4MBKA

Crystal structure of k234r inhibitor-resistant variant of shv beta-lactamase in complex with sa2-13
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADRTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase SHV-1
publication title Penam sulfones and beta-lactamase inhibition: SA2-13 and the importance of the C2 side chain length and composition.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 95
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4mbkA00
2JC7A 3OPHA 4E3IA 4QU3A 2J7VA 2ZC6B 4KG6A 1ALQA 1RGZA 3LCEA 1N4OA 2B5RA 5FSRA 3IF5A 3SS4A 3IF6C 3IHAA 3V50A 1YMSA 3FWLA 1HD8A 4DDYA 4S2MA 4DXCA 1LL5A 1M6KA 1XP4A 2HDRA 1MBLA 3FYZA 4U0XA 5GHZA 4WBGA 1L0EA 3HVFA 4E3JA 4YINA 1PWGA 3LEZA 3FZCA 1JWVA 3C4OA 3HUOA 2Y4AA 4GNUA 4LV3A 2WZZA 4KZ3A 1NJ4A 4E6WA 3IWOA 4ZDXA 4X69A 4IVIA 2QMIA 5EVLA 1G68A 4EBLA 4E3NA 3NC8A 4KZ8A 3UE0A 1NZUA 1LL9A 5E43A 3V5MA 4GKUA 2PU4A 4S2NC 5AQ7A 5HAIA 3VFFA 4PM5A 3MXRA 5A92A 2P9VA 4OONA 5EE8A 3DTMA 3UNWA 2Q9MA 2Y59A 4ZJ2A 1IKGA 1HZOA 4JXSA 1W8QA 4P85A 2A3UA 1NY0A 4K0XA 4RX2A 3DWKA 3UN7A 1KGGA 1MXOA 3N8RA 4JBFA 1N9BA 4KZ5A 1ERQA 4KG5A 3WS4A 2QZ6A 4PMAA 4OP8A 1K38A 2Y2PA 5A93A 3UDXA 2GDNA 4R3BA 4KZ4A 5CTNA 3IF6A 1K6RA 3G31A 1FR6A 4Y0UA 4HESA 4N1XA 5CXWA 2XDMA 2XD5A 4OPYA 4R4SA 3IXDA 3V39A 4R3JA 4KZ9A 5I94A 2JCHA 2OLUA 4IEDA 4PM9A 2X02A 1RGYA 4OOMA 3JYIA 3C5AA 2ZQDA 1SCWA 4DRTA 4FSFA 2C6WB 4JXGA 4LV2A 5CRFA 3GV9A 3VP2A 2BLSA 3BFCA 2EXBA 5L2FA 1ES2A 1I2WA 1MWSA 3N8LA 1K57A 2X01A 1TEMA 1L0FA 5JYOA 3VP4A 5EVIB 3OCLA 1K25A 1KVLA 1JTDA 3O86A 4P87A 4E3OA 2EX2A 3NIAA 5DTSA 3Q7ZA 5DF9A 3UPPA 5CEDA 2Q9NA 5KSHA 3VP1A 3SOIA 4N9KA 3WS5A 5F83A 1K56D 3ZG7B 4QHCA 2HP6A 4RX3A 4EV4A 1WYBA 2DCFA 1DY6A 2Y2NA 5TR7A 4OPZA 3VP3A 3P98A 2WGWB 4OQHA 1K56A 5E2EA 5TGFA 1I2SA 1CI9A 4LCMA 3G34A 5GL9A 4S2KA 1FOFA 2ZQ8A 1WE4A 4GD8A 4KZAA 4GB7A 1BSGA 1RCJA 1ES4A 2ZQ9A 1XX2A 3IHBA 3N7WA 3NBLA 2RL3A 4R1GA 3Q81A 1PW8A 3OC2A 3VSLA 5FQKA 2WKHA 2DRWA 4BLMA 2Y55A 5EUAA 1ERMA 1O07A 4R23A 4OLGA 3ZCZA 1S0WA 3TG9A 3HLDA 3HREA 3W4QA 4WMCD 3E2LA 1K54C 5HL1A 2EFUA 3PAGA 1K55A 4B4ZA 4YFMA 3PBQA 5J8XA 1ESUA 1G6AA 4JF5A 1GCEA 4B4XA 3ZG5A 1ESIA 4MEZA 3HLBA 4WMCA 1BLCA 1MPLA 4S2IA 4U3TA 2ZC4B 5AQ9A 5CGXA 3ZNYA 4BL2A 3O87A 4WEKA 4RVAA 4DF6A 5A91A 1IEMA 3Q1FA 4KQRA 5EVIC 1E3UD 3HLGA 3SH7A 4GD6A 4QY6A 1SKFA 1CEGA 2WADA 5GLCA 4EBNA 3ZVTA 2QPNA 3G30A 5CGWA 3GRJA 3IQAA 1H8YA 1BLSA 3A3DA 4R4RA 4RA7A 3W4PA 4IVKA 1SDEA 5FI2A 3WWXA 5FAOA 1LHYA 1AXBA 4QB8A 4OH0A 4X6TA 5GLDA 4OP5A 3SH8A 1EI5A 3GSGA 4KZ7A 4ZJ3A 5JYPA 4C6YA 1YM1A 4FH2A 3Q07A 4DE0A 4R0QA 4EBPA 1YT4A 1PYYA 2XFTA 4Y7PA 3BM6A 1GA9A 1NRFA 3HLEA 4ID4A 1FR1A 4WZ4A 3A3JA 1JWZA 2ZC7A 3OPLA 5CTMA 5GHXA 3GMWA 3A3FA 2VGJA 3GR2A 3WS1A 1CI8A 2G2WA 2OLVA 3BLSA 3RXWA 2EX6A 4ZJ1A 4FD8A 4P0MA 1IYQA 1I5QA 2WKIA 5DTTA 1KDWA 3D4FA 3PBSA 5EVID 1ES5A 3S1YA 2XK1A 1JVJA 1HTZA 1YLTA 1ZKJA 3CJMA 1XPBA 1MWTA 3VOZA 1DJCA 3OPRA 4S2PA 3VSKA 3TSGA 5BOHA 1FCOA 3HLCA 4GOGA 1H8ZA 4LV1A 5EVIA 1YLWA 2R9XA 1XA1A 3IXGA 4A5RA 5F82A 4D2OA 3RJUA 2Y2GA 5HW3A 2P74A 1FCNA 1ZG6A 3EQUA 4E3MA 1BTLA 1PZOA 1FQGA 4EWFA 4Q8IA 3BECA 5F1FA 4MBFA 2I72A 1Q2PA 2J9PA 2ZC5B 1KDSA 1KVMA 5M1AA 5DF8A 4PM6A 1S6RA 4CPKA 4GN2A 3WS2A 5GLBA 1K6SA 4KZ6A 5F1GA 3FKVA 1NYMA 4Z9QA 5HX9A 3SS3A 1IELA 2WGWA 2PU2A 4EUZA 5EOOA 3PAEA 4Y0TA 5AQAA 4OPQA 4BQMA 1EROA 4NETA 5HFOA 3HBRA 1JWPA 1XGJA 2JE5A 4KENB 2Y2OA 4N9LA 4S2NA 2PBYA 1M40A 1MWRA 1XXMA 3IXBA 2ZJ9A 5TFQA 4KQQA 5A90A 1VM1A 3MXSA 3MZFA 1PWCA 2P9VB 2XH9A 5KZHA 1NYYA 1YLYA 3IXHA 1LI0A 4X68A 4PPRA 1TVFA 4U0TA 2HDQA 1BT5A 2Y2LA 4LV0A 1TDGA 2E8IA 1PIOA 2XLNA 4M3KA 4QD4A 1BLHA 2HPBA 1PI4A 3G32A 3UE3A 3MFDA 1XKZA 4WM9A 2ZD8A 4C3QA 3Q7VB 1YQSA 4JXWA 4PM7A 3V3RA 4IBRA 2WYXA 3MZEA 5DVAA 4X55A 5GHYA 3QNBA 4DE2A 1DJAA 3VFHA 4C75A 3WRTA 1FCMA 3TOIA 4WELA 1SHVA 3OZHA 5IHVA 3ZDJA 1DJBA 4QJGA 4ZTKA 2OSUA 4DKIA 3M6BA 2Z2LB 4K0WA 4WYYA 4F94A 4KG2A 5HARA 1J9MA 3N8SA 3MBZA 2EX8A 3WS0A 2R9WA 4P6BA 4OQIA 3S4XA 1ZG4A 3BFGA 1WYCA 2Y91A 4UA7A 3IH8A 2OV5A 