4MBKA

Crystal structure of k234r inhibitor-resistant variant of shv beta-lactamase in complex with sa2-13
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADRTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Penam sulfones and beta-lactamase inhibition: SA2-13 and the importance of the C2 side chain length and composition.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 95
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4mbkA00
3V3RA 4KG6A 4BD1A 1E3UD 3BFEA 4EBPA 5E2HA 2ZQAA 4S2NC 1LHYA 5F82A 5FAQA 3WRTA 4R0QA 1HZOA 2Y2GA 5IHVA 3PAEA 3MXRA 1K54A 4QHCA 5EVID 1M6KA 2EFXA 3P09A 3SH8A 3HVFA 5HFOA 4RX2A 3A3DA 1SKFA 1KDSA 1IYOA 1J9MA 2P74A 4KZ5A 3BFDA 1E4DA 3C7VA 1ES2A 3IF6C 3O87A 3AGDA 4R1GA 4WMCD 2J9OA 1PWGA 3G31A 4Y7PA 4OOLA 2VGKA 4OH0A 4PM9A 1JWPA 4UA9A 3GRJA 3FKWA 2H10A 4N92A 4OOMA 5FQ9A 4IEDA 4U3TA 4E3OA 4BL3A 2VGJA 5FI6A 2WKIA 2HP5A 4E3JA 1K38A 3NDEA 5JYPA 1PW1A 1HVBA 2EFUA 4R3BA 1YM1A 1FCNA 1XXMA 2A3UA 4R4RA 5CRFA 5CGWA 3IHBA 3IHAA 4OKPA 5DF8A 5FQKA 4DDSA 4K0XA 3N7WA 3UE0A 4MBKA 1ESIA 1BUEA 3IXHA 3GMWA 5FDHA 4IVKA 1S0WA 2UWXA 4XUZA 1DJCA 1K6SA 3W4PA 3BYDA 5GLCA 1KE0A 1CI8A 1L2SA 1ES5A 3WS0A 3NI9A 3A3JA 4ZTKA 3D4FA 2ZQCA 1ONHA 5FQQA 1YLYA 3JYIA 1YMXA 5TGFA 3SH9A 3WS5A 3C4PA 2BG1A 1IELA 4LENA 4OP8A 2H0YA 3HLDA 3SS4A 2ZJ9A 1WYCA 2QPNA 3VP0A 2HDSA 3ITAA 1NZUA 2EX6A 4BD0A 3LY3A 3ZVWA 5CGXA 3W4QA 1FOFA 2ZC4B 4KZ9A 4WZ5A 2ZLYA 5HARA 4YFMA 3ZNTA 2DCFA 1K4EA 3O3VA 3IWQA 3DWKA 2G2UA 1FR6A 3QNBA 5CHUA 3BFCA 3PBQA 4JF6A 4S2MA 2X01A 4P87A 2IWBA 4FSFA 3IXDA 3G4PA 2RCXA 4GDBA 4NK3A 2XD1A 2Z2LB 3UN7A 3LEZA 1KGEA 4S2PA 5GL9A 2ZC6B 4JF5A 3S22A 3UDIA 2EX8A 2PBYA 4R23A 2B5RA 5JYOA 4EBLA 5EVIB 4LV1A 1SDEA 1NYMA 1YLZA 1ALQA 2Y2NA 3HLEA 4JXVA 4DE1A 1W8QA 5GLAA 2Y2JA 4E3MA 1XA7A 4E3KA 3V5MA 3Q07A 3HLWA 3O88A 4X53A 1WYBA 5BOHA 3VP2A 3ZG0A 3VP3A 2FFYA 4X69A 3CJMA 4O7DA 1ESUA 3ITBA 4Y0TA 3HUNA 2V1ZA 3BM6A 3VP4A 3ZDJA 3PBSA 1L0DA 2GDNA 5M18A 1EI5A 1YLWA 3HLGA 4X55A 3ZCZA 4UHUA 2Y2LA 3DW0A 4P85A 1TVFA 4KG5A 4R3JA 3MZDA 3WRZA 4U0XA 4WM9A 1K55C 3C5AA 4KQOA 4KQQA 3VFFA 2ZQDA 1MWTA 2WAEA 4OPYA 4RX3A 5DF9A 4X6TA 1FR1A 3DWZA 3HLFA 1EWZA 3Q7VB 4C75A 5E2FA 3NBLA 2V2FF 1TDLA 1GHPA 1QMEA 1AXBA 5J8XA 4QJGA 4HBTA 4LV2A 3B3XA 4S2JA 5U47A 1ZG4A 4GD8A 1LLBA 4GZBA 1E3UA 1N9BA 5KSHA 1BLSA 1YMSA 3ZG7B 5DTTA 3MBZA 1Z6FA 1O7EA 4E6XA 5KSCA 3BFGA 4JKTA 4OQGA 1H5XA 1JTDA 4DE2A 1SCWA 5EVIA 3OZHA 5CEBA 1IYSA 5HAPA 5EPHA 2ZD8A 1GHIA 2XH9A 3UO9A 4P0MA 3SS3A 3IT9A 4ZJ2A 3S4XA 4S2IA 4Z9QA 3RJUA 4WMCA 4JLFA 3VOYA 3N8SA 2OLUA 1RGZA 3UPNA 3E2LA 1PI4A 3IQAA 2P9VB 4MLLA 3AGFA 1K57C 4ZBEA 3NC8A 1JWVA 1PIOA 2JC7A 2ZC5B 4RVAA 4D2OA 5F1GA 4KZBA 2Y91A 4PM5A 2Q9NA 4KZ8A 4X56A 4F94A 2OSUA 2PU2A 2Y2KA 3IF5A 3IF6B 3TG9A 1H8ZA 4DRTA 2XDMA 1XGIA 5DF7A 4Y0UA 4WBGA 3ZG9B 4OLDA 4ID4A 3NY4A 2EXAA 2JCHA 5DVAA 4OPRA 1PI5A 3PTEA 2WAFA 2ZMAA 5F83A 3Q7VA 2XFSA 4ZDXA 2WKHA 5CXWA 3HL9A 4XXRA 1C3BA 1RGYA 1MY8A 4HBUA 4JXSA 2WZXA 1BTLA 3MKEA 2QZ6A 3PBTA 1YQSA 5AQBA 3NIAA 4OQHA 5CECA 2ZM0A 4EBNA 2XK1A 1GCEA 4N9KA 3UY6A 1Q2QA 1Q2PA 4FCFA 1K4FA 1K6RA 1XPBA 1GHMA 1CK3A 2H0TA 5EOOA 3VSKA 2OLVA 4E3LA 1KVMA 1KE4A 4PM7A 2WGWB 4P6BA 4S2NA 2EXBA 5CEDA 3GVBA 4LV3A 2ZQ7A 5KMWA 2Y59A 2P9VA 4DE3A 5KZHA 1KGGA 3G2YA 3A3FA 4BJPA 1MWUA 1KVLA 1BULA 5HL1A 1IKIA 2EX2A 2Y2QA 5AQ9A 1E25A 5TFQA 2HDRA 2HP9A 3V39A 3Q82A 3Q81A 5CHMA 3IF6A 4WELA 3LO7A 3RXWA 1L0FA 2Y2HA 4JXWA 3G32A 1XA1A 2XD5A 3MZEA 4C3QA 5I94A 1G68A 1M40A 1XX2A 2IWCA 3HUMA 3MKFA 1KE3A 3LCEA 1FQGA 2BLSA 1FCOA 3HUOA 5L2FA 4FH4A 1MPLA 4OVDA 4QU3A 2PU4A 1K54C 3M6HA 4OQ0A 2Y2MA 4MEZA 3BRMA 4FH2A 4UAAA 1JWZA 3C4OA 4OOYA 2I72A 1NY0A 1K56D 3UPOA 2A49A 2WGVA 3N8LA 1EROA 2HDUA 4LV0A 1NXYA 2E8IA 3BEBA 2IWDA 4R4SA 1LL9A 5AQAA 3SS5A 1YLPA 1ONGA 2ZM8A 3GQZA 2WKEA 1HTZA 2HPBA 3GSGA 3OCLA 2HP6A 3VOZA 1G6AA 4EV4A 3A3IA 3PBNA 2WGWA 4MNRA 2EX9A 5E2GA 2FFFB 3S1YA 1NYYA 3FWLA 3VFHA 3W8KA 2V20A 2R9WA 3BLSA 1U60A 2WYXA 1W5DA 5FI7A 1PW8A 5CTMA 1I2SA 2JBFA 4KZ7A 2JE5A 4PM6A 3TOIA 3V3SA 3UDXA 1K25A 1MWRA 2XLNA 3G35A 2Y55A 3UPPA 5FA7A 3FYZA 4E6WA 4N9LA 1LL5A 2HDQA 1NJ4A 1N4OA 3M6BA 5FQIA 1L0EA 1HD8A 1FSWA 3CMZA 3Q7ZA 1XGJA 4PM8A 3N8RA 3UDFA 4KQRA 1O07A 3WS4A 4KZ4A 4ZAMA 3ZGAB 1OMEA 2XR0A 1TDGA 2WZZA 2Y4AA 2ZC3B 4IBRA 1W79A 5CERA 5A93A 4OLGA 1IYQA 1XKZA 4DF6A 3ZG8B 1I2WA 3BECA 1FCMA 5M19A 3UE3A 3NDGA 5HW3A 2G2WA 5A92A 5FATA 4OQIA 1NRFA 4S2OA 5EECA 4DDYA 1CEGA 4S2KA 3ISGA 4WZ5C 4NETA 1BLHA 3O86A 3QNCA 5FQJA 1W8YA 4DE0A 1GA9A 5DTKA 1BSGA 4UA7A 4GOGA 5EOEA 4EQIA 1PZPA 5A91A 3OPPA 3WS1A 2XQZA 3W4OA 3N6IA 3V50A 5HAQA 1RCJA 3HLBA 5HX9A 3WWXA 5GHXA 3ZVTA 4Y0OA 2XEPA 4KENB 3FZCA 5CGSA 3IH8A 1JTGA 3RXXA 2H5SA 5FAOA 3EQVA 1DJBA 1CI9A 4K91A 4XUXA 1KGFA 1LI9A 1PWCA 2DRWA 1IKGA 1K55A 4L0LA 4QD4A 4PPRA 2CC1A 3MZFA 4ZJ1A 4RYEA 3UE1A 4B4ZA 3PBOA 2R9XA 3AGEA 4JPMA 1ZG6A 1FSYA 3MFDA 1ERMA 4HEFA 1SHVA 4M3KA 4QY5A 4ZJ3A 4S2LA 3SH7A 1BT5A 2X71A 4MBFA 5D3OA 3Q1FA 4DKIA 4DXCA 3SOIA 5FQMA 1MKIA 3G2ZA 4QB8A 5FASA 2C6WB 1H8YA 1PWDA 4IVIA 3E2KA 4BLMA 1NZOA 4HESA 4JXGA 4GNUA 2XFTA 1MBLA 1S6RA 2C5WB 3IXGA 3IWOA 4GN2A 3VP1A 1ERQA 2ZC7A 5DTSA 5GHZA 5FI2A 3UNWA 2WUQA 4A5RA 2Y2OA 4Q8IA 3QHYA 4GD6A 3ZFZA 3DTMA 5A90A 5EVLA 1DY6A 4OONA 4UA6A 1BLCA 1ZKJA 1LI0A 4U0TA 4MBHA 1IYPA 1WE4A 1ZC2A 4GB7A 4QY6A 2QMIA 2Q9MA 3P98A 4OPQA 1MWSA 1VQQA 4WYYA 1K57A 4CPKA 4BENA 4FD8A 1JVJA 2WGIA 1PYYA 4KZ3A 1L0GA 2XF3A 4WZ4A 4EUZA 1ES3A 2J7VA 2WADA 5EE8A 3ZG5A 3CZDA 1BZAA 3HBRA 1DJAA 3G30A 4WEJA 3A3EA 3BFFA 4DXBA 3IH9A 1XP4A 5EVIC 5TR7A 3FV7A 1BLPA 1CEFA 3BLMA 3OPHA 3TSGA 4B88A 1I5QA 1K56A 4N1HA 4RA7A 1W7FA 4C6YA 5E2EA 1YLTA 2Y2IA 5EUAA 2ZQ9A 4JF4A 3N4IA 3IXBA 3NCKA 4OP5A 3OC2A 5HAIA 4YINA 2OV5A 4KZ6A 4E3NA 2Y2PA 4GKUA 4LCMA 1IEMA 1ES4A 3M2KA 1QMFA 4LCLA 3ZHHA 3WS2A 1SDNA 5FAPA 4BQMA 5E43A 2RL3A 1YLJA 3VMAA 5CTNA 3LY4A 1KDWA 3MXSA 3HREA 3IWIA 2WK0A 3HLCA 4X68A 3OPLA 5M1AA 2ZM2A 4KZAA 4GDNA 2DNSA 2ZQ8A 4WEKA 3OCNA 3CG5A 1RP5A 3FKVA 3M2JA 3VSLA 4H8RA 2J9PA 4JBFA 3C7UA 1GA0A 4OPZA 5FSRA 1PZOA 3PAGA 1TEMA 4IBXA 3ZNYA 5F1FA 3G34A 4E3IA 1Y54A 5GLDA 4BL2A 5AQ7A 4PMAA 3I7JA 4KG2A 2XGNA 2X02A 5CHJA 1VM1A 3GR2A 4B4XA 2Z2MB 3EQUA 4CJNA 5GLBA 1YT4A 3GV9A 4K0WA 5GHYA 4N1XA 5G18A 4EWFA 3GTCA 3OPRA 2J8YA 3PBRA 1MXOA
chains in the Genus database with same CATH superfamily
