4MBKA

Crystal structure of k234r inhibitor-resistant variant of shv beta-lactamase in complex with sa2-13
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADRTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Penam sulfones and beta-lactamase inhibition: SA2-13 and the importance of the C2 side chain length and composition.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 95
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4mbkA00
1K57A 2ZM2A 3GQZA 1YM1A 5JYPA 1GA0A 1CK3A 5GHYA 3NDGA 4Z9QA 4GB7A 3ZDJA 1JWPA 3VOZA 4HBUA 4LV1A 2XQZA 1K55A 1XX2A 4DF6A 4B4ZA 1XP4A 2Y2LA 1BTLA 3ZG7B 4MNRA 3MKFA 2Y2NA 3A3JA 4OLDA 4WELA 5HAIA 5E2EA 5TGFA 3V50A 4Y0UA 1YLWA 4BD1A 4GD8A 1K6RA 3W4OA 2Y2PA 2ZLYA 1K4FA 4ZBEA 2Y2IA 5CHMA 2G2WA 2ZQAA 4RX2A 4XUXA 1H8YA 2Q9NA 4HBTA 3PAGA 3TOIA 2XD5A 4L0LA 3BLMA 4WZ5C 4OP8A 2H0TA 3UPOA 3GTCA 1ONHA 1IKIA 5EVIB 1SDNA 4OOLA 1KDSA 2IWCA 4R3JA 4GDBA 3S4XA 4ZDXA 4OPYA 1GHIA 2P9VA 2ZM8A 5CRFA 5FQQA 4P85A 3WS5A 1PI4A 4R4RA 1EI5A 5F82A 3ZNYA 3MZFA 3VFFA 3ZFZA 3N4IA 4OQIA 3PBOA 1XPBA 4NETA 2G2UA 1NXYA 3OPHA 4R3BA 3BFDA 1MWSA 3RXXA 5D3OA 3B3XA 1W7FA 4KZ9A 2XGNA 3MBZA 5EVLA 3SH7A 1WYCA 1KGFA 5FQIA 4GZBA 5AQAA 3NDEA 3LY4A 4PM7A 3UE1A 4H8RA 3WRZA 4HESA 5CEDA 3C5AA 1IYOA 4S2MA 4DE3A 2XD1A 4X69A 3PBRA 1K56A 5DTKA 1QMEA 5DF9A 1DJAA 4DRTA 3BEBA 4KENB 3IHAA 5CGSA 3EQUA 2QZ6A 4K0WA 1MPLA 5JYOA 3LCEA 4JF4A 4DXCA 3NC8A 4E3OA 2IWDA 2Y2JA 5A93A 2HP5A 2E8IA 3VP1A 3MZDA 5E2GA 5EECA 4OPRA 2WKIA 4N1HA 4CPKA 1Q2QA 1FR6A 4KZ4A 3ZGAB 2Y55A 4X56A 3S22A 4JF6A 2V2FF 4WMCA 1NYYA 2OLVA 4S2JA 4S2NA 1VM1A 2ZC4B 4KZ3A 1ZG6A 1FQGA 1MXOA 1Y54A 5GLBA 4DE0A 3SH9A 4GKUA 2JBFA 4UA7A 1FCMA 1FR1A 1CEGA 2ZMAA 4O7DA 5F1GA 4Y0TA 2OSUA 4JLFA 4EV4A 5FASA 1E3UA 1ERMA 3HREA 2ZC5B 1W8QA 5GLDA 4LENA 4EWFA 2XF3A 1KE0A 1Z6FA 2WGWB 1G6AA 2HPBA 3BLSA 1YLYA 3BRMA 3A3FA 1K6SA 4GOGA 4OOMA 3LEZA 3EQVA 2H0YA 5HARA 3G34A 4LV0A 1ES4A 5FQMA 4LCMA 4LCLA 1CI9A 4WZ4A 1ES2A 1SCWA 2XEPA 4XXRA 4BD0A 4QJGA 4Q8IA 3G2YA 2XFSA 3FKWA 2WGIA 1YT4A 3G31A 4BQMA 2J7VA 1OMEA 4MBKA 2R9WA 2EXAA 5KSHA 2XFTA 4FD8A 1MY8A 4QB8A 1RGYA 1PWDA 4PM9A 2ZJ9A 3IXGA 3HLFA 3HUNA 3C4OA 1QMFA 4RVAA 2H5SA 2DCFA 1RCJA 3HBRA 3BM6A 3VP4A 1JWVA 1I2WA 1PYYA 3C4PA 1PIOA 5EOOA 3CZDA 1L0EA 1XGIA 3DW0A 4BENA 5F1FA 1I5QA 4B4XA 4K0XA 1LL9A 4DDYA 1O07A 3BFCA 1BSGA 4QY6A 2ZC7A 1KDWA 5GHZA 3SS5A 3TSGA 1K57C 3PBSA 4JXGA 2HDRA 4ZJ3A 3E2KA 3VP2A 5U47A 5FSRA 5KMWA 2BLSA 4JPMA 4OH0A 4K91A 2CC1A 3C7UA 3SS3A 5FAPA 3AGDA 2XLNA 3Q7VB 5AQBA 3N8SA 3VMAA 3ZG8B 3IF6C 4E3NA 1FCNA 1K54A 1KE3A 1SHVA 1ES3A 3IF5A 4UA6A 1NYMA 3TG9A 3VOYA 4P87A 3ISGA 3BYDA 3ZNTA 3G35A 4MBFA 2Y2QA 2A3UA 2WGVA 5CERA 1FSYA 1GHPA 2OLUA 3WRTA 3VSKA 1YLJA 4EQIA 1WYBA 4KG6A 4NK3A 1K38A 3ZVWA 5CEBA 5A90A 5CHUA 5DF7A 2PU2A 4C6YA 4KZ6A 4WBGA 4GD6A 4GNUA 4JXSA 2J8YA 1CI8A 2XDMA 3G32A 3IT9A 4YINA 3RJUA 4BL3A 1MWUA 4BLMA 4C75A 5EVIA 4KG2A 3IHBA 4OP5A 3NI9A 4JKTA 4OVDA 4WZ5A 3HUOA 4BJPA 4E3LA 2Z2LB 4F94A 2HP9A 2WKHA 1YLZA 1DJCA 3IQAA 1SKFA 5TR7A 1TDLA 1TDGA 4RYEA 3O87A 3JYIA 1KGEA 2ZQCA 2WK0A 5E2HA 2IWBA 3RXWA 1BZAA 1U60A 3NCKA 4UAAA 4DE1A 1N4OA 4E6WA 1W79A 1GHMA 1BUEA 3UDXA 2XK1A 1ES5A 5KZHA 4IBXA 4OONA 4S2KA 4KQOA 5M18A 1RGZA 4S2IA 5HW3A 4FSFA 1LI0A 3VP0A 3WS0A 3UPNA 4PM5A 4E3IA 3IWQA 2P74A 3N8RA 1IELA 4JF5A 5DTTA 1VQQA 2H10A 2VGKA 4X55A 3S1YA 2WKEA 3DTMA 1KVMA 2XR0A 3LY3A 3OC2A 4IVIA 1TVFA 3FYZA 4OOYA 2ZQ7A 4R0QA 3UNWA 1E4DA 4BL2A 1Q2PA 3HLDA 1ONGA 3QNCA 2WZXA 5EOEA 1ZG4A 3MZEA 4R4SA 3ZG0A 2EX8A 2Y91A 5FI7A 4R1GA 4U0XA 4E3KA 2EFXA 5F83A 2EFUA 3CG5A 2J9PA 3WS1A 4CJNA 3VP3A 3UE3A 3GV9A 4OLGA 2I72A 1FCOA 3HLBA 1PW1A 3WS4A 1H8ZA 2PU4A 2OV5A 2EX2A 2JCHA 3DWKA 4DE2A 1BLSA 5BOHA 3ZCZA 3ZVTA 1IEMA 4N1XA 1BLPA 4FH2A 4E3JA 5KSCA 2Z2MB 4IVKA 3BFFA 1JWZA 4GN2A 4N9LA 2RCXA 1LL5A 2X71A 4ZAMA 3V3SA 3HLEA 4XUZA 4FH4A 1K25A 3UE0A 3Q1FA 2WGWA 4X53A 3WS2A 2EX6A 2J9OA 3HL9A 1S6RA 3QNBA 2V1ZA 1CEFA 1JVJA 4X68A 1DY6A 4KQQA 1LI9A 4PM6A 1ALQA 1M6KA 4OQGA 1IYSA 3O86A 1AXBA 2QPNA 5CXWA 5A91A 3UO9A 4OQHA 3V39A 4GDNA 1IYPA 4KZ7A 3OPRA 3OPPA 1YMSA 3QHYA 3W4PA 2HDQA 4OQ0A 3G4PA 4JXVA 3VFHA 3PAEA 3ZG9B 2B5RA 1JTGA 3Q81A 1ERQA 5FAOA 3ITAA 5HX9A 5DVAA 4IBRA 3MXSA 1KVLA 1RP5A 1O7EA 2WYXA 4QU3A 3FKVA 3A3EA 1ZC2A 2WAFA 1EWZA 2PBYA 1IYQA 5FQJA 3PTEA 4P0MA 2JC7A 3GSGA 1J9MA 1L0DA 5GL9A 3BECA 4C3QA 4QHCA 1GA9A 3OCNA 5M19A 1K55C 3A3IA 1XKZA 3GVBA 4MEZA 4JXWA 2X02A 2WAEA 2FFFB 1ZKJA 3MKEA 3IF6B 4KZ5A 1MWRA 4U0TA 3FWLA 1NZOA 3G30A 4E6XA 2Y4AA 3NBLA 3PBTA 3Q7VA 1YMXA 3Q7ZA 4DDSA 4U3TA 4EBNA 1XXMA 1PW8A 2BG1A 3GMWA 5L2FA 2QMIA 3A3DA 2HDSA 2Y2MA 3VSLA 1N9BA 2ZQDA 5HAQA 4KZ8A 3C7VA 3IF6A 1NZUA 1HZOA 3I7JA 4M3KA 2X01A 1LLBA 1IKGA 3AGFA 3HUMA 2C5WB 4DKIA 3UN7A 4E3MA 4R23A 4KZAA 4WYYA 4QY5A 3V5MA 5A92A 1EROA 3BFEA 3FZCA 2ZC3B 4FCFA 3IH9A 3ZG5A 2FFYA 4Y0OA 3SOIA 3WWXA 1NY0A 5DTSA 2EX9A 4ZJ2A 3IXBA 3NY4A 1MKIA 4KG5A 2P9VB 5EVIC 1PWGA 1C3BA 3E2LA 1I2SA 2ZQ9A 4LV3A 4PPRA 4DXBA 4ID4A 3CMZA 1PWCA 3BFGA 2HDUA 4WEKA 4N9KA 1L0GA 1YQSA 5FQ9A 4RX3A 1M40A 1H5XA 4PM8A 2UWXA 2WUQA 2DRWA 3UDIA 5J8XA 1NRFA 3ITBA 5E43A 2C6WB 1K4EA 2Y2OA 4OPQA 2ZQ8A 1FSWA 5IHVA 1JTDA 5HFOA 3SS4A 5AQ7A 5HL1A 4IEDA 4S2PA 2ZC6B 3HLWA 3M2KA 3O3VA 4ZTKA 3N8LA 1GCEA 4PMAA 3V3RA 1WE4A 1XA7A 2WZZA 5EUAA 1W8YA 1DJBA 3N6IA 5CGWA 4S2NC 2WADA 1BLCA 5EPHA 4KZBA 4ZJ1A 1BT5A 2ZD8A 2HP6A 1MBLA 1FOFA 3P98A 1KGGA 3ZHHA 2Y2KA 5M1AA 5FAQA 1XA1A 3W4QA 1ESIA 1S0WA 1YLPA 3UPPA 1G68A 3CJMA 2XH9A 3IXHA 2A49A 5EVID 1XGJA 4MLLA 5TFQA 1PZPA 1L0FA 1BLHA 5FQKA 3IH8A 5CHJA 3P09A 4X6TA 4KQRA 3HVFA 3GRJA 4EUZA 1HVBA 3HLGA 4OPZA 3UDFA 3O88A 3PBQA 1K56D 1PI5A 3IWOA 4S2LA 3W8KA 2GDNA 3PBNA 1TEMA 5G18A 5GHXA 4P6BA 5FA7A 1LHYA 3MXRA 4UHUA 5GLAA 5CECA 5HAPA 4RA7A 3SH8A 3NIAA 2JE5A 1HD8A 3IWIA 4EBLA 3Q07A 2RL3A 3LO7A 4A5RA 3D4FA 2EXBA 3OZHA 4JBFA 3OCLA 3AGEA 5AQ9A 3OPLA 3M6BA 4UA9A 2Y2HA 4WM9A 5CGXA 5FI6A 4B88A 4Y7PA 1E25A 3GR2A 4D2OA 2DNSA 1ESUA 4QD4A 4YFMA 3UY6A 3M2JA 4LV2A 4WMCD 2Q9MA 5EE8A 5FDHA 4HEFA 1PZOA 4EBPA 5I94A 2V20A 3N7WA 5CTMA 1KE4A 2Y2GA 1W5DA 1L2SA 5CTNA 3HLCA 3Q82A 5GLCA 2VGJA 4S2OA 1SDEA 2ZM0A 4WEJA 1YLTA 5FI2A 1BULA 3IXDA 3G2ZA 1HTZA 3M6HA 4OKPA 5FATA 3FV7A 5E2FA 1MWTA 1NJ4A 3MFDA 1K54C 1E3UD 2R9XA 2Y59A 4N92A 3DWZA 5DF8A 4MBHA
chains in the Genus database with same CATH superfamily