3UO9A 3NDEA 1CK3A 3GVBA 1H5XA 2Y2HA 4OKPA 1ONHA 2ZQ7A 4RYEA 1RP5A 4S2JA 1HVBA 5GLAA 3UDFA 1KE0A 4E3LA 1E3UA 1KE3A 2V2FF 4XUZA 3N6IA 1KGFA 3AGEA 2IWDA 1BUEA 4BENA 2Y2QA 5M19A 1SDNA 4E3KA 3G35A 4JXVA 2HDSA 5FQIA 1LI9A 1GHIA 1XA7A 1JTGA 5U47A 3VOYA 5FI6A 4JF4A 4MBKA 1KE4A 4NK3A 4O7DA 2BG1A 2EXAA 3VMAA 2ZQAA 2XQZA 2C5WB 4CJNA 2XGNA 4LENA 3WRZA 2CC1A 1K54A 4S2LA 3A3IA 4FCFA 2WZXA 3UDIA 3UPOA 1KGEA 3E2KA 3C7UA 2FFYA 3N4IA 4HBUA 5FA7A 1CEFA 3HL9A 3BFFA 5CGSA 4UHUA 1BULA 3CG5A 3Q82A 4BD1A 4DDSA 1K4EA 3HLWA 5FAPA 4PM8A 5CECA 3S22A 3PBTA 1K4FA 2EFXA 4QY5A 5E2FA 2Y2MA 4X53A 5DF7A 2XF3A 2V1ZA 3GTCA 1K57C 3MKFA 2ZM0A 1MWUA 3O88A 4GZBA 3IWQA 3OCNA 2IWBA 3OPPA 4XXRA 2ZC3B 3HLFA 5FI7A 3W4OA 3PTEA 3FKWA 1W7FA 2HDUA 1GA0A 2ZMAA 2ZM2A 4HEFA 4IBXA 3M2KA 4N92A 4BJPA 1O7EA 1Z6FA 2H5SA 3SS5A 4UAAA 4WZ5C 2HP5A 2EX9A 3HUMA 1L2SA 3V3SA 2WUQA 1IYSA 1L0DA 1YLPA 3EQVA 3LO7A 4GDNA 4BD0A 5CEBA 5HAQA 5KSCA 3UPNA 1W79A 1ES3A 1IKIA 1PZPA 2WGIA 3G2ZA 4JLFA 3I7JA 3BRMA 5D3OA 1U60A 2ZLYA 4OOYA 5CHMA 4JF6A 1PWDA 3BFEA 1L0GA 3M6HA 4S2OA 4WEJA 1GHMA 4GDBA 3HUNA 1LLBA 5EPHA 3Q7VA 4B88A 3ZG9B 2WKEA 2JBFA 3QNCA 2Y2KA 4MLLA 3ZVWA 3PBNA 4K91A 2XD1A 3NY4A 3FV7A 5FQMA 4LCLA 1ONGA 1QMFA 2VGKA 2H10A 4OOLA 4XUXA 5E2GA 5KMWA 1E25A 2J8YA 3ZGAB 4UA9A 3O3VA 4DE1A 3SH9A 2XEPA 1C3BA 5FAQA 3LY3A 4JKTA 1PI5A 1MY8A 4EQIA 1K55C 2J9OA 3LY4A 3MZDA 2G2UA 1E4DA 3AGDA 2FFFB 2RCXA 3ISGA 3ZHHA 4MBHA 4JPMA 3ZG8B 4DXBA 2WK0A 1YLJA 3BFDA 3ZG0A 3IF6B 4DE3A 3PBRA 1VQQA 3DWZA 1W8YA 2UWXA 4WZ5A 3W8KA 5E2HA 2Z2MB 2IWCA 3ZNTA 1TDLA 4OQGA 2H0YA 3GQZA 1IYPA 2ZQCA 3BLMA 5CERA 4BL3A 4ZBEA 5CHJA 3C7VA 1FSYA 3MKEA 4FH4A 3PBOA 3RXXA 4X56A 3BEBA 4OVDA 2ZM8A 1W5DA 3CMZA 5FQ9A 3DW0A 5M18A 5G18A 3ITBA 4N1HA 1Y54A 1BZAA 3M2JA 4H8RA 5AQBA 3ZFZA 3G2YA 1QMEA 2H0TA 3AGFA 4MNRA 4UA6A 1NZOA 1IYOA 4KQOA 3C4PA 4KZBA 1EWZA 4E6XA 5HAPA 3UY6A 4OPRA 2Y2IA 3NCKA 5EOEA 5DTKA 3IT9A 4HBTA 1Q2QA 2WGVA 3NI9A 1FSWA 2HP9A 3ITAA 3P09A 5FDHA 5FASA 3QHYA 3B3XA 4OLDA 4OQ0A 2XR0A 3BYDA 2Y2JA 3IWIA 3VP0A 5CHUA 1BLPA 1NXYA 3G4PA 3UE1A 1ZC2A 4L0LA 2WAFA 2X71A 1XGIA 2V20A 1MKIA 1PW1A 4ZAMA 5FQJA 2DNSA 5FATA 2WAEA 3NDGA 1YMXA 5EECA 3IH9A 1GHPA 1YLZA 2XFSA 3A3EA 3CZDA 2A49A 1OMEA 4Y0OA 5FQQA
chains in the Genus database with same CATH superfamily
1KOUA 2JC7A 5L10A 1STZA 3KSGA 1RGZA 3LCEA 1D1JA 2B5RA 3SS4A 3V50A 4HNBA 3FWLA 4DDYA 4DXCA 1OTDA 5GHZA 1G6OA 1JWVA 5C5KA 4HH2A 4E6WA 5EVLA 4PKYG 2ZL1B 4KZ8A 2W1TA 1LL9A 5E43A 5HAIA 2M7UA 4AFIA 2Y59A 3RTYA 1IKGA 2G7UA 2W3FA 2A3UA 4RX2A 3DWKA 4JBFA 3R4KA 1SKOA 4KG5A 4X25A 2FZ0A 2QZ6A 2YKFA 4OP8A 2Y2PA 3UDXA 3LR0A 2K7SA 4B9OA 1FR6A 4F3LA 4Y0UA 4KUKA 2YKHA 1S1YA 5LBRA 3IXDA 4R3JA 2VKSA 4MN6A 3PR6A 3DTKA 1VB6A 4CLCD 2ZQDA 2L4RA 3BFCA 2EXBA 1I2WA 1S4SA 4CLCA 2QJ7A 1ACFA 4ME4A 4E3OA 4P87A 2EX2A 5CEDA 5TBMB 2OWHA 2VV6A 3ZG7B 1TS6A 2B95A 2WKPA 4EV4A 2V1AA 4OPZA 2WGWB 3IBJA 2INWA 4KZAA 2O9AA 2ZQ9A 1RCJA 3N7WA 2RL3A 4R1GA 3NECA 3VSLA 2DRWA 3HJKA 1ERMA 4WMCD 1K54C 5F5YA 3IS2A 4MEZA 5HL6A 4WMCA 1BLCA 2KDKA 4U3TA 5AQ9A 4NKPA 1IEMA 2ZMFA 3Q1FA 4KQRA 5EVIC 1P9RA 2W27A 3UE6A 4GD6A 2WADA 1CEGA 1YAXA 3ZVTA 5AVEA 3IQAA 4R4RA 1LHYA 1EI5A 3MR0A 3CAXA 3Q07A 1YT4A 1PYYA 2XFTA 3BM6A 3SZTA 4WZ4A 1JWZA 2JKRI 3H7WB 3A3FA 2G2WA 3EWKA 3UB7A 3KYZA 4P0MA 1KDWA 3D4FA 3PBSA 2O9CA 4LRYC 3MQQA 3VOZA 3TSGA 4I39A 4LV1A 4GOGA 5HPIA 4D2OA 5HW3A 3EQUA 1ZG6A 2PDRA 3DBAA 1PZOA 2D02A 1FQGA 1YKDA 2I72A 1PNEA 1T19A 1KVMA 1S6RA 4GN2A 3WS2A 1TS0A 5GLBA 1AWIA 2ZOIA 4DJ2A 1K6SA 3FKVA 4Y0TA 1S1ZA 4OPQA 3HBRA 1JWPA 4S2NA 2PBYA 1MWRA 4KQQA 3IBRA 5IT5A 2K2NA 2GNXA 1VM1A 5EFWA 3S7OA 2P9VB 4X68A 1LI0A 2QJ5A 5HDSA 1TVFA 2OOLA 2HDQA 4B93A 1TDGA 2E8IA 2XSSA 4WLAA 1NLYA 3HJIA 4Y15A 3VOLA 1H0MA 5L07A 3G32A 3UE3A 3MFDA 4PHTA 2A24B 1YQSA 1V9ZA 3MXQA 3F1OB 3MZEA 1PFLA 1DJAA 3VFHA 4C75A 3TOIA 1H3QA 1DJBA 4DKIA 4K0WA 1OTEA 1OTAA 1ZG4A 2OV5A 3EGXC 3A0VA 1H5XA 3R7WA 1ONHA 2ZQ7A 4S2JA 1RP5A 4Y13A 5L09A 1E3UA 4XUZA 1KGFA 4EQ1A 3S7PA 4BENA 3D9YA 5M19A 4JXVA 4L9EA 2WKQA 3NOTC 5CX7A 2ZQAA 1T1BA 2CC1A 