4MBKA

Crystal structure of k234r inhibitor-resistant variant of shv beta-lactamase in complex with sa2-13
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
265
structure length
265
Chain Sequence
b'SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADRTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Penam sulfones and beta-lactamase inhibition: SA2-13 and the importance of the C2 side chain length and composition.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 95
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4mbkA00
3GSGA 4S2IA 3SH8A 1PW1A 4ID4A 4FD8A 4OP5A 4OLDA 1NXYA 2Z2LB 1KDWA 3M6BA 5F83A 4GDNA 1FOFA 2X02A 4WMCD 2ZQ9A 5EVLA 3WS5A 3ZG7B 1I2WA 1FQGA 2XF3A 1MWTA 3ZNTA 1JTGA 5EE8A 1I5QA 3S4XA 3V5MA 2ZQCA 3OPPA 3SH7A 1IELA 4JXVA 1NJ4A 5TR7A 4MNRA 3HUNA 3C7UA 3HLDA 5E2FA 3QNCA 1WE4A 1YM1A 1PZPA 2EX9A 2UWXA 4ZTKA 4C3QA 3DW0A 1NZOA 2ZQDA 2EXAA 5AQBA 3SS4A 4EBLA 1ES5A 2Y4AA 1TDLA 4KZ6A 4X53A 1XGIA 4GOGA 3HL9A 2J9PA 5CHUA 2ZQ8A 5F1FA 5E2GA 5U47A 1WYCA 2HP6A 2XDMA 5EECA 4E3MA 1LHYA 3OCNA 1CEGA 1GHMA 1K6RA 2Y2MA 3ZVTA 1YMXA 2EX6A 3G2YA 5CEBA 4OQHA 3HLEA 5A93A 4FSFA 5GHXA 2EFXA 3V50A 3HUMA 1KVLA 5A92A 3IWIA 3UE3A 1AXBA 4QD4A 5AQ7A 1FR1A 4DXCA 1XPBA 2DCFA 1I2SA 1GHIA 2E8IA 2PU4A 4JKTA 4DE0A 2ZLYA 1PW8A 2Y2OA 3N8SA 3PAGA 4JXWA 4YINA 5DF8A 3WS0A 3AGEA 3UY6A 3MZFA 3IHBA 4WELA 3E2LA 4UA7A 1SHVA 3GMWA 3Q7VB 1ALQA 3ZG0A 1KE0A 2HP5A 3WRZA 2JCHA 3VFFA 3BFCA 3N8RA 4PM7A 2WGVA 3BFGA 1RP5A 3BFEA 1XP4A 1ES3A 3LY3A 5TFQA 2XFSA 4KQRA 4N9KA 1KE3A 3TG9A 3EQUA 4S2PA 4EBNA 1QMEA 1DJAA 1PI4A 3WS4A 3ZDJA 4LV1A 3NC8A 2VGJA 4BD0A 3UPPA 1ZC2A 2HDQA 4GNUA 4PM9A 3MXRA 2P74A 2HPBA 1JWZA 3DTMA 1IKGA 2PU2A 5GLCA 1G68A 5FQKA 3BYDA 4JBFA 4OP8A 5EUAA 3UDIA 2H0YA 3GRJA 3WS2A 3G4PA 3UE0A 3N8LA 1MBLA 1BLPA 4GB7A 4S2NC 2R9XA 4DE1A 4OOYA 5HAQA 3OCLA 2FFYA 1KGFA 1EWZA 3SOIA 2ZJ9A 3O88A 1BUEA 1K4FA 2WKHA 4BJPA 4JF6A 3CMZA 3OPHA 4KZ4A 5FA7A 4KZ8A 2J8YA 1NZUA 1KE4A 4DDYA 3OPLA 3WRTA 4EQIA 4Y7PA 1PWCA 1JTDA 3JYIA 3NBLA 4PMAA 2HDSA 4B4ZA 3NY4A 3ZNYA 1K56A 4D2OA 3AGFA 5EVIB 5HAIA 5G18A 2CC1A 4U0TA 2BG1A 1K54A 3MXSA 1N9BA 5EVIC 3DWZA 3GTCA 1O7EA 3HLGA 4PM6A 4ZJ2A 1NYYA 1E4DA 1E3UD 3FWLA 2G2WA 5A91A 2WKIA 1YQSA 3VP1A 3C7VA 5FI6A 4E6WA 3UN7A 2IWCA 3BRMA 3TOIA 4C6YA 2Y2GA 1IYSA 4N92A 3D4FA 1LI0A 1W5DA 4S2JA 3IXHA 3PTEA 1JWPA 3GVBA 1BTLA 3IWOA 4XUZA 1IYPA 1O07A 2XEPA 3EQVA 5HAPA 1MWRA 2XR0A 1MWSA 4NETA 3UDXA 2J9OA 3C4OA 4S2KA 5FQJA 3PBSA 5F1GA 2ZC3B 3V3RA 3P98A 4HBTA 3Q7ZA 5FQIA 5GLDA 4BL2A 3BECA 2Y2QA 5GLBA 3C4PA 3S22A 2BLSA 2Q9MA 2Y2KA 3M6HA 1HVBA 4P0MA 3A3JA 1YLYA 3AGDA 2DNSA 3BLSA 5BOHA 4OONA 2XGNA 4EUZA 2RCXA 3V39A 4UAAA 5JYOA 4UA6A 1DJCA 4R3BA 2XFTA 3VOYA 1IEMA 2GDNA 3ZFZA 2A3UA 4ZBEA 1KGGA 5FATA 3G35A 1HZOA 4KG2A 4RX3A 5KMWA 3PBOA 1TEMA 5A90A 5AQAA 3UDFA 1YLZA 4ZDXA 4IEDA 3UNWA 1HTZA 3NDEA 1ZKJA 3VP0A 5HW3A 5CGSA 1K57A 3PBRA 3NDGA 3GV9A 1S0WA 2OLVA 2X01A 1K54C 3O87A 5GL9A 1FSYA 1BLSA 3NI9A 1MXOA 2V2FF 3ISGA 5FDHA 5FASA 2XLNA 5FI7A 1XXMA 3VMAA 1GA0A 3W8KA 1FCNA 2HP9A 1M40A 2Y55A 1PYYA 1BT5A 3MZDA 4MEZA 3BLMA 2Y2PA 2JBFA 2DRWA 4N1XA 2EX8A 3Q82A 2WZZA 2ZM8A 1L0GA 2OSUA 4E3NA 1NY0A 2EFUA 3UPOA 1YMSA 4BQMA 4KZ7A 2H10A 3ZVWA 2J7VA 4MBHA 1IKIA 1H5XA 5CTNA 5E2HA 5FSRA 4E3IA 4A5RA 1YLWA 5HX9A 4QJGA 1M6KA 1YT4A 1SKFA 4H8RA 4WMCA 3VP4A 4QB8A 1E25A 2WGWA 4L0LA 3RJUA 4BENA 5I94A 4JXSA 4RA7A 4OPQA 2Y2HA 5CEDA 1EI5A 3IH8A 1ONGA 1H8YA 4R0QA 2X71A 5DVAA 3A3IA 5M18A 1N4OA 2H0TA 3QNBA 5CGWA 3UE1A 4EWFA 1KDSA 1W79A 1RGZA 4MLLA 5FAQA 1ZG6A 3N6IA 4EBPA 4BLMA 5CTMA 4U0XA 5FAOA 1BZAA 3UPNA 3IT9A 3HVFA 1K57C 2VGKA 3HLCA 1Q2PA 3CZDA 4Z9QA 3ZCZA 3BM6A 3E2KA 2OLUA 2C5WB 3G31A 4QY6A 4PPRA 5CERA 2Z2MB 1MPLA 3MKEA 4LV3A 3Q81A 2RL3A 4N1HA 5TGFA 4CPKA 2HDUA 3HREA 4S2LA 4X55A 4KQOA 4WM9A 2Y2LA 1K6SA 5KSCA 3WS1A 1GHPA 3A3FA 1BLHA 2WGIA 1W8YA 5FQQA 4ZJ1A 3SS5A 3Q07A 5EOEA 2XK1A 2ZC4B 4R3JA 4OOLA 4B4XA 3HUOA 5CRFA 3BFFA 4LCLA 3I7JA 2JE5A 2QZ6A 1W7FA 4X56A 1TDGA 1L2SA 1W8QA 2QPNA 3LEZA 4OQIA 2V20A 2WADA 4OPRA 4X69A 1ERMA 5HARA 1MY8A 4WEKA 1C3BA 1KGEA 3ITBA 4R1GA 1XA7A 1K4EA 5HFOA 1JVJA 2WGWB 4WYYA 4FH2A 4C75A 5DF7A 1YLTA 3G34A 5E2EA 3IF6A 2ZM0A 3OZHA 3VFHA 3FKWA 2IWDA 1LL5A 1IYOA 4S2OA 1VM1A 1FSWA 2WUQA 2HDRA 3G30A 4X6TA 5EVID 3FZCA 3VSLA 1Q2QA 2G2UA 1L0DA 4GN2A 2P9VA 1ONHA 4R4RA 5AQ9A 3VSKA 5E43A 3N4IA 5FQMA 5D3OA 4IVIA 2XD1A 4Y0OA 4DF6A 1QMFA 2Y2JA 4GD8A 4KZ9A 4GZBA 4OOMA 3TSGA 3Q1FA 3W4OA 2IWBA 3C5AA 1Y54A 3Q7VA 4IBXA 4JXGA 2Y91A 1PZOA 4JF5A 3WWXA 4K0WA 5M19A 3OPRA 4BL3A 3PBQA 4M3KA 1XKZA 4DRTA 3ITAA 3CJMA 1SDEA 3VP2A 2WKEA 4KG6A 5GHZA 5FAPA 4WZ5A 1J9MA 3M2JA 3IQAA 1Z6FA 1RCJA 3IH9A 4OKPA 3N7WA 4LV0A 4UHUA 5FQ9A 3BEBA 3G2ZA 1CI9A 1IYQA 5GHYA 3MZEA 3UO9A 2PBYA 3ZG5A 1YLJA 3FKVA 4XUXA 2OV5A 1LI9A 4E3KA 2Y2NA 4JLFA 3IXBA 5IHVA 4DDSA 3FV7A 2B5RA 2WZXA 1CI8A 3RXXA 1ESIA 1YLPA 1XX2A 1RGYA 4OPYA 2Y2IA 1NYMA 4YFMA 4OH0A 2WAFA 4B88A 1OMEA 1ESUA 3IF6B 3LY4A 1LL9A 3PAEA 4JF4A 4R23A 4S2NA 4XXRA 5L2FA 4IBRA 4KENB 3IWQA 4DKIA 1DJBA 3MBZA 4X68A 3ZG9B 1WYBA 3BFDA 1DY6A 4BD1A 1PIOA 3PBTA 1K56D 3IF6C 2R9WA 3MKFA 3S1YA 1K55A 2WAEA 3V3SA 2WK0A 2ZC5B 1FR6A 2EXBA 4PM5A 3P09A 2P9VB 4KZ5A 2ZQAA 3DWKA 3SS3A 3ZHHA 1HD8A 1ERQA 4O7DA 3RXWA 1FCMA 4FCFA 2V1ZA 1ES2A 3IXGA 4KG5A 4MBKA 3CG5A 3HBRA 1G6AA 4HBUA 1PWGA 4P6BA 2WYXA 1VQQA 1ZG4A 3MFDA 1E3UA 1MKIA 5CHMA 2ZD8A 3IXDA 4E3OA 1PI5A 1CK3A 4QY5A 4RYEA 3O3VA 2Q9NA 4Y0UA 4CJNA 4MBFA 3GR2A 4DE2A 4OVDA 1K38A 1MWUA 3HLBA 4EV4A 3ZG8B 3PBNA 1FCOA 4S2MA 3HLFA 2XQZA 1BSGA 5EPHA 4ZAMA 4P87A 2ZQ7A 4OPZA 5EVIA 3LCEA 3A3EA 2ZC7A 2XD5A 3NIAA 4HESA 3FYZA 4HEFA 1JWVA 3B3XA 4WZ5C 1CEFA 4RX2A 1L0EA 3W4QA 5KZHA 3A3DA 3QHYA 4E3JA 4LV2A 4DE3A 2A49A 4WEJA 5CHJA 4E3LA 3VP3A 4ZJ3A 2EX2A 2C6WB 4QHCA 1LLBA 4QU3A 1L0FA 4GDBA 3ZGAB 4KQQA 4E6XA 2FFFB 2Y59A 1NRFA 1SDNA 3HLWA 3LO7A 4IVKA 3O86A 4KZBA 4UA9A 2ZM2A 5GLAA 4DXBA 1ES4A 4K91A 3GQZA 4R4SA 3W4PA 2XH9A 1GCEA 5JYPA 4KZ3A 1SCWA 4OQGA 4Q8IA 3NCKA 5CGXA 4F94A 4WBGA 2JC7A 3IHAA 4RVAA 2I72A 4JPMA 5J8XA 4GKUA 1BULA 4OQ0A 1K55C 1GA9A 1U60A 4GD6A 1H8ZA 1PWDA 4Y0TA 2QMIA 4OLGA 1KVMA 1EROA 4N9LA 1K25A 4P85A 2ZC6B 3VOZA 3G32A 4PM8A 3OC2A 1BLCA 5DF9A 5KSHA 2H5SA 5HL1A 4K0XA 5CXWA 4NK3A 4WZ4A 4FH4A 5DTTA 5DTKA 5FI2A 2ZMAA 4LENA 1XA1A 3M2KA 5M1AA 5CECA 5DTSA 5F82A 4KZAA 1S6RA 1TVFA 4U3TA 3IF5A 3SH9A 1XGJA 5EOOA 4LCMA
chains in the Genus database with same CATH superfamily