3V3RA 3TW8A 4O0PA 4BD1A 1E3UD 2PR5A 3SZTA 3K2NA 4S2NC 5F82A 3WRTA 4EUVA 1HZOA 4RQ9A 3PAEA 3MXRA 4QHCA 3SH8A 2E8JA 1SKFA 1E4DA 2BASA 3IF6C 3MS6A 3O87A 1PWGA 3G31A 2EWVA 1F2KA 3CWFA 4OH0A 1MZUA 3GRJA 5IU1A 4EQ1A 3EEAA 4OOMA 4IEDA 1CF0A 3NDEA 5TBMA 1HVBA 2EFUA 4R3BA 1VEUB 4QWOA 5CRFA 5CGWA 4DDSA 4K0XA 5G4ZA 4MBKA 4H6JA 1OJGA 5FDHA 4MN6A 1CI8A 3D4FA 2ZQCA 5FQQA 1YLYA 1YSPA 1YMXA 5TGFA 3WS5A 3C4PA 1P9RA 1LL8A 1DRMA 2ZMVA 3LR4A 4NG2A 2QJ7A 3LY3A 5CGXA 3FG8A 3HJIA 2PHYA 2ZC4B 4G3VA 3ZNTA 4Q0IA 3O3VA 3DWKA 2PT7A 1FR6A 4S2MA 2X01A 4P87A 4EESA 4GDBA 2RCXA 3NECA 2XD1A 3R7WB 3LEZA 1VETA 1NWZA 3F1PA 3S22A 2O9AA 4BBUA 5DKKA 1YLZA 3HLEA 1ALQA 4NKPA 4DE1A 2Y2JA 2W0NA 4E3MA 3V5MA 3ZG0A 4AFIA 4O7DA 2V1ZA 3QP4A 3ZDJA 3PBSA 2GDNA 3CITA 5M18A 3HLGA 4X55A 4MN5A 5TBMB 4KG5A 1TS8A 4R38A 4KQOA 1STZA 2ZQDA 4RX3A 4X6TA 1FR1A 4H6JB 4C75A 3C2WA 3NBLA 4B9OA 1TDLA 5J8XA 4LV2A 1N9BA 3A0VA 4Y13A 1BLSA 4EU0A 3BFGA 4JKTA 3EGDC 4HHDA 1JTDA 3LIAA 5EVIA 3OZHA 5CEBA 4MMNA 3UO9A 4FUWA 4L9EA 5HWVA 4JLFA 2OLUA 2P9VB 4MLLA 3AGFA 3EGXC 1JWVA 2JC7A 1ODVA 2Y91A 4X56A 2PU2A 3IF6B 1X0OA 1XGIA 2XDMA 5DF7A 4Y0UA 2VV7A 1D7EA 4OLDA 3NY4A 4OPRA 2W1TA 3PTEA 5F83A 3Q7VA 4ZDXA 2WKHA 5CXWA 1MY8A 3ICYA 2HF6A 4JXSA 2QZ6A 3PBTA 3T4LA 4CQHA 2ZM0A 4EBNA 2K2NA 1GHMA 1W63M 1CK3A 5EOOA 2XA7M 4E3LA 1KVMA 4P6BA 5HZHA 2J3TD 2ZQ7A 1MWUA 1KVLA 1NRJA 1IKIA 5TFQA 2Y79A 4C3QA 5J4EA 3HUMA 3LCEA 1FQGA 1MPLA 1K54C 2Y2MA 1MC0A 3PHYA 1JWZA 4OOYA 3U4LP 3N8LA 4GCZA 2HDUA 5IS1A 5AQAA 4UQIM 2PYRA 4DMZA 1K0KA 4Y2FA 2HPBA 1OT9A 3C8CA 3VOZA 4EV4A 3A3IA 2WGWA 4XT2A 1SZVA 5E2GA 3FWLA 3VFHA 2V20A 2Z6DA 3U2AA 1P97A 3BY9A 4F3LA 3BJNA 2JBFA 4KZ7A 3V3SA 2HV1A 3E0YA 1N4OA 3CMZA 2JN7A 1XGJA 3UDFA 3N8RA 4I3AA 3ZGAB 5L09A 3UMEA 3MMHA 5A93A 4OLGA 3CUEA 3T4QA 1XKZA 3T4JA 2ZL1B 1J3WA 3UE3A 4DDYA 1YSQA 4S2KA 2D02A 4NETA 3O86A 5FQJA 4FTXA 1GA9A 5DTKA 3QP6A 3FC7A 4GOGA 1S4SA 3WS1A 2O0YA 5HX9A 3LICA 3IH8A 3LI9A 5L8MA 1DJBA 1CI9A 4K91A 4GLQA 2XROA 4QD4A 4RYEA 1T18A 2R9XA 3AGEA 2QHKA 2PD7A 1V9YA 4DXCA 3MJQA 5D3OA 3Q1FA 2HJ9C 3MFXA 2C6WB 4BBTA 1H8YA 4IVIA 3E2KA 1NZOA 3UB6A 5L10A 2FZ0A 2C5WB 1V9ZA 3IXGA 2WUQA 4DJ2A 5EVLA 4UA6A 1TF1A 4OONA 4MBHA 1WE4A 4QY6A 4OPQA 2XA7S 3LIFA 2O9BA 4FD8A 1OPXA 1L0GA 1ACFA 2PDRA 1ES3A 2WADA 3T50A 3G30A 3BFFA 3IH9A 1XP4A 3OPHA 3BLMA 1K56A 4C6YA 3ZQ5A 2ZQ9A 3N4IA 2B18A 2Y2PA 4GKUA 2VX8A 4EETB 3LEQA 4WF0A 1YLJA 5HL6A 5CTNA 3MXSA 2KOIA 3HREA 1OTIA 2P7JA 3HLCA 4X68A 3OPLA 2DNSA 2ZQ8A 3QP2A 4UQIS 1GA0A 1PZOA 3PAGA 4I3IA 4IBXA 3G34A 5GLDA 4BL2A 2P08A 4GS9B 5AQ7A 4HOIA 4BWIA 2XGNA 2Z2MB 3UE6A 4N1XA 5G18A 4EWFA 2JKRI 1MXOA 3H7WA 4EBPA 1YAXA 1LHYA 5FAQA 4R0QA 3P09A 4RX2A 3A3DA 1KDSA 1ZHHB 3FPWA 3CHWP 1ES2A 2AVXA 2J9OA 4PM9A 1JWPA 3FKWA 4N92A 5FQ9A 3CI6A 4E3OA 3E4QA 3H82A 4E3JA 5JYPA 4EEPA 1FILA 1YM1A 1FCNA 1XXMA 2A3UA 3JVVA 3IHAA 4OKPA 5DF8A 3N7WA 3UE0A 1ESIA 1BUEA 2QYBA 4IVKA 1DJCA 3CLOA 1KE0A 1L2SA 3LFVA 3NI9A 3A3JA 1G5UA 2HJEA 1IELA 4LENA 5HWWA 3SS4A 2W3FA 2QPNA 3HJKA 2HDSA 3ITAA 2JHEA 4HI4A 3LR3A 3KSFA 4R70A 4YFMA 3VE4A 2DCFA 1GSVA 1H3QA 3QNBA 5CHUA 1DP6A 3PBQA 2PBDP 2ZOHA 4FSFA 4NK3A 3G4PA 1VEUA 1P0ZA 5FEGA 2ZC6B 4JF5A 2PBYA 5AVFA 4EBLA 3CPTB 1SDEA 4ZRRA 3S7QA 5GLAA 3OOVA 1XA7A 4HIAA 5L07A 1BYWA 1XJ2A 4E3KA 3Q07A 5BOHA 1UWNX 3V67A 3B42A 4Y0TA 3VP4A 1EI5A 1YLWA 3H82B 5FEFA 4UHUA 4P85A 1TVFA 3MZDA 2JKTI 3C5AA 5AVEA 5DF9A 3HLFA 1QMEA 5C5KA 4QJGA 4HBTA 3B3XA 1W63Q 5KSHA 1SKOB 3R7WA 4E6XA 5KSCA 1GSXA 2OWHA 4R3AA 4DE2A 1IYSA 5EPHA 1GHIA 2XH9A 2VA0A 4Z9QA 4WMCA 2W3EA 1RGZA 1PI4A 2INWA 3IQAA 3NC8A 1PIOA 4D2OA 4RVAA 4PM5A 4KZ8A 1Y28A 3F1NB 2ZMFA 3ZG9B 4IHQA 2EXAA 1PI5A 2K7SA 2GZAA 2XFSA 3HL9A 2GJ3A 4O01A 1YQSA 4CLCD 5CECA 4GHIB 2O9CA 3UY6A 4L9FA 4Y17A 1K4FA 4LRYC 1K6RA 1OT6A 1XPBA 3KX0X 5TJJA 4S2NA 2EXBA 5CEDA 5KMWA 2P9VA 1KGGA 3A3FA 3T1XA 1BULA 3D72A 5I5LA 2D01A 1E25A 3GECA 2OAQ1 2HDRA 3T4TA 3KYQA 5CHMA 3IF6A 3G32A 1XA1A 2XD5A 1M40A 1XX2A 3B47A 3HUOA 1FCOA 5L2FA 4FH4A 5F6AA 4QU3A 1S1ZA 4UAAA 3BRMA 2I72A 2A49A 4L9GA 4M4XA 1LSXA 1G28A 2E8IA 2VV8A 2IWDA 4R4SA 4KQDA 3SS5A 1YLPA 1ONGA 1NLZA 5IT5A 4EXOA 2W3GA 3S1YA 4DJ3A 4HQAA 2VKSA 3BLSA 1U60A 1PW8A 3PXPA 4IUKA 3FYZA 4N9LA 1LL5A 5FQIA 1HD8A 4PM8A 3WS4A 4IJGA 2K31A 1OMEA 2XR0A 2WZZA 1W79A 2I9VA 4I5SA 1IYQA 4DF6A 1TS0A 3NDGA 3MQ0A 4IUHA 5A92A 1NRFA 4S2OA 3UB9A 4WZ5C 4DE0A 4HJ4A 2EWWA 2XQZA 3W4OA 5GHXA 1UGUA 3RXXA 4MN7A 2H5SA 5FAOA 4YNRA 3IX8A 5HD5A 4XUXA 2DRWA 3ULFA 5HPIA 1H8MA 4X1LA 4EEUA 4JPMA 2W1RA 1ZG6A 4I3JA 4HEFA 1SHVA 2VLGA 1TS7A 2KX6A 4S2LA 1BT5A 2X71A 4QB8A 2ZL1A 3IX3A 2A2LA 5FASA 1OTAA 3LR0A 4GNUA 1S6RA 3W2ZA 1ERQA 5DTSA 5GHZA 2Z6CA 4KUOA 3BWLA 3LI8A 3ZFZA 5A90A 2PR6A 1BLCA 3A0RA 1MWSA 4CPKA 2WGIA 1PYYA 2DMWA 5EE8A 4BMWA 3DTKA 2WKRA 1BZAA 4NXFA 3C38A 4WEJA 4P6ZM 2QWSA 1OTEA 4B88A 1S66L 4N1HA 1W7FA 3MSHA 4JF4A 4OP5A 1XFNA 4KZ6A 2G7UA 4LCMA 1QMFA 5LBRA 1SDNA 4BQMA 5E43A 2RL3A 3VMAA 3LY4A 2V8FA 3IWIA 2WK0A 2QKPA 1IFQA 4KZAA 1RP5A 3IBJA 3FKVA 3M2JA 3K3DA 3ZNYA 1Y54A 1F5MA 3I7JA 3GR2A 2IA2A 4B4XA 4CJNA 5FDSA 3GV9A 5G4YA 1LSWA 2J8YA 4KG6A 5E2HA 2ZQAA 3OLOA 3NULA 1K54A 1XJ3A 5EVID 1WA9A 5DJUA 1IYOA 1J9MA 2P74A 3S7PA 3BFDA 3C7VA 3RFBA 4R1GA 4PAUA 3BQAA 1KOUA 3EOIA 4Y7PA 2VGKA 1MKMA 4U3TA 2VGJA 2H28A 2WKIA 2HP5A 2WKQA 4WLAA 1L3LA 4GS9A 5FQKA 3BW6A 3GMWA 1S0WA 2UWXA 3W4PA 1H0MA 3WS0A 1UWPX 4ETZA 3LR5A 4UEYA 3JYIA 2BG1A 4OP8A 2H0YA 3HLDA 1WYCA 3EEHA 2EX6A 3ZVWA 3DTIA 5HD3A 5EVEA 2ZLYA 3F1OB 2LB9A 2ZOIA 5HARA 3H9WA 2VJWA 2G2UA 4G3KA 4JF6A 4E04A 3IXDA 2A24B 4S2PA 5DFXA 5K5BA 4ME4A 4R23A 2YKFA 2L4RA 4LV1A 1NYMA 2Y2NA 1G6OA 2P04A 4ETXA 3HLWA 3O88A 4X53A 1WYBA 3VP3A 2FFYA 4X69A 4MDZA 3CJMA 1ESUA 3ITBA 2JKFA 2ZBBA 4U0XA 1K55C 3NJAA 4CLCC 2WAEA 4OPYA 3DWZA 2HGVA 4GZBA 1E3UA 1Z09A 1CJFA 3ZG7B 1Z6FA 2M7UA 1H5XA 3G6OA 3CPTA 1PRQA 2ZD8A 3SS3A 3IT9A 2J3WA 4S2IA 3VOYA 3UPNA 3E2LA 4ZBEA 1K57C 2PD8A 2ZC5B 5F1GA 3LGOA 2V0WA 2Q9NA 2Y2KA 3IF5A 3TG9A 1P9WA 4WBGA 4DN0A 2Y8HA 4ID4A 2QJ5A 3DAVA 2WAFA 1XJ4A 2ZMAA 3OBFA 4PKYA 2GNXA 4WL9A 1F98A 1C3BA 2ACGA 4HY8A 4HBUA 2WZXA 1SKOA 3FPVA 3JPUA 1GCEA 4FOFA 4ARZB 1Q2QA 2V1BA 4FCFA 4JGOA 1DP8A 2OLVA 2V8CA 4PM7A 3GVBA 4LV3A 2Y59A 5KZHA 4DE3A 2Y2QA 4HP9A 5AQ9A 4Z1WA 5CX7A 3LUQA 3V39A 3F1NA 5EV0A 4JXWA 3MZEA 5I94A 5DJTA 2GX5A 1T1BA 2JKGA 2W3DA 3MKFA 1KE3A 2BLSA 3VE3A 4OVDA 2PU4A 3M6HA 4FH2A 3C4OA 1K56D 2WGVA 2KLIA 4GHIA 2V1AA 1F9IA 2W27A 3BEBA 1T1AA 3GSGA 2HP6A 1G6AA 4QPRA 3PBNA 2V9AA 4MNRA 4HH3A 2EX9A 3RTYA 3W8KA 3MR0A 5FI7A 5CTMA 1I2SA 3UDXA 1K25A 5FA7A 4E6WA 1TD5A 2HDQA 3M6BA 4CLCB 2HZ5A 1L0EA 1FSWA 2J3TC 4KQRA 4KZ4A 4HJ3A 1TDGA 2ZC3B 4IBRA 2PYPA 2VGLM 3ZG8B 1I2WA 3BECA 4ESPA 1T19A 4OQIA 5EECA 1CEGA 3KSGA 4X1MA 3O5YA 1BLHA 1W8YA 2JKTM 1A0KA 1BSGA 4UA7A 1PZPA 2KDKA 3OPPA 4D60A 4HNBA 3V50A 5HAQA 3L9KA 1RCJA 5EM0A 5F69A 3FZCA 1IOUA 1JTGA 1IKGA 3IS2B 4L0LA 3UE1A 3PBOA 1VB6A 1FSYA 2NUPC 3MFDA 4QY5A 3LIEA 3SH7A 1JNUA 1MKIA 3G2ZA 3IX4A 4BLMA 4HESA 4JXGA 3VP1A 4LRZE 2XFTA 1MBLA 2ZC7A 3D3OA 4A5RA 4Q8IA 4GD6A 3DTMA 4WUJA 4U0TA 1LI0A 1S1YA 1IYPA 4GB7A 1ZC2A 2XSSA 3E98A 1VQQA 4WYYA 3T4OA 5HPFA 2BTFP 1JVJA 2XF3A 1D06A 4WZ4A 3ZG5A 3CZDA 3A3EA 4DXBA 5EVIC 4Y5FA 3FV7A 4EERA 1I5QA 1OJ5A 4PHTA 4LGWA 2NUTC 3UB5P 3VOLA 4E3NA 1IEMA 1ES4A 4LCLA 3ZHHA 1XJ6A 1KDWA 1S4RA 1S67L 5M1AA 3BQ8A 5EFWA 2R78A 3OCNA 3CG5A 2MJ6A 4JGQA 2J9PA 4JBFA 3C7UA 3TE8A 4OPZA 5FSRA 3KSHA 1TEMA 5F1FA 4E3IA 2OAP1 4PMAA 2X02A 5CHJA 