2VEAA 1MC0A 3A3IA 4FCFA 3UDIA 3E2KA 5FA7A 2LB5A 1BULA 3CG5A 4DDSA 4BD1A 1GSWA 1TD5A 5CECA 1WA9A 3PBTA 2PBDP 2EFXA 3H82B 1MWUA 3O88A 4CLCC 3IWQA 3OPPA 4BBUA 5TBMA 3C30A 4HEFA 3UB6A 1L2SA 4BD0A 3LO7A 5KSCA 1ES3A 4NEED 1D7EA 2WGIA 3TE8A 4JF6A 3BFEA 3ZQ5A 4S2OA 1VEUA 2W1TB 2WKEA 2Y2KA 3LIDA 3NY4A 1QMFA 2H10A 3LYXA 2J8YA 5FAQA 1T1CA 1PI5A 1SKOB 4Y2FA 1E4DA 4DXBA 3ZHHA 2EWWA 4DE3A 1VQQA 4FOFA 2JN7A 4F3LB 4WZ5A 5E2HA 1TDLA 4OQGA 4X1LA 5FL3A 3GQZA 5CERA 3MKEA 1LL8A 4X56A 1OTIA 2J3TD 4I5SA 5G18A 3LEQA 1W63Q 4H8RA 3EGDC 4MNRA 4CLCB 5J3WA 4KQOA 3C4PA 5F68A 4EW7A 3VV4A 3IT9A 4HBTA 3NI9A 1T18A 5FDHA 5I5LA 3QHYA 3CITA 2Y2JA 3G4PA 3UE1A 1ZC2A 1FIKA 2WAFA 2X71A 1XGIA 2A2LA 5FATA 1A0KA 1GHPA 2P04A 3LR5A 2XFSA 5FI7A 1OMEA 4QU3A 4E04A 3IF5A 3IF6C 3T4LA 1M6KA 3FYZA 3IS2B 4E3JA 4YINA 3LEZA 2J3WA 4H6JA 4LV3A 3IWOA 4X69A 4IVIA 1G68A 4BMWA 3NC8A 3UE0A 2B18A 4S2NC 5A92A 2P9VA 3IX3A 3DTMA 3T1XA 1HZOA 4JXSA 1NY0A 1K38A 2GDNA 4KZ4A 3G31A 2XA7S 4HESA 1UGUA 3K3DA 2W3DA 3V39A 5I94A 3C8CA 2OLUA 1RGYA 3DTEA 1YSQA 1SCWA 4DRTA 4JXGA 4NXBA 5EVEA 1TS8A 5L2FA 1OTBA 1N9OA 2BASA 2HF6A 3N8LA 3OCLA 1JTDA 2Q9NA 3U2AA 3WS5A 5F83A 4Q0JA 4RX3A 1WYBA 1DY6A 5TR7A 1XJ4A 2VK3A 1F2KA 4OQHA 5TGFA 1CI9A 3CLOA 3G34A 5GL9A 1FOFA 4GD8A 1P97A 1ES4A 3T50A 3MFXA 2OWJA 3OC2A 2PR6A 2WKHA 2Y55A 3F1PA 3FC7A 3HREA 3E2LA 3PBQA 1ESUA 5EM0A 1G6AA 4JF5A 4WUJA 2O0YA 5CGXA 2UV0E 4RVAA 3H82A 1F98A 3SH7A 4QY6A 5GLCA 3U4LP 3OOVA 1S66L 1H8YA 4RA7A 4QB8A 5GLDA 1LSXA 4OP5A 4KZ7A 2P08A 1YM1A 4LFUA 3OLOA 2M7VA 3HLEA 4ID4A 3TRCA 5GHXA 3GMWA 2VGJA 1CI8A 2OLVA 3R7WB 2VA0A 1IYQA 1I5QA 2WKIA 3S1YA 3T4SA 1JVJA 1YLTA 4HJ6A 5BOHA 3QP2A 3HLCA 2R9XA 3L9KA 5F82A 3PHYA 3MSHA 3UB8A 2Y2GA 1FCNA 4E3MA 1BTLA 2V8CA 4Q8IA 2J9PA 2ZC5B 4I3AA 5DF8A 4PM6A 4ETXA 4KZ6A 4JGPA 1FILA 5EOOA 5AQAA 5HFOA 4IHQA 1XGJA 3V67A 4HJ3A 4KENB 2Y2OA 4N9LA 3B33A 3LI8A 4GLQA 3IXBA 4JGRA 2J3TC 3MXSA 5MC7A 5IS1A 5KZHA 1NYYA 3D3OA 2Z6CA 4Y3IA 2Y2LA 4LV0A 2K31A 4M3KA 4ZRRA 5DJTA 2HPBA 4YNRA 4WM9A 3EEAA 1VEUB 4PM7A 3LUQA 3V3RA 2WYXA 4X55A 3QNBA 3WRTA 1FCMA 4WELA 1SHVA 4QJGA 4IUKA 5HWTA 2OSUA 4EEUA 3M6BA 4EU0A 1OT6A 4F94A 1J9MA 3N8SA 3MBZA 3WS0A 2XA7M 4P6BA 4OQIA 4ARZA 2Y91A 3UO9A 2HV1A 1YSPA 4RYEA 1HVBA 5GLAA 3UDFA 2HZ5A 3G35A 4LGWA 1LI9A 5FI6A 4JF4A 3VMAA 2C5WB 2XGNA 4LENA 2MJ6A 2QHKA 4S2LA 4Y17A 1KGEA 2NUPC 3N4IA 4HBUA 1CEFA 3HL9A 4UHUA 1K4EA 3BY9A 3HLWA 3S22A 5L8MA 5E2FA 2Y2MA 4X53A 2XF3A 2V1ZA 3GTCA 1IOUA 3GDIA 2VLGA 1MZUA 3OCNA 3W4OA 3BJNA 1W7FA 1GA0A 3M2KA 4N92A 4BJPA 1Z6FA 3SS5A 4UAAA 2V9AA 2WUQA 5HWVA 1L0DA 1YLPA 3EQVA 3B42A 1OT9A 4CQHA 2JKFA 2W1RA 4H6JB 5CHMA 3K3CA 4HP9A 2OAP1 3HUNA 5EPHA 3W2ZA 3ZG9B 2JBFA 3QNCA 3PBNA 3LR3A 1CJFA 2Z6DA 2VGKA 5E2GA 4Q0IA 3SH9A 2XEPA 3LY3A 4EQIA 2BTFP 3QP4A 4EUVA 3NJAA 3AGDA 4O01A 2FFFB 2WK0A 1YLJA 3PBRA 2UWXA 3T4QA 3ZNTA 3CUEA 4BL3A 1IYPA 4ZBEA 3C7VA 5HSQA 1XFNA 3UB9A 3BEBA 5HD3A 3CMZA 5FQ9A 3DW0A 5M18A 1N9LA 1Y54A 1BZAA 5AQBA 5FDSA 3LGOA 1VETA 3NCKA 1UWPX 1OJGA 1H8MA 2WGVA 3P09A 2HP9A 4PAUA 3B3XA 3JVUA 4MCWA 4NXFA 1S4RA 1NXYA 4L0LA 1MKIA 4ZAMA 5FQJA 2DNSA 2PAVP 2KOIA 3NDGA 2HGVA 4BWIA 5EECA 4FTXA 1YLZA 4IJGA 3UMEA 3FPVA 2V0UA 2ZC6B 4KG6A 2W3HA 1YMSA 2QWSA 3F1PB 1TF1A 4G3KA 1BYWA 2W3EA 1XP4A 2HDRA 3PXPA 4DN0A 1L0EA 4G3WA 2PYRA 3HVFA 3FZCA 3C4OA 4GNUA 2Y4AA 2GJ3A 3E4PA 4KZ3A 2QMIA 4Y5FA 3V5MA 2Y8HA 5J4EA 3UNWA 2I9VA 1W8QA 2FH5A 4MN7A 3LICA 4K0XA 4L9GA 1KGGA 1MXOA 4KZ5A 4Z1WA 4PMAA 4NXGA 3UB5P 4R3BA 5CTNA 4N1XA 2XDMA 4O0PA 4OPYA 4R4SA 4KZ9A 4IEDA 4PM9A 3QP6A 4R6LA 5A8BA 3MQ0A 3C5AA 1N9NA 1S67L 4FSFA 3VP2A 3GV9A 1Z09A 2BLSA 1K57A 2X01A 1L0FA 4BBTA 5JYOA 3VP4A 1K25A 3O86A 1VHMA 3MMHA 2ZOHA 5DTSA 3QP1A 3VP1A 4GHIA 3SOIA 3RH8B 3IX4A 4QHCA 4NG2A 4DJ3A 3VP3A 4FUWA 5EV0A 5E2EA 1I2SA 3KSHA 4S2KA 1WE4A 1V9YA 1NLZA 2ZMVA 1X0OA 4GB7A 3IHBA 2JKRM 3Q81A 1PW8A 3E0YA 4R3AA 5EUAA 1O07A 4R23A 4O8GA 1S0WA 3HLDA 5HL1A 1K55A 1Y4OA 3K2NA 4YFMA 4B4ZA 3T1SA 1GCEA 4ESPA 3JPUA 3ZG5A 3NOUC 2ZC4B 3ZNYA 4CLCE 3T4JA 3HLGA 3F1NA 1SKFA 4G3VA 4EBNA 2QPNA 3G30A 5CGWA 