGA 5F83A 1FOFA 1JTDA 1LL9A 1DY6A 3ZGAB 5EVIB 5DTKA 4ZDXA 2H5SA 1FCNA 5EVIA 5GLAA 3E2KA 1ZC2A 3V39A 4BL3A 4GD8A 1XXMA 4FSFA 5AQBA 5FQ9A 3G34A 3ZHHA 2ZC5B 2UWXA 4K0WA 1PI4A 2V1ZA 5JYPA 4JLFA 5A91A 3HUMA 1W7FA 3BFDA 1KE0A 2ZM8A 3RJUA 1HD8A 5F82A 2XQZA 3TOIA 3E2LA 3WS2A 2P9VB 1FR1A 4KENB 1ES5A 5CERA 1OMEA 4BD0A 4CPKA 4HBTA 4OPQA 5CHJA 3VP2A 5G18A 5FSRA 3P98A 3C7UA 4OH0A 4S2MA 4C6YA 4N1HA 3OPLA 1PWGA 3WS0A 1K54A 5FI2A 5HX9A 3IWQA 2WKHA 4E3MA 4N92A 3G2ZA 4KZAA 3QNBA 3WS5A 1GHPA 5EPHA 3BEBA 3A3IA 5EOOA 1XGJA 4M3KA 1EWZA 1O07A 4EBPA 1E4DA 1BLCA 3MXSA 4IBXA 3Q82A 3N4IA 4DE0A 2DNSA 3DTMA 2QZ6A 4R0QA 4LV3A 5L2FA 3S4XA 1IYPA 3UPOA 4FH2A 3ZVWA 2HDSA 3BLMA 2Z2MB 4OP5A 4OOMA 1IEMA 1PWDA 3C7VA 3Q7ZA 1CI9A 1XX2A 3HLEA 3G2YA 3NC8A 3HUOA 4RA7A 2IWCA 2XLNA 3BM6A 3HBRA 3ZG8B 1GA0A 3OCLA 2WGWB 2XF3A 4WMCD 4OLGA 4ZJ1A 4E6WA 4Q8IA 3A3JA 2HP6A 2WGWA 1ERMA 4MEZA 5M1AA 1L0FA 4XUZA 4A5RA 1SDEA 3ISGA 4RYEA 2HDUA 3PBQA 1MXOA 4GB7A 4DE3A 3M2KA 5EVLA 3SH8A 1ESIA 3IXHA 4BLMA 1I5QA 1E3UA 3EQUA 4IEDA 1ZG6A 3IT9A 5EUAA 4S2NC 5I94A 3LY3A 3VP4A 1N4OA 1S6RA 3N6IA 3B3XA 2Y2PA 4PM5A 1G68A 4OKPA 4EWFA 1KGGA 1JWVA 3N8RA 3PBTA 1K57C 3ZCZA 5AQ9A 1K25A 2EFUA 2X71A 3IHAA 1MWRA 2DRWA 1M40A 3A3FA 2OLUA 4HEFA 1Q2QA 4DRTA 3VMAA 2EXBA 4WELA 4N9KA 4OVDA 4HESA 1CEGA 1WE4A 3HUNA 5KZHA 5DF8A 2C5WB 1I2SA 3DWZA 3VFFA 1K55A 4KZ4A 1IKGA 4E3KA 4OLDA 3O86A 2X01A 3ZG9B 3AGFA 4U3TA 1J9MA 3GR2A 2FFFB 3ZG0A 3Q07A 3LY4A 2H10A 3M6HA 4E6XA 1H8ZA 4LV1A 4PM8A 4IBRA 1ES4A 4UA6A 3M2JA 4JF6A 2PBYA 1MY8A 4PMAA 2FFYA 1NRFA 4BD1A 4WEJA 1Y54A 3IH9A 1TVFA 4S2PA 4KQOA 3N8SA 3O87A 1YLWA 1L0EA 2J9PA 3WRTA 4KZBA 3LO7A 1CK3A 4R1GA 5FAOA 4BJPA 3DWKA 1KGEA 2Y2NA 1PIOA 4LV0A 2WZZA 5FASA 1BT5A 3QNCA 4KZ3A 4UAAA 5CRFA 4D2OA 1MWSA 5FQKA 5HAPA 2Y2OA 2WUQA 4Y0TA 2XEPA 3NBLA 5BOHA 4X53A 4MBFA 1KE4A 4IVIA 3IQAA 1Q2PA 4S2NA 3P09A 5KMWA 2Y2LA 2HP9A 5DF7A 4KZ6A 5D3OA 3C5AA 4GZBA 4FCFA 4GOGA 3VFHA 3OPHA 1FCMA 3Q1FA 4KG6A 1MWTA 4MNRA 5FAQA 3N7WA 5FQIA 3SH9A 4N9LA 1K57A 1XPBA 5F1FA 1NZUA 2P9VA 4S2IA 5CGXA 2ZQ7A 1JVJA 4X56A 1K56A 2C6WB 1VQQA 2ZJ9A 4LENA 2EX6A 5GLDA 3UE3A 1VM1A 5CTMA 4H8RA 1PZPA 3SS4A 4XXRA 1KDSA 3M6BA 2ZLYA 3IF6C 2X02A 4MBKA 2Q9NA 4DF6A 1W79A 4Y0UA 4DDYA 3IHBA 1BSGA 2JCHA 4BL2A 4NETA 4EQIA 1YLYA 3BECA 5EVID 3ZNTA 4WMCA 3FZCA 4UA7A 3DW0A 4OQGA 3UDFA 3IXBA 1QMEA 4IVKA 4Z9QA 5FI7A 3A3DA 2WZXA 2WK0A 2ZMAA 4YFMA 2J7VA 1FR6A 1DJBA 5FA7A 1BLPA 2ZQDA 3G31A 4OPRA 3QHYA 2Y4AA 3BYDA 4JXVA 3G4PA 5FDHA 3NDGA 4R23A 1JWPA 1L0DA 3HLWA 1W8YA 2VGKA 2WGIA 5CHUA 1IYOA 2PU4A 3HREA 3CJMA 4UHUA 4ZAMA 4DKIA 4PM7A 4QY6A 1MWUA 4S2JA 3MZEA 2DCFA 1YMSA 5HAQA 4EV4A 1XGIA 4GDNA 2ZM0A 5TFQA 1ES2A 3EQVA 5TGFA 1MKIA 1PWCA 5E2FA 4XUXA 3I7JA 3WS4A 1ZG4A 3CMZA 1U60A 2Q9MA 1YLJA 4L0LA 1S0WA 1ESUA 3IWOA 4JF5A 4LCLA 4OQ0A 5E2HA 1I2WA 1KGFA 2XR0A 3HLCA 4FD8A 1XA7A 4KZ8A 4GN2A 4OP8A 4RX3A 3UE1A 1PYYA 1NYYA 4JF4A 5DVAA 5EE8A 2BLSA 2I72A 1LLBA 4WZ4A 2HP5A 2HPBA 1G6AA 4S2LA 2JBFA 3SS3A 2G2WA 1PW8A 3NI9A 3IF6B 2XDMA 1BUEA 5CXWA 4EBLA 3IF6A 4C75A 1IELA 1BTLA 1MPLA 4QU3A 5E2EA 1RCJA 4N1XA 3PBSA 2V2FF 2WADA 3SS5A 3UPNA 3C4PA 3FKVA 4KZ5A 4E3NA 4E3IA 1SKFA 3HLBA 4U0XA 4B88A 3MKFA 1XKZA 3W8KA 1IYSA 3ZFZA 1PZOA 5FQQA 4CJNA 3PAGA 4P87A 3WS1A 2WKEA 2WAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YM1 A;  3HVF A;  1WYC A;  3ZG7 B;  1E3U D;  1ZKJ A;  2Y55 A;  3BFG A;  3MZD A;  3VSK A;  1FSY A;  2Y2G A;  5CTN A;  1YMX A;  3W4Q A;  2WGV A;  5M18 A;  3AGD A;  1IKI A;  5KSC A;  4PM9 A;  2Y2K A;  1CI8 A;  3AGE A;  3BRM A;  1KVM A;  2Y2M A;  5HW3 A;  1M6K A;  4ZTK A;  1ES3 A;  1YLT A;  1RGZ A;  1GHM A;  5CGS A;  1KE3 A;  2QPN A;  4PM6 A;  3C4O A;  4R3J A;  3IWI A;  1FQG A;  4LV2 A;  4B4Z A;  4S2O A;  2XGN A;  3UDX A;  4U0T A;  2ZQ8 A;  1CEF A;  1NY0 A;  1FSW A;  2XD1 A;  3V50 A;  5DF9 A;  1C3B A;  3OC2 A;  3BFF A;  4RX2 A;  4WM9 A;  3WWX A;  2Y2H A;  4P6B A;  1IYQ A;  2ZC7 A;  1SHV A;  1TEM A;  4QB8 A;  4QD4 A;  4WYY A;  4NK3 A;  3GSG A;  4OQH A;  5GHY A;  4QY5 A;  4OPY A;  4WZ5 C;  1L0G A;  3GQZ A;  3GRJ A;  3GVB A;  5HAI A;  2XK1 A;  3HLD A;  5FAT A;  1PW1 A;  3D4F A;  4R4S A;  4DDS A;  3IH8 A;  3VP1 A;  1LI0 A;  1K6S A;  2XD5 A;  3MBZ A;  1ERO A;  2V20 A;  3G30 A;  5A92 A;  5E43 A;  2GDN A;  1YLP A;  5FQM A;  3UNW A;  3S22 A;  3VSL A;  2Z2L B;  5CEB A;  3OPP A;  3VOY A;  4X69 A;  2ZC3 B;  2ZQC A;  1NXY A;  2A3U A;  3ITB A;  4S2K A;  1SCW A;  3LCE A;  4GD6 A;  2WAF A;  5TR7 A;  4R3B A;  3GMW A;  