1STZA 5EV0A 5DJUA 1JWPA 4LV1A 1K55A 4DF6A 3LIFA 4CLCA 3T12B 2Y2LA 4MNRA 4ME4A 2Y2NA 3A3JA 4OLDA 4WELA 4HQAA 4BBTA 4GS9B 4GD8A 3W4OA 2PHYA 4H6JB 5CHMA 2M7UA 2B95A 2B02A 3BQ8A 4GS9A 3H9WA 1P0ZA 3GTCA 4H6JA 4OOLA 3IX8A 1GHIA 3WS5A 3ZNYA 3VFFA 3N4IA 4OQIA 1XPBA 1W7FA 3MBZA 1KGFA 2VGLS 3B47A 5K5BA 4PM7A 4D60A 3WRZA 4HESA 5L8MA 3PBRA 1K56A 2K31A 3BEBA 2ZMVA 5CGSA 2QZ6A 4K0WA 1MPLA 3LCEA 4JF4A 1WA9A 2IWDA 5A93A 5EECA 4N1HA 2ZMFA 2PYRA 2V2FF 3DBAA 1VM1A 3BQAA 1FQGA 1XJ6A 3CPTB 4GKUA 1FCMA 4O7DA 4DJ3A 1W8QA 2HPBA 3BRMA 3CPTA 3A3FA 3KSFA 5HL6A 1OT9A 1XJ4A 1CI9A 5A8BA 3LIEA 4Q8IA 2XFSA 2I9VA 4F3LB 5KSHA 3SW1A 3BWLA 1S4SA 2V1BA 3HUNA 4XT2B 2DCFA 3F1PB 1TS7A 4F3LA 4B4XA 1LL9A 1ZTUA 1KDWA 4JXGA 3E2KA 5KMWA 5FSRA 1TF1A 3FPWA 4K91A 2VKSA 4CLCE 3VMAA 2E8JA 3N8SA 5AQBA 3VOYA 1ES3A 4EEPA 4MN7A 3ISGA 4P87A 3BYDA 3ZNTA 2Y2QA 1GHPA 5F69A 3VSKA 1YLJA 4EQIA 2W0NA 4KG6A 2WKPA 4NK3A 2VX8A 5A90A 4KZ6A 3JPUA 4WBGA 3F1OB 4JXSA 4YINA 2M7VA 4BLMA 2YKFA 4C75A 3IHBA 3G6OA 3F1OA 1YLZA 1YPRA 5TR7A 1OT6A 1TDLA 3MR0A 3EEAA 3C30A 4Z1WA 1BZAA 1U60A 2K2NA 3QP1A 2XK1A 5DFXA 1RGZA 3BY8A 1DP9A 4YNRA 3S1YA 2A24B 5CX7A 3T4OA 2XR0A 1MZUA 1E4DA 1XJ2A 3D3OA 2WZXA 5LBRA 4MN6A 5FI7A 4E3KA 3RH8B 2EFXA 5F83A 3LR5A 3T1QB 4CJNA 3VP3A 4OLGA 3HLBA 1FCOA 2PU4A 2OV5A 4B9OA 4N1XA 4E3JA 1T18A 4N9LA 2WKRA 3E98A 3V3SA 2JN7A 1K25A 2ZL1A 2V1ZA 1JVJA 1OPXA 4EW7A 4LRYC 3E4PA 3B42A 3OPPA 3QHYA 3W4PA 3A0VA 2W3EA 3PAEA 4QPRA 1JTGA 1NWZA 4R6LA 3T4KA 1KVLA 1RP5A 4QU3A 3FKVA 1EWZA 4ZRRA 2P08A 3BECA 3LFVA 2O99A 4UQIM 3OBFA 4I39A 2OAQ1 4MEZA 1ZKJA 3MKEA 3IF6B 3LIBA 4E6XA 3NBLA 4EBNA 4DDSA 1P9WA 1TS8A 2W1TB 3IF6A 2X01A 4M3KA 3VE3A 4R70A 2QJ5A 3UN7A 4E3MA 3T4TA 4QY5A 5EVEA 5A92A 1EROA 3BFEA 2OWHA 3K3CA 4Y0OA 3SOIA 1EW0A 5DTSA 2EX9A 3NY4A 3MF0A 4E04A 3LI8A 1I2SA 2ZQ9A 2FH5A 1MC0A 3BFGA 2HDUA 4RX3A 3UB7A 1H5XA 3R7WA 2WUQA 1NRFA 1SKOB 2Q0OA 4Q0IA 5HDSA 5HFOA 3SS4A 3B33A 5HL1A 4IEDA 4S2PA 1SKOA 3N8LA 1GCEA 4PMAA 3UB6A 4S2NC 2WADA 3T4LA 2KX6A 3QP6A 4Y17A 1FOFA 3P98A 1KGGA 2Y2KA 4MN5A 3GECA 1ESIA 1YLPA 5I5LA 3CJMA 2XH9A 4Y5FA 2A49A 4UQIS 5EVID 4WF0A 4B93A 5CHJA 3HVFA 1F9IA 4OPZA 3TE8A 2INWA 3W8KA 1TEMA 5G18A 1YSQA 4P6BA 5MC7A 4R3AA 3SH8A 4A5RA 3OZHA 3OCLA 1S4RA 3OPLA 3M6BA 4HOIA 5CGXA 5FI6A 1S67L 1E25A 2L1MA 4YFMA 1TS6A 5CTNA 3HLCA 3Q82A 3U4LP 1SDEA 1BULA 4HIAA 3M6HA 4FUWA 4OKPA 3MFDA 2R9XA 4N92A 4I3JA 4MBHA 4PKYA 1K57A 5IS1A 1YM1A 1GA0A 1CK3A 5GHYA 4GB7A 1X0OA 4JGPA 2XQZA 4B4ZA 1BTLA 1D7EA 3MKFA 5HWVA 5TGFA 3V50A 5DJTA 1H3QA 2ZLYA 1F2KA 2G2WA 4XUXA 1H8YA 4LFUA 3TOIA 2XD5A 2HJ9C 4L0LA 3S7OA 4WZ5C 2H0TA 4EETB 5HZHA 4HNBA 5EVIB 2W3DA 1SDNA 2ZM8A 2P9VA 3K2NA 1PI4A 5F82A 4EERA 3MZFA 1J3WA 3PBOA 2J3WA 1NXYA 2O9CA 1MWSA 4KZ9A 4Y15A 3SH7A 5J7EA 2XRNA 1WYCA 3NDEA 2G7UA 3UE1A 3L7HA 4AFIA 3C5AA 4DE3A 5DTKA 4G3VA 1DJAA 3E4QA 4KENB 3IHAA 3NOPC 2LB5A 4Q0JA 2E8IA 3KYEA 3VP1A 5E2GA 2FZ0A 4X56A 3O5YA 4EQ1A 2R78A 2ZC4B 4KZ3A 4WUJA 3LEQA 1ZG6A 5GLBA 1W63M 3SH9A 4UA7A 1FR1A 1CEGA 2ZMAA 4Y0TA 2OSUA 4HJ6A 3P7NA 4LENA 2XF3A 1KE0A 3LIDA 2WGWB 1G6AA 1YLYA 4GOGA 3EQVA 3H7WB 2H0YA 3G34A 5HSQA 4LCLA 4XXRA 2XEPA 2QKPA 3CLOA 3G2YA 2HF6A 2WGIA 3G31A 4BQMA 2CMNA 2R9WA 1MY8A 4QB8A 1RGYA 4PM9A 2ZJ9A 1L3LA 3IS2A 4R38A 1I2WA 4G3KA 1PIOA 5EOOA 4HHDA 3CZDA 4ETZA 4BENA 5AVFA 4K0XA 4PKYG 4HJ3A 3BFCA 3GDIA 1K57C 3PBSA 2HDRA 5DFYA 3HJIA 2V1AA 1V9YA 5FAPA 2XLNA 3Q7VB 1FCNA 1KE3A 3TG9A 3JVUA 1ODVA 2A3UA 2WGVA 4NXGA 5CERA 2OLUA 1G28A 1WYBA 4EESA 3T4SA 1K38A 4II7A 5CEBA 5CHUA 4C6YA 4GD6A 2AVXA 3G32A 1CI8A 2JKGA 3IT9A 3LIAA 1MWUA 3MQQA 1P97A 4KG2A 1T1CA 2Z2LB 4GW9A 4X1MA 1TDGA 3CUEA 3JYIA 1LSWA 2WK0A 2PAVP 3E0YA 1N4OA 3ICYA 1S1YA 1GHMA 3PR6A 4IBXA 4S2KA 5M18A 4S2IA 4FSFA 3IWQA 4K08A 1IELA 4JF5A 1GSXA 4HP9A 3P01A 4X55A 3DTMA 3OC2A 1TVFA 3FYZA 3HLDA 1ONGA 5EOEA 3MZEA 4R4SA 3ZG0A 2Y91A 4R1GA 3EGXC 2EFUA 1PW1A 2B18A 2JCHA 5BOHA 1BLPA 4IVKA 3BFFA 4GN2A 2RCXA 3ZYTA 3DAVA 4ZAMA 3EOIA 3HLEA 3A0RA 3UE0A 3Q1FA 4X53A 1G5UA 3WS2A 2J9OA 3HL9A 1S6RA 2J3TC 4KQQA 4EXOA 1ALQA 1M6KA 1IYSA 4GCZA 4WN5A 3V39A 1N9OA 4BBUA 3LR0A 2HDQA 3VFHA 2B5RA 1ACFA 3TJZC 3Q81A 3ITAA 4XT2A 4IBRA 2O0YA 3F1PA 1ZC2A 2WAFA 2PBYA 3GSGA 1J9MA 2IA2A 5GL9A 2HZ5A 3K3DA 1K55C 5J3WA 4CLCC 4NEED 5AVEA 1VB6A 1MWRA 1NZOA 1AWIA 1YMXA 3Q7ZA 1LL8A 2BG1A 3GMWA 2QMIA 2HDSA 3IBJA 3U2AA 4KZ8A 3LGOA 3IX4A 4R23A 3V5MA 3IH9A 4JGQA 2OAP1 2FFYA 1CF0A 4KG5A 4X1LA 1PWGA 2D02A 3IX3A 4ETXA 3E2LA 3NOUC 2P04A 4N9KA 3KYZA 1YQSA 1M40A 5KIZA 2DRWA 4KQDA 3ITBA 5E43A 3PYPA 1K4EA 2O9BA 2ZQ8A 1FSWA 2BTFP 2MJ6A 3VE4A 3HLWA 1WE4A 2WZZA 1W8YA 2A24A 5EPHA 3C38A 4KZBA 1BT5A 2ZD8A 1XA1A 3W4QA 1T1AA 3C2WA 4BWIA 3JVVA 1BLHA 1K0KA 4LGWA 4X6TA 4GHIB 4WL9A 3R4KA 1HVBA 3UMEA 3UDFA 3O88A 1PI5A 4MCWA 4S2LA 2GDNA 4YOFA 5GHXA 4G3WA 3MXRA 4UHUA 5GLAA 4RA7A 2JE5A 3IWIA 3DTIA 3LO7A 3HJKA 4WM9A 4B88A 5FDHA 4HEFA 5FL3A 1W5DA 5FI2A 2UV0E 3IXDA 1HTZA 3T1SA 1MWTA 1E3UD 3FC7A 3GQZA 4Y2FA 3ZDJA 4MMNA 3VOZA 1XX2A 2PR6A 1XP4A 5DKLA 4Y0UA 1YLWA 2H28A 2W1TA 4BD1A 1K6RA 4EUVA 2Y2IA 2ZQAA 4BMWA 2Q9NA 3PAGA 3BLMA 4OP8A 3CI6A 1IKIA 4IJGA 4GDBA 4ZDXA 4OPYA 4I38A 4P85A 4R4RA 1LSXA 3OPHA 4HY8A 3BFDA 3B3XA 2XGNA 4NKPA 3EEHA 3RTYA 4GZBA 4IUHA 5HDCA 2V8FA 2PD8A 3LY4A 4PHTA 4H8RA 3UE6A 5CEDA 1IYOA 4X69A 5EM1A 3EQUA 5JYOA 1N9NA 3S7QA 2Y2JA 3BJNA 2HP5A 3MZDA 1LT0A 4I3IA 1Q2QA 2KOIA 3LI9A 1FR6A 2PDRA 4KZ4A 3ULFA 2Y55A 2OLVA 2GJ3A 2GZAA 1Y54A 4KUOA 3H82B 5FASA 1E3UA 1ERMA 3HREA 5GLDA 1OTAA 3BLSA 1ZHHB 3H82A 4OOMA 3LEZA 4GJ4A 2HV1A 4HH3A 1ES4A 5FQMA 2GX5A 4LCMA 1ES2A 2VK3A 4QJGA 3FKWA 1YT4A 1OMEA 4MBKA 2EXAA 1PWDA 3IXGA 3OOVA 2H5SA 1RCJA 3BM6A 5FDSA 1JWVA 2W3HA 1PYYA 3C4PA 3UB5P 3VP4A 2ZOHA 1L0EA 2VZWA 3DW0A 1I5QA 4QY6A 2ZC7A 3TSGA 5GHZA 3VP2A 2BLSA 4JPMA 4M4XA 1SZVA 3SS3A 3AGDA 4E3NA 3IF6C 1K54A 4UA6A 3IF5A 2QHKA 1F98A 3G35A 4O8GA 3WRTA 2HGVA 1PFLA 3PHYA 3CWFA 3ZVWA 2L4RA 5DF7A 2NUPC 3LYXA 2V0WA 1TD5A 2XDMA 3KO6A 5EVIA 2OWJA 3NI9A 4JKTA 4OP5A 4OVDA 4Y13A 2EWVA 3HUOA 4BJPA 4E3LA 4IUKA 4F94A 2HP9A 3MMHA 2WKHA 3IQAA 4RYEA 3NECA 2HJEA 3RXWA 4DE1A 1W79A 1BUEA 3UDXA 4KQOA 2XSSA 3NHQA 1LI0A 3VP0A 4PM5A 4E3IA 1YKDA 5DTTA 1VQQA 1N9LA 2H10A 2VGKA 4NXFA 2WKEA 3LY3A 3EGDC 3A0SA 4R0QA 3UB8A 3UNWA 2ZQ7A 4BL2A 2EX8A 4U0XA 2J9PA 3WS1A 5AJGA 3GV9A 2I72A 1H8ZA 5EM0A 1IOUA 3C8CA 3V67A 4O01A 3ZCZA 3ZVTA 3W2ZA 2Z6CA 2Z2MB 1H8MA 1Y4OA 1JWZA 1BYWA 1OTDA 2X71A 4NXEA 2KLIA 4XUZA 3T50A 4Q0HA 2WGWA 3QNBA 1CEFA 2QJ7A 1VHMA 1DY6A 3H7WA 1LI9A 3MQOA 5EFWA 4PM6A 5HD5A 5HWWA 4OQGA 3O86A 1MKMA 3UB9A 2V0UA 1G6OA 1IFQA 4GDNA 1IYPA 1YMSA 4JXVA 3ZG9B 5L07A 5FAOA 5DVAA 5HD3A 3PTEA 4P0MA 2ZOIA 1F5MA 4QHCA 5M19A 3A3IA 3S7NA 1XKZA 4JXWA 1UGUA 2X02A 2WAEA 4KZ5A 1PRQA 3G30A 2Y4AA 3PBTA 3Q7VA 4U3TA 1XXMA 1PW8A 5L2FA 4DMZA 1N9BA 1XFNA 3C7VA 3I7JA 1IKGA 3AGFA 3HUMA 2C5WB 2JKTI 4DKIA 2L0WA 4KZAA 4WYYA 5C5KA 1T1BA 3FZCA 2XA7M 4FCFA 5G4ZA 1MKIA 5EVIC 1CQAA 1C3BA 4LV3A 4PPRA 4DXBA 3MS6A 4ID4A 3CMZA 4BBVA 4WEKA 1L0GA 2UWXA 1D1JA 2Y2OA 2Y8HA 1JTDA 2JKTM 3MSHA 3O3VA 1S1ZA 1OJ5A 3V3RA 2VA0A 2LB9A 1Z09A 2K7SA 1DRMA 2J80A 1D06A 4ZJ1A 3BW6A 1MBLA 3ZHHA 5M1AA 2VV7A 1DP8A 5FAQA 4NG2A 5IT5A 3UPPA 3RFBA 2OOLA 3IXHA 1S66L 4MLLA 2WKQA 2VEAA 3IH8A 3P09A 2EWWA 4KQRA 3GRJA 3PBQA 3IWOA 3NJAA 5FA7A 1LHYA 2YKHA 3TW8A 4EBLA 2RL3A 2QWSA 1T19A 2XA7S 3D4FA 4JBFA 4FTXA 4UA9A 3GR2A 3VV4A 4D2OA 1PNEA 2PT7A 4QD4A 3M2JA 4WMCD 2Q9MA 2Y2GA 1L2SA 2KDKA 2W3GA 2VGJA 4S2OA 4LRXC 4WEJA 