3ZNYA

Crystal structure of the class a extended-spectrum beta-lactamase ctx- m-96, a natural d240g mutant derived from ctx-m-12
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
260
structure length
260
Chain Sequence
DVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKKSESEPSLLNQRVEIKKSDLVNYNPIAEKHVNGTMSLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGGYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDILASAAKIVTDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CTX-M-12A ENZYME
publication title Structural and Kinetic Insights Into the "Ceftazidimase" Behavior of the Extended-Spectrum Beta-Lactamase Ctx-M-96.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 92
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3znyA00
3DWKA 3NIAA 3GRJA 3IH8A 4GB7A 1VM1A 1BLCA 3MXSA 4N1HA 4WM9A 5HFOA 3VSLA 1BULA 1PIOA 5A92A 1PWCA 1K56A 4A5RA 2GDNA 3VP3A 1W8QA 4OVDA 5FQMA 3HBRA 5D3OA 5HAPA 2Y2NA 4XXRA 2V2FF 1BLSA 4BQMA 2ZC4B 4MEZA 3IF6A 3IWOA 1KE4A 4GNUA 3GQZA 4MBKA 1RP5A 5F83A 1RCJA 3I7JA 4LV1A 5FQIA 2ZMAA 2FFFB 4OOMA 1FQGA 1PWGA 4E6WA 3MKFA 4PM6A 4WMCD 5FSRA 3WS2A 3Q7VB 3UN7A 1YLJA 5HARA 3VP2A 4MLLA 1YLPA 1FOFA 1XA1A 1ES4A 3S1YA 4DE2A 1YQSA 2WAFA 2JBFA 3WS1A 3IXBA 1CI9A 3E2KA 3PAGA 3RXXA 1PYYA 1KE3A 2HDQA 4JBFA 4OPRA 4P85A 4E3IA 4E3OA 5DTKA 1MWRA 4DXBA 4HEFA 3C4OA 2HDRA 3CJMA 4KG2A 4Y0TA 3C7VA 4GKUA 1AXBA 2Q9MA 2Y55A 4K91A 2ZQ8A 4KG6A 4Z9QA 5EPHA 4N92A 4DE3A 5CERA 1ES2A 2Y2JA 2XD1A 1M6KA 3IT9A 4HBUA 1H8ZA 1N4OA 1YM1A 2HP5A 2X71A 4OQ0A 3V5MA 5I94A 4LCLA 3G2ZA 3G32A 2G2UA 1MKIA 5TFQA 3V50A 4P6BA 1ZC2A 4K0XA 2EX6A 3MZFA 2Z2MB 1KVMA 3VSKA 1TEMA 2Y2PA 3OPHA 1ZKJA 1LLBA 3MXRA 3TOIA 5F1FA 3GMWA 4OPYA 2X01A 4QD4A 3S4XA 4S2MA 5F1GA 4JKTA 4EBLA 1LI0A 3E2LA 3G31A 4OKPA 3GR2A 3VOZA 1S6RA 4BENA 3OCNA 4EWFA 4GD8A 5FAPA 1KDWA 3MZEA 4LCMA 4KZ7A 3HLDA 4KZ9A 3A3DA 2EX8A 5CTMA 1BSGA 1DY6A 1HTZA 1XGIA 2WAEA 1NYYA 2ZC7A 1CI8A 2HPBA 2JE5A 1MWSA 3V3RA 4ZBEA 1O7EA 4B4XA 3P98A 1S0WA 3ZVTA 3LCEA 4JF4A 4S2KA 5A91A 3EQUA 1ONHA 1NRFA 2P9VA 4N9LA 4OLDA 4WZ5C 3LO7A 3BRMA 4QY6A 4S2JA 4D2OA 1YMSA 3WS0A 3ZG8B 3TG9A 1LI9A 2XFTA 3FWLA 4KENB 5FQJA 2UWXA 1PZOA 1C3BA 2H0YA 2XGNA 2ZQAA 3G35A 3IXHA 4WZ5A 1N9BA 3UDIA 4E6XA 5HX9A 3N8RA 5TGFA 2Q9NA 4PPRA 4GDNA 1JVJA 4UA6A 4XUZA 3UE3A 2DRWA 1TVFA 1KE0A 1KVLA 4FH4A 4DE0A 4PM9A 2ZD8A 3V3SA 3UO9A 4H8RA 2OLVA 4NETA 2P9VB 4P0MA 3UNWA 1LL9A 3LY3A 1YLYA 3VP4A 1SCWA 4KZ4A 4OONA 1YLWA 2BLSA 5HL1A 3WWXA 5CHUA 5GLCA 4PM7A 4O7DA 2EX9A 1K38A 2FFYA 3GTCA 3WS5A 2EXBA 4OOLA 1W7FA 1MXOA 2XK1A 1U60A 4IEDA 4JXGA 2HDSA 4Q8IA 1ONGA 3VP1A 4F94A 4HBTA 1L0GA 1KGEA 4MBFA 5KSHA 4R0QA 4BLMA 3UDFA 2JCHA 1K56D 3FV7A 2OV5A 1XKZA 3ZGAB 2G2WA 3UDXA 1GA9A 3N8LA 3HLBA 4LENA 4R3JA 5CGXA 4BJPA 4BL3A 3OPLA 2ZQ9A 2I72A 1H5XA 4PM8A 1OMEA 1LHYA 2Y2GA 4C6YA 5FASA 3IF6C 5JYPA 2XD5A 1FR6A 3DTMA 4WZ4A 5A90A 1XP4A 2J7VA 3ZNTA 4UA7A 4ZTKA 4X69A 5EVLA 3UY6A 5M19A 1SHVA 4DRTA 1L0FA 4ZDXA 4UHUA 2HDUA 4M3KA 4QHCA 5IHVA 1K55A 2R9WA 4K0WA 3IWQA 1ES3A 1MBLA 1IELA 1DJAA 5GLAA 1YMXA 2WUQA 2ZC5B 2XDMA 3BLSA 5EVIC 3IF5A 4YINA 5HAQA 2IWCA 2RCXA 3AGFA 4QY5A 2XH9A 2ZM2A 5AQ7A 5CHMA 4DXCA 5E43A 5E2FA 1FCMA 3LY4A 4U3TA 3HUMA 3BEBA 5GL9A 3NC8A 2HP9A 3SS4A 5TR7A 5CTNA 1K25A 3IF6B 3NDGA 3G4PA 2EX2A 5CHJA 5EVIA 4GDBA 4NK3A 5FI6A 3PBTA 1BT5A 3M6BA 3PBOA 5HW3A 3GVBA 4S2LA 4L0LA 5E2EA 5JYOA 4S2IA 4R1GA 4KQQA 2RL3A 2XLNA 3P09A 3PBQA 2DCFA 1GHMA 3QNBA 2OSUA 4DDSA 1VQQA 5DF7A 4ZJ1A 3Q7ZA 5CRFA 3C4PA 1G6AA 4E3LA 1Y54A 3BFDA 1FR1A 3M6HA 3O88A 4QU3A 5EVIB 5F82A 1K57A 1Z6FA 4KG5A 4ZAMA 5U47A 3MZDA 4LV3A 4C3QA 1RGYA 4U0TA 1ALQA 1BTLA 1SDNA 3Q07A 5FA7A 4R23A 3UPOA 4OH0A 1GA0A 3PBRA 3PAEA 1FSWA 2Y59A 2WGIA 1M40A 3ZG5A 1WYCA 4R4SA 5GHZA 4FSFA 4WELA 3FZCA 3AGDA 4EUZA 4Y7PA 1FCNA 4HESA 1IEMA 5CEBA 2XF3A 1K6SA 5DTSA 4QJGA 1WYBA 2J9OA 4WYYA 3ZG7B 4KZ3A 3LEZA 1E3UA 1ERQA 4OP5A 2ZC6B 1K4EA 4OQIA 3GSGA 4Y0UA 1XA7A 3JYIA 1CK3A 4IVIA 2Y91A 3A3FA 2Y2KA 3PBSA 4UA9A 3N7WA 3IWIA 4MBHA 1NYMA 1IKIA 3CMZA 3Q1FA 4PMAA 1JTDA 2C5WB 3IXDA 4IBXA 1NZOA 4OOYA 2IWDA 2C6WB 3OC2A 4X56A 3A3EA 3ZVWA 4RX3A 3PTEA 5CGSA 1IYSA 4ID4A 5FQQA 2EXAA 1ERMA 5FQKA 3ITBA 3OCLA 4WEKA 5FAQA 5FI2A 4BD1A 3VP0A 2Y2HA 3D4FA 3MFDA 5BOHA 3C7UA 5GLDA 1I2WA 4KQRA 1ES5A 4DKIA 3G34A 2ZLYA 3W4PA 1NY0A 1MPLA 5DF8A 1CEFA 4U0XA 1SDEA 1JWPA 5EE8A 1W79A 3B3XA 5A93A 3ZG0A 1G68A 2WZXA 2Z2LB 5CXWA 5AQAA 5FQ9A 5HAIA 4DE1A 5L2FA 5GHYA 1HZOA 2OLUA 2Y2OA 3W8KA 1GHPA 1IYQA 3OPRA 1JWZA 4GN2A 1BLPA 2H0TA 3GV9A 1RGZA 3UE0A 5FDHA 4X53A 2Y2MA 2Y4AA 4OLGA 3Q81A 1IYPA 2ZM8A 2BG1A 3DWZA 5DVAA 5M18A 2ZC3B 2VGKA 1EI5A 1K55C 3FKVA 3G2YA 4GZBA 2A3UA 2ZM0A 3N6IA 5FAOA 1BUEA 1LL5A 3SH8A 3O87A 4OP8A 5EECA 4R3BA 1PW8A 4X55A 2ZQCA 3CG5A 4ZJ3A 2QMIA 3VFFA 2EFUA 5GLBA 1IKGA 3SS3A 1WE4A 3OPPA 2Y2IA 1TDLA 4X68A 3WS4A 2ZQ7A 2PU4A 4BD0A 1NZUA 3Q7VA 1EROA 4JXVA 5EVID 1DJCA 4OPQA 1HVBA 2XFSA 1BLHA 3HLCA 5FATA 4FH2A 4UAAA 1PZPA 4CPKA 2ZQDA 3ZNYA 1I2SA 3ISGA 4GD6A 4KZ8A 4EBPA 3ZDJA 2J9PA 3BYDA 4B4ZA 2B5RA 5CECA 3IXGA 3HLWA 3SOIA 5DTTA 3HLFA 2JC7A 1NXYA 4FCFA 1IYOA 3VFHA 1YLTA 4OQHA 5DF9A 3ZG9B 2R9XA 1K57C 1PI5A 1O07A 1K4FA 1MWTA 1DJBA 3RJUA 1ESIA 2WADA 2WKEA 2ZJ9A 3FYZA 4DDYA 1MY8A 3VMAA 2WKHA 5E2GA 3ZCZA 4Y0OA 3DW0A 3NDEA 4WMCA 5KSCA 1XXMA 4S2PA 5KMWA 3HL9A 2WKIA 1E25A 1L0DA 4N9KA 1MWUA 3Q82A 3BLMA 1Q2QA 2V20A 3BFGA 1QMFA 3MKEA 3WRZA 1GCEA 3OZHA 1W8YA 2H10A 3HVFA 4JF6A 4E3MA 5EUAA 2PU2A 3M2KA 3SH9A 1GHIA 1SKFA 3EQVA 2Y2QA 4E3JA 3IHAA 2WGWA 5CEDA 3W4QA 1E3UD 3A3JA 5AQ9A 4JLFA 1XPBA 4KZ6A 3RXWA 3QHYA 1JWVA 3NBLA 1HD8A 3ZFZA 4C75A 4IVKA 2WGVA 1ZG6A 3CZDA 1PWDA 1CEGA 3M2JA 4KZBA 4EBNA 5AQBA 2EFXA 3BM6A 5G18A 3N4IA 3MBZA 1L0EA 3G30A 4FD8A 5KZHA 5J8XA 1JTGA 1YLZA 2WGWB 4OPZA 4S2NC 5EOOA 4RX2A 1W5DA 3BFCA 5CGWA 4RYEA 3SH7A 3W4OA 4JXWA 3IHBA 4JXSA 1QMEA 1ZG4A 2XQZA 5GHXA 1PW1A 1ESUA 4S2NA 1KDSA 1L2SA 4ZJ2A 4PM5A 3BECA 3QNCA 1TDGA 4JF5A 5EOEA 1XGJA 2E8IA 2QPNA 3FKWA 3NCKA 3O86A 4GOGA 4BL2A 1NJ4A 2A49A 2P74A 3C5AA 1K6RA 1J9MA 1KGGA 4WEJA 4YFMA 1BZAA 5E2HA 3TSGA 4EV4A 4B88A 2IWBA 4CJNA 1EWZA 4E3KA 2V1ZA 3V39A 2J8YA 2CC1A 3BFEA 3PBNA 3ZHHA 1YT4A 5M1AA 3UE1A 3IH9A 1K54C 1PI4A 2VGJA 1Q2PA 3NY4A 3A3IA 3O3VA 1XX2A 3NI9A 4P87A 3HUOA 4JPMA 3S22A 1E4DA 2WK0A 1FCOA 4KZ5A 4EQIA 2Y2LA 2HP6A 4IBRA 2DNSA 1FSYA 4R4RA 4RA7A 3N8SA 4E3NA 4N1XA 4S2OA 2XR0A 2X02A 1K54A 4LV2A 3BFFA 4LV0A 3VOYA 2PBYA 4KQOA 3ITAA 3WRTA 1I5QA 2WZZA 5FI7A 1H8YA 4DF6A 4MNRA 3UPPA 2WYXA 2QZ6A 2H5SA 3HLEA 1KGFA 4X6TA 4XUXA 3HREA 4OQGA 3SS5A 4RVAA 4WBGA 3HUNA 3HLGA 3AGEA 4KZAA 2XEPA 4QB8A 3IQAA 3UPNA
chains in the Genus database with same CATH superfamily