3GRJA 2PD7A 1SDEA 5FAOA 3SH8A 4OH0A 1LSVA 2VZWA 5JYPA 4C6YA 4FH2A 4EBPA 4Y7PA 1MKMA 1GA9A 4ARZB 3KSIA 1FR1A 3A3JA 2ZC7A 5CTMA 1XFQA 3WS1A 3C2WA 2LB9A 2Q0OA 5DTTA 5EVID 1ES5A 3A0SA 3L7HA 3CJMA 4D60A 1XPBA 4EERA 4S2PA 1FCOA 1H8ZA 5EVIA 4A5RA 3RJUA 2P74A 1EW0A 4EWFA 3BECA 3S7NA 4MBFA 3CPTA 4LRZE 1KDSA 5M1AA 1NYMA 2M1CA 1ODVA 5FEGA 4EUZA 1EROA 4NETA 1YPRA 3MJQA 4I3IA 5DFYA 2JE5A 3IX8A 5A90A 4BBVA 1HLUP 4ETZA 2XH9A 2EA9A 1YLYA 3T12B 4PPRA 1BT5A 5G4YA 3KO6A 1PIOA 2XLNA 3EEHA 4QD4A 1BLHA 3MQOA 2VJWA 1K0KA 4C3QA 2W0NA 5AJGA 5DVAA 5GHYA 4YWZA 1OPXA 3OZHA 3ZDJA 2XROA 3C38A 4ZTKA 4WYYA 1L3LA 4K08A 2PYPA 3VE3A 4XT2A 2EX8A 4QWOA 2GZAA 4DMZA 3S4XA 1WYCA 1CK3A 3GVBA 2Y2HA 5FEFA 1IFQA 2WKRA 3P7NA 1KE0A 1KE3A 3LFVA 2H28A 3AGEA 1BUEA 2Y2QA 5HD5A 1SDNA 2R78A 5FQIA 5U47A 4MBKA 1Y28A 1KE4A 1VETB 4NK3A 2HJ9C 2BG1A 2XQZA 4CJNA 3H9WA 2WZXA 3C7UA 5HWWA 3BFFA 5CGSA 2VX8A 3Q82A 3ULFA 4R70A 4PM8A 1NWZA 1K4FA 1K57C 4GZBA 2IWBA 4XXRA 2ZC3B 4EEPA 3FKWA 2HDUA 2ZM2A 4IBXA 2GX5A 4KQDA 5F6AA 2H5SA 4WZ5C 2HP5A 2EX9A 3HUMA 4UEYA 5DFXA 1DRMA 4HH3A 5CEBA 5HAQA 3G2ZA 4JLFA 3BRMA 2IA2A 1U60A 3BQ8A 4OOYA 2QKPA 1L0GA 2O99A 3M6HA 4WEJA 1GHMA 4HP4A 3Q7VA 4B88A 4MLLA 3ZVWA 4QPRA 1ONGA 4OOLA 5KMWA 4EETB 2V8FA 3PYPA 4UA9A 3O3VA 1J3WA 1C3BA 1K55C 2J9OA 3LY4A 3MZDA 4X1MA 3E98A 3ISGA 3ZG8B 4JPMA 1OJ5A 3ZG0A 3BW6A 3LIBA 1W8YA 4RQ9A 3W8KA 2IWCA 2PR5A 2ZQCA 3BLMA 3A0RA 4FH4A 3QP8A 1ZHHB 5DKLA 3ITBA 4N1HA 3T4TA 4GJ4A 3G2YA 1QMEA 1NZOA 4KZBA 4E6XA 5K5BA 4GS9A 4HY8A 3UY6A 4OPRA 5EOEA 5DTKA 1Q2QA 5F69A 4GHIB 1FSWA 3ITAA 1D06A 4LRXC 4OLDA 4OQ0A 3BYDA 3KSFA 5CHUA 1BLPA 3RFBA 1PW1A 4MN5A 1YMXA 3KX0X 3CWFA 3A3EA 5DJUA 5FQQA 3OPHA 4E3IA 2J7VA 4GW9A 1ALQA 1N4OA 5FSRA 3IHAA 3VE4A 1HD8A 2PHYA 4S2MA 1DP9A 1LL5A 4U0XA 1MBLA 2CMNA 4WBGA 3G6OA 1PWGA 1UWNX 3HUOA 2WZZA 1NJ4A 4L9FA 4ZDXA 2PRFA 4EBLA 4E3NA 1NZUA 3F1NB 4GKUA 2PU4A 5AQ7A 3VFFA 4PM5A 3MXRA 4OONA 5EE8A 2Q9MA 4ZJ2A 1GSVA 4P85A 2J80A 4MDZA 3UN7A 3N8RA 1DP8A 1N9BA 1ERQA 3WS4A 2PD8A 3E4QA 5A93A 4II7A 4LPZA 3DAVA 3IF6A 1K6RA 3SW1A 5CXWA 1LSWA 4HIAA 2DMWA 3T4KA 2XD5A 3S7QA 2JCHA 1W63M 3B47A 2X02A 4OOMA 1XJ6A 3JYIA 2VGLS 2C6WB 4LV2A 5CRFA 1ES2A 1MWSA 1TEMA 5EVIB 1KVLA 3NIAA 3T4OA 3Q7ZA 5DF9A 3UPPA 5KSHA 1TS7A 1F5MA 3CPTB 4N9KA 1K56D 2HP6A 3QP5A 1NRJA 2DCFA 2KX6A 2Y2NA 3DTIA 3P98A 1K56A 2VV8A 4LCMA 2L1MA 3T1QB 2ZQ8A 3EOIA 1BSGA 1XX2A 3NBLA 5FQKA 4BLMA 2Y79A 4OLGA 3ZCZA 3TG9A 3W4QA 2EFUA 3PAGA 5J8XA 4HI4A 4B4XA 1ESIA 3HLBA 1MPLA 4I3JA 4S2IA 4BL2A 2L0WA 3O87A 4WEKA 4DF6A 5A91A 4LLOB 2ZL1A 4WN5A 1E3UD 3LIEA 4JGOA 2HJEA 1BLSA 3A3DA 3W4PA 3WWXA 4IVKA 5FI2A 1AXBA 4X6TA 2JHEA 3GSGA 4ZJ3A 2JKTI 3UMDA 5HPFA 4UQIS 3NHQA 4DE0A 4R0QA 3P01A 3TW8A 4XT2B 1NRFA 4P6ZS 3D72A 1PRQA 3BY8A 3OPLA 3MS6A 3GR2A 3BLSA 3RXWA 2EX6A 4ZJ1A 4FD8A 1CQAA 2XK1A 1HTZA 1ZKJA 3ZYTA 1MWTA 1DJCA 2NUTC 3OPRA 3VSKA 3BQAA 1YLWA 1XA1A 3IXGA 1CF0A 2EWVA 3JVVA 5F1FA 1Q2PA 4WF0A 4M4XA 4CPKA 2ZBBA 5F1GA 5HX9A 4Z9QA 2KLIA 3SS3A 1IELA 2WGWA 5AVFA 2PU2A 3LIAA 3PAEA 4YOFA 4BQMA 4I38A 2ACGA 2E8JA 1M40A 1XXMA 2ZJ9A 5TFQA 4IUHA 4GCZA 3MZFA 4HQAA 1PWCA 3IXHA 5TJJA 4EESA 2D01A 3CI6A 1GSXA 4U0TA 3LI9A 2OAQ1 5J7EA 4WL9A 5DKKA 4EXOA 1PI4A 1XKZA 2ZD8A 3Q7VB 4JXWA 4IBRA 3KYQA 4DE2A 1G5UA 3CHWP 5IHVA 3TJZC 2VV7A 2O9BA 2AVXA 2Z2LB 4KG2A 5HARA 2R9WA 3BFGA 4UA7A 3IH8A 3H7WA 1T1AA 3NDEA 4OKPA 4HOIA 3MF0A 2VGLM 2V2FF 1DP6A 4E3LA 3N6IA 2IWDA 4E3KA 4HJ4A 2HDSA 1GHIA 1XA7A 1JTGA 3VOYA 4GS9B 4O7DA 2EXAA 3HCYA 3FG8A 3WRZA 1K54A 1JNUA 2JKGA 3UPOA 1F9IA 3NULA 2FFYA 3LR4A 3BWLA 5FAPA 2B02A 4QY5A 1XJ3A 5IU1A 3FPWA 5DF7A 3MKFA 2ZM0A 1G28A 4MMNA 2QYBA 3HLFA 3PTEA 2PT7A 2W3GA 2ZMAA 4HHDA 3GECA 1O7EA 2V1BA 4NXEA 3V3SA 2V0WA 1IYSA 4GDNA 3CUEC 3UPNA 1W79A 1IKIA 1PZPA 5D3OA 1LT0A 4JGQA 1SZVA 3I7JA 2ZLYA 1PWDA 4GDBA 1LLBA 2A24A 3F1OA 4K91A 2XD1A 3FV7A 5FQMA 4LCLA 4XUXA 1E25A 3ZGAB 4DE1A 5HZHA 3NOPC 4UQIM 1ZTUA 4JKTA 3OBFA 1MY8A 2G2UA 4R38A 5HDCA 5G4ZA 4P6ZM 2RCXA 4MBHA 1P9WA 3BFDA 3IF6B 3DWZA 2Z2MB 1XJ2A 2H0YA 3T1RA 5CHJA 1FSYA 3PBOA 2JKTM 3ICYA 3RXXA 4OVDA 2ZM8A 1W5DA 4PKYA 3ZFZA 3M2JA 2H0TA 3AGFA 4UA6A 2XRNA 1IYOA 5EM1A 1EWZA 5HAPA 2P7JA 5KIZA 3LIFA 2Y2IA 1P0ZA 5FASA 3O5YA 2XR0A 3IWIA 4KUOA 3VP0A 3E4OA 3KYEA 2V20A 5HDDA 2WAEA 3IH9A 4Q0HA 3CZDA 2A49A 4Y0OA