3G2ZA 2BASA 2PR5A 5DF8A 3DWZA 3NOTC 4KUKA 1VEUB 2ZM2A 1VETB 5JYPA 3NDGA 4CQHA 4Z9QA 4HBUA 1A0KA 1OTEA 1VEUA 3ZG7B 1VETA 1XJ3A 3MXQA 3BY9A 5HAIA 5E2EA 3KSHA 3QP4A 2Y2PA 4DN0A 3MQ0A 1K4FA 4ZBEA 5HPFA 4RX2A 4HBTA 4P6ZM 4JGRA 3IBRA 3UPOA 4O0PA 3FPVA 1ONHA 2A2LA 2PD7A 1KDSA 2IWCA 4R3JA 3S4XA 5FQQA 3CUEC 1EI5A 4L9GA 3ZFZA 4NETA 2G2UA 4R3BA 3RXXA 5D3OA 5EVLA 5FQIA 5AQAA 1DP6A 4S2MA 2XD1A 1QMEA 5DF9A 4DRTA 1UWNX 4DXCA 3NC8A 4E3OA 4JGOA 3NULA 4OPRA 2WKIA 3E4OA 4CPKA 3OLOA 3ZGAB 3S22A 4JF6A 3LUQA 2W3FA 4WMCA 1NYYA 4S2JA 4S2NA 3CITA 2VV6A 3LR4A 1MXOA 4DE0A 2JBFA 5F1GA 1FIKA 3T1XA 4JLFA 4EV4A 1GSVA 2ZC5B 4GLQA 4ESPA 4EWFA 1Z6FA 2ZL1B 5FEGA 2VLGA 1K6SA 4GHIA 2JKFA 2PRFA 4L9EA 2Y79A 5HARA 4LV0A 3D72A 4WZ4A 1SCWA 4BD0A 2XROA 3KX0X 4FOFA 4P6ZS 2J7VA 4WLAA 2QYBA 3D9YA 2XFTA 2V8CA 4FD8A 3HLFA 1FILA 1QMFA 3C4OA 4RVAA 3HBRA 3LR3A 4HI4A 1XGIA 4LRZE 5FEFA 5F1FA 4DDYA 1O07A 4RQ9A 1BSGA 3SS5A 4ZJ3A 5U47A 4MDZA 4OH0A 2CC1A 3C7UA 1Y28A 5HWTA 3ZG8B 1SHVA 1NYMA 4MBFA 4Y3IA 1FSYA 2EA9A 1XFQA 3MJQA 3HCYA 3UMDA 2PU2A 1OJGA 1YAXA 5F5YA 1P9RA 5F6AA 4GNUA 2P7JA 2J8YA 3RJUA 4BL3A 2D01A 4ARZB 4WZ5A 3CHWP 3R7WB 3QP8A 4X25A 1DJCA 1SKFA 3LICA 3O87A 4ARZA 1KGEA 2ZQCA 3DTKA 5E2HA 2IWBA 4E6WA 4UAAA 3NCKA 5KZHA 1ES5A 4OONA 4NXBA 5HW3A 4HH2A 3WS0A 3UPNA 2JHEA 5TBMB 3N8RA 2P74A 5CRFA 3QP2A 4IVIA 1KVMA 4OOYA 1Q2PA 3QNCA 5L10A 1ZG4A 5TBMA 1H0MA 3CG5A 5HDDA 3UE3A 3WS4A 2EX2A 3KSGA 3DWKA 4DE2A 1BLSA 1IEMA 3KYQA 2NUTC 4FH2A 5KSCA 3KSIA 2GNXA 3CAXA 1LL5A 4FH4A 1KOUA 2EX6A 4DJ2A 3F1NB 4X68A 4L9FA 2VJWA 1AXBA 2QPNA 2W27A 5CXWA 5A91A 4OQHA 3UO9A 3F1NA 4KZ7A 3OPRA 4OQ0A 3G4PA 1ERQA 1OTIA 5HX9A 3MXSA 1O7EA 2WYXA 3A3EA 4HJ4A 4IHQA 1IYQA 5FQJA 2JC7A 3MFXA 1L0DA 3TRCA 4C3QA 1GA9A 3OCNA 4HP4A 3GVBA 2FFFB 4U0TA 3FWLA 5TJJA 5G4YA 1W63Q 3QP5A 2PBDP 1JNUA 3A3DA 2Y2MA 3VSLA 2ZQDA 3VOLA 5HAQA 1NZUA 1HZOA 5DKKA 2J3TD 1CJFA 1LLBA 1NLYA 2ZC3B 3ZG5A 3WWXA 1TS0A 1NY0A 3EWKA 4ZJ2A 5HPIA 3IXBA 2P9VB 3L9KA 1PWCA 5L09A 3T4JA 2VV8A 5FQ9A 1HLUP 4PM8A 3UDIA 5J8XA 3S7PA 2C6WB 4OPQA 4CLCD 4EEUA 5IHVA 5AQ7A 3ZQ5A 2PYPA 2ZC6B 3M2KA 4ZTKA 1XA7A 1V9ZA 5EUAA 2M1CA 1GSWA 1DJBA 3N6IA 4LLOB 5CGWA 4I5SA 1BLCA 2ZBBA 3DTEA 2HP6A 1S0WA 1G68A 4YWZA 4I3AA 4PAUA 5F68A 1XGJA 5TFQA 2JKRI 1PZPA 1L0FA 3PXPA 5FQKA 3FG8A 2DMWA 1YSPA 4EUZA 1UWPX 3HLGA 1K56D 2W1RA 2V9AA 3PBNA 3T1RA 2VGLM 5J4EA 5CECA 5HAPA 3NIAA 1HD8A 3Q07A 1NLZA 2EXBA 4LPZA 1OTBA 3AGEA 5AQ9A 2ACGA 2O9AA 2Z6DA 2Y2HA 4Y7PA 3SZTA 1NRJA 2DNSA 1ESUA 3IS2B 3UY6A 4LV2A 5EE8A 1PZOA 4EBPA 5I94A 2V20A 3N7WA 5CTMA 1KE4A 2JKRM 4QWOA 5GLCA 2ZM0A 1YLTA 1LSVA 5FATA 3FV7A 5E2FA 3T4QA 1NJ4A 1K54C 5IU1A 2Y59A 4UEYA 4EU0A 4CLCB
chains in the Genus database with same CATH topology
1K57A 2ZM2A 3GQZA 1YM1A 5JYPA 1GA0A 1CK3A 5GHYA 3NDGA 4Z9QA 4GB7A 3ZDJA 1JWPA 3VOZA 4HBUA 4LV1A 2XQZA 1K55A 1XX2A 4DF6A 4B4ZA 1XP4A 2Y2LA 1BTLA 3ZG7B 4MNRA 3MKFA 2Y2NA 3A3JA 4OLDA 4WELA 5HAIA 5E2EA 5TGFA 3V50A 4Y0UA 1YLWA 4BD1A 4GD8A 1K6RA 3W4OA 2Y2PA 2ZLYA 1K4FA 4ZBEA 2Y2IA 5CHMA 2G2WA 2ZQAA 4RX2A 4XUXA 1H8YA 2Q9NA 4HBTA 3PAGA 3TOIA 2XD5A 4L0LA 3BLMA 4WZ5C 4OP8A 2H0TA 3UPOA 3GTCA 1ONHA 1IKIA 5EVIB 1SDNA 4OOLA 1KDSA 2IWCA 4R3JA 4GDBA 3S4XA 4ZDXA 4OPYA 1GHIA 2P9VA 2ZM8A 5CRFA 5FQQA 4P85A 3WS5A 1PI4A 4R4RA 1EI5A 5F82A 3ZNYA 3MZFA 3VFFA 3ZFZA 3N4IA 4OQIA 3PBOA 1XPBA 4NETA 2G2UA 1NXYA 3OPHA 4R3BA 3BFDA 1MWSA 3RXXA 5D3OA 3B3XA 1W7FA 4KZ9A 2XGNA 3MBZA 5EVLA 3SH7A 1WYCA 1KGFA 5FQIA 4GZBA 5AQAA 3NDEA 3LY4A 4PM7A 3UE1A 4H8RA 3WRZA 4HESA 5CEDA 3C5AA 1IYOA 4S2MA 4DE3A 2XD1A 4X69A 3PBRA 1K56A 5DTKA 1QMEA 5DF9A 1DJAA 4DRTA 3BEBA 4KENB 3IHAA 5CGSA 3EQUA 2QZ6A 4K0WA 1MPLA 5JYOA 3LCEA 4JF4A 4DXCA 3NC8A 4E3OA 2IWDA 2Y2JA 5A93A 2HP5A 2E8IA 3VP1A 3MZDA 5E2GA 5EECA 4OPRA 2WKIA 4N1HA 4CPKA 1Q2QA 1FR6A 4KZ4A 3ZGAB 2Y55A 4X56A 3S22A 4JF6A 2V2FF 4WMCA 1NYYA 2OLVA 4S2JA 4S2NA 1VM1A 2ZC4B 4KZ3A 1ZG6A 1FQGA 1MXOA 1Y54A 5GLBA 4DE0A 3SH9A 4GKUA 2JBFA 4UA7A 1FCMA 1FR1A 1CEGA 2ZMAA 4O7DA 5F1GA 4Y0TA 2OSUA 4JLFA 4EV4A 5FASA 1E3UA 1ERMA 3HREA 2ZC5B 1W8QA 5GLDA 4LENA 4EWFA 2XF3A 1KE0A 1Z6FA 2WGWB 1G6AA 2HPBA 3BLSA 1YLYA 3BRMA 3A3FA 1K6SA 4GOGA 4OOMA 3LEZA 3EQVA 2H0YA 5HARA 3G34A 4LV0A 1ES4A 5FQMA 4LCMA 4LCLA 1CI9A 4WZ4A 1ES2A 1SCWA 2XEPA 4XXRA 4BD0A 4QJGA 4Q8IA 3G2YA 2XFSA 3FKWA 2WGIA 1YT4A 3G31A 4BQMA 2J7VA 1OMEA 4MBKA 2R9WA 2EXAA 5KSHA 2XFTA 4FD8A 1MY8A 4QB8A 1RGYA 1PWDA 4PM9A 2ZJ9A 3IXGA 3HLFA 3HUNA 3C4OA 1QMFA 4RVAA 2H5SA 2DCFA 1RCJA 3HBRA 3BM6A 3VP4A 1JWVA 1I2WA 1PYYA 3C4PA 1PIOA 5EOOA 3CZDA 1L0EA 1XGIA 3DW0A 4BENA 5F1FA 1I5QA 4B4XA 4K0XA 1LL9A 4DDYA 1O07A 3BFCA 1BSGA 4QY6A 2ZC7A 1KDWA 5GHZA 3SS5A 3TSGA 1K57C 3PBSA 4JXGA 2HDRA 4ZJ3A 3E2KA 3VP2A 5U47A 5FSRA 5KMWA 2BLSA 4JPMA 4OH0A 4K91A 2CC1A 3C7UA 3SS3A 5FAPA 3AGDA 2XLNA 3Q7VB 5AQBA 3N8SA 3VMAA 3ZG8B 3IF6C 4E3NA 1FCNA 1K54A 1KE3A 1SHVA 1ES3A 3IF5A 4UA6A 1NYMA 3TG9A 3VOYA 4P87A 3ISGA 3BYDA 3ZNTA 3G35A 4MBFA 2Y2QA 2A3UA 2WGVA 5CERA 1FSYA 1GHPA 2OLUA 3WRTA 3VSKA 1YLJA 4EQIA 1WYBA 4KG6A 4NK3A 1K38A 3ZVWA 5CEBA 5A90A 5CHUA 5DF7A 2PU2A 4C6YA 4KZ6A 4WBGA 4GD6A 4GNUA 4JXSA 2J8YA 1CI8A 2XDMA 3G32A 3IT9A 4YINA 3RJUA 4BL3A 1MWUA 4BLMA 4C75A 5EVIA 4KG2A 3IHBA 4OP5A 3NI9A 4JKTA 4OVDA 4WZ5A 3HUOA 4BJPA 4E3LA 2Z2LB 4F94A 2HP9A 2WKHA 1YLZA 1DJCA 3IQAA 1SKFA 5TR7A 1TDLA 1TDGA 4RYEA 3O87A 3JYIA 1KGEA 2ZQCA 2WK0A 5E2HA 2IWBA 3RXWA 1BZAA 1U60A 3NCKA 4UAAA 4DE1A 1N4OA 4E6WA 1W79A 1GHMA 1BUEA 3UDXA 2XK1A 1ES5A 5KZHA 4IBXA 4OONA 4S2KA 4KQOA 5M18A 1RGZA 4S2IA 5HW3A 4FSFA 1LI0A 3VP0A 3WS0A 3UPNA 4PM5A 4E3IA 3IWQA 2P74A 3N8RA 1IELA 4JF5A 5DTTA 1VQQA 2H10A 2VGKA 4X55A 3S1YA 2WKEA 3DTMA 1KVMA 2XR0A 3LY3A 3OC2A 4IVIA 1TVFA 3FYZA 4OOYA 2ZQ7A 4R0QA 3UNWA 1E4DA 4BL2A 1Q2PA 3HLDA 1ONGA 3QNCA 2WZXA 5EOEA 1ZG4A 3MZEA 4R4SA 3ZG0A 2EX8A 2Y91A 5FI7A 4R1GA 4U0XA 4E3KA 2EFXA 5F83A 2EFUA 3CG5A 2J9PA 3WS1A 4CJNA 3VP3A 3UE3A 3GV9A 4OLGA 2I72A 1FCOA 3HLBA 1PW1A 3WS4A 1H8ZA 2PU4A 2OV5A 2EX2A 2JCHA 3DWKA 4DE2A 1BLSA 5BOHA 3ZCZA 3ZVTA 1IEMA 4N1XA 1BLPA 4FH2A 4E3JA 5KSCA 2Z2MB 4IVKA 3BFFA 1JWZA 4GN2A 4N9LA 2RCXA 1LL5A 2X71A 4ZAMA 3V3SA 3HLEA 4XUZA 4FH4A 1K25A 3UE0A 3Q1FA 2WGWA 4X53A 3WS2A 2EX6A 2J9OA 3HL9A 1S6RA 3QNBA 2V1ZA 1CEFA 1JVJA 4X68A 1DY6A 4KQQA 1LI9A 4PM6A 1ALQA 1M6KA 4OQGA 1IYSA 3O86A 1AXBA 2QPNA 5CXWA 5A91A 3UO9A 4OQHA 3V39A 4GDNA 1IYPA 4KZ7A 3OPRA 3OPPA 1YMSA 3QHYA 3W4PA 2HDQA 4OQ0A 3G4PA 4JXVA 3VFHA 3PAEA 3ZG9B 2B5RA 1JTGA 3Q81A 1ERQA 5FAOA 3ITAA 5HX9A 5DVAA 4IBRA 3MXSA 1KVLA 1RP5A 1O7EA 2WYXA 4QU3A 3FKVA 3A3EA 1ZC2A 2WAFA 1EWZA 2PBYA 1IYQA 5FQJA 3PTEA 4P0MA 2JC7A 3GSGA 1J9MA 1L0DA 5GL9A 3BECA 4C3QA 4QHCA 1GA9A 3OCNA 5M19A 1K55C 3A3IA 1XKZA 3GVBA 4MEZA 4JXWA 2X02A 2WAEA 2FFFB 1ZKJA 3MKEA 3IF6B 4KZ5A 1MWRA 4U0TA 3FWLA 1NZOA 3G30A 4E6XA 2Y4AA 3NBLA 3PBTA 3Q7VA 1YMXA 3Q7ZA 4DDSA 4U3TA 4EBNA 1XXMA 1PW8A 2BG1A 3GMWA 5L2FA 2QMIA 3A3DA 2HDSA 2Y2MA 3VSLA 