2ZOHA 1L3LA 1NXYA 5F83A 3M6BA 1FOFA 4WMCD 3WS5A 2O9AA 1I2WA 1MWTA 3MS6A 4GS9A 1JTGA 3V5MA 2ZQCA 3SH7A 1IELA 4MNRA 1WE4A 4EEUA 2EX9A 3DTKA 3DW0A 1V9YA 4R3AA 5DKLA 1S1ZA 1TDLA 1ZTUA 4R6LA 1XGIA 2ZQ8A 1WYCA 2XDMA 4E3MA 1GHMA 1Z09A 4FSFA 1KVLA 2JKTM 3ICYA 4L9GA 2JKTI 1YKDA 2VEAA 3NJAA 1PW8A 4YINA 3D72A 3WS0A 3UY6A 3IHBA 3E2LA 3WRZA 3VFFA 1NLZA 1OTDA 4PM7A 3BFEA 3MF0A 1VETB 5TFQA 3C2WA 1DJAA 4NEED 1PI4A 3NC8A 1ZC2A 2O9BA 3MXRA 1G6OA 2P74A 4RQ9A 2PU2A 1G68A 4PHTA 3HCYA 5EM1A 3N8LA 1OTEA 1BLPA 2FH5A 3CLOA 4S2NC 3D9YA 1EWZA 3DBAA 1F2KA 1P9RA 1K4FA 2WKHA 4JF6A 2ZL1A 1S66L 2WKRA 4KZ8A 4MMNA 3C8CA 4IUKA 3F1NA 3IBJA 2HDSA 1K56A 2HGVA 5HAIA 5G18A 4Y17A 1K54A 5EVIC 1P0ZA 4PM6A 4ZJ2A 2L0WA 3FWLA 2VLGA 5HWWA 3VP1A 4E6WA 3UN7A 5HPIA 2L4RA 2XA7M 4IUHA 2Y2GA 3D4FA 1LI0A 1BTLA 1XJ3A 3EQVA 5HAPA 1MWRA 3UDXA 2J9OA 3V3RA 4HBTA 5FQIA 3CHWP 4B93A 3C4PA 3S22A 2BLSA 2NUTC 3M6HA 5EM0A 4CLCA 3AGDA 5BOHA 3V39A 3IBRA 4UA6A 2M7VA 2JHEA 5DFXA 1KGGA 5FATA 1YPRA 4KG2A 3PBOA 1XJ4A 5A90A 3UDFA 4MN6A 1ZKJA 1OT9A 1K54C 1FSYA 3NI9A 5F69A 1OJGA 3ISGA 1XXMA 3W8KA 1FCNA 2HP9A 3EGXC 2EX8A 2WZZA 3KSIA 1NY0A 4X1MA 2EFUA 2H10A 2J7VA 1H5XA 4QJGA 3LIAA 1SKFA 5I94A 5HWTA 1X0OA 3UB8A 5CEDA 3MQOA 3QNBA 4G3WA 2GJ3A 4MLLA 5FAQA 4ME4A 3DTIA 3T4OA 3N6IA 4EBPA 5FAOA 2W3EA 2VGKA 3L9KA 4Z9QA 3BM6A 2OLUA 2C5WB 4PPRA 5CERA 2Z2MB 4LV3A 3Q81A 4CPKA 4S2LA 2K31A 5KSCA 2FZ0A 3Q07A 1F5MA 4HY8A 5CRFA 4LCLA 2JE5A 4X56A 1W7FA 1L2SA 4OPRA 2WADA 5HARA 1C3BA 1K4EA 4C75A 4LLOB 4EUVA 1IYOA 4EW7A 1FSWA 2HDRA 1OTBA 5EVID 3FZCA 3LIDA 3VSLA 1L0DA 4GN2A 4I39A 4LGWA 3VSKA 3S7OA 4Y13A 4IVIA 4Y0OA 3C5AA 4IBXA 2Y91A 1PZOA 4K0WA 3OPRA 3S7PA 1XKZA 4YNRA 2YKHA 1D1JA 4KG6A 3R4KA 5GHZA 3IQAA 5AVFA 5HZHA 2QHKA 3BEBA 3LI8A 1CI9A 5GHYA 3MZEA 1LI9A 2PHYA 4DDSA 5IHVA 3FV7A 4WF0A 4ESPA 1CI8A 1ESIA 3T50A 4YFMA 1XJ6A 3IF6B 4IBRA 1DJBA 3MBZA 1IFQA 3MR0A 1WYBA 1D06A 1PIOA 1K56D 3MKFA 2R9WA 3PBTA 3V3SA 3UB6A 3LGOA 2EXBA 4PM5A 3P09A 3SS3A 3E98A 3BWLA 4O7DA 1FCMA 5FEFA 4MBKA 4BBUA 4P6BA 1PWGA 2KDKA 4O01A 1ZG4A 3MFDA 4HJ4A 4LFUA 1AWIA 2WKQA 1OTIA 1CK3A 3NOUC 2A2LA 3GR2A 4MBFA 1VB6A 4OVDA 2WKPA 4Y2FA 1FCOA 2PDRA 3HLFA 2XQZA 1BSGA 4JGRA 5EPHA 2ZQ7A 4OPZA 3KSHA 4MN5A 1LT0A 2Z6DA 3B3XA 3FC7A 1CEFA 4RX2A 4IJGA 3A3DA 3QHYA 2OWHA 3NOPC 3VP3A 3VE3A 2GX5A 1MKMA 4E6XA 1TS8A 2Y59A 1SKOA 4I38A 4UA9A 4DXBA 1ES4A 4OQGA 4Q8IA 2I72A 5J8XA 3QP1A 4GKUA 3EOIA 4Y0TA 2QMIA 4OLGA 5L10A 3E4PA 1K25A 4JGPA 3VOZA 5AVEA 2ZOIA 3RH8B 3T1QB 2ZMAA 3L7HA 5M1AA 1XGJA 3S7NA 3GSGA 4FD8A 4OP5A 4GDNA 2X02A 2ZQ9A 5EVLA 2D01A 3T12B 2PYPA 4JXVA 3HLDA 4ZTKA 4C3QA 4E04A 1NZOA 5AQBA 4EBLA 1TD5A 2Y4AA 3JPUA 4KZ6A 4GOGA 5HD3A 4O8GA 2W1TB 5E2GA 5F1FA 2HP6A 3OCNA 3ZVTA 1YMXA 3HLEA 5A93A 4BMWA 3HUMA 2JKRI 3C30A 3GECA 4QD4A 2DCFA 2V8FA 2O0YA 4F3LB 1GHIA 2GZAA 2ZLYA 4JXWA 4HI4A 2VKSA 3MZFA 1Y4OA 4UA7A 3GMWA 3BFCA 3N8RA 1T19A 3F1OA 2WGVA 5J7EA 1XP4A 4KQRA 3TG9A 2H28A 1WA9A 4ARZB 2PRFA 3WS4A 3ZDJA 4LV1A 4Q0HA 2VZWA 2HDQA 4GNUA 4PM9A 3R7WB 3DTMA 3IX4A 1IKGA 4EU0A 4G3VA 4JBFA 3OBFA 4GHIA 3UDIA 2VV8A 5L09A 3WS2A 3QP8A 4LPZA 5FEGA 2V1AA 5HAQA 1V9ZA 2FFYA 1KGFA 3IS2A 1S67L 1BUEA 3U4LP 1NLYA 3A0VA 4KZ4A 4GCZA 5AJGA 2DMWA 2V0UA 3H7WA 1H0MA 4Y15A 5TBMA 2CC1A 2Z6CA 3UB5P 4U0TA 3PYPA 3DWZA 3GTCA 3HLGA 1E4DA 5FDSA 5A91A 2WKIA 1YQSA 5FI6A 2PBDP 1DRMA 2KLIA 3IX3A 3KSFA 4C6YA 1IYSA 3VV4A 3IXHA 3PTEA 1JWPA 3IWOA 1O07A 2XEPA 2XR0A 4NETA 1ODVA 3K3DA 5F1GA 3BECA 3TE8A 2Q9MA 4P0MA 3A3JA 2EWWA 1YLYA 4HIAA 3A0SA 4OONA 2XGNA 3MQ0A 1DJCA 2XFTA 1IEMA 1XFQA 2W27A 2HJEA 4ZBEA 2Y79A 5KMWA 5AQAA 1W63Q 2O9CA 5EVEA 1K57A 4UEYA 4GW9A 4BBTA 2X01A 3SW1A 1S1YA 5GL9A 2CMNA 2W0NA 2G7UA 3S7QA 3VMAA 1GA0A 3LICA 2Y55A 3MZDA 2Y2PA 2JBFA 4N1XA 2QJ7A 1L0GA 4E3NA 3B42A 2D02A 3D3OA 4MBHA 5CTNA 1YLWA 1M6KA 1YT4A 3VP4A 2Q0OA 2WGWA 3EEAA 4L0LA 4RA7A 5K5BA 3KO6A 1LSVA 2JKGA 4OPQA 3UE6A 3TJZC 4HQAA 1ONGA 1H8YA 2B18A 5M18A 4KUKA 1DP6A 4NXFA 3UE1A 4EWFA 3HJIA 4HJ6A 4FUWA 1RGZA 2V1BA 1XJ2A 4U0XA 3UPNA 3IT9A 1K57C 4EERA 3HLCA 2YKFA 1MPLA 2V0WA 5TGFA 3HREA 4Z1WA 2B02A 2KX6A 4L9FA 3WS1A 1BLHA 4ZJ1A 5EOEA 2XK1A 4OOLA 4B4XA 3BFFA 2QZ6A 1W8QA 2IA2A 1LSWA 1ERMA 1KGEA 3JVUA 1MC0A 1JVJA 2J80A 3O5YA 4FH2A 2K2NA 3ULFA 5DF7A 3G34A 2M1CA 3CWFA 2IWDA 4QPRA 4QWOA 2QKPA 2OAQ1 1XFNA 4R4RA 5AQ9A 5E43A 5FQMA 5D3OA 4DF6A 1QMFA 4OOMA 3TSGA 2IWBA 4PAUA 4DRTA 3CJMA 3VP2A 2A24B 3M2JA 4OKPA 3IH9A 3NECA 3T4KA 3T4JA 2VX8A 4ARZA 3UMDA 3G2ZA 4E3KA 1UWNX 4XUXA 2OV5A 2Y2NA 4GLQA 3R7WA 1XX2A 4OPYA 2W1RA 1NYMA 4OH0A 2WAFA 1OMEA 1ESUA 3LY4A 4JF4A 4XXRA 5L2FA 3UB9A 4KENB 3IWQA 3ZG9B 1TS6A 3S1YA 1K55A 2HV1A 2WAEA 3A0RA 2ZC5B 1UWPX 3CPTB 2P9VB 3DWKA 4HP4A 1HD8A 3RXWA 4FCFA 5JYOA 1ES2A 3CG5A 4ETXA 1E3UA 1CF0A 1G5UA 2NUPC 5CHMA 3IXDA 3K2NA 4LRYC 4CJNA 4CLCC 3SZTA 2XSSA 4S2MA 4ZAMA 4P87A 4PKYA 5G4ZA 3A3EA 3F1PA 3VOLA 1K0KA 4B9OA 4HESA 3BW6A 4HEFA 1G28A 1DP8A 2BASA 4PKYG 4E3LA 4NG2A 2C6WB 4QHCA 3EEHA 1L0FA 4GDBA 4KQQA 1NRFA 2EA9A 5GLAA 3GQZA 2XH9A 4WBGA 3HJKA 4JGQA 4JPMA 5HD5A 1K55C 1U60A 3UB7A 1PWDA 5IT5A 1EROA 4N9LA 4P85A 2ZC6B 3OC2A 1BLCA 5DF9A 5KSHA 1P97A 4YWZA 5DTTA 4WZ4A 2VK3A 4KZAA 4BWIA 4U3TA 3SH9A 5EOOA 4DMZA 4OLDA 2Z2LB 2VV7A 3ZG7B 3V67A 1FQGA 2XF3A 3LIBA 3H9WA 2MJ6A 5EE8A 1I5QA 2ZBBA 5TR7A 3E4OA 5E2FA 1VETA 2UWXA 5HDCA 2EXAA 1GSWA 1ES5A 1NRJA 4ZRRA 2VA0A 3HL9A 5CHUA 4JGOA 2Y2MA 2K7SA 4XT2B 3G2YA 3V50A 2W3DA 4EETB 5A92A 1AXBA 5AQ7A 1FR1A 2XA7S 4Q0JA 2Y2OA 5DF8A 3KYQA 5I5LA 4WELA 1ALQA 3BY8A 1KE0A 4GS9B 3W2ZA 3H82B 4EEPA 1ES3A 3CUEA 4N9KA 3EQUA 4S2PA 1OTAA 1QMEA 2P04A 1MZUA 4UQIM 3UPPA 4HHDA 4CLCD 2HPBA 1ACFA 3GRJA 3G4PA 1T1AA 3UE0A 3T4TA 3QP2A 4K08A 1YAXA 2I9VA 2ZJ9A 3O88A 3T4LA 2INWA 5FA7A 4NXGA 2PD7A 3WRTA 4EQIA 4Y7PA 1PWCA 3ZQ5A 1JTDA 3JYIA 3NBLA 4L9EA 4PMAA 1TS0A 2R78A 4B4ZA 2A24A 1D7EA 5EVIB 2HF6A 4ETZA 2BG1A 2PR6A 4KQDA 3CUEC 1O7EA 4EESA 1E3UD 2IWCA 3BRMA 3KX0X 5F6AA 1W63M 1W5DA 5J3WA 4XUZA 3CPTA 5HPFA 1MWSA 2XROA 4S2KA 1F98A 2XRNA 2ZC3B 3P98A 5GLDA 3Q7ZA 2Y2QA 1HVBA 2ZL1B 1YSQA 3KSGA 3BQAA 3BLSA 2RCXA 4UAAA 1A0KA 3F1NB 5F68A 3LEQA 2B95A 2GDNA 3ZFZA 2A3UA 2PD8A 5A8BA 1HZOA 4RX3A 1TEMA 4IEDA 1HTZA 5HW3A 3VP0A 3PBRA 3NDGA 3CAXA 1TF1A 1S0WA 2W3HA 5J4EA 3O87A 3RFBA 5FDHA 5FASA 3MQQA 5FI7A 4FTXA 1PYYA 3BLMA 2DRWA 3Q82A 5DJTA 1F9IA 1YMSA 4KZ7A 3ZVWA 3GDIA 1IKIA 5FSRA 4WLAA 3CI6A 4H8RA 4QB8A 3RJUA 3MMHA 4JXSA 3BQ8A 2Y2HA 3IH8A 4R0QA 5DVAA 1N4OA 1T1CA 2H0TA 5CGWA 1W79A 5DKKA 3MXQA 1SZVA 4BLMA 5CTMA 5KIZA 3HVFA 1OPXA 1VEUB 3CZDA 3PR6A 2J3TC 3MKEA 2RL3A 2HDUA 1OT6A 2V9AA 4X55A 4WM9A 1K6SA 1GHPA 3A3FA 2GNXA 2WGIA 1W8YA 3SS5A 4MDZA 3B33A 2ZC4B 2ACGA 3HUOA 3T4SA 1TDGA 4X69A 3LEZA 2V20A 1MY8A 4WL9A 3ITBA 4R1GA 5G4YA 5HFOA 4WYYA 2J3WA 3IF6A 3LYXA 3OZHA 4UQIS 3T4QA 1T1BA 3G30A 4R38A 1ONHA 3FPWA 4HJ3A 5F5YA 3NHQA 2XD1A 2Y2JA 4KZ9A 2QYBA 3Q1FA 4DN0A 3W4OA 4JXGA 4KUOA 3G6OA 5M19A 3H82A 4HP9A 4M3KA 1SDEA 2WKEA 3N7WA 4UHUA 5FQ9A 2JKFA 1IYQA 2OWJA 3ZG5A 3FKVA 4JLFA 3IXBA 3QP5A 2B5RA 1Y28A 1YLPA 5MC7A 2OAP1 4NXEA 4R23A 2W3FA 4S2NA 4DKIA 4P6ZM 4BD1A 1DY6A 3IF6C 2M7UA 4D60A 4KZ5A 2ZQAA 4DJ2A 4KG5A 1FIKA 3HBRA 4BD0A 1G6AA 1VQQA 1PNEA 4I5SA 5DJUA 2ZD8A 2AVXA 4IHQA 3O3VA 4CLCE 1GSVA 1MWUA 3HLBA 4EV4A 3ZG8B 3PBNA 1N9OA 5EVIA 2OOLA 2O99A 1T18A 2ZC7A 2XD5A 3NIAA 1JWVA 1L0EA 4LV2A 2A49A 4WEJA 1S4RA 4ZJ3A 3VE4A 2FFFB 3HLWA 1SDNA 3LO7A 4DE3A 4IVKA 4X1LA 4F94A 2JC7A 3IHAA 4RVAA 3EWKA 1GA9A 1CJFA 4GD6A 2J3TD 4H6JB 3LFVA 2W1TA 4NK3A 4FH4A 5FI2A 3M2KA 1S6RA 3NULA 3IXGA 3IF5A 2P08A 4LCMA 4S2IA 3SH8A 3K3CA 4F3LA 1PW1A 3EGDC 4ID4A 1UGUA 4NXBA 1KDWA 3ZNTA 2PYRA 3NOTC 3S4XA 1SKOB 1PFLA 5IU1A 3OPPA 5HSQA 1NJ4A 3HUNA 3C7UA 2BTFP 3QNCA 1YM1A 1PZPA 3KYZA 2ZQDA 3SS4A 4X53A 2PT7A 2J9PA 5CX7A 5U47A 3T1XA 5EECA 1LHYA 1CEGA 1K6RA 5HDDA 5CEBA 2EX6A 4OQHA 4WN5A 5GHXA 2EFXA 2L1MA 5LBRA 3IWIA 3UE3A 2JN7A 5FL3A 1IOUA 4DXCA 5HDSA 1XPBA 1I2SA 3P7NA 3LIEA 3E0YA 2E8IA 2PU4A 3FG8A 4G3KA 4JKTA 4DE0A 3PAGA 3N8SA 1LSXA 1VEUA 3AGEA 1SHVA 3Q7VB 3UMEA 3ZG0A 2HP5A 2JCHA 3TW8A 4II7A 4WUJA 3BFGA 1BYWA 1RP5A 3LY3A 2XFSA 1KE3A 1H8MA 4EBNA 3U2AA 3JVVA 1PRQA 3BJNA 2VGJA 1JWZA 1LL8A 3LIFA 4HNBA 5GLCA 5FQKA 3BYDA 5EUAA 4OP8A 4GJ4A 3KYEA 2H0YA 3C38A 2W3GA 4MN7A 1MBLA 4GB7A 4HH2A 2R9XA 4DE1A 4OOYA 3OCLA 3DTEA 4P6ZS 3SOIA 4EXOA 4BJPA 3CMZA 5HWVA 3OPHA 2J8YA 1NZUA 1KE4A 4DDYA 1OJ5A 3OPLA 3F1OB 3MFXA 3NY4A 3ZNYA 2PR5A 4D2OA 2Y8HA 2ZMVA 3AGFA 3OLOA 3T1SA 3MXSA 1N9BA 4DJ3A 4NKPA 1N9NA 1NYYA 3PHYA 2G2WA 3C7VA 2VV6A 3RTYA 3TOIA 4GHIB 1JNUA 4N92A 1P9WA 4S2JA 3GVBA 1IYPA 3C4OA 1TS7A 5FQJA 3PBSA 3IS2B 4HH3A 4BL2A 5GLBA 2Y2KA 2DNSA 4EUZA 1HLUP 1NWZA 4R3BA 3VOYA 5IS1A 3H7WB 4FOFA 5TJJA 3LR0A 3G35A 3OOVA 3P01A 1N9LA 3FPVA 5TBMB 1YLZA 4ZDXA 3UNWA 3NDEA 2PAVP 5CGSA 1DP9A 3GV9A 2OLVA 2HJ9C 5DFYA 1BLSA 2VGLM 1MXOA 2V2FF 2XLNA 1M40A 1BT5A 4MEZA 4EQ1A 1S4SA 2ZM8A 2OSUA 3UPOA 4BQMA 3TRCA 5E2HA 4E3IA 4A5RA 1VHMA 5HX9A 4H6JA 4WMCA 2ZMFA 1E25A 2UV0E 4BENA 2QJ5A 3QP6A 1EI5A 4MCWA 2X71A 3A3IA 4I3IA 1H3QA 1YSPA 1KDSA 2E8JA 4R70A 1ZG6A 1BZAA 1Q2PA 3ZCZA 3E2KA 4QY6A 3G31A 4N1HA 4KQOA 4BBVA 2Y2LA 3BY9A 4Y5FA 5FQQA 5C5KA 3LR4A 4R3JA 3I7JA 3B47A 2QPNA 4OQIA 3LUQA 2QWSA 4WEKA 1XA7A 4YOFA 5L8MA 2WGWB 1YLTA 5E2EA 3ZYTA 2ZM0A 3VFHA 3FKWA 1LL5A 4S2OA 1J3WA 1VM1A 2WUQA 4X6TA 1Q2QA 2G2UA 2P9VA 3LR3A 3N4IA 1GSXA 4GD8A 4GZBA 4X25A 1Y54A 3Q7VA 4JF5A 3WWXA 3IX8A 4HOIA 4BL3A 3PBQA 4AFIA 4M4XA 3ITAA 3LI9A 2KOIA 4WZ5A 1J9MA 1Z6FA 1RCJA 4LV0A 3UO9A 2PBYA 1YLJA 5EV0A 2WZXA 3DAVA 3RXXA 1RGYA 2VJWA 2Y2IA 4B88A 2EWVA 1FILA 3MSHA 1LL9A 3PAEA 2JKRM 4X68A 3BFDA 4Y3IA 2WK0A 1FR6A 2LB9A 3ZHHA 1ERQA 4I3AA 2V1ZA 3LR5A 4HBUA 4LRZE 2WYXA 1MKIA 1EW0A 4CLCB 2P7JA 4CQHA 1KOUA 4E3OA 1PI5A 4RYEA 4QY5A 2LB5A 2Q9NA 4Y0UA 4DE2A 1K38A 4I3JA 3LCEA 5EFWA 3FYZA 3QP4A 4WZ5C 3E4QA 3W4QA 5KZHA 4E3JA 5CHJA 2EX2A 4QU3A 1LLBA 3ZGAB 4Q0IA 4KZBA 3O86A 2ZM2A 4K91A 1STZA 3PXPA 4R4SA 3W4PA 1GCEA 5JYPA 4KZ3A 1SCWA 2VGLS 3NCKA 5CGXA 5HL6A 1BULA 4OQ0A 3T1RA 5L07A 1H8ZA 1ZHHB 4LRXC 2HZ5A 4O0PA 3MJQA 1KVMA 3G32A 4PM8A 2H5SA 5HL1A 4K0XA 5CXWA 2V8CA 4XT2A 5DTKA 1CQAA 4LENA 1XA1A 5CECA 5DTSA 5F82A 1TVFA 3F1PB 5FAPA 3CITA
chains in the Genus database with same CATH topology
3GSGA 4S2IA 3SH8A 1PW1A 4ID4A 4FD8A 4OP5A 4OLDA 1NXYA 2Z2LB 1KDWA 3M6BA 5F83A 4GDNA 1FOFA 2X02A 4WMCD 2ZQ9A 5EVLA 3WS5A 3ZG7B 1I2WA 1FQGA 2XF3A 1MWTA 3ZNTA 1JTGA 5EE8A 1I5QA 3S4XA 3V5MA 2ZQCA 3OPPA 3SH7A 1IELA 4JXVA 1NJ4A 5TR7A 4MNRA 3HUNA 3C7UA 3HLDA 5E2FA 3QNCA 1WE4A 1YM1A 1PZPA 2EX9A 2UWXA 4ZTKA 4C3QA 3DW0A 1NZOA 2ZQDA 2EXAA 5AQBA 3SS4A 4EBLA 1ES5A 2Y4AA 1TDLA 4KZ6A 4X53A 1XGIA 4GOGA 3HL9A 2J9PA 5CHUA 2ZQ8A 5F1FA 5E2GA 5U47A 1WYCA 2HP6A 2XDMA 5EECA 4E3MA 1LHYA 3OCNA 1CEGA 1GHMA 1K6RA 2Y2MA 3ZVTA 1YMXA 2EX6A 3G2YA 5CEBA 4OQHA 3HLEA 5A93A 4FSFA 5GHXA 2EFXA 3V50A 3HUMA 1KVLA 5A92A 3IWIA 3UE3A 1AXBA 4QD4A 5AQ7A 1FR1A 4DXCA 1XPBA 2DCFA 1I2SA 1GHIA 2E8IA 2PU4A 4JKTA 4DE0A 2ZLYA 1PW8A 2Y2OA 3N8SA 3PAGA 4JXWA 4YINA 5DF8A 3WS0A 3AGEA 3UY6A 3MZFA 3IHBA 4WELA 3E2LA 4UA7A 1SHVA 3GMWA 3Q7VB 1ALQA 3ZG0A 1KE0A 2HP5A 3WRZA 2JCHA 3VFFA 3BFCA 3N8RA 4PM7A 2WGVA 3BFGA 1RP5A 3BFEA 1XP4A 1ES3A 3LY3A 5TFQA 2XFSA 4KQRA 4N9KA 1KE3A 3TG9A 3EQUA 4S2PA 4EBNA 1QMEA 1DJAA 1PI4A 3WS4A 3ZDJA 4LV1A 3NC8A 2VGJA 4BD0A 3UPPA 1ZC2A 2HDQA 4GNUA 4PM9A 3MXRA 2P74A 2HPBA 1JWZA 3DTMA 1IKGA 2PU2A 5GLCA 1G68A 5FQKA 3BYDA 4JBFA 4OP8A 5EUAA 3UDIA 2H0YA 3GRJA 3WS2A 3G4PA 3UE0A 3N8LA 1MBLA 1BLPA 4GB7A 4S2NC 2R9XA 4DE1A 4OOYA 5HAQA 3OCLA 2FFYA 1KGFA 1EWZA 3SOIA 2ZJ9A 3O88A 1BUEA 1K4FA 2WKHA 4BJPA 4JF6A 3CMZA 3OPHA 4KZ4A 5FA7A 4KZ8A 2J8YA 1NZUA 1KE4A 4DDYA 3OPLA 3WRTA 4EQIA 4Y7PA 1PWCA 1JTDA 3JYIA 3NBLA 4PMAA 2HDSA 4B4ZA 3NY4A 3ZNYA 1K56A 4D2OA 3AGFA 5EVIB 5HAIA 5G18A 2CC1A 4U0TA 2BG1A 1K54A 3MXSA 1N9BA 5EVIC 3DWZA 3GTCA 1O7EA 3HLGA 4PM6A 4ZJ2A 1NYYA 1E4DA 1E3UD 3FWLA 2G2WA 5A91A 2WKIA 1YQSA 3VP1A 3C7VA 5FI6A 4E6WA 3UN7A 2IWCA 3BRMA 3TOIA 4C6YA 2Y2GA 1IYSA 4N92A 3D4FA 1LI0A 1W5DA 4S2JA 3IXHA 3PTEA 1JWPA 3GVBA 1BTLA 3IWOA 4XUZA 1IYPA 1O07A 2XEPA 3EQVA 5HAPA 1MWRA 2XR0A 1MWSA 4NETA 3UDXA 2J9OA 3C4OA 4S2KA 5FQJA 3PBSA 5F1GA 2ZC3B 3V3RA 3P98A 4HBTA 3Q7ZA 5FQIA 5GLDA 4BL2A 3BECA 2Y2QA 5GLBA 3C4PA 3S22A 2BLSA 2Q9MA 2Y2KA 3M6HA 1HVBA 4P0MA 3A3JA 1YLYA 3AGDA 2DNSA 3BLSA 5BOHA 4OONA 2XGNA 4EUZA 2RCXA 3V39A 4UAAA 5JYOA 4UA6A 1DJCA 4R3BA 2XFTA 3VOYA 1IEMA 2GDNA 3ZFZA 2A3UA 4ZBEA 1KGGA 5FATA 3G35A 1HZOA 4KG2A 4RX3A 5KMWA 3PBOA 1TEMA 5A90A 5AQAA 3UDFA 1YLZA 4ZDXA 4IEDA 3UNWA 1HTZA 3NDEA 1ZKJA 3VP0A 5HW3A 5CGSA 1K57A 3PBRA 3NDGA 3GV9A 1S0WA 2OLVA 2X01A 1K54C 3O87A 5GL9A 1FSYA 1BLSA 3NI9A 1MXOA 2V2FF 3ISGA 5FDHA 5FASA 2XLNA 5FI7A 1XXMA 3VMAA 1GA0A 3W8KA 1FCNA 2HP9A 1M40A 2Y55A 1PYYA 1BT5A 3MZDA 4MEZA 3BLMA 2Y2PA 2JBFA 2DRWA 4N1XA 2EX8A 3Q82A 2WZZA 2ZM8A 1L0GA 2OSUA 4E3NA 1NY0A 2EFUA 3UPOA 1YMSA 4BQMA 4KZ7A 2H10A 3ZVWA 2J7VA 4MBHA 1IKIA 1H5XA 5CTNA 5E2HA 5FSRA 4E3IA 4A5RA 1YLWA 5HX9A 4QJGA 1M6KA 1YT4A 1SKFA 4H8RA 4WMCA 3VP4A 4QB8A 1E25A 2WGWA 4L0LA 3RJUA 4BENA 5I94A 4JXSA 4RA7A 4OPQA 2Y2HA 5CEDA 1EI5A 3IH8A 1ONGA 1H8YA 4R0QA 2X71A 5DVAA 3A3IA 5M18A 1N4OA 2H0TA 3QNBA 5CGWA 3UE1A 4EWFA 1KDSA 1W79A 1RGZA 4MLLA 5FAQA 1ZG6A 3N6IA 4EBPA 4BLMA 5CTMA 4U0XA 5FAOA 1BZAA 3UPNA 3IT9A 3HVFA 1K57C 2VGKA 3HLCA 1Q2PA 3CZDA 4Z9QA 3ZCZA 3BM6A 3E2KA 2OLUA 2C5WB 3G31A 4QY6A 4PPRA 5CERA 2Z2MB 1MPLA 3MKEA 4LV3A 3Q81A 2RL3A 4N1HA 5TGFA 4CPKA 2HDUA 3HREA 4S2LA 4X55A 4KQOA 4WM9A 2Y2LA 1K6SA 5KSCA 3WS1A 1GHPA 3A3FA 1BLHA 2WGIA 1W8YA 5FQQA 4ZJ1A 3SS5A 3Q07A 5EOEA 2XK1A 2ZC4B 4R3JA 4OOLA 4B4XA 3HUOA 5CRFA 3BFFA 4LCLA 3I7JA 2JE5A 2QZ6A 1W7FA 4X56A 1TDGA 1L2SA 1W8QA 2QPNA 3LEZA 4OQIA 2V20A 2WADA 4OPRA 4X69A 1ERMA 5HARA 1MY8A 4WEKA 1C3BA 1KGEA 3ITBA 4R1GA 1XA7A 1K4EA 5HFOA 1JVJA 2WGWB 4WYYA 4FH2A 4C75A 5DF7A 1YLTA 3G34A 5E2EA 3IF6A 2ZM0A 3OZHA 3VFHA 3FKWA 2IWDA 1LL5A 1IYOA 4S2OA 1VM1A 1FSWA 2WUQA 2HDRA 3G30A 4X6TA 5EVID 3FZCA 3VSLA 1Q2QA 2G2UA 1L0DA 4GN2A 2P9VA 1ONHA 4R4RA 5AQ9A 3VSKA 5E43A 3N4IA 5FQMA 5D3OA 4IVIA 2XD1A 4Y0OA 4DF6A 1QMFA 2Y2JA 4GD8A 4KZ9A 4GZBA 4OOMA 3TSGA 3Q1FA 3W4OA 2IWBA 3C5AA 1Y54A 3Q7VA 4IBXA 4JXGA 2Y91A 1PZOA 4JF5A 3WWXA 4K0WA 5M19A 3OPRA 4BL3A 3PBQA 4M3KA 1XKZA 4DRTA 3ITAA 3CJMA 1SDEA 3VP2A 2WKEA 4KG6A 5GHZA 5FAPA 4WZ5A 1J9MA 3M2JA 3IQAA 1Z6FA 