3MXSA 5L10A 3MF0A 1PIOA 5A92A 1K56A 2GDNA 2VV6A 4OVDA 2VKSA 5HAPA 2ZC4B 4MEZA 3GQZA 1RCJA 4OOMA 1FQGA 1PWGA 2Q0OA 4PM6A 4WMCD 3Q7VB 4KQDA 1YLJA 1YLPA 5CX7A 1YQSA 4HHDA 3IXBA 3E2KA 4OPRA 1KE3A 4E3IA 4DXBA 4H6JA 2HDRA 3C7VA 3CPTA 1AXBA 2Q9MA 1W63M 4N92A 4HBUA 4KUKA 4XT2A 3F1NB 5TFQA 4UQIM 3VSKA 4G3VA 1TEMA 3OPHA 3GMWA 1VB6A 4QD4A 4S2MA 4JKTA 1XJ6A 5HZHA 2PR5A 3G31A 4ZRRA 4GLQA 2LB9A 4Y15A 4P6ZM 2Y8HA 4LCMA 4KZ7A 2VV8A 3A3DA 1K0KA 5EFWA 1BSGA 1DY6A 1HTZA 3LUQA 1OTEA 1MWSA 2M1CA 3EQUA 3QP4A 4N9LA 4OLDA 4QY6A 4S2JA 3KX0X 3FWLA 2UWXA 2H0YA 1C3BA 2XGNA 2ZQAA 3FG8A 3G35A 3IXHA 5F69A 1N9BA 3UDIA 4DJ3A 5HX9A 3N8RA 2DRWA 4L9GA 2ZD8A 4H8RA 1YLYA 4KZ4A 5FEFA 1YLWA 5CHUA 5GLCA 1OTAA 4PM7A 4O7DA 5DJUA 3BY8A 4IEDA 1U60A 4Q8IA 3P7NA 1ONGA 4F94A 1L0GA 4R0QA 4BLMA 3UDFA 1LSXA 2JCHA 3DBAA 3KYEA 5DFYA 2YKFA 1AWIA 1SKOA 3L9KA 2KX6A 5JYPA 1FR6A 3DTMA 4MN6A 4WZ4A 4X69A 3UY6A 1FILA 1SHVA 1L0FA 2ZOHA 2HDUA 3IWQA 5J7EA 4I3AA 2VEAA 1YMXA 2ZC5B 4YINA 5HAQA 2IWCA 3AGFA 1YSQA 5CHMA 5DKLA 1FCMA 5GL9A 3LIDA 3NDGA 5EVIA 1KOUA 4NK3A 5FI6A 3C8CA 4S2LA 1ODVA 4KQQA 2RL3A 3P09A 1FIKA 3PBQA 4CQHA 2DCFA 2OSUA 1VQQA 3BY9A 4ZJ1A 5EVIB 1V9YA 4KG5A 4LV3A 1RGYA 1ALQA 2VX8A 3HCYA 1TS8A 2R78A 3ZG5A 1M40A 4WELA 3FZCA 4EUZA 4Y7PA 5IS1A 4MDZA 5CEBA 5DTSA 1VHMA 4HP9A 3LEZA 2A2LA 4OQIA 3T4TA 4Y0UA 1CK3A 3PBSA 2OWJA 1IKIA 1JTDA 2C5WB 2L4RA 3G6OA 1IYSA 5FQQA 2OAP1 4JGPA 4RQ9A 4WEKA 5FAQA 2V1AA 3VP0A 4HJ3A 4Y2FA 3MFDA 5BOHA 3C7UA 4KQRA 4NEED 1NWZA 1ES5A 1NY0A 1CEFA 2D01A 3EOIA 2WZXA 4DE1A 4EUVA 1S1ZA 1IYQA 2HJ9C 3MQOA 1JWZA 1BLPA 3GV9A 3PR6A 2CMNA 3T12B 1T19A 1XJ4A 3G2YA 2PYPA 2ZM0A 3N6IA 1LL5A 1TD5A 3FPVA 2ZQCA 3CG5A 2EFUA 5GLBA 1IKGA 3SS3A 1WE4A 1TDLA 2PU4A 3B42A 1EROA 2HV1A 3HLCA 4FH2A 1PZPA 4EW7A 2GNXA 1VEUA 3ZDJA 3BYDA 1ACFA 4LFUA 3IXGA 3HLWA 5DTTA 2JC7A 3LEQA 3VFHA 1YLTA 5DF9A 3ZG9B 1K57C 1DJBA 2WADA 2ZJ9A 4DDYA 3ZQ5A 1VEUB 3DW0A 4WMCA 4NKPA 2WKIA 5AJGA 1D06A 1E25A 3RFBA 4N9KA 3Q82A 3BLMA 3MKEA 2V1BA 4JF6A 1T18A 5EUAA 3M2KA 2Y2QA 4E3JA 2XSSA 3IHAA 1D1JA 3W4QA 1E3UD 4JLFA 2XA7M 4KZ6A 3QHYA 4WLAA 1HD8A 3VOLA 4IVKA 2WGVA 1ZG6A 3LR3A 3NOPC 2EFXA 1X0OA 3BM6A 3KSHA 5J8XA 4HY8A 4Z1WA 3BFCA 3T1SA 3W4OA 2ZL1A 3C30A 1LT0A 1KDSA 1L2SA 1WA9A 4HIAA 1XFQA 4Y13A 1TDGA 4JF5A 3NCKA 1T1CA 5E2HA 3TSGA 1BZAA 2IWBA 4E3KA 2V1ZA 3F1PA 2J8YA 3BFEA 2ZBBA 1K54C 2VGJA 3QP6A 3MJQA 3O3VA 4JPMA 1E4DA 1FCOA 2Y2LA 2HP6A 2DNSA 4N1XA 5TBMA 2X02A 4HQAA 3F1PB 3NOUC 4EU0A 3UPPA 4X6TA 3LICA 4MCWA 3SS5A 3HUNA 3HLGA 4KZAA 3TJZC 4KUOA 4K08A 3SW1A 1CQAA 3NIAA 3IH8A 5TBMB 1VM1A 1BLCA 5HFOA 4A5RA 1Y4OA 4FUWA 3LI8A 4XXRA 2JKTI 1BLSA 4BQMA 1V9ZA 3IWOA 4GNUA 4MBKA 1RP5A 3TRCA 5FQIA 1XJ3A 2FFFB 3WS2A 1FOFA 3NOTC 3E98A 1T1BA 4JBFA 4E3OA 1MWRA 3IX8A 5EV0A 4I39A 2K2NA 5CERA 2XD1A 5HL6A 4OQ0A 5I94A 3G2ZA 3CWFA 3P01A 4K0XA 4O0PA 1OJ5A 1KVMA 1DRMA 1DP8A 3MXQA 2FH5A 5F1FA 3FPWA 3RH8B 4GS9B 4AFIA 1GSWA 1LI0A 4OKPA 3BWLA 3GR2A 3VOZA 2KDKA 2VGLS 1KDWA 3MZEA 1XJ2A 4KZ9A 2ZC7A 2JE5A 3T1RA 2JKFA 4B4XA 1O7EA 3ZVTA 3LCEA 4II7A 5A91A 3UMDA 3LR4A 5EVEA 2H28A 1CF0A 1SZVA 1S4RA 4D2OA 4WZ5A 3DAVA 2KLIA 4E6XA 2Q9NA 3H82A 1JVJA 1KE0A 1KVLA 4FH4A 2Y79A 4DE0A 5LBRA 3V3SA 4B9OA 3UO9A 2OLVA 4P0MA 3UNWA 3BJNA 1LL9A 2BLSA 3WWXA 3GTCA 4OOLA 1W7FA 2XK1A 2HDSA 1TF1A 1PFLA 2G2WA 3UB7A 4LENA 4EEPA 4M4XA 2VZWA 4PM8A 1OMEA 2Y2GA 3IF6C 2XD5A 4IUHA 2PBDP 1XP4A 2J7VA 3ZNTA 4UA7A 3T4OA 1LL8A 1YPRA 1HLUP 1TS6A 2BTFP 4K0WA 1IELA 1DJAA 3TW8A 1T1AA 3BLSA 3IF5A 2RCXA 2ZM2A 5E2FA 4U3TA 3HUMA 4Y17A 2HP9A 1K25A 5HPIA 1BT5A 3T4LA 5HW3A 3GVBA 5JYOA 4L0LA 2V0UA 3R7WA 3EGXC 1OT9A 1GHMA 4DDSA 1Z09A 1ZTUA 3A0SA 1G6AA 3M6HA 4H6JB 1K57A 1Z6FA 5EM0A 3CPTB 1OT6A 4ZAMA 4C3QA 4U0TA 3R7WB 5FL3A 2NUPC 1SDNA 1G6OA 2W0NA 4R23A 3UPOA 3DTIA 2WGIA 4XT2B 5TJJA 4FSFA 2EWVA 4HESA 3CUEC 1K6SA 2J9OA 4WYYA 3ZG7B 4KZ3A 1E3UA 3U2AA 5HDCA 2VJWA 3GSGA 3JVUA 4IVIA 2Y2KA 4UA9A 1BYWA 3N7WA 4I3IA 5I5LA 3IWIA 4MBHA 1NYMA 3CMZA 4PMAA 3E4QA 2UV0E 3EWKA 4O01A 3E0YA 3ZVWA 2VA0A 3ITBA 3OCLA 2Y2HA 3H9WA 4DKIA 4CLCC 3F1OA 5DF8A 3JPUA 5EE8A 5A8BA 1H0MA 3MSHA 5HAIA 5GHYA 3OPRA 1RGZA 4X53A 3Q81A 1IYPA 3U4LP 1K55C 4GZBA 1BUEA 2W3GA 4OP8A 2D02A 4X55A 2P7JA 3ICYA 4X68A 3S7NA 2ZQ7A 4FOFA 1SKOB 1NZUA 1HVBA 3QP2A 5FATA 4CPKA 2ZQDA 4I5SA 3QP5A 4EBPA 2B5RA 4JGOA 5CECA 2O9CA 1MKMA 1NXYA 4FCFA 2HGVA 3IBRA 1N9OA 2R9XA 1O07A 1K4FA 3RJUA 2J80A 3FYZA 2PYRA 1MY8A 4FTXA 3VMAA 5E2GA 3LIEA 5KSCA 3S7PA 3HL9A 4JGRA 3ZYTA 5EM1A 1Q2QA 2V20A 3OZHA 4Y5FA 3R4KA 4E3MA 2PDRA 4ARZA 3SH9A 1GHIA 1SKFA 3NULA 5HWVA 4I3JA 3RTYA 4YOFA 4PKYG 3M2JA 4KZBA 3OBFA 2B18A 2W1RA 5G18A 4ARZB 3N4IA 3D3OA 4WUJA 5KZHA 4S2NC 4RYEA 3SH7A 4JXWA 2M7VA 1QMEA 2XQZA 3TE8A 4ETZA 2VLGA 3UB9A 4ZJ2A 4PM5A 3QNCA 3KYQA 1XGJA 2E8IA 4BL2A 2A49A 4NG2A 1J9MA 1KGGA 3BQAA 4EV4A 4B88A 3T4SA 3IBJA 4LRXC 3O5YA 3KSFA 2Z6CA 1PI4A 3NY4A 1Q2PA 3A3IA 3HUOA 3S22A 3T4JA 4BWIA 2WK0A 4EQIA 4IBRA 2EA9A 2PHYA 3BFFA 2WZZA 5FDSA 5L09A 2QKPA 3H7WA 4XUXA 5KMWA 3AGEA 1VETA 4E04A 2JN7A 4LPZA 3VSLA 1BULA 4WL9A 4GW9A 1PWCA 5FQMA 1UWPX 3H7WB 3KO6A 2V2FF 5IU1A 3S7QA 2O0YA 1VETB 3IF6A 4NXEA 1KE4A 3T4KA 4LV1A 4NXGA 3MKFA 5FSRA 3UN7A 5HARA 3VP2A 1XA1A 3S1YA 4DE2A 4EETB 2WAFA 2JBFA 4QPRA 3PAGA 1PYYA 4P85A 5J3WA 5DTKA 4PKYA 4Y0TA 3CJMA 5HPFA 2Y55A 4K91A 4KG6A 4Z9QA 5EPHA 3MFXA 1ES2A 4BBVA 2Y2JA 3IT9A 1H8ZA 2HP5A 3V5MA 2JKRM 4LCLA 2EWWA 2V8FA 3G32A 2G2UA 4PHTA 4ESPA 4BBTA 3V50A 2EX6A 2QWSA 1N9NA 1ZKJA 1OJGA 4OPYA 2X01A 3S4XA 4X1LA 4EBLA 2INWA 4O8GA 1LSWA 2W3EA 1S6RA 4EWFA 1CJFA 2WKQA 4GD8A 5FAPA 3C2WA 1S4SA 3V3RA 1CI8A 4Q0IA 1NRFA 2P9VA 3LO7A 3S7OA 1UGUA 1YMSA 2ZL1B 4P6ZS 2P08A 2XFTA 2O99A 4KENB 5KIZA 1PZOA 3A0VA 1P9WA 4GDNA 2W27A 4UA6A 3UE3A 1TVFA 2P9VB 3VP4A 3LY3A 1SCWA 4OONA 2DMWA 5HL1A 1OTBA 2EX9A 1K38A 2FFYA 3NECA 2EXBA 4JXGA 1P0ZA 3EEHA 3K3CA 4HBTA 4MBFA 2OV5A 1XKZA 3UDXA 3VE4A 2J3WA 3N8LA 3HLBA 5CGXA 4BL3A 3LR5A 5DFXA 2ZQ9A 2I72A 4LGWA 1LHYA 4C6YA 2PRFA 4QWOA 5EVLA 4DRTA 3QP1A 4G3KA 4QHCA 4JGQA 1K55A 1MBLA 4MN7A 2ACGA 1JNUA 2WUQA 2XDMA 5EVIC 2L0WA 3MR0A 4QY5A 2XH9A 3DTEA 4DXCA 3LY4A 5TR7A 4GHIA 5CHJA 3G4PA 3PBTA 3M6BA 4LRYC 3CLOA 2LB5A 4F3LA 5HD3A 4R1GA 2XLNA 3QNBA 1TS7A 5DF7A 3Q7ZA 5CRFA 3C4PA 1TS0A 1Y54A 3O88A 1FR1A 1PRQA 5F82A 1BTLA 5HSQA 3Q07A 5FA7A 3PBRA 1WYCA 4R4SA 5GHZA 1L3LA 3IX4A 1FCNA 4QJGA 3EEAA 1ERQA 2ZC6B 2PAVP 1K4EA 4L9FA 2ZOIA 5HDDA 2V9AA 4IBXA 1DP6A 1NZOA 2J3TD 4Q0HA 2C6WB 2J3TC 4GCZA 4X56A 2OWHA 2GX5A 5FQKA 2W1TA 5FI2A 3D4FA 5GLDA 1I2WA 4DMZA 3G34A 4Q0JA 2QHKA 3W4PA 1ZHHB 3LR0A 2A24A 3H82B 1W79A 5A93A 1YAXA 1G68A 5L2FA 5CXWA 5FQ9A 1HZOA 2JHEA 3W8KA 3UE6A 4EESA 4X25A 2H0TA 3L7HA 5F5YA 4OLGA 5M18A 2ZM8A 2A24B 3CITA 2A3UA 4MN5A 3SH8A 3JVVA 4R3BA 4ZJ3A 1PNEA 2Y2IA 4I38A 1MC0A 3WS4A 3Q7VA 4JXVA 1DJCA 5C5KA 4UAAA 3ZNYA 3ISGA 3NJAA 4GD6A 2J9PA 2GJ3A 4B4ZA 2P04A 1F5MA 2O9AA 1MWTA 4R38A 3UB8A 4Y0OA 3F1NA 3NDEA 1XXMA 4S2PA 4R6LA 1L0DA 4L9EA 1QMFA 2H10A 2PU2A 2XROA 3NHQA 4NXBA 3A3JA 5AQ9A 1XPBA 2V8CA 3RXWA 1JWVA 2MJ6A 3NBLA 4YNRA 3ZFZA 2PD7A 4IHQA 3B47A 3KSGA 2QJ7A 3CZDA 5K5BA 5AQBA 3MBZA 1L0EA 4WF0A 5AVFA 4IJGA 1JTGA 1YLZA 5EOOA 2B95A 2HF6A 1W5DA 1F9IA 3IHBA 4JXSA 3UMEA 2K7SA 5GHXA 2XA7S 1D7EA 1G5UA 