1LHY A;  1NJ4 A;  1RP5 A;  4HBU A;  3UE0 A;  5HL1 A;  4JXS A;  3V3R A;  3NDE A;  2J9O A;  3GV9 A;  2R9W A;  5J8X A;  1GA9 A;  4DXB A;  5GLC A;  4JPM A;  3O88 A;  4QJG A;  4RVA A;  2EX9 A;  5FAP A;  1N9B A;  1KDW A;  2A49 A;  3IXG A;  3PBO A;  2CC1 A;  2ZC4 B;  1EI5 A;  5FI6 A;  3SOI A;  1K38 A;  3ZNY A;  3Q7V B;  3MZF A;  4Y7P A;  3PTE A;  1BLH A;  5GHX A;  3V5M A;  1JWZ A;  2H0Y A;  3Q7V A;  1Z6F A;  2OSU A;  4ZJ2 A;  4KZ7 A;  3PAE A;  1GHI A;  4X55 A;  1LL5 A;  3WRZ A;  4OOL A;  3N8L A;  5FQJ A;  1XA1 A;  3VP0 A;  4KG5 A;  2BG1 A;  3G32 A;  2Y59 A;  3HLG A;  1FCO A;  2G2U A;  1WYB A;  2Y2Q A;  1DJA A;  4KZ9 A;  4K91 A;  4UA9 A;  2R9X A;  1K55 C;  2JC7 A;  1L2S A;  3W4O A;  3W4P A;  2Y2J A;  3PBR A;  4KQQ A;  3RXW A;  3CG5 A;  3OPR A;  1K56 D;  3ZG5 A;  1NZO A;  4BQM A;  5JYO A;  2QMI A;  3UO9 A;  1ONH A;  3VOZ A;  2XFT A;  1BLS A;  3OCN A;  4EBN A;  2ZD8 A;  1BZA A;  5A93 A;  5E2G A;  1K4E A;  5M19 A;  1AXB A;  4OPZ A;  4O7D A;  3ITA A;  4WZ5 A;  1E25 A;  3HL9 A;  5GLB A;  3SH7 A;  4LCM A;  5HAR A;  5EOE A;  5KSH A;  1SDN A;  4E3O A;  2Y91 A;  5EEC A;  5DTS A;  4WBG A;  3OZH A;  4WEK A;  2J8Y A;  1H8Y A;  3FV7 A;  3FYZ A;  1HZO A;  4ZJ3 A;  2ZM2 A;  2XFS A;  2ZQA A;  2Y2I A;  2EFX A;  2PU2 A;  1HTZ A;  1K4F A;  1ERQ A;  2OV5 A;  4MBH A;  1TDG A;  3NIA A;  3IF5 A;  5U47 A;  1KVL A;  4JKT A;  5CHM A;  2E8I A;  3BFC A;  3MKE A;  5DTT A;  5EVI C;  5IHV A;  3BLS A;  4R4R A;  1TDL A;  3MFD A;  5AQ7 A;  3G35 A;  5AQA A;  3GTC A;  3A3E A;  1NYM A;  4OQI A;  4Y0O A;  2B5R A;  3FWL A;  1BUL A;  2EXA A;  3IXD A;  1LI9 A;  1O7E A;  3LEZ A;  5GHZ A;  3ZDJ A;  3JYI A;  3UPP A;  1XP4 A;  2JE5 A;  4FH4 A;  2IWD A;  4X6T A;  4E3J A;  5CGW A;  1ONG A;  3O3V A;  3UN7 A;  3BFE A;  4GKU A;  4F94 A;  4MLL A;  1H5X A;  1QMF A;  1YLZ A;  2OLV A;  3ZVT A;  4JXG A;  4ZBE A;  4BEN A;  5GL9 A;  3NCK A;  5HFO A;  4JXW A;  5F1G A;  3S1Y A;  4ID4 A;  1K54 C;  3HLF A;  3MXR A;  5CEC A;  1W5D A;  5A90 A;  2HDQ A;  4DE1 A;  2P74 A;  5CED A;  3V3S A;  3NY4 A;  2RCX A;  4DXC A;  2ZQ9 A;  2RL3 A;  1DJC A;  4OOY A;  1YQS A;  4OON A;  3PBN A;  2EX2 A;  2H0T A;  1HVB A;  3Q81 A;  4KG2 A;  1RGY A;  3FKW A;  3CZD A;  4X68 A;  2WKI A;  4C3Q A;  3TG9 A;  1YT4 A;  4KQR A;  4DE2 A;  2XH9 A;  1JTG A;  1MBL A;  1PI5 A;  2EX8 A;  4PPR A;  4QHC A;  4E3L A;  2ZC6 B;  4JBF A;  4K0X A;  4GNU A;  3UY6 A;  4EUZ A;  4P0M A;  3VP3 A;  1K6R A;  4P85 A;  4YIN A;  4B4X A;  1GCE A;  4GDB A;  2VGJ A;  3RXX A;  2IWB A;  3UDI A;  1ALQ A;  1W8Q A;  2HDR A;  2WYX A;  3TSG A;  5F83 A;  1FOF A;  1JTD A;  1LL9 A;  1DY6 A;  3ZGA B;  5EVI B;  5DTK A;  4ZDX A;  2H5S A;  1FCN A;  5EVI A;  5GLA A;  3E2K A;  1ZC2 A;  3V39 A;  4BL3 A;  4GD8 A;  1XXM A;  4FSF A;  5AQB A;  5FQ9 A;  3G34 A;  3ZHH A;  2ZC5 B;  2UWX A;  4K0W A;  1PI4 A;  2V1Z A;  5JYP A;  4JLF A;  5A91 A;  3HUM A;  1W7F A;  3BFD A;  1KE0 A;  2ZM8 A;  3RJU A;  1HD8 A;  5F82 A;  2XQZ A;  3TOI A;  3E2L A;  3WS2 A;  2P9V B;  1FR1 A;  4KEN B;  1ES5 A;  5CER A;  1OME A;  4BD0 A;  4CPK A;  4HBT A;  4OPQ A;  5CHJ A;  3VP2 A;  5G18 A;  5FSR A;  3P98 A;  3C7U A;  4OH0 A;  4S2M A;  4C6Y A;  4N1H A;  3OPL A;  1PWG A;  3WS0 A;  1K54 A;  5FI2 A;  5HX9 A;  3IWQ A;  2WKH A;  4E3M A;  4N92 A;  3G2Z A;  4KZA A;  3QNB A;  3WS5 A;  1GHP A;  5EPH A;  3BEB A;  3A3I A;  5EOO A;  1XGJ A;  4M3K A;  1EWZ A;  1O07 A;  4EBP A;  1E4D A;  1BLC A;  3MXS A;  4IBX A;  3Q82 A;  3N4I A;  4DE0 A;  2DNS A;  3DTM A;  2QZ6 A;  4R0Q A;  4LV3 A;  5L2F A;  3S4X A;  1IYP A;  3UPO A;  4FH2 A;  3ZVW A;  2HDS A;  3BLM A;  2Z2M B;  4OP5 A;  4OOM A;  1IEM A;  1PWD A;  3C7V A;  3Q7Z A;  1CI9 A;  1XX2 A;  3HLE A;  3G2Y A;  3NC8 A;  3HUO A;  4RA7 A;  2IWC A;  2XLN A;  3BM6 A;  3HBR A;  3ZG8 B;  1GA0 A;  3OCL A;  2WGW B;  2XF3 A;  4WMC D;  4OLG A;  4ZJ1 A;  4E6W A;  4Q8I A;  3A3J A;  2HP6 A;  2WGW A;  1ERM A;  4MEZ A;  5M1A A;  1L0F A;  4XUZ A;  4A5R A;  1SDE A;  3ISG A;  4RYE A;  2HDU A;  3PBQ A;  1MXO A;  4GB7 A;  4DE3 A;  3M2K A;  5EVL A;  3SH8 A;  1ESI A;  3IXH A;  4BLM A;  1I5Q A;  1E3U A;  3EQU A;  4IED A;  1ZG6 A;  3IT9 A;  5EUA A;  4S2N C;  5I94 A;  3LY3 A;  3VP4 A;  1N4O A;  1S6R A;  3N6I A;  3B3X A;  2Y2P A;  4PM5 A;  1G68 A;  4OKP A;  4EWF A;  1KGG A;  1JWV A;  3N8R A;  3PBT A;  1K57 C;  3ZCZ A;  5AQ9 A;  1K25 A;  2EFU A;  2X71 A;  3IHA A;  1MWR A;  2DRW A;  1M40 A;  3A3F A;  2OLU A;  4HEF A;  1Q2Q A;  4DRT A;  