1N9BA 2ZQDA 5HAQA 4KZ8A 3C7VA 3IF6A 1NZUA 1HZOA 3I7JA 4M3KA 2X01A 1LLBA 1IKGA 3AGFA 3HUMA 2C5WB 4DKIA 3UN7A 4E3MA 4R23A 4KZAA 4WYYA 4QY5A 3V5MA 5A92A 1EROA 3BFEA 3FZCA 2ZC3B 4FCFA 3IH9A 3ZG5A 2FFYA 4Y0OA 3SOIA 3WWXA 1NY0A 5DTSA 2EX9A 4ZJ2A 3IXBA 3NY4A 1MKIA 4KG5A 2P9VB 5EVIC 1PWGA 1C3BA 3E2LA 1I2SA 2ZQ9A 4LV3A 4PPRA 4DXBA 4ID4A 3CMZA 1PWCA 3BFGA 2HDUA 4WEKA 4N9KA 1L0GA 1YQSA 5FQ9A 4RX3A 1M40A 1H5XA 4PM8A 2UWXA 2WUQA 2DRWA 3UDIA 5J8XA 1NRFA 3ITBA 5E43A 2C6WB 1K4EA 2Y2OA 4OPQA 2ZQ8A 1FSWA 5IHVA 1JTDA 5HFOA 3SS4A 5AQ7A 5HL1A 4IEDA 4S2PA 2ZC6B 3HLWA 3M2KA 3O3VA 4ZTKA 3N8LA 1GCEA 4PMAA 3V3RA 1WE4A 1XA7A 2WZZA 5EUAA 1W8YA 1DJBA 3N6IA 5CGWA 4S2NC 2WADA 1BLCA 5EPHA 4KZBA 4ZJ1A 1BT5A 2ZD8A 2HP6A 1MBLA 1FOFA 3P98A 1KGGA 3ZHHA 2Y2KA 5M1AA 5FAQA 1XA1A 3W4QA 1ESIA 1S0WA 1YLPA 3UPPA 1G68A 3CJMA 2XH9A 3IXHA 2A49A 5EVID 1XGJA 4MLLA 5TFQA 1PZPA 1L0FA 1BLHA 5FQKA 3IH8A 5CHJA 3P09A 4X6TA 4KQRA 3HVFA 3GRJA 4EUZA 1HVBA 3HLGA 4OPZA 3UDFA 3O88A 3PBQA 1K56D 1PI5A 3IWOA 4S2LA 3W8KA 2GDNA 3PBNA 1TEMA 5G18A 5GHXA 4P6BA 5FA7A 1LHYA 3MXRA 4UHUA 5GLAA 5CECA 5HAPA 4RA7A 3SH8A 3NIAA 2JE5A 1HD8A 3IWIA 4EBLA 3Q07A 2RL3A 3LO7A 4A5RA 3D4FA 2EXBA 3OZHA 4JBFA 3OCLA 3AGEA 5AQ9A 3OPLA 3M6BA 4UA9A 2Y2HA 4WM9A 5CGXA 5FI6A 4B88A 4Y7PA 1E25A 3GR2A 4D2OA 2DNSA 1ESUA 4QD4A 4YFMA 3UY6A 3M2JA 4LV2A 4WMCD 2Q9MA 5EE8A 5FDHA 4HEFA 1PZOA 4EBPA 5I94A 2V20A 3N7WA 5CTMA 1KE4A 2Y2GA 1W5DA 1L2SA 5CTNA 3HLCA 3Q82A 5GLCA 2VGJA 4S2OA 1SDEA 2ZM0A 4WEJA 1YLTA 5FI2A 1BULA 3IXDA 3G2ZA 1HTZA 3M6HA 4OKPA 5FATA 3FV7A 5E2FA 1MWTA 1NJ4A 3MFDA 1K54C 1E3UD 2R9XA 2Y59A 4N92A 3DWZA 5DF8A 4MBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K57 A;  2ZM2 A;  3GQZ A;  1YM1 A;  5JYP A;  1GA0 A;  1CK3 A;  5GHY A;  3NDG A;  4Z9Q A;  4GB7 A;  3ZDJ A;  1JWP A;  3VOZ A;  4HBU A;  4LV1 A;  2XQZ A;  1K55 A;  1XX2 A;  4DF6 A;  4B4Z A;  1XP4 A;  2Y2L A;  1BTL A;  3ZG7 B;  4MNR A;  3MKF A;  2Y2N A;  3A3J A;  4OLD A;  4WEL A;  5HAI A;  5E2E A;  5TGF A;  3V50 A;  4Y0U A;  1YLW A;  4BD1 A;  4GD8 A;  1K6R A;  3W4O A;  2Y2P A;  2ZLY A;  1K4F A;  4ZBE A;  2Y2I A;  5CHM A;  2G2W A;  2ZQA A;  4RX2 A;  4XUX A;  1H8Y A;  2Q9N A;  4HBT A;  3PAG A;  3TOI A;  2XD5 A;  4L0L A;  3BLM A;  4WZ5 C;  4OP8 A;  2H0T A;  3UPO A;  3GTC A;  1ONH A;  1IKI A;  5EVI B;  1SDN A;  4OOL A;  1KDS A;  2IWC A;  4R3J A;  4GDB A;  3S4X A;  4ZDX A;  4OPY A;  1GHI A;  2P9V A;  2ZM8 A;  5CRF A;  5FQQ A;  4P85 A;  3WS5 A;  1PI4 A;  4R4R A;  1EI5 A;  5F82 A;  3ZNY A;  3MZF A;  3VFF A;  3ZFZ A;  3N4I A;  4OQI A;  3PBO A;  1XPB A;  4NET A;  2G2U A;  1NXY A;  3OPH A;  4R3B A;  3BFD A;  1MWS A;  3RXX A;  5D3O A;  3B3X A;  1W7F A;  4KZ9 A;  2XGN A;  3MBZ A;  5EVL A;  3SH7 A;  1WYC A;  1KGF A;  5FQI A;  4GZB A;  5AQA A;  3NDE A;  3LY4 A;  4PM7 A;  3UE1 A;  4H8R A;  3WRZ A;  4HES A;  5CED A;  3C5A A;  1IYO A;  4S2M A;  4DE3 A;  2XD1 A;  4X69 A;  3PBR A;  1K56 A;  5DTK A;  1QME A;  5DF9 A;  1DJA A;  4DRT A;  3BEB A;  4KEN B;  3IHA A;  5CGS A;  3EQU A;  2QZ6 A;  4K0W A;  1MPL A;  5JYO A;  3LCE A;  4JF4 A;  4DXC A;  3NC8 A;  4E3O A;  2IWD A;  2Y2J A;  5A93 A;  2HP5 A;  2E8I A;  3VP1 A;  3MZD A;  5E2G A;  5EEC A;  4OPR A;  2WKI A;  4N1H A;  4CPK A;  1Q2Q A;  1FR6 A;  4KZ4 A;  3ZGA B;  2Y55 A;  4X56 A;  3S22 A;  4JF6 A;  2V2F F;  4WMC A;  1NYY A;  2OLV A;  4S2J A;  4S2N A;  1VM1 A;  2ZC4 B;  4KZ3 A;  1ZG6 A;  1FQG A;  1MXO A;  1Y54 A;  5GLB A;  4DE0 A;  3SH9 A;  4GKU A;  2JBF A;  4UA7 A;  1FCM A;  1FR1 A;  1CEG A;  2ZMA A;  4O7D A;  5F1G A;  4Y0T A;  2OSU A;  4JLF A;  4EV4 A;  5FAS A;  1E3U A;  1ERM A;  3HRE A;  2ZC5 B;  1W8Q A;  5GLD A;  4LEN A;  4EWF A;  2XF3 A;  1KE0 A;  1Z6F A;  2WGW B;  1G6A A;  2HPB A;  3BLS A;  1YLY A;  3BRM A;  3A3F A;  1K6S A;  4GOG A;  4OOM A;  3LEZ A;  3EQV A;  2H0Y A;  5HAR A;  3G34 A;  4LV0 A;  1ES4 A;  5FQM A;  4LCM A;  4LCL A;  1CI9 A;  4WZ4 A;  1ES2 A;  1SCW A;  2XEP A;  4XXR A;  4BD0 A;  4QJG A;  4Q8I A;  3G2Y A;  2XFS A;  3FKW A;  2WGI A;  1YT4 A;  3G31 A;  4BQM A;  2J7V A;  1OME A;  4MBK A;  2R9W A;  2EXA A;  5KSH A;  2XFT A;  4FD8 A;  1MY8 A;  4QB8 A;  1RGY A;  1PWD A;  4PM9 A;  2ZJ9 A;  3IXG A;  3HLF A;  3HUN A;  3C4O A;  1QMF A;  4RVA A;  2H5S A;  2DCF A;  1RCJ A;  3HBR A;  3BM6 A;  3VP4 A;  1JWV A;  1I2W A;  1PYY A;  3C4P A;  1PIO A;  5EOO A;  3CZD A;  1L0E A;  1XGI A;  3DW0 A;  4BEN A;  5F1F A;  1I5Q A;  4B4X A;  4K0X A;  1LL9 A;  4DDY A;  1O07 A;  3BFC A;  1BSG A;  4QY6 A;  2ZC7 A;  1KDW A;  5GHZ A;  3SS5 A;  3TSG A;  1K57 C;  3PBS A;  4JXG A;  2HDR A;  4ZJ3 A;  3E2K A;  3VP2 A;  5U47 A;  5FSR A;  5KMW A;  2BLS A;  4JPM A;  4OH0 A;  4K91 A;  2CC1 A;  3C7U A;  3SS3 A;  5FAP A;  3AGD A;  2XLN A;  3Q7V B;  5AQB A;  3N8S A;  3VMA A;  3ZG8 B;  3IF6 C;  4E3N A;  1FCN A;  1K54 A;  1KE3 A;  1SHV A;  1ES3 A;  3IF5 A;  4UA6 A;  1NYM A;  3TG9 A;  3VOY A;  4P87 A;  3ISG A;  3BYD A;  3ZNT A;  3G35 A;  4MBF A;  2Y2Q A;  2A3U A;  2WGV A;  5CER A;  1FSY A;  1GHP A;  2OLU A;  3WRT A;  3VSK A;  1YLJ A;  4EQI A;  1WYB A;  4KG6 A;  4NK3 A;  1K38 A;  3ZVW A;  5CEB A;  5A90 A;  5CHU A;  5DF7 A;  2PU2 A;  4C6Y A;  4KZ6 A;  4WBG A;  4GD6 A;  4GNU A;  4JXS A;  2J8Y A;  1CI8 A;  2XDM A;  3G32 A;  3IT9 A;  4YIN A;  3RJU A;  4BL3 A;  1MWU A;  4BLM A;  4C75 A;  5EVI A;  4KG2 A;  3IHB A;  4OP5 A;  3NI9 A;  4JKT A;  4OVD A;  4WZ5 A;  3HUO A;  4BJP A;  4E3L A;  2Z2L B;  4F94 A;  2HP9 A;  2WKH A;  1YLZ A;  1DJC A;  3IQA A;  1SKF A;  5TR7 A;  1TDL A;  1TDG A;  4RYE A;  3O87 A;  3JYI A;  1KGE A;  2ZQC A;  2WK0 A;  5E2H A;  2IWB A;  3RXW A;  1BZA A;  1U60 A;  3NCK A;  4UAA A;  4DE1 A;  1N4O A;  4E6W A;  1W79 A;  1GHM A;  1BUE A;  3UDX A;  2XK1 A;  1ES5 A;  5KZH A;  4IBX A;  4OON A;  4S2K A;  4KQO A;  5M18 A;  1RGZ A;  4S2I A;  5HW3 A;  4FSF A;  1LI0 A;  3VP0 A;  3WS0 A;  3UPN A;  4PM5 A;  4E3I A;  3IWQ A;  2P74 A;  3N8R A;  1IEL A;  4JF5 A;  5DTT A;  1VQQ A;  2H10 A;  2VGK A;  4X55 A;  3S1Y A;  2WKE A;  3DTM A;  1KVM A;  2XR0 A;  3LY3 A;  3OC2 A;  4IVI A;  1TVF A;  3FYZ A;  4OOY A;  2ZQ7 A;  4R0Q A;  3UNW A;  1E4D A;  4BL2 A;  1Q2P A;  3HLD A;  1ONG A;  3QNC A;  2WZX A;  5EOE A;  1ZG4 A;  3MZE A;  4R4S A;  3ZG0 A;  2EX8 A;  2Y91 A;  5FI7 A;  4R1G A;  4U0X A;  4E3K A;  2EFX A;  5F83 A;  2EFU A;  3CG5 A;  2J9P A;  3WS1 A;  4CJN A;  3VP3 A;  3UE3 A;  3GV9 A;  4OLG A;  2I72 A;  1FCO A;  3HLB A;  1PW1 A;  3WS4 A;  1H8Z A;  2PU4 A;  2OV5 A;  2EX2 A;  2JCH A;  3DWK A;  4DE2 A;  1BLS A;  5BOH A;  3ZCZ A;  3ZVT A;  1IEM A;  4N1X A;  1BLP A;  4FH2 A;  4E3J A;  5KSC A;  2Z2M B;  4IVK A;  3BFF A;  1JWZ A;  4GN2 A;  4N9L A;  2RCX A;  1LL5 A;  2X71 A;  4ZAM A;  3V3S A;  3HLE A;  4XUZ A;  4FH4 A;  1K25 A;  3UE0 A;  3Q1F A;  2WGW A;  4X53 A;  3WS2 A;  2EX6 A;  2J9O A;  3HL9 A;  1S6R A;  3QNB A;  