1RCJA 3IH9A 4OKPA 3N7WA 4LV0A 4UHUA 5FQ9A 3BEBA 3G2ZA 1CI9A 1IYQA 5GHYA 3MZEA 3UO9A 2PBYA 3ZG5A 1YLJA 3FKVA 4XUXA 2OV5A 1LI9A 4E3KA 2Y2NA 4JLFA 3IXBA 5IHVA 4DDSA 3FV7A 2B5RA 2WZXA 1CI8A 3RXXA 1ESIA 1YLPA 1XX2A 1RGYA 4OPYA 2Y2IA 1NYMA 4YFMA 4OH0A 2WAFA 4B88A 1OMEA 1ESUA 3IF6B 3LY4A 1LL9A 3PAEA 4JF4A 4R23A 4S2NA 4XXRA 5L2FA 4IBRA 4KENB 3IWQA 4DKIA 1DJBA 3MBZA 4X68A 3ZG9B 1WYBA 3BFDA 1DY6A 4BD1A 1PIOA 3PBTA 1K56D 3IF6C 2R9WA 3MKFA 3S1YA 1K55A 2WAEA 3V3SA 2WK0A 2ZC5B 1FR6A 2EXBA 4PM5A 3P09A 2P9VB 4KZ5A 2ZQAA 3DWKA 3SS3A 3ZHHA 1HD8A 1ERQA 4O7DA 3RXWA 1FCMA 4FCFA 2V1ZA 1ES2A 3IXGA 4KG5A 4MBKA 3CG5A 3HBRA 1G6AA 4HBUA 1PWGA 4P6BA 2WYXA 1VQQA 1ZG4A 3MFDA 1E3UA 1MKIA 5CHMA 2ZD8A 3IXDA 4E3OA 1PI5A 1CK3A 4QY5A 4RYEA 3O3VA 2Q9NA 4Y0UA 4CJNA 4MBFA 3GR2A 4DE2A 4OVDA 1K38A 1MWUA 3HLBA 4EV4A 3ZG8B 3PBNA 1FCOA 4S2MA 3HLFA 2XQZA 1BSGA 5EPHA 4ZAMA 4P87A 2ZQ7A 4OPZA 5EVIA 3LCEA 3A3EA 2ZC7A 2XD5A 3NIAA 4HESA 3FYZA 4HEFA 1JWVA 3B3XA 4WZ5C 1CEFA 4RX2A 1L0EA 3W4QA 5KZHA 3A3DA 3QHYA 4E3JA 4LV2A 4DE3A 2A49A 4WEJA 5CHJA 4E3LA 3VP3A 4ZJ3A 2EX2A 2C6WB 4QHCA 1LLBA 4QU3A 1L0FA 4GDBA 3ZGAB 4KQQA 4E6XA 2FFFB 2Y59A 1NRFA 1SDNA 3HLWA 3LO7A 4IVKA 3O86A 4KZBA 4UA9A 2ZM2A 5GLAA 4DXBA 1ES4A 4K91A 3GQZA 4R4SA 3W4PA 2XH9A 1GCEA 5JYPA 4KZ3A 1SCWA 4OQGA 4Q8IA 3NCKA 5CGXA 4F94A 4WBGA 2JC7A 3IHAA 4RVAA 2I72A 4JPMA 5J8XA 4GKUA 1BULA 4OQ0A 1K55C 1GA9A 1U60A 4GD6A 1H8ZA 1PWDA 4Y0TA 2QMIA 4OLGA 1KVMA 1EROA 4N9LA 1K25A 4P85A 2ZC6B 3VOZA 3G32A 4PM8A 3OC2A 1BLCA 5DF9A 5KSHA 2H5SA 5HL1A 4K0XA 5CXWA 4NK3A 4WZ4A 4FH4A 5DTTA 5DTKA 5FI2A 2ZMAA 4LENA 1XA1A 3M2KA 5M1AA 5CECA 5DTSA 5F82A 4KZAA 1S6RA 1TVFA 4U3TA 3IF5A 3SH9A 1XGJA 5EOOA 4LCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GSG A;  4S2I A;  3SH8 A;  1PW1 A;  4ID4 A;  4FD8 A;  4OP5 A;  4OLD A;  1NXY A;  2Z2L B;  1KDW A;  3M6B A;  5F83 A;  4GDN A;  1FOF A;  2X02 A;  4WMC D;  2ZQ9 A;  5EVL A;  3WS5 A;  3ZG7 B;  1I2W A;  1FQG A;  2XF3 A;  1MWT A;  3ZNT A;  1JTG A;  5EE8 A;  1I5Q A;  3S4X A;  3V5M A;  2ZQC A;  3OPP A;  3SH7 A;  1IEL A;  4JXV A;  1NJ4 A;  5TR7 A;  4MNR A;  3HUN A;  3C7U A;  3HLD A;  5E2F A;  3QNC A;  1WE4 A;  1YM1 A;  1PZP A;  2EX9 A;  2UWX A;  4ZTK A;  4C3Q A;  3DW0 A;  1NZO A;  2ZQD A;  2EXA A;  5AQB A;  3SS4 A;  4EBL A;  1ES5 A;  2Y4A A;  1TDL A;  4KZ6 A;  4X53 A;  1XGI A;  4GOG A;  3HL9 A;  2J9P A;  5CHU A;  2ZQ8 A;  5F1F A;  5E2G A;  5U47 A;  1WYC A;  2HP6 A;  2XDM A;  5EEC A;  4E3M A;  1LHY A;  3OCN A;  1CEG A;  1GHM A;  1K6R A;  2Y2M A;  3ZVT A;  1YMX A;  2EX6 A;  3G2Y A;  5CEB A;  4OQH A;  3HLE A;  5A93 A;  4FSF A;  5GHX A;  2EFX A;  3V50 A;  3HUM A;  1KVL A;  5A92 A;  3IWI A;  3UE3 A;  1AXB A;  4QD4 A;  5AQ7 A;  1FR1 A;  4DXC A;  1XPB A;  2DCF A;  1I2S A;  1GHI A;  2E8I A;  2PU4 A;  4JKT A;  4DE0 A;  2ZLY A;  1PW8 A;  2Y2O A;  3N8S A;  3PAG A;  4JXW A;  4YIN A;  5DF8 A;  3WS0 A;  3AGE A;  3UY6 A;  3MZF A;  3IHB A;  4WEL A;  3E2L A;  4UA7 A;  1SHV A;  3GMW A;  3Q7V B;  1ALQ A;  3ZG0 A;  1KE0 A;  2HP5 A;  3WRZ A;  2JCH A;  3VFF A;  3BFC A;  3N8R A;  4PM7 A;  2WGV A;  3BFG A;  1RP5 A;  3BFE A;  1XP4 A;  1ES3 A;  3LY3 A;  5TFQ A;  2XFS A;  4KQR A;  4N9K A;  1KE3 A;  3TG9 A;  3EQU A;  4S2P A;  4EBN A;  1QME A;  1DJA A;  1PI4 A;  3WS4 A;  3ZDJ A;  4LV1 A;  3NC8 A;  2VGJ A;  4BD0 A;  3UPP A;  1ZC2 A;  2HDQ A;  4GNU A;  4PM9 A;  3MXR A;  2P74 A;  2HPB A;  1JWZ A;  3DTM A;  1IKG A;  2PU2 A;  5GLC A;  1G68 A;  5FQK A;  3BYD A;  4JBF A;  4OP8 A;  5EUA A;  3UDI A;  2H0Y A;  3GRJ A;  3WS2 A;  3G4P A;  3UE0 A;  3N8L A;  1MBL A;  1BLP A;  4GB7 A;  4S2N C;  2R9X A;  4DE1 A;  4OOY A;  5HAQ A;  3OCL A;  2FFY A;  1KGF A;  1EWZ A;  3SOI A;  2ZJ9 A;  3O88 A;  1BUE A;  1K4F A;  2WKH A;  4BJP A;  4JF6 A;  3CMZ A;  3OPH A;  4KZ4 A;  5FA7 A;  4KZ8 A;  2J8Y A;  1NZU A;  1KE4 A;  4DDY A;  3OPL A;  3WRT A;  4EQI A;  4Y7P A;  1PWC A;  1JTD A;  3JYI A;  3NBL A;  4PMA A;  2HDS A;  4B4Z A;  3NY4 A;  3ZNY A;  1K56 A;  4D2O A;  3AGF A;  5EVI B;  5HAI A;  5G18 A;  2CC1 A;  4U0T A;  2BG1 A;  1K54 A;  3MXS A;  1N9B A;  5EVI C;  3DWZ A;  3GTC A;  1O7E A;  3HLG A;  4PM6 A;  4ZJ2 A;  1NYY A;  1E4D A;  1E3U D;  3FWL A;  2G2W A;  5A91 A;  2WKI A;  1YQS A;  3VP1 A;  3C7V A;  5FI6 A;  4E6W A;  3UN7 A;  2IWC A;  3BRM A;  3TOI A;  4C6Y A;  2Y2G A;  1IYS A;  4N92 A;  3D4F A;  1LI0 A;  1W5D A;  4S2J A;  3IXH A;  3PTE A;  1JWP A;  3GVB A;  1BTL A;  3IWO A;  4XUZ A;  1IYP A;  1O07 A;  2XEP A;  3EQV A;  5HAP A;  1MWR A;  2XR0 A;  1MWS A;  4NET A;  3UDX A;  2J9O A;  3C4O A;  4S2K A;  5FQJ A;  3PBS A;  5F1G A;  2ZC3 B;  3V3R A;  3P98 A;  4HBT A;  3Q7Z A;  5FQI A;  5GLD A;  4BL2 A;  3BEC A;  2Y2Q A;  5GLB A;  3C4P A;  3S22 A;  2BLS A;  2Q9M A;  2Y2K A;  3M6H A;  1HVB A;  4P0M A;  3A3J A;  1YLY A;  3AGD A;  2DNS A;  3BLS A;  5BOH A;  4OON A;  2XGN A;  4EUZ A;  2RCX A;  3V39 A;  4UAA A;  5JYO A;  4UA6 A;  1DJC A;  4R3B A;  2XFT A;  3VOY A;  1IEM A;  2GDN A;  3ZFZ A;  2A3U A;  4ZBE A;  1KGG A;  5FAT A;  3G35 A;  1HZO A;  4KG2 A;  4RX3 A;  5KMW A;  3PBO A;  1TEM A;  5A90 A;  5AQA A;  3UDF A;  1YLZ A;  4ZDX A;  4IED A;  3UNW A;  1HTZ A;  3NDE A;  1ZKJ A;  3VP0 A;  5HW3 A;  5CGS A;  1K57 A;  3PBR A;  3NDG A;  3GV9 A;  1S0W A;  2OLV A;  2X01 A;  1K54 C;  3O87 A;  5GL9 A;  1FSY A;  1BLS A;  3NI9 A;  1MXO A;  2V2F F;  3ISG A;  5FDH A;  5FAS A;  2XLN A;  5FI7 A;  1XXM A;  3VMA A;  1GA0 A;  3W8K A;  1FCN A;  2HP9 A;  1M40 A;  2Y55 A;  1PYY A;  1BT5 A;  3MZD A;  4MEZ A;  3BLM A;  2Y2P A;  2JBF A;  2DRW A;  4N1X A;  2EX8 A;  3Q82 A;  2WZZ A;  2ZM8 A;  1L0G A;  2OSU A;  4E3N A;  1NY0 A;  2EFU A;  3UPO A;  1YMS A;  4BQM A;  4KZ7 A;  2H10 A;  3ZVW A;  2J7V A;  4MBH A;  1IKI A;  1H5X A;  5CTN A;  5E2H A;  5FSR A;  4E3I A;  4A5R A;  1YLW A;  5HX9 A;  4QJG A;  1M6K A;  1YT4 A;  1SKF A;  4H8R A;  4WMC A;  3VP4 A;  4QB8 A;  1E25 A;  2WGW A;  4L0L A;  3RJU A;  4BEN A;  5I94 A;  4JXS A;  4RA7 A;  4OPQ A;  2Y2H A;  5CED A;  1EI5 A;  3IH8 A;  1ONG A;  1H8Y A;  4R0Q A;  2X71 A;  5DVA A;  3A3I A;  5M18 A;  1N4O A;  2H0T A;  3QNB A;  5CGW A;  3UE1 A;  4EWF A;  1KDS A;  1W79 A;  1RGZ A;  4MLL A;  5FAQ A;  1ZG6 A;  3N6I A;  4EBP A;  4BLM A;  5CTM A;  4U0X A;  5FAO A;  1BZA A;  3UPN A;  3IT9 A;  3HVF A;  1K57 C;  2VGK A;  3HLC A;  1Q2P A;  3CZD A;  4Z9Q A;  3ZCZ A;  3BM6 A;  3E2K A;  2OLU A;  2C5W B;  3G31 A;  4QY6 A;  4PPR A;  5CER A;  2Z2M B;  1MPL A;  3MKE A;  4LV3 A;  3Q81 A;  2RL3 A;  4N1H A;  5TGF A;  4CPK A;  2HDU A;  3HRE A;  4S2L A;  4X55 A;  4KQO A;  4WM9 A;  2Y2L A;  1K6S A;  5KSC A;  3WS1 A;  1GHP A;  3A3F A;  1BLH A;  2WGI A;  1W8Y A;  5FQQ A;  4ZJ1 A;  3SS5 A;  3Q07 A;  5EOE A;  2XK1 A;  2ZC4 B;  4R3J A;  4OOL A;  4B4X A;  3HUO A;  5CRF A;  3BFF A;  4LCL A;  3I7J A;  2JE5 A;  2QZ6 A;  1W7F A;  4X56 A;  1TDG A;  