3VMA A;  2EXB A;  4WEL A;  4N9K A;  4OVD A;  4HES A;  1CEG A;  1WE4 A;  3HUN A;  5KZH A;  5DF8 A;  2C5W B;  1I2S A;  3DWZ A;  3VFF A;  1K55 A;  4KZ4 A;  1IKG A;  4E3K A;  4OLD A;  3O86 A;  2X01 A;  3ZG9 B;  3AGF A;  4U3T A;  1J9M A;  3GR2 A;  2FFF B;  3ZG0 A;  3Q07 A;  3LY4 A;  2H10 A;  3M6H A;  4E6X A;  1H8Z A;  4LV1 A;  4PM8 A;  4IBR A;  1ES4 A;  4UA6 A;  3M2J A;  4JF6 A;  2PBY A;  1MY8 A;  4PMA A;  2FFY A;  1NRF A;  4BD1 A;  4WEJ A;  1Y54 A;  3IH9 A;  1TVF A;  4S2P A;  4KQO A;  3N8S A;  3O87 A;  1YLW A;  1L0E A;  2J9P A;  3WRT A;  4KZB A;  3LO7 A;  1CK3 A;  4R1G A;  5FAO A;  4BJP A;  3DWK A;  1KGE A;  2Y2N A;  1PIO A;  4LV0 A;  2WZZ A;  5FAS A;  1BT5 A;  3QNC A;  4KZ3 A;  4UAA A;  5CRF A;  4D2O A;  1MWS A;  5FQK A;  5HAP A;  2Y2O A;  2WUQ A;  4Y0T A;  2XEP A;  3NBL A;  5BOH A;  4X53 A;  4MBF A;  1KE4 A;  4IVI A;  3IQA A;  1Q2P A;  4S2N A;  3P09 A;  5KMW A;  2Y2L A;  2HP9 A;  5DF7 A;  4KZ6 A;  5D3O A;  3C5A A;  4GZB A;  4FCF A;  4GOG A;  3VFH A;  3OPH A;  1FCM A;  3Q1F A;  4KG6 A;  1MWT A;  4MNR A;  5FAQ A;  3N7W A;  5FQI A;  3SH9 A;  4N9L A;  1K57 A;  1XPB A;  5F1F A;  1NZU A;  2P9V A;  4S2I A;  5CGX A;  2ZQ7 A;  1JVJ A;  4X56 A;  1K56 A;  2C6W B;  1VQQ A;  2ZJ9 A;  4LEN A;  2EX6 A;  5GLD A;  3UE3 A;  1VM1 A;  5CTM A;  4H8R A;  1PZP A;  3SS4 A;  4XXR A;  1KDS A;  3M6B A;  2ZLY A;  3IF6 C;  2X02 A;  4MBK A;  2Q9N A;  4DF6 A;  1W79 A;  4Y0U A;  4DDY A;  3IHB A;  1BSG A;  2JCH A;  4BL2 A;  4NET A;  4EQI A;  1YLY A;  3BEC A;  5EVI D;  3ZNT A;  4WMC A;  3FZC A;  4UA7 A;  3DW0 A;  4OQG A;  3UDF A;  3IXB A;  1QME A;  4IVK A;  4Z9Q A;  5FI7 A;  3A3D A;  2WZX A;  2WK0 A;  2ZMA A;  4YFM A;  2J7V A;  1FR6 A;  1DJB A;  5FA7 A;  1BLP A;  2ZQD A;  3G31 A;  4OPR A;  3QHY A;  2Y4A A;  3BYD A;  4JXV A;  3G4P A;  5FDH A;  3NDG A;  4R23 A;  1JWP A;  1L0D A;  3HLW A;  1W8Y A;  2VGK A;  2WGI A;  5CHU A;  1IYO A;  2PU4 A;  3HRE A;  3CJM A;  4UHU A;  4ZAM A;  4DKI A;  4PM7 A;  4QY6 A;  1MWU A;  4S2J A;  3MZE A;  2DCF A;  1YMS A;  5HAQ A;  4EV4 A;  1XGI A;  4GDN A;  2ZM0 A;  5TFQ A;  1ES2 A;  3EQV A;  5TGF A;  1MKI A;  1PWC A;  5E2F A;  4XUX A;  3I7J A;  3WS4 A;  1ZG4 A;  3CMZ A;  1U60 A;  2Q9M A;  1YLJ A;  4L0L A;  1S0W A;  1ESU A;  3IWO A;  4JF5 A;  4LCL A;  4OQ0 A;  5E2H A;  1I2W A;  1KGF A;  2XR0 A;  3HLC A;  4FD8 A;  1XA7 A;  4KZ8 A;  4GN2 A;  4OP8 A;  4RX3 A;  3UE1 A;  1PYY A;  1NYY A;  4JF4 A;  5DVA A;  5EE8 A;  2BLS A;  2I72 A;  1LLB A;  4WZ4 A;  2HP5 A;  2HPB A;  1G6A A;  4S2L A;  2JBF A;  3SS3 A;  2G2W A;  1PW8 A;  3NI9 A;  3IF6 B;  2XDM A;  1BUE A;  5CXW A;  4EBL A;  3IF6 A;  4C75 A;  1IEL A;  1BTL A;  1MPL A;  4QU3 A;  5E2E A;  1RCJ A;  4N1X A;  3PBS A;  2V2F F;  2WAD A;  3SS5 A;  3UPN A;  3C4P A;  3FKV A;  4KZ5 A;  4E3N A;  4E3I A;  1SKF A;  3HLB A;  4U0X A;  4B88 A;  3MKF A;  1XKZ A;  3W8K A;  1IYS A;  3ZFZ A;  1PZO A;  5FQQ A;  4CJN A;  3PAG A;  4P87 A;  3WS1 A;  2WKE A;  2WAE A; 
#chains in the Genus database with same CATH topology
 1YM1 A;  1WYC A;  1NLY A;  3W4Q A;  1BYW A;  5CTN A;  3AGD A;  4PM9 A;  2Y2K A;  3AGE A;  1KVM A;  2Y2M A;  2B18 A;  5CGS A;  1KE3 A;  4R3J A;  3IWI A;  1IOU A;  1OTI A;  2ZQ8 A;  4Y15 A;  2XD1 A;  4BBT A;  2XRN A;  3OC2 A;  4RX2 A;  4NXF A;  4WM9 A;  4P6B A;  4WYY A;  1IYQ A;  1TEM A;  4NK3 A;  3GSG A;  2KX6 A;  4WZ5 C;  3GRJ A;  3UMD A;  2XK1 A;  3HLD A;  5FAT A;  3E4P A;  3D4F A;  4DDS A;  4HQA A;  4I3A A;  5A92 A;  2PD8 A;  3G30 A;  2GDN A;  5FQM A;  3S22 A;  3VSL A;  5CEB A;  1W63 Q;  2PHY A;  4MN6 A;  2ZC3 B;  3ITB A;  5TR7 A;  3GMW A;  1NJ4 A;  2INW A;  3V3R A;  3F1P B;  5J8X A;  5GLC A;  5TBM B;  3O88 A;  3GDI A;  5FAP A;  1N9B A;  2FH5 A;  2HJ9 C;  3PBO A;  3UME A;  3H82 A;  1K38 A;  3MZF A;  2PYP A;  3LFV A;  5AVF A;  2OSU A;  4X55 A;  1LL5 A;  2A24 A;  4OOL A;  5FQJ A;  4KG5 A;  2Y59 A;  2W3H A;  2G2U A;  1WYB A;  1SZV A;  2Y2Q A;  2L1M A;  4KZ9 A;  4UA9 A;  1K55 C;  2JC7 A;  4NEE D;  3CG5 A;  3KSH A;  2J3T D;  5DJU A;  3KYZ A;  1BLS A;  3OCN A;  5G4Z A;  3EOI A;  2ZD8 A;  5E2G A;  5M19 A;  4HP4 A;  4DJ2 A;  5KSH A;  3KSF A;  1H8Y A;  4ZJ3 A;  3HCY A;  3HJK A;  3IF5 A;  3IX8 A;  5DTT A;  5IHV A;  5AQ7 A;  1IFQ A;  2W3G A;  2PAV P;  3GTC A;  1NYM A;  4Y0O A;  3FWL A;  4X1L A;  1T1B A;  2GX5 A;  2IWD A;  3B47 A;  2VKS A;  2XSS A;  5CGW A;  3UN7 A;  1OT6 A;  4GKU A;  3ZVT A;  3W2Z A;  4ZBE A;  4BEN A;  1TF1 A;  5HFO A;  4WUJ A;  4ID4 A;  3MR0 A;  4DXC A;  2EWW A;  3RTY A;  2JKF A;  3BY9 A;  1HVB A;  1D1J A;  3FKW A;  3CZD A;  2OOL A;  1UGU A;  4WLA A;  4QHC A;  1MBL A;  2PT7 A;  2ZMV A;  4JBF A;  4P0M A;  3PHY A;  2PBD P;  2VGJ A;  4CLC B;  2KDK A;  1ALQ A;  1W8Q A;  2HDR A;  3TSG A;  3K3D A;  3FG8 A;  3KX0 X;  2W0N A;  5DTK A;  5EVI A;  3D9Y A;  1P9W A;  3E2K A;  3LI9 A;  5A91 A;  3HUM A;  1W7F A;  3BFD A;  1PRQ A;  1HD8 A;  3TOI A;  5DKK A;  3TW8 A;  3WS2 A;  1FR1 A;  4HBT A;  5C5K A;  3VP2 A;  3T4S A;  4OH0 A;  1XFN A;  3OPL A;  3WS0 A;  1OJ5 A;  2MJ6 A;  3A0R A;  4E3M A;  4N92 A;  4KZA A;  1AWI A;  1SKO B;  3CLO A;  3MF0 A;  2I9V A;  4L9G A;  3Q82 A;  1VB6 A;  1YAX A;  3T12 B;  2DNS A;  3EWK A;  4GLQ A;  4R0Q A;  4LV3 A;  3KYE A;  3ZQ5 A;  1IYP A;  2V8C A;  2HDS A;  4OOM A;  1CI9 A;  1XX2 A;  3HLE A;  2XLN A;  3BM6 A;  3HBR A;  3OCL A;  2XF3 A;  3S7Q A;  4OLG A;  2M7V A;  1ERM A;  4MEZ A;  2VGL S;  1DP9 A;  4LFU A;  5M1A A;  3ISG A;  4RYE A;  2HDU A;  1MXO A;  2ZOH A;  5EFW A;  2V0U A;  3LIA A;  4BLM A;  3K3C A;  4NXE A;  2QJ7 A;  1ZG6 A;  3IT9 A;  4WL9 A;  2M1C A;  3L7H A;  3N6I A;  3B3X A;  2Y2P A;  5DJT A;  2JKR I;  1K57 C;  1K25 A;  1MWR A;  1M40 A;  2J3T C;  4WEL A;  3NOU C;  2C5W B;  1N9N A;  1K55 A;  4HJ3 A;  2KLI A;  2VLG A;  2LB9 A;  3F1N B;  3ZG9 B;  3AGF A;  4U3T A;  1J9M A;  3MXQ A;  3SZT A;  1H8Z A;  4LV1 A;  4PM8 A;  4EUV A;  1X0O A;  1NRJ A;  2PDR A;  5L09 A;  4PMA A;  1L3L A;  2WKQ A;  4WEJ A;  1XJ6 A;  4S2P A;  1YLW A;  4UQI S;  3UB7 A;  1CK3 A;  3E4Q A;  3E98 A;  3DWK A;  4LV0 A;  4UAA A;  2Z6C A;  1CQA A;  5FDS A;  5HAP A;  3QP5 A;  2XEP A;  5BOH A;  4X53 A;  4MBF A;  4IVI A;  1S1Y A;  3C5A A;  3VFH A;  3OPH A;  4MNR A;  5FAQ A;  5FQI A;  4ESP A;  4N9L A;  2O9B A;  4G3K A;  3LR4 A;  4CLC E;  5F1F A;  4S2I A;  2ZQ7 A;  4GCZ A;  2PR5 A;  2ZJ9 A;  2BTF P;  2EX6 A;  3VE3 A;  5J4E A;  4H8R A;  1S67 L;  5HPF A;  4XXR A;  1F2K A;  3IF6 C;  4HIA A;  4P6Z S;  3LUQ A;  1VHM A;  2PD7 A;  4EQI A;  5EVI D;  3UDF A;  3IXB A;  4IVK A;  4BWI A;  3PYP A;  2J7V A;  1FR6 A;  1F98 A;  2Y4A A;  3QHY A;  4BMW A;  1OTB A;  3NDG A;  4GS9 A;  2VGK A;  3T4L A;  4UHU A;  4DKI A;  1MWU A;  3NEC A;  5HL6 A;  5HAQ A;  2VK3 A;  1W63 M;  2OAQ 1;  5E2F A;  5DFY A;  1ZG4 A;  3CMZ A;  3KSG A;  3DAV A;  3IX4 A;  4JF5 A;  3IWO A;  5E2H A;  4OP8 A;  1OTE A;  4FD8 A;  1NYY A;  3U4L P;  2VV7 A;  1G6A A;  5AJG A;  3LR5 A;  4EBL A;  4YWZ A;  1BTL A;  1MPL A;  1ZHH B;  1RCJ A;  3PBS A;  1DP8 A;  4D60 A;  4F3L A;  3UPN A;  1SKF A;  4U0X A;  3MKF A;  3W8K A;  5HWT A;  1IYS A;  1EW0 A;  3ZFZ A;  5FQQ A;  4GHI A;  1NLZ A;  1J3W A;  3RFB A;  2Y55 A;  2V9A A;  3BFG A;  3MZD A;  4Q0J A;  2WGV A;  5KSC A;  1FIK A;  4ZTK A;  1GHM A;  1Y28 A;  1S4R A;  4PM6 A;  3C4O A;  3G6O A;  3OBF A;  4I38 A;  2XGN A;  3H7W A;  3UDX A;  4P6Z M;  1C3B A;  2VX8 A;  4WN5 A;  2HJE A;  2Y2H A;  4QB8 A;  4PKY G;  4OPY A;  5HAI A;  4Y3I A;  2ZOI A;  3MQO A;  3VP1 A;  3KO6 A;  1K6S A;  1ERO A;  2Z6D A;  5E43 A;  2Z2L B;  4X69 A;  3EEH A;  2GZA A;  1NXY A;  1SCW A;  3LCE A;  2WAF A;  3UE0 A;  1LHY A;  1RP5 A;  3NDE A;  2J9O A;  2R9W A;  2JKG A;  3F1P A;  3IXG A;  2A49 A;  2CC1 A;  1G6O A;  2ZC4 B;  3SOI A;  3LYX A;  2ZL1 B;  3RH8 B;  1BLH A;  5GHX A;  1DRM A;  3PAE A;  4MDZ A;  4MN5 A;  3VP0 A;  2BG1 A;  2JHE A;  3G32 A;  3LI8 A;  1DJA A;  4K91 A;  1L2S A;  3W4O A;  2Y2J A;  4KQQ A;  3ZG5 A;  3F1O B;  4RQ9 A;  3VOZ A;  4O7D A;  3NUL A;  4LCM A;  3CUE A;  5HAR A;  5EOE A;  3T1S A;  4DJ3 A;  5DTS A;  3OZH A;  3FV7 A;  3FYZ A;  2ZM2 A;  1HLU P;  2EFX A;  1K4F A;  4O01 A;  1LSW A;  3FC7 A;  1H8M A;  1KVL A;  5CHM A;  2E8I A;  3BFC A;  1T19 A;  5EVI C;  3MFD A;  4LRY C;  1D06 A;  5AQA A;  2K31 A;  2B5R A;  3IXD A;  1O7E A;  2XRO A;  3JYI A;  5HDC A;  4X6T A;  3MMH A;  2R78 A;  3O3V A;  1QMF A;  4JXG A;  4PKY A;  2JN7 A;  3NCK A;  4Y5F A;  4JXW A;  3S1Y A;  2WKP A;  1W5D A;  4DE1 A;  3V3S A;  2ZQ9 A;  2RL3 A;  1DJC A;  1YQS A;  4OON A;  2B02 A;  4X68 A;  4C3Q A;  1YT4 A;  4KQR A;  2EX8 A;  4E3L A;  4EET B;  4K0X A;  3VP3 A;  1K6R A;  4P85 A;  4B4X A;  1GCE A;  3T1Q B;  5F83 A;  1GSW A;  1JTD A;  1DY6 A;  4ZDX A;  5KIZ A;  4GD8 A;  2PYR A;  1XXM A;  2JKT M;  5AQB A;  4L9E A;  4B9O A;  3UB8 A;  4K0W A;  2V1Z A;  5F82 A;  2XQZ A;  3GEC A;  3E2L A;  2P9V B;  1ES5 A;  4CPK A;  2Y8H A;  1KOU A;  3C7U A;  4C6Y A;  1PWG A;  4NG2 A;  3ZYT A;  1TS0 