1VM1A 3A0SA 1HLUP 5GLBA 1YT4A 4K0WA 3T1QB 4R6LA 2Q0OA 3OPRA 3P01A 3PBRA 4B93A 3E4OA 3BFEA 4G3WA 4HP4A 2Y2GA 5IHVA 1M6KA 2EFXA 3SW1A 2B02A 2L1MA 3HVFA 5HFOA 4KZ5A 2VGLS 3B33A 3DTEA 4WMCD 3AGDA 4OOLA 4Y15A 4LRXC 4LPZA 4UA9A 2H10A 3LIBA 4BL3A 5FI6A 1K38A 4WN5A 1AWIA 1PW1A 1T1CA 3MXQA 5F5YA 2FH5A 4R4RA 1VETB 3IHBA 3F1PB 1D1JA 3IXHA 4XUZA 1K6SA 3BYDA 5GLCA 1ES5A 4ZTKA 3TRCA 1ONHA 5DKLA 2VEAA 3SH9A 2ZJ9A 5HWTA 3VP0A 3NOPC 4HH2A 4NXBA 1NZUA 4BD0A 2PRFA 3W4QA 1FOFA 4KZ9A 4WZ5A 1K4EA 3IWQA 1FIKA 3BFCA 3CUEC 3KYEA 2IWBA 5AJGA 2Z2LB 3UN7A 1KGEA 5GL9A 3UDIA 5DFYA 2EX8A 4BBVA 2B5RA 5JYOA 2V0UA 1LT0A 4X25A 5EVIB 2VK3A 3DBAA 4JXVA 3D9YA 1W8QA 3JVUA 5HDCA 3TJZC 3VP2A 3GDIA 3UMDA 3HUNA 3BM6A 3R4KA 3UB8A 1L0DA 1LSVA 1NLYA 3ZCZA 4GJ4A 3EWKA 2Y2LA 3DW0A 4CLCE 4R3JA 3WRZA 4WM9A 4LLOB 1CQAA 4KQQA 3VFFA 3F1OA 1MWTA 2W1TB 1YPRA 2UV0E 1EWZA 3Q7VB 5E2FA 2V2FF 1GHPA 1AXBA 4S2JA 5U47A 1N9NA 1ZG4A 4GD8A 1LLBA 4Q0HA 2A24A 5HDSA 1YMSA 5DTTA 3MBZA 1O7EA 2OWJA 3RH8B 5J3WA 4OQGA 1SCWA 5HAPA 4P0MA 3MQOA 4ZJ2A 3L7HA 3S4XA 3RJUA 3N8SA 4YWZA 1XFQA 4KZBA 3IBRA 4LFUA 4F94A 1GSWA 2OSUA 4DRTA 1H8ZA 2JCHA 5DVAA 3KYZA 3K3CA 3E4PA 4XXRA 5J7EA 2B95A 1RGYA 2OOLA 1BTLA 3MKEA 3PR6A 5AQBA 3NIAA 4OQHA 5F68A 3T1SA 5EM1A 2XK1A 4N9KA 1Q2PA 2H0TA 3QP5A 3VSKA 4I38A 1KE4A 2WGWB 4XT2B 4EW7A 3UB7A 5FL3A 3G2YA 4BJPA 3NOUC 5HL1A 2EX2A 4F3LB 2HP9A 3Q82A 3Q81A 3RXWA 4WELA 3LO7A 1L0FA 2Y2HA 2EA9A 1G68A 4Q0JA 4II7A 2IWCA 2VV6A 4OQ0A 4MEZA 4P6ZS 5HSQA 1NY0A 3UPOA 1EROA 2WKPA 4LV0A 1NXYA 2CMNA 4ARZA 1LL9A 3S7NA 3LYXA 2ZM8A 3GQZA 1HTZA 2WKEA 3OCLA 5A8BA 2O99A 2FFFB 1NYYA 1OTDA 2R9WA 4HJ6A 4O8GA 2WYXA 1W5DA 3S7OA 3TOIA 2JE5A 4PM6A 1MWRA 2XLNA 3G35A 2Y55A 3UPPA 5HDDA 1NJ4A 4MCWA 1YKDA 4GW9A 3Q7ZA 1EW0A 1O07A 1DP9A 3QP1A 4ZAMA 3ZYTA 2Y4AA 1VHMA 5CERA 3T4KA 4K08A 3C30A 1FCMA 4JGPA 5M19A 5HW3A 2G2WA 5FATA 1PFLA 4PKYG 3ISGA 3QNCA 5EOEA 4EQIA 5A91A 3MQQA 3N6IA 3HCYA 3HLBA 3WWXA 3ZVTA 4Y0OA 2XEPA 2YKHA 2JKRM 4KENB 5CGSA 3CAXA 4Y3IA 3EQVA 3P7NA 4NEED 1KGFA 1LI9A 1PWCA 1K55A 2PAVP 4CLCA 4PPRA 3VV4A 2LB5A 2CC1A 3MZFA 4ZJ1A 4B4ZA 3BY8A 4I39A 1ERMA 1Y4OA 4M3KA 4ZJ3A 3T1RA 3T12B 2M1CA 4MBFA 4DKIA 4NXEA 3SOIA 3LIDA 5FQMA 1PWDA 2W3HA 4GN2A 3IWOA 1ZTUA 5FI2A 3UNWA 2Y2OA 3QHYA 2XRNA 3NOTC 1TS6A 1DY6A 2L0WA 1N9LA 1ZKJA 3NHQA 3KO6A 2QMIA 2Q9MA 3P98A 3QP8A 1K57A 4BENA 3KSIA 4NXGA 4KZ3A 4YOFA 4EUZA 2J7VA 1PNEA 3HBRA 1DJAA 2J80A 1OTBA 5TR7A 1BLPA 1CEFA 3IS2A 3TSGA 3H7WB 4RA7A 5E2EA 1YLTA 2Y2IA 5EUAA 3IXBA 3NCKA 3PYPA 3OC2A 5HAIA 4YINA 2VZWA 2OV5A 3M2KA 3WS2A 5FAPA 2ZM2A 4GDNA 4WEKA 5MC7A 1N9OA 5KIZA 3VSLA 4H8RA 3T4SA 2M7VA 4JGRA 4KG2A 3MF0A 4KUKA 3EQUA 5GHYA 3GTCA
chains in the Genus database with same CATH topology
3V3RA 4KG6A 4BD1A 1E3UD 3BFEA 4EBPA 5E2HA 2ZQAA 4S2NC 1LHYA 5F82A 5FAQA 3WRTA 4R0QA 1HZOA 2Y2GA 5IHVA 3PAEA 3MXRA 1K54A 4QHCA 5EVID 1M6KA 2EFXA 3P09A 3SH8A 3HVFA 5HFOA 4RX2A 3A3DA 1SKFA 1KDSA 1IYOA 1J9MA 2P74A 4KZ5A 3BFDA 1E4DA 3C7VA 1ES2A 3IF6C 3O87A 3AGDA 4R1GA 4WMCD 2J9OA 1PWGA 3G31A 4Y7PA 4OOLA 2VGKA 4OH0A 4PM9A 1JWPA 4UA9A 3GRJA 3FKWA 2H10A 4N92A 4OOMA 5FQ9A 4IEDA 4U3TA 4E3OA 4BL3A 2VGJA 5FI6A 2WKIA 2HP5A 4E3JA 1K38A 3NDEA 5JYPA 1PW1A 1HVBA 2EFUA 4R3BA 1YM1A 1FCNA 1XXMA 2A3UA 4R4RA 5CRFA 5CGWA 3IHBA 3IHAA 4OKPA 5DF8A 5FQKA 4DDSA 4K0XA 3N7WA 3UE0A 4MBKA 1ESIA 1BUEA 3IXHA 3GMWA 5FDHA 4IVKA 1S0WA 2UWXA 4XUZA 1DJCA 1K6SA 3W4PA 3BYDA 5GLCA 1KE0A 1CI8A 1L2SA 1ES5A 3WS0A 3NI9A 3A3JA 4ZTKA 3D4FA 2ZQCA 1ONHA 5FQQA 1YLYA 3JYIA 1YMXA 5TGFA 3SH9A 3WS5A 3C4PA 2BG1A 1IELA 4LENA 4OP8A 2H0YA 3HLDA 3SS4A 2ZJ9A 1WYCA 2QPNA 3VP0A 2HDSA 3ITAA 1NZUA 2EX6A 4BD0A 3LY3A 3ZVWA 5CGXA 3W4QA 1FOFA 2ZC4B 4KZ9A 4WZ5A 2ZLYA 5HARA 4YFMA 3ZNTA 2DCFA 1K4EA 3O3VA 3IWQA 3DWKA 2G2UA 1FR6A 3QNBA 5CHUA 3BFCA 3PBQA 4JF6A 4S2MA 2X01A 4P87A 2IWBA 4FSFA 3IXDA 3G4PA 2RCXA 4GDBA 4NK3A 2XD1A 2Z2LB 3UN7A 3LEZA 1KGEA 4S2PA 5GL9A 2ZC6B 4JF5A 3S22A 3UDIA 2EX8A 2PBYA 4R23A 2B5RA 5JYOA 4EBLA 5EVIB 4LV1A 1SDEA 1NYMA 1YLZA 1ALQA 2Y2NA 3HLEA 4JXVA 4DE1A 1W8QA 5GLAA 2Y2JA 4E3MA 1XA7A 4E3KA 3V5MA 3Q07A 3HLWA 3O88A 4X53A 1WYBA 5BOHA 3VP2A 3ZG0A 3VP3A 2FFYA 4X69A 3CJMA 4O7DA 1ESUA 3ITBA 4Y0TA 3HUNA 2V1ZA 3BM6A 3VP4A 3ZDJA 3PBSA 1L0DA 2GDNA 5M18A 1EI5A 1YLWA 3HLGA 4X55A 3ZCZA 4UHUA 2Y2LA 3DW0A 4P85A 1TVFA 4KG5A 4R3JA 3MZDA 3WRZA 4U0XA 4WM9A 1K55C 3C5AA 4KQOA 4KQQA 3VFFA 2ZQDA 1MWTA 2WAEA 4OPYA 4RX3A 5DF9A 4X6TA 1FR1A 3DWZA 3HLFA 1EWZA 3Q7VB 4C75A 5E2FA 3NBLA 2V2FF 1TDLA 1GHPA 1QMEA 1AXBA 5J8XA 4QJGA 4HBTA 4LV2A 3B3XA 4S2JA 5U47A 1ZG4A 4GD8A 1LLBA 4GZBA 1E3UA 1N9BA 5KSHA 1BLSA 1YMSA 3ZG7B 5DTTA 3MBZA 1Z6FA 1O7EA 4E6XA 5KSCA 3BFGA 4JKTA 4OQGA 1H5XA 1JTDA 4DE2A 1SCWA 5EVIA 3OZHA 5CEBA 1IYSA 5HAPA 5EPHA 2ZD8A 1GHIA 2XH9A 3UO9A 4P0MA 3SS3A 3IT9A 4ZJ2A 3S4XA 4S2IA 4Z9QA 3RJUA 4WMCA 4JLFA 3VOYA 3N8SA 2OLUA 1RGZA 3UPNA 3E2LA 1PI4A 3IQAA 2P9VB 4MLLA 3AGFA 1K57C 4ZBEA 3NC8A 1JWVA 1PIOA 2JC7A 2ZC5B 4RVAA 4D2OA 5F1GA 4KZBA 2Y91A 4PM5A 2Q9NA 4KZ8A 4X56A 4F94A 2OSUA 2PU2A 2Y2KA 3IF5A 3IF6B 3TG9A 1H8ZA 4DRTA 2XDMA 1XGIA 5DF7A 4Y0UA 4WBGA 3ZG9B 4OLDA 4ID4A 3NY4A 2EXAA 2JCHA 5DVAA 4OPRA 1PI5A 3PTEA 2WAFA 2ZMAA 5F83A 3Q7VA 2XFSA 4ZDXA 2WKHA 5CXWA 3HL9A 4XXRA 1C3BA 1RGYA 1MY8A 4HBUA 4JXSA 2WZXA 1BTLA 3MKEA 2QZ6A 3PBTA 1YQSA 5AQBA 3NIAA 4OQHA 5CECA 2ZM0A 4EBNA 2XK1A 1GCEA 4N9KA 3UY6A 1Q2QA 1Q2PA 4FCFA 1K4FA 1K6RA 1XPBA 1GHMA 1CK3A 2H0TA 5EOOA 3VSKA 2OLVA 4E3LA 1KVMA 1KE4A 4PM7A 2WGWB 4P6BA 4S2NA 2EXBA 5CEDA 3GVBA 4LV3A 2ZQ7A 5KMWA 2Y59A 2P9VA 4DE3A 5KZHA 1KGGA 3G2YA 3A3FA 4BJPA 1MWUA 1KVLA 1BULA 5HL1A 1IKIA 2EX2A 2Y2QA 5AQ9A 1E25A 5TFQA 2HDRA 2HP9A 3V39A 3Q82A 3Q81A 5CHMA 3IF6A 4WELA 3LO7A 3RXWA 1L0FA 2Y2HA 4JXWA 3G32A 1XA1A 2XD5A 3MZEA 4C3QA 5I94A 1G68A 1M40A 1XX2A 2IWCA 3HUMA 3MKFA 1KE3A 3LCEA 1FQGA 2BLSA 1FCOA 3HUOA 5L2FA 4FH4A 1MPLA 4OVDA 4QU3A 2PU4A 1K54C 3M6HA 4OQ0A 2Y2MA 4MEZA 3BRMA 4FH2A 4UAAA 1JWZA 3C4OA 4OOYA 2I72A 1NY0A 1K56D 3UPOA 2A49A 2WGVA 3N8LA 1EROA 2HDUA 4LV0A 1NXYA 2E8IA 3BEBA 2IWDA 4R4SA 1LL9A 5AQAA 3SS5A 1YLPA 1ONGA 2ZM8A 3GQZA 2WKEA 1HTZA 2HPBA 3GSGA 3OCLA 2HP6A 3VOZA 1G6AA 4EV4A 3A3IA 3PBNA 2WGWA 4MNRA 2EX9A 5E2GA 2FFFB 3S1YA 1NYYA 3FWLA 3VFHA 3W8KA 2V20A 2R9WA 3BLSA 1U60A 2WYXA 1W5DA 5FI7A 1PW8A 5CTMA 1I2SA 2JBFA 4KZ7A 2JE5A 4PM6A 3TOIA 3V3SA 3UDXA 1K25A 1MWRA 2XLNA 3G35A 2Y55A 3UPPA 5FA7A 3FYZA 4E6WA 4N9LA 1LL5A 2HDQA 1NJ4A 1N4OA 3M6BA 5FQIA 1L0EA 1HD8A 1FSWA 3CMZA 3Q7ZA 1XGJA 4PM8A 3N8RA 3UDFA 4KQRA 1O07A 3WS4A 4KZ4A 4ZAMA 3ZGAB 1OMEA 2XR0A 1TDGA 2WZZA 2Y4AA 2ZC3B 4IBRA 1W79A 5CERA 5A93A 4OLGA 1IYQA 1XKZA 4DF6A 3ZG8B 1I2WA 3BECA 1FCMA 5M19A 3UE3A 3NDGA 5HW3A 2G2WA 5A92A 5FATA 4OQIA 1NRFA 4S2OA 5EECA 4DDYA 1CEGA 4S2KA 3ISGA 4WZ5C 4NETA 1BLHA 3O86A 3QNCA 5FQJA 1W8YA 4DE0A 1GA9A 5DTKA 1BSGA 4UA7A 4GOGA 5EOEA 4EQIA 1PZPA 5A91A 3OPPA 3WS1A 2XQZA 3W4OA 3N6IA 3V50A 5HAQA 1RCJA 3HLBA 5HX9A 