3W2ZA 2WKRA 2OAQ1 2JKTM 3D72A 2JKGA 5IT5A 5EOEA 3O86A 5F68A 1NJ4A 2P74A 2E8JA 4YFMA 2O9BA 1EWZA 4CLCD 5DJTA 4HNBA 3PBNA 3ZHHA 5M1AA 5DKKA 3UE1A 1NLZA 2V0WA 3NI9A 4P87A 1FSYA 2JKRI 4E3NA 4S2OA 2XR0A 1K54A 4LV0A 3F1OB 4KQOA 3ITAA 4G3WA 5FI7A 1H8YA 4DF6A 4MNRA 1G28A 4LRZE 1KGFA 4QB8A 2XRNA 2Z6DA 3DWKA 3GRJA 4GB7A 4N1HA 4WM9A 4X1MA 1J3WA 3MQQA 2AVXA 3VP3A 3LFVA 1W8QA 2NUTC 2W3FA 3HBRA 5D3OA 2Y2NA 5MC7A 4MMNA 5AVEA 5F83A 3I7JA 2ZMAA 4E6WA 4MLLA 3E4OA 1ES4A 3KSIA 4B93A 3WS1A 4CLCE 1CI9A 3RXXA 2HDQA 1P9RA 2G7UA 4HEFA 3C4OA 4KG2A 3VE3A 4GKUA 2ZQ8A 3VV4A 3K2NA 3GECA 4DE3A 3LIAA 1M6KA 1N4OA 2VGLM 1YM1A 2X71A 1MKIA 2VV7A 4P6BA 1ZC2A 3MZFA 2Z2MB 4BBUA 2L1MA 3PXPA 2Y2PA 4ETXA 3MXRA 1LLBA 3TOIA 1EW0A 5F1GA 3LYXA 3E2LA 3DTKA 1OTDA 2BASA 4BENA 3OCNA 3PYPA 1YSPA 3HLDA 2EX8A 5CTMA 1MZUA 2WAEA 1XGIA 1NYYA 2HPBA 4ZBEA 4WN5A 3P98A 1S0WA 1H3QA 5HDSA 4JF4A 4S2KA 2QYBA 1ONHA 4WZ5C 1F2KA 3BRMA 4EEUA 3OOVA 3WS0A 3ZG8B 3TG9A 1LI9A 1IFQA 4HP4A 5FQJA 4Y3IA 2GZAA 5TGFA 4PPRA 4XUZA 4PM9A 3LIFA 2W3DA 4NETA 1S1YA 3LIBA 4EERA 2WKPA 3WS5A 1MXOA 3ULFA 2PD8A 3LGOA 1DP9A 1KGEA 5KSHA 3FV7A 1K56D 3ZGAB 1GA9A 4R3JA 4BJPA 3OPLA 3CHWP 1H5XA 3C38A 5FASA 3GDIA 1NRJA 5A90A 4ZTKA 5M19A 4ZDXA 4HI4A 4UHUA 3V67A 1N9LA 4M3KA 1IOUA 5IHVA 2R9WA 4ME4A 1ES3A 3K3DA 5GLAA 2ZMVA 2M7UA 3UB5P 3E4PA 5AQ7A 5E43A 3T1XA 3BEBA 3NC8A 5HD5A 1S66L 3CAXA 5CTNA 3SS4A 3IF6B 5J4EA 2EX2A 4GDBA 2FZ0A 3PBOA 5E2EA 4S2IA 4NXFA 4E3LA 3BFDA 4QU3A 4UEYA 5F6AA 4EQ1A 3UB6A 5U47A 3MZDA 3PHYA 1S67L 3QP8A 4BMWA 4OH0A 1GA0A 3PAEA 1FSWA 2Y59A 3AGDA 4LLOB 1IEMA 4UQIS 2XF3A 1WYBA 5G4ZA 4OP5A 3CUEA 4HJ6A 1XA7A 3JYIA 3HJKA 3MQ0A 4PAUA 2Y91A 3A3FA 3Q1FA 4HJ4A 3IXDA 3FC7A 4OOYA 2IWDA 3OC2A 3A3EA 4RX3A 3PTEA 5CGSA 3T4QA 4ID4A 4DN0A 2EXAA 1ERMA 4BD1A 1F98A 1P97A 2VK3A 2ZLYA 2ZMFA 3EGDC 1MPLA 4U0XA 1SDEA 1JWPA 1LSVA 3B33A 5FEGA 3B3XA 3ZG0A 5AQAA 2Z2LB 4CLCA 2OLUA 4HH3A 2Y2OA 1GHPA 4GN2A 1H8MA 3UE0A 5FDHA 3SZTA 2Y2MA 2Y4AA 2BG1A 3DWZA 5DVAA 4DJ2A 2ZC3B 2VGKA 1EI5A 3FKVA 3VP1A 5FAOA 3O87A 5EECA 3KYZA 4HOIA 1PW8A 4CLCB 2QMIA 3IX3A 3VFFA 1GSVA 3T1QB 3OPPA 5HWWA 4BD0A 1OPXA 5EVID 1YKDA 3CI6A 4OPQA 2XFSA 1BLHA 1I2SA 2K31A 4KZ8A 2KOIA 2PR6A 1STZA 3SOIA 3HLFA 1IYOA 3IS2A 4OQHA 1UWNX 4R70A 4HH2A 1PI5A 1ESIA 2WKEA 4YWZA 4D60A 2WKHA 1OTIA 3ZCZA 4R3AA 4GHIB 3HJIA 4IUKA 1MWUA 2OOLA 4F3LB 3BFGA 3WRZA 1GCEA 4GS9A 1W8YA 3IS2B 3MMHA 3HVFA 4EXOA 1XFNA 1A0KA 3EQVA 5L07A 4GJ4A 2WGWA 5CEDA 3BW6A 4C75A 2YKHA 2HJEA 1PWDA 1CEGA 1Y28A 4EBNA 2HZ5A 3G30A 3D9YA 4FD8A 2WGWB 4OPZA 2W3HA 3LI9A 4RX2A 3A0RA 5CGWA 1ZG4A 2QJ5A 3MS6A 1PW1A 1ESUA 4S2NA 3BECA 3T50A 2QPNA 3FKWA 4GOGA 3C5AA 1K6RA 4WEJA 4CJNA 3V39A 2B02A 5HWTA 2I9VA 2CC1A 1YT4A 5L8MA 3IH9A 1GSXA 1XX2A 2W1TB 4KZ5A 2IA2A 4R4RA 4RA7A 3N8SA 5G4YA 4LV2A 3VOYA 2PBYA 3WRTA 1I5QA 3BQ8A 2PT7A 1W63Q 2WYXA 1NLYA 2QZ6A 2H5SA 3HLEA 3HREA 3OLOA 4OQGA 4RVAA 4WBGA 3UPNA 2XEPA 3IQAA
chains in the Genus database with same CATH topology
3DWKA 3NIAA 3GRJA 3IH8A 4GB7A 1VM1A 1BLCA 3MXSA 4N1HA 4WM9A 5HFOA 3VSLA 1BULA 1PIOA 5A92A 1PWCA 1K56A 4A5RA 2GDNA 3VP3A 1W8QA 4OVDA 5FQMA 3HBRA 5D3OA 5HAPA 2Y2NA 4XXRA 2V2FF 1BLSA 4BQMA 2ZC4B 4MEZA 3IF6A 3IWOA 1KE4A 4GNUA 3GQZA 4MBKA 1RP5A 5F83A 1RCJA 3I7JA 4LV1A 5FQIA 2ZMAA 2FFFB 4OOMA 1FQGA 1PWGA 4E6WA 3MKFA 4PM6A 4WMCD 5FSRA 3WS2A 3Q7VB 3UN7A 1YLJA 5HARA 3VP2A 4MLLA 1YLPA 1FOFA 1XA1A 1ES4A 3S1YA 4DE2A 1YQSA 2WAFA 2JBFA 3WS1A 3IXBA 1CI9A 3E2KA 3PAGA 3RXXA 1PYYA 1KE3A 2HDQA 4JBFA 4OPRA 4P85A 4E3IA 4E3OA 5DTKA 1MWRA 4DXBA 4HEFA 3C4OA 2HDRA 3CJMA 4KG2A 4Y0TA 3C7VA 4GKUA 1AXBA 2Q9MA 2Y55A 4K91A 2ZQ8A 4KG6A 4Z9QA 5EPHA 4N92A 4DE3A 5CERA 1ES2A 2Y2JA 2XD1A 1M6KA 3IT9A 4HBUA 1H8ZA 1N4OA 1YM1A 2HP5A 2X71A 4OQ0A 3V5MA 5I94A 4LCLA 3G2ZA 3G32A 2G2UA 1MKIA 5TFQA 3V50A 4P6BA 1ZC2A 4K0XA 2EX6A 3MZFA 2Z2MB 1KVMA 3VSKA 1TEMA 2Y2PA 3OPHA 1ZKJA 1LLBA 3MXRA 3TOIA 5F1FA 3GMWA 4OPYA 2X01A 4QD4A 3S4XA 4S2MA 5F1GA 4JKTA 4EBLA 1LI0A 3E2LA 3G31A 4OKPA 3GR2A 3VOZA 1S6RA 4BENA 3OCNA 4EWFA 4GD8A 5FAPA 1KDWA 3MZEA 4LCMA 4KZ7A 3HLDA 4KZ9A 3A3DA 2EX8A 5CTMA 1BSGA 1DY6A 1HTZA 1XGIA 2WAEA 1NYYA 2ZC7A 1CI8A 2HPBA 2JE5A 1MWSA 3V3RA 4ZBEA 1O7EA 4B4XA 3P98A 1S0WA 3ZVTA 3LCEA 4JF4A 4S2KA 5A91A 3EQUA 1ONHA 1NRFA 2P9VA 4N9LA 4OLDA 4WZ5C 3LO7A 3BRMA 4QY6A 4S2JA 4D2OA 1YMSA 3WS0A 3ZG8B 3TG9A 1LI9A 2XFTA 3FWLA 4KENB 5FQJA 2UWXA 1PZOA 1C3BA 2H0YA 2XGNA 2ZQAA 3G35A 3IXHA 4WZ5A 1N9BA 3UDIA 4E6XA 5HX9A 3N8RA 5TGFA 2Q9NA 4PPRA 4GDNA 1JVJA 4UA6A 4XUZA 3UE3A 2DRWA 1TVFA 1KE0A 1KVLA 4FH4A 4DE0A 4PM9A 2ZD8A 3V3SA 3UO9A 4H8RA 2OLVA 4NETA 2P9VB 4P0MA 3UNWA 1LL9A 3LY3A 1YLYA 3VP4A 1SCWA 4KZ4A 4OONA 1YLWA 2BLSA 5HL1A 3WWXA 5CHUA 5GLCA 4PM7A 4O7DA 2EX9A 1K38A 2FFYA 3GTCA 3WS5A 2EXBA 4OOLA 1W7FA 1MXOA 2XK1A 1U60A 4IEDA 4JXGA 2HDSA 4Q8IA 1ONGA 3VP1A 4F94A 4HBTA 1L0GA 1KGEA 4MBFA 5KSHA 4R0QA 4BLMA 3UDFA 2JCHA 1K56D 3FV7A 2OV5A 1XKZA 3ZGAB 2G2WA 3UDXA 1GA9A 3N8LA 3HLBA 4LENA 4R3JA 5CGXA 4BJPA 4BL3A 3OPLA 2ZQ9A 2I72A 1H5XA 4PM8A 1OMEA 1LHYA 2Y2GA 4C6YA 5FASA 3IF6C 5JYPA 2XD5A 1FR6A 3DTMA 4WZ4A 5A90A 1XP4A 2J7VA 3ZNTA 4UA7A 4ZTKA 4X69A 5EVLA 3UY6A 5M19A 1SHVA 4DRTA 1L0FA 4ZDXA 4UHUA 2HDUA 4M3KA 4QHCA 5IHVA 1K55A 2R9WA 4K0WA 3IWQA 1ES3A 1MBLA 1IELA 1DJAA 5GLAA 1YMXA 2WUQA 2ZC5B 2XDMA 3BLSA 5EVIC 3IF5A 4YINA 5HAQA 2IWCA 2RCXA 3AGFA 4QY5A 2XH9A 2ZM2A 5AQ7A 5CHMA 4DXCA 5E43A 5E2FA 1FCMA 3LY4A 4U3TA 3HUMA 3BEBA 5GL9A 3NC8A 2HP9A 3SS4A 5TR7A 5CTNA 1K25A 3IF6B 3NDGA 3G4PA 2EX2A 5CHJA 5EVIA 4GDBA 4NK3A 5FI6A 3PBTA 1BT5A 3M6BA 3PBOA 5HW3A 3GVBA 4S2LA 4L0LA 5E2EA 5JYOA 4S2IA 4R1GA 4KQQA 2RL3A 2XLNA 3P09A 3PBQA 2DCFA 1GHMA 3QNBA 2OSUA 4DDSA 1VQQA 5DF7A 4ZJ1A 3Q7ZA 5CRFA 3C4PA 1G6AA 4E3LA 1Y54A 3BFDA 1FR1A 3M6HA 3O88A 4QU3A 5EVIB 5F82A 1K57A 1Z6FA 4KG5A 4ZAMA 5U47A 3MZDA 4LV3A 4C3QA 1RGYA 4U0TA 1ALQA 1BTLA 1SDNA 3Q07A 5FA7A 4R23A 3UPOA 4OH0A 1GA0A 3PBRA 3PAEA 1FSWA 2Y59A 2WGIA 1M40A 3ZG5A 1WYCA 4R4SA 5GHZA 4FSFA 4WELA 3FZCA 3AGDA 4EUZA 4Y7PA 1FCNA 4HESA 1IEMA 5CEBA 2XF3A 1K6SA 5DTSA 4QJGA 1WYBA 2J9OA 4WYYA 3ZG7B 4KZ3A 3LEZA 1E3UA 1ERQA 4OP5A 2ZC6B 1K4EA 4OQIA 3GSGA 4Y0UA 1XA7A 3JYIA 1CK3A 4IVIA 2Y91A 3A3FA 2Y2KA 3PBSA 4UA9A 3N7WA 3IWIA 4MBHA 1NYMA 1IKIA 3CMZA 3Q1FA 4PMAA 1JTDA 2C5WB 3IXDA 4IBXA 1NZOA 4OOYA 2IWDA 2C6WB 3OC2A 4X56A 3A3EA 3ZVWA 4RX3A 3PTEA 5CGSA 1IYSA 4ID4A 5FQQA 2EXAA 1ERMA 5FQKA 3ITBA 3OCLA 4WEKA 5FAQA 5FI2A 4BD1A 3VP0A 2Y2HA 3D4FA 3MFDA 5BOHA 3C7UA 5GLDA 1I2WA 4KQRA 1ES5A 4DKIA 3G34A 2ZLYA 3W4PA 1NY0A 1MPLA 5DF8A 1CEFA 4U0XA 1SDEA 1JWPA 5EE8A 1W79A 3B3XA 5A93A 3ZG0A 1G68A 2WZXA 2Z2LB 5CXWA 5AQAA 5FQ9A 5HAIA 4DE1A 5L2FA 5GHYA 1HZOA 2OLUA 2Y2OA 3W8KA 1GHPA 1IYQA 3OPRA 1JWZA 4GN2A 1BLPA 2H0TA 3GV9A 1RGZA 3UE0A 5FDHA 4X53A 2Y2MA 2Y4AA 4OLGA 3Q81A 1IYPA 2ZM8A 2BG1A 3DWZA 5DVAA 5M18A 2ZC3B 2VGKA 1EI5A 1K55C 3FKVA 3G2YA 4GZBA 2A3UA 2ZM0A 3N6IA 5FAOA 1BUEA 1LL5A 3SH8A 3O87A 4OP8A 5EECA 4R3BA 1PW8A 4X55A 2ZQCA 