A;  1K54 A;  3BJN A;  5HX9 A;  2WKH A;  1GHP A;  1SKO A;  1Z09 A;  4HP9 A;  3MXS A;  4DE0 A;  3R7W B;  3ICY A;  1WA9 A;  3S4X A;  3UPO A;  1LL8 A;  3BLM A;  3Q7Z A;  3NC8 A;  3MJQ A;  3G2Y A;  4RA7 A;  1GA0 A;  4WMC D;  2WGW B;  3A3J A;  3IBR A;  3LIF A;  4A5R A;  2M7U A;  3E4O A;  4DE3 A;  4O0P A;  5AVE A;  5EVL A;  2VJW A;  3EGX C;  3EEA A;  1I5Q A;  2K2N A;  5EUA A;  1XFQ A;  5I94 A;  3QP4 A;  1N4O A;  4EWF A;  1JWV A;  3N8R A;  1JNU A;  3PBT A;  5AQ9 A;  2X71 A;  4NKP A;  4HEF A;  1Q2Q A;  2EXB A;  4N9K A;  4HES A;  1CEG A;  1WE4 A;  5KZH A;  4KZ4 A;  3T4T A;  3DTK A;  1IKG A;  3F1N A;  3Q07 A;  2H10 A;  3M6H A;  4IBR A;  3E0Y A;  4UA6 A;  3B33 A;  5EV0 A;  3M2J A;  2EA9 A;  2FFY A;  1NRF A;  4KUK A;  4BD1 A;  5HPI A;  1F9I A;  4NXG A;  1TVF A;  4KQO A;  4R70 A;  2L0W A;  2J9P A;  3WRT A;  5G4Y A;  1F5M A;  1S4S A;  1VEU B;  1BT5 A;  4KZ3 A;  5CRF A;  4D2O A;  5FQK A;  1OJG A;  3S7N A;  4E04 A;  2WUQ A;  3EGD C;  3NBL A;  1KE4 A;  3IQA A;  1Q2P A;  4S2N A;  3P09 A;  3L9K A;  5DF7 A;  2B95 A;  4GOG A;  3UE6 A;  1V9Z A;  3SH9 A;  1NZU A;  2C6W B;  3T50 A;  4JGP A;  1OTD A;  3SS4 A;  1D7E A;  3D3O A;  3M6B A;  2ACG A;  2Q9N A;  3FPV A;  4DF6 A;  4Y0U A;  5IS1 A;  2JCH A;  1YSP A;  1ACF A;  2DMW A;  2A24 B;  2WK0 A;  3SW1 A;  4YFM A;  1H0M A;  1BLP A;  2ZQD A;  4JXV A;  3G4P A;  3JPU A;  3KSI A;  3HRE A;  3CJM A;  2J3W A;  2E8J A;  4PM7 A;  4QY6 A;  4YNR A;  3LIB A;  2ZM0 A;  5TFQ A;  1ES2 A;  4I39 A;  5TGF A;  1MKI A;  5DFX A;  1OT9 A;  3I7J A;  1XJ2 A;  3HJI A;  1U60 A;  2Q9M A;  1S0W A;  1ESU A;  5EVE A;  1KGF A;  4KZ8 A;  3HLC A;  5IU1 A;  3UE1 A;  3LR0 A;  2BLS A;  3C38 A;  1K0K A;  4B93 A;  2HPB A;  2JBF A;  3NI9 A;  2XDM A;  1BUE A;  4C75 A;  5E2E A;  5HWW A;  1N9L A;  2WAD A;  4II7 A;  4HJ6 A;  3T4J A;  4CQH A;  1XKZ A;  3PAG A;  2WKE A;  3JVU A;  3HVF A;  1VET B;  3ZG7 B;  1ZKJ A;  2A2L A;  1FSY A;  2Y2G A;  5M18 A;  1IKI A;  1CI8 A;  5HW3 A;  1STZ A;  1MC0 A;  4JGO A;  1ES3 A;  1LSX A;  1RGZ A;  3S7P A;  4PHT A;  3H9W A;  2GJ3 A;  4LV2 A;  4S2O A;  4U0T A;  1NY0 A;  1FSW A;  3V50 A;  5DF9 A;  5GHY A;  2W3D A;  5EM1 A;  3GQZ A;  3GVB A;  5L8M A;  3CUE C;  4R4S A;  1LI0 A;  1YLP A;  5FEG A;  4QWO A;  3VV4 A;  3OPP A;  4S2K A;  4GD6 A;  3MFX A;  4HBU A;  5MC7 A;  4JPM A;  4QJG A;  4RVA A;  4MMN A;  4JGQ A;  1S66 L;  3LIE A;  5FI6 A;  1A0K A;  3R4K A;  3ZNY A;  4EW7 A;  3Q7V B;  4Y7P A;  3PTE A;  2ZL1 A;  2H0Y A;  1Z6F A;  4IUH A;  2V1B A;  3A0S A;  4JGR A;  2R9X A;  4Y17 A;  3T4O A;  3W4P A;  3RXW A;  3OPR A;  4BQM A;  3CI6 A;  5JYO A;  2QMI A;  1ONH A;  4R38 A;  4EBN A;  1K4E A;  1AXB A;  3ITA A;  3SH7 A;  5F6A A;  2Y91 A;  4WBG A;  2ZQA A;  2XFS A;  3DTI A;  4H6J B;  2PU2 A;  3QP6 A;  4CLC C;  1V9Y A;  1ERQ A;  2OV5 A;  3FPW A;  1TDG A;  3NOP C;  4ARZ B;  2HGV A;  3MQ0 A;  4JKT A;  3MKE A;  1XJ4 A;  4R4R A;  3MS6 A;  1TDL A;  2OAP 1;  3G35 A;  3A3E A;  4OQI A;  1BUL A;  5GHZ A;  1LI9 A;  2FZ0 A;  3LEZ A;  1XP4 A;  2JE5 A;  2JKT I;  4FH4 A;  5HDS A;  4F94 A;  3IS2 A;  3BFE A;  1H5X A;  3LIC A;  5GL9 A;  5F1G A;  2V1A A;  1K54 C;  3HLF A;  3MXR A;  5FL3 A;  5A90 A;  4I3I A;  2HDQ A;  5CED A;  2RCX A;  4OOY A;  1H3Q A;  2H0T A;  4KG2 A;  4Z1W A;  2WKI A;  1S1Z A;  5HDD A;  2XH9 A;  1PI5 A;  4O8G A;  3UY6 A;  4GNU A;  4EUZ A;  5HSQ A;  2IWB A;  3UDI A;  2O0Y A;  1LL9 A;  3ZGA B;  3MQQ A;  2H5S A;  4YOF A;  4BL3 A;  4FOF A;  4FSF A;  3G34 A;  5IT5 A;  5JYP A;  4JLF A;  5TBM A;  4PAU A;  4AFI A;  4BD0 A;  1ZTU A;  4OPQ A;  5CHJ A;  3DBA A;  5G18 A;  4KQD A;  4S2M A;  2HF6 A;  5L10 A;  2QKP A;  4N1H A;  4L9F A;  3CPT B;  4LRZ E;  3IWQ A;  5L07 A;  3G2Z A;  3PR6 A;  1P97 A;  1LSV A;  3WS5 A;  5EPH A;  3BEB A;  3A3I A;  5EOO A;  4IHQ A;  4EBP A;  2H28 A;  4IBX A;  3N4I A;  3DTM A;  2IA2 A;  2QZ6 A;  3BWL A;  3R7W A;  2VEA A;  3ZVW A;  4OP5 A;  2Z2M B;  1PWD A;  3HUO A;  2P08 A;  3ZG8 B;  4Q8I A;  4IJG A;  2WGW A;  4G3V A;  5J3W A;  2XA7 M;  5J7E A;  4ETX A;  4GB7 A;  1GSV A;  3SH8 A;  1ESI A;  3IXH A;  2QYB A;  4IED A;  1E3U A;  3EQU A;  5DKL A;  4S2N C;  3VP4 A;  1ODV A;  1S6R A;  4PM5 A;  1G68 A;  1KGG A;  4FUW A;  4R3A A;  3IX3 A;  2EFU A;  3IHA A;  2DRW A;  3A3F A;  2OLU A;  3CIT A;  1NWZ A;  3MSH A;  5HD3 A;  4OVD A;  3C8C A;  2VA0 A;  1YKD A;  1MZU A;  4OLD A;  4NXB A;  2X01 A;  2HV1 A;  5HWV A;  4HNB A;  2W1T B;  3LY4 A;  4E6X A;  4JF6 A;  2PBY A;  1MY8 