1L2S A;  1W8Q A;  2QPN A;  3LEZ A;  4OQI A;  2V20 A;  2WAD A;  4OPR A;  4X69 A;  1ERM A;  5HAR A;  1MY8 A;  4WEK A;  1C3B A;  1KGE A;  3ITB A;  4R1G A;  1XA7 A;  1K4E A;  5HFO A;  1JVJ A;  2WGW B;  4WYY A;  4FH2 A;  4C75 A;  5DF7 A;  1YLT A;  3G34 A;  5E2E A;  3IF6 A;  2ZM0 A;  3OZH A;  3VFH A;  3FKW A;  2IWD A;  1LL5 A;  1IYO A;  4S2O A;  1VM1 A;  1FSW A;  2WUQ A;  2HDR A;  3G30 A;  4X6T A;  5EVI D;  3FZC A;  3VSL A;  1Q2Q A;  2G2U A;  1L0D A;  4GN2 A;  2P9V A;  1ONH A;  4R4R A;  5AQ9 A;  3VSK A;  5E43 A;  3N4I A;  5FQM A;  5D3O A;  4IVI A;  2XD1 A;  4Y0O A;  4DF6 A;  1QMF A;  2Y2J A;  4GD8 A;  4KZ9 A;  4GZB A;  4OOM A;  3TSG A;  3Q1F A;  3W4O A;  2IWB A;  3C5A A;  1Y54 A;  3Q7V A;  4IBX A;  4JXG A;  2Y91 A;  1PZO A;  4JF5 A;  3WWX A;  4K0W A;  5M19 A;  3OPR A;  4BL3 A;  3PBQ A;  4M3K A;  1XKZ A;  4DRT A;  3ITA A;  3CJM A;  1SDE A;  3VP2 A;  2WKE A;  4KG6 A;  5GHZ A;  5FAP A;  4WZ5 A;  1J9M A;  3M2J A;  3IQA A;  1Z6F A;  1RCJ A;  3IH9 A;  4OKP A;  3N7W A;  4LV0 A;  4UHU A;  5FQ9 A;  3BEB A;  3G2Z A;  1CI9 A;  1IYQ A;  5GHY A;  3MZE A;  3UO9 A;  2PBY A;  3ZG5 A;  1YLJ A;  3FKV A;  4XUX A;  2OV5 A;  1LI9 A;  4E3K A;  2Y2N A;  4JLF A;  3IXB A;  5IHV A;  4DDS A;  3FV7 A;  2B5R A;  2WZX A;  1CI8 A;  3RXX A;  1ESI A;  1YLP A;  1XX2 A;  1RGY A;  4OPY A;  2Y2I A;  1NYM A;  4YFM A;  4OH0 A;  2WAF A;  4B88 A;  1OME A;  1ESU A;  3IF6 B;  3LY4 A;  1LL9 A;  3PAE A;  4JF4 A;  4R23 A;  4S2N A;  4XXR A;  5L2F A;  4IBR A;  4KEN B;  3IWQ A;  4DKI A;  1DJB A;  3MBZ A;  4X68 A;  3ZG9 B;  1WYB A;  3BFD A;  1DY6 A;  4BD1 A;  1PIO A;  3PBT A;  1K56 D;  3IF6 C;  2R9W A;  3MKF A;  3S1Y A;  1K55 A;  2WAE A;  3V3S A;  2WK0 A;  2ZC5 B;  1FR6 A;  2EXB A;  4PM5 A;  3P09 A;  2P9V B;  4KZ5 A;  2ZQA A;  3DWK A;  3SS3 A;  3ZHH A;  1HD8 A;  1ERQ A;  4O7D A;  3RXW A;  1FCM A;  4FCF A;  2V1Z A;  1ES2 A;  3IXG A;  4KG5 A;  4MBK A;  3CG5 A;  3HBR A;  1G6A A;  4HBU A;  1PWG A;  4P6B A;  2WYX A;  1VQQ A;  1ZG4 A;  3MFD A;  1E3U A;  1MKI A;  5CHM A;  2ZD8 A;  3IXD A;  4E3O A;  1PI5 A;  1CK3 A;  4QY5 A;  4RYE A;  3O3V A;  2Q9N A;  4Y0U A;  4CJN A;  4MBF A;  3GR2 A;  4DE2 A;  4OVD A;  1K38 A;  1MWU A;  3HLB A;  4EV4 A;  3ZG8 B;  3PBN A;  1FCO A;  4S2M A;  3HLF A;  2XQZ A;  1BSG A;  5EPH A;  4ZAM A;  4P87 A;  2ZQ7 A;  4OPZ A;  5EVI A;  3LCE A;  3A3E A;  2ZC7 A;  2XD5 A;  3NIA A;  4HES A;  3FYZ A;  4HEF A;  1JWV A;  3B3X A;  4WZ5 C;  1CEF A;  4RX2 A;  1L0E A;  3W4Q A;  5KZH A;  3A3D A;  3QHY A;  4E3J A;  4LV2 A;  4DE3 A;  2A49 A;  4WEJ A;  5CHJ A;  4E3L A;  3VP3 A;  4ZJ3 A;  2EX2 A;  2C6W B;  4QHC A;  1LLB A;  4QU3 A;  1L0F A;  4GDB A;  3ZGA B;  4KQQ A;  4E6X A;  2FFF B;  2Y59 A;  1NRF A;  1SDN A;  3HLW A;  3LO7 A;  4IVK A;  3O86 A;  4KZB A;  4UA9 A;  2ZM2 A;  5GLA A;  4DXB A;  1ES4 A;  4K91 A;  3GQZ A;  4R4S A;  3W4P A;  2XH9 A;  1GCE A;  5JYP A;  4KZ3 A;  1SCW A;  4OQG A;  4Q8I A;  3NCK A;  5CGX A;  4F94 A;  4WBG A;  2JC7 A;  3IHA A;  4RVA A;  2I72 A;  4JPM A;  5J8X A;  4GKU A;  1BUL A;  4OQ0 A;  1K55 C;  1GA9 A;  1U60 A;  4GD6 A;  1H8Z A;  1PWD A;  4Y0T A;  2QMI A;  4OLG A;  1KVM A;  1ERO A;  4N9L A;  1K25 A;  4P85 A;  2ZC6 B;  3VOZ A;  3G32 A;  4PM8 A;  3OC2 A;  1BLC A;  5DF9 A;  5KSH A;  2H5S A;  5HL1 A;  4K0X A;  5CXW A;  4NK3 A;  4WZ4 A;  4FH4 A;  5DTT A;  5DTK A;  5FI2 A;  2ZMA A;  4LEN A;  1XA1 A;  3M2K A;  5M1A A;  5CEC A;  5DTS A;  5F82 A;  4KZA A;  1S6R A;  1TVF A;  4U3T A;  3IF5 A;  3SH9 A;  1XGJ A;  5EOO A;  4LCM A; 
#chains in the Genus database with same CATH topology
 2ZOH A;  1L3L A;  1NXY A;  5F83 A;  3M6B A;  1FOF A;  4WMC D;  3WS5 A;  2O9A A;  1I2W A;  1MWT A;  3MS6 A;  4GS9 A;  1JTG A;  3V5M A;  2ZQC A;  3SH7 A;  1IEL A;  4MNR A;  1WE4 A;  4EEU A;  2EX9 A;  3DTK A;  3DW0 A;  1V9Y A;  4R3A A;  5DKL A;  1S1Z A;  1TDL A;  1ZTU A;  4R6L A;  1XGI A;  2ZQ8 A;  1WYC A;  2XDM A;  4E3M A;  1GHM A;  1Z09 A;  4FSF A;  1KVL A;  2JKT M;  3ICY A;  4L9G A;  2JKT I;  1YKD A;  2VEA A;  3NJA A;  1PW8 A;  4YIN A;  3D72 A;  3WS0 A;  3UY6 A;  3IHB A;  3E2L A;  3WRZ A;  3VFF A;  1NLZ A;  1OTD A;  4PM7 A;  3BFE A;  3MF0 A;  1VET B;  5TFQ A;  3C2W A;  1DJA A;  4NEE D;  1PI4 A;  3NC8 A;  1ZC2 A;  2O9B A;  3MXR A;  1G6O A;  2P74 A;  4RQ9 A;  2PU2 A;  1G68 A;  4PHT A;  3HCY A;  5EM1 A;  3N8L A;  1OTE A;  1BLP A;  2FH5 A;  3CLO A;  4S2N C;  3D9Y A;  1EWZ A;  3DBA A;  1F2K A;  1P9R A;  1K4F A;  2WKH A;  4JF6 A;  2ZL1 A;  1S66 L;  2WKR A;  4KZ8 A;  4MMN A;  3C8C A;  4IUK A;  3F1N A;  3IBJ A;  2HDS A;  1K56 A;  2HGV A;  5HAI A;  5G18 A;  4Y17 A;  1K54 A;  5EVI C;  1P0Z A;  4PM6 A;  4ZJ2 A;  2L0W A;  3FWL A;  2VLG A;  5HWW A;  3VP1 A;  4E6W A;  3UN7 A;  5HPI A;  2L4R A;  2XA7 M;  4IUH A;  2Y2G A;  3D4F A;  1LI0 A;  1BTL A;  1XJ3 A;  3EQV A;  5HAP A;  1MWR A;  3UDX A;  2J9O A;  3V3R A;  4HBT A;  5FQI A;  3CHW P;  4B93 A;  3C4P A;  3S22 A;  2BLS A;  2NUT C;  3M6H A;  5EM0 A;  4CLC A;  3AGD A;  5BOH A;  3V39 A;  3IBR A;  4UA6 A;  2M7V A;  2JHE A;  5DFX A;  1KGG A;  5FAT A;  1YPR A;  4KG2 A;  3PBO A;  1XJ4 A;  5A90 A;  3UDF A;  4MN6 A;  1ZKJ A;  1OT9 A;  1K54 C;  1FSY A;  3NI9 A;  5F69 A;  1OJG A;  3ISG A;  1XXM A;  3W8K A;  1FCN A;  2HP9 A;  3EGX C;  2EX8 A;  2WZZ A;  3KSI A;  1NY0 A;  4X1M A;  2EFU A;  2H10 A;  2J7V A;  1H5X A;  4QJG A;  3LIA A;  1SKF A;  5I94 A;  5HWT A;  1X0O A;  3UB8 A;  5CED A;  3MQO A;  3QNB A;  4G3W A;  2GJ3 A;  4MLL A;  5FAQ A;  4ME4 A;  3DTI A;  3T4O A;  3N6I A;  4EBP A;  5FAO A;  2W3E A;  2VGK A;  3L9K A;  4Z9Q A;  3BM6 A;  2OLU A;  2C5W B;  4PPR A;  5CER A;  2Z2M B;  4LV3 A;  3Q81 A;  4CPK A;  4S2L A;  2K31 A;  5KSC A;  2FZ0 A;  3Q07 A;  1F5M A;  4HY8 A;  5CRF A;  4LCL A;  2JE5 A;  4X56 A;  1W7F A;  1L2S A;  4OPR A;  2WAD A;  5HAR A;  1C3B A;  1K4E A;  4C75 A;  4LLO B;  4EUV A;  1IYO A;  4EW7 A;  1FSW A;  2HDR A;  1OTB A;  5EVI D;  3FZC A;  3LID A;  3VSL A;  1L0D A;  4GN2 A;  4I39 A;  4LGW A;  3VSK A;  3S7O A;  4Y13 A;  4IVI A;  4Y0O A;  3C5A A;  4IBX A;  2Y91 A;  1PZO A;  4K0W A;  3OPR A;  3S7P A;  1XKZ A;  4YNR A;  2YKH A;  1D1J A;  4KG6 A;  3R4K A;  5GHZ A;  3IQA A;  5AVF A;  5HZH A;  2QHK A;  3BEB A;  3LI8 A;  1CI9 A;  5GHY A;  3MZE A;  1LI9 A;  2PHY A;  4DDS A;  5IHV A;  3FV7 A;  4WF0 A;  4ESP A;  1CI8 A;  1ESI A;  3T50 A;  4YFM A;  1XJ6 A;  3IF6 B;  4IBR A;  1DJB A;  3MBZ A;  1IFQ A;  3MR0 A;  1WYB A;  1D06 A;  1PIO A;  1K56 D;  3MKF A;  2R9W A;  3PBT A;  3V3S A;  3UB6 A;  3LGO A;  2EXB A;  4PM5 A;  3P09 A;  3SS3 A;  3E98 A;  3BWL A;  4O7D A;  1FCM A;  5FEF A;  4MBK A;  4BBU A;  4P6B A;  1PWG A;  2KDK A;  4O01 A;  1ZG4 A;  3MFD A;  4HJ4 A;  4LFU A;  1AWI A;  2WKQ A;  1OTI A;  1CK3 A;  3NOU C;  2A2L A;  3GR2 A;  4MBF A;  1VB6 A;  4OVD A;  2WKP A;  4Y2F A;  1FCO A;  2PDR A;  3HLF A;  2XQZ A;  1BSG A;  4JGR A;  5EPH A;  2ZQ7 A;  4OPZ A;  3KSH A;  4MN5 A;  1LT0 A;  2Z6D A;  3B3X A;  3FC7 A;  1CEF A;  4RX2 A;  4IJG A;  3A3D A;  3QHY A;  2OWH A;  3NOP C;  3VP3 A;  3VE3 A;  2GX5 A;  1MKM A;  4E6X A;  1TS8 A;  2Y59 A;  1SKO A;  4I38 A;  4UA9 A;  4DXB A;  1ES4 A;  4OQG A;  4Q8I A;  2I72 A;  5J8X A;  3QP1 A;  4GKU A;  3EOI A;  4Y0T A;  2QMI A;  4OLG A;  5L10 A;  3E4P A;  1K25 A;  4JGP A;  3VOZ A;  5AVE A;  2ZOI A;  3RH8 B;  3T1Q B;  2ZMA A;  3L7H A;  5M1A A;  1XGJ A;  3S7N A;  3GSG A;  4FD8 A;  4OP5 A;  4GDN A;  2X02 A;  2ZQ9 A;  5EVL A;  2D01 A;  3T12 B;  2PYP A;  4JXV A;  3HLD A;  4ZTK A;  4C3Q A;  4E04 A;  1NZO A;  5AQB A;  4EBL A;  1TD5 A;  2Y4A A;  3JPU A;  4KZ6 A;  4GOG A;  5HD3 A;  4O8G A;  2W1T B;  5E2G A;  5F1F A;  2HP6 A;  3OCN A;  3ZVT A;  1YMX A;  3HLE A;  5A93 A;  4BMW A;  3HUM A;  2JKR I;  3C30 A;  3GEC A;  4QD4 A;  2DCF A;  2V8F A;  2O0Y A;  4F3L B;  1GHI A;  2GZA A;  2ZLY A;  4JXW A;  4HI4 A;  2VKS A;  3MZF A;  1Y4O A;  4UA7 A;  3GMW A;  3BFC A;  3N8R A;  1T19 A;  3F1O A;  2WGV A;  5J7E A;  1XP4 A;  4KQR A;  3TG9 A;  2H28 A;  1WA9 A;  4ARZ B;  2PRF A;  3WS4 A;  3ZDJ A;  4LV1 A;  4Q0H A;  2VZW A;  2HDQ A;  4GNU A;  4PM9 A;  3R7W B;  3DTM A;  3IX4 A;  1IKG A;  4EU0 A;  4G3V A;  4JBF A;  3OBF A;  4GHI A;  3UDI A;  2VV8 A;  5L09 A;  3WS2 A;  3QP8 A;  4LPZ A;  5FEG A;  2V1A A;  5HAQ A;  1V9Z A;  2FFY A;  1KGF A;  3IS2 A;  1S67 L;  1BUE A;  3U4L P;  1NLY A;  3A0V A;  4KZ4 A;  4GCZ A;  5AJG A;  2DMW A;  2V0U A;  3H7W A;  1H0M A;  4Y15 A;  5TBM A;  2CC1 A;  2Z6C A;  3UB5 P;  4U0T A;  3PYP A;  3DWZ A;  3GTC A;  3HLG A;  1E4D A;  5FDS A;  5A91 A;  2WKI A;  1YQS A;  5FI6 A;  2PBD P;  1DRM A;  2KLI A;  3IX3 A;  3KSF A;  4C6Y A;  1IYS A;  3VV4 A;  3IXH A;  3PTE A;  1JWP A;  3IWO A;  1O07 A;  2XEP A;  2XR0 A;  4NET A;  1ODV A;  3K3D A;  5F1G A;  3BEC A;  3TE8 A;  2Q9M A;  4P0M A;  3A3J A;  2EWW A;  1YLY A;  4HIA A;  3A0S A;  4OON A;  2XGN A;  3MQ0 A;  1DJC A;  2XFT A;  1IEM A;  1XFQ A;  2W27 A;  2HJE A;  4ZBE A;  2Y79 A;  5KMW A;  5AQA A;  1W63 Q;  2O9C A;  5EVE A;  1K57 A;  4UEY A;  4GW9 A;  4BBT A;  2X01 A;  3SW1 A;  1S1Y A;  5GL9 A;  2CMN A;  2W0N A;  2G7U A;  3S7Q A;  3VMA A;  1GA0 A;  3LIC A;  2Y55 A;  3MZD A;  2Y2P A;  2JBF A;  4N1X A;  2QJ7 A;  1L0G A;  4E3N A;  3B42 A;  2D02 A;  3D3O A;  4MBH A;  5CTN A;  1YLW A;  1M6K A;  1YT4 A;  3VP4 A;  2Q0O A;  2WGW A;  3EEA A;  4L0L A;  4RA7 A;  5K5B A;  3KO6 A;  1LSV A;  2JKG A;  4OPQ A;  3UE6 A;  3TJZ C;  4HQA A;  1ONG A;  1H8Y A;  2B18 A;  5M18 A;  4KUK A;  1DP6 A;  4NXF A;  3UE1 A;  4EWF A;  3HJI A;  4HJ6 A;  4FUW A;  1RGZ A;  2V1B A;  1XJ2 A;  4U0X A;  3UPN A;  3IT9 A;  1K57 C;  4EER A;  3HLC A;  2YKF A;  1MPL A;  2V0W A;  5TGF A;  3HRE A;  4Z1W A;  2B02 A;  2KX6 A;  4L9F A;  3WS1 A;  1BLH A;  4ZJ1 A;  5EOE A;  2XK1 A;  4OOL A;  4B4X A;  3BFF A;  2QZ6 A;  1W8Q A;  2IA2 A;  1LSW A;  1ERM A;  1KGE A;  3JVU A;  1MC0 A;  1JVJ A;  2J80 A;  3O5Y A;  4FH2 A;  2K2N A;  3ULF A;  5DF7 A;  3G34 A;  2M1C A;  3CWF A;  2IWD A;  4QPR A;  4QWO A;  2QKP A;  2OAQ 1;  1XFN A;  4R4R A;  5AQ9 A;  5E43 A;  5FQM A;  5D3O A;  4DF6 A;  1QMF A;  4OOM A;  3TSG A;  2IWB A;  4PAU A;  4DRT A;  3CJM A;  3VP2 A;  2A24 B;  3M2J A;  4OKP A;  3IH9 A;  3NEC A;  3T4K A;  3T4J A;  2VX8 A;  4ARZ A;  3UMD A;  3G2Z A;  4E3K A;  1UWN X;  4XUX A;  2OV5 A;  2Y2N A;  4GLQ A;  3R7W A;  1XX2 A;  4OPY A;  2W1R A;  1NYM A;  4OH0 A;  2WAF A;  1OME A;  1ESU A;  3LY4 A;  4JF4 A;  4XXR A;  5L2F A;  3UB9 A;  4KEN B;  3IWQ A;  3ZG9 B;  1TS6 A;  3S1Y A;  1K55 A;  2HV1 A;  2WAE A;  3A0R A;  2ZC5 B;  1UWP X;  3CPT B;  2P9V B;  3DWK A;  4HP4 A;  1HD8 A;  3RXW A;  4FCF A;  5JYO A;  1ES2 A;  3CG5 A;  4ETX A;  1E3U A;  1CF0 A;  1G5U A;  2NUP C;  5CHM A;  3IXD A;  3K2N A;  4LRY C;  4CJN A;  4CLC C;  3SZT A;  2XSS A;  4S2M A;  4ZAM A;  4P87 A;  4PKY A;  5G4Z A;  3A3E A;  3F1P A;  3VOL A;  1K0K A;  4B9O A;  4HES A;  3BW6 A;  4HEF A;  1G28 A;  1DP8 A;  2BAS A;  4PKY G;  4E3L A;  4NG2 A;  2C6W B;  4QHC A;  3EEH A;  1L0F A;  4GDB A;  4KQQ A;  1NRF A;  2EA9 A;  5GLA A;  3GQZ A;  2XH9 A;  4WBG A;  3HJK A;  4JGQ A;  4JPM A;  5HD5 A;  1K55 C;  1U60 A;  3UB7 A;  1PWD A;  5IT5 A;  1ERO A;  4N9L A;  4P85 A;  2ZC6 B;  3OC2 A;  1BLC A;  5DF9 A;  5KSH A;  1P97 A;  4YWZ A;  5DTT A;  4WZ4 A;  2VK3 A;  4KZA A;  4BWI A;  4U3T A;  3SH9 A;  5EOO A;  4DMZ A;  4OLD A;  2Z2L B;  2VV7 A;  3ZG7 B;  3V67 A;  1FQG A;  2XF3 A;  3LIB A;  3H9W A;  2MJ6 A;  5EE8 A;  1I5Q A;  2ZBB A;  5TR7 A;  3E4O A;  5E2F A;  1VET A;  2UWX A;  5HDC A;  2EXA A;  1GSW A;  1ES5 A;  1NRJ A;  4ZRR A;  2VA0 A;  3HL9 A;  5CHU A;  4JGO A;  2Y2M A;  2K7S A;  4XT2 B;  3G2Y A;  3V50 A;  2W3D A;  4EET B;  5A92 A;  1AXB A;  5AQ7 A;  1FR1 A;  2XA7 S;  4Q0J A;  2Y2O A;  5DF8 A;  3KYQ A;  5I5L A;  4WEL A;  1ALQ A;  3BY8 A;  1KE0 A;  4GS9 B;  3W2Z A;  3H82 B;  4EEP A;  1ES3 A;  3CUE A;  4N9K A;  3EQU A;  4S2P A;  1OTA A;  1QME A;  2P04 A;  1MZU A;  4UQI M;  3UPP A;  4HHD A;  4CLC D;  2HPB A;  1ACF A;  3GRJ A;  3G4P A;  1T1A A;  3UE0 A;  3T4T A;  3QP2 A;  4K08 A;  1YAX A;  2I9V A;  2ZJ9 A;  3O88 A;  3T4L A;  2INW A;  5FA7 A;  4NXG A;  2PD7 A;  3WRT A;  4EQI A;  4Y7P A;  1PWC A;  3ZQ5 A;  1JTD A;  3JYI A;  3NBL A;  4L9E A;  4PMA A;  1TS0 A;  2R78 A;  4B4Z A;  2A24 A;  1D7E A;  5EVI B;  2HF6 A;  4ETZ A;  2BG1 A;  2PR6 A;  4KQD A;  3CUE C;  1O7E A;  4EES A;  1E3U D;  2IWC A;  3BRM A;  3KX0 X;  5F6A A;  1W63 M;  1W5D A;  5J3W A;  4XUZ A;  3CPT A;  5HPF A;  1MWS A;  2XRO A;  4S2K A;  1F98 A;  2XRN A;  2ZC3 B;  3P98 A;  5GLD A;  3Q7Z A;  2Y2Q A;  1HVB A;  2ZL1 B;  1YSQ A;  3KSG A;  3BQA A;  3BLS A;  2RCX A;  4UAA A;  1A0K A;  3F1N B;  5F68 A;  3LEQ A;  2B95 A;  2GDN A;  3ZFZ A;  2A3U A;  2PD8 A;  5A8B A;  1HZO A;  4RX3 A;  1TEM A;  4IED A;  1HTZ A;  5HW3 A;  3VP0 A;  3PBR A;  3NDG A;  3CAX A;  1TF1 A;  1S0W A;  2W3H A;  5J4E A;  3O87 A;  3RFB A;  5FDH A;  5FAS A;  3MQQ A;  5FI7 A;  4FTX A;  1PYY A;  3BLM A;  2DRW A;  3Q82 A;  5DJT A;  1F9I A;  1YMS A;  4KZ7 A;  3ZVW A;  3GDI A;  1IKI A;  5FSR A;  4WLA A;  3CI6 A;  4H8R A;  4QB8 A;  3RJU A;  3MMH A;  4JXS A;  3BQ8 A;  2Y2H A;  3IH8 A;  4R0Q A;  5DVA A;  1N4O A;  1T1C A;  2H0T A;  5CGW A;  1W79 A;  5DKK A;  3MXQ A;  1SZV A;  4BLM A;  5CTM A;  5KIZ A;  3HVF A;  1OPX A;  1VEU B;  3CZD A;  3PR6 A;  2J3T C;  3MKE A;  2RL3 A;  2HDU A;  1OT6 A;  2V9A A;  4X55 A;  4WM9 A;  1K6S A;  1GHP A;  3A3F A;  2GNX A;  2WGI A;  1W8Y A;  3SS5 A;  4MDZ A;  3B33 A;  2ZC4 B;  2ACG A;  3HUO A;  3T4S A;  1TDG A;  4X69 A;  3LEZ A;  2V20 A;  1MY8 A;  4WL9 A;  3ITB A;  4R1G A;  5G4Y A;  5HFO A;  4WYY A;  2J3W A;  3IF6 A;  3LYX A;  3OZH A;  4UQI S;  3T4Q A;  1T1B A;  3G30 A;  4R38 A;  1ONH A;  3FPW A;  4HJ3 A;  5F5Y