3CG5A 4ZJ3A 2QMIA 3VFFA 2EFUA 5GLBA 1IKGA 3SS3A 1WE4A 3OPPA 2Y2IA 1TDLA 4X68A 3WS4A 2ZQ7A 2PU4A 4BD0A 1NZUA 3Q7VA 1EROA 4JXVA 5EVID 1DJCA 4OPQA 1HVBA 2XFSA 1BLHA 3HLCA 5FATA 4FH2A 4UAAA 1PZPA 4CPKA 2ZQDA 3ZNYA 1I2SA 3ISGA 4GD6A 4KZ8A 4EBPA 3ZDJA 2J9PA 3BYDA 4B4ZA 2B5RA 5CECA 3IXGA 3HLWA 3SOIA 5DTTA 3HLFA 2JC7A 1NXYA 4FCFA 1IYOA 3VFHA 1YLTA 4OQHA 5DF9A 3ZG9B 2R9XA 1K57C 1PI5A 1O07A 1K4FA 1MWTA 1DJBA 3RJUA 1ESIA 2WADA 2WKEA 2ZJ9A 3FYZA 4DDYA 1MY8A 3VMAA 2WKHA 5E2GA 3ZCZA 4Y0OA 3DW0A 3NDEA 4WMCA 5KSCA 1XXMA 4S2PA 5KMWA 3HL9A 2WKIA 1E25A 1L0DA 4N9KA 1MWUA 3Q82A 3BLMA 1Q2QA 2V20A 3BFGA 1QMFA 3MKEA 3WRZA 1GCEA 3OZHA 1W8YA 2H10A 3HVFA 4JF6A 4E3MA 5EUAA 2PU2A 3M2KA 3SH9A 1GHIA 1SKFA 3EQVA 2Y2QA 4E3JA 3IHAA 2WGWA 5CEDA 3W4QA 1E3UD 3A3JA 5AQ9A 4JLFA 1XPBA 4KZ6A 3RXWA 3QHYA 1JWVA 3NBLA 1HD8A 3ZFZA 4C75A 4IVKA 2WGVA 1ZG6A 3CZDA 1PWDA 1CEGA 3M2JA 4KZBA 4EBNA 5AQBA 2EFXA 3BM6A 5G18A 3N4IA 3MBZA 1L0EA 3G30A 4FD8A 5KZHA 5J8XA 1JTGA 1YLZA 2WGWB 4OPZA 4S2NC 5EOOA 4RX2A 1W5DA 3BFCA 5CGWA 4RYEA 3SH7A 3W4OA 4JXWA 3IHBA 4JXSA 1QMEA 1ZG4A 2XQZA 5GHXA 1PW1A 1ESUA 4S2NA 1KDSA 1L2SA 4ZJ2A 4PM5A 3BECA 3QNCA 1TDGA 4JF5A 5EOEA 1XGJA 2E8IA 2QPNA 3FKWA 3NCKA 3O86A 4GOGA 4BL2A 1NJ4A 2A49A 2P74A 3C5AA 1K6RA 1J9MA 1KGGA 4WEJA 4YFMA 1BZAA 5E2HA 3TSGA 4EV4A 4B88A 2IWBA 4CJNA 1EWZA 4E3KA 2V1ZA 3V39A 2J8YA 2CC1A 3BFEA 3PBNA 3ZHHA 1YT4A 5M1AA 3UE1A 3IH9A 1K54C 1PI4A 2VGJA 1Q2PA 3NY4A 3A3IA 3O3VA 1XX2A 3NI9A 4P87A 3HUOA 4JPMA 3S22A 1E4DA 2WK0A 1FCOA 4KZ5A 4EQIA 2Y2LA 2HP6A 4IBRA 2DNSA 1FSYA 4R4RA 4RA7A 3N8SA 4E3NA 4N1XA 4S2OA 2XR0A 2X02A 1K54A 4LV2A 3BFFA 4LV0A 3VOYA 2PBYA 4KQOA 3ITAA 3WRTA 1I5QA 2WZZA 5FI7A 1H8YA 4DF6A 4MNRA 3UPPA 2WYXA 2QZ6A 2H5SA 3HLEA 1KGFA 4X6TA 4XUXA 3HREA 4OQGA 3SS5A 4RVAA 4WBGA 3HUNA 3HLGA 3AGEA 4KZAA 2XEPA 4QB8A 3IQAA 3UPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWK A;  3NIA A;  3GRJ A;  3IH8 A;  4GB7 A;  1VM1 A;  1BLC A;  3MXS A;  4N1H A;  4WM9 A;  5HFO A;  3VSL A;  1BUL A;  1PIO A;  5A92 A;  1PWC A;  1K56 A;  4A5R A;  2GDN A;  3VP3 A;  1W8Q A;  4OVD A;  5FQM A;  3HBR A;  5D3O A;  5HAP A;  2Y2N A;  4XXR A;  2V2F F;  1BLS A;  4BQM A;  2ZC4 B;  4MEZ A;  3IF6 A;  3IWO A;  1KE4 A;  4GNU A;  3GQZ A;  4MBK A;  1RP5 A;  5F83 A;  1RCJ A;  3I7J A;  4LV1 A;  5FQI A;  2ZMA A;  2FFF B;  4OOM A;  1FQG A;  1PWG A;  4E6W A;  3MKF A;  4PM6 A;  4WMC D;  5FSR A;  3WS2 A;  3Q7V B;  3UN7 A;  1YLJ A;  5HAR A;  3VP2 A;  4MLL A;  1YLP A;  1FOF A;  1XA1 A;  1ES4 A;  3S1Y A;  4DE2 A;  1YQS A;  2WAF A;  2JBF A;  3WS1 A;  3IXB A;  1CI9 A;  3E2K A;  3PAG A;  3RXX A;  1PYY A;  1KE3 A;  2HDQ A;  4JBF A;  4OPR A;  4P85 A;  4E3I A;  4E3O A;  5DTK A;  1MWR A;  4DXB A;  4HEF A;  3C4O A;  2HDR A;  3CJM A;  4KG2 A;  4Y0T A;  3C7V A;  4GKU A;  1AXB A;  2Q9M A;  2Y55 A;  4K91 A;  2ZQ8 A;  4KG6 A;  4Z9Q A;  5EPH A;  4N92 A;  4DE3 A;  5CER A;  1ES2 A;  2Y2J A;  2XD1 A;  1M6K A;  3IT9 A;  4HBU A;  1H8Z A;  1N4O A;  1YM1 A;  2HP5 A;  2X71 A;  4OQ0 A;  3V5M A;  5I94 A;  4LCL A;  3G2Z A;  3G32 A;  2G2U A;  1MKI A;  5TFQ A;  3V50 A;  4P6B A;  1ZC2 A;  4K0X A;  2EX6 A;  3MZF A;  2Z2M B;  1KVM A;  3VSK A;  1TEM A;  2Y2P A;  3OPH A;  1ZKJ A;  1LLB A;  3MXR A;  3TOI A;  5F1F A;  3GMW A;  4OPY A;  2X01 A;  4QD4 A;  3S4X A;  4S2M A;  5F1G A;  4JKT A;  4EBL A;  1LI0 A;  3E2L A;  3G31 A;  4OKP A;  3GR2 A;  3VOZ A;  1S6R A;  4BEN A;  3OCN A;  4EWF A;  4GD8 A;  5FAP A;  1KDW A;  3MZE A;  4LCM A;  4KZ7 A;  3HLD A;  4KZ9 A;  3A3D A;  2EX8 A;  5CTM A;  1BSG A;  1DY6 A;  1HTZ A;  1XGI A;  2WAE A;  1NYY A;  2ZC7 A;  1CI8 A;  2HPB A;  2JE5 A;  1MWS A;  3V3R A;  4ZBE A;  1O7E A;  4B4X A;  3P98 A;  1S0W A;  3ZVT A;  3LCE A;  4JF4 A;  4S2K A;  5A91 A;  3EQU A;  1ONH A;  1NRF A;  2P9V A;  4N9L A;  4OLD A;  4WZ5 C;  3LO7 A;  3BRM A;  4QY6 A;  4S2J A;  4D2O A;  1YMS A;  3WS0 A;  3ZG8 B;  3TG9 A;  1LI9 A;  2XFT A;  3FWL A;  4KEN B;  5FQJ A;  2UWX A;  1PZO A;  1C3B A;  2H0Y A;  2XGN A;  2ZQA A;  3G35 A;  3IXH A;  4WZ5 A;  1N9B A;  3UDI A;  4E6X A;  5HX9 A;  3N8R A;  5TGF A;  2Q9N A;  4PPR A;  4GDN A;  1JVJ A;  4UA6 A;  4XUZ A;  3UE3 A;  2DRW A;  1TVF A;  1KE0 A;  1KVL A;  4FH4 A;  4DE0 A;  4PM9 A;  2ZD8 A;  3V3S A;  3UO9 A;  4H8R A;  2OLV A;  4NET A;  2P9V B;  4P0M A;  3UNW A;  1LL9 A;  3LY3 A;  1YLY A;  3VP4 A;  1SCW A;  4KZ4 A;  4OON A;  1YLW A;  2BLS A;  5HL1 A;  3WWX A;  5CHU A;  5GLC A;  4PM7 A;  4O7D A;  2EX9 A;  1K38 A;  2FFY A;  3GTC A;  3WS5 A;  2EXB A;  4OOL A;  1W7F A;  1MXO A;  2XK1 A;  1U60 A;  4IED A;  4JXG A;  2HDS A;  4Q8I A;  1ONG A;  3VP1 A;  4F94 A;  4HBT A;  1L0G A;  1KGE A;  4MBF A;  5KSH A;  4R0Q A;  4BLM A;  3UDF A;  2JCH A;  1K56 D;  3FV7 A;  2OV5 A;  1XKZ A;  3ZGA B;  2G2W A;  3UDX A;  1GA9 A;  3N8L A;  3HLB A;  4LEN A;  4R3J A;  5CGX A;  4BJP A;  4BL3 A;  3OPL A;  2ZQ9 A;  2I72 A;  1H5X A;  4PM8 A;  1OME A;  1LHY A;  2Y2G A;  4C6Y A;  5FAS A;  3IF6 C;  5JYP A;  2XD5 A;  1FR6 A;  3DTM A;  4WZ4 A;  5A90 A;  1XP4 A;  2J7V A;  3ZNT A;  4UA7 A;  4ZTK A;  4X69 A;  5EVL A;  3UY6 A;  5M19 A;  1SHV A;  4DRT A;  1L0F A;  4ZDX A;  4UHU A;  2HDU A;  4M3K A;  4QHC A;  5IHV A;  1K55 A;  2R9W A;  4K0W A;  3IWQ A;  1ES3 A;  1MBL A;  1IEL A;  1DJA A;  5GLA A;  1YMX A;  2WUQ A;  2ZC5 B;  2XDM A;  3BLS A;  5EVI C;  3IF5 A;  4YIN A;  5HAQ A;  2IWC A;  2RCX A;  3AGF A;  4QY5 A;  2XH9 A;  2ZM2 A;  5AQ7 A;  5CHM A;  4DXC A;  5E43 A;  5E2F A;  1FCM A;  3LY4 A;  4U3T A;  3HUM A;  3BEB A;  5GL9 A;  3NC8 A;  2HP9 A;  3SS4 A;  5TR7 A;  5CTN A;  1K25 A;  3IF6 B;  3NDG A;  3G4P A;  2EX2 A;  5CHJ A;  5EVI A;  4GDB A;  4NK3 A;  5FI6 A;  3PBT A;  1BT5 A;  3M6B A;  3PBO A;  5HW3 A;  3GVB A;  4S2L A;  4L0L A;  5E2E A;  5JYO A;  4S2I A;  4R1G A;  4KQQ A;  2RL3 A;  2XLN A;  3P09 A;  3PBQ A;  2DCF A;  1GHM A;  3QNB A;  2OSU A;  4DDS A;  1VQQ A;  5DF7 A;  4ZJ1 A;  3Q7Z A;  5CRF A;  3C4P A;  1G6A A;  4E3L A;  1Y54 A;  3BFD A;  1FR1 A;  3M6H A;  3O88 A;  4QU3 A;  5EVI B;  5F82 A;  1K57 A;  1Z6F A;  4KG5 A;  4ZAM A;  5U47 A;  3MZD A;  4LV3 A;  4C3Q A;  1RGY A;  4U0T A;  1ALQ A;  1BTL A;  1SDN A;  3Q07 A;  5FA7 A;  4R23 A;  3UPO A;  4OH0 A;  1GA0 A;  3PBR A;  3PAE A;  1FSW A;  2Y59 A;  2WGI A;  1M40 A;  3ZG5 A;  1WYC A;  4R4S A;  5GHZ A;  4FSF A;  4WEL A;  3FZC A;  3AGD A;  4EUZ A;  4Y7P A;  1FCN A;  4HES A;  1IEM A;  5CEB A;  2XF3 A;  1K6S A;  5DTS A;  4QJG A;  1WYB A;  2J9O A;  4WYY A;  3ZG7 B;  4KZ3 A;  3LEZ A;  1E3U A;  1ERQ A;  4OP5 A;  2ZC6 B;  1K4E A;  4OQI A;  3GSG A;  4Y0U A;  1XA7 A;  3JYI A;  1CK3 A;  4IVI A;  2Y91 A;  3A3F A;  2Y2K A;  3PBS A;  4UA9 A;  3N7W A;  3IWI A;  4MBH A;  1NYM A;  1IKI A;  3CMZ A;  3Q1F A;  4PMA A;  1JTD A;  2C5W B;  3IXD A;  4IBX A;  1NZO A;  4OOY A;  2IWD A;  2C6W B;  3OC2 A;  4X56 A;  3A3E A;  3ZVW A;  4RX3 A;  3PTE A;  5CGS A;  1IYS A;  4ID4 A;  5FQQ A;  2EXA A;  1ERM A;  5FQK A;  3ITB A;  3OCL A;  4WEK A;  5FAQ A;  5FI2 A;  4BD1 A;  3VP0 A;  2Y2H A;  3D4F A;  3MFD A;  5BOH A;  3C7U A;  5GLD A;  1I2W A;  4KQR A;  1ES5 A;  4DKI A;  3G34 A;  2ZLY A;  3W4P A;  1NY0 A;  1MPL A;  5DF8 A;  1CEF A;  4U0X A;  1SDE A;  1JWP A;  5EE8 A;  1W79 A;  3B3X A;  5A93 A;  3ZG0 A;  1G68 A;  2WZX A;  2Z2L B;  5CXW A;  5AQA A;  5FQ9 A;  5HAI A;  4DE1 A;  5L2F A;  5GHY A;  1HZO A;  2OLU A;  2Y2O A;  3W8K A;  1GHP A;  1IYQ A;  3OPR A;  1JWZ A;  4GN2 A;  1BLP A;  2H0T A;  3GV9 A;  1RGZ A;  3UE0 A;  5FDH A;  4X53 A;  2Y2M A;  2Y4A A;  4OLG A;  3Q81 A;  1IYP A;  2ZM8 A;  2BG1 A;  3DWZ A;  5DVA A;  5M18 A;  2ZC3 B;  2VGK A;  1EI5 A;  1K55 C;  3FKV A;  3G2Y A;  4GZB A;  2A3U A;  2ZM0 A;  3N6I A;  5FAO A;  1BUE A;  1LL5 A;  3SH8 A;  3O87 A;  4OP8 A;  5EEC A;  4R3B A;  1PW8 A;  4X55 A;  2ZQC A;  3CG5 A;  4ZJ3 A;  2QMI A;  3VFF A;  2EFU A;  5GLB A;  1IKG A;  3SS3 A;  1WE4 A;  3OPP A;  2Y2I A;  1TDL A;  4X68 A;  3WS4 A;  2ZQ7 A;  2PU4 A;  4BD0 A;  1NZU A;  3Q7V A;  1ERO A;  4JXV A;  5EVI D;  1DJC A;  4OPQ A;  1HVB A;  2XFS A;  1BLH A;  3HLC A;  5FAT A;  4FH2 A;  4UAA A;  1PZP A;  4CPK A;  2ZQD A;  3ZNY A;  1I2S A;  3ISG A;  4GD6 A;  4KZ8 A;  4EBP A;  3ZDJ A;  2J9P A;  3BYD A;  4B4Z A;  2B5R A;  5CEC A;  3IXG A;  3HLW A;  3SOI A;  5DTT A;  3HLF A;  2JC7 A;  1NXY A;  4FCF A;  1IYO A;  3VFH A;  1YLT A;  4OQH A;  5DF9 A;  3ZG9 B;  2R9X A;  1K57 C;  1PI5 A;  1O07 A;  1K4F A;  1MWT A;  1DJB A;  3RJU A;  1ESI A;  2WAD A;  2WKE A;  2ZJ9 A;  3FYZ A;  4DDY A;  1MY8 A;  3VMA A;  2WKH A;  5E2G A;  3ZCZ A;  4Y0O A;  3DW0 A;  3NDE A;  4WMC A;  5KSC A;  1XXM A;  4S2P A;  5KMW A;  3HL9 A;  2WKI A;  1E25 A;  1L0D A;  4N9K A;  1MWU A;  3Q82 A;  3BLM A;  1Q2Q A;  2V20 A;  3BFG A;  1QMF A;  3MKE A;  3WRZ A;  1GCE A;  3OZH A;  1W8Y A;  2H10 A;  3HVF A;  4JF6 A;  4E3M A;  5EUA A;  2PU2 A;  3M2K A;  3SH9 A;  1GHI A;  1SKF A;  3EQV A;  2Y2Q A;  4E3J A;  3IHA A;  2WGW A;  5CED A;  3W4Q A;  1E3U D;  3A3J A;  5AQ9 A;  4JLF A;  1XPB A;  4KZ6 A;  3RXW A;  3QHY A;  1JWV A;  3NBL A;  1HD8 A;  3ZFZ A;  4C75 A;  4IVK A;  2WGV A;  1ZG6 A;  3CZD A;  1PWD A;  1CEG A;  3M2J A;  4KZB A;  4EBN A;  5AQB A;  2EFX A;  3BM6 A;  5G18 A;  3N4I A;  3MBZ A;  1L0E A;  3G30 A;  4FD8 A;  5KZH A;  5J8X A;  1JTG A;  1YLZ A;  2WGW B;  4OPZ A;  4S2N C;  5EOO A;  4RX2 A;  1W5D A;  3BFC A;  5CGW A;  4RYE A;  3SH7 A;  3W4O A;  4JXW A;  3IHB A;  4JXS A;  1QME A;  1ZG4 A;  2XQZ A;  5GHX A;  1PW1 A;  1ESU A;  4S2N A;  1KDS A;  1L2S A;  4ZJ2 A;  4PM5 A;  3BEC A;  3QNC A;  1TDG A;  4JF5 A;  5EOE A;  1XGJ A;  2E8I A;  2QPN A;  3FKW A;  3NCK A;  3O86 A;  4GOG A;  4BL2 A;  1NJ4 A;  2A49 A;  2P74 A;  3C5A A;  1K6R A;  1J9M A;  1KGG A;  4WEJ A;  4YFM A;  1BZA A;  5E2H A;  3TSG A;  4EV4 A;  4B88 A;  2IWB A;  4CJN A;  1EWZ A;  4E3K A;  2V1Z A;  3V39 A;  2J8Y A;  2CC1 A;  3BFE A;  3PBN A;  3ZHH A;  1YT4 A;  5M1A A;  3UE1 A;  3IH9 A;  1K54 C;  1PI4 A;  2VGJ A;  1Q2P A;  3NY4 A;  3A3I A;  3O3V A;  1XX2 A;  3NI9 A;  4P87 A;  3HUO A;  4JPM A;  3S22 A;  1E4D A;  2WK0 A;  1FCO A;  4KZ5 A;  4EQI A;  2Y2L A;  2HP6 A;  4IBR A;  2DNS A;  1FSY A;  4R4R A;  4RA7 A;  3N8S A;  4E3N A;  4N1X A;  4S2O A;  2XR0 A;  2X02 A;  1K54 A;  4LV2 A;  3BFF A;  4LV0 A;  3VOY A;  2PBY A;  4KQO A;  3ITA A;  3WRT A;  1I5Q A;  2WZZ A;  5FI7 A;  1H8Y A;  4DF6 A;  4MNR A;  3UPP A;  2WYX A;  2QZ6 A;  2H5S A;  3HLE A;  1KGF A;  4X6T A;  4XUX A;  3HRE A;  4OQG A;  3SS5 A;  4RVA A;  4WBG A;  3HUN A;  3HLG A;  3AGE A;  4KZA A;  2XEP A;  4QB8 A;  3IQA A;  3UPN A; 
#chains in the Genus database with same CATH topology
 3MXS A;  5L10 A;  3MF0 A;  1PIO A;  5A92 A;  1K56 A;  2GDN A;  2VV6 A;  4OVD A;  2VKS A;  5HAP A;  2ZC4 B;  4MEZ A;  3GQZ A;  1RCJ A;  4OOM A;  1FQG A;  1PWG A;  2Q0O A;  4PM6 A;  4WMC D;  3Q7V B;  4KQD A;  1YLJ A;  1YLP A;  5CX7 A;  1YQS A;  4HHD A;  3IXB A;  3E2K A;  4OPR A;  1KE3 A;  4E3I A;  4DXB A;  4H6J A;  2HDR A;  3C7V A;  3CPT A;  1AXB A;  2Q9M A;  1W63 M;  4N92 A;  4HBU A;  4KUK A;  4XT2 A;  3F1N B;  5TFQ A;  4UQI M;  3VSK A;  4G3V A;  1TEM A;  3OPH A;  3GMW A;  1VB6 A;  4QD4 A;  4S2M A;  4JKT A;  1XJ6 A;  5HZH A;  2PR5 A;  3G31 A;  4ZRR A;  4GLQ A;  2LB9 A;  4Y15 A;  4P6Z M;  2Y8H A;  4LCM A;  4KZ7 A;  2VV8 A;  3A3D A;  1K0K A;  5EFW A;  1BSG A;  1DY6 A;  1HTZ A;  3LUQ A;  1OTE A;  1MWS A;  2M1C A;  3EQU A;  3QP4 A;  4N9L A;  4OLD A;  4QY6 A;  4S2J A;  3KX0 X;  3FWL A;  2UWX A;  2H0Y A;  1C3B A;  2XGN A;  2ZQA A;  3FG8 A;  3G35 A;  3IXH A;  5F69 A;  1N9B A;  3UDI A;  4DJ3 A;  5HX9 A;  3N8R A;  2DRW A;  4L9G A;  2ZD8 A;  4H8R A;  1YLY A;  4KZ4 A;  5FEF A;  1YLW A;  5CHU A;  5GLC A;  1OTA A;  4PM7 A;  4O7D A;  5DJU A;  3BY8 A;  4IED A;  1U60 A;  4Q8I A;  3P7N A;  1ONG A;  4F94 A;  1L0G A;  4R0Q A;  4BLM A;  3UDF A;  1LSX A;  2JCH A;  3DBA A;  3KYE A;  5DFY A;  2YKF A;  1AWI A;  1SKO A;  3L9K A;  2KX6 A;  5JYP A;  1FR6 A;  3DTM A;  4MN6 A;  4WZ4 A;  4X69 A;  3UY6 A;  1FIL A;  1SHV A;  1L0F A;  2ZOH A;  2HDU A;  3IWQ A;  5J7E A;  4I3A A;  2VEA A;  1YMX A;  2ZC5 B;  4YIN A;  5HAQ A;  2IWC A;  3AGF A;  1YSQ A;  5CHM A;  5DKL A;  1FCM A;  5GL9 A;  3LID A;  3NDG A;  5EVI A;  1KOU A;  4NK3 A;  5FI6 A;  3C8C A;  4S2L A;  1ODV A;  4KQQ A;  2RL3 A;  3P09 A;  1FIK A;  3PBQ A;  4CQH A;  2DCF A;  2OSU A;  1VQQ A;  3BY9 A;  4ZJ1 A;  5EVI B;  1V9Y A;  4KG5 A;  4LV3 A;  1RGY A;  1ALQ A;  2VX8 A;  3HCY A;  1TS8 A;  2R78 A;  3ZG5 A;  1M40 A;  4WEL A;  3FZC A;  4EUZ A;  4Y7P A;  5IS1 A;  4MDZ A;  5CEB A;  5DTS A;  1VHM A;  4HP9 A;  3LEZ A;  2A2L A;  4OQI A;  3T4T A;  4Y0U A;  1CK3 A;  3PBS A;  2OWJ A;  1IKI A;  1JTD A;  2C5W B;  2L4R A;  3G6O A;  1IYS A;  5FQQ A;  2OAP 1;  4JGP A;  4RQ9 A;  4WEK A;  5FAQ A;  2V1A A;  3VP0 A;  4HJ3 A;  4Y2F A;  3MFD A;  5BOH A;  3C7U A;  4KQR A;  4NEE D;  1NWZ A;  1ES5 A;  1NY0 A;  1CEF A;  2D01 A;  3EOI A;  2WZX A;  4DE1 A;  4EUV A;  1S1Z A;  1IYQ A;  2HJ9 C;  3MQO A;  1JWZ A;  1BLP A;  3GV9 A;  3PR6 A;  2CMN A;  3T12 B;  1T19 A;  1XJ4 A;  3G2Y A;  2PYP A;  2ZM0 A;  3N6I A;  1LL5 A;  1TD5 A;  3FPV A;  2ZQC A;  3CG5 A;  2EFU A;  5GLB A;  1IKG A;  3SS3 A;  1WE4 A;  1TDL A;  2PU4 A;  3B42 A;  1ERO A;  2HV1 A;  3HLC A;  4FH2 A;  1PZP A;  4EW7 A;  2GNX A;  1VEU A;  3ZDJ A;  3BYD A;  1ACF A;  4LFU A;  3IXG A;  3HLW A;  5DTT A;  2JC7 A;  3LEQ A;  3VFH A;  1YLT A;  5DF9 A;  3ZG9 B;  1K57 C;  1DJB A;  2WAD A;  2ZJ9 A;  4DDY A;  3ZQ5 A;  1VEU B;  3DW0 A;  4WMC A;  4NKP A;  2WKI A;  5AJG A;  1D06 A;  1E25 A;  3RFB A;  4N9K A;  3Q82 A;  3BLM A;  3MKE A;  2V1B A;  4JF6 A;  1T18 A;  5EUA A;  3M2K A;  2Y2Q A;  4E3J A;  2XSS A;  3IHA A;  1D1J A;  3W4Q A;  1E3U D;  4JLF A;  2XA7 M;  4KZ6 A;  3QHY A;  4WLA A;  1HD8 A;  3VOL A;  4IVK A;  2WGV A;  