A;  1CJF A;  3IH9 A;  5LBR A;  3O87 A;  4KZB A;  4CLC A;  1PIO A;  2WZZ A;  5FAS A;  3QNC A;  3H7W B;  1VEU A;  2D01 A;  3PXP A;  1T18 A;  3NOT C;  4BBV A;  4M4X A;  4Y0T A;  4WF0 A;  2QHK A;  3UB9 A;  2HP9 A;  2L4R A;  4IUK A;  4FCF A;  3Q1F A;  1FCM A;  1MWT A;  4XT2 B;  4X25 A;  5CGX A;  1K56 A;  4LEN A;  5GLD A;  1VM1 A;  5CTM A;  2ZLY A;  2X02 A;  4MBK A;  4DDY A;  2CMN A;  4BL2 A;  3BQ8 A;  1YLY A;  3ZNT A;  3FZC A;  3DW0 A;  4OQG A;  2VZW A;  4Z9Q A;  3A3D A;  2WZX A;  5HZH A;  2ZMA A;  1DJB A;  5FA7 A;  3BYD A;  5FDH A;  4R23 A;  1JWP A;  4X1M A;  2WGI A;  2PU4 A;  4ZAM A;  1T1A A;  2ZMF A;  1YMS A;  4EV4 A;  4GDN A;  1PWC A;  3WS4 A;  1G5U A;  4KUO A;  1YLJ A;  4LCL A;  1P0Z A;  1I2W A;  1XA7 A;  4Q0H A;  4RX3 A;  1TS6 A;  1PYY A;  2W3E A;  4K08 A;  3OLO A;  4JF4 A;  4EQ1 A;  5EE8 A;  1LLB A;  4WZ4 A;  4MN7 A;  4S2L A;  4MCW A;  3SS3 A;  2G2W A;  2J80 A;  1PW8 A;  1YPR A;  3IF6 B;  2NUT C;  3ULF A;  5CXW A;  2PRF A;  3CWF A;  2V2F F;  3SS5 A;  3C4P A;  2QJ5 A;  4E3I A;  4B88 A;  4EEU A;  2WAE A;  2LB5 A;  4FTX A;  1PNE A;  1E3U D;  5EM0 A;  1VET A;  1DP6 A;  3VSK A;  1YMX A;  3BRM A;  1M6K A;  1YLT A;  3UB5 P;  2QPN A;  1FQG A;  4B4Z A;  4Y13 A;  4EES A;  2YKF A;  1CEF A;  4QPR A;  3BFF A;  3WWX A;  4QD4 A;  2ZC7 A;  1SHV A;  4OQH A;  4QY5 A;  1L0G A;  2VV6 A;  1PW1 A;  3JVV A;  3IH8 A;  2XD5 A;  3MBZ A;  2V20 A;  3CHW P;  2V0W A;  4LGW A;  2GNX A;  3UNW A;  3VOY A;  2ZQC A;  1OTA A;  2A3U A;  4R3B A;  5HL1 A;  4Y2F A;  3V67 A;  3LGO A;  4JXS A;  3GV9 A;  2EWV A;  4HHD A;  1GA9 A;  2P04 A;  4DXB A;  4CLC D;  2EX9 A;  5A8B A;  1KDW A;  3H82 B;  3T1X A;  1EI5 A;  3P01 A;  2W1R A;  3V5M A;  1JWZ A;  3Q7V A;  4ZJ2 A;  4KZ7 A;  1GHI A;  3WRZ A;  5CX7 A;  3N8L A;  1XA1 A;  1MKM A;  3HLG A;  1FCO A;  3QP1 A;  4BBU A;  3KYQ A;  1CF0 A;  4ETZ A;  3PBR A;  2QWS A;  1K56 D;  4G3W A;  1NZO A;  4EXO A;  3UO9 A;  4Q0I A;  2XFT A;  3C2W A;  1BZA A;  5A93 A;  4OPZ A;  4WZ5 A;  2Y79 A;  1E25 A;  2W3F A;  3HL9 A;  5GLB A;  3K2N A;  3BY8 A;  4ME4 A;  1SDN A;  4GJ4 A;  4E3O A;  5EEC A;  4EU0 A;  4WEK A;  2J8Y A;  1TS7 A;  1HZO A;  2Y2I A;  4DN0 A;  1HTZ A;  3B42 A;  4H6J A;  4MBH A;  3NIA A;  3O5Y A;  2D02 A;  4ZRR A;  5U47 A;  3U2A A;  4ARZ A;  3BLS A;  4HJ4 A;  2EXA A;  3ZDJ A;  3UPP A;  2UV0 E;  3LR3 A;  4E3J A;  1ONG A;  5F68 A;  4MLL A;  2OLV A;  1YLZ A;  4LLO B;  3TJZ C;  1P9R A;  3S7O A;  4HH3 A;  5CEC A;  2P74 A;  3NY4 A;  3PBN A;  2EX2 A;  3Q81 A;  1RGY A;  3TG9 A;  2AVX A;  3VE4 A;  5I5L A;  4DE2 A;  4UEY A;  3P7N A;  3NHQ A;  1JTG A;  4PPR A;  2OWH A;  2ZC6 B;  4YIN A;  4GDB A;  2OWJ A;  2W27 A;  1UWP X;  3RXX A;  2WYX A;  1FOF A;  1XJ3 A;  1PFL A;  5EVI B;  1FCN A;  5GLA A;  1ZC2 A;  3V39 A;  1UWN X;  5FQ9 A;  2O9C A;  3ZHH A;  2ZC5 B;  2UWX A;  1PI4 A;  5K5B A;  2WKR A;  2HZ5 A;  1KE0 A;  2ZM8 A;  3RJU A;  2KOI A;  4LPZ A;  2ZBB A;  4KEN B;  5CER A;  1OME A;  3BQA A;  5FSR A;  3P98 A;  2G7U A;  5FI2 A;  3CPT A;  3QNB A;  2VGL M;  1XGJ A;  4M3K A;  1EWZ A;  1O07 A;  1E4D A;  1BLC A;  3T4K A;  3T4Q A;  1T1C A;  3BW6 A;  5FEF A;  3TE8 A;  5L2F A;  3F1O A;  4FH2 A;  1IEM A;  3C7V A;  2IWC A;  4ZJ1 A;  4E6W A;  2HP6 A;  2NUP C;  1L0F A;  4XUZ A;  1SDE A;  3T1R A;  4HI4 A;  3PBQ A;  3M2K A;  4I3J A;  3LY3 A;  4OKP A;  3ZCZ A;  4HH2 A;  5F5Y A;  4EER A;  3DTE A;  2K7S A;  4DRT A;  1GSX A;  3C30 A;  4HOI A;  3VMA A;  4UQI M;  2XA7 S;  3LID A;  2P7J A;  3IBJ A;  3HUN A;  5DF8 A;  3DWZ A;  1I2S A;  3VFF A;  4E3K A;  3O86 A;  3OOV A;  3GR2 A;  2FFF B;  3ZG0 A;  2W1T A;  3NJA A;  1ES4 A;  3LEQ A;  5TJJ A;  1Y54 A;  3CAX A;  3N8S A;  1L0E A;  3LO7 A;  4R1G A;  5FAO A;  4BJP A;  1KGE A;  2Y2N A;  4R6L A;  1MWS A;  2O99 A;  2BAS A;  2Y2O A;  1TS8 A;  2JKR M;  5KMW A;  2Y2L A;  4KZ6 A;  5D3O A;  4GZB A;  4GW9 A;  4KG6 A;  4EEP A;  3N7W A;  1K57 A;  4XT2 A;  1XPB A;  1TD5 A;  2P9V A;  2Q0O A;  1JVJ A;  4X56 A;  1VQQ A;  3TRC A;  3UE3 A;  1FIL A;  1PZP A;  3D72 A;  1KDS A;  2O9A A;  1W79 A;  3IHB A;  5HD5 A;  4HY8 A;  1BSG A;  1Y4O A;  1N9O A;  4NET A;  3BEC A;  4WMC A;  4LRX C;  4UA7 A;  3UB6 A;  1QME A;  2PR6 A;  1G28 A;  5FI7 A;  3G31 A;  4OPR A;  3VOL A;  4GS9 B;  1L0D A;  3HLW A;  1W8Y A;  5CHU A;  1IYO A;  3A0V A;  4S2J A;  3MZE A;  2DCF A;  2V8F A;  1XGI A;  3EQV A;  1OPX A;  4XUX A;  3QP2 A;  4DMZ A;  3QP8 A;  4L0L A;  4OQ0 A;  1LT0 A;  2XR0 A;  4GN2 A;  4I5S A;  5DVA A;  2I72 A;  2HP5 A;  5F69 A;  3IF6 A;  1IEL A;  1YSQ A;  4QU3 A;  4F3L B;  4N1X A;  3FKV A;  4KZ5 A;  2VV8 A;  4E3N A;  3HLB A;  4GHI B;  3IS2 B;  1PZO A;  4CJN A;  4P87 A;  2YKH A;  3WS1 A; 
