3JPUA

Lasr-tp4 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
161
structure length
161
Chain Sequence
GFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENRAEANRFMESVLPTLWMLKDYALQSGAGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional activator protein lasR
publication title Molecular basis for the recognition of structurally distinct autoinducer mimics by the Pseudomonas aeruginosa LasR quorum-sensing signaling receptor.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 52
structure length 161
sequence length 161
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3jpuA00
3QP2A 4LFUA 3QP4A 2Q0OA 3QP8A 4Y17A 4Y15A 1L3LA 5L07A 3QP5A 2AVXA 5L10A 5L09A 3QP6A 4NG2A 3SZTA 2UV0E 4LGWA 4Y13A 3IX3A 3IX4A 3QP1A 3JPUA 1H0MA 3IX8A
chains in the Genus database with same CATH superfamily
2ZMVA 1LSXA 1WYBA 5HZHA 1FCMA 3LCEA 5GLBA 1UWNX 4GHIB 1WYCA 3Q7ZA 1W8QA 4HJ4A 5CHJA 3BW6A 3Q1FA 4G3WA 4Y3IA 1CI8A 4NXEA 1TD5A 2W3DA 1Z6FA 2WKHA 4R6LA 5DFXA 1NYMA 2HDQA 3NDEA 1L3LA 3IT9A 2OWJA 3CUEC 1K56A 2PR5A 3T12B 3A3IA 3MFXA 5L2FA 2XD1A 1LT0A 4BD1A 4FTXA 4BD0A 4WEJA 4JF5A 1PWGA 3MSHA 4C6YA 1O7EA 3HLDA 3A3JA 1CJFA 4ZBEA 2Y2HA 2R78A 5FAPA 1F5MA 2O9CA 2HP5A 3BWLA 2XD5A 2A3UA 4NG2A 5M18A 5TR7A 3LYXA 2YKFA 4FCFA 2UWXA 4JGPA 1K57C 2XLNA 4PPRA 4ARZB 4R4SA 5CERA 3R4KA 2PYRA 4GS9A 1E4DA 3PBNA 4WM9A 2Y2GA 5CGXA 4WBGA 1OJGA 5FATA 5L10A 5D3OA 1NRJA 3FZCA 1TDLA 3GMWA 4KZBA 5EPHA 2FFYA 3DAVA 3BFDA 3LI9A 2PT7A 2JHEA 1XP4A 3UB9A 4PM7A 3O87A 4S2MA 3UMDA 2ZC3B 4EETB 2W3FA 4BWIA 3VP4A 1OTEA 3BFCA 1EROA 1XKZA 1GSWA 5KSCA 4HY8A 4E3KA 3IF6B 4A5RA 1ODVA 2JKTI 3O3VA 4I3IA 1OTAA 2XDMA 1DRMA 1HD8A 4JPMA 2I72A 2W0NA 3LY4A 4GN2A 4DF6A 1K56D 1KE3A 2IWCA 4UA9A 1W79A 4E3IA 1ALQA 2PU4A 3ITBA 2K31A 4OLGA 1FR1A 4UHUA 4Q0JA 3MR0A 1PWDA 1P97A 3NCKA 2KOIA 4KZ3A 3LR5A 2O9BA 3OPLA 2Y2MA 2OWHA 3IWOA 3IX8A 1NY0A 4EWFA 3VFHA 4FD8A 5G4ZA 2WGWA 2QZ6A 5EVIB 1KGGA 3S7PA 4HH2A 3AGEA 1ZHHB 1FILA 3MFDA 2JE5A 3H82A 4HHDA 3HLWA 4BMWA 4JF6A 3LI8A 3F1NA 3T4QA 3V5MA 3ZVTA 1QMFA 3MQOA 1JTDA 1YMXA 2WKEA 4MDZA 2ACGA 2XROA 2G2UA 2HV1A 2Z2MB 3CJMA 4MMNA 3NC8A 3KYZA 4DE2A 1GA0A 1HVBA 4E3NA 2XGNA 5L09A 1KDSA 1KVLA 1GCEA 3M2KA 4NEED 1T1AA 5DJTA 4C75A 5DJUA 5HAPA 2B02A 2P9VB 2B5RA 2Y8HA 3PBTA 1RCJA 3CPTA 1KE0A 3IHAA 4S2KA 2QPNA 2WUQA 4ZRRA 3V50A 3P98A 1NYYA 1W8YA 3P09A 1PYYA 3KX0X 1ES5A 1N9LA 1AWIA 1NLYA 4FSFA 2XR0A 3E2LA 1PIOA 4LRZE 4EU0A 2ZL1A 3UDIA 3T4JA 2B18A 2GJ3A 2J80A 4O0PA 2A49A 3VV4A 1YQSA 2EFUA 4H6JA 4P6BA 5FQ9A 5IHVA 3C38A 2QKPA 1T19A 5J4EA 1G6OA 3MZDA 5CTMA 3B47A 3HVFA 2Y2OA 3D9YA 3FC7A 4QY5A 2JKRI 3UO9A 2VGLM 4RQ9A 3QP8A 4QD4A 3S7OA 4P6ZS 3D3OA 1PZPA 4IHQA 4DRTA 3IQAA 4MN6A 5EOOA 4RA7A 2Y59A 3TOIA 1SCWA 1XXMA 4G3VA 5KZHA 2WAEA 4GLQA 1SHVA 2P04A 2IA2A 3K3CA 5EUAA 3CLOA 4EV4A 4Y15A 5DFYA 1BLPA 5L07A 4ZDXA 3DTIA 2JN7A 2Y2IA 3K3DA 3U2AA 1SDEA 2QJ7A 1SKOA 3SS3A 5GHXA 2Z6CA 3ZNYA 3BRMA 3B42A 3HLEA 1S4SA 3OBFA 3KSGA 4GJ4A 3CITA 3NOTC 4FUWA 4R1GA 2J7VA 4GKUA 3NHQA 4R3AA 2PD7A 1DP6A 2CMNA 5HFOA 4EBNA 2WADA 5EM1A 3BFGA 2VA0A 3PBQA 1VEUA 1IFQA 1JVJA 2WKRA 4F3LB 4XUXA 4N9KA 4IBXA 4EEUA 3JVVA 3QP4A 5DTTA 3TW8A 2DMWA 2OV5A 4HEFA 4Y7PA 1W5DA 2G7UA 1I2WA 4Z9QA 1YSQA 3QP2A 1ERQA 3NBLA 1YLYA 4UQIM 4EXOA 1SDNA 3E4QA 4GDBA 1XX2A 5GLCA 3Q81A 4EW7A 4S2LA 5KSHA 2EX6A 3WS5A 4CLCE 5CECA 3D4FA 4DE3A 