chains in the Genus database with same CATH topology
2JC7A 3OPHA 4E3IA 4QU3A 2J7VA 2ZC6B 4KG6A 1ALQA 1RGZA 3LCEA 1N4OA 2B5RA 5FSRA 3IF5A 3SS4A 3IF6C 3IHAA 3V50A 1YMSA 3FWLA 1HD8A 4DDYA 4S2MA 4DXCA 1LL5A 1M6KA 1XP4A 2HDRA 1MBLA 3FYZA 4U0XA 5GHZA 4WBGA 1L0EA 3HVFA 4E3JA 4YINA 1PWGA 3LEZA 3FZCA 1JWVA 3C4OA 3HUOA 2Y4AA 4GNUA 4LV3A 2WZZA 4KZ3A 1NJ4A 4E6WA 3IWOA 4ZDXA 4X69A 4IVIA 2QMIA 5EVLA 1G68A 4EBLA 4E3NA 3NC8A 4KZ8A 3UE0A 1NZUA 1LL9A 5E43A 3V5MA 4GKUA 2PU4A 4S2NC 5AQ7A 5HAIA 3VFFA 4PM5A 3MXRA 5A92A 2P9VA 4OONA 5EE8A 3DTMA 3UNWA 2Q9MA 2Y59A 4ZJ2A 1IKGA 1HZOA 4JXSA 1W8QA 4P85A 2A3UA 1NY0A 4K0XA 4RX2A 3DWKA 3UN7A 1KGGA 1MXOA 3N8RA 4JBFA 1N9BA 4KZ5A 1ERQA 4KG5A 3WS4A 2QZ6A 4PMAA 4OP8A 1K38A 2Y2PA 5A93A 3UDXA 2GDNA 4R3BA 4KZ4A 5CTNA 3IF6A 1K6RA 3G31A 1FR6A 4Y0UA 4HESA 4N1XA 5CXWA 2XDMA 2XD5A 4OPYA 4R4SA 3IXDA 3V39A 4R3JA 4KZ9A 5I94A 2JCHA 2OLUA 4IEDA 4PM9A 2X02A 1RGYA 4OOMA 3JYIA 3C5AA 2ZQDA 1SCWA 4DRTA 4FSFA 2C6WB 4JXGA 4LV2A 5CRFA 3GV9A 3VP2A 2BLSA 3BFCA 2EXBA 5L2FA 1ES2A 1I2WA 1MWSA 3N8LA 1K57A 2X01A 1TEMA 1L0FA 5JYOA 3VP4A 5EVIB 3OCLA 1K25A 1KVLA 1JTDA 3O86A 4P87A 4E3OA 2EX2A 3NIAA 5DTSA 3Q7ZA 5DF9A 3UPPA 5CEDA 2Q9NA 5KSHA 3VP1A 3SOIA 4N9KA 3WS5A 5F83A 1K56D 3ZG7B 4QHCA 2HP6A 4RX3A 4EV4A 1WYBA 2DCFA 1DY6A 2Y2NA 5TR7A 4OPZA 3VP3A 3P98A 2WGWB 4OQHA 1K56A 5E2EA 5TGFA 1I2SA 1CI9A 4LCMA 3G34A 5GL9A 4S2KA 1FOFA 2ZQ8A 1WE4A 4GD8A 4KZAA 4GB7A 1BSGA 1RCJA 1ES4A 2ZQ9A 1XX2A 3IHBA 3N7WA 3NBLA 2RL3A 4R1GA 3Q81A 1PW8A 3OC2A 3VSLA 5FQKA 2WKHA 2DRWA 4BLMA 2Y55A 5EUAA 1ERMA 1O07A 4R23A 4OLGA 3ZCZA 1S0WA 3TG9A 3HLDA 3HREA 3W4QA 4WMCD 3E2LA 1K54C 5HL1A 2EFUA 3PAGA 1K55A 4B4ZA 4YFMA 3PBQA 5J8XA 1ESUA 1G6AA 4JF5A 1GCEA 4B4XA 3ZG5A 1ESIA 4MEZA 3HLBA 4WMCA 1BLCA 1MPLA 4S2IA 4U3TA 2ZC4B 5AQ9A 5CGXA 3ZNYA 4BL2A 3O87A 4WEKA 4RVAA 4DF6A 5A91A 1IEMA 3Q1FA 4KQRA 5EVIC 1E3UD 3HLGA 3SH7A 4GD6A 4QY6A 1SKFA 1CEGA 2WADA 5GLCA 4EBNA 3ZVTA 2QPNA 3G30A 5CGWA 3GRJA 3IQAA 1H8YA 1BLSA 3A3DA 4R4RA 4RA7A 3W4PA 4IVKA 1SDEA 5FI2A 3WWXA 5FAOA 1LHYA 1AXBA 4QB8A 4OH0A 4X6TA 5GLDA 4OP5A 3SH8A 1EI5A 3GSGA 4KZ7A 4ZJ3A 5JYPA 4C6YA 1YM1A 4FH2A 3Q07A 4DE0A 4R0QA 4EBPA 1YT4A 1PYYA 2XFTA 4Y7PA 3BM6A 1GA9A 1NRFA 3HLEA 4ID4A 1FR1A 4WZ4A 3A3JA 1JWZA 2ZC7A 3OPLA 5CTMA 5GHXA 3GMWA 3A3FA 2VGJA 3GR2A 3WS1A 1CI8A 2G2WA 2OLVA 3BLSA 3RXWA 2EX6A 4ZJ1A 4FD8A 4P0MA 1IYQA 1I5QA 2WKIA 5DTTA 1KDWA 3D4FA 3PBSA 5EVID 1ES5A 3S1YA 2XK1A 1JVJA 1HTZA 1YLTA 1ZKJA 3CJMA 1XPBA 1MWTA 3VOZA 1DJCA 3OPRA 4S2PA 3VSKA 3TSGA 5BOHA 1FCOA 3HLCA 4GOGA 1H8ZA 4LV1A 5EVIA 1YLWA 2R9XA 1XA1A 3IXGA 4A5RA 5F82A 4D2OA 3RJUA 2Y2GA 5HW3A 2P74A 1FCNA 1ZG6A 3EQUA 4E3MA 1BTLA 1PZOA 1FQGA 4EWFA 4Q8IA 3BECA 5F1FA 4MBFA 2I72A 1Q2PA 2J9PA 2ZC5B 1KDSA 1KVMA 5M1AA 5DF8A 4PM6A 1S6RA 4CPKA 4GN2A 3WS2A 5GLBA 1K6SA 4KZ6A 5F1GA 3FKVA 1NYMA 4Z9QA 5HX9A 3SS3A 1IELA 2WGWA 2PU2A 4EUZA 5EOOA 3PAEA 4Y0TA 5AQAA 4OPQA 4BQMA 1EROA 4NETA 5HFOA 3HBRA 1JWPA 1XGJA 2JE5A 4KENB 2Y2OA 4N9LA 4S2NA 2PBYA 1M40A 1MWRA 1XXMA 3IXBA 2ZJ9A 5TFQA 4KQQA 5A90A 1VM1A 3MXSA 3MZFA 1PWCA 2P9VB 2XH9A 5KZHA 1NYYA 1YLYA 3IXHA 1LI0A 4X68A 4PPRA 1TVFA 4U0TA 2HDQA 1BT5A 2Y2LA 4LV0A 1TDGA 2E8IA 1PIOA 2XLNA 4M3KA 4QD4A 1BLHA 2HPBA 1PI4A 3G32A 3UE3A 3MFDA 1XKZA 4WM9A 2ZD8A 4C3QA 3Q7VB 1YQSA 4JXWA 4PM7A 3V3RA 4IBRA 2WYXA 3MZEA 5DVAA 4X55A 5GHYA 3QNBA 4DE2A 1DJAA 3VFHA 4C75A 3WRTA 1FCMA 3TOIA 4WELA 1SHVA 3OZHA 5IHVA 3ZDJA 1DJBA 4QJGA 4ZTKA 2OSUA 4DKIA 3M6BA 2Z2LB 4K0WA 4WYYA 4F94A 4KG2A 5HARA 1J9MA 3N8SA 3MBZA 2EX8A 3WS0A 2R9WA 4P6BA 4OQIA 3S4XA 1ZG4A 3BFGA 1WYCA 2Y91A 4UA7A 3IH8A 2OV5A 3UO9A 3NDEA 1CK3A 3GVBA 1H5XA 2Y2HA 4OKPA 1ONHA 2ZQ7A 4RYEA 1RP5A 4S2JA 1HVBA 5GLAA 3UDFA 1KE0A 4E3LA 1E3UA 1KE3A 2V2FF 4XUZA 3N6IA 1KGFA 3AGEA 2IWDA 1BUEA 4BENA 2Y2QA 5M19A 1SDNA 4E3KA 3G35A 4JXVA 2HDSA 5FQIA 1LI9A 