3WWXA 5GHXA 3ZVTA 4Y0OA 2XEPA 4KENB 3FZCA 5CGSA 3IH8A 1JTGA 3RXXA 2H5SA 5FAOA 3EQVA 1DJBA 1CI9A 4K91A 4XUXA 1KGFA 1LI9A 1PWCA 2DRWA 1IKGA 1K55A 4L0LA 4QD4A 4PPRA 2CC1A 3MZFA 4ZJ1A 4RYEA 3UE1A 4B4ZA 3PBOA 2R9XA 3AGEA 4JPMA 1ZG6A 1FSYA 3MFDA 1ERMA 4HEFA 1SHVA 4M3KA 4QY5A 4ZJ3A 4S2LA 3SH7A 1BT5A 2X71A 4MBFA 5D3OA 3Q1FA 4DKIA 4DXCA 3SOIA 5FQMA 1MKIA 3G2ZA 4QB8A 5FASA 2C6WB 1H8YA 1PWDA 4IVIA 3E2KA 4BLMA 1NZOA 4HESA 4JXGA 4GNUA 2XFTA 1MBLA 1S6RA 2C5WB 3IXGA 3IWOA 4GN2A 3VP1A 1ERQA 2ZC7A 5DTSA 5GHZA 5FI2A 3UNWA 2WUQA 4A5RA 2Y2OA 4Q8IA 3QHYA 4GD6A 3ZFZA 3DTMA 5A90A 5EVLA 1DY6A 4OONA 4UA6A 1BLCA 1ZKJA 1LI0A 4U0TA 4MBHA 1IYPA 1WE4A 1ZC2A 4GB7A 4QY6A 2QMIA 2Q9MA 3P98A 4OPQA 1MWSA 1VQQA 4WYYA 1K57A 4CPKA 4BENA 4FD8A 1JVJA 2WGIA 1PYYA 4KZ3A 1L0GA 2XF3A 4WZ4A 4EUZA 1ES3A 2J7VA 2WADA 5EE8A 3ZG5A 3CZDA 1BZAA 3HBRA 1DJAA 3G30A 4WEJA 3A3EA 3BFFA 4DXBA 3IH9A 1XP4A 5EVIC 5TR7A 3FV7A 1BLPA 1CEFA 3BLMA 3OPHA 3TSGA 4B88A 1I5QA 1K56A 4N1HA 4RA7A 1W7FA 4C6YA 5E2EA 1YLTA 2Y2IA 5EUAA 2ZQ9A 4JF4A 3N4IA 3IXBA 3NCKA 4OP5A 3OC2A 5HAIA 4YINA 2OV5A 4KZ6A 4E3NA 2Y2PA 4GKUA 4LCMA 1IEMA 1ES4A 3M2KA 1QMFA 4LCLA 3ZHHA 3WS2A 1SDNA 5FAPA 4BQMA 5E43A 2RL3A 1YLJA 3VMAA 5CTNA 3LY4A 1KDWA 3MXSA 3HREA 3IWIA 2WK0A 3HLCA 4X68A 3OPLA 5M1AA 2ZM2A 4KZAA 4GDNA 2DNSA 2ZQ8A 4WEKA 3OCNA 3CG5A 1RP5A 3FKVA 3M2JA 3VSLA 4H8RA 2J9PA 4JBFA 3C7UA 1GA0A 4OPZA 5FSRA 1PZOA 3PAGA 1TEMA 4IBXA 3ZNYA 5F1FA 3G34A 4E3IA 1Y54A 5GLDA 4BL2A 5AQ7A 4PMAA 3I7JA 4KG2A 2XGNA 2X02A 5CHJA 1VM1A 3GR2A 4B4XA 2Z2MB 3EQUA 4CJNA 5GLBA 1YT4A 3GV9A 4K0WA 5GHYA 4N1XA 5G18A 4EWFA 3GTCA 3OPRA 2J8YA 3PBRA 1MXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V3R A;  4KG6 A;  4BD1 A;  1E3U D;  3BFE A;  4EBP A;  5E2H A;  2ZQA A;  4S2N C;  1LHY A;  5F82 A;  5FAQ A;  3WRT A;  4R0Q A;  1HZO A;  2Y2G A;  5IHV A;  3PAE A;  3MXR A;  1K54 A;  4QHC A;  5EVI D;  1M6K A;  2EFX A;  3P09 A;  3SH8 A;  3HVF A;  5HFO A;  4RX2 A;  3A3D A;  1SKF A;  1KDS A;  1IYO A;  1J9M A;  2P74 A;  4KZ5 A;  3BFD A;  1E4D A;  3C7V A;  1ES2 A;  3IF6 C;  3O87 A;  3AGD A;  4R1G A;  4WMC D;  2J9O A;  1PWG A;  3G31 A;  4Y7P A;  4OOL A;  2VGK A;  4OH0 A;  4PM9 A;  1JWP A;  4UA9 A;  3GRJ A;  3FKW A;  2H10 A;  4N92 A;  4OOM A;  5FQ9 A;  4IED A;  4U3T A;  4E3O A;  4BL3 A;  2VGJ A;  5FI6 A;  2WKI A;  2HP5 A;  4E3J A;  1K38 A;  3NDE A;  5JYP A;  1PW1 A;  1HVB A;  2EFU A;  4R3B A;  1YM1 A;  1FCN A;  1XXM A;  2A3U A;  4R4R A;  5CRF A;  5CGW A;  3IHB A;  3IHA A;  4OKP A;  5DF8 A;  5FQK A;  4DDS A;  4K0X A;  3N7W A;  3UE0 A;  4MBK A;  1ESI A;  1BUE A;  3IXH A;  3GMW A;  5FDH A;  4IVK A;  1S0W A;  2UWX A;  4XUZ A;  1DJC A;  1K6S A;  3W4P A;  3BYD A;  5GLC A;  1KE0 A;  1CI8 A;  1L2S A;  1ES5 A;  3WS0 A;  3NI9 A;  3A3J A;  4ZTK A;  3D4F A;  2ZQC A;  1ONH A;  5FQQ A;  1YLY A;  3JYI A;  1YMX A;  5TGF A;  3SH9 A;  3WS5 A;  3C4P A;  2BG1 A;  1IEL A;  4LEN A;  4OP8 A;  2H0Y A;  3HLD A;  3SS4 A;  2ZJ9 A;  1WYC A;  2QPN A;  3VP0 A;  2HDS A;  3ITA A;  1NZU A;  2EX6 A;  4BD0 A;  3LY3 A;  3ZVW A;  5CGX A;  3W4Q A;  1FOF A;  2ZC4 B;  4KZ9 A;  4WZ5 A;  2ZLY A;  5HAR A;  4YFM A;  3ZNT A;  2DCF A;  1K4E A;  3O3V A;  3IWQ A;  3DWK A;  2G2U A;  1FR6 A;  3QNB A;  5CHU A;  3BFC A;  3PBQ A;  4JF6 A;  4S2M A;  2X01 A;  4P87 A;  2IWB A;  4FSF A;  3IXD A;  3G4P A;  2RCX A;  4GDB A;  4NK3 A;  2XD1 A;  2Z2L B;  3UN7 A;  3LEZ A;  1KGE A;  4S2P A;  5GL9 A;  2ZC6 B;  4JF5 A;  3S22 A;  3UDI A;  2EX8 A;  2PBY A;  4R23 A;  2B5R A;  5JYO A;  4EBL A;  5EVI B;  4LV1 A;  1SDE A;  1NYM A;  1YLZ A;  1ALQ A;  2Y2N A;  3HLE A;  4JXV A;  4DE1 A;  1W8Q A;  5GLA A;  2Y2J A;  4E3M A;  1XA7 A;  4E3K A;  3V5M A;  3Q07 A;  3HLW A;  3O88 A;  4X53 A;  1WYB A;  5BOH A;  3VP2 A;  3ZG0 A;  3VP3 A;  2FFY A;  4X69 A;  3CJM A;  4O7D A;  1ESU A;  3ITB A;  4Y0T A;  3HUN A;  2V1Z A;  3BM6 A;  3VP4 A;  3ZDJ A;  3PBS A;  1L0D A;  2GDN A;  5M18 A;  1EI5 A;  1YLW A;  3HLG A;  4X55 A;  3ZCZ A;  4UHU A;  2Y2L A;  3DW0 A;  4P85 A;  1TVF A;  4KG5 A;  4R3J A;  3MZD A;  3WRZ A;  4U0X A;  4WM9 A;  1K55 C;  3C5A A;  4KQO A;  4KQQ A;  3VFF A;  2ZQD A;  1MWT A;  2WAE A;  4OPY A;  4RX3 A;  5DF9 A;  4X6T A;  1FR1 A;  3DWZ A;  3HLF A;  1EWZ A;  3Q7V B;  4C75 A;  5E2F A;  3NBL A;  2V2F F;  1TDL A;  1GHP A;  1QME A;  1AXB A;  5J8X A;  4QJG A;  4HBT A;  4LV2 A;  3B3X A;  4S2J A;  5U47 A;  1ZG4 A;  4GD8 A;  1LLB A;  4GZB A;  1E3U A;  1N9B A;  5KSH A;  1BLS A;  1YMS A;  3ZG7 B;  5DTT A;  3MBZ A;  1Z6F A;  1O7E A;  4E6X A;  5KSC A;  3BFG A;  4JKT A;  4OQG A;  1H5X A;  1JTD A;  4DE2 A;  1SCW A;  5EVI A;  3OZH A;  5CEB A;  1IYS A;  5HAP A;  5EPH A;  2ZD8 A;  1GHI A;  2XH9 A;  3UO9 A;  4P0M A;  3SS3 A;  3IT9 A;  4ZJ2 A;  3S4X A;  4S2I A;  4Z9Q A;  3RJU A;  4WMC A;  4JLF A;  3VOY A;  3N8S A;  2OLU A;  1RGZ A;  3UPN A;  3E2L A;  1PI4 A;  3IQA A;  2P9V B;  4MLL A;  3AGF A;  1K57 C;  4ZBE A;  3NC8 A;  1JWV A;  1PIO A;  2JC7 A;  2ZC5 B;  4RVA A;  4D2O A;  5F1G A;  4KZB A;  2Y91 A;  4PM5 A;  2Q9N A;  4KZ8 A;  4X56 A;  4F94 A;  2OSU A;  2PU2 A;  2Y2K A;  3IF5 A;  3IF6 B;  3TG9 A;  1H8Z A;  4DRT A;  2XDM A;  1XGI A;  5DF7 A;  4Y0U A;  4WBG A;  3ZG9 B;  4OLD A;  4ID4 A;  3NY4 A;  2EXA A;  2JCH A;  5DVA A;  4OPR A;  1PI5 A;  3PTE A;  2WAF A;  2ZMA A;  5F83 A;  3Q7V A;  2XFS A;  4ZDX A;  2WKH A;  5CXW A;  3HL9 A;  4XXR A;  1C3B A;  1RGY A;  1MY8 A;  4HBU A;  4JXS A;  2WZX A;  1BTL A;  3MKE A;  2QZ6 A;  3PBT A;  1YQS A;  5AQB A;  3NIA A;  4OQH A;  5CEC A;  2ZM0 A;  4EBN A;  2XK1 A;  1GCE A;  4N9K A;  3UY6 A;  1Q2Q A;  1Q2P A;  4FCF A;  1K4F A;  1K6R A;  1XPB A;  1GHM A;  1CK3 A;  2H0T A;  5EOO A;  3VSK A;  2OLV A;  4E3L A;  1KVM A;  1KE4 A;  4PM7 A;  2WGW B;  4P6B A;  4S2N A;  2EXB A;  5CED A;  3GVB A;  4LV3 A;  2ZQ7 A;  5KMW A;  2Y59 A;  2P9V A;  4DE3 A;  5KZH A;  1KGG A;  3G2Y A;  3A3F A;  4BJP A;  1MWU A;  1KVL A;  1BUL A;  5HL1 A;  1IKI A;  2EX2 A;  2Y2Q A;  5AQ9 A;  1E25 A;  5TFQ A;  2HDR A;  2HP9 A;  3V39 A;  3Q82 A;  3Q81 A;  5CHM A;  3IF6 A;  4WEL A;  3LO7 A;  3RXW A;  1L0F A;  2Y2H A;  4JXW A;  3G32 A;  1XA1 A;  2XD5 A;  3MZE A;  4C3Q A;  5I94 A;  1G68 A;  1M40 A;  1XX2 A;  2IWC A;  3HUM A;  3MKF A;  1KE3 A;  3LCE A;  1FQG A;  2BLS A;  1FCO A;  3HUO A;  5L2F A;  4FH4 A;  1MPL A;  4OVD A;  4QU3 A;  2PU4 A;  1K54 C;  3M6H A;  4OQ0 A;  2Y2M A;  4MEZ A;  3BRM A;  4FH2 A;  4UAA A;  1JWZ A;  3C4O A;  4OOY A;  2I72 A;  1NY0 A;  1K56 D;  3UPO A;  2A49 A;  2WGV A;  3N8L A;  1ERO A;  2HDU A;  4LV0 A;  1NXY A;  2E8I A;  3BEB A;  2IWD A;  4R4S A;  1LL9 A;  5AQA A;  3SS5 A;  1YLP A;  1ONG A;  2ZM8 A;  3GQZ A;  2WKE A;  1HTZ A;  2HPB A;  3GSG A;  3OCL A;  2HP6 A;  3VOZ A;  1G6A A;  4EV4 A;  3A3I A;  3PBN A;  2WGW A;  4MNR A;  2EX9 A;  5E2G A;  2FFF B;  3S1Y A;  1NYY A;  3FWL A;  3VFH A;  