4BBTA 3Q7VA 3UE0A 5TBMA 1K38A 2W3HA 3WS0A 2HDUA 1NJ4A 4WN5A 4EESA 1VQQA 4NK3A 4QU3A 5HPFA 2XH9A 1MPLA 1ACFA 1CI9A 1YLTA 3PXPA 3ZDJA 3HJKA 5F6AA 2W3GA 1D7EA 1NZOA 1BZAA 3OPPA 3GSGA 2ZMFA 3V67A 2VKSA 4II7A 4EQIA 2QYBA 4B88A 2ZC5B 2V0UA 1P9RA 2WKIA 1ONGA 2XFTA 1JWPA 4DE0A 3CG5A 1W63Q 3N8SA 2E8JA 4K08A 3UE3A 1VETA 4OPZA 1T18A 2Y2NA 1LSWA 2VX8A 2ZMAA 4LV3A 5EFWA 3UDXA 3VOYA 4X1LA 3ZCZA 4Y2FA 4GD8A 1P9WA 3MQQA 2WYXA 1G5UA 5HAQA 1XJ6A 2Q9NA 4HP9A 5FASA 4EQ1A 1FSYA 5JYPA 1O07A 3HLGA 3GECA 2UV0E 1OTBA 1KOUA 3T1QB 2R9XA 4YFMA 1GHPA 4GHIA 4NETA 3ZG7B 1LL9A 1K54A 3PAEA 5CHMA 1LI0A 3C7VA 5AQ7A 4JLFA 2ZC7A 3DWZA 2VV8A 4JBFA 1PRQA 3OCLA 1ZTUA 4L9FA 4KQQA 1I5QA 4CLCB 2EX9A 3W4PA 5AVFA 4IVIA 1EWZA 4I38A 4R38A 1F98A 2J9PA 1MWTA 5MC7A 4KENB 3MF0A 2V2FF 1KVMA 3QNCA 4F94A 5F68A 2M7UA 4IUHA 4KZ5A 4L9EA 1MKIA 4EEPA 5A92A 3JYIA 2C6WB 4LLOB 4BQMA 5E2EA 5DF7A 4DN0A 2HPBA 2C5WB 4PM9A 2INWA 1ERMA 5HDSA 3QHYA 4ARZA 2P74A 4RX3A 4OQ0A 4Y0UA 1JTGA 3MZFA 4OVDA 1K54C 1J3WA 3CMZA 3ITAA 4PM6A 5CGSA 4EUZA 5GLAA 5EOEA 2RL3A 3VP1A 1WA9A 2EA9A 4OQHA 3LEQA 3UE6A 1MC0A 5TGFA 4HBUA 1CEGA 1UGUA 1L0FA 2OOLA 2G2WA 3BQAA 4RYEA 4JXVA 5KMWA 3V3RA 2QMIA 3IF6A 5HWVA 5FDHA 4EBLA 4LGWA 1L0GA 2EXBA 4MBKA 3L9KA 2W1RA 2WGIA 3E98A 4OONA 2Y79A 1PWCA 1BYWA 5IU1A 3BM6A 4GDNA 4Y17A 1XJ4A 3NI9A 4UA6A 2EXAA 1K55A 2V1BA 5HWTA 3WS1A 2H0TA 5EECA 1K4FA 4DXBA 3LUQA 3T4KA 1L0DA 1GHMA 3UPOA 2DCFA 1C3BA 1DY6A 1HLUP 3G34A 3EQUA 2HP6A 2O99A 1A0KA 5DTSA 1KE4A 1OMEA 5GHYA 1N9NA 2LB9A 4BLMA 4UQIS 1S6RA 2H0YA 4Q8IA 2L4RA 5U47A 2A24B 4KUKA 3HLFA 1GHIA 5A93A 4E3OA 2VV6A 3RTYA 4ME4A 3ZNTA 3DTMA 2OLVA 4XT2B 4LRXC 4X53A 3T4OA 1Q2QA 5FEFA 3GRJA 3A3DA 3VSLA 1FQGA 4LCLA 4UA7A 1FCOA 2OSUA 2WKPA 3PR6A 2D02A 2A2LA 2HGVA 2VJWA 4PMAA 4IVKA 5IT5A 4BBUA 2ZQ8A 4UAAA 5CX7A 2DRWA 3F1PB 4S2OA 2HDRA 4DKIA 3HL9A 4EERA 3U4LP 2XSSA 1MWRA 4JXGA 3DW0A 1K55C 3T1XA 2Q0OA 3S1YA 4S2PA 3A3FA 2K7SA 4GCZA 2P9VA 1DP8A 3DWKA 5HL1A 1LLBA 1JWZA 5IS1A 5EVLA 2P08A 3UB6A 5L8MA 3IXDA 4YNRA 1MZUA 3MMHA 1NXYA 4JGQA 5A90A 1XA7A 2YKHA 4GOGA 2PBYA 2WZXA 2P7JA 3Q82A 4KQOA 1CK3A 1FSWA 1N4OA 3FKWA 3UY6A 3PBRA 4IBRA 1IYQA 4WMCA 4MN7A 2XA7M 1IELA 2J3WA 3BEBA 3IS2B 1FCNA 4IJGA 4OQGA 4MCWA 3W4QA 1K6SA 1N9OA 2JC7A 2M1CA 1DP9A 1U60A 5TFQA 1S1ZA 4S2NA 4BJPA 1NWZA 2ZOHA 4WELA 5EVID 4DJ3A 2MJ6A 1Y4OA 3HUMA 3WRTA 1Y28A 5FQQA 2PRFA 3O88A 1H5XA 3LY3A 4E6WA 4OOMA 3E4PA 2Z6DA 2ZQAA 3LIFA 4ZJ2A 3MQ0A 3VE4A 2XF3A 5HX9A 4OPQA 3G2YA 4LRYC 4S2IA 4KQRA 3DTKA 5A91A 3T1SA 3MKEA 2PDRA 3A3EA 4HBTA 4K91A 4R70A 4OQIA 4I3AA 1STZA 1J9MA 3GVBA 3BLSA 5TJJA 2PYPA 1IKIA 3C8CA 4E6XA 3QP5A 1XFNA 3L7HA 1L2SA 2BTFP 4AFIA 2HP9A 1MBLA 3IX4A 3M6HA 1BLHA 4DE1A 4Y0TA 4D2OA 2IWDA 2RCXA 2OLUA 1H8MA 5FQIA 3OLOA 3ZG5A 4K0WA 4F3LA 4NXFA 1TDGA 3RJUA 1CEFA 4GNUA 1VM1A 1YT4A 4KZ9A 1LI9A 3ZQ5A 4PKYG 1VHMA 1OJ5A 1LL5A 5F1FA 4X1MA 2PHYA 5DKLA 4UEYA 3QNBA 5FAQA 4C3QA 4HIAA 1HZOA 4WL9A 1F9IA 4WMCD 1G68A 2Y2KA 5AVEA 3R7WB 1DJBA 1SZVA 4OOLA 3S22A 4M3KA 2IWBA 4RX2A 5CEBA 1YAXA 3E0YA 1Z09A 1DJCA 1LL8A 3MXSA 4DMZA 3UE1A 1S66L 3LIEA 3NOPC 3BLMA 4DXCA 2KX6A 2O0YA 5HWWA 5J8XA 4I3JA 4Y5FA 3LICA 1W7FA 5EV0A 3C2WA 3RFBA 1ZKJA 1MKMA 1KGFA 4PM5A 3KSHA 1OT6A 4M4XA 5AJGA 4N1HA 4ZTKA 5F82A 5GL9A 3MS6A 2ZBBA 2ZQ9A 4EBPA 5EE8A 4BENA 5HDCA 4QHCA 1PI4A 2V0WA 4GW9A 1MXOA 2PU2A 2QHKA 2X71A 3VSKA 4JGOA 3TSGA 4DJ2A 3HCYA 