1ZG6 A;  3LR3 A;  3NOP C;  2EFX A;  1X0O A;  3BM6 A;  3KSH A;  5J8X A;  4HY8 A;  4Z1W A;  3BFC A;  3T1S A;  3W4O A;  2ZL1 A;  3C30 A;  1LT0 A;  1KDS A;  1L2S A;  1WA9 A;  4HIA A;  1XFQ A;  4Y13 A;  1TDG A;  4JF5 A;  3NCK A;  1T1C A;  5E2H A;  3TSG A;  1BZA A;  2IWB A;  4E3K A;  2V1Z A;  3F1P A;  2J8Y A;  3BFE A;  2ZBB A;  1K54 C;  2VGJ A;  3QP6 A;  3MJQ A;  3O3V A;  4JPM A;  1E4D A;  1FCO A;  2Y2L A;  2HP6 A;  2DNS A;  4N1X A;  5TBM A;  2X02 A;  4HQA A;  3F1P B;  3NOU C;  4EU0 A;  3UPP A;  4X6T A;  3LIC A;  4MCW A;  3SS5 A;  3HUN A;  3HLG A;  4KZA A;  3TJZ C;  4KUO A;  4K08 A;  3SW1 A;  1CQA A;  3NIA A;  3IH8 A;  5TBM B;  1VM1 A;  1BLC A;  5HFO A;  4A5R A;  1Y4O A;  4FUW A;  3LI8 A;  4XXR A;  2JKT I;  1BLS A;  4BQM A;  1V9Z A;  3IWO A;  4GNU A;  4MBK A;  1RP5 A;  3TRC A;  5FQI A;  1XJ3 A;  2FFF B;  3WS2 A;  1FOF A;  3NOT C;  3E98 A;  1T1B A;  4JBF A;  4E3O A;  1MWR A;  3IX8 A;  5EV0 A;  4I39 A;  2K2N A;  5CER A;  2XD1 A;  5HL6 A;  4OQ0 A;  5I94 A;  3G2Z A;  3CWF A;  3P01 A;  4K0X A;  4O0P A;  1OJ5 A;  1KVM A;  1DRM A;  1DP8 A;  3MXQ A;  2FH5 A;  5F1F A;  3FPW A;  3RH8 B;  4GS9 B;  4AFI A;  1GSW A;  1LI0 A;  4OKP A;  3BWL A;  3GR2 A;  3VOZ A;  2KDK A;  2VGL S;  1KDW A;  3MZE A;  1XJ2 A;  4KZ9 A;  2ZC7 A;  2JE5 A;  3T1R A;  2JKF A;  4B4X A;  1O7E A;  3ZVT A;  3LCE A;  4II7 A;  5A91 A;  3UMD A;  3LR4 A;  5EVE A;  2H28 A;  1CF0 A;  1SZV A;  1S4R A;  4D2O A;  4WZ5 A;  3DAV A;  2KLI A;  4E6X A;  2Q9N A;  3H82 A;  1JVJ A;  1KE0 A;  1KVL A;  4FH4 A;  2Y79 A;  4DE0 A;  5LBR A;  3V3S A;  4B9O A;  3UO9 A;  2OLV A;  4P0M A;  3UNW A;  3BJN A;  1LL9 A;  2BLS A;  3WWX A;  3GTC A;  4OOL A;  1W7F A;  2XK1 A;  2HDS A;  1TF1 A;  1PFL A;  2G2W A;  3UB7 A;  4LEN A;  4EEP A;  4M4X A;  2VZW A;  4PM8 A;  1OME A;  2Y2G A;  3IF6 C;  2XD5 A;  4IUH A;  2PBD P;  1XP4 A;  2J7V A;  3ZNT A;  4UA7 A;  3T4O A;  1LL8 A;  1YPR A;  1HLU P;  1TS6 A;  2BTF P;  4K0W A;  1IEL A;  1DJA A;  3TW8 A;  1T1A A;  3BLS A;  3IF5 A;  2RCX A;  2ZM2 A;  5E2F A;  4U3T A;  3HUM A;  4Y17 A;  2HP9 A;  1K25 A;  5HPI A;  1BT5 A;  3T4L A;  5HW3 A;  3GVB A;  5JYO A;  4L0L A;  2V0U A;  3R7W A;  3EGX C;  1OT9 A;  1GHM A;  4DDS A;  1Z09 A;  1ZTU A;  3A0S A;  1G6A A;  3M6H A;  4H6J B;  1K57 A;  1Z6F A;  5EM0 A;  3CPT B;  1OT6 A;  4ZAM A;  4C3Q A;  4U0T A;  3R7W B;  5FL3 A;  2NUP C;  1SDN A;  1G6O A;  2W0N A;  4R23 A;  3UPO A;  3DTI A;  2WGI A;  4XT2 B;  5TJJ A;  4FSF A;  2EWV A;  4HES A;  3CUE C;  1K6S A;  2J9O A;  4WYY A;  3ZG7 B;  4KZ3 A;  1E3U A;  3U2A A;  5HDC A;  2VJW A;  3GSG A;  3JVU A;  4IVI A;  2Y2K A;  4UA9 A;  1BYW A;  3N7W A;  4I3I A;  5I5L A;  3IWI A;  4MBH A;  1NYM A;  3CMZ A;  4PMA A;  3E4Q A;  2UV0 E;  3EWK A;  4O01 A;  3E0Y A;  3ZVW A;  2VA0 A;  3ITB A;  3OCL A;  2Y2H A;  3H9W A;  4DKI A;  4CLC C;  3F1O A;  5DF8 A;  3JPU A;  5EE8 A;  5A8B A;  1H0M A;  3MSH A;  5HAI A;  5GHY A;  3OPR A;  1RGZ A;  4X53 A;  3Q81 A;  1IYP A;  3U4L P;  1K55 C;  4GZB A;  1BUE A;  2W3G A;  4OP8 A;  2D02 A;  4X55 A;  2P7J A;  3ICY A;  4X68 A;  3S7N A;  2ZQ7 A;  4FOF A;  1SKO B;  1NZU A;  1HVB A;  3QP2 A;  5FAT A;  4CPK A;  2ZQD A;  4I5S A;  3QP5 A;  4EBP A;  2B5R A;  4JGO A;  5CEC A;  2O9C A;  1MKM A;  1NXY A;  4FCF A;  2HGV A;  3IBR A;  1N9O A;  2R9X A;  1O07 A;  1K4F A;  3RJU A;  2J80 A;  3FYZ A;  2PYR A;  1MY8 A;  4FTX A;  3VMA A;  5E2G A;  3LIE A;  5KSC A;  3S7P A;  3HL9 A;  4JGR A;  3ZYT A;  5EM1 A;  1Q2Q A;  2V20 A;  3OZH A;  4Y5F A;  3R4K A;  4E3M A;  2PDR A;  4ARZ A;  3SH9 A;  1GHI A;  1SKF A;  3NUL A;  5HWV A;  4I3J A;  3RTY A;  4YOF A;  4PKY G;  3M2J A;  4KZB A;  3OBF A;  2B18 A;  2W1R A;  5G18 A;  4ARZ B;  3N4I A;  3D3O A;  4WUJ A;  5KZH A;  4S2N C;  4RYE A;  3SH7 A;  4JXW A;  2M7V A;  1QME A;  2XQZ A;  3TE8 A;  4ETZ A;  2VLG A;  3UB9 A;  4ZJ2 A;  4PM5 A;  3QNC A;  3KYQ A;  1XGJ A;  2E8I A;  4BL2 A;  2A49 A;  4NG2 A;  1J9M A;  1KGG A;  3BQA A;  4EV4 A;  4B88 A;  3T4S A;  3IBJ A;  4LRX C;  3O5Y A;  3KSF A;  2Z6C A;  1PI4 A;  3NY4 A;  1Q2P A;  3A3I A;  3HUO A;  3S22 A;  3T4J A;  4BWI A;  2WK0 A;  4EQI A;  4IBR A;  2EA9 A;  2PHY A;  3BFF A;  2WZZ A;  5FDS A;  5L09 A;  2QKP A;  3H7W A;  4XUX A;  5KMW A;  3AGE A;  1VET A;  4E04 A;  2JN7 A;  4LPZ A;  3VSL A;  1BUL A;  4WL9 A;  4GW9 A;  1PWC A;  5FQM A;  1UWP X;  3H7W B;  3KO6 A;  2V2F F;  5IU1 A;  3S7Q A;  2O0Y A;  1VET B;  3IF6 A;  4NXE A;  1KE4 A;  3T4K A;  4LV1 A;  4NXG A;  3MKF A;  5FSR A;  3UN7 A;  5HAR A;  3VP2 A;  1XA1 A;  3S1Y A;  4DE2 A;  4EET B;  2WAF A;  2JBF A;  4QPR A;  3PAG A;  1PYY A;  4P85 A;  5J3W A;  5DTK A;  4PKY A;  4Y0T A;  3CJM A;  5HPF A;  2Y55 A;  4K91 A;  4KG6 A;  4Z9Q A;  5EPH A;  3MFX A;  1ES2 A;  4BBV A;  2Y2J A;  3IT9 A;  1H8Z A;  2HP5 A;  3V5M A;  2JKR M;  4LCL A;  2EWW A;  2V8F A;  3G32 A;  2G2U A;  4PHT A;  4ESP A;  4BBT A;  3V50 A;  2EX6 A;  2QWS A;  1N9N A;  1ZKJ A;  1OJG A;  4OPY A;  2X01 A;  3S4X A;  4X1L A;  4EBL A;  2INW A;  4O8G A;  1LSW A;  2W3E A;  1S6R A;  4EWF A;  1CJF A;  2WKQ A;  4GD8 A;  5FAP A;  3C2W A;  1S4S A;  3V3R A;  1CI8 A;  4Q0I A;  1NRF A;  2P9V A;  3LO7 A;  3S7O A;  1UGU A;  1YMS A;  2ZL1 B;  4P6Z S;  2P08 A;  2XFT A;  2O99 A;  4KEN B;  5KIZ A;  1PZO A;  3A0V A;  1P9W A;  4GDN A;  2W27 A;  4UA6 A;  3UE3 A;  1TVF A;  2P9V B;  3VP4 A;  3LY3 A;  1SCW A;  4OON A;  2DMW A;  5HL1 A;  1OTB A;  2EX9 A;  1K38 A;  2FFY A;  3NEC A;  2EXB A;  4JXG A;  1P0Z A;  3EEH A;  3K3C A;  4HBT A;  4MBF A;  2OV5 A;  1XKZ A;  3UDX A;  3VE4 A;  2J3W A;  3N8L A;  3HLB A;  5CGX A;  4BL3 A;  3LR5 A;  5DFX A;  2ZQ9 A;  2I72 A;  4LGW A;  1LHY A;  4C6Y A;  2PRF A;  4QWO A;  5EVL A;  4DRT A;  3QP1 A;  4G3K A;  4QHC A;  4JGQ A;  1K55 A;  1MBL A;  4MN7 A;  2ACG A;  1JNU A;  2WUQ A;  2XDM A;  5EVI C;  2L0W A;  3MR0 A;  4QY5 A;  2XH9 A;  3DTE A;  4DXC A;  3LY4 A;  5TR7 A;  4GHI A;  5CHJ A;  3G4P A;  3PBT A;  3M6B A;  4LRY C;  3CLO A;  2LB5 A;  4F3L A;  5HD3 A;  4R1G A;  2XLN A;  3QNB A;  1TS7 A;  5DF7 A;  3Q7Z A;  5CRF A;  3C4P A;  1TS0 A;  1Y54 A;  3O88 A;  1FR1 A;  1PRQ A;  5F82 A;  1BTL A;  5HSQ A;  3Q07 A;  5FA7 A;  3PBR A;  1WYC A;  4R4S A;  5GHZ A;  1L3L A;  3IX4 A;  1FCN A;  4QJG A;  3EEA A;  1ERQ A;  2ZC6 B;  2PAV P;  1K4E A;  4L9F A;  2ZOI A;  5HDD A;  2V9A A;  4IBX A;  1DP6 A;  1NZO A;  2J3T D;  4Q0H A;  2C6W B;  2J3T C;  4GCZ A;  4X56 A;  2OWH A;  2GX5 A;  5FQK A;  2W1T A;  5FI2 A;  3D4F A;  5GLD A;  1I2W A;  4DMZ A;  3G34 A;  4Q0J A;  2QHK A;  3W4P A;  1ZHH B;  3LR0 A;  2A24 A;  3H82 B;  1W79 A;  5A93 A;  1YAX A;  1G68 A;  5L2F A;  5CXW A;  5FQ9 A;  1HZO A;  2JHE A;  3W8K A;  3UE6 A;  4EES A;  4X25 A;  2H0T A;  3L7H A;  5F5Y A;  4OLG A;  5M18 A;  2ZM8 A;  2A24 B;  3CIT A;  2A3U A;  4MN5 A;  3SH8 A;  3JVV A;  4R3B A;  4ZJ3 A;  1PNE A;  2Y2I A;  4I38 A;  1MC0 A;  3WS4 A;  3Q7V A;  