3W8K A;  2V20 A;  2R9W A;  3BLS A;  1U60 A;  2WYX A;  1W5D A;  5FI7 A;  1PW8 A;  5CTM A;  1I2S A;  2JBF A;  4KZ7 A;  2JE5 A;  4PM6 A;  3TOI A;  3V3S A;  3UDX A;  1K25 A;  1MWR A;  2XLN A;  3G35 A;  2Y55 A;  3UPP A;  5FA7 A;  3FYZ A;  4E6W A;  4N9L A;  1LL5 A;  2HDQ A;  1NJ4 A;  1N4O A;  3M6B A;  5FQI A;  1L0E A;  1HD8 A;  1FSW A;  3CMZ A;  3Q7Z A;  1XGJ A;  4PM8 A;  3N8R A;  3UDF A;  4KQR A;  1O07 A;  3WS4 A;  4KZ4 A;  4ZAM A;  3ZGA B;  1OME A;  2XR0 A;  1TDG A;  2WZZ A;  2Y4A A;  2ZC3 B;  4IBR A;  1W79 A;  5CER A;  5A93 A;  4OLG A;  1IYQ A;  1XKZ A;  4DF6 A;  3ZG8 B;  1I2W A;  3BEC A;  1FCM A;  5M19 A;  3UE3 A;  3NDG A;  5HW3 A;  2G2W A;  5A92 A;  5FAT A;  4OQI A;  1NRF A;  4S2O A;  5EEC A;  4DDY A;  1CEG A;  4S2K A;  3ISG A;  4WZ5 C;  4NET A;  1BLH A;  3O86 A;  3QNC A;  5FQJ A;  1W8Y A;  4DE0 A;  1GA9 A;  5DTK A;  1BSG A;  4UA7 A;  4GOG A;  5EOE A;  4EQI A;  1PZP A;  5A91 A;  3OPP A;  3WS1 A;  2XQZ A;  3W4O A;  3N6I A;  3V50 A;  5HAQ A;  1RCJ A;  3HLB A;  5HX9 A;  3WWX A;  5GHX A;  3ZVT A;  4Y0O A;  2XEP A;  4KEN B;  3FZC A;  5CGS A;  3IH8 A;  1JTG A;  3RXX A;  2H5S A;  5FAO A;  3EQV A;  1DJB A;  1CI9 A;  4K91 A;  4XUX A;  1KGF A;  1LI9 A;  1PWC A;  2DRW A;  1IKG A;  1K55 A;  4L0L A;  4QD4 A;  4PPR A;  2CC1 A;  3MZF A;  4ZJ1 A;  4RYE A;  3UE1 A;  4B4Z A;  3PBO A;  2R9X A;  3AGE A;  4JPM A;  1ZG6 A;  1FSY A;  3MFD A;  1ERM A;  4HEF A;  1SHV A;  4M3K A;  4QY5 A;  4ZJ3 A;  4S2L A;  3SH7 A;  1BT5 A;  2X71 A;  4MBF A;  5D3O A;  3Q1F A;  4DKI A;  4DXC A;  3SOI A;  5FQM A;  1MKI A;  3G2Z A;  4QB8 A;  5FAS A;  2C6W B;  1H8Y A;  1PWD A;  4IVI A;  3E2K A;  4BLM A;  1NZO A;  4HES A;  4JXG A;  4GNU A;  2XFT A;  1MBL A;  1S6R A;  2C5W B;  3IXG A;  3IWO A;  4GN2 A;  3VP1 A;  1ERQ A;  2ZC7 A;  5DTS A;  5GHZ A;  5FI2 A;  3UNW A;  2WUQ A;  4A5R A;  2Y2O A;  4Q8I A;  3QHY A;  4GD6 A;  3ZFZ A;  3DTM A;  5A90 A;  5EVL A;  1DY6 A;  4OON A;  4UA6 A;  1BLC A;  1ZKJ A;  1LI0 A;  4U0T A;  4MBH A;  1IYP A;  1WE4 A;  1ZC2 A;  4GB7 A;  4QY6 A;  2QMI A;  2Q9M A;  3P98 A;  4OPQ A;  1MWS A;  1VQQ A;  4WYY A;  1K57 A;  4CPK A;  4BEN A;  4FD8 A;  1JVJ A;  2WGI A;  1PYY A;  4KZ3 A;  1L0G A;  2XF3 A;  4WZ4 A;  4EUZ A;  1ES3 A;  2J7V A;  2WAD A;  5EE8 A;  3ZG5 A;  3CZD A;  1BZA A;  3HBR A;  1DJA A;  3G30 A;  4WEJ A;  3A3E A;  3BFF A;  4DXB A;  3IH9 A;  1XP4 A;  5EVI C;  5TR7 A;  3FV7 A;  1BLP A;  1CEF A;  3BLM A;  3OPH A;  3TSG A;  4B88 A;  1I5Q A;  1K56 A;  4N1H A;  4RA7 A;  1W7F A;  4C6Y A;  5E2E A;  1YLT A;  2Y2I A;  5EUA A;  2ZQ9 A;  4JF4 A;  3N4I A;  3IXB A;  3NCK A;  4OP5 A;  3OC2 A;  5HAI A;  4YIN A;  2OV5 A;  4KZ6 A;  4E3N A;  2Y2P A;  4GKU A;  4LCM A;  1IEM A;  1ES4 A;  3M2K A;  1QMF A;  4LCL A;  3ZHH A;  3WS2 A;  1SDN A;  5FAP A;  4BQM A;  5E43 A;  2RL3 A;  1YLJ A;  3VMA A;  5CTN A;  3LY4 A;  1KDW A;  3MXS A;  3HRE A;  3IWI A;  2WK0 A;  3HLC A;  4X68 A;  3OPL A;  5M1A A;  2ZM2 A;  4KZA A;  4GDN A;  2DNS A;  2ZQ8 A;  4WEK A;  3OCN A;  3CG5 A;  1RP5 A;  3FKV A;  3M2J A;  3VSL A;  4H8R A;  2J9P A;  4JBF A;  3C7U A;  1GA0 A;  4OPZ A;  5FSR A;  1PZO A;  3PAG A;  1TEM A;  4IBX A;  3ZNY A;  5F1F A;  3G34 A;  4E3I A;  1Y54 A;  5GLD A;  4BL2 A;  5AQ7 A;  4PMA A;  3I7J A;  4KG2 A;  2XGN A;  2X02 A;  5CHJ A;  1VM1 A;  3GR2 A;  4B4X A;  2Z2M B;  3EQU A;  4CJN A;  5GLB A;  1YT4 A;  3GV9 A;  4K0W A;  5GHY A;  4N1X A;  5G18 A;  4EWF A;  3GTC A;  3OPR A;  2J8Y A;  3PBR A;  1MXO A; 
#chains in the Genus database with same CATH topology
 3V3R A;  3TW8 A;  4O0P A;  4BD1 A;  1E3U D;  2PR5 A;  3SZT A;  3K2N A;  4S2N C;  5F82 A;  3WRT A;  4EUV A;  1HZO A;  4RQ9 A;  3PAE A;  3MXR A;  4QHC A;  3SH8 A;  2E8J A;  1SKF A;  1E4D A;  2BAS A;  3IF6 C;  3MS6 A;  3O87 A;  1PWG A;  3G31 A;  2EWV A;  1F2K A;  3CWF A;  4OH0 A;  1MZU A;  3GRJ A;  5IU1 A;  4EQ1 A;  3EEA A;  4OOM A;  4IED A;  1CF0 A;  3NDE A;  5TBM A;  1HVB A;  2EFU A;  4R3B A;  1VEU B;  4QWO A;  5CRF A;  5CGW A;  4DDS A;  4K0X A;  5G4Z A;  4MBK A;  4H6J A;  1OJG A;  5FDH A;  4MN6 A;  1CI8 A;  3D4F A;  2ZQC A;  5FQQ A;  1YLY A;  1YSP A;  1YMX A;  5TGF A;  3WS5 A;  3C4P A;  1P9R A;  1LL8 A;  1DRM A;  2ZMV A;  3LR4 A;  4NG2 A;  2QJ7 A;  3LY3 A;  5CGX A;  3FG8 A;  3HJI A;  2PHY A;  2ZC4 B;  4G3V A;  3ZNT A;  4Q0I A;  3O3V A;  3DWK A;  2PT7 A;  1FR6 A;  4S2M A;  2X01 A;  4P87 A;  4EES A;  4GDB A;  2RCX A;  3NEC A;  2XD1 A;  3R7W B;  3LEZ A;  1VET A;  1NWZ A;  3F1P A;  3S22 A;  2O9A A;  4BBU A;  5DKK A;  1YLZ A;  3HLE A;  1ALQ A;  4NKP A;  4DE1 A;  2Y2J A;  2W0N A;  4E3M A;  3V5M A;  3ZG0 A;  4AFI A;  4O7D A;  2V1Z A;  3QP4 A;  3ZDJ A;  3PBS A;  2GDN A;  3CIT A;  5M18 A;  3HLG A;  4X55 A;  4MN5 A;  5TBM B;  4KG5 A;  1TS8 A;  4R38 A;  4KQO A;  1STZ A;  2ZQD A;  4RX3 A;  4X6T A;  1FR1 A;  4H6J B;  4C75 A;  3C2W A;  3NBL A;  4B9O A;  1TDL A;  5J8X A;  4LV2 A;  1N9B A;  3A0V A;  4Y13 A;  1BLS A;  4EU0 A;  3BFG A;  4JKT A;  3EGD C;  4HHD A;  1JTD A;  3LIA A;  5EVI A;  3OZH A;  5CEB A;  4MMN A;  3UO9 A;  4FUW A;  4L9E A;  5HWV A;  4JLF A;  2OLU A;  2P9V B;  4MLL A;  3AGF A;  3EGX C;  1JWV A;  2JC7 A;  1ODV A;  2Y91 A;  4X56 A;  2PU2 A;  3IF6 B;  1X0O A;  1XGI A;  2XDM A;  5DF7 A;  4Y0U A;  2VV7 A;  1D7E A;  4OLD A;  3NY4 A;  4OPR A;  2W1T A;  3PTE A;  5F83 A;  3Q7V A;  4ZDX A;  2WKH A;  5CXW A;  1MY8 A;  3ICY A;  2HF6 A;  4JXS A;  2QZ6 A;  3PBT A;  3T4L A;  4CQH A;  2ZM0 A;  4EBN A;  2K2N A;  1GHM A;  1W63 M;  1CK3 A;  5EOO A;  2XA7 M;  4E3L A;  1KVM A;  4P6B A;  5HZH A;  2J3T D;  2ZQ7 A;  1MWU A;  1KVL A;  1NRJ A;  1IKI A;  5TFQ A;  2Y79 A;  4C3Q A;  5J4E A;  3HUM A;  3LCE A;  1FQG A;  1MPL A;  1K54 C;  2Y2M A;  1MC0 A;  3PHY A;  1JWZ A;  4OOY A;  3U4L P;  3N8L A;  4GCZ A;  2HDU A;  5IS1 A;  5AQA A;  4UQI M;  2PYR A;  4DMZ A;  1K0K A;  4Y2F A;  2HPB A;  1OT9 A;  3C8C A;  3VOZ A;  4EV4 A;  3A3I A;  2WGW A;  4XT2 A;  1SZV A;  5E2G A;  3FWL A;  3VFH A;  2V20 A;  2Z6D A;  3U2A A;  1P97 A;  3BY9 A;  4F3L A;  3BJN A;  2JBF A;  4KZ7 A;  3V3S A;  2HV1 A;  3E0Y A;  1N4O A;  3CMZ A;  2JN7 A;  1XGJ A;  3UDF A;  3N8R A;  4I3A A;  3ZGA B;  5L09 A;  3UME A;  3MMH A;  5A93 A;  4OLG A;  3CUE A;  3T4Q A;  1XKZ A;  3T4J A;  2ZL1 B;  1J3W A;  3UE3 A;  4DDY A;  1YSQ A;  4S2K A;  2D02 A;  4NET A;  3O86 A;  5FQJ A;  4FTX A;  1GA9 A;  5DTK A;  3QP6 A;  3FC7 A;  4GOG A;  1S4S A;  3WS1 A;  2O0Y A;  5HX9 A;  3LIC A;  3IH8 A;  3LI9 A;  5L8M A;  1DJB A;  1CI9 A;  4K91 A;  4GLQ A;  2XRO A;  4QD4 A;  4RYE A;  1T18 A;  2R9X A;  3AGE A;  2QHK A;  2PD7 A;  1V9Y A;  4DXC A;  3MJQ A;  5D3O A;  3Q1F A;  2HJ9 C;  3MFX A;  2C6W B;  4BBT A;  1H8Y A;  4IVI A;  3E2K A;  1NZO A;  3UB6 A;  5L10 A;  2FZ0 A;  2C5W B;  1V9Z A;  3IXG A;  2WUQ A;  4DJ2 A;  5EVL A;  4UA6 A;  1TF1 A;  4OON A;  4MBH A;  1WE4 