2V1Z A;  1CEF A;  1JVJ A;  4X68 A;  1DY6 A;  4KQQ A;  1LI9 A;  4PM6 A;  1ALQ A;  1M6K A;  4OQG A;  1IYS A;  3O86 A;  1AXB A;  2QPN A;  5CXW A;  5A91 A;  3UO9 A;  4OQH A;  3V39 A;  4GDN A;  1IYP A;  4KZ7 A;  3OPR A;  3OPP A;  1YMS A;  3QHY A;  3W4P A;  2HDQ A;  4OQ0 A;  3G4P A;  4JXV A;  3VFH A;  3PAE A;  3ZG9 B;  2B5R A;  1JTG A;  3Q81 A;  1ERQ A;  5FAO A;  3ITA A;  5HX9 A;  5DVA A;  4IBR A;  3MXS A;  1KVL A;  1RP5 A;  1O7E A;  2WYX A;  4QU3 A;  3FKV A;  3A3E A;  1ZC2 A;  2WAF A;  1EWZ A;  2PBY A;  1IYQ A;  5FQJ A;  3PTE A;  4P0M A;  2JC7 A;  3GSG A;  1J9M A;  1L0D A;  5GL9 A;  3BEC A;  4C3Q A;  4QHC A;  1GA9 A;  3OCN A;  5M19 A;  1K55 C;  3A3I A;  1XKZ A;  3GVB A;  4MEZ A;  4JXW A;  2X02 A;  2WAE A;  2FFF B;  1ZKJ A;  3MKE A;  3IF6 B;  4KZ5 A;  1MWR A;  4U0T A;  3FWL A;  1NZO A;  3G30 A;  4E6X A;  2Y4A A;  3NBL A;  3PBT A;  3Q7V A;  1YMX A;  3Q7Z A;  4DDS A;  4U3T A;  4EBN A;  1XXM A;  1PW8 A;  2BG1 A;  3GMW A;  5L2F A;  2QMI A;  3A3D A;  2HDS A;  2Y2M A;  3VSL A;  1N9B A;  2ZQD A;  5HAQ A;  4KZ8 A;  3C7V A;  3IF6 A;  1NZU A;  1HZO A;  3I7J A;  4M3K A;  2X01 A;  1LLB A;  1IKG A;  3AGF A;  3HUM A;  2C5W B;  4DKI A;  3UN7 A;  4E3M A;  4R23 A;  4KZA A;  4WYY A;  4QY5 A;  3V5M A;  5A92 A;  1ERO A;  3BFE A;  3FZC A;  2ZC3 B;  4FCF A;  3IH9 A;  3ZG5 A;  2FFY A;  4Y0O A;  3SOI A;  3WWX A;  1NY0 A;  5DTS A;  2EX9 A;  4ZJ2 A;  3IXB A;  3NY4 A;  1MKI A;  4KG5 A;  2P9V B;  5EVI C;  1PWG A;  1C3B A;  3E2L A;  1I2S A;  2ZQ9 A;  4LV3 A;  4PPR A;  4DXB A;  4ID4 A;  3CMZ A;  1PWC A;  3BFG A;  2HDU A;  4WEK A;  4N9K A;  1L0G A;  1YQS A;  5FQ9 A;  4RX3 A;  1M40 A;  1H5X A;  4PM8 A;  2UWX A;  2WUQ A;  2DRW A;  3UDI A;  5J8X A;  1NRF A;  3ITB A;  5E43 A;  2C6W B;  1K4E A;  2Y2O A;  4OPQ A;  2ZQ8 A;  1FSW A;  5IHV A;  1JTD A;  5HFO A;  3SS4 A;  5AQ7 A;  5HL1 A;  4IED A;  4S2P A;  2ZC6 B;  3HLW A;  3M2K A;  3O3V A;  4ZTK A;  3N8L A;  1GCE A;  4PMA A;  3V3R A;  1WE4 A;  1XA7 A;  2WZZ A;  5EUA A;  1W8Y A;  1DJB A;  3N6I A;  5CGW A;  4S2N C;  2WAD A;  1BLC A;  5EPH A;  4KZB A;  4ZJ1 A;  1BT5 A;  2ZD8 A;  2HP6 A;  1MBL A;  1FOF A;  3P98 A;  1KGG A;  3ZHH A;  2Y2K A;  5M1A A;  5FAQ A;  1XA1 A;  3W4Q A;  1ESI A;  1S0W A;  1YLP A;  3UPP A;  1G68 A;  3CJM A;  2XH9 A;  3IXH A;  2A49 A;  5EVI D;  1XGJ A;  4MLL A;  5TFQ A;  1PZP A;  1L0F A;  1BLH A;  5FQK A;  3IH8 A;  5CHJ A;  3P09 A;  4X6T A;  4KQR A;  3HVF A;  3GRJ A;  4EUZ A;  1HVB A;  3HLG A;  4OPZ A;  3UDF A;  3O88 A;  3PBQ A;  1K56 D;  1PI5 A;  3IWO A;  4S2L A;  3W8K A;  2GDN A;  3PBN A;  1TEM A;  5G18 A;  5GHX A;  4P6B A;  5FA7 A;  1LHY A;  3MXR A;  4UHU A;  5GLA A;  5CEC A;  5HAP A;  4RA7 A;  3SH8 A;  3NIA A;  2JE5 A;  1HD8 A;  3IWI A;  4EBL A;  3Q07 A;  2RL3 A;  3LO7 A;  4A5R A;  3D4F A;  2EXB A;  3OZH A;  4JBF A;  3OCL A;  3AGE A;  5AQ9 A;  3OPL A;  3M6B A;  4UA9 A;  2Y2H A;  4WM9 A;  5CGX A;  5FI6 A;  4B88 A;  4Y7P A;  1E25 A;  3GR2 A;  4D2O A;  2DNS A;  1ESU A;  4QD4 A;  4YFM A;  3UY6 A;  3M2J A;  4LV2 A;  4WMC D;  2Q9M A;  5EE8 A;  5FDH A;  4HEF A;  1PZO A;  4EBP A;  5I94 A;  2V20 A;  3N7W A;  5CTM A;  1KE4 A;  2Y2G A;  1W5D A;  1L2S A;  5CTN A;  3HLC A;  3Q82 A;  5GLC A;  2VGJ A;  4S2O A;  1SDE A;  2ZM0 A;  4WEJ A;  1YLT A;  5FI2 A;  1BUL A;  3IXD A;  3G2Z A;  1HTZ A;  3M6H A;  4OKP A;  5FAT A;  3FV7 A;  5E2F A;  1MWT A;  1NJ4 A;  3MFD A;  1K54 C;  1E3U D;  2R9X A;  2Y59 A;  4N92 A;  3DWZ A;  5DF8 A;  4MBH A; 
#chains in the Genus database with same CATH topology
 1STZ A;  5EV0 A;  5DJU A;  1JWP A;  4LV1 A;  1K55 A;  4DF6 A;  3LIF A;  4CLC A;  3T12 B;  2Y2L A;  4MNR A;  4ME4 A;  2Y2N A;  3A3J A;  4OLD A;  4WEL A;  4HQA A;  4BBT A;  4GS9 B;  4GD8 A;  3W4O A;  2PHY A;  4H6J B;  5CHM A;  2M7U A;  2B95 A;  2B02 A;  3BQ8 A;  4GS9 A;  3H9W A;  1P0Z A;  3GTC A;  4H6J A;  4OOL A;  3IX8 A;  1GHI A;  3WS5 A;  3ZNY A;  3VFF A;  3N4I A;  4OQI A;  1XPB A;  1W7F A;  3MBZ A;  1KGF A;  2VGL S;  3B47 A;  5K5B A;  4PM7 A;  4D60 A;  3WRZ A;  4HES A;  5L8M A;  3PBR A;  1K56 A;  2K31 A;  3BEB A;  2ZMV A;  5CGS A;  2QZ6 A;  4K0W A;  1MPL A;  3LCE A;  4JF4 A;  1WA9 A;  2IWD A;  5A93 A;  5EEC A;  4N1H A;  2ZMF A;  2PYR A;  2V2F F;  3DBA A;  1VM1 A;  3BQA A;  1FQG A;  1XJ6 A;  3CPT B;  4GKU A;  1FCM A;  4O7D A;  4DJ3 A;  1W8Q A;  2HPB A;  3BRM A;  3CPT A;  3A3F A;  3KSF A;  5HL6 A;  1OT9 A;  1XJ4 A;  1CI9 A;  5A8B A;  3LIE A;  4Q8I A;  2XFS A;  2I9V A;  4F3L B;  5KSH A;  3SW1 A;  3BWL A;  1S4S A;  2V1B A;  3HUN A;  4XT2 B;  2DCF A;  3F1P B;  1TS7 A;  4F3L A;  4B4X A;  1LL9 A;  1ZTU A;  1KDW A;  4JXG A;  3E2K A;  5KMW A;  5FSR A;  1TF1 A;  3FPW A;  4K91 A;  2VKS A;  4CLC E;  3VMA A;  2E8J A;  3N8S A;  5AQB A;  3VOY A;  1ES3 A;  4EEP A;  4MN7 A;  3ISG A;  4P87 A;  3BYD A;  3ZNT A;  2Y2Q A;  1GHP A;  5F69 A;  3VSK A;  1YLJ A;  4EQI A;  2W0N A;  4KG6 A;  2WKP A;  4NK3 A;  2VX8 A;  5A90 A;  4KZ6 A;  3JPU A;  4WBG A;  3F1O B;  4JXS A;  4YIN A;  2M7V A;  4BLM A;  2YKF A;  4C75 A;  3IHB A;  3G6O A;  3F1O A;  1YLZ A;  1YPR A;  5TR7 A;  1OT6 A;  1TDL A;  3MR0 A;  3EEA A;  3C30 A;  4Z1W A;  1BZA A;  1U60 A;  2K2N A;  3QP1 A;  2XK1 A;  5DFX A;  1RGZ A;  3BY8 A;  1DP9 A;  4YNR A;  3S1Y A;  2A24 B;  5CX7 A;  3T4O A;  2XR0 A;  1MZU A;  1E4D A;  1XJ2 A;  3D3O A;  2WZX A;  5LBR A;  4MN6 A;  5FI7 A;  4E3K A;  3RH8 B;  2EFX A;  5F83 A;  3LR5 A;  3T1Q B;  4CJN A;  3VP3 A;  4OLG A;  3HLB A;  1FCO A;  2PU4 A;  2OV5 A;  4B9O A;  4N1X A;  4E3J A;  1T18 A;  4N9L A;  2WKR A;  3E98 A;  3V3S A;  2JN7 A;  1K25 A;  2ZL1 A;  2V1Z A;  1JVJ A;  1OPX A;  4EW7 A;  4LRY C;  3E4P A;  3B42 A;  3OPP A;  3QHY A;  3W4P A;  3A0V A;  2W3E A;  3PAE A;  4QPR A;  1JTG A;  1NWZ A;  4R6L A;  3T4K A;  1KVL A;  1RP5 A;  4QU3 A;  3FKV A;  1EWZ A;  4ZRR A;  2P08 A;  3BEC A;  3LFV A;  2O99 A;  4UQI M;  3OBF A;  4I39 A;  2OAQ 1;  4MEZ A;  1ZKJ A;  3MKE A;  3IF6 B;  3LIB A;  4E6X A;  3NBL A;  4EBN A;  4DDS A;  1P9W A;  1TS8 A;  2W1T B;  3IF6 A;  2X01 A;  4M3K A;  3VE3 A;  4R70 A;  2QJ5 A;  3UN7 A;  4E3M A;  3T4T A;  4QY5 A;  5EVE A;  5A92 A;  1ERO A;  3BFE A;  2OWH A;  3K3C A;  4Y0O A;  3SOI A;  1EW0 A;  5DTS A;  2EX9 A;  3NY4 A;  3MF0 A;  4E04 A;  3LI8 A;  1I2S A;  2ZQ9 A;  2FH5 A;  1MC0 A;  3BFG A;  2HDU A;  4RX3 A;  3UB7 A;  1H5X A;  3R7W A;  2WUQ A;  1NRF A;  1SKO B;  2Q0O A;  4Q0I A;  5HDS A;  5HFO A;  3SS4 A;  3B33 A;  5HL1 A;  4IED A;  4S2P A;  1SKO A;  3N8L A;  1GCE A;  4PMA A;  3UB6 A;  4S2N C;  2WAD A;  3T4L A;  2KX6 A;  3QP6 A;  4Y17 A;  1FOF A;  3P98 A;  1KGG A;  2Y2K A;  4MN5 A;  3GEC A;  1ESI A;  1YLP A;  5I5L A;  3CJM A;  2XH9 A;  4Y5F A;  2A49 A;  4UQI S;  5EVI D;  4WF0 A;  4B93 A;  5CHJ A;  3HVF A;  1F9I A;  4OPZ A;  3TE8 A;  2INW A;  3W8K A;  1TEM A;  5G18 A;  1YSQ A;  4P6B A;  5MC7 