4JXV A;  1DJC A;  5C5K A;  4UAA A;  3ZNY A;  3ISG A;  3NJA A;  4GD6 A;  2J9P A;  2GJ3 A;  4B4Z A;  2P04 A;  1F5M A;  2O9A A;  1MWT A;  4R38 A;  3UB8 A;  4Y0O A;  3F1N A;  3NDE A;  1XXM A;  4S2P A;  4R6L A;  1L0D A;  4L9E A;  1QMF A;  2H10 A;  2PU2 A;  2XRO A;  3NHQ A;  4NXB A;  3A3J A;  5AQ9 A;  1XPB A;  2V8C A;  3RXW A;  1JWV A;  2MJ6 A;  3NBL A;  4YNR A;  3ZFZ A;  2PD7 A;  4IHQ A;  3B47 A;  3KSG A;  2QJ7 A;  3CZD A;  5K5B A;  5AQB A;  3MBZ A;  1L0E A;  4WF0 A;  5AVF A;  4IJG A;  1JTG A;  1YLZ A;  5EOO A;  2B95 A;  2HF6 A;  1W5D A;  1F9I A;  3IHB A;  4JXS A;  3UME A;  2K7S A;  5GHX A;  2XA7 S;  1D7E A;  1G5U A;  3W2Z A;  2WKR A;  2OAQ 1;  2JKT M;  3D72 A;  2JKG A;  5IT5 A;  5EOE A;  3O86 A;  5F68 A;  1NJ4 A;  2P74 A;  2E8J A;  4YFM A;  2O9B A;  1EWZ A;  4CLC D;  5DJT A;  4HNB A;  3PBN A;  3ZHH A;  5M1A A;  5DKK A;  3UE1 A;  1NLZ A;  2V0W A;  3NI9 A;  4P87 A;  1FSY A;  2JKR I;  4E3N A;  4S2O A;  2XR0 A;  1K54 A;  4LV0 A;  3F1O B;  4KQO A;  3ITA A;  4G3W A;  5FI7 A;  1H8Y A;  4DF6 A;  4MNR A;  1G28 A;  4LRZ E;  1KGF A;  4QB8 A;  2XRN A;  2Z6D A;  3DWK A;  3GRJ A;  4GB7 A;  4N1H A;  4WM9 A;  4X1M A;  1J3W A;  3MQQ A;  2AVX A;  3VP3 A;  3LFV A;  1W8Q A;  2NUT C;  2W3F A;  3HBR A;  5D3O A;  2Y2N A;  5MC7 A;  4MMN A;  5AVE A;  5F83 A;  3I7J A;  2ZMA A;  4E6W A;  4MLL A;  3E4O A;  1ES4 A;  3KSI A;  4B93 A;  3WS1 A;  4CLC E;  1CI9 A;  3RXX A;  2HDQ A;  1P9R A;  2G7U A;  4HEF A;  3C4O A;  4KG2 A;  3VE3 A;  4GKU A;  2ZQ8 A;  3VV4 A;  3K2N A;  3GEC A;  4DE3 A;  3LIA A;  1M6K A;  1N4O A;  2VGL M;  1YM1 A;  2X71 A;  1MKI A;  2VV7 A;  4P6B A;  1ZC2 A;  3MZF A;  2Z2M B;  4BBU A;  2L1M A;  3PXP A;  2Y2P A;  4ETX A;  3MXR A;  1LLB A;  3TOI A;  1EW0 A;  5F1G A;  3LYX A;  3E2L A;  3DTK A;  1OTD A;  2BAS A;  4BEN A;  3OCN A;  3PYP A;  1YSP A;  3HLD A;  2EX8 A;  5CTM A;  1MZU A;  2WAE A;  1XGI A;  1NYY A;  2HPB A;  4ZBE A;  4WN5 A;  3P98 A;  1S0W A;  1H3Q A;  5HDS A;  4JF4 A;  4S2K A;  2QYB A;  1ONH A;  4WZ5 C;  1F2K A;  3BRM A;  4EEU A;  3OOV A;  3WS0 A;  3ZG8 B;  3TG9 A;  1LI9 A;  1IFQ A;  4HP4 A;  5FQJ A;  4Y3I A;  2GZA A;  5TGF A;  4PPR A;  4XUZ A;  4PM9 A;  3LIF A;  2W3D A;  4NET A;  1S1Y A;  3LIB A;  4EER A;  2WKP A;  3WS5 A;  1MXO A;  3ULF A;  2PD8 A;  3LGO A;  1DP9 A;  1KGE A;  5KSH A;  3FV7 A;  1K56 D;  3ZGA B;  1GA9 A;  4R3J A;  4BJP A;  3OPL A;  3CHW P;  1H5X A;  3C38 A;  5FAS A;  3GDI A;  1NRJ A;  5A90 A;  4ZTK A;  5M19 A;  4ZDX A;  4HI4 A;  4UHU A;  3V67 A;  1N9L A;  4M3K A;  1IOU A;  5IHV A;  2R9W A;  4ME4 A;  1ES3 A;  3K3D A;  5GLA A;  2ZMV A;  2M7U A;  3UB5 P;  3E4P A;  5AQ7 A;  5E43 A;  3T1X A;  3BEB A;  3NC8 A;  5HD5 A;  1S66 L;  3CAX A;  5CTN A;  3SS4 A;  3IF6 B;  5J4E A;  2EX2 A;  4GDB A;  2FZ0 A;  3PBO A;  5E2E A;  4S2I A;  4NXF A;  4E3L A;  3BFD A;  4QU3 A;  4UEY A;  5F6A A;  4EQ1 A;  3UB6 A;  5U47 A;  3MZD A;  3PHY A;  1S67 L;  3QP8 A;  4BMW A;  4OH0 A;  1GA0 A;  3PAE A;  1FSW A;  2Y59 A;  3AGD A;  4LLO B;  1IEM A;  4UQI S;  2XF3 A;  1WYB A;  5G4Z A;  4OP5 A;  3CUE A;  4HJ6 A;  1XA7 A;  3JYI A;  3HJK A;  3MQ0 A;  4PAU A;  2Y91 A;  3A3F A;  3Q1F A;  4HJ4 A;  3IXD A;  3FC7 A;  4OOY A;  2IWD A;  3OC2 A;  3A3E A;  4RX3 A;  3PTE A;  5CGS A;  3T4Q A;  4ID4 A;  4DN0 A;  2EXA A;  1ERM A;  4BD1 A;  1F98 A;  1P97 A;  2VK3 A;  2ZLY A;  2ZMF A;  3EGD C;  1MPL A;  4U0X A;  1SDE A;  1JWP A;  1LSV A;  3B33 A;  5FEG A;  3B3X A;  3ZG0 A;  5AQA A;  2Z2L B;  4CLC A;  2OLU A;  4HH3 A;  2Y2O A;  1GHP A;  4GN2 A;  1H8M A;  3UE0 A;  5FDH A;  3SZT A;  2Y2M A;  2Y4A A;  2BG1 A;  3DWZ A;  5DVA A;  4DJ2 A;  2ZC3 B;  2VGK A;  1EI5 A;  3FKV A;  3VP1 A;  5FAO A;  3O87 A;  5EEC A;  3KYZ A;  4HOI A;  1PW8 A;  4CLC B;  2QMI A;  3IX3 A;  3VFF A;  1GSV A;  3T1Q B;  3OPP A;  5HWW A;  4BD0 A;  1OPX A;  5EVI D;  1YKD A;  3CI6 A;  4OPQ A;  2XFS A;  1BLH A;  1I2S A;  2K31 A;  4KZ8 A;  2KOI A;  2PR6 A;  1STZ A;  3SOI A;  3HLF A;  1IYO A;  3IS2 A;  4OQH A;  1UWN X;  4R70 A;  4HH2 A;  1PI5 A;  1ESI A;  2WKE A;  4YWZ A;  4D60 A;  2WKH A;  1OTI A;  3ZCZ A;  4R3A A;  4GHI B;  3HJI A;  4IUK A;  1MWU A;  2OOL A;  4F3L B;  3BFG A;  3WRZ A;  1GCE A;  4GS9 A;  1W8Y A;  3IS2 B;  3MMH A;  3HVF A;  4EXO A;  1XFN A;  1A0K A;  3EQV A;  5L07 A;  4GJ4 A;  2WGW A;  5CED A;  3BW6 A;  4C75 A;  2YKH A;  2HJE A;  1PWD A;  1CEG A;  1Y28 A;  4EBN A;  2HZ5 A;  3G30 A;  3D9Y A;  4FD8 A;  2WGW B;  4OPZ A;  2W3H A;  3LI9 A;  4RX2 A;  3A0R A;  5CGW A;  1ZG4 A;  2QJ5 A;  3MS6 A;  1PW1 A;  1ESU A;  4S2N A;  3BEC A;  3T50 A;  2QPN A;  3FKW A;  4GOG A;  3C5A A;  1K6R A;  4WEJ A;  4CJN A;  3V39 A;  2B02 A;  5HWT A;  2I9V A;  2CC1 A;  1YT4 A;  5L8M A;  3IH9 A;  1GSX A;  1XX2 A;  2W1T B;  4KZ5 A;  2IA2 A;  4R4R A;  4RA7 A;  3N8S A;  5G4Y A;  4LV2 A;  3VOY A;  2PBY A;  3WRT A;  1I5Q A;  3BQ8 A;  2PT7 A;  1W63 Q;  2WYX A;  1NLY A;  2QZ6 A;  2H5S A;  3HLE A;  3HRE A;  3OLO A;  4OQG A;  4RVA A;  4WBG A;  3UPN A;  2XEP A;  3IQA A; 
#chains in the Genus database with same CATH homology
 3DWK A;  3NIA A;  3GRJ A;  3IH8 A;  4GB7 A;  1VM1 A;  1BLC A;  3MXS A;  4N1H A;  4WM9 A;  5HFO A;  3VSL A;  1BUL A;  1PIO A;  5A92 A;  1PWC A;  1K56 A;  4A5R A;  2GDN A;  3VP3 A;  1W8Q A;  4OVD A;  5FQM A;  3HBR A;  5D3O A;  5HAP A;  2Y2N A;  4XXR A;  2V2F F;  1BLS A;  4BQM A;  2ZC4 B;  4MEZ A;  3IF6 A;  3IWO A;  1KE4 A;  4GNU A;  3GQZ A;  4MBK A;  1RP5 A;  5F83 A;  1RCJ A;  3I7J A;  4LV1 A;  5FQI A;  2ZMA A;  2FFF B;  4OOM A;  1FQG A;  1PWG A;  4E6W A;  3MKF A;  4PM6 A;  4WMC D;  5FSR A;  3WS2 A;  3Q7V B;  3UN7 A;  1YLJ A;  5HAR A;  3VP2 A;  4MLL A;  1YLP A;  1FOF A;  1XA1 A;  1ES4 A;  3S1Y A;  4DE2 A;  1YQS A;  2WAF A;  2JBF A;  3WS1 A;  3IXB A;  1CI9 A;  3E2K A;  3PAG A;  3RXX A;  1PYY A;  1KE3 A;  2HDQ A;  4JBF A;  4OPR A;  4P85 A;  4E3I A;  4E3O A;  5DTK A;  1MWR A;  4DXB A;  4HEF A;  3C4O A;  2HDR A;  3CJM A;  4KG2 A;  4Y0T A;  3C7V A;  4GKU A;  1AXB A;  2Q9M A;  2Y55 A;  4K91 A;  2ZQ8 A;  4KG6 A;  4Z9Q A;  5EPH A;  4N92 A;  4DE3 A;  5CER A;  1ES2 A;  2Y2J A;  2XD1 A;  1M6K A;  3IT9 A;  4HBU A;  1H8Z A;  1N4O A;  1YM1 A;  2HP5 A;  2X71 A;  4OQ0 A;  3V5M A;  5I94 A;  4LCL A;  3G2Z A;  3G32 A;  2G2U A;  1MKI A;  5TFQ A;  3V50 A;  4P6B A;  1ZC2 A;  4K0X A;  2EX6 A;  3MZF A;  2Z2M B;  1KVM A;  3VSK A;  1TEM A;  2Y2P A;  3OPH A;  1ZKJ A;  1LLB A;  3MXR A;  3TOI A;  5F1F A;  3GMW A;  4OPY A;  2X01 A;  4QD4 A;  3S4X A;  4S2M A;  5F1G A;  4JKT A;  4EBL A;  1LI0 A;  3E2L A;  3G31 A;  4OKP A;  3GR2 A;  3VOZ A;  1S6R A;  4BEN A;  3OCN A;  4EWF A;  4GD8 A;  5FAP A;  1KDW A;  3MZE A;  4LCM A;  4KZ7 A;  3HLD A;  4KZ9 A;  3A3D A;  2EX8 A;  5CTM A;  1BSG A;  1DY6 A;  1HTZ A;  1XGI A;  2WAE A;  1NYY A;  2ZC7 A;  1CI8 A;  2HPB A;  2JE5 A;  1MWS A;  3V3R A;  4ZBE A;  1O7E A;  4B4X A;  3P98 A;  1S0W