A;  3NHQ A;  2XD1 A;  2Y2J A;  4KZ9 A;  2QYB A;  3Q1F A;  4DN0 A;  3W4O A;  4JXG A;  4KUO A;  3G6O A;  5M19 A;  3H82 A;  4HP9 A;  4M3K A;  1SDE A;  2WKE A;  3N7W A;  4UHU A;  5FQ9 A;  2JKF A;  1IYQ A;  2OWJ A;  3ZG5 A;  3FKV A;  4JLF A;  3IXB A;  3QP5 A;  2B5R A;  1Y28 A;  1YLP A;  5MC7 A;  2OAP 1;  4NXE A;  4R23 A;  2W3F A;  4S2N A;  4DKI A;  4P6Z M;  4BD1 A;  1DY6 A;  3IF6 C;  2M7U A;  4D60 A;  4KZ5 A;  2ZQA A;  4DJ2 A;  4KG5 A;  1FIK A;  3HBR A;  4BD0 A;  1G6A A;  1VQQ A;  1PNE A;  4I5S A;  5DJU A;  2ZD8 A;  2AVX A;  4IHQ A;  3O3V A;  4CLC E;  1GSV A;  1MWU A;  3HLB A;  4EV4 A;  3ZG8 B;  3PBN A;  1N9O A;  5EVI A;  2OOL A;  2O99 A;  1T18 A;  2ZC7 A;  2XD5 A;  3NIA A;  1JWV A;  1L0E A;  4LV2 A;  2A49 A;  4WEJ A;  1S4R A;  4ZJ3 A;  3VE4 A;  2FFF B;  3HLW A;  1SDN A;  3LO7 A;  4DE3 A;  4IVK A;  4X1L A;  4F94 A;  2JC7 A;  3IHA A;  4RVA A;  3EWK A;  1GA9 A;  1CJF A;  4GD6 A;  2J3T D;  4H6J B;  3LFV A;  2W1T A;  4NK3 A;  4FH4 A;  5FI2 A;  3M2K A;  1S6R A;  3NUL A;  3IXG A;  3IF5 A;  2P08 A;  4LCM A;  4S2I A;  3SH8 A;  3K3C A;  4F3L A;  1PW1 A;  3EGD C;  4ID4 A;  1UGU A;  4NXB A;  1KDW A;  3ZNT A;  2PYR A;  3NOT C;  3S4X A;  1SKO B;  1PFL A;  5IU1 A;  3OPP A;  5HSQ A;  1NJ4 A;  3HUN A;  3C7U A;  2BTF P;  3QNC A;  1YM1 A;  1PZP A;  3KYZ A;  2ZQD A;  3SS4 A;  4X53 A;  2PT7 A;  2J9P A;  5CX7 A;  5U47 A;  3T1X A;  5EEC A;  1LHY A;  1CEG A;  1K6R A;  5HDD A;  5CEB A;  2EX6 A;  4OQH A;  4WN5 A;  5GHX A;  2EFX A;  2L1M A;  5LBR A;  3IWI A;  3UE3 A;  2JN7 A;  5FL3 A;  1IOU A;  4DXC A;  5HDS A;  1XPB A;  1I2S A;  3P7N A;  3LIE A;  3E0Y A;  2E8I A;  2PU4 A;  3FG8 A;  4G3K A;  4JKT A;  4DE0 A;  3PAG A;  3N8S A;  1LSX A;  1VEU A;  3AGE A;  1SHV A;  3Q7V B;  3UME A;  3ZG0 A;  2HP5 A;  2JCH A;  3TW8 A;  4II7 A;  4WUJ A;  3BFG A;  1BYW A;  1RP5 A;  3LY3 A;  2XFS A;  1KE3 A;  1H8M A;  4EBN A;  3U2A A;  3JVV A;  1PRQ A;  3BJN A;  2VGJ A;  1JWZ A;  1LL8 A;  3LIF A;  4HNB A;  5GLC A;  5FQK A;  3BYD A;  5EUA A;  4OP8 A;  4GJ4 A;  3KYE A;  2H0Y A;  3C38 A;  2W3G A;  4MN7 A;  1MBL A;  4GB7 A;  4HH2 A;  2R9X A;  4DE1 A;  4OOY A;  3OCL A;  3DTE A;  4P6Z S;  3SOI A;  4EXO A;  4BJP A;  3CMZ A;  5HWV A;  3OPH A;  2J8Y A;  1NZU A;  1KE4 A;  4DDY A;  1OJ5 A;  3OPL A;  3F1O B;  3MFX A;  3NY4 A;  3ZNY A;  2PR5 A;  4D2O A;  2Y8H A;  2ZMV A;  3AGF A;  3OLO A;  3T1S A;  3MXS A;  1N9B A;  4DJ3 A;  4NKP A;  1N9N A;  1NYY A;  3PHY A;  2G2W A;  3C7V A;  2VV6 A;  3RTY A;  3TOI A;  4GHI B;  1JNU A;  4N92 A;  1P9W A;  4S2J A;  3GVB A;  1IYP A;  3C4O A;  1TS7 A;  5FQJ A;  3PBS A;  3IS2 B;  4HH3 A;  4BL2 A;  5GLB A;  2Y2K A;  2DNS A;  4EUZ A;  1HLU P;  1NWZ A;  4R3B A;  3VOY A;  5IS1 A;  3H7W B;  4FOF A;  5TJJ A;  3LR0 A;  3G35 A;  3OOV A;  3P01 A;  1N9L A;  3FPV A;  5TBM B;  1YLZ A;  4ZDX A;  3UNW A;  3NDE A;  2PAV P;  5CGS A;  1DP9 A;  3GV9 A;  2OLV A;  2HJ9 C;  5DFY A;  1BLS A;  2VGL M;  1MXO A;  2V2F F;  2XLN A;  1M40 A;  1BT5 A;  4MEZ A;  4EQ1 A;  1S4S A;  2ZM8 A;  2OSU A;  3UPO A;  4BQM A;  3TRC A;  5E2H A;  4E3I A;  4A5R A;  1VHM A;  5HX9 A;  4H6J A;  4WMC A;  2ZMF A;  1E25 A;  2UV0 E;  4BEN A;  2QJ5 A;  3QP6 A;  1EI5 A;  4MCW A;  2X71 A;  3A3I A;  4I3I A;  1H3Q A;  1YSP A;  1KDS A;  2E8J A;  4R70 A;  1ZG6 A;  1BZA A;  1Q2P A;  3ZCZ A;  3E2K A;  4QY6 A;  3G31 A;  4N1H A;  4KQO A;  4BBV A;  2Y2L A;  3BY9 A;  4Y5F A;  5FQQ A;  5C5K A;  3LR4 A;  4R3J A;  3I7J A;  3B47 A;  2QPN A;  4OQI A;  3LUQ A;  2QWS A;  4WEK A;  1XA7 A;  4YOF A;  5L8M A;  2WGW B;  1YLT A;  5E2E A;  3ZYT A;  2ZM0 A;  3VFH A;  3FKW A;  1LL5 A;  4S2O A;  1J3W A;  1VM1 A;  2WUQ A;  4X6T A;  1Q2Q A;  2G2U A;  2P9V A;  3LR3 A;  3N4I A;  1GSX A;  4GD8 A;  4GZB A;  4X25 A;  1Y54 A;  3Q7V A;  4JF5 A;  3WWX A;  3IX8 A;  4HOI A;  4BL3 A;  3PBQ A;  4AFI A;  4M4X A;  3ITA A;  3LI9 A;  2KOI A;  4WZ5 A;  1J9M A;  1Z6F A;  1RCJ A;  4LV0 A;  3UO9 A;  2PBY A;  1YLJ A;  5EV0 A;  2WZX A;  3DAV A;  3RXX A;  1RGY A;  2VJW A;  2Y2I A;  4B88 A;  2EWV A;  1FIL A;  3MSH A;  1LL9 A;  3PAE A;  2JKR M;  4X68 A;  3BFD A;  4Y3I A;  2WK0 A;  1FR6 A;  2LB9 A;  3ZHH A;  1ERQ A;  4I3A A;  2V1Z A;  3LR5 A;  4HBU A;  4LRZ E;  2WYX A;  1MKI A;  1EW0 A;  4CLC B;  2P7J A;  4CQH A;  1KOU A;  4E3O A;  1PI5 A;  4RYE A;  4QY5 A;  2LB5 A;  2Q9N A;  4Y0U A;  4DE2 A;  1K38 A;  4I3J A;  3LCE A;  5EFW A;  3FYZ A;  3QP4 A;  4WZ5 C;  3E4Q A;  3W4Q A;  5KZH A;  4E3J A;  5CHJ A;  2EX2 A;  4QU3 A;  1LLB A;  3ZGA B;  4Q0I A;  4KZB A;  3O86 A;  2ZM2 A;  4K91 A;  1STZ A;  3PXP A;  4R4S A;  3W4P A;  1GCE A;  5JYP A;  4KZ3 A;  1SCW A;  2VGL S;  3NCK A;  5CGX A;  5HL6 A;  1BUL A;  4OQ0 A;  3T1R A;  5L07 A;  1H8Z A;  1ZHH B;  4LRX C;  2HZ5 A;  4O0P A;  3MJQ A;  1KVM A;  3G32 A;  4PM8 A;  2H5S A;  5HL1 A;  4K0X A;  5CXW A;  2V8C A;  4XT2 A;  5DTK A;  1CQA A;  4LEN A;  1XA1 A;  5CEC A;  5DTS A;  5F82 A;  1TVF A;  3F1P B;  5FAP A;  3CIT A; 
#chains in the Genus database with same CATH homology
 3GSG A;  4S2I A;  3SH8 A;  1PW1 A;  4ID4 A;  4FD8 A;  4OP5 A;  4OLD A;  1NXY A;  2Z2L B;  1KDW A;  3M6B A;  5F83 A;  4GDN A;  1FOF A;  2X02 A;  4WMC D;  2ZQ9 A;  5EVL A;  3WS5 A;  3ZG7 B;  1I2W A;  1FQG A;  2XF3 A;  1MWT A;  3ZNT A;  1JTG A;  5EE8 A;  1I5Q A;  3S4X A;  3V5M A;  2ZQC A;  3OPP A;  3SH7 A;  1IEL A;  4JXV A;  1NJ4 A;  5TR7 A;  4MNR A;  3HUN A;  3C7U A;  3HLD A;  5E2F A;  3QNC A;  1WE4 A;  1YM1 A;  1PZP A;  2EX9 A;  2UWX A;  4ZTK A;  4C3Q A;  3DW0 A;  1NZO A;  2ZQD A;  2EXA A;  5AQB A;  3SS4 A;  4EBL A;  1ES5 A;  2Y4A A;  1TDL A;  4KZ6 A;  4X53 A;  1XGI A;  4GOG A;  3HL9 A;  2J9P A;  5CHU A;  2ZQ8 A;  5F1F A;  5E2G A;  5U47 A;  1WYC A;  2HP6 A;  2XDM A;  5EEC A;  4E3M A;  1LHY A;  3OCN A;  1CEG A;  1GHM A;  1K6R A;  2Y2M A;  3ZVT A;  1YMX A;  2EX6 A;  3G2Y A;  5CEB A;  4OQH A;  3HLE A;  5A93 A;  4FSF A;  5GHX A;  2EFX A;  3V50 A;  3HUM A;  1KVL A;  5A92 A;  3IWI A;  3UE3 A;  1AXB A;  4QD4 A;  5AQ7 A;  1FR1 A;  4DXC A;  1XPB A;  2DCF A;  1I2S A;  1GHI A;  2E8I A;  2PU4 A;  4JKT A;  4DE0 A;  2ZLY A;  1PW8 A;  2Y2O A;  3N8S A;  3PAG A;  4JXW A;  4YIN A;  5DF8 A;  3WS0 A;  3AGE A;  3UY6 A;  3MZF A;  3IHB A;  4WEL A;  3E2L A;  4UA7 A;  1SHV A;  3GMW A;  3Q7V B;  1ALQ A;  3ZG0 A;  1KE0 A;  2HP5 A;  3WRZ A;  2JCH A;  3VFF A;  3BFC A;  3N8R A;  4PM7 A;  2WGV A;  3BFG A;  1RP5 A;  3BFE A;  1XP4 A;  1ES3 A;  3LY3 A;  5TFQ A;  2XFS A;  4KQR A;  4N9K A;  1KE3 A;  3TG9 A;  3EQU A;  4S2P A;  4EBN A;  1QME A;  1DJA A;  1PI4 A;  3WS4 A;  3ZDJ A;  4LV1 A;  3NC8 A;  2VGJ A;  4BD0 A;  3UPP A;  1ZC2 A;  2HDQ A;  4GNU A;  4PM9 A;  3MXR A;  2P74 A;  2HPB A;  1JWZ A;  3DTM A;  1IKG A;  2PU2 A;  5GLC A;  1G68 A;  5FQK A;  3BYD A;  4JBF A;  4OP8 A;  5EUA A;  3UDI A;  2H0Y A;  3GRJ A;  3WS2 A;  3G4P A;  3UE0 A;  3N8L A;  1MBL