1GHIA 1XA7A 1JTGA 5U47A 3VOYA 5FI6A 4JF4A 4MBKA 1KE4A 4NK3A 4O7DA 2BG1A 2EXAA 3VMAA 2ZQAA 2XQZA 2C5WB 4CJNA 2XGNA 4LENA 3WRZA 2CC1A 1K54A 4S2LA 3A3IA 4FCFA 2WZXA 3UDIA 3UPOA 1KGEA 3E2KA 3C7UA 2FFYA 3N4IA 4HBUA 5FA7A 1CEFA 3HL9A 3BFFA 5CGSA 4UHUA 1BULA 3CG5A 3Q82A 4BD1A 4DDSA 1K4EA 3HLWA 5FAPA 4PM8A 5CECA 3S22A 3PBTA 1K4FA 2EFXA 4QY5A 5E2FA 2Y2MA 4X53A 5DF7A 2XF3A 2V1ZA 3GTCA 1K57C 3MKFA 2ZM0A 1MWUA 3O88A 4GZBA 3IWQA 3OCNA 2IWBA 3OPPA 4XXRA 2ZC3B 3HLFA 5FI7A 3W4OA 3PTEA 3FKWA 1W7FA 2HDUA 1GA0A 2ZMAA 2ZM2A 4HEFA 4IBXA 3M2KA 4N92A 4BJPA 1O7EA 1Z6FA 2H5SA 3SS5A 4UAAA 4WZ5C 2HP5A 2EX9A 3HUMA 1L2SA 3V3SA 2WUQA 1IYSA 1L0DA 1YLPA 3EQVA 3LO7A 4GDNA 4BD0A 5CEBA 5HAQA 5KSCA 3UPNA 1W79A 1ES3A 1IKIA 1PZPA 2WGIA 3G2ZA 4JLFA 3I7JA 3BRMA 5D3OA 1U60A 2ZLYA 4OOYA 5CHMA 4JF6A 1PWDA 3BFEA 1L0GA 3M6HA 4S2OA 4WEJA 1GHMA 4GDBA 3HUNA 1LLBA 5EPHA 3Q7VA 4B88A 3ZG9B 2WKEA 2JBFA 3QNCA 2Y2KA 4MLLA 3ZVWA 3PBNA 4K91A 2XD1A 3NY4A 3FV7A 5FQMA 4LCLA 1ONGA 1QMFA 2VGKA 2H10A 4OOLA 4XUXA 5E2GA 5KMWA 1E25A 2J8YA 3ZGAB 4UA9A 3O3VA 4DE1A 3SH9A 2XEPA 1C3BA 5FAQA 3LY3A 4JKTA 1PI5A 1MY8A 4EQIA 1K55C 2J9OA 3LY4A 3MZDA 2G2UA 1E4DA 3AGDA 2FFFB 2RCXA 3ISGA 3ZHHA 4MBHA 4JPMA 3ZG8B 4DXBA 2WK0A 1YLJA 3BFDA 3ZG0A 3IF6B 4DE3A 3PBRA 1VQQA 3DWZA 1W8YA 2UWXA 4WZ5A 3W8KA 5E2HA 2Z2MB 2IWCA 3ZNTA 1TDLA 4OQGA 2H0YA 3GQZA 1IYPA 2ZQCA 3BLMA 5CERA 4BL3A 4ZBEA 5CHJA 3C7VA 1FSYA 3MKEA 4FH4A 3PBOA 3RXXA 4X56A 3BEBA 4OVDA 2ZM8A 1W5DA 3CMZA 5FQ9A 3DW0A 5M18A 5G18A 3ITBA 4N1HA 1Y54A 1BZAA 3M2JA 4H8RA 5AQBA 3ZFZA 3G2YA 1QMEA 2H0TA 3AGFA 4MNRA 4UA6A 1NZOA 1IYOA 4KQOA 3C4PA 4KZBA 1EWZA 4E6XA 5HAPA 3UY6A 4OPRA 2Y2IA 3NCKA 5EOEA 5DTKA 3IT9A 4HBTA 1Q2QA 2WGVA 3NI9A 1FSWA 2HP9A 3ITAA 3P09A 5FDHA 5FASA 3QHYA 3B3XA 4OLDA 4OQ0A 2XR0A 3BYDA 2Y2JA 3IWIA 3VP0A 5CHUA 1BLPA 1NXYA 3G4PA 3UE1A 1ZC2A 4L0LA 2WAFA 2X71A 1XGIA 2V20A 1MKIA 1PW1A 4ZAMA 5FQJA 2DNSA 5FATA 2WAEA 3NDGA 1YMXA 5EECA 3IH9A 1GHPA 1YLZA 2XFSA 3A3EA 3CZDA 2A49A 1OMEA 4Y0OA 5FQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JC7 A;  3OPH A;  4E3I A;  4QU3 A;  2J7V A;  2ZC6 B;  4KG6 A;  1ALQ A;  1RGZ A;  3LCE A;  1N4O A;  2B5R A;  5FSR A;  3IF5 A;  3SS4 A;  3IF6 C;  3IHA A;  3V50 A;  1YMS A;  3FWL A;  1HD8 A;  4DDY A;  4S2M A;  4DXC A;  1LL5 A;  1M6K A;  1XP4 A;  2HDR A;  1MBL A;  3FYZ A;  4U0X A;  5GHZ A;  4WBG A;  1L0E A;  3HVF A;  4E3J A;  4YIN A;  1PWG A;  3LEZ A;  3FZC A;  1JWV A;  3C4O A;  3HUO A;  2Y4A A;  4GNU A;  4LV3 A;  2WZZ A;  4KZ3 A;  1NJ4 A;  4E6W A;  3IWO A;  4ZDX A;  4X69 A;  4IVI A;  2QMI A;  5EVL A;  1G68 A;  4EBL A;  4E3N A;  3NC8 A;  4KZ8 A;  3UE0 A;  1NZU A;  1LL9 A;  5E43 A;  3V5M A;  4GKU A;  2PU4 A;  4S2N C;  5AQ7 A;  5HAI A;  3VFF A;  4PM5 A;  3MXR A;  5A92 A;  2P9V A;  4OON A;  5EE8 A;  3DTM A;  3UNW A;  2Q9M A;  2Y59 A;  4ZJ2 A;  1IKG A;  1HZO A;  4JXS A;  1W8Q A;  4P85 A;  2A3U A;  1NY0 A;  4K0X A;  4RX2 A;  3DWK A;  3UN7 A;  1KGG A;  1MXO A;  3N8R A;  4JBF A;  1N9B A;  4KZ5 A;  1ERQ A;  4KG5 A;  3WS4 A;  2QZ6 A;  4PMA A;  4OP8 A;  1K38 A;  2Y2P A;  5A93 A;  3UDX A;  2GDN A;  4R3B A;  4KZ4 A;  5CTN A;  3IF6 A;  1K6R A;  3G31 A;  1FR6 A;  4Y0U A;  4HES A;  4N1X A;  5CXW A;  2XDM A;  2XD5 A;  4OPY A;  4R4S A;  3IXD A;  3V39 A;  4R3J A;  4KZ9 A;  5I94 A;  2JCH A;  2OLU A;  4IED A;  4PM9 A;  2X02 A;  1RGY A;  4OOM A;  3JYI A;  3C5A A;  2ZQD A;  1SCW A;  4DRT A;  4FSF A;  2C6W B;  4JXG A;  4LV2 A;  5CRF A;  3GV9 A;  3VP2 A;  2BLS A;  3BFC A;  2EXB A;  5L2F A;  1ES2 A;  1I2W A;  1MWS A;  3N8L A;  1K57 A;  2X01 A;  1TEM A;  1L0F A;  5JYO A;  3VP4 A;  5EVI B;  3OCL A;  1K25 A;  1KVL A;  1JTD A;  3O86 A;  4P87 A;  4E3O A;  2EX2 A;  3NIA A;  5DTS A;  3Q7Z A;  5DF9 A;  3UPP A;  5CED A;  2Q9N A;  5KSH A;  3VP1 A;  3SOI A;  4N9K A;  3WS5 A;  5F83 A;  1K56 D;  3ZG7 B;  4QHC A;  2HP6 A;  4RX3 A;  4EV4 A;  1WYB A;  2DCF A;  1DY6 A;  2Y2N A;  5TR7 A;  4OPZ A;  3VP3 A;  3P98 A;  2WGW B;  4OQH A;  1K56 A;  5E2E A;  5TGF A;  1I2S A;  1CI9 A;  4LCM A;  3G34 