A;  3ZVT A;  3LCE A;  4JF4 A;  4S2K A;  5A91 A;  3EQU A;  1ONH A;  1NRF A;  2P9V A;  4N9L A;  4OLD A;  4WZ5 C;  3LO7 A;  3BRM A;  4QY6 A;  4S2J A;  4D2O A;  1YMS A;  3WS0 A;  3ZG8 B;  3TG9 A;  1LI9 A;  2XFT A;  3FWL A;  4KEN B;  5FQJ A;  2UWX A;  1PZO A;  1C3B A;  2H0Y A;  2XGN A;  2ZQA A;  3G35 A;  3IXH A;  4WZ5 A;  1N9B A;  3UDI A;  4E6X A;  5HX9 A;  3N8R A;  5TGF A;  2Q9N A;  4PPR A;  4GDN A;  1JVJ A;  4UA6 A;  4XUZ A;  3UE3 A;  2DRW A;  1TVF A;  1KE0 A;  1KVL A;  4FH4 A;  4DE0 A;  4PM9 A;  2ZD8 A;  3V3S A;  3UO9 A;  4H8R A;  2OLV A;  4NET A;  2P9V B;  4P0M A;  3UNW A;  1LL9 A;  3LY3 A;  1YLY A;  3VP4 A;  1SCW A;  4KZ4 A;  4OON A;  1YLW A;  2BLS A;  5HL1 A;  3WWX A;  5CHU A;  5GLC A;  4PM7 A;  4O7D A;  2EX9 A;  1K38 A;  2FFY A;  3GTC A;  3WS5 A;  2EXB A;  4OOL A;  1W7F A;  1MXO A;  2XK1 A;  1U60 A;  4IED A;  4JXG A;  2HDS A;  4Q8I A;  1ONG A;  3VP1 A;  4F94 A;  4HBT A;  1L0G A;  1KGE A;  4MBF A;  5KSH A;  4R0Q A;  4BLM A;  3UDF A;  2JCH A;  1K56 D;  3FV7 A;  2OV5 A;  1XKZ A;  3ZGA B;  2G2W A;  3UDX A;  1GA9 A;  3N8L A;  3HLB A;  4LEN A;  4R3J A;  5CGX A;  4BJP A;  4BL3 A;  3OPL A;  2ZQ9 A;  2I72 A;  1H5X A;  4PM8 A;  1OME A;  1LHY A;  2Y2G A;  4C6Y A;  5FAS A;  3IF6 C;  5JYP A;  2XD5 A;  1FR6 A;  3DTM A;  4WZ4 A;  5A90 A;  1XP4 A;  2J7V A;  3ZNT A;  4UA7 A;  4ZTK A;  4X69 A;  5EVL A;  3UY6 A;  5M19 A;  1SHV A;  4DRT A;  1L0F A;  4ZDX A;  4UHU A;  2HDU A;  4M3K A;  4QHC A;  5IHV A;  1K55 A;  2R9W A;  4K0W A;  3IWQ A;  1ES3 A;  1MBL A;  1IEL A;  1DJA A;  5GLA A;  1YMX A;  2WUQ A;  2ZC5 B;  2XDM A;  3BLS A;  5EVI C;  3IF5 A;  4YIN A;  5HAQ A;  2IWC A;  2RCX A;  3AGF A;  4QY5 A;  2XH9 A;  2ZM2 A;  5AQ7 A;  5CHM A;  4DXC A;  5E43 A;  5E2F A;  1FCM A;  3LY4 A;  4U3T A;  3HUM A;  3BEB A;  5GL9 A;  3NC8 A;  2HP9 A;  3SS4 A;  5TR7 A;  5CTN A;  1K25 A;  3IF6 B;  3NDG A;  3G4P A;  2EX2 A;  5CHJ A;  5EVI A;  4GDB A;  4NK3 A;  5FI6 A;  3PBT A;  1BT5 A;  3M6B A;  3PBO A;  5HW3 A;  3GVB A;  4S2L A;  4L0L A;  5E2E A;  5JYO A;  4S2I A;  4R1G A;  4KQQ A;  2RL3 A;  2XLN A;  3P09 A;  3PBQ A;  2DCF A;  1GHM A;  3QNB A;  2OSU A;  4DDS A;  1VQQ A;  5DF7 A;  4ZJ1 A;  3Q7Z A;  5CRF A;  3C4P A;  1G6A A;  4E3L A;  1Y54 A;  3BFD A;  1FR1 A;  3M6H A;  3O88 A;  4QU3 A;  5EVI B;  5F82 A;  1K57 A;  1Z6F A;  4KG5 A;  4ZAM A;  5U47 A;  3MZD A;  4LV3 A;  4C3Q A;  1RGY A;  4U0T A;  1ALQ A;  1BTL A;  1SDN A;  3Q07 A;  5FA7 A;  4R23 A;  3UPO A;  4OH0 A;  1GA0 A;  3PBR A;  3PAE A;  1FSW A;  2Y59 A;  2WGI A;  1M40 A;  3ZG5 A;  1WYC A;  4R4S A;  5GHZ A;  4FSF A;  4WEL A;  3FZC A;  3AGD A;  4EUZ A;  4Y7P A;  1FCN A;  4HES A;  1IEM A;  5CEB A;  2XF3 A;  1K6S A;  5DTS A;  4QJG A;  1WYB A;  2J9O A;  4WYY A;  3ZG7 B;  4KZ3 A;  3LEZ A;  1E3U A;  1ERQ A;  4OP5 A;  2ZC6 B;  1K4E A;  4OQI A;  3GSG A;  4Y0U A;  1XA7 A;  3JYI A;  1CK3 A;  4IVI A;  2Y91 A;  3A3F A;  2Y2K A;  3PBS A;  4UA9 A;  3N7W A;  3IWI A;  4MBH A;  1NYM A;  1IKI A;  3CMZ A;  3Q1F A;  4PMA A;  1JTD A;  2C5W B;  3IXD A;  4IBX A;  1NZO A;  4OOY A;  2IWD A;  2C6W B;  3OC2 A;  4X56 A;  3A3E A;  3ZVW A;  4RX3 A;  3PTE A;  5CGS A;  1IYS A;  4ID4 A;  5FQQ A;  2EXA A;  1ERM A;  5FQK A;  3ITB A;  3OCL A;  4WEK A;  5FAQ A;  5FI2 A;  4BD1 A;  3VP0 A;  2Y2H A;  3D4F A;  3MFD A;  5BOH A;  3C7U A;  5GLD A;  1I2W A;  4KQR A;  1ES5 A;  4DKI A;  3G34 A;  2ZLY A;  3W4P A;  1NY0 A;  1MPL A;  5DF8 A;  1CEF A;  4U0X A;  1SDE A;  1JWP A;  5EE8 A;  1W79 A;  3B3X A;  5A93 A;  3ZG0 A;  1G68 A;  2WZX A;  2Z2L B;  5CXW A;  5AQA A;  5FQ9 A;  5HAI A;  4DE1 A;  5L2F A;  5GHY A;  1HZO A;  2OLU A;  2Y2O A;  3W8K A;  1GHP A;  1IYQ A;  3OPR A;  1JWZ A;  4GN2 A;  1BLP A;  2H0T A;  3GV9 A;  1RGZ A;  3UE0 A;  5FDH A;  4X53 A;  2Y2M A;  2Y4A A;  4OLG A;  3Q81 A;  1IYP A;  2ZM8 A;  2BG1 A;  3DWZ A;  5DVA A;  5M18 A;  2ZC3 B;  2VGK A;  1EI5 A;  1K55 C;  3FKV A;  3G2Y A;  4GZB A;  2A3U A;  2ZM0 A;  3N6I A;  5FAO A;  1BUE A;  1LL5 A;  3SH8 A;  3O87 A;  4OP8 A;  5EEC A;  4R3B A;  1PW8 A;  4X55 A;  2ZQC A;  3CG5 A;  4ZJ3 A;  2QMI A;  3VFF A;  2EFU A;  5GLB A;  1IKG A;  3SS3 A;  1WE4 A;  3OPP A;  2Y2I A;  1TDL A;  4X68 A;  3WS4 A;  2ZQ7 A;  2PU4 A;  4BD0 A;  1NZU A;  3Q7V A;  1ERO A;  4JXV A;  5EVI D;  1DJC A;  4OPQ A;  1HVB A;  2XFS A;  1BLH A;  3HLC A;  5FAT A;  4FH2 A;  4UAA A;  1PZP A;  4CPK A;  2ZQD A;  3ZNY A;  1I2S A;  3ISG A;  4GD6 A;  4KZ8 A;  4EBP A;  3ZDJ A;  2J9P A;  3BYD A;  4B4Z A;  2B5R A;  5CEC A;  3IXG A;  3HLW A;  3SOI A;  5DTT A;  3HLF A;  2JC7 A;  1NXY A;  4FCF A;  1IYO A;  3VFH A;  1YLT A;  4OQH A;  5DF9 A;  3ZG9 B;  2R9X A;  1K57 C;  1PI5 A;  1O07 A;  1K4F A;  1MWT A;  1DJB A;  3RJU A;  1ESI A;  2WAD A;  2WKE A;  2ZJ9 A;  3FYZ A;  4DDY A;  1MY8 A;  3VMA A;  2WKH A;  5E2G A;  3ZCZ A;  4Y0O A;  3DW0 A;  3NDE A;  4WMC A;  5KSC A;  1XXM A;  4S2P A;  5KMW A;  3HL9 A;  2WKI A;  1E25 A;  1L0D A;  4N9K A;  1MWU A;  3Q82 A;  3BLM A;  1Q2Q A;  2V20 A;  3BFG A;  1QMF A;  3MKE A;  3WRZ A;  1GCE A;  3OZH A;  1W8Y A;  2H10 A;  3HVF A;  4JF6 A;  4E3M A;  5EUA A;  2PU2 A;  3M2K A;  3SH9 A;  1GHI A;  1SKF A;  3EQV A;  2Y2Q A;  4E3J A;  3IHA A;  2WGW A;  5CED A;  3W4Q A;  1E3U D;  3A3J A;  5AQ9 A;  4JLF A;  1XPB A;  4KZ6 A;  3RXW A;  3QHY A;  1JWV A;  3NBL A;  1HD8 A;  3ZFZ A;  4C75 A;  4IVK A;  2WGV A;  1ZG6 A;  3CZD A;  1PWD A;  1CEG A;  3M2J A;  4KZB A;  4EBN A;  5AQB A;  2EFX A;  3BM6 A;  5G18 A;  3N4I A;  3MBZ A;  1L0E A;  3G30 A;  4FD8 A;  5KZH A;  5J8X A;  1JTG A;  1YLZ A;  2WGW B;  4OPZ A;  4S2N C;  5EOO A;  4RX2 A;  1W5D A;  3BFC A;  5CGW A;  4RYE A;  3SH7 A;  3W4O A;  4JXW A;  3IHB A;  4JXS A;  1QME A;  1ZG4 A;  2XQZ A;  5GHX A;  1PW1 A;  1ESU A;  4S2N A;  1KDS A;  1L2S A;  4ZJ2 A;  4PM5 A;  3BEC A;  3QNC A;  1TDG A;  4JF5 A;  5EOE A;  1XGJ A;  2E8I A;  2QPN A;  3FKW A;  3NCK A;  3O86 A;  4GOG A;  4BL2 A;  1NJ4 A;  2A49 A;  2P74 A;  3C5A A;  1K6R A;  1J9M A;  1KGG A;  4WEJ A;  4YFM A;  1BZA A;  5E2H A;  3TSG A;  4EV4 A;  4B88 A;  2IWB A;  4CJN A;  1EWZ A;  4E3K A;  2V1Z A;  3V39 A;  2J8Y A;  2CC1 A;  3BFE A;  3PBN A;  3ZHH A;  1YT4 A;  5M1A A;  3UE1 A;  3IH9 A;  1K54 C;  1PI4 A;  2VGJ A;  1Q2P A;  3NY4 A;  3A3I A;  3O3V A;  1XX2 A;  3NI9 A;  4P87 A;  3HUO A;  4JPM A;  3S22 A;  1E4D A;  2WK0 A;  1FCO A;  4KZ5 A;  4EQI A;  2Y2L A;  2HP6 A;  4IBR A;  2DNS A;  1FSY A;  4R4R A;  4RA7 A;  3N8S A;  4E3N A;  4N1X A;  4S2O A;  2XR0 A;  2X02 A;  1K54 A;  4LV2 A;  3BFF A;  4LV0 A;  3VOY A;  2PBY A;  4KQO A;  3ITA A;  3WRT A;  1I5Q A;  2WZZ A;  5FI7 A;  1H8Y A;  4DF6 A;  4MNR A;  3UPP A;  2WYX A;  2QZ6 A;  2H5S A;  3HLE A;  1KGF A;  4X6T A;  4XUX A;  3HRE A;  4OQG A;  3SS5 A;  4RVA A;  4WBG A;  3HUN A;  3HLG A;  3AGE A;  4KZA A;  2XEP A;  4QB8 A;  3IQA A;  3UPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...