A;  1BLP A;  4GB7 A;  4S2N C;  2R9X A;  4DE1 A;  4OOY A;  5HAQ A;  3OCL A;  2FFY A;  1KGF A;  1EWZ A;  3SOI A;  2ZJ9 A;  3O88 A;  1BUE A;  1K4F A;  2WKH A;  4BJP A;  4JF6 A;  3CMZ A;  3OPH A;  4KZ4 A;  5FA7 A;  4KZ8 A;  2J8Y A;  1NZU A;  1KE4 A;  4DDY A;  3OPL A;  3WRT A;  4EQI A;  4Y7P A;  1PWC A;  1JTD A;  3JYI A;  3NBL A;  4PMA A;  2HDS A;  4B4Z A;  3NY4 A;  3ZNY A;  1K56 A;  4D2O A;  3AGF A;  5EVI B;  5HAI A;  5G18 A;  2CC1 A;  4U0T A;  2BG1 A;  1K54 A;  3MXS A;  1N9B A;  5EVI C;  3DWZ A;  3GTC A;  1O7E A;  3HLG A;  4PM6 A;  4ZJ2 A;  1NYY A;  1E4D A;  1E3U D;  3FWL A;  2G2W A;  5A91 A;  2WKI A;  1YQS A;  3VP1 A;  3C7V A;  5FI6 A;  4E6W A;  3UN7 A;  2IWC A;  3BRM A;  3TOI A;  4C6Y A;  2Y2G A;  1IYS A;  4N92 A;  3D4F A;  1LI0 A;  1W5D A;  4S2J A;  3IXH A;  3PTE A;  1JWP A;  3GVB A;  1BTL A;  3IWO A;  4XUZ A;  1IYP A;  1O07 A;  2XEP A;  3EQV A;  5HAP A;  1MWR A;  2XR0 A;  1MWS A;  4NET A;  3UDX A;  2J9O A;  3C4O A;  4S2K A;  5FQJ A;  3PBS A;  5F1G A;  2ZC3 B;  3V3R A;  3P98 A;  4HBT A;  3Q7Z A;  5FQI A;  5GLD A;  4BL2 A;  3BEC A;  2Y2Q A;  5GLB A;  3C4P A;  3S22 A;  2BLS A;  2Q9M A;  2Y2K A;  3M6H A;  1HVB A;  4P0M A;  3A3J A;  1YLY A;  3AGD A;  2DNS A;  3BLS A;  5BOH A;  4OON A;  2XGN A;  4EUZ A;  2RCX A;  3V39 A;  4UAA A;  5JYO A;  4UA6 A;  1DJC A;  4R3B A;  2XFT A;  3VOY A;  1IEM A;  2GDN A;  3ZFZ A;  2A3U A;  4ZBE A;  1KGG A;  5FAT A;  3G35 A;  1HZO A;  4KG2 A;  4RX3 A;  5KMW A;  3PBO A;  1TEM A;  5A90 A;  5AQA A;  3UDF A;  1YLZ A;  4ZDX A;  4IED A;  3UNW A;  1HTZ A;  3NDE A;  1ZKJ A;  3VP0 A;  5HW3 A;  5CGS A;  1K57 A;  3PBR A;  3NDG A;  3GV9 A;  1S0W A;  2OLV A;  2X01 A;  1K54 C;  3O87 A;  5GL9 A;  1FSY A;  1BLS A;  3NI9 A;  1MXO A;  2V2F F;  3ISG A;  5FDH A;  5FAS A;  2XLN A;  5FI7 A;  1XXM A;  3VMA A;  1GA0 A;  3W8K A;  1FCN A;  2HP9 A;  1M40 A;  2Y55 A;  1PYY A;  1BT5 A;  3MZD A;  4MEZ A;  3BLM A;  2Y2P A;  2JBF A;  2DRW A;  4N1X A;  2EX8 A;  3Q82 A;  2WZZ A;  2ZM8 A;  1L0G A;  2OSU A;  4E3N A;  1NY0 A;  2EFU A;  3UPO A;  1YMS A;  4BQM A;  4KZ7 A;  2H10 A;  3ZVW A;  2J7V A;  4MBH A;  1IKI A;  1H5X A;  5CTN A;  5E2H A;  5FSR A;  4E3I A;  4A5R A;  1YLW A;  5HX9 A;  4QJG A;  1M6K A;  1YT4 A;  1SKF A;  4H8R A;  4WMC A;  3VP4 A;  4QB8 A;  1E25 A;  2WGW A;  4L0L A;  3RJU A;  4BEN A;  5I94 A;  4JXS A;  4RA7 A;  4OPQ A;  2Y2H A;  5CED A;  1EI5 A;  3IH8 A;  1ONG A;  1H8Y A;  4R0Q A;  2X71 A;  5DVA A;  3A3I A;  5M18 A;  1N4O A;  2H0T A;  3QNB A;  5CGW A;  3UE1 A;  4EWF A;  1KDS A;  1W79 A;  1RGZ A;  4MLL A;  5FAQ A;  1ZG6 A;  3N6I A;  4EBP A;  4BLM A;  5CTM A;  4U0X A;  5FAO A;  1BZA A;  3UPN A;  3IT9 A;  3HVF A;  1K57 C;  2VGK A;  3HLC A;  1Q2P A;  3CZD A;  4Z9Q A;  3ZCZ A;  3BM6 A;  3E2K A;  2OLU A;  2C5W B;  3G31 A;  4QY6 A;  4PPR A;  5CER A;  2Z2M B;  1MPL A;  3MKE A;  4LV3 A;  3Q81 A;  2RL3 A;  4N1H A;  5TGF A;  4CPK A;  2HDU A;  3HRE A;  4S2L A;  4X55 A;  4KQO A;  4WM9 A;  2Y2L A;  1K6S A;  5KSC A;  3WS1 A;  1GHP A;  3A3F A;  1BLH A;  2WGI A;  1W8Y A;  5FQQ A;  4ZJ1 A;  3SS5 A;  3Q07 A;  5EOE A;  2XK1 A;  2ZC4 B;  4R3J A;  4OOL A;  4B4X A;  3HUO A;  5CRF A;  3BFF A;  4LCL A;  3I7J A;  2JE5 A;  2QZ6 A;  1W7F A;  4X56 A;  1TDG A;  1L2S A;  1W8Q A;  2QPN A;  3LEZ A;  4OQI A;  2V20 A;  2WAD A;  4OPR A;  4X69 A;  1ERM A;  5HAR A;  1MY8 A;  4WEK A;  1C3B A;  1KGE A;  3ITB A;  4R1G A;  1XA7 A;  1K4E A;  5HFO A;  1JVJ A;  2WGW B;  4WYY A;  4FH2 A;  4C75 A;  5DF7 A;  1YLT A;  3G34 A;  5E2E A;  3IF6 A;  2ZM0 A;  3OZH A;  3VFH A;  3FKW A;  2IWD A;  1LL5 A;  1IYO A;  4S2O A;  1VM1 A;  1FSW A;  2WUQ A;  2HDR A;  3G30 A;  4X6T A;  5EVI D;  3FZC A;  3VSL A;  1Q2Q A;  2G2U A;  1L0D A;  4GN2 A;  2P9V A;  1ONH A;  4R4R A;  5AQ9 A;  3VSK A;  5E43 A;  3N4I A;  5FQM A;  5D3O A;  4IVI A;  2XD1 A;  4Y0O A;  4DF6 A;  1QMF A;  2Y2J A;  4GD8 A;  4KZ9 A;  4GZB A;  4OOM A;  3TSG A;  3Q1F A;  3W4O A;  2IWB A;  3C5A A;  1Y54 A;  3Q7V A;  4IBX A;  4JXG A;  2Y91 A;  1PZO A;  4JF5 A;  3WWX A;  4K0W A;  5M19 A;  3OPR A;  4BL3 A;  3PBQ A;  4M3K A;  1XKZ A;  4DRT A;  3ITA A;  3CJM A;  1SDE A;  3VP2 A;  2WKE A;  4KG6 A;  5GHZ A;  5FAP A;  4WZ5 A;  1J9M A;  3M2J A;  3IQA A;  1Z6F A;  1RCJ A;  3IH9 A;  4OKP A;  3N7W A;  4LV0 A;  4UHU A;  5FQ9 A;  3BEB A;  3G2Z A;  1CI9 A;  1IYQ A;  5GHY A;  3MZE A;  3UO9 A;  2PBY A;  3ZG5 A;  1YLJ A;  3FKV A;  4XUX A;  2OV5 A;  1LI9 A;  4E3K A;  2Y2N A;  4JLF A;  3IXB A;  5IHV A;  4DDS A;  3FV7 A;  2B5R A;  2WZX A;  1CI8 A;  3RXX A;  1ESI A;  1YLP A;  1XX2 A;  1RGY A;  4OPY A;  2Y2I A;  1NYM A;  4YFM A;  4OH0 A;  2WAF A;  4B88 A;  1OME A;  1ESU A;  3IF6 B;  3LY4 A;  1LL9 A;  3PAE A;  4JF4 A;  4R23 A;  4S2N A;  4XXR A;  5L2F A;  4IBR A;  4KEN B;  3IWQ A;  4DKI A;  1DJB A;  3MBZ A;  4X68 A;  3ZG9 B;  1WYB A;  3BFD A;  1DY6 A;  4BD1 A;  1PIO A;  3PBT A;  1K56 D;  3IF6 C;  2R9W A;  3MKF A;  3S1Y A;  1K55 A;  2WAE A;  3V3S A;  2WK0 A;  2ZC5 B;  1FR6 A;  2EXB A;  4PM5 A;  3P09 A;  2P9V B;  4KZ5 A;  2ZQA A;  3DWK A;  3SS3 A;  3ZHH A;  1HD8 A;  1ERQ A;  4O7D A;  3RXW A;  1FCM A;  4FCF A;  2V1Z A;  1ES2 A;  3IXG A;  4KG5 A;  4MBK A;  3CG5 A;  3HBR A;  1G6A A;  4HBU A;  1PWG A;  4P6B A;  2WYX A;  1VQQ A;  1ZG4 A;  3MFD A;  1E3U A;  1MKI A;  5CHM A;  2ZD8 A;  3IXD A;  4E3O A;  1PI5 A;  1CK3 A;  4QY5 A;  4RYE A;  3O3V A;  2Q9N A;  4Y0U A;  4CJN A;  4MBF A;  3GR2 A;  4DE2 A;  4OVD A;  1K38 A;  1MWU A;  3HLB A;  4EV4 A;  3ZG8 B;  3PBN A;  1FCO A;  4S2M A;  3HLF A;  2XQZ A;  1BSG A;  5EPH A;  4ZAM A;  4P87 A;  2ZQ7 A;  4OPZ A;  5EVI A;  3LCE A;  3A3E A;  2ZC7 A;  2XD5 A;  3NIA A;  4HES A;  3FYZ A;  4HEF A;  1JWV A;  3B3X A;  4WZ5 C;  1CEF A;  4RX2 A;  1L0E A;  3W4Q A;  5KZH A;  3A3D A;  3QHY A;  4E3J A;  4LV2 A;  4DE3 A;  2A49 A;  4WEJ A;  5CHJ A;  4E3L A;  3VP3 A;  4ZJ3 A;  2EX2 A;  2C6W B;  4QHC A;  1LLB A;  4QU3 A;  1L0F A;  4GDB A;  3ZGA B;  4KQQ A;  4E6X A;  2FFF B;  2Y59 A;  1NRF A;  1SDN A;  3HLW A;  3LO7 A;  4IVK A;  3O86 A;  4KZB A;  4UA9 A;  2ZM2 A;  5GLA A;  4DXB A;  1ES4 A;  4K91 A;  3GQZ A;  4R4S A;  3W4P A;  2XH9 A;  1GCE A;  5JYP A;  4KZ3 A;  1SCW A;  4OQG A;  4Q8I A;  3NCK A;  5CGX A;  4F94 A;  4WBG A;  2JC7 A;  3IHA A;  4RVA A;  2I72 A;  4JPM A;  5J8X A;  4GKU A;  1BUL A;  4OQ0 A;  1K55 C;  1GA9 A;  1U60 A;  4GD6 A;  1H8Z A;  1PWD A;  4Y0T A;  2QMI A;  4OLG A;  1KVM A;  1ERO A;  4N9L A;  1K25 A;  4P85 A;  2ZC6 B;  3VOZ A;  3G32 A;  4PM8 A;  3OC2 A;  1BLC A;  5DF9 A;  5KSH A;  2H5S A;  5HL1 A;  4K0X A;  5CXW A;  4NK3 A;  4WZ4 A;  4FH4 A;  5DTT A;  5DTK A;  5FI2 A;  2ZMA A;  4LEN A;  1XA1 A;  3M2K A;  5M1A A;  5CEC A;  5DTS A;  5F82 A;  4KZA A;  1S6R A;  1TVF A;  4U3T A;  3IF5 A;  3SH9 A;  1XGJ A;  5EOO A;  4LCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...