3S7QA 2XRNA 4L9GA 3CHWP 3LIAA 5F83A 4OPYA 4X6TA 4IUKA 5HARA 1PZOA 1Y54A 3QP6A 4OOYA 1F2KA 4X69A 4WUJA 5GHZA 3IXBA 3T4SA 3FKVA 5BOHA 2FFFB 2Y2JA 1IKGA 4X68A 3NULA 5HAIA 5K5BA 3LGOA 4GB7A 2ZC6B 4OP5A 3HJIA 4FH4A 3BQ8A 1T1BA 2OAP1 3BY9A 5DKKA 1YLPA 2HF6A 4WLAA 3F1OA 3LR4A 1GSXA 1OTDA 2HZ5A 1RP5A 3T4TA 1P0ZA 4R3JA 2HJ9C 2E8IA 3IX3A 3FWLA 3T50A 3IWQA 4KZ4A 5FA7A 2NUTC 3UPNA 3EOIA 5HD5A 2JBFA 1TS0A 1S67L 3HLCA 1BTLA 2ZOIA 2XA7S 2FZ0A 1OTIA 5GLDA 2QWSA 3BFEA 3NDGA 3LIDA 5F1GA 2CC1A 3O5YA 1PNEA 5EM0A 3IHBA 4QY6A 3SS4A 1PW8A 1V9ZA 4R4RA 1JWVA 1L0EA 2VK3A 5TBMB 3VE3A 5HSQA 3KYQA 3LR3A 4BL3A 2JCHA 2PBDP 5A8BA 4X55A 3SOIA 4KZAA 2M7VA 2JKTM 3UNWA 5HPIA 2Q9MA 2VEAA 4E3JA 2FH5A 1XFQA 4YWZA 1X0OA 2OAQ1 2Y2LA 3VP3A 2V20A 1PI5A 5F69A 3SH7A 3CUEA 1M40A 2ZM2A 4YOFA 3JVUA 3H7WB 4E3LA 4PAUA 5CGWA 1E3UA 1BSGA 1H8ZA 4B4ZA 3LO7A 1ES4A 4PHTA 4KG2A 2KLIA 3P01A 4U0TA 4BBVA 3RXWA 4QJGA 4CLCD 2J9OA 3ULFA 1G28A 2VGLS 3GTCA 2JKGA 5CHUA 2D01A 3LEZA 4Q0HA 5CEDA 4Y13A 3WS4A 4KZ7A 4E3MA 1S0WA 1D06A 1ES2A 1K57A 1FIKA 2Y2QA 2ZLYA 5C5KA 3BECA 4KG6A 1V9YA 3OPRA 3EGXC 1OPXA 2V8FA 5CTNA 5E2FA 3E4OA 5FSRA 5J3WA 3RH8B 4FOFA 3G2ZA 2A24A 3AGFA 2XEPA 2LB5A 3TE8A 3S4XA 2W1TB 2VGJA 1NZUA 3M2JA 5CXWA 4P6ZM 4GD6A 3ZYTA 4S2JA 3GDIA 2GDNA 2BLSA 3OCNA 4XT2A 3S7NA 1M6KA 4ZJ3A 2PD8A 1YLZA 3FPWA 3VFFA 3G30A 4R3BA 3Q07A 3NIAA 3FYZA 4R0QA 3IH8A 5FI7A 2EWVA 3T1RA 1ZG6A 1SKFA 4IEDA 5E43A 3VOLA 3F1PA 3MXQA 4HH3A 4X56A 4QPRA 1MY8A 5M19A 1I2SA 2XQZA 5F5YA 1EW0A 1YM1A 3OZHA 1IOUA 1TS8A 3GV9A 4Z1WA 1E3UD 1VB6A 2V1AA 5EVIA 3ZFZA 1QMEA 3PBSA 4H8RA 1YLJA 1RGYA 3ZG8B 2JKRM 4MN5A 3HBRA 3ZVWA 3CI6A 3ZG9B 1CF0A 5HDDA 2WK0A 4JXWA 3IF6C 2NUPC 1E25A 4X25A 1K25A 3KSIA 5FI6A 1D1JA 4JGRA 3IS2A 2ZM8A 4HQAA 2K2NA 1RGZA 1GSVA 1K4EA 3EWKA 3W8KA 2X02A 1ZC2A 1XGIA 3TG9A 1XA1A 4HI4A 1ESUA 3IH9A 2PAVP 4LV2A 3PTEA 1OT9A 2R9WA 3K2NA 3VMAA 3PYPA 2ZQDA 1S1YA 5HD3A 3EGDC 4GS9B 4HP4A 4MLLA 2WZZA 1ESIA 4LV1A 4WYYA 4OP8A 4MBFA 3IF5A 4L0LA 3OOVA 5AQ9A 1XPBA 5EVIC 3UDFA 2AVXA 3T4LA 2ZQCA 3SS5A 4N9LA 4ESPA 3MJQA 2HDSA 2W27A 2Y55A 4XUZA 2HJEA 1ONHA 4NXGA 4NXBA 2QJ5A 4K0XA 3C4PA 1BLSA 4RVAA 1TF1A 4WZ5A 3N7WA 5G4YA 3H9WA 3SH9A 2KDKA 4U0XA 1W63M 1IYSA 3HUNA 2ZJ9A 5FI2A 2B95A 4WZ4A 3V39A 4ZAMA 4Q0IA 3VP0A 1AXBA 5FQJA 3UMEA 3ICYA 1EI5A 2XFSA 4Y0OA 2X01A 3R7WA 3G4PA 1LSVA 1NLZA 4QB8A 3KYEA 5E2GA 3CAXA 4CPKA 1BLCA 2Y2PA 4LFUA 4MBHA 3G35A 1PW1A 3D72A 3UB7A 4FH2A 2BG1A 4OKPA 2WGWB 2PR6A 4I5SA 1TEMA 5HL6A 2O9AA 2VGKA 3QP1A 4CQHA 4ETXA 4MNRA 2W3EA 2V8CA 2WKQA 4O8GA 4HOIA 3W4OA 3H82B 4PM8A 3N4IA 2J3TC 3ZGAB 3ZG0A 1K6RA 2EFXA 1MWSA 3F1NB 3A0RA 4WZ5C 1FOFA 3A0VA 4ID4A 4S2NC 4B9OA 5G18A 4HNBA 3LFVA 1WE4A 3OPHA 3TJZC 3PAGA 1JNUA 4LCMA 3FG8A 4DDYA 3BJNA 1XJ2A 1IYOA 1BT5A 4JF4A 3BYDA 4QWOA 4D60A 4O7DA 5FAOA 1YPRA 2VV7A 3WS2A 4ETZA 2XK1A 2Y4AA 1CQAA 1YMSA 2WAFA 4R23A 2J3TD 1Q2PA 3WWXA 4P0MA 2DNSA 4DDSA 2GX5A 3CPTB 3UB5P 3C7UA 1XJ3A 5JYOA 4P87A 1BUEA 2JKFA 3I7JA 5KIZA 1DJAA 3GQZA 3N8RA 5AQAA 4KZ6A 1NRFA 3B3XA 1IYPA 5FDSA 2ZL1B 3PHYA 3MXRA 3NOUC 5E2HA 5DF9A 3V3SA 1YLWA 3C4OA 3JPUA 4HJ3A 4KZ8A 4H6JB 4HJ6A 3NY4A 2EX2A 3G6OA 4O01A 1H8YA 2L1MA 3FPVA 1KGEA 3G31A 3NECA 5FQKA 2H28A 2L0WA 3HREA 4CJNA 3DBAA 4G3KA 3KSFA 3UN7A 5LBRA 1H0MA 4LENA 3IBJA 2H10A 4N92A 5FQMA 3O86A 3UPPA 4B4XA 5I94A 3UB8A 4B93A 2I9VA 2V1ZA 3B33A 1YSPA 1IEMA 3TRCA 5DF8A 3SH8A 3VP2A 