A;  4R3A A;  3SH8 A;  4A5R A;  3OZH A;  3OCL A;  1S4R A;  3OPL A;  3M6B A;  4HOI A;  5CGX A;  5FI6 A;  1S67 L;  1E25 A;  2L1M A;  4YFM A;  1TS6 A;  5CTN A;  3HLC A;  3Q82 A;  3U4L P;  1SDE A;  1BUL A;  4HIA A;  3M6H A;  4FUW A;  4OKP A;  3MFD A;  2R9X A;  4N92 A;  4I3J A;  4MBH A;  4PKY A;  1K57 A;  5IS1 A;  1YM1 A;  1GA0 A;  1CK3 A;  5GHY A;  4GB7 A;  1X0O A;  4JGP A;  2XQZ A;  4B4Z A;  1BTL A;  1D7E A;  3MKF A;  5HWV A;  5TGF A;  3V50 A;  5DJT A;  1H3Q A;  2ZLY A;  1F2K A;  2G2W A;  4XUX A;  1H8Y A;  4LFU A;  3TOI A;  2XD5 A;  2HJ9 C;  4L0L A;  3S7O A;  4WZ5 C;  2H0T A;  4EET B;  5HZH A;  4HNB A;  5EVI B;  2W3D A;  1SDN A;  2ZM8 A;  2P9V A;  3K2N A;  1PI4 A;  5F82 A;  4EER A;  3MZF A;  1J3W A;  3PBO A;  2J3W A;  1NXY A;  2O9C A;  1MWS A;  4KZ9 A;  4Y15 A;  3SH7 A;  5J7E A;  2XRN A;  1WYC A;  3NDE A;  2G7U A;  3UE1 A;  3L7H A;  4AFI A;  3C5A A;  4DE3 A;  5DTK A;  4G3V A;  1DJA A;  3E4Q A;  4KEN B;  3IHA A;  3NOP C;  2LB5 A;  4Q0J A;  2E8I A;  3KYE A;  3VP1 A;  5E2G A;  2FZ0 A;  4X56 A;  3O5Y A;  4EQ1 A;  2R78 A;  2ZC4 B;  4KZ3 A;  4WUJ A;  3LEQ A;  1ZG6 A;  5GLB A;  1W63 M;  3SH9 A;  4UA7 A;  1FR1 A;  1CEG A;  2ZMA A;  4Y0T A;  2OSU A;  4HJ6 A;  3P7N A;  4LEN A;  2XF3 A;  1KE0 A;  3LID A;  2WGW B;  1G6A A;  1YLY A;  4GOG A;  3EQV A;  3H7W B;  2H0Y A;  3G34 A;  5HSQ A;  4LCL A;  4XXR A;  2XEP A;  2QKP A;  3CLO A;  3G2Y A;  2HF6 A;  2WGI A;  3G31 A;  4BQM A;  2CMN A;  2R9W A;  1MY8 A;  4QB8 A;  1RGY A;  4PM9 A;  2ZJ9 A;  1L3L A;  3IS2 A;  4R38 A;  1I2W A;  4G3K A;  1PIO A;  5EOO A;  4HHD A;  3CZD A;  4ETZ A;  4BEN A;  5AVF A;  4K0X A;  4PKY G;  4HJ3 A;  3BFC A;  3GDI A;  1K57 C;  3PBS A;  2HDR A;  5DFY A;  3HJI A;  2V1A A;  1V9Y A;  5FAP A;  2XLN A;  3Q7V B;  1FCN A;  1KE3 A;  3TG9 A;  3JVU A;  1ODV A;  2A3U A;  2WGV A;  4NXG A;  5CER A;  2OLU A;  1G28 A;  1WYB A;  4EES A;  3T4S A;  1K38 A;  4II7 A;  5CEB A;  5CHU A;  4C6Y A;  4GD6 A;  2AVX A;  3G32 A;  1CI8 A;  2JKG A;  3IT9 A;  3LIA A;  1MWU A;  3MQQ A;  1P97 A;  4KG2 A;  1T1C A;  2Z2L B;  4GW9 A;  4X1M A;  1TDG A;  3CUE A;  3JYI A;  1LSW A;  2WK0 A;  2PAV P;  3E0Y A;  1N4O A;  3ICY A;  1S1Y A;  1GHM A;  3PR6 A;  4IBX A;  4S2K A;  5M18 A;  4S2I A;  4FSF A;  3IWQ A;  4K08 A;  1IEL A;  4JF5 A;  1GSX A;  4HP9 A;  3P01 A;  4X55 A;  3DTM A;  3OC2 A;  1TVF A;  3FYZ A;  3HLD A;  1ONG A;  5EOE A;  3MZE A;  4R4S A;  3ZG0 A;  2Y91 A;  4R1G A;  3EGX C;  2EFU A;  1PW1 A;  2B18 A;  2JCH A;  5BOH A;  1BLP A;  4IVK A;  3BFF A;  4GN2 A;  2RCX A;  3ZYT A;  3DAV A;  4ZAM A;  3EOI A;  3HLE A;  3A0R A;  3UE0 A;  3Q1F A;  4X53 A;  1G5U A;  3WS2 A;  2J9O A;  3HL9 A;  1S6R A;  2J3T C;  4KQQ A;  4EXO A;  1ALQ A;  1M6K A;  1IYS A;  4GCZ A;  4WN5 A;  3V39 A;  1N9O A;  4BBU A;  3LR0 A;  2HDQ A;  3VFH A;  2B5R A;  1ACF A;  3TJZ C;  3Q81 A;  3ITA A;  4XT2 A;  4IBR A;  2O0Y A;  3F1P A;  1ZC2 A;  2WAF A;  2PBY A;  3GSG A;  1J9M A;  2IA2 A;  5GL9 A;  2HZ5 A;  3K3D A;  1K55 C;  5J3W A;  4CLC C;  4NEE D;  5AVE A;  1VB6 A;  1MWR A;  1NZO A;  1AWI A;  1YMX A;  3Q7Z A;  1LL8 A;  2BG1 A;  3GMW A;  2QMI A;  2HDS A;  3IBJ A;  3U2A A;  4KZ8 A;  3LGO A;  3IX4 A;  4R23 A;  3V5M A;  3IH9 A;  4JGQ A;  2OAP 1;  2FFY A;  1CF0 A;  4KG5 A;  4X1L A;  1PWG A;  2D02 A;  3IX3 A;  4ETX A;  3E2L A;  3NOU C;  2P04 A;  4N9K A;  3KYZ A;  1YQS A;  1M40 A;  5KIZ A;  2DRW A;  4KQD A;  3ITB A;  5E43 A;  3PYP A;  1K4E A;  2O9B A;  2ZQ8 A;  1FSW A;  2BTF P;  2MJ6 A;  3VE4 A;  3HLW A;  1WE4 A;  2WZZ A;  1W8Y A;  2A24 A;  5EPH A;  3C38 A;  4KZB A;  1BT5 A;  2ZD8 A;  1XA1 A;  3W4Q A;  1T1A A;  3C2W A;  4BWI A;  3JVV A;  1BLH A;  1K0K A;  4LGW A;  4X6T A;  4GHI B;  4WL9 A;  3R4K A;  1HVB A;  3UME A;  3UDF A;  3O88 A;  1PI5 A;  4MCW A;  4S2L A;  2GDN A;  4YOF A;  5GHX A;  4G3W A;  3MXR A;  4UHU A;  5GLA A;  4RA7 A;  2JE5 A;  3IWI A;  3DTI A;  3LO7 A;  3HJK A;  4WM9 A;  4B88 A;  5FDH A;  4HEF A;  5FL3 A;  1W5D A;  5FI2 A;  2UV0 E;  3IXD A;  1HTZ A;  3T1S A;  1MWT A;  1E3U D;  3FC7 A;  3GQZ A;  4Y2F A;  3ZDJ A;  4MMN A;  3VOZ A;  1XX2 A;  2PR6 A;  1XP4 A;  5DKL A;  4Y0U A;  1YLW A;  2H28 A;  2W1T A;  4BD1 A;  1K6R A;  4EUV A;  2Y2I A;  2ZQA A;  4BMW A;  2Q9N A;  3PAG A;  3BLM A;  4OP8 A;  3CI6 A;  1IKI A;  4IJG A;  4GDB A;  4ZDX A;  4OPY A;  4I38 A;  4P85 A;  4R4R A;  1LSX A;  3OPH A;  4HY8 A;  3BFD A;  3B3X A;  2XGN A;  4NKP A;  3EEH A;  3RTY A;  4GZB A;  4IUH A;  5HDC A;  2V8F A;  2PD8 A;  3LY4 A;  4PHT A;  4H8R A;  3UE6 A;  5CED A;  1IYO A;  4X69 A;  5EM1 A;  3EQU A;  5JYO A;  1N9N A;  3S7Q A;  2Y2J A;  3BJN A;  2HP5 A;  3MZD A;  1LT0 A;  4I3I A;  1Q2Q A;  2KOI A;  3LI9 A;  1FR6 A;  2PDR A;  4KZ4 A;  3ULF A;  2Y55 A;  2OLV A;  2GJ3 A;  2GZA A;  1Y54 A;  4KUO A;  3H82 B;  5FAS A;  1E3U A;  1ERM A;  3HRE A;  5GLD A;  1OTA A;  3BLS A;  1ZHH B;  3H82 A;  4OOM A;  3LEZ A;  4GJ4 A;  2HV1 A;  4HH3 A;  1ES4 A;  5FQM A;  2GX5 A;  4LCM A;  1ES2 A;  2VK3 A;  4QJG A;  3FKW A;  1YT4 A;  1OME A;  4MBK A;  2EXA A;  1PWD A;  3IXG A;  3OOV A;  2H5S A;  1RCJ A;  3BM6 A;  5FDS A;  1JWV A;  2W3H A;  1PYY A;  3C4P A;  3UB5 P;  3VP4 A;  2ZOH A;  1L0E A;  2VZW A;  3DW0 A;  1I5Q A;  4QY6 A;  2ZC7 A;  3TSG A;  5GHZ A;  3VP2 A;  2BLS A;  4JPM A;  4M4X A;  1SZV A;  3SS3 A;  3AGD A;  4E3N A;  3IF6 C;  1K54 A;  4UA6 A;  3IF5 A;  2QHK A;  1F98 A;  3G35 A;  4O8G A;  3WRT A;  2HGV A;  1PFL A;  3PHY A;  3CWF A;  3ZVW A;  2L4R A;  5DF7 A;  2NUP C;  3LYX A;  2V0W A;  1TD5 A;  2XDM A;  3KO6 A;  5EVI A;  2OWJ A;  3NI9 A;  4JKT A;  4OP5 A;  4OVD A;  4Y13 A;  2EWV A;  3HUO A;  4BJP A;  4E3L A;  4IUK A;  4F94 A;  2HP9 A;  3MMH A;  2WKH A;  3IQA A;  4RYE A;  3NEC A;  2HJE A;  3RXW A;  4DE1 A;  1W79 A;  1BUE A;  3UDX A;  4KQO A;  2XSS A;  3NHQ A;  1LI0 A;  3VP0 A;  4PM5 A;  4E3I A;  1YKD A;  5DTT A;  1VQQ A;  1N9L A;  2H10 A;  2VGK A;  4NXF A;  2WKE A;  3LY3 A;  3EGD C;  3A0S A;  4R0Q A;  3UB8 A;  3UNW A;  2ZQ7 A;  4BL2 A;  2EX8 A;  4U0X A;  2J9P A;  3WS1 A;  5AJG A;  3GV9 A;  2I72 A;  1H8Z A;  5EM0 A;  1IOU A;  3C8C A;  3V67 A;  4O01 A;  3ZCZ A;  3ZVT A;  3W2Z A;  2Z6C A;  2Z2M B;  1H8M A;  1Y4O A;  1JWZ A;  1BYW A;  1OTD A;  2X71 A;  4NXE A;  2KLI A;  4XUZ A;  3T50 A;  4Q0H A;  2WGW A;  3QNB A;  1CEF A;  2QJ7 A;  1VHM A;  1DY6 A;  3H7W A;  1LI9 A;  3MQO A;  5EFW A;  4PM6 A;  5HD5 A;  5HWW A;  4OQG A;  3O86 A;  1MKM A;  3UB9 A;  2V0U A;  1G6O A;  1IFQ A;  4GDN A;  1IYP A;  1YMS A;  4JXV A;  3ZG9 B;  5L07 A;  5FAO A;  5DVA A;  5HD3 A;  3PTE A;  4P0M A;  2ZOI A;  1F5M A;  4QHC A;  5M19 A;  3A3I A;  3S7N A;  1XKZ A;  4JXW A;  1UGU A;  2X02 A;  2WAE A;  4KZ5 A;  1PRQ A;  3G30 A;  2Y4A A;  3PBT A;  3Q7V A;  4U3T A;  1XXM A;  1PW8 A;  5L2F A;  4DMZ A;  1N9B A;  1XFN A;  3C7V A;  3I7J A;  1IKG A;  3AGF A;  3HUM A;  2C5W