#chains in the Genus database with same CATH homology
 1YM1 A;  3HVF A;  1WYC A;  3ZG7 B;  1E3U D;  1ZKJ A;  2Y55 A;  3BFG A;  3MZD A;  3VSK A;  1FSY A;  2Y2G A;  5CTN A;  1YMX A;  3W4Q A;  2WGV A;  5M18 A;  3AGD A;  1IKI A;  5KSC A;  4PM9 A;  2Y2K A;  1CI8 A;  3AGE A;  3BRM A;  1KVM A;  2Y2M A;  5HW3 A;  1M6K A;  4ZTK A;  1ES3 A;  1YLT A;  1RGZ A;  1GHM A;  5CGS A;  1KE3 A;  2QPN A;  4PM6 A;  3C4O A;  4R3J A;  3IWI A;  1FQG A;  4LV2 A;  4B4Z A;  4S2O A;  2XGN A;  3UDX A;  4U0T A;  2ZQ8 A;  1CEF A;  1NY0 A;  1FSW A;  2XD1 A;  3V50 A;  5DF9 A;  1C3B A;  3OC2 A;  3BFF A;  4RX2 A;  4WM9 A;  3WWX A;  2Y2H A;  4P6B A;  1IYQ A;  2ZC7 A;  1SHV A;  1TEM A;  4QB8 A;  4QD4 A;  4WYY A;  4NK3 A;  3GSG A;  4OQH A;  5GHY A;  4QY5 A;  4OPY A;  4WZ5 C;  1L0G A;  3GQZ A;  3GRJ A;  3GVB A;  5HAI A;  2XK1 A;  3HLD A;  5FAT A;  1PW1 A;  3D4F A;  4R4S A;  4DDS A;  3IH8 A;  3VP1 A;  1LI0 A;  1K6S A;  2XD5 A;  3MBZ A;  1ERO A;  2V20 A;  3G30 A;  5A92 A;  5E43 A;  2GDN A;  1YLP A;  5FQM A;  3UNW A;  3S22 A;  3VSL A;  2Z2L B;  5CEB A;  3OPP A;  3VOY A;  4X69 A;  2ZC3 B;  2ZQC A;  1NXY A;  2A3U A;  3ITB A;  4S2K A;  1SCW A;  3LCE A;  4GD6 A;  2WAF A;  5TR7 A;  4R3B A;  3GMW A;  1LHY A;  1NJ4 A;  1RP5 A;  4HBU A;  3UE0 A;  5HL1 A;  4JXS A;  3V3R A;  3NDE A;  2J9O A;  3GV9 A;  2R9W A;  5J8X A;  1GA9 A;  4DXB A;  5GLC A;  4JPM A;  3O88 A;  4QJG A;  4RVA A;  2EX9 A;  5FAP A;  1N9B A;  1KDW A;  2A49 A;  3IXG A;  3PBO A;  2CC1 A;  2ZC4 B;  1EI5 A;  5FI6 A;  3SOI A;  1K38 A;  3ZNY A;  3Q7V B;  3MZF A;  4Y7P A;  3PTE A;  1BLH A;  5GHX A;  3V5M A;  1JWZ A;  2H0Y A;  3Q7V A;  1Z6F A;  2OSU A;  4ZJ2 A;  4KZ7 A;  3PAE A;  1GHI A;  4X55 A;  1LL5 A;  3WRZ A;  4OOL A;  3N8L A;  5FQJ A;  1XA1 A;  3VP0 A;  4KG5 A;  2BG1 A;  3G32 A;  2Y59 A;  3HLG A;  1FCO A;  2G2U A;  1WYB A;  2Y2Q A;  1DJA A;  4KZ9 A;  4K91 A;  4UA9 A;  2R9X A;  1K55 C;  2JC7 A;  1L2S A;  3W4O A;  3W4P A;  2Y2J A;  3PBR A;  4KQQ A;  3RXW A;  3CG5 A;  3OPR A;  1K56 D;  3ZG5 A;  1NZO A;  4BQM A;  5JYO A;  2QMI A;  3UO9 A;  1ONH A;  3VOZ A;  2XFT A;  1BLS A;  3OCN A;  4EBN A;  2ZD8 A;  1BZA A;  5A93 A;  5E2G A;  1K4E A;  5M19 A;  1AXB A;  4OPZ A;  4O7D A;  3ITA A;  4WZ5 A;  1E25 A;  3HL9 A;  5GLB A;  3SH7 A;  4LCM A;  5HAR A;  5EOE A;  5KSH A;  1SDN A;  4E3O A;  2Y91 A;  5EEC A;  5DTS A;  4WBG A;  3OZH A;  4WEK A;  2J8Y A;  1H8Y A;  3FV7 A;  3FYZ A;  1HZO A;  4ZJ3 A;  2ZM2 A;  2XFS A;  2ZQA A;  2Y2I A;  2EFX A;  2PU2 A;  1HTZ A;  1K4F A;  1ERQ A;  2OV5 A;  4MBH A;  1TDG A;  3NIA A;  3IF5 A;  5U47 A;  1KVL A;  4JKT A;  5CHM A;  2E8I A;  3BFC A;  3MKE A;  5DTT A;  5EVI C;  5IHV A;  3BLS A;  4R4R A;  1TDL A;  3MFD A;  5AQ7 A;  3G35 A;  5AQA A;  3GTC A;  3A3E A;  1NYM A;  4OQI A;  4Y0O A;  2B5R A;  3FWL A;  1BUL A;  2EXA A;  3IXD A;  1LI9 A;  1O7E A;  3LEZ A;  5GHZ A;  3ZDJ A;  3JYI A;  3UPP A;  1XP4 A;  2JE5 A;  4FH4 A;  2IWD A;  4X6T A;  4E3J A;  5CGW A;  1ONG A;  3O3V A;  3UN7 A;  3BFE A;  4GKU A;  4F94 A;  4MLL A;  1H5X A;  1QMF A;  1YLZ A;  2OLV A;  3ZVT A;  4JXG A;  4ZBE A;  4BEN A;  5GL9 A;  3NCK A;  5HFO A;  4JXW A;  5F1G A;  3S1Y A;  4ID4 A;  1K54 C;  3HLF A;  3MXR A;  5CEC A;  1W5D A;  5A90 A;  2HDQ A;  4DE1 A;  2P74 A;  5CED A;  3V3S A;  3NY4 A;  2RCX A;  4DXC A;  2ZQ9 A;  2RL3 A;  1DJC A;  4OOY A;  1YQS A;  4OON A;  3PBN A;  2EX2 A;  2H0T A;  1HVB A;  3Q81 A;  4KG2 A;  1RGY A;  3FKW A;  3CZD A;  4X68 A;  2WKI A;  4C3Q A;  3TG9 A;  1YT4 A;  4KQR A;  4DE2 A;  2XH9 A;  1JTG A;  1MBL A;  1PI5 A;  2EX8 A;  4PPR A;  4QHC A;  4E3L A;  2ZC6 B;  4JBF A;  4K0X A;  4GNU A;  3UY6 A;  4EUZ A;  4P0M A;  3VP3 A;  1K6R A;  4P85 A;  4YIN A;  4B4X A;  1GCE A;  4GDB A;  2VGJ A;  3RXX A;  2IWB A;  3UDI A;  1ALQ A;  1W8Q A;  2HDR A;  2WYX A;  3TSG A;  5F83 A;  1FOF A;  1JTD A;  1LL9 A;  1DY6 A;  3ZGA B;  5EVI B;  5DTK A;  4ZDX A;  2H5S A;  1FCN A;  5EVI A;  5GLA A;  3E2K A;  1ZC2 A;  3V39 A;  4BL3 A;  4GD8 A;  1XXM A;  4FSF A;  5AQB A;  5FQ9 A;  3G34 A;  3ZHH A;  2ZC5 B;  2UWX A;  4K0W A;  1PI4 A;  2V1Z A;  5JYP A;  4JLF A;  5A91 A;  3HUM A;  1W7F A;  3BFD A;  1KE0 A;  2ZM8 A;  3RJU A;  1HD8 A;  5F82 A;  2XQZ A;  3TOI A;  3E2L A;  3WS2 A;  2P9V B;  1FR1 A;  4KEN