3M6BA 2GZAA 4BL2A 4I39A 3VOZA 2VLGA 1SKOB 2GNXA 4WF0A 5EVEA 2V9AA 3A0SA 4JKTA 4KUOA 2EWWA 3BY8A 3GR2A 3IWIA 4YINA 1ZG4A 1YKDA 4CLCA 1UWPX 3P7NA 1VEUB 3LIBA 1GA9A 2VZWA 4E04A 1TS6A 2Z2LB 1KDWA 3EEAA 4P85A 1G6AA 5DVAA 3BFFA 1T1CA 1N9BA 3SW1A 4PKYA 4OPRA 3AGDA 3HLBA 3C30A 2H5SA 5AQBA 3IXGA 4NKPA 1HTZA 4EUVA 3H7WA 4GZBA 1XGJA 3LR0A 5CRFA 4XXRA 1TVFA 3EEHA 3N8LA 3SZTA 4JXSA 1H3QA 3IXHA 5FL3A 5HW3A 2WGVA 5DTKA 3MKFA 4WEKA 4ZJ1A 3CZDA 2ZM0A 1BULA 4MEZA 1PFLA 3MBZA 3Q7VB 3NJAA 3ISGA 3EQVA 4N1XA 1ES3A 1FR6A 2EX8A 3C5AA 4KG5A 3W2ZA 3WRZA 3PBOA 1LHYA 1K0KA 4KQDA 3DTEA 5J7EA 3KO6A 4LV0A 4CLCC 5M1AA 3FV7A 3IBRA 4OLDA 4LPZA 3OC2A 4U3TA 3HUOA 2W1TA 2ZQ7A 2ZD8A 5FEGA 1S4RA 3F1OB 3RXXA 3E2KA 3N6IA 2ZC4B 1TS7A 1MWUA 3MZEA 1VETB 3CWFA 3G32A 4OH0A 2J8YA 3ZHHA 4HESA 2Y91A 5I5LA 2BASA
chains in the Genus database with same CATH topology
3QP2A 4LFUA 3QP4A 2Q0OA 3QP8A 4Y17A 4Y15A 1L3LA 5L07A 3QP5A 2AVXA 5L10A 5L09A 3QP6A 4NG2A 3SZTA 2UV0E 4LGWA 4Y13A 3IX3A 3IX4A 3QP1A 3JPUA 1H0MA 3IX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QP2 A;  4LFU A;  3QP4 A;  2Q0O A;  3QP8 A;  4Y17 A;  4Y15 A;  1L3L A;  5L07 A;  3QP5 A;  2AVX A;  5L10 A;  5L09 A;  3QP6 A;  4NG2 A;  3SZT A;  2UV0 E;  4LGW A;  4Y13 A;  3IX3 A;  3IX4 A;  3QP1 A;  3JPU A;  1H0M A;  3IX8 A; 
#chains in the Genus database with same CATH topology
 2ZMV A;  1LSX A;  1WYB A;  5HZH A;  1FCM A;  3LCE A;  5GLB A;  1UWN X;  4GHI B;  1WYC A;  3Q7Z A;  1W8Q A;  4HJ4 A;  5CHJ A;  3BW6 A;  3Q1F A;  4G3W A;  4Y3I A;  1CI8 A;  4NXE A;  1TD5 A;  2W3D A;  1Z6F A;  2WKH A;  4R6L A;  5DFX A;  1NYM A;  2HDQ A;  3NDE A;  1L3L A;  3IT9 A;  2OWJ A;  3CUE C;  1K56 A;  2PR5 A;  3T12 B;  3A3I A;  3MFX A;  5L2F A;  2XD1 A;  1LT0 A;  4BD1 A;  4FTX A;  4BD0 A;  4WEJ A;  4JF5 A;  1PWG A;  3MSH A;  4C6Y A;  1O7E A;  3HLD A;  3A3J A;  1CJF A;  4ZBE A;  2Y2H A;  2R78 A;  5FAP A;  1F5M A;  2O9C A;  2HP5 A;  3BWL A;  2XD5 A;  2A3U A;  4NG2 A;  5M18 A;  5TR7 A;  3LYX A;  2YKF A;  4FCF A;  2UWX A;  4JGP A;  1K57 C;  2XLN A;  4PPR A;  4ARZ B;  4R4S A;  5CER A;  3R4K A;  2PYR A;  4GS9 A;  1E4D A;  3PBN A;  4WM9 A;  2Y2G A;  5CGX A;  4WBG A;  1OJG A;  5FAT A;  5L10 A;  5D3O A;  1NRJ A;  3FZC A;  1TDL A;  3GMW A;  4KZB A;  5EPH A;  2FFY A;  3DAV A;  3BFD A;  3LI9 A;  2PT7 A;  2JHE A;  1XP4 A;  3UB9 A;  4PM7 A;  3O87 A;  4S2M A;  3UMD A;  2ZC3 B;  4EET B;  2W3F A;  4BWI A;  3VP4 A;  1OTE A;  3BFC A;  1ERO A;  1XKZ A;  1GSW A;  5KSC A;  4HY8 A;  4E3K A;  3IF6 B;  4A5R A;  1ODV A;  2JKT I;  3O3V A;  4I3I A;  1OTA A;  2XDM A;  1DRM A;  1HD8 A;  4JPM A;  2I72 A;  2W0N A;  3LY4 A;  4GN2 A;  4DF6 A;  1K56 D;  1KE3 A;  2IWC A;  4UA9 A;  1W79 A;  4E3I A;  1ALQ A;  2PU4 A;  3ITB A;  2K31 A;  4OLG A;  1FR1 A;  4UHU A;  4Q0J A;  3MR0 A;  1PWD A;  1P97 A;  3NCK A;  2KOI A;  4KZ3 A;  3LR5 A;  2O9B A;  3OPL A;  2Y2M A;  2OWH A;  3IWO A;  3IX8 A;  1NY0 A;  4EWF A;  3VFH A;  4FD8 A;  5G4Z A;  2WGW A;  2QZ6 A;  5EVI B;  1KGG A;  3S7P A;  4HH2 A;  3AGE A;  1ZHH B;  1FIL A;  3MFD A;  2JE5 A;  3H82 A;  4HHD A;  3HLW A;  4BMW A;  4JF6 A;  3LI8 A;  3F1N A;  3T4Q A;  3V5M A;  3ZVT A;  1QMF A;  3MQO A;  1JTD A;  1YMX A;  2WKE A;  4MDZ A;  2ACG A;  2XRO A;  2G2U A;  2HV1 A;  2Z2M B;  3CJM A;  4MMN A;  3NC8 A;  3KYZ A;  4DE2 A;  1GA0 A;  1HVB A;  