A;  5GL9 A;  4S2K A;  1FOF A;  2ZQ8 A;  1WE4 A;  4GD8 A;  4KZA A;  4GB7 A;  1BSG A;  1RCJ A;  1ES4 A;  2ZQ9 A;  1XX2 A;  3IHB A;  3N7W A;  3NBL A;  2RL3 A;  4R1G A;  3Q81 A;  1PW8 A;  3OC2 A;  3VSL A;  5FQK A;  2WKH A;  2DRW A;  4BLM A;  2Y55 A;  5EUA A;  1ERM A;  1O07 A;  4R23 A;  4OLG A;  3ZCZ A;  1S0W A;  3TG9 A;  3HLD A;  3HRE A;  3W4Q A;  4WMC D;  3E2L A;  1K54 C;  5HL1 A;  2EFU A;  3PAG A;  1K55 A;  4B4Z A;  4YFM A;  3PBQ A;  5J8X A;  1ESU A;  1G6A A;  4JF5 A;  1GCE A;  4B4X A;  3ZG5 A;  1ESI A;  4MEZ A;  3HLB A;  4WMC A;  1BLC A;  1MPL A;  4S2I A;  4U3T A;  2ZC4 B;  5AQ9 A;  5CGX A;  3ZNY A;  4BL2 A;  3O87 A;  4WEK A;  4RVA A;  4DF6 A;  5A91 A;  1IEM A;  3Q1F A;  4KQR A;  5EVI C;  1E3U D;  3HLG A;  3SH7 A;  4GD6 A;  4QY6 A;  1SKF A;  1CEG A;  2WAD A;  5GLC A;  4EBN A;  3ZVT A;  2QPN A;  3G30 A;  5CGW A;  3GRJ A;  3IQA A;  1H8Y A;  1BLS A;  3A3D A;  4R4R A;  4RA7 A;  3W4P A;  4IVK A;  1SDE A;  5FI2 A;  3WWX A;  5FAO A;  1LHY A;  1AXB A;  4QB8 A;  4OH0 A;  4X6T A;  5GLD A;  4OP5 A;  3SH8 A;  1EI5 A;  3GSG A;  4KZ7 A;  4ZJ3 A;  5JYP A;  4C6Y A;  1YM1 A;  4FH2 A;  3Q07 A;  4DE0 A;  4R0Q A;  4EBP A;  1YT4 A;  1PYY A;  2XFT A;  4Y7P A;  3BM6 A;  1GA9 A;  1NRF A;  3HLE A;  4ID4 A;  1FR1 A;  4WZ4 A;  3A3J A;  1JWZ A;  2ZC7 A;  3OPL A;  5CTM A;  5GHX A;  3GMW A;  3A3F A;  2VGJ A;  3GR2 A;  3WS1 A;  1CI8 A;  2G2W A;  2OLV A;  3BLS A;  3RXW A;  2EX6 A;  4ZJ1 A;  4FD8 A;  4P0M A;  1IYQ A;  1I5Q A;  2WKI A;  5DTT A;  1KDW A;  3D4F A;  3PBS A;  5EVI D;  1ES5 A;  3S1Y A;  2XK1 A;  1JVJ A;  1HTZ A;  1YLT A;  1ZKJ A;  3CJM A;  1XPB A;  1MWT A;  3VOZ A;  1DJC A;  3OPR A;  4S2P A;  3VSK A;  3TSG A;  5BOH A;  1FCO A;  3HLC A;  4GOG A;  1H8Z A;  4LV1 A;  5EVI A;  1YLW A;  2R9X A;  1XA1 A;  3IXG A;  4A5R A;  5F82 A;  4D2O A;  3RJU A;  2Y2G A;  5HW3 A;  2P74 A;  1FCN A;  1ZG6 A;  3EQU A;  4E3M A;  1BTL A;  1PZO A;  1FQG A;  4EWF A;  4Q8I A;  3BEC A;  5F1F A;  4MBF A;  2I72 A;  1Q2P A;  2J9P A;  2ZC5 B;  1KDS A;  1KVM A;  5M1A A;  5DF8 A;  4PM6 A;  1S6R A;  4CPK A;  4GN2 A;  3WS2 A;  5GLB A;  1K6S A;  4KZ6 A;  5F1G A;  3FKV A;  1NYM A;  4Z9Q A;  5HX9 A;  3SS3 A;  1IEL A;  2WGW A;  2PU2 A;  4EUZ A;  5EOO A;  3PAE A;  4Y0T A;  5AQA A;  4OPQ A;  4BQM A;  1ERO A;  4NET A;  5HFO A;  3HBR A;  1JWP A;  1XGJ A;  2JE5 A;  4KEN B;  2Y2O A;  4N9L A;  4S2N A;  2PBY A;  1M40 A;  1MWR A;  1XXM A;  3IXB A;  2ZJ9 A;  5TFQ A;  4KQQ A;  5A90 A;  1VM1 A;  3MXS A;  3MZF A;  1PWC A;  2P9V B;  2XH9 A;  5KZH A;  1NYY A;  1YLY A;  3IXH A;  1LI0 A;  4X68 A;  4PPR A;  1TVF A;  4U0T A;  2HDQ A;  1BT5 A;  2Y2L A;  4LV0 A;  1TDG A;  2E8I A;  1PIO A;  2XLN A;  4M3K A;  4QD4 A;  1BLH A;  2HPB A;  1PI4 A;  3G32 A;  3UE3 A;  3MFD A;  1XKZ A;  4WM9 A;  2ZD8 A;  4C3Q A;  3Q7V B;  1YQS A;  4JXW A;  4PM7 A;  3V3R A;  4IBR A;  2WYX A;  3MZE A;  5DVA A;  4X55 A;  5GHY A;  3QNB A;  4DE2 A;  1DJA A;  3VFH A;  4C75 A;  3WRT A;  1FCM A;  3TOI A;  4WEL A;  1SHV A;  3OZH A;  5IHV A;  3ZDJ A;  1DJB A;  4QJG A;  4ZTK A;  2OSU A;  4DKI A;  3M6B A;  2Z2L B;  4K0W A;  4WYY A;  4F94 A;  4KG2 A;  5HAR A;  1J9M A;  3N8S A;  3MBZ A;  2EX8 A;  3WS0 A;  2R9W A;  4P6B A;  4OQI A;  3S4X A;  1ZG4 A;  3BFG A;  1WYC A;  2Y91 A;  4UA7 A;  3IH8 A;  2OV5 A;  3UO9 A;  3NDE A;  1CK3 A;  3GVB A;  1H5X A;  2Y2H A;  4OKP A;  1ONH A;  2ZQ7 A;  4RYE A;  1RP5 A;  4S2J A;  1HVB A;  5GLA A;  3UDF A;  1KE0 A;  4E3L A;  1E3U A;  1KE3 A;  2V2F F;  4XUZ A;  3N6I A;  1KGF A;  3AGE A;  2IWD A;  1BUE A;  4BEN A;  2Y2Q A;  5M19 A;  1SDN A;  4E3K A;  3G35 A;  4JXV A;  2HDS A;  5FQI A;  1LI9 A;  1GHI A;  1XA7 A;  1JTG A;  5U47 A;  3VOY A;  5FI6 A;  4JF4 A;  4MBK A;  1KE4 A;  4NK3 A;  4O7D A;  2BG1 A;  2EXA A;  3VMA A;  2ZQA A;  2XQZ A;  2C5W B;  4CJN A;  2XGN A;  4LEN A;  3WRZ A;  2CC1 A;  1K54 A;  4S2L A;  3A3I A;  4FCF A;  2WZX A;  3UDI A;  3UPO A;  1KGE A;  3E2K A;  3C7U A;  2FFY A;  3N4I A;  4HBU A;  5FA7 A;  1CEF A;  3HL9 A;  3BFF A;  5CGS A;  