B;  2JKT I;  4DKI A;  2L0W A;  4KZA A;  4WYY A;  5C5K A;  1T1B A;  3FZC A;  2XA7 M;  4FCF A;  5G4Z A;  1MKI A;  5EVI C;  1CQA A;  1C3B A;  4LV3 A;  4PPR A;  4DXB A;  3MS6 A;  4ID4 A;  3CMZ A;  4BBV A;  4WEK A;  1L0G A;  2UWX A;  1D1J A;  2Y2O A;  2Y8H A;  1JTD A;  2JKT M;  3MSH A;  3O3V A;  1S1Z A;  1OJ5 A;  3V3R A;  2VA0 A;  2LB9 A;  1Z09 A;  2K7S A;  1DRM A;  2J80 A;  1D06 A;  4ZJ1 A;  3BW6 A;  1MBL A;  3ZHH A;  5M1A A;  2VV7 A;  1DP8 A;  5FAQ A;  4NG2 A;  5IT5 A;  3UPP A;  3RFB A;  2OOL A;  3IXH A;  1S66 L;  4MLL A;  2WKQ A;  2VEA A;  3IH8 A;  3P09 A;  2EWW A;  4KQR A;  3GRJ A;  3PBQ A;  3IWO A;  3NJA A;  5FA7 A;  1LHY A;  2YKH A;  3TW8 A;  4EBL A;  2RL3 A;  2QWS A;  1T19 A;  2XA7 S;  3D4F A;  4JBF A;  4FTX A;  4UA9 A;  3GR2 A;  3VV4 A;  4D2O A;  1PNE A;  2PT7 A;  4QD4 A;  3M2J A;  4WMC D;  2Q9M A;  2Y2G A;  1L2S A;  2KDK A;  2W3G A;  2VGJ A;  4S2O A;  4LRX C;  4WEJ A;  3G2Z A;  2BAS A;  2PR5 A;  5DF8 A;  3DWZ A;  3NOT C;  4KUK A;  1VEU B;  2ZM2 A;  1VET B;  5JYP A;  3NDG A;  4CQH A;  4Z9Q A;  4HBU A;  1A0K A;  1OTE A;  1VEU A;  3ZG7 B;  1VET A;  1XJ3 A;  3MXQ A;  3BY9 A;  5HAI A;  5E2E A;  3KSH A;  3QP4 A;  2Y2P A;  4DN0 A;  3MQ0 A;  1K4F A;  4ZBE A;  5HPF A;  4RX2 A;  4HBT A;  4P6Z M;  4JGR A;  3IBR A;  3UPO A;  4O0P A;  3FPV A;  1ONH A;  2A2L A;  2PD7 A;  1KDS A;  2IWC A;  4R3J A;  3S4X A;  5FQQ A;  3CUE C;  1EI5 A;  4L9G A;  3ZFZ A;  4NET A;  2G2U A;  4R3B A;  3RXX A;  5D3O A;  5EVL A;  5FQI A;  5AQA A;  1DP6 A;  4S2M A;  2XD1 A;  1QME A;  5DF9 A;  4DRT A;  1UWN X;  4DXC A;  3NC8 A;  4E3O A;  4JGO A;  3NUL A;  4OPR A;  2WKI A;  3E4O A;  4CPK A;  3OLO A;  3ZGA B;  3S22 A;  4JF6 A;  3LUQ A;  2W3F A;  4WMC A;  1NYY A;  4S2J A;  4S2N A;  3CIT A;  2VV6 A;  3LR4 A;  1MXO A;  4DE0 A;  2JBF A;  5F1G A;  1FIK A;  3T1X A;  4JLF A;  4EV4 A;  1GSV A;  2ZC5 B;  4GLQ A;  4ESP A;  4EWF A;  1Z6F A;  2ZL1 B;  5FEG A;  2VLG A;  1K6S A;  4GHI A;  2JKF A;  2PRF A;  4L9E A;  2Y79 A;  5HAR A;  4LV0 A;  3D72 A;  4WZ4 A;  1SCW A;  4BD0 A;  2XRO A;  3KX0 X;  4FOF A;  4P6Z S;  2J7V A;  4WLA A;  2QYB A;  3D9Y A;  2XFT A;  2V8C A;  4FD8 A;  3HLF A;  1FIL A;  1QMF A;  3C4O A;  4RVA A;  3HBR A;  3LR3 A;  4HI4 A;  1XGI A;  4LRZ E;  5FEF A;  5F1F A;  4DDY A;  1O07 A;  4RQ9 A;  1BSG A;  3SS5 A;  4ZJ3 A;  5U47 A;  4MDZ A;  4OH0 A;  2CC1 A;  3C7U A;  1Y28 A;  5HWT A;  3ZG8 B;  1SHV A;  1NYM A;  4MBF A;  4Y3I A;  1FSY A;  2EA9 A;  1XFQ A;  3MJQ A;  3HCY A;  3UMD A;  2PU2 A;  1OJG A;  1YAX A;  5F5Y A;  1P9R A;  5F6A A;  4GNU A;  2P7J A;  2J8Y A;  3RJU A;  4BL3 A;  2D01 A;  4ARZ B;  4WZ5 A;  3CHW P;  3R7W B;  3QP8 A;  4X25 A;  1DJC A;  1SKF A;  3LIC A;  3O87 A;  4ARZ A;  1KGE A;  2ZQC A;  3DTK A;  5E2H A;  2IWB A;  4E6W A;  4UAA A;  3NCK A;  5KZH A;  1ES5 A;  4OON A;  4NXB A;  5HW3 A;  4HH2 A;  3WS0 A;  3UPN A;  2JHE A;  5TBM B;  3N8R A;  2P74 A;  5CRF A;  3QP2 A;  4IVI A;  1KVM A;  4OOY A;  1Q2P A;  3QNC A;  5L10 A;  1ZG4 A;  5TBM A;  1H0M A;  3CG5 A;  5HDD A;  3UE3 A;  3WS4 A;  2EX2 A;  3KSG A;  3DWK A;  4DE2 A;  1BLS A;  1IEM A;  3KYQ A;  2NUT C;  4FH2 A;  5KSC A;  3KSI A;  2GNX A;  3CAX A;  1LL5 A;  4FH4 A;  1KOU A;  2EX6 A;  4DJ2 A;  3F1N B;  4X68 A;  4L9F A;  2VJW A;  1AXB A;  2QPN A;  2W27 A;  5CXW A;  5A91 A;  4OQH A;  3UO9 A;  3F1N A;  4KZ7 A;  3OPR A;  4OQ0 A;  3G4P A;  1ERQ A;  1OTI A;  5HX9 A;  3MXS A;  1O7E A;  2WYX A;  3A3E A;  4HJ4 A;  4IHQ A;  1IYQ A;  5FQJ A;  2JC7 A;  3MFX A;  1L0D A;  3TRC A;  4C3Q A;  1GA9 A;  3OCN A;  4HP4 A;  3GVB A;  2FFF B;  4U0T A;  3FWL A;  5TJJ A;  5G4Y A;  1W63 Q;  3QP5 A;  2PBD P;  1JNU A;  3A3D A;  2Y2M A;  3VSL A;  2ZQD A;  3VOL A;  5HAQ A;  1NZU A;  1HZO A;  5DKK A;  2J3T D;  1CJF A;  1LLB A;  1NLY A;  2ZC3 B;  3ZG5 A;  3WWX A;  1TS0 A;  1NY0 A;  3EWK A;  4ZJ2 A;  5HPI A;  3IXB A;  2P9V B;  3L9K A;  1PWC A;  5L09 A;  3T4J A;  2VV8 A;  5FQ9 A;  1HLU P;  4PM8 A;  3UDI A;  5J8X A;  3S7P A;  2C6W B;  4OPQ A;  4CLC D;  4EEU A;  5IHV A;  5AQ7 A;  3ZQ5 A;  2PYP A;  2ZC6 B;  3M2K A;  4ZTK A;  1XA7 A;  1V9Z A;  5EUA A;  2M1C A;  1GSW A;  1DJB A;  3N6I A;  4LLO B;  5CGW A;  4I5S A;  1BLC A;  2ZBB A;  3DTE A;  2HP6 A;  1S0W A;  1G68 A;  4YWZ A;  4I3A A;  4PAU A;  5F68 A;  1XGJ A;  5TFQ A;  2JKR I;  1PZP A;  1L0F A;  3PXP A;  5FQK A;  3FG8 A;  2DMW A;  1YSP A;  4EUZ A;  1UWP X;  3HLG A;  1K56 D;  2W1R A;  2V9A A;  3PBN A;  3T1R A;  2VGL M;  5J4E A;  5CEC A;  5HAP A;  3NIA A;  1HD8 A;  3Q07 A;  1NLZ A;  2EXB A;  4LPZ A;  1OTB A;  3AGE A;  5AQ9 A;  2ACG A;  2O9A A;  2Z6D A;  2Y2H A;  4Y7P A;  3SZT A;  1NRJ A;  2DNS A;  1ESU A;  3IS2 B;  3UY6 A;  4LV2 A;  5EE8 A;  1PZO A;  4EBP A;  5I94 A;  2V20 A;  3N7W A;  5CTM A;  1KE4 A;  2JKR M;  4QWO A;  5GLC A;  2ZM0 A;  1YLT A;  1LSV A;  5FAT A;  3FV7 A;  5E2F A;  3T4Q A;  1NJ4 A;  1K54 C;  5IU1 A;  2Y59 A;  4UEY A;  4EU0 A;  4CLC B; 
#chains in the Genus database with same CATH homology
 1K57 A;  2ZM2 A;  3GQZ A;  1YM1 A;  5JYP A;  1GA0 A;  1CK3 A;  5GHY A;  3NDG A;  4Z9Q A;  4GB7 A;  3ZDJ A;  1JWP A;  3VOZ A;  4HBU A;  4LV1 A;  2XQZ A;  1K55 A;  1XX2 A;  4DF6 A;  4B4Z A;  1XP4 A;  2Y2L A;  1BTL A;  3ZG7 B;  4MNR A;  3MKF A;  2Y2N A;  3A3J A;  4OLD A;  4WEL A;  5HAI A;  5E2E A;  5TGF A;  3V50 A;  4Y0U A;  1YLW A;  4BD1 A;  4GD8 A;  1K6R A;  3W4O A;  2Y2P A;  2ZLY A;  1K4F A;  4ZBE A;  2Y2I A;  5CHM A;  2G2W A;  2ZQA A;  4RX2 A;  4XUX A;  1H8Y A;  2Q9N A;  4HBT A;  3PAG A;  3TOI A;  2XD5 A;  4L0L A;  3BLM A;  4WZ5 C;  4OP8 A;  2H0T A;  3UPO A;  3GTC A;  1ONH A;  1IKI A;  5EVI B;  1SDN A;  4OOL A;  1KDS A;  2IWC A;  4R3J A;  4GDB A;  3S4X A;  4ZDX A;  4OPY A;  1GHI A;  2P9V A;  2ZM8 A;  5CRF A;  5FQQ A;  4P85 A;  3WS5 A;  1PI4 A;  4R4R A;  1EI5 A;  5F82 A;  3ZNY A;  3MZF A;  3VFF A;  3ZFZ A;  3N4I A;  4OQI A;  3PBO A;  1XPB A;  4NET A;  2G2U A;  1NXY A;  3OPH A;  4R3B A;  3BFD A;  1MWS A;  3RXX A;  5D3O A;  3B3X A;  1W7F A;  4KZ9 A;  2XGN A;  3MBZ A;  5EVL A;  3SH7 A;  1WYC A;  1KGF A;  5FQI A;  4GZB A;  5AQA A;  3NDE A;  3LY4 A;  4PM7 A;  3UE1 A;  4H8R A;  3WRZ A;  4HES A;  5CED A;  3C5A A;  1IYO A;  4S2M A;  4DE3 A;  2XD1 A;  4X69 A;  3PBR A;  1K56 A;  5DTK A;  1QME A;  5DF9 A;  1DJA A;  4DRT A;  3BEB A;  4KEN B;  3IHA A;  5CGS A;  3EQU A;  2QZ6 A;  4K0W A;  1MPL A;  5JYO A;  3LCE A;  4JF4 A;  4DXC A;  3NC8 A;  4E3O A;  2IWD A;  2Y2J A;  5A93 A;  2HP5 A;  2E8I A;  3VP1 A;  3MZD A;  5E2G A;  5EEC A;  4OPR A;  2WKI A;  4N1H A;  4CPK A;  1Q2Q A;  1FR6 A;  4KZ4 A;  3ZGA B;  2Y55 A;  4X56 A;  3S22 A;  4JF6 A;  2V2F F;  4WMC A;  1NYY A;  2OLV A;  4S2J A;  4S2N A;  1VM1 A;  2ZC4 B;  4KZ3 A;  1ZG6 A;  1FQG A;  1MXO A;  1Y54 A;  5GLB A;  4DE0 A;  3SH9 A;  4GKU A;  2JBF A;  4UA7 A;  1FCM A;  1FR1 A;  1CEG A;  2ZMA A;  