4E3N A;  2XGN A;  5L09 A;  1KDS A;  1KVL A;  1GCE A;  3M2K A;  4NEE D;  1T1A A;  5DJT A;  4C75 A;  5DJU A;  5HAP A;  2B02 A;  2P9V B;  2B5R A;  2Y8H A;  3PBT A;  1RCJ A;  3CPT A;  1KE0 A;  3IHA A;  4S2K A;  2QPN A;  2WUQ A;  4ZRR A;  3V50 A;  3P98 A;  1NYY A;  1W8Y A;  3P09 A;  1PYY A;  3KX0 X;  1ES5 A;  1N9L A;  1AWI A;  1NLY A;  4FSF A;  2XR0 A;  3E2L A;  1PIO A;  4LRZ E;  4EU0 A;  2ZL1 A;  3UDI A;  3T4J A;  2B18 A;  2GJ3 A;  2J80 A;  4O0P A;  2A49 A;  3VV4 A;  1YQS A;  2EFU A;  4H6J A;  4P6B A;  5FQ9 A;  5IHV A;  3C38 A;  2QKP A;  1T19 A;  5J4E A;  1G6O A;  3MZD A;  5CTM A;  3B47 A;  3HVF A;  2Y2O A;  3D9Y A;  3FC7 A;  4QY5 A;  2JKR I;  3UO9 A;  2VGL M;  4RQ9 A;  3QP8 A;  4QD4 A;  3S7O A;  4P6Z S;  3D3O A;  1PZP A;  4IHQ A;  4DRT A;  3IQA A;  4MN6 A;  5EOO A;  4RA7 A;  2Y59 A;  3TOI A;  1SCW A;  1XXM A;  4G3V A;  5KZH A;  2WAE A;  4GLQ A;  1SHV A;  2P04 A;  2IA2 A;  3K3C A;  5EUA A;  3CLO A;  4EV4 A;  4Y15 A;  5DFY A;  1BLP A;  5L07 A;  4ZDX A;  3DTI A;  2JN7 A;  2Y2I A;  3K3D A;  3U2A A;  1SDE A;  2QJ7 A;  1SKO A;  3SS3 A;  5GHX A;  2Z6C A;  3ZNY A;  3BRM A;  3B42 A;  3HLE A;  1S4S A;  3OBF A;  3KSG A;  4GJ4 A;  3CIT A;  3NOT C;  4FUW A;  4R1G A;  2J7V A;  4GKU A;  3NHQ A;  4R3A A;  2PD7 A;  1DP6 A;  2CMN A;  5HFO A;  4EBN A;  2WAD A;  5EM1 A;  3BFG A;  2VA0 A;  3PBQ A;  1VEU A;  1IFQ A;  1JVJ A;  2WKR A;  4F3L B;  4XUX A;  4N9K A;  4IBX A;  4EEU A;  3JVV A;  3QP4 A;  5DTT A;  3TW8 A;  2DMW A;  2OV5 A;  4HEF A;  4Y7P A;  1W5D A;  2G7U A;  1I2W A;  4Z9Q A;  1YSQ A;  3QP2 A;  1ERQ A;  3NBL A;  1YLY A;  4UQI M;  4EXO A;  1SDN A;  3E4Q A;  4GDB A;  1XX2 A;  5GLC A;  3Q81 A;  4EW7 A;  4S2L A;  5KSH A;  2EX6 A;  3WS5 A;  4CLC E;  5CEC A;  3D4F A;  4DE3 A;  4BBT A;  3Q7V A;  3UE0 A;  5TBM A;  1K38 A;  2W3H A;  3WS0 A;  2HDU A;  1NJ4 A;  4WN5 A;  4EES A;  1VQQ A;  4NK3 A;  4QU3 A;  5HPF A;  2XH9 A;  1MPL A;  1ACF A;  1CI9 A;  1YLT A;  3PXP A;  3ZDJ A;  3HJK A;  5F6A A;  2W3G A;  1D7E A;  1NZO A;  1BZA A;  3OPP A;  3GSG A;  2ZMF A;  3V67 A;  2VKS A;  4II7 A;  4EQI A;  2QYB A;  4B88 A;  2ZC5 B;  2V0U A;  1P9R A;  2WKI A;  1ONG A;  2XFT A;  1JWP A;  4DE0 A;  3CG5 A;  1W63 Q;  3N8S A;  2E8J A;  4K08 A;  3UE3 A;  1VET A;  4OPZ A;  1T18 A;  2Y2N A;  1LSW A;  2VX8 A;  2ZMA A;  4LV3 A;  5EFW A;  3UDX A;  3VOY A;  4X1L A;  3ZCZ A;  4Y2F A;  4GD8 A;  1P9W A;  3MQQ A;  2WYX A;  1G5U A;  5HAQ A;  1XJ6 A;  2Q9N A;  4HP9 A;  5FAS A;  4EQ1 A;  1FSY A;  5JYP A;  1O07 A;  3HLG A;  3GEC A;  2UV0 E;  1OTB A;  1KOU A;  3T1Q B;  2R9X A;  4YFM A;  1GHP A;  4GHI A;  4NET A;  3ZG7 B;  1LL9 A;  1K54 A;  3PAE A;  5CHM A;  1LI0 A;  3C7V A;  5AQ7 A;  4JLF A;  2ZC7 A;  3DWZ A;  2VV8 A;  4JBF A;  1PRQ A;  3OCL A;  1ZTU A;  4L9F A;  4KQQ A;  1I5Q A;  4CLC B;  2EX9 A;  3W4P A;  5AVF A;  4IVI A;  1EWZ A;  4I38 A;  4R38 A;  1F98 A;  2J9P A;  1MWT A;  5MC7 A;  4KEN B;  3MF0 A;  2V2F F;  1KVM A;  3QNC A;  4F94 A;  5F68 A;  2M7U A;  4IUH A;  4KZ5 A;  4L9E A;  1MKI A;  4EEP A;  5A92 A;  3JYI A;  2C6W B;  4LLO B;  4BQM A;  5E2E A;  5DF7 A;  4DN0 A;  2HPB A;  2C5W B;  4PM9 A;  2INW A;  1ERM A;  5HDS A;  3QHY A;  4ARZ A;  2P74 A;  4RX3 A;  4OQ0 A;  4Y0U A;  1JTG A;  3MZF A;  4OVD A;  1K54 C;  1J3W A;  3CMZ A;  3ITA A;  4PM6 A;  5CGS A;  4EUZ A;  5GLA A;  5EOE A;  2RL3 