A;  4QY6 A;  4OPQ A;  2XA7 S;  3LIF A;  2O9B A;  4FD8 A;  1OPX A;  1L0G A;  1ACF A;  2PDR A;  1ES3 A;  2WAD A;  3T50 A;  3G30 A;  3BFF A;  3IH9 A;  1XP4 A;  3OPH A;  3BLM A;  1K56 A;  4C6Y A;  3ZQ5 A;  2ZQ9 A;  3N4I A;  2B18 A;  2Y2P A;  4GKU A;  2VX8 A;  4EET B;  3LEQ A;  4WF0 A;  1YLJ A;  5HL6 A;  5CTN A;  3MXS A;  2KOI A;  3HRE A;  1OTI A;  2P7J A;  3HLC A;  4X68 A;  3OPL A;  2DNS A;  2ZQ8 A;  3QP2 A;  4UQI S;  1GA0 A;  1PZO A;  3PAG A;  4I3I A;  4IBX A;  3G34 A;  5GLD A;  4BL2 A;  2P08 A;  4GS9 B;  5AQ7 A;  4HOI A;  4BWI A;  2XGN A;  2Z2M B;  3UE6 A;  4N1X A;  5G18 A;  4EWF A;  2JKR I;  1MXO A;  3H7W A;  4EBP A;  1YAX A;  1LHY A;  5FAQ A;  4R0Q A;  3P09 A;  4RX2 A;  3A3D A;  1KDS A;  1ZHH B;  3FPW A;  3CHW P;  1ES2 A;  2AVX A;  2J9O A;  4PM9 A;  1JWP A;  3FKW A;  4N92 A;  5FQ9 A;  3CI6 A;  4E3O A;  3E4Q A;  3H82 A;  4E3J A;  5JYP A;  4EEP A;  1FIL A;  1YM1 A;  1FCN A;  1XXM A;  2A3U A;  3JVV A;  3IHA A;  4OKP A;  5DF8 A;  3N7W A;  3UE0 A;  1ESI A;  1BUE A;  2QYB A;  4IVK A;  1DJC A;  3CLO A;  1KE0 A;  1L2S A;  3LFV A;  3NI9 A;  3A3J A;  1G5U A;  2HJE A;  1IEL A;  4LEN A;  5HWW A;  3SS4 A;  2W3F A;  2QPN A;  3HJK A;  2HDS A;  3ITA A;  2JHE A;  4HI4 A;  3LR3 A;  3KSF A;  4R70 A;  4YFM A;  3VE4 A;  2DCF A;  1GSV A;  1H3Q A;  3QNB A;  5CHU A;  1DP6 A;  3PBQ A;  2PBD P;  2ZOH A;  4FSF A;  4NK3 A;  3G4P A;  1VEU A;  1P0Z A;  5FEG A;  2ZC6 B;  4JF5 A;  2PBY A;  5AVF A;  4EBL A;  3CPT B;  1SDE A;  4ZRR A;  3S7Q A;  5GLA A;  3OOV A;  1XA7 A;  4HIA A;  5L07 A;  1BYW A;  1XJ2 A;  4E3K A;  3Q07 A;  5BOH A;  1UWN X;  3V67 A;  3B42 A;  4Y0T A;  3VP4 A;  1EI5 A;  1YLW A;  3H82 B;  5FEF A;  4UHU A;  4P85 A;  1TVF A;  3MZD A;  2JKT I;  3C5A A;  5AVE A;  5DF9 A;  3HLF A;  1QME A;  5C5K A;  4QJG A;  4HBT A;  3B3X A;  1W63 Q;  5KSH A;  1SKO B;  3R7W A;  4E6X A;  5KSC A;  1GSX A;  2OWH A;  4R3A A;  4DE2 A;  1IYS A;  5EPH A;  1GHI A;  2XH9 A;  2VA0 A;  4Z9Q A;  4WMC A;  2W3E A;  1RGZ A;  1PI4 A;  2INW A;  3IQA A;  3NC8 A;  1PIO A;  4D2O A;  4RVA A;  4PM5 A;  4KZ8 A;  1Y28 A;  3F1N B;  2ZMF A;  3ZG9 B;  4IHQ A;  2EXA A;  1PI5 A;  2K7S A;  2GZA A;  2XFS A;  3HL9 A;  2GJ3 A;  4O01 A;  1YQS A;  4CLC D;  5CEC A;  4GHI B;  2O9C A;  3UY6 A;  4L9F A;  4Y17 A;  1K4F A;  4LRY C;  1K6R A;  1OT6 A;  1XPB A;  3KX0 X;  5TJJ A;  4S2N A;  2EXB A;  5CED A;  5KMW A;  2P9V A;  1KGG A;  3A3F A;  3T1X A;  1BUL A;  3D72 A;  5I5L A;  2D01 A;  1E25 A;  3GEC A;  2OAQ 1;  2HDR A;  3T4T A;  3KYQ A;  5CHM A;  3IF6 A;  3G32 A;  1XA1 A;  2XD5 A;  1M40 A;  1XX2 A;  3B47 A;  3HUO A;  1FCO A;  5L2F A;  4FH4 A;  5F6A A;  4QU3 A;  1S1Z A;  4UAA A;  3BRM A;  2I72 A;  2A49 A;  4L9G A;  4M4X A;  1LSX A;  1G28 A;  2E8I A;  2VV8 A;  2IWD A;  4R4S A;  4KQD A;  3SS5 A;  1YLP A;  1ONG A;  1NLZ A;  5IT5 A;  4EXO A;  2W3G A;  3S1Y A;  4DJ3 A;  4HQA A;  2VKS A;  3BLS A;  1U60 A;  1PW8 A;  3PXP A;  4IUK A;  3FYZ A;  4N9L A;  1LL5 A;  5FQI A;  1HD8 A;  4PM8 A;  3WS4 A;  4IJG A;  2K31 A;  1OME A;  2XR0 A;  2WZZ A;  1W79 A;  2I9V A;  4I5S A;  1IYQ A;  4DF6 A;  1TS0 A;  3NDG A;  3MQ0 A;  4IUH A;  5A92 A;  1NRF A;  4S2O A;  3UB9 A;  4WZ5 C;  4DE0 A;  4HJ4 A;  2EWW A;  2XQZ A;  3W4O A;  5GHX A;  1UGU A;  3RXX A;  4MN7 A;  2H5S A;  5FAO A;  4YNR A;  3IX8 A;  5HD5 A;  4XUX A;  2DRW A;  3ULF A;  5HPI A;  1H8M A;  4X1L A;  4EEU A;  4JPM A;  2W1R A;  1ZG6 A;  4I3J A;  4HEF A;  1SHV A;  2VLG A;  1TS7 A;  2KX6 A;  4S2L A;  1BT5 A;  2X71 A;  4QB8 A;  2ZL1 A;  3IX3 A;  2A2L A;  5FAS A;  1OTA A;  3LR0 A;  4GNU A;  1S6R A;  3W2Z A;  1ERQ A;  5DTS A;  5GHZ A;  2Z6C A;  4KUO A;  3BWL A;  3LI8 A;  3ZFZ A;  5A90 A;  2PR6 A;  1BLC A;  3A0R A;  1MWS A;  4CPK A;  2WGI A;  1PYY A;  2DMW A;  5EE8 A;  4BMW A;  3DTK A;  2WKR A;  1BZA A;  4NXF A;  3C38 A;  4WEJ A;  4P6Z M;  2QWS A;  1OTE A;  4B88 A;  1S66 L;  4N1H A;  1W7F A;  3MSH A;  4JF4 A;  4OP5 A;  1XFN A;  4KZ6 A;  2G7U A;  4LCM A;  1QMF A;  5LBR A;  1SDN A;  4BQM A;  5E43 A;  2RL3 A;  3VMA A;  3LY4 A;  2V8F A;  3IWI A;  2WK0 A;  2QKP A;  1IFQ A;  4KZA A;  1RP5 A;  3IBJ A;  3FKV A;  3M2J A;  3K3D A;  3ZNY A;  1Y54 A;  1F5M A;  3I7J A;  3GR2 A;  2IA2 A;  4B4X A;  4CJN A;  5FDS A;  3GV9 A;  5G4Y A;  1LSW A;  2J8Y A;  4KG6 A;  5E2H A;  2ZQA A;  3OLO A;  3NUL A;  1K54 A;  1XJ3 A;  5EVI D;  1WA9 A;  5DJU A;  1IYO A;  1J9M A;  2P74 A;  3S7P A;  3BFD A;  3C7V A;  3RFB A;  4R1G A;  4PAU A;  3BQA A;  1KOU A;  3EOI A;  4Y7P A;  2VGK A;  1MKM A;  4U3T A;  2VGJ A;  2H28 A;  2WKI A;  2HP5 A;  2WKQ A;  4WLA A;  1L3L A;  4GS9 A;  5FQK A;  3BW6 A;  3GMW A;  1S0W A;  2UWX A;  3W4P A;  1H0M A;  3WS0 A;  1UWP X;  4ETZ A;  3LR5 A;  4UEY A;  3JYI A;  2BG1 A;  4OP8 A;  2H0Y A;  3HLD A;  1WYC A;  3EEH A;  2EX6 A;  3ZVW A;  3DTI A;  5HD3 A;  5EVE A;  2ZLY A;  3F1O B;  2LB9 A;  2ZOI A;  5HAR A;  3H9W A;  2VJW A;  2G2U A;  4G3K A;  4JF6 A;  4E04 A;  3IXD A;  2A24 B;  4S2P A;  5DFX A;  5K5B A;  4ME4 A;  4R23 A;  2YKF A;  2L4R A;  4LV1 A;  1NYM A;  2Y2N A;  1G6O A;  2P04 A;  4ETX A;  3HLW A;  3O88 A;  4X53 A;  1WYB A;  3VP3 A;  2FFY A;  4X69 A;  4MDZ A;  3CJM A;  1ESU A;  3ITB A;  2JKF A;  2ZBB A;  4U0X A;  1K55 C;  3NJA A;  4CLC C;  2WAE A;  4OPY A;  3DWZ A;  2HGV A;  4GZB A;  1E3U A;  1Z09 A;  1CJF A;  3ZG7 B;  1Z6F A;  2M7U A;  1H5X A;  3G6O A;  3CPT A;  1PRQ A;  2ZD8 A;  3SS3 A;  3IT9 A;  2J3W A;  4S2I A;  3VOY A;  3UPN A;  3E2L A;  4ZBE A;  1K57 C;  2PD8 A;  2ZC5 B;  5F1G A;  3LGO A;  2V0W A;  2Q9N A;  2Y2K A;  3IF5 A;  3TG9 A;  1P9W A;  4WBG A;  4DN0 A;  2Y8H A;  4ID4 A;  2QJ5 A;  3DAV A;  2WAF A;  1XJ4 A;  2ZMA A;  3OBF A;  4PKY A;  2GNX A;  4WL9 A;  1F98 A;  1C3B A;  2ACG A;  4HY8 A;  4HBU A;  2WZX A;  1SKO A;  3FPV A;  3JPU A;  1GCE A;  4FOF A;  4ARZ B;  1Q2Q A;  2V1B A;  4FCF A;  4JGO A;  1DP8 A;  2OLV A;  2V8C A;  4PM7 A;  3GVB A;  4LV3 A;  2Y59 A;  5KZH A;  4DE3 A;  2Y2Q A;  4HP9 A;  5AQ9 A;  4Z1W A;  5CX7 A;  3LUQ A;  3V39 A;  3F1N A;  5EV0 A;  4JXW A;  3MZE A;  5I94 A;  5DJT A;  2GX5 A;  1T1B A;  2JKG A;  2W3D A;  3MKF A;  1KE3 A;  2BLS A;  3VE3 A;  4OVD A;  2PU4 A;  3M6H A;  4FH2 A;  3C4O A;  1K56 D;  2WGV A;  2KLI A;  4GHI A;  2V1A A;  1F9I A;  2W27 A;  3BEB A;  1T1A A;  3GSG A;  2HP6 A;  1G6A A;  4QPR A;  3PBN A;  2V9A A;  4MNR A;  4HH3 A;  2EX9 A;  3RTY A;  3W8K A;  3MR0 A;  5FI7 A;  5CTM A;  1I2S A;  3UDX A;  1K25 A;  5FA7 A;  4E6W A;  1TD5 A;  2HDQ A;  3M6B A;  4CLC B;  2HZ5 A;  1L0E A;  1FSW A;  2J3T C;  4KQR A;  4KZ4 A;  4HJ3 A;  1TDG A;  2ZC3 B;  4IBR A;  2PYP A;  2VGL M;  3ZG8 B;  1I2W A;  3BEC A;  4ESP A;  1T19 A;  4OQI A;  5EEC A;  1CEG A;  3KSG A;  4X1M A;  3O5Y A;  1BLH A;  1W8Y A;  2JKT M;  1A0K A;  1BSG A;  4UA7 A;  1PZP A;  2KDK A;  3OPP A;  4D60 A;  4HNB A;  3V50 A;  5HAQ A;  3L9K A;  1RCJ A;  5EM0 A;  5F69 A;  3FZC A;  1IOU A;  1JTG A;  1IKG A;  3IS2 B;  4L0L A;  3UE1 A;  3PBO A;  1VB6 A;  1FSY A;  2NUP C;  3MFD A;  4QY5 A;  3LIE A;  3SH7 A;  1JNU A;  1MKI A;  3G2Z A;  3IX4 A;  4BLM A;  4HES A;  4JXG A;  3VP1 A;  4LRZ E;  2XFT A;  1MBL A;  2ZC7 A;  3D3O A;  4A5R A;  4Q8I A;  4GD6 A;  3DTM A;  4WUJ A;  4U0T A;  1LI0 A;  1S1Y A;  1IYP A;  4GB7 A;  1ZC2 A;  2XSS A;  3E98 A;  1VQQ A;  4WYY A;  3T4O A;  5HPF A;  2BTF P;  1JVJ A;  2XF3 A;  1D06 A;  4WZ4 A;  3ZG5 A;  3CZD A;  3A3E A;  4DXB A;  5EVI C;  4Y5F A;  3FV7 A;  4EER A;  1I5Q A;  1OJ5 A;  4PHT A;  4LGW A;  2NUT C;  3UB5 P;  3VOL A;  4E3N A;  1IEM A;  1ES4 A;  4LCL A;  3ZHH A;  1XJ6 A;  1KDW A;  1S4R A;  1S67 L;  5M1A A;  3BQ8 A;  5EFW A;  2R78 A;  3OCN A;  3CG5 A;  2MJ6 A;  4JGQ A;  2J9P A;  4JBF A;  3C7U A;  3TE8 A;  4OPZ A;  5FSR A;  3KSH A;  1TEM A;  5F1F A;  4E3I A;  2OAP 1;  4PMA A;  2X02 A;  5CHJ A;  1VM1 A;  3A0S A;  1HLU P;  5GLB A;  1YT4 A;  4K0W A;  3T1Q B;  4R6L A;  2Q0O A;  3OPR A;  3P01 A;  3PBR A;  4B93 A;  3E4O A;  3BFE A;  4G3W A;  4HP4 A;  2Y2G A;  5IHV A;  1M6K A;  2EFX A;  3SW1 A;  2B02 A;  2L1M A;  3HVF A;  5HFO A;  4KZ5 A;  2VGL S;  3B33 A;  3DTE A;  4WMC D;  3AGD A;  4OOL A;  4Y15 A;  4LRX C;  4LPZ A;  4UA9 A;  2H10 A;  3LIB A;  4BL3 A;  5FI6 A;  1K38 A;  4WN5 A;  1AWI A;  1PW1 A;  1T1C A;  3MXQ A;  5F5Y A;  2FH5 A;  4R4R A;  1VET B;  3IHB A;  3F1P B;  1D1J A;  3IXH A;  4XUZ A;  1K6S A;  3BYD A;  5GLC A;  1ES5 A;  4ZTK A;  3TRC A;  1ONH A;  5DKL A;  2VEA A;  3SH9 A;  2ZJ9 A;  5HWT A;  3VP0 A;  3NOP C;  4HH2 A;  4NXB A;  1NZU A;  4BD0 A;  2PRF A;  3W4Q A;  1FOF A;  4KZ9 A;  4WZ5 A;  1K4E A;  3IWQ A;  1FIK A;  3BFC A;  3CUE C;  3KYE A;  2IWB A;  5AJG A;  2Z2L B;  3UN7 A;  1KGE A;  5GL9 A;  3UDI A;  5DFY A;  2EX8 A;  4BBV A;  2B5R A;  5JYO A;  2V0U A;  1LT0 A;  4X25 A;  5EVI B;  2VK3 A;  3DBA A;  4JXV A;  3D9Y A;  1W8Q A;  3JVU A;  5HDC A;  3TJZ C;  3VP2 A;  3GDI A;  3UMD A;  3HUN A;  3BM6 A;  3R4K A;  3UB8 A;  1L0D A;  1LSV A;  1NLY A;  3ZCZ A;  4GJ4 A;  3EWK A;  2Y2L A;  3DW0 A;  4CLC E;  4R3J A;  3WRZ A;  4WM9 A;  4LLO B;  1CQA A;  4KQQ A;  3VFF A;  3F1O A;  1MWT A;  2W1T B;  1YPR A;  2UV0 E;  1EWZ A;  3Q7V B;  5E2F A;  2V2F F;  1GHP A;  1AXB A;  4S2J A;  5U47 A;  1N9N A;  1ZG4 A;  4GD8 A;  1LLB A;  4Q0H A;  2A24 A;  5HDS A;  1YMS A;  5DTT A;  3MBZ A;  1O7E A;  2OWJ A;  3RH8 B;  5J3W A;  4OQG A;  1SCW A;  5HAP A;  4P0M A;  3MQO A;  4ZJ2 A;  3L7H A;  3S4X A;  3RJU A;  3N8S A;  4YWZ A;  1XFQ A;  4KZB A;  3IBR A;  4LFU A;  4F94 A;  1GSW A;  2OSU A;  4DRT A;  1H8Z A;  2JCH A;  5DVA A;  3KYZ A;  3K3C A;  3E4P A;  4XXR A;  5J7E A;  2B95 A;  1RGY A;  2OOL A;  1BTL A;  3MKE A;  3PR6 A;  5AQB A;  3NIA A;  4OQH A;  5F68 A;  3T1S A;  5EM1 A;  2XK1 A;  4N9K A;  1Q2P A;  2H0T A;  3QP5 A;  3VSK A;  4I38 A;  1KE4 A;  2WGW B;  4XT2 B;  4EW7 A;  3UB7 A;  5FL3 A;  3G2Y A;  4BJP A;  3NOU C;  5HL1 A;  2EX2 A;  4F3L B;  2HP9 A;  3Q82 A;  3Q81 A;  3RXW A;  4WEL A;  3LO7 A;  1L0F A;  2Y2H A;  2EA9 A;  1G68 A;  4Q0J A;  4II7 A;  2IWC A;  2VV6 A;  4OQ0 A;  4MEZ A;  4P6Z S;  5HSQ A;  1NY0 A;  3UPO A;  1ERO A;  2WKP A;  4LV0 A;  1NXY A;  2CMN A;  4ARZ A;  1LL9 A;  3S7N A;  3LYX A;  2ZM8 A;  3GQZ A;  1HTZ A;  2WKE A;  3OCL A;  5A8B A;  2O99 A;  2FFF B;  1NYY A;  1OTD A;  2R9W A;  4HJ6 A;  4O8G A;  2WYX A;  1W5D A;  3S7O A;  3TOI A;  2JE5 A;  4PM6 A;  1MWR A;  2XLN A;  3G35 A;  2Y55 A;  3UPP A;  5HDD A;  1NJ4 A;  4MCW A;  1YKD A;  4GW9 A;  3Q7Z A;  1EW0 A;  1O07 A;  1DP9 A;  3QP1 A;  4ZAM A;  3ZYT A;  2Y4A A;  1VHM A;  5CER A;  3T4K A;  4K08 A;  3C30 A;  1FCM A;  4JGP A;  5M19 A;  5HW3 A;  2G2W A;  5FAT A;  1PFL A;  4PKY G;  3ISG A;  3QNC A;  5EOE A;  4EQI A;  5A91 A;  3MQQ A;  3N6I A;  3HCY A;  3HLB A;  3WWX A;  3ZVT A;  4Y0O A;  2XEP A;  2YKH A;  2JKR M;  4KEN B;  5CGS A;  3CAX A;  4Y3I A;  3EQV A;  3P7N A;  4NEE D;  1KGF A;  1LI9 A;  1PWC A;  1K55 A;  2PAV P;  4CLC A;  4PPR A;  3VV4 A;  2LB5 A;  2CC1 A;  3MZF A;  4ZJ1 A;  4B4Z A;  3BY8 A;  4I39 A;  1ERM A;  1Y4O A;  4M3K A;  4ZJ3 A;  3T1R A;  3T12 B;  2M1C A;  4MBF A;  4DKI A;  4NXE A;  3SOI A;  3LID A;  5FQM A;  1PWD A;  2W3H A;  4GN2 A;  3IWO A;  1ZTU A;  5FI2 A;  3UNW A;  2Y2O A;  3QHY A;  2XRN A;  3NOT C;  1TS6 A;  1DY6 A;  2L0W A;  1N9L A;  1ZKJ A;  3NHQ A;  3KO6 A;  2QMI A;  2Q9M A;  3P98 A;  3QP8 A;  1K57 A;  4BEN A;  3KSI A;  4NXG A;  4KZ3 A;  4YOF A;  4EUZ A;  2J7V A;  1PNE A;  3HBR A;  1DJA A;  2J80 A;  1OTB A;  5TR7 A;  1BLP A;  1CEF A;  3IS2 A;  3TSG A;  3H7W B;  4RA7 A;  5E2E A;  1YLT A;  2Y2I A;  5EUA A;  3IXB A;  3NCK A;  3PYP A;  3OC2 A;  5HAI A;  4YIN A;  2VZW A;  2OV5 A;  3M2K A;  3WS2 A;  5FAP A;  2ZM2 A;  4GDN A;  4WEK A;  5MC7 A;  1N9O A;  5KIZ A;  3VSL A;  4H8R A;  3T4S A;  2M7V A;  4JGR A;  4KG2 A;  3MF0 A;  4KUK A;  3EQU A;  5GHY A;  3GTC A; 
#chains in the Genus database with same CATH homology
 3V3R A;  4KG6 A;  4BD1 A;  1E3U D;  3BFE A;  4EBP A;  5E2H A;  2ZQA A;  4S2N C;  1LHY A;  5F82 A;  5FAQ A;  3WRT A;  4R0Q A;  1HZO A;  2Y2G A;  5IHV A;  3PAE A;  3MXR A;  1K54 A;  4QHC A;  5EVI D;  1M6K A;  2EFX A;  3P09 A;  3SH8 A;  3HVF A;  5HFO A;  4RX2 A;  3A3D A;  1SKF A;  1KDS A;  1IYO A;  1J9M A;  2P74 A;  4KZ5 A;  3BFD A;  1E4D A;  3C7V A;  1ES2 A;  3IF6 C;  3O87 A;  3AGD A;  4R1G A;  4WMC D;  2J9O A;  1PWG A;  3G31 A;  4Y7P A;  4OOL A;  2VGK A;  4OH0 A;  4PM9 A;  1JWP A;  4UA9 A;  3GRJ A;  3FKW A;  2H10 A;  4N92 A;  4OOM A;  5FQ9 A;  4IED A;  4U3T A;  4E3O A;  4BL3 A;  2VGJ A;  5FI6 A;  2WKI A;  2HP5 A;  4E3J A;  1K38 A;  3NDE A;  5JYP A;  1PW1 A;  1HVB A;  2EFU A;  4R3B A;  1YM1 A;  1FCN A;  1XXM A;  2A3U A;  4R4R A;  5CRF A;  5CGW A;  3IHB A;  3IHA A;  4OKP A;  5DF8 A;  5FQK A;  4DDS A;  4K0X A;  3N7W A;  3UE0 A;  4MBK A;  1ESI A;  1BUE A;  3IXH A;  3GMW A;  5FDH A;  4IVK A;  1S0W A;  2UWX A;  4XUZ A;  1DJC A;  1K6S A;  3W4P A;  3BYD A;  5GLC A;  1KE0 A;  1CI8 A;  1L2S A;  1ES5 A;  3WS0 A;  3NI9 A;  3A3J A;  4ZTK A;  3D4F A;  2ZQC A;  1ONH A;  5FQQ A;  1YLY A;  3JYI A;  1YMX A;  5TGF A;  3SH9 A;  3WS5 A;  3C4P A;  2BG1 A;  1IEL A;  4LEN A;  4OP8 A;  2H0Y A;  3HLD A;  3SS4 A;  2ZJ9 A;  1WYC A;  2QPN A;  3VP0 A;  2HDS A;  3ITA A;  1NZU A;  2EX6 A;  4BD0 A;  3LY3 A;  3ZVW A;  5CGX A;  3W4Q A;  1FOF A;  2ZC4 B;  4KZ9 A;  4WZ5 A;  2ZLY A;  5HAR A;  4YFM A;  3ZNT A;  2DCF A;  1K4E A;  3O3V A;  3IWQ A;  3DWK A;  2G2U A;  1FR6 A;  3QNB A;  5CHU A;  3BFC A;  3PBQ A;  4JF6 A;  4S2M A;  2X01 A;  4P87 A;  2IWB A;  4FSF A;  3IXD A;  3G4P A;  2RCX A;  4GDB A;  4NK3 A;  2XD1 A;  2Z2L B;  3UN7 A;  3LEZ A;  1KGE A;  4S2P A;  5GL9 A;  2ZC6 B;  4JF5 A;  3S22 A;  3UDI A;  2EX8 A;  2PBY A;  4R23 A;  2B5R A;  5JYO A;  4EBL A;  5EVI B;  