4O7D A;  5F1G A;  4Y0T A;  2OSU A;  4JLF A;  4EV4 A;  5FAS A;  1E3U A;  1ERM A;  3HRE A;  2ZC5 B;  1W8Q A;  5GLD A;  4LEN A;  4EWF A;  2XF3 A;  1KE0 A;  1Z6F A;  2WGW B;  1G6A A;  2HPB A;  3BLS A;  1YLY A;  3BRM A;  3A3F A;  1K6S A;  4GOG A;  4OOM A;  3LEZ A;  3EQV A;  2H0Y A;  5HAR A;  3G34 A;  4LV0 A;  1ES4 A;  5FQM A;  4LCM A;  4LCL A;  1CI9 A;  4WZ4 A;  1ES2 A;  1SCW A;  2XEP A;  4XXR A;  4BD0 A;  4QJG A;  4Q8I A;  3G2Y A;  2XFS A;  3FKW A;  2WGI A;  1YT4 A;  3G31 A;  4BQM A;  2J7V A;  1OME A;  4MBK A;  2R9W A;  2EXA A;  5KSH A;  2XFT A;  4FD8 A;  1MY8 A;  4QB8 A;  1RGY A;  1PWD A;  4PM9 A;  2ZJ9 A;  3IXG A;  3HLF A;  3HUN A;  3C4O A;  1QMF A;  4RVA A;  2H5S A;  2DCF A;  1RCJ A;  3HBR A;  3BM6 A;  3VP4 A;  1JWV A;  1I2W A;  1PYY A;  3C4P A;  1PIO A;  5EOO A;  3CZD A;  1L0E A;  1XGI A;  3DW0 A;  4BEN A;  5F1F A;  1I5Q A;  4B4X A;  4K0X A;  1LL9 A;  4DDY A;  1O07 A;  3BFC A;  1BSG A;  4QY6 A;  2ZC7 A;  1KDW A;  5GHZ A;  3SS5 A;  3TSG A;  1K57 C;  3PBS A;  4JXG A;  2HDR A;  4ZJ3 A;  3E2K A;  3VP2 A;  5U47 A;  5FSR A;  5KMW A;  2BLS A;  4JPM A;  4OH0 A;  4K91 A;  2CC1 A;  3C7U A;  3SS3 A;  5FAP A;  3AGD A;  2XLN A;  3Q7V B;  5AQB A;  3N8S A;  3VMA A;  3ZG8 B;  3IF6 C;  4E3N A;  1FCN A;  1K54 A;  1KE3 A;  1SHV A;  1ES3 A;  3IF5 A;  4UA6 A;  1NYM A;  3TG9 A;  3VOY A;  4P87 A;  3ISG A;  3BYD A;  3ZNT A;  3G35 A;  4MBF A;  2Y2Q A;  2A3U A;  2WGV A;  5CER A;  1FSY A;  1GHP A;  2OLU A;  3WRT A;  3VSK A;  1YLJ A;  4EQI A;  1WYB A;  4KG6 A;  4NK3 A;  1K38 A;  3ZVW A;  5CEB A;  5A90 A;  5CHU A;  5DF7 A;  2PU2 A;  4C6Y A;  4KZ6 A;  4WBG A;  4GD6 A;  4GNU A;  4JXS A;  2J8Y A;  1CI8 A;  2XDM A;  3G32 A;  3IT9 A;  4YIN A;  3RJU A;  4BL3 A;  1MWU A;  4BLM A;  4C75 A;  5EVI A;  4KG2 A;  3IHB A;  4OP5 A;  3NI9 A;  4JKT A;  4OVD A;  4WZ5 A;  3HUO A;  4BJP A;  4E3L A;  2Z2L B;  4F94 A;  2HP9 A;  2WKH A;  1YLZ A;  1DJC A;  3IQA A;  1SKF A;  5TR7 A;  1TDL A;  1TDG A;  4RYE A;  3O87 A;  3JYI A;  1KGE A;  2ZQC A;  2WK0 A;  5E2H A;  2IWB A;  3RXW A;  1BZA A;  1U60 A;  3NCK A;  4UAA A;  4DE1 A;  1N4O A;  4E6W A;  1W79 A;  1GHM A;  1BUE A;  3UDX A;  2XK1 A;  1ES5 A;  5KZH A;  4IBX A;  4OON A;  4S2K A;  4KQO A;  5M18 A;  1RGZ A;  4S2I A;  5HW3 A;  4FSF A;  1LI0 A;  3VP0 A;  3WS0 A;  3UPN A;  4PM5 A;  4E3I A;  3IWQ A;  2P74 A;  3N8R A;  1IEL A;  4JF5 A;  5DTT A;  1VQQ A;  2H10 A;  2VGK A;  4X55 A;  3S1Y A;  2WKE A;  3DTM A;  1KVM A;  2XR0 A;  3LY3 A;  3OC2 A;  4IVI A;  1TVF A;  3FYZ A;  4OOY A;  2ZQ7 A;  4R0Q A;  3UNW A;  1E4D A;  4BL2 A;  1Q2P A;  3HLD A;  1ONG A;  3QNC A;  2WZX A;  5EOE A;  1ZG4 A;  3MZE A;  4R4S A;  3ZG0 A;  2EX8 A;  2Y91 A;  5FI7 A;  4R1G A;  4U0X A;  4E3K A;  2EFX A;  5F83 A;  2EFU A;  3CG5 A;  2J9P A;  3WS1 A;  4CJN A;  3VP3 A;  3UE3 A;  3GV9 A;  4OLG A;  2I72 A;  1FCO A;  3HLB A;  1PW1 A;  3WS4 A;  1H8Z A;  2PU4 A;  2OV5 A;  2EX2 A;  2JCH A;  3DWK A;  4DE2 A;  1BLS A;  5BOH A;  3ZCZ A;  3ZVT A;  1IEM A;  4N1X A;  1BLP A;  4FH2 A;  4E3J A;  5KSC A;  2Z2M B;  4IVK A;  3BFF A;  1JWZ A;  4GN2 A;  4N9L A;  2RCX A;  1LL5 A;  2X71 A;  4ZAM A;  3V3S A;  3HLE A;  4XUZ A;  4FH4 A;  1K25 A;  3UE0 A;  3Q1F A;  2WGW A;  4X53 A;  3WS2 A;  2EX6 A;  2J9O A;  3HL9 A;  1S6R A;  3QNB A;  2V1Z A;  1CEF A;  1JVJ A;  4X68 A;  1DY6 A;  4KQQ A;  1LI9 A;  4PM6 A;  1ALQ A;  1M6K A;  4OQG A;  1IYS A;  3O86 A;  1AXB A;  2QPN A;  5CXW A;  5A91 A;  3UO9 A;  4OQH A;  3V39 A;  4GDN A;  1IYP A;  4KZ7 A;  3OPR A;  3OPP A;  1YMS A;  3QHY A;  3W4P A;  2HDQ A;  4OQ0 A;  3G4P A;  4JXV A;  3VFH A;  3PAE A;  3ZG9 B;  2B5R A;  1JTG A;  3Q81 A;  1ERQ A;  5FAO A;  3ITA A;  5HX9 A;  5DVA A;  4IBR A;  3MXS A;  1KVL A;  1RP5 A;  1O7E A;  2WYX A;  4QU3 A;  3FKV A;  3A3E A;  1ZC2 A;  2WAF A;  1EWZ A;  2PBY A;  1IYQ A;  5FQJ A;  3PTE A;  4P0M A;  2JC7 A;  3GSG A;  1J9M A;  1L0D A;  5GL9 A;  3BEC A;  4C3Q A;  4QHC A;  1GA9 A;  3OCN A;  5M19 A;  1K55 C;  3A3I A;  1XKZ A;  3GVB A;  4MEZ A;  4JXW A;  2X02 A;  2WAE A;  2FFF B;  1ZKJ A;  3MKE A;  3IF6 B;  4KZ5 A;  1MWR A;  4U0T A;  3FWL A;  1NZO A;  3G30 A;  4E6X A;  2Y4A A;  3NBL A;  3PBT A;  3Q7V A;  1YMX A;  3Q7Z A;  4DDS A;  4U3T A;  4EBN A;  1XXM A;  1PW8 A;  2BG1 A;  3GMW A;  5L2F A;  2QMI A;  3A3D A;  2HDS A;  2Y2M A;  3VSL A;  1N9B A;  2ZQD A;  5HAQ A;  4KZ8 A;  3C7V A;  3IF6 A;  1NZU A;  1HZO A;  3I7J A;  4M3K A;  2X01 A;  1LLB A;  1IKG A;  3AGF A;  3HUM A;  2C5W B;  4DKI A;  3UN7 A;  4E3M A;  4R23 A;  4KZA A;  4WYY A;  4QY5 A;  3V5M A;  5A92 A;  1ERO A;  3BFE A;  3FZC A;  2ZC3 B;  4FCF A;  3IH9 A;  3ZG5 A;  2FFY A;  4Y0O A;  3SOI A;  3WWX A;  1NY0 A;  5DTS A;  2EX9 A;  4ZJ2 A;  3IXB A;  3NY4 A;  1MKI A;  4KG5 A;  2P9V B;  5EVI C;  1PWG A;  1C3B A;  3E2L A;  1I2S A;  2ZQ9 A;  4LV3 A;  4PPR A;  4DXB A;  4ID4 A;  3CMZ A;  1PWC A;  3BFG A;  2HDU A;  4WEK A;  4N9K A;  1L0G A;  1YQS A;  5FQ9 A;  4RX3 A;  1M40 A;  1H5X A;  4PM8 A;  2UWX A;  2WUQ A;  2DRW A;  3UDI A;  5J8X A;  1NRF A;  3ITB A;  5E43 A;  2C6W B;  1K4E A;  2Y2O A;  4OPQ A;  2ZQ8 A;  1FSW A;  5IHV A;  1JTD A;  5HFO A;  3SS4 A;  5AQ7 A;  5HL1 A;  4IED A;  4S2P A;  2ZC6 B;  3HLW A;  3M2K A;  3O3V A;  4ZTK A;  3N8L A;  1GCE A;  4PMA A;  3V3R A;  1WE4 A;  1XA7 A;  2WZZ A;  5EUA A;  1W8Y A;  1DJB A;  3N6I A;  5CGW A;  4S2N C;  2WAD A;  1BLC A;  5EPH A;  4KZB A;  4ZJ1 A;  1BT5 A;  2ZD8 A;  2HP6 A;  1MBL A;  1FOF A;  3P98 A;  1KGG A;  3ZHH A;  2Y2K A;  5M1A A;  5FAQ A;  1XA1 A;  3W4Q A;  1ESI A;  1S0W A;  1YLP A;  3UPP A;  1G68 A;  3CJM A;  2XH9 A;  3IXH A;  2A49 A;  5EVI D;  1XGJ A;  4MLL A;  5TFQ A;  1PZP A;  1L0F A;  1BLH A;  5FQK A;  3IH8 A;  5CHJ A;  3P09 A;  4X6T A;  4KQR A;  3HVF A;  3GRJ A;  4EUZ A;  1HVB A;  3HLG A;  4OPZ A;  3UDF A;  3O88 A;  3PBQ A;  1K56 D;  1PI5 A;  3IWO A;  4S2L A;  3W8K A;  2GDN A;  3PBN A;  1TEM A;  5G18 A;  5GHX A;  4P6B A;  5FA7 A;  1LHY A;  3MXR A;  4UHU A;  5GLA A;  5CEC A;  5HAP A;  4RA7 A;  3SH8 A;  3NIA A;  2JE5 A;  1HD8 A;  3IWI A;  4EBL A;  3Q07 A;  2RL3 A;  3LO7 A;  4A5R A;  3D4F A;  2EXB A;  3OZH A;  4JBF A;  3OCL A;  3AGE A;  5AQ9 A;  3OPL A;  3M6B A;  4UA9 A;  2Y2H A;  4WM9 A;  5CGX A;  5FI6 A;  4B88 A;  4Y7P A;  1E25 A;  3GR2 A;  4D2O A;  2DNS A;  1ESU A;  4QD4 A;  4YFM A;  3UY6 A;  3M2J A;  4LV2 A;  4WMC D;  2Q9M A;  5EE8 A;  5FDH A;  4HEF A;  1PZO A;  4EBP A;  5I94 A;  2V20 A;  3N7W A;  5CTM A;  1KE4 A;  2Y2G A;  1W5D A;  1L2S A;  5CTN A;  3HLC A;  3Q82 A;  5GLC A;  2VGJ A;  4S2O A;  1SDE A;  2ZM0 A;  4WEJ A;  1YLT A;  5FI2 A;  1BUL A;  3IXD A;  3G2Z A;  1HTZ A;  3M6H A;  4OKP A;  5FAT A;  3FV7 A;  5E2F A;  1MWT A;  1NJ4 A;  3MFD A;  1K54 C;  1E3U D;  2R9X A;  2Y59 A;  4N92 A;  3DWZ A;  5DF8 A;  4MBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...