A;  3VP1 A;  1WA9 A;  2EA9 A;  4OQH A;  3LEQ A;  3UE6 A;  1MC0 A;  5TGF A;  4HBU A;  1CEG A;  1UGU A;  1L0F A;  2OOL A;  2G2W A;  3BQA A;  4RYE A;  4JXV A;  5KMW A;  3V3R A;  2QMI A;  3IF6 A;  5HWV A;  5FDH A;  4EBL A;  4LGW A;  1L0G A;  2EXB A;  4MBK A;  3L9K A;  2W1R A;  2WGI A;  3E98 A;  4OON A;  2Y79 A;  1PWC A;  1BYW A;  5IU1 A;  3BM6 A;  4GDN A;  4Y17 A;  1XJ4 A;  3NI9 A;  4UA6 A;  2EXA A;  1K55 A;  2V1B A;  5HWT A;  3WS1 A;  2H0T A;  5EEC A;  1K4F A;  4DXB A;  3LUQ A;  3T4K A;  1L0D A;  1GHM A;  3UPO A;  2DCF A;  1C3B A;  1DY6 A;  1HLU P;  3G34 A;  3EQU A;  2HP6 A;  2O99 A;  1A0K A;  5DTS A;  1KE4 A;  1OME A;  5GHY A;  1N9N A;  2LB9 A;  4BLM A;  4UQI S;  1S6R A;  2H0Y A;  4Q8I A;  2L4R A;  5U47 A;  2A24 B;  4KUK A;  3HLF A;  1GHI A;  5A93 A;  4E3O A;  2VV6 A;  3RTY A;  4ME4 A;  3ZNT A;  3DTM A;  2OLV A;  4XT2 B;  4LRX C;  4X53 A;  3T4O A;  1Q2Q A;  5FEF A;  3GRJ A;  3A3D A;  3VSL A;  1FQG A;  4LCL A;  4UA7 A;  1FCO A;  2OSU A;  2WKP A;  3PR6 A;  2D02 A;  2A2L A;  2HGV A;  2VJW A;  4PMA A;  4IVK A;  5IT5 A;  4BBU A;  2ZQ8 A;  4UAA A;  5CX7 A;  2DRW A;  3F1P B;  4S2O A;  2HDR A;  4DKI A;  3HL9 A;  4EER A;  3U4L P;  2XSS A;  1MWR A;  4JXG A;  3DW0 A;  1K55 C;  3T1X A;  2Q0O A;  3S1Y A;  4S2P A;  3A3F A;  2K7S A;  4GCZ A;  2P9V A;  1DP8 A;  3DWK A;  5HL1 A;  1LLB A;  1JWZ A;  5IS1 A;  5EVL A;  2P08 A;  3UB6 A;  5L8M A;  3IXD A;  4YNR A;  1MZU A;  3MMH A;  1NXY A;  4JGQ A;  5A90 A;  1XA7 A;  2YKH A;  4GOG A;  2PBY A;  2WZX A;  2P7J A;  3Q82 A;  4KQO A;  1CK3 A;  1FSW A;  1N4O A;  3FKW A;  3UY6 A;  3PBR A;  4IBR A;  1IYQ A;  4WMC A;  4MN7 A;  2XA7 M;  1IEL A;  2J3W A;  3BEB A;  3IS2 B;  1FCN A;  4IJG A;  4OQG A;  4MCW A;  3W4Q A;  1K6S A;  1N9O A;  2JC7 A;  2M1C A;  1DP9 A;  1U60 A;  5TFQ A;  1S1Z A;  4S2N A;  4BJP A;  1NWZ A;  2ZOH A;  4WEL A;  5EVI D;  4DJ3 A;  2MJ6 A;  1Y4O A;  3HUM A;  3WRT A;  1Y28 A;  5FQQ A;  2PRF A;  3O88 A;  1H5X A;  3LY3 A;  4E6W A;  4OOM A;  3E4P A;  2Z6D A;  2ZQA A;  3LIF A;  4ZJ2 A;  3MQ0 A;  3VE4 A;  2XF3 A;  5HX9 A;  4OPQ A;  3G2Y A;  4LRY C;  4S2I A;  4KQR A;  3DTK A;  5A91 A;  3T1S A;  3MKE A;  2PDR A;  3A3E A;  4HBT A;  4K91 A;  4R70 A;  4OQI A;  4I3A A;  1STZ A;  1J9M A;  3GVB A;  3BLS A;  5TJJ A;  2PYP A;  1IKI A;  3C8C A;  4E6X A;  3QP5 A;  1XFN A;  3L7H A;  1L2S A;  2BTF P;  4AFI A;  2HP9 A;  1MBL A;  3IX4 A;  3M6H A;  1BLH A;  4DE1 A;  4Y0T A;  4D2O A;  2IWD A;  2RCX A;  2OLU A;  1H8M A;  5FQI A;  3OLO A;  3ZG5 A;  4K0W A;  4F3L A;  4NXF A;  1TDG A;  3RJU A;  1CEF A;  4GNU A;  1VM1 A;  1YT4 A;  4KZ9 A;  1LI9 A;  3ZQ5 A;  4PKY G;  1VHM A;  1OJ5 A;  1LL5 A;  5F1F A;  4X1M A;  2PHY A;  5DKL A;  4UEY A;  3QNB A;  5FAQ A;  4C3Q A;  4HIA A;  1HZO A;  4WL9 A;  1F9I A;  4WMC D;  1G68 A;  2Y2K A;  5AVE A;  3R7W B;  1DJB A;  1SZV A;  4OOL A;  3S22 A;  4M3K A;  2IWB A;  4RX2 A;  5CEB A;  1YAX A;  3E0Y A;  1Z09 A;  1DJC A;  1LL8 A;  3MXS A;  4DMZ A;  3UE1 A;  1S66 L;  3LIE A;  3NOP C;  3BLM A;  4DXC A;  2KX6 A;  2O0Y A;  5HWW A;  5J8X A;  4I3J A;  4Y5F A;  3LIC A;  1W7F A;  5EV0 A;  3C2W A;  3RFB A;  1ZKJ A;  1MKM A;  1KGF A;  4PM5 A;  3KSH A;  1OT6 A;  4M4X A;  5AJG A;  4N1H A;  4ZTK A;  5F82 A;  5GL9 A;  3MS6 A;  2ZBB A;  2ZQ9 A;  4EBP A;  5EE8 A;  4BEN A;  5HDC A;  4QHC A;  1PI4 A;  2V0W A;  4GW9 A;  1MXO A;  2PU2 A;  2QHK A;  2X71 A;  3VSK A;  4JGO A;  3TSG A;  4DJ2 A;  3HCY A;  3S7Q A;  2XRN A;  4L9G A;  3CHW P;  3LIA A;  5F83 A;  4OPY A;  4X6T A;  4IUK A;  5HAR A;  1PZO A;  1Y54 A;  3QP6 A;  4OOY A;  1F2K A;  4X69 A;  4WUJ A;  5GHZ A;  3IXB A;  3T4S A;  3FKV A;  5BOH A;  2FFF B;  2Y2J A;  1IKG A;  4X68 A;  3NUL A;  5HAI A;  5K5B A;  3LGO A;  4GB7 A;  2ZC6 B;  4OP5 A;  3HJI A;  4FH4 A;  3BQ8 A;  1T1B A;  2OAP 1;  3BY9 A;  5DKK A;  1YLP A;  2HF6 A;  4WLA A;  3F1O A;  3LR4 A;  1GSX A;  1OTD A;  2HZ5 A;  1RP5 A;  3T4T A;  1P0Z A;  4R3J A;  2HJ9 C;  2E8I A;  3IX3 A;  3FWL A;  3T50 A;  3IWQ A;  4KZ4 A;  5FA7 A;  2NUT C;  3UPN A;  3EOI A;  5HD5 A;  2JBF A;  1TS0 A;  1S67 L;  3HLC A;  1BTL A;  2ZOI A;  2XA7 S;  2FZ0 A;  1OTI A;  5GLD A;  2QWS A;  3BFE A;  3NDG A;  3LID A;  5F1G A;  2CC1 A;  3O5Y A;  1PNE A;  5EM0 A;  3IHB A;  4QY6 A;  3SS4 A;  1PW8 A;  1V9Z A;  4R4R A;  1JWV A;  1L0E A;  2VK3 A;  5TBM B;  3VE3 A;  5HSQ A;  3KYQ A;  3LR3 A;  4BL3 A;  2JCH A;  2PBD P;  5A8B A;  4X55 A;  3SOI A;  4KZA A;  2M7V A;  2JKT M;  3UNW A;  5HPI A;  2Q9M A;  2VEA A;  4E3J A;  2FH5 A;  1XFQ A;  4YWZ A;  1X0O A;  2OAQ 1;  2Y2L A;  3VP3 A;  2V20 A;  1PI5 A;  5F69 A;  3SH7 A;  3CUE A;  1M40 A;  2ZM2 A;  4YOF A;  3JVU A;  3H7W B;  4E3L A;  4PAU A;  5CGW A;  1E3U A;  1BSG A;  1H8Z A;  4B4Z A;  3LO7 A;  1ES4 A;  4PHT A;  4KG2 A;  2KLI A;  3P01 A;  4U0T A;  4BBV A;  3RXW A;  4QJG A;  4CLC D;  2J9O A;  3ULF A;  1G28 A;  2VGL S;  3GTC A;  2JKG A;  5CHU A;  2D01 A;  3LEZ A;  4Q0H A;  5CED A;  4Y13 A;  3WS4 A;  4KZ7 A;  4E3M A;  1S0W A;  1D06 A;  1ES2 A;  1K57 A;  1FIK A;  2Y2Q A;  2ZLY A;  5C5K A;  3BEC A;  4KG6 A;  1V9Y A;  3OPR A;  3EGX C;  1OPX A;  2V8F A;  5CTN A;  5E2F A;  3E4O A;  5FSR A;  5J3W A;  3RH8 B;  4FOF A;  3G2Z A;  2A24 A;  3AGF A;  2XEP A;  2LB5 A;  3TE8 A;  3S4X A;  2W1T B;  2VGJ A;  1NZU A;  3M2J A;  5CXW A;  4P6Z M;  4GD6 A;  3ZYT A;  4S2J A;  3GDI A;  2GDN A;  2BLS A;  3OCN A;  4XT2 A;  3S7N A;  1M6K A;  4ZJ3 A;  2PD8 A;  1YLZ A;  3FPW A;  3VFF A;  3G30 A;  4R3B A;  3Q07 A;  3NIA A;  3FYZ A;  4R0Q A;  3IH8 A;  5FI7 A;  2EWV A;  3T1R A;  1ZG6 A;  1SKF A;  4IED A;  5E43 A;  3VOL A;  3F1P A;  3MXQ A;  4HH3 A;  4X56 A;  4QPR A;  1MY8 A;  5M19 A;  1I2S A;  2XQZ A;  5F5Y A;  1EW0 A;  1YM1 A;  3OZH A;  1IOU A;  1TS8 A;  3GV9 A;  4Z1W A;  1E3U D;  1VB6 A;  2V1A A;  5EVI A;  3ZFZ A;  1QME A;  3PBS A;  4H8R A;  1YLJ A;  1RGY A;  3ZG8 B;  2JKR M;  4MN5 A;  3HBR A;  3ZVW A;  3CI6 A;  3ZG9 B;  1CF0 A;  5HDD A;  2WK0 A;  4JXW A;  3IF6 C;  2NUP C;  1E25 A;  4X25 A;  1K25 A;  3KSI A;  5FI6 A;  1D1J A;  4JGR A;  3IS2 A;  2ZM8 A;  4HQA A;  2K2N A;  1RGZ A;  1GSV A;  1K4E A;  3EWK A;  3W8K A;  2X02 A;  1ZC2 A;  1XGI A;  3TG9 A;  1XA1 A;  4HI4 A;  1ESU A;  3IH9 A;  2PAV P;  4LV2 A;  3PTE A;  1OT9 A;  2R9W A;  3K2N A;  3VMA A;  3PYP A;  2ZQD A;  1S1Y A;  5HD3 A;  3EGD C;  4GS9 B;  4HP4 A;  4MLL A;  2WZZ A;  1ESI A;  4LV1 A;  4WYY A;  4OP8 A;  4MBF A;  3IF5 A;  4L0L A;  3OOV A;  5AQ9 A;  1XPB A;  5EVI C;  3UDF A;  2AVX A;  3T4L A;  2ZQC A;  3SS5 A;  4N9L A;  4ESP A;  3MJQ A;  2HDS A;  2W27 A;  2Y55 A;  4XUZ A;  2HJE A;  1ONH A;  4NXG A;  4NXB A;  2QJ5 A;  4K0X A;  3C4P A;  1BLS A;  4RVA A;  1TF1 A;  4WZ5 A;  3N7W A;  5G4Y A;  3H9W A;  