B;  1ES5 A;  5CER A;  1OME A;  4BD0 A;  4CPK A;  4HBT A;  4OPQ A;  5CHJ A;  3VP2 A;  5G18 A;  5FSR A;  3P98 A;  3C7U A;  4OH0 A;  4S2M A;  4C6Y A;  4N1H A;  3OPL A;  1PWG A;  3WS0 A;  1K54 A;  5FI2 A;  5HX9 A;  3IWQ A;  2WKH A;  4E3M A;  4N92 A;  3G2Z A;  4KZA A;  3QNB A;  3WS5 A;  1GHP A;  5EPH A;  3BEB A;  3A3I A;  5EOO A;  1XGJ A;  4M3K A;  1EWZ A;  1O07 A;  4EBP A;  1E4D A;  1BLC A;  3MXS A;  4IBX A;  3Q82 A;  3N4I A;  4DE0 A;  2DNS A;  3DTM A;  2QZ6 A;  4R0Q A;  4LV3 A;  5L2F A;  3S4X A;  1IYP A;  3UPO A;  4FH2 A;  3ZVW A;  2HDS A;  3BLM A;  2Z2M B;  4OP5 A;  4OOM A;  1IEM A;  1PWD A;  3C7V A;  3Q7Z A;  1CI9 A;  1XX2 A;  3HLE A;  3G2Y A;  3NC8 A;  3HUO A;  4RA7 A;  2IWC A;  2XLN A;  3BM6 A;  3HBR A;  3ZG8 B;  1GA0 A;  3OCL A;  2WGW B;  2XF3 A;  4WMC D;  4OLG A;  4ZJ1 A;  4E6W A;  4Q8I A;  3A3J A;  2HP6 A;  2WGW A;  1ERM A;  4MEZ A;  5M1A A;  1L0F A;  4XUZ A;  4A5R A;  1SDE A;  3ISG A;  4RYE A;  2HDU A;  3PBQ A;  1MXO A;  4GB7 A;  4DE3 A;  3M2K A;  5EVL A;  3SH8 A;  1ESI A;  3IXH A;  4BLM A;  1I5Q A;  1E3U A;  3EQU A;  4IED A;  1ZG6 A;  3IT9 A;  5EUA A;  4S2N C;  5I94 A;  3LY3 A;  3VP4 A;  1N4O A;  1S6R A;  3N6I A;  3B3X A;  2Y2P A;  4PM5 A;  1G68 A;  4OKP A;  4EWF A;  1KGG A;  1JWV A;  3N8R A;  3PBT A;  1K57 C;  3ZCZ A;  5AQ9 A;  1K25 A;  2EFU A;  2X71 A;  3IHA A;  1MWR A;  2DRW A;  1M40 A;  3A3F A;  2OLU A;  4HEF A;  1Q2Q A;  4DRT A;  3VMA A;  2EXB A;  4WEL A;  4N9K A;  4OVD A;  4HES A;  1CEG A;  1WE4 A;  3HUN A;  5KZH A;  5DF8 A;  2C5W B;  1I2S A;  3DWZ A;  3VFF A;  1K55 A;  4KZ4 A;  1IKG A;  4E3K A;  4OLD A;  3O86 A;  2X01 A;  3ZG9 B;  3AGF A;  4U3T A;  1J9M A;  3GR2 A;  2FFF B;  3ZG0 A;  3Q07 A;  3LY4 A;  2H10 A;  3M6H A;  4E6X A;  1H8Z A;  4LV1 A;  4PM8 A;  4IBR A;  1ES4 A;  4UA6 A;  3M2J A;  4JF6 A;  2PBY A;  1MY8 A;  4PMA A;  2FFY A;  1NRF A;  4BD1 A;  4WEJ A;  1Y54 A;  3IH9 A;  1TVF A;  4S2P A;  4KQO A;  3N8S A;  3O87 A;  1YLW A;  1L0E A;  2J9P A;  3WRT A;  4KZB A;  3LO7 A;  1CK3 A;  4R1G A;  5FAO A;  4BJP A;  3DWK A;  1KGE A;  2Y2N A;  1PIO A;  4LV0 A;  2WZZ A;  5FAS A;  1BT5 A;  3QNC A;  4KZ3 A;  4UAA A;  5CRF A;  4D2O A;  1MWS A;  5FQK A;  5HAP A;  2Y2O A;  2WUQ A;  4Y0T A;  2XEP A;  3NBL A;  5BOH A;  4X53 A;  4MBF A;  1KE4 A;  4IVI A;  3IQA A;  1Q2P A;  4S2N A;  3P09 A;  5KMW A;  2Y2L A;  2HP9 A;  5DF7 A;  4KZ6 A;  5D3O A;  3C5A A;  4GZB A;  4FCF A;  4GOG A;  3VFH A;  3OPH A;  1FCM A;  3Q1F A;  4KG6 A;  1MWT A;  4MNR A;  5FAQ A;  3N7W A;  5FQI A;  3SH9 A;  4N9L A;  1K57 A;  1XPB A;  5F1F A;  1NZU A;  2P9V A;  4S2I A;  5CGX A;  2ZQ7 A;  1JVJ A;  4X56 A;  1K56 A;  2C6W B;  1VQQ A;  2ZJ9 A;  4LEN A;  2EX6 A;  5GLD A;  3UE3 A;  1VM1 A;  5CTM A;  4H8R A;  1PZP A;  3SS4 A;  4XXR A;  1KDS A;  3M6B A;  2ZLY A;  3IF6 C;  2X02 A;  4MBK A;  2Q9N A;  4DF6 A;  1W79 A;  4Y0U A;  4DDY A;  3IHB A;  1BSG A;  2JCH A;  4BL2 A;  4NET A;  4EQI A;  1YLY A;  3BEC A;  5EVI D;  3ZNT A;  4WMC A;  3FZC A;  4UA7 A;  3DW0 A;  4OQG A;  3UDF A;  3IXB A;  1QME A;  4IVK A;  4Z9Q A;  5FI7 A;  3A3D A;  2WZX A;  2WK0 A;  2ZMA A;  4YFM A;  2J7V A;  1FR6 A;  1DJB A;  5FA7 A;  1BLP A;  2ZQD A;  3G31 A;  4OPR A;  3QHY A;  2Y4A A;  3BYD A;  4JXV A;  3G4P A;  5FDH A;  3NDG A;  4R23 A;  1JWP A;  1L0D A;  3HLW A;  1W8Y A;  2VGK A;  2WGI A;  5CHU A;  1IYO A;  2PU4 A;  3HRE A;  3CJM A;  4UHU A;  4ZAM A;  4DKI A;  4PM7 A;  4QY6 A;  1MWU A;  4S2J A;  3MZE A;  2DCF A;  1YMS A;  5HAQ A;  4EV4 A;  1XGI A;  4GDN A;  2ZM0 A;  5TFQ A;  1ES2 A;  3EQV A;  5TGF A;  1MKI A;  1PWC A;  5E2F A;  4XUX A;  3I7J A;  3WS4 A;  1ZG4 A;  3CMZ A;  1U60 A;  2Q9M A;  1YLJ A;  4L0L A;  1S0W A;  1ESU A;  3IWO A;  4JF5 A;  4LCL A;  4OQ0 A;  5E2H A;  1I2W A;  1KGF A;  2XR0 A;  3HLC A;  4FD8 A;  1XA7 A;  4KZ8 A;  4GN2 A;  4OP8 A;  4RX3 A;  3UE1 A;  1PYY A;  1NYY A;  4JF4 A;  5DVA A;  5EE8 A;  2BLS A;  2I72 A;  1LLB A;  4WZ4 A;  2HP5 A;  2HPB A;  1G6A A;  4S2L A;  2JBF A;  3SS3 A;  2G2W A;  1PW8 A;  3NI9 A;  3IF6 B;  2XDM A;  1BUE A;  5CXW A;  4EBL A;  3IF6 A;  4C75 A;  1IEL A;  1BTL A;  1MPL A;  4QU3 A;  5E2E A;  1RCJ A;  4N1X A;  3PBS A;  2V2F F;  2WAD A;  3SS5 A;  3UPN A;  3C4P A;  3FKV A;  4KZ5 A;  4E3N A;  4E3I A;  1SKF A;  3HLB A;  4U0X A;  4B88 A;  3MKF A;  1XKZ A;  3W8K A;  1IYS A;  3ZFZ A;  1PZO A;  5FQQ A;  4CJN A;  3PAG A;  4P87 A;  3WS1 A;  2WKE A;  2WAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...