4LV1 A;  1SDE A;  1NYM A;  1YLZ A;  1ALQ A;  2Y2N A;  3HLE A;  4JXV A;  4DE1 A;  1W8Q A;  5GLA A;  2Y2J A;  4E3M A;  1XA7 A;  4E3K A;  3V5M A;  3Q07 A;  3HLW A;  3O88 A;  4X53 A;  1WYB A;  5BOH A;  3VP2 A;  3ZG0 A;  3VP3 A;  2FFY A;  4X69 A;  3CJM A;  4O7D A;  1ESU A;  3ITB A;  4Y0T A;  3HUN A;  2V1Z A;  3BM6 A;  3VP4 A;  3ZDJ A;  3PBS A;  1L0D A;  2GDN A;  5M18 A;  1EI5 A;  1YLW A;  3HLG A;  4X55 A;  3ZCZ A;  4UHU A;  2Y2L A;  3DW0 A;  4P85 A;  1TVF A;  4KG5 A;  4R3J A;  3MZD A;  3WRZ A;  4U0X A;  4WM9 A;  1K55 C;  3C5A A;  4KQO A;  4KQQ A;  3VFF A;  2ZQD A;  1MWT A;  2WAE A;  4OPY A;  4RX3 A;  5DF9 A;  4X6T A;  1FR1 A;  3DWZ A;  3HLF A;  1EWZ A;  3Q7V B;  4C75 A;  5E2F A;  3NBL A;  2V2F F;  1TDL A;  1GHP A;  1QME A;  1AXB A;  5J8X A;  4QJG A;  4HBT A;  4LV2 A;  3B3X A;  4S2J A;  5U47 A;  1ZG4 A;  4GD8 A;  1LLB A;  4GZB A;  1E3U A;  1N9B A;  5KSH A;  1BLS A;  1YMS A;  3ZG7 B;  5DTT A;  3MBZ A;  1Z6F A;  1O7E A;  4E6X A;  5KSC A;  3BFG A;  4JKT A;  4OQG A;  1H5X A;  1JTD A;  4DE2 A;  1SCW A;  5EVI A;  3OZH A;  5CEB A;  1IYS A;  5HAP A;  5EPH A;  2ZD8 A;  1GHI A;  2XH9 A;  3UO9 A;  4P0M A;  3SS3 A;  3IT9 A;  4ZJ2 A;  3S4X A;  4S2I A;  4Z9Q A;  3RJU A;  4WMC A;  4JLF A;  3VOY A;  3N8S A;  2OLU A;  1RGZ A;  3UPN A;  3E2L A;  1PI4 A;  3IQA A;  2P9V B;  4MLL A;  3AGF A;  1K57 C;  4ZBE A;  3NC8 A;  1JWV A;  1PIO A;  2JC7 A;  2ZC5 B;  4RVA A;  4D2O A;  5F1G A;  4KZB A;  2Y91 A;  4PM5 A;  2Q9N A;  4KZ8 A;  4X56 A;  4F94 A;  2OSU A;  2PU2 A;  2Y2K A;  3IF5 A;  3IF6 B;  3TG9 A;  1H8Z A;  4DRT A;  2XDM A;  1XGI A;  5DF7 A;  4Y0U A;  4WBG A;  3ZG9 B;  4OLD A;  4ID4 A;  3NY4 A;  2EXA A;  2JCH A;  5DVA A;  4OPR A;  1PI5 A;  3PTE A;  2WAF A;  2ZMA A;  5F83 A;  3Q7V A;  2XFS A;  4ZDX A;  2WKH A;  5CXW A;  3HL9 A;  4XXR A;  1C3B A;  1RGY A;  1MY8 A;  4HBU A;  4JXS A;  2WZX A;  1BTL A;  3MKE A;  2QZ6 A;  3PBT A;  1YQS A;  5AQB A;  3NIA A;  4OQH A;  5CEC A;  2ZM0 A;  4EBN A;  2XK1 A;  1GCE A;  4N9K A;  3UY6 A;  1Q2Q A;  1Q2P A;  4FCF A;  1K4F A;  1K6R A;  1XPB A;  1GHM A;  1CK3 A;  2H0T A;  5EOO A;  3VSK A;  2OLV A;  4E3L A;  1KVM A;  1KE4 A;  4PM7 A;  2WGW B;  4P6B A;  4S2N A;  2EXB A;  5CED A;  3GVB A;  4LV3 A;  2ZQ7 A;  5KMW A;  2Y59 A;  2P9V A;  4DE3 A;  5KZH A;  1KGG A;  3G2Y A;  3A3F A;  4BJP A;  1MWU A;  1KVL A;  1BUL A;  5HL1 A;  1IKI A;  2EX2 A;  2Y2Q A;  5AQ9 A;  1E25 A;  5TFQ A;  2HDR A;  2HP9 A;  3V39 A;  3Q82 A;  3Q81 A;  5CHM A;  3IF6 A;  4WEL A;  3LO7 A;  3RXW A;  1L0F A;  2Y2H A;  4JXW A;  3G32 A;  1XA1 A;  2XD5 A;  3MZE A;  4C3Q A;  5I94 A;  1G68 A;  1M40 A;  1XX2 A;  2IWC A;  3HUM A;  3MKF A;  1KE3 A;  3LCE A;  1FQG A;  2BLS A;  1FCO A;  3HUO A;  5L2F A;  4FH4 A;  1MPL A;  4OVD A;  4QU3 A;  2PU4 A;  1K54 C;  3M6H A;  4OQ0 A;  2Y2M A;  4MEZ A;  3BRM A;  4FH2 A;  4UAA A;  1JWZ A;  3C4O A;  4OOY A;  2I72 A;  1NY0 A;  1K56 D;  3UPO A;  2A49 A;  2WGV A;  3N8L A;  1ERO A;  2HDU A;  4LV0 A;  1NXY A;  2E8I A;  3BEB A;  2IWD A;  4R4S A;  1LL9 A;  5AQA A;  3SS5 A;  1YLP A;  1ONG A;  2ZM8 A;  3GQZ A;  2WKE A;  1HTZ A;  2HPB A;  3GSG A;  3OCL A;  2HP6 A;  3VOZ A;  1G6A A;  4EV4 A;  3A3I A;  3PBN A;  2WGW A;  4MNR A;  2EX9 A;  5E2G A;  2FFF B;  3S1Y A;  1NYY A;  3FWL A;  3VFH A;  3W8K A;  2V20 A;  2R9W A;  3BLS A;  1U60 A;  2WYX A;  1W5D A;  5FI7 A;  1PW8 A;  5CTM A;  1I2S A;  2JBF A;  4KZ7 A;  2JE5 A;  4PM6 A;  3TOI A;  3V3S A;  3UDX A;  1K25 A;  1MWR A;  2XLN A;  3G35 A;  2Y55 A;  3UPP A;  5FA7 A;  3FYZ A;  4E6W A;  4N9L A;  1LL5 A;  2HDQ A;  1NJ4 A;  1N4O A;  3M6B A;  5FQI A;  1L0E A;  1HD8 A;  1FSW A;  3CMZ A;  3Q7Z A;  1XGJ A;  4PM8 A;  3N8R A;  3UDF A;  4KQR A;  1O07 A;  3WS4 A;  4KZ4 A;  4ZAM A;  3ZGA B;  1OME A;  2XR0 A;  1TDG A;  2WZZ A;  2Y4A A;  2ZC3 B;  4IBR A;  1W79 A;  5CER A;  5A93 A;  4OLG A;  1IYQ A;  1XKZ A;  4DF6 A;  3ZG8 B;  1I2W A;  3BEC A;  1FCM A;  5M19 A;  3UE3 A;  3NDG A;  5HW3 A;  2G2W A;  5A92 A;  5FAT A;  4OQI A;  1NRF A;  4S2O A;  5EEC A;  4DDY A;  1CEG A;  4S2K A;  3ISG A;  4WZ5 C;  4NET A;  1BLH A;  3O86 A;  3QNC A;  5FQJ A;  1W8Y A;  4DE0 A;  1GA9 A;  5DTK A;  1BSG A;  4UA7 A;  4GOG A;  5EOE A;  4EQI A;  1PZP A;  5A91 A;  3OPP A;  3WS1 A;  2XQZ A;  3W4O A;  3N6I A;  3V50 A;  5HAQ A;  1RCJ A;  3HLB A;  5HX9 A;  3WWX A;  5GHX A;  3ZVT A;  4Y0O A;  2XEP A;  4KEN B;  3FZC A;  5CGS A;  3IH8 A;  1JTG A;  3RXX A;  2H5S A;  5FAO A;  3EQV A;  1DJB A;  1CI9 A;  4K91 A;  4XUX A;  1KGF A;  1LI9 A;  1PWC A;  2DRW A;  1IKG A;  1K55 A;  4L0L A;  4QD4 A;  4PPR A;  2CC1 A;  3MZF A;  4ZJ1 A;  4RYE A;  3UE1 A;  4B4Z A;  3PBO A;  2R9X A;  3AGE A;  4JPM A;  1ZG6 A;  1FSY A;  3MFD A;  1ERM A;  4HEF A;  1SHV A;  4M3K A;  4QY5 A;  4ZJ3 A;  4S2L A;  3SH7 A;  1BT5 A;  2X71 A;  4MBF A;  5D3O A;  3Q1F A;  4DKI A;  4DXC A;  3SOI A;  5FQM A;  1MKI A;  3G2Z A;  4QB8 A;  5FAS A;  2C6W B;  1H8Y A;  1PWD A;  4IVI A;  3E2K A;  4BLM A;  1NZO A;  4HES A;  4JXG A;  4GNU A;  2XFT A;  1MBL A;  1S6R A;  2C5W B;  3IXG A;  3IWO A;  4GN2 A;  3VP1 A;  1ERQ A;  2ZC7 A;  5DTS A;  5GHZ A;  5FI2 A;  3UNW A;  2WUQ A;  4A5R A;  2Y2O A;  4Q8I A;  3QHY A;  4GD6 A;  3ZFZ A;  3DTM A;  5A90 A;  5EVL A;  1DY6 A;  4OON A;  4UA6 A;  1BLC A;  1ZKJ A;  1LI0 A;  4U0T A;  4MBH A;  1IYP A;  1WE4 A;  1ZC2 A;  4GB7 A;  4QY6 A;  2QMI A;  2Q9M A;  3P98 A;  4OPQ A;  1MWS A;  1VQQ A;  4WYY A;  1K57 A;  4CPK A;  4BEN A;  4FD8 A;  1JVJ A;  2WGI A;  1PYY A;  4KZ3 A;  1L0G A;  2XF3 A;  4WZ4 A;  4EUZ A;  1ES3 A;  2J7V A;  2WAD A;  5EE8 A;  3ZG5 A;  3CZD A;  1BZA A;  3HBR A;  1DJA A;  3G30 A;  4WEJ A;  3A3E A;  3BFF A;  4DXB A;  3IH9 A;  1XP4 A;  5EVI C;  5TR7 A;  3FV7 A;  1BLP A;  1CEF A;  3BLM A;  3OPH A;  3TSG A;  4B88 A;  1I5Q A;  1K56 A;  4N1H A;  4RA7 A;  1W7F A;  4C6Y A;  5E2E A;  1YLT A;  2Y2I A;  5EUA A;  2ZQ9 A;  4JF4 A;  3N4I A;  3IXB A;  3NCK A;  4OP5 A;  3OC2 A;  5HAI A;  4YIN A;  2OV5 A;  4KZ6 A;  4E3N A;  2Y2P A;  4GKU A;  4LCM A;  1IEM A;  1ES4 A;  3M2K A;  1QMF A;  4LCL A;  3ZHH A;  3WS2 A;  1SDN A;  5FAP A;  4BQM A;  5E43 A;  2RL3 A;  1YLJ A;  3VMA A;  5CTN A;  3LY4 A;  1KDW A;  3MXS A;  3HRE A;  3IWI A;  2WK0 A;  3HLC A;  4X68 A;  3OPL A;  5M1A A;  2ZM2 A;  4KZA A;  4GDN A;  2DNS A;  2ZQ8 A;  4WEK A;  3OCN A;  3CG5 A;  1RP5 A;  3FKV A;  3M2J A;  3VSL A;  4H8R A;  2J9P A;  4JBF A;  3C7U A;  1GA0 A;  4OPZ A;  5FSR A;  1PZO A;  3PAG A;  1TEM A;  4IBX A;  3ZNY A;  5F1F A;  3G34 A;  4E3I A;  1Y54 A;  5GLD A;  4BL2 A;  5AQ7 A;  4PMA A;  3I7J A;  4KG2 A;  2XGN A;  2X02 A;  5CHJ A;  1VM1 A;  3GR2 A;  4B4X A;  2Z2M B;  3EQU A;  4CJN A;  5GLB A;  1YT4 A;  3GV9 A;  4K0W A;  5GHY A;  4N1X A;  5G18 A;  4EWF A;  3GTC A;  3OPR A;  2J8Y A;  3PBR A;  1MXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...