3SH9 A;  2KDK A;  4U0X A;  1W63 M;  1IYS A;  3HUN A;  2ZJ9 A;  5FI2 A;  2B95 A;  4WZ4 A;  3V39 A;  4ZAM A;  4Q0I A;  3VP0 A;  1AXB A;  5FQJ A;  3UME A;  3ICY A;  1EI5 A;  2XFS A;  4Y0O A;  2X01 A;  3R7W A;  3G4P A;  1LSV A;  1NLZ A;  4QB8 A;  3KYE A;  5E2G A;  3CAX A;  4CPK A;  1BLC A;  2Y2P A;  4LFU A;  4MBH A;  3G35 A;  1PW1 A;  3D72 A;  3UB7 A;  4FH2 A;  2BG1 A;  4OKP A;  2WGW B;  2PR6 A;  4I5S A;  1TEM A;  5HL6 A;  2O9A A;  2VGK A;  3QP1 A;  4CQH A;  4ETX A;  4MNR A;  2W3E A;  2V8C A;  2WKQ A;  4O8G A;  4HOI A;  3W4O A;  3H82 B;  4PM8 A;  3N4I A;  2J3T C;  3ZGA B;  3ZG0 A;  1K6R A;  2EFX A;  1MWS A;  3F1N B;  3A0R A;  4WZ5 C;  1FOF A;  3A0V A;  4ID4 A;  4S2N C;  4B9O A;  5G18 A;  4HNB A;  3LFV A;  1WE4 A;  3OPH A;  3TJZ C;  3PAG A;  1JNU A;  4LCM A;  3FG8 A;  4DDY A;  3BJN A;  1XJ2 A;  1IYO A;  1BT5 A;  4JF4 A;  3BYD A;  4QWO A;  4D60 A;  4O7D A;  5FAO A;  1YPR A;  2VV7 A;  3WS2 A;  4ETZ A;  2XK1 A;  2Y4A A;  1CQA A;  1YMS A;  2WAF A;  4R23 A;  2J3T D;  1Q2P A;  3WWX A;  4P0M A;  2DNS A;  4DDS A;  2GX5 A;  3CPT B;  3UB5 P;  3C7U A;  1XJ3 A;  5JYO A;  4P87 A;  1BUE A;  2JKF A;  3I7J A;  5KIZ A;  1DJA A;  3GQZ A;  3N8R A;  5AQA A;  4KZ6 A;  1NRF A;  3B3X A;  1IYP A;  5FDS A;  2ZL1 B;  3PHY A;  3MXR A;  3NOU C;  5E2H A;  5DF9 A;  3V3S A;  1YLW A;  3C4O A;  3JPU A;  4HJ3 A;  4KZ8 A;  4H6J B;  4HJ6 A;  3NY4 A;  2EX2 A;  3G6O A;  4O01 A;  1H8Y A;  2L1M A;  3FPV A;  1KGE A;  3G31 A;  3NEC A;  5FQK A;  2H28 A;  2L0W A;  3HRE A;  4CJN A;  3DBA A;  4G3K A;  3KSF A;  3UN7 A;  5LBR A;  1H0M A;  4LEN A;  3IBJ A;  2H10 A;  4N92 A;  5FQM A;  3O86 A;  3UPP A;  4B4X A;  5I94 A;  3UB8 A;  4B93 A;  2I9V A;  2V1Z A;  3B33 A;  1YSP A;  1IEM A;  3TRC A;  5DF8 A;  3SH8 A;  3VP2 A;  3M6B A;  2GZA A;  4BL2 A;  4I39 A;  3VOZ A;  2VLG A;  1SKO B;  2GNX A;  4WF0 A;  5EVE A;  2V9A A;  3A0S A;  4JKT A;  4KUO A;  2EWW A;  3BY8 A;  3GR2 A;  3IWI A;  4YIN A;  1ZG4 A;  1YKD A;  4CLC A;  1UWP X;  3P7N A;  1VEU B;  3LIB A;  1GA9 A;  2VZW A;  4E04 A;  1TS6 A;  2Z2L B;  1KDW A;  3EEA A;  4P85 A;  1G6A A;  5DVA A;  3BFF A;  1T1C A;  1N9B A;  3SW1 A;  4PKY A;  4OPR A;  3AGD A;  3HLB A;  3C30 A;  2H5S A;  5AQB A;  3IXG A;  4NKP A;  1HTZ A;  4EUV A;  3H7W A;  4GZB A;  1XGJ A;  3LR0 A;  5CRF A;  4XXR A;  1TVF A;  3EEH A;  3N8L A;  3SZT A;  4JXS A;  1H3Q A;  3IXH A;  5FL3 A;  5HW3 A;  2WGV A;  5DTK A;  3MKF A;  4WEK A;  4ZJ1 A;  3CZD A;  2ZM0 A;  1BUL A;  4MEZ A;  1PFL A;  3MBZ A;  3Q7V B;  3NJA A;  3ISG A;  3EQV A;  4N1X A;  1ES3 A;  1FR6 A;  2EX8 A;  3C5A A;  4KG5 A;  3W2Z A;  3WRZ A;  3PBO A;  1LHY A;  1K0K A;  4KQD A;  3DTE A;  5J7E A;  3KO6 A;  4LV0 A;  4CLC C;  5M1A A;  3FV7 A;  3IBR A;  4OLD A;  4LPZ A;  3OC2 A;  4U3T A;  3HUO A;  2W1T A;  2ZQ7 A;  2ZD8 A;  5FEG A;  1S4R A;  3F1O B;  3RXX A;  3E2K A;  3N6I A;  2ZC4 B;  1TS7 A;  1MWU A;  3MZE A;  1VET B;  3CWF A;  3G32 A;  4OH0 A;  2J8Y A;  3ZHH A;  4HES A;  2Y91 A;  5I5L A;  2BAS A; 
#chains in the Genus database with same CATH homology
 3QP2 A;  4LFU A;  3QP4 A;  2Q0O A;  3QP8 A;  4Y17 A;  4Y15 A;  1L3L A;  5L07 A;  3QP5 A;  2AVX A;  5L10 A;  5L09 A;  3QP6 A;  4NG2 A;  3SZT A;  2UV0 E;  4LGW A;  4Y13 A;  3IX3 A;  3IX4 A;  3QP1 A;  3JPU A;  1H0M A;  3IX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...