4UHU A;  1BUL A;  3CG5 A;  3Q82 A;  4BD1 A;  4DDS A;  1K4E A;  3HLW A;  5FAP A;  4PM8 A;  5CEC A;  3S22 A;  3PBT A;  1K4F A;  2EFX A;  4QY5 A;  5E2F A;  2Y2M A;  4X53 A;  5DF7 A;  2XF3 A;  2V1Z A;  3GTC A;  1K57 C;  3MKF A;  2ZM0 A;  1MWU A;  3O88 A;  4GZB A;  3IWQ A;  3OCN A;  2IWB A;  3OPP A;  4XXR A;  2ZC3 B;  3HLF A;  5FI7 A;  3W4O A;  3PTE A;  3FKW A;  1W7F A;  2HDU A;  1GA0 A;  2ZMA A;  2ZM2 A;  4HEF A;  4IBX A;  3M2K A;  4N92 A;  4BJP A;  1O7E A;  1Z6F A;  2H5S A;  3SS5 A;  4UAA A;  4WZ5 C;  2HP5 A;  2EX9 A;  3HUM A;  1L2S A;  3V3S A;  2WUQ A;  1IYS A;  1L0D A;  1YLP A;  3EQV A;  3LO7 A;  4GDN A;  4BD0 A;  5CEB A;  5HAQ A;  5KSC A;  3UPN A;  1W79 A;  1ES3 A;  1IKI A;  1PZP A;  2WGI A;  3G2Z A;  4JLF A;  3I7J A;  3BRM A;  5D3O A;  1U60 A;  2ZLY A;  4OOY A;  5CHM A;  4JF6 A;  1PWD A;  3BFE A;  1L0G A;  3M6H A;  4S2O A;  4WEJ A;  1GHM A;  4GDB A;  3HUN A;  1LLB A;  5EPH A;  3Q7V A;  4B88 A;  3ZG9 B;  2WKE A;  2JBF A;  3QNC A;  2Y2K A;  4MLL A;  3ZVW A;  3PBN A;  4K91 A;  2XD1 A;  3NY4 A;  3FV7 A;  5FQM A;  4LCL A;  1ONG A;  1QMF A;  2VGK A;  2H10 A;  4OOL A;  4XUX A;  5E2G A;  5KMW A;  1E25 A;  2J8Y A;  3ZGA B;  4UA9 A;  3O3V A;  4DE1 A;  3SH9 A;  2XEP A;  1C3B A;  5FAQ A;  3LY3 A;  4JKT A;  1PI5 A;  1MY8 A;  4EQI A;  1K55 C;  2J9O A;  3LY4 A;  3MZD A;  2G2U A;  1E4D A;  3AGD A;  2FFF B;  2RCX A;  3ISG A;  3ZHH A;  4MBH A;  4JPM A;  3ZG8 B;  4DXB A;  2WK0 A;  1YLJ A;  3BFD A;  3ZG0 A;  3IF6 B;  4DE3 A;  3PBR A;  1VQQ A;  3DWZ A;  1W8Y A;  2UWX A;  4WZ5 A;  3W8K A;  5E2H A;  2Z2M B;  2IWC A;  3ZNT A;  1TDL A;  4OQG A;  2H0Y A;  3GQZ A;  1IYP A;  2ZQC A;  3BLM A;  5CER A;  4BL3 A;  4ZBE A;  5CHJ A;  3C7V A;  1FSY A;  3MKE A;  4FH4 A;  3PBO A;  3RXX A;  4X56 A;  3BEB A;  4OVD A;  2ZM8 A;  1W5D A;  3CMZ A;  5FQ9 A;  3DW0 A;  5M18 A;  5G18 A;  3ITB A;  4N1H A;  1Y54 A;  1BZA A;  3M2J A;  4H8R A;  5AQB A;  3ZFZ A;  3G2Y A;  1QME A;  2H0T A;  3AGF A;  4MNR A;  4UA6 A;  1NZO A;  1IYO A;  4KQO A;  3C4P A;  4KZB A;  1EWZ A;  4E6X A;  5HAP A;  3UY6 A;  4OPR A;  2Y2I A;  3NCK A;  5EOE A;  5DTK A;  3IT9 A;  4HBT A;  1Q2Q A;  2WGV A;  3NI9 A;  1FSW A;  2HP9 A;  3ITA A;  3P09 A;  5FDH A;  5FAS A;  3QHY A;  3B3X A;  4OLD A;  4OQ0 A;  2XR0 A;  3BYD A;  2Y2J A;  3IWI A;  3VP0 A;  5CHU A;  1BLP A;  1NXY A;  3G4P A;  3UE1 A;  1ZC2 A;  4L0L A;  2WAF A;  2X71 A;  1XGI A;  2V20 A;  1MKI A;  1PW1 A;  4ZAM A;  5FQJ A;  2DNS A;  5FAT A;  2WAE A;  3NDG A;  1YMX A;  5EEC A;  3IH9 A;  1GHP A;  1YLZ A;  2XFS A;  3A3E A;  3CZD A;  2A49 A;  1OME A;  4Y0O A;  5FQQ A; 
#chains in the Genus database with same CATH topology
 1KOU A;  2JC7 A;  5L10 A;  1STZ A;  3KSG A;  1RGZ A;  3LCE A;  1D1J A;  2B5R A;  3SS4 A;  3V50 A;  4HNB A;  3FWL A;  4DDY A;  4DXC A;  1OTD A;  5GHZ A;  1G6O A;  1JWV A;  5C5K A;  4HH2 A;  4E6W A;  5EVL A;  4PKY G;  2ZL1 B;  4KZ8 A;  2W1T A;  1LL9 A;  5E43 A;  5HAI A;  2M7U A;  4AFI A;  2Y59 A;  3RTY A;  1IKG A;  2G7U A;  2W3F A;  2A3U A;  4RX2 A;  3DWK A;  4JBF A;  3R4K A;  1SKO A;  4KG5 A;  4X25 A;  2FZ0 A;  2QZ6 A;  2YKF A;  4OP8 A;  2Y2P A;  3UDX A;  3LR0 A;  2K7S A;  4B9O A;  1FR6 A;  4F3L A;  4Y0U A;  4KUK A;  2YKH A;  1S1Y A;  5LBR A;  3IXD A;  4R3J A;  2VKS A;  4MN6 A;  3PR6 A;  3DTK A;  1VB6 A;  4CLC D;  2ZQD A;  2L4R A;  3BFC A;  2EXB A;  1I2W A;  1S4S A;  4CLC A;  2QJ7 A;  1ACF A;  4ME4 A;  4E3O A;  4P87 A;  2EX2 A;  5CED A;  5TBM B;  2OWH A;  2VV6 A;  3ZG7 B;  1TS6 A;  2B95 A;  2WKP A;  4EV4 A;  2V1A A;  4OPZ A;  2WGW B;  3IBJ A;  2INW A;  4KZA A;  2O9A A;  2ZQ9 A;  1RCJ A;  3N7W A;  2RL3 A;  4R1G A;  3NEC A;  3VSL A;  2DRW A;  3HJK A;  1ERM A;  4WMC D;  1K54 C;  5F5Y A;  3IS2 A;  4MEZ A;  5HL6 A;  4WMC A;  1BLC A;  2KDK A;  4U3T A;  5AQ9 A;  4NKP A;  1IEM A;  2ZMF A;  3Q1F A;  4KQR A;  5EVI C;  1P9R A;  2W27 A;  3UE6 A;  4GD6 A;  2WAD A;  1CEG A;  1YAX A;  3ZVT A;  5AVE A;  3IQA A;  4R4R A;  1LHY A;  1EI5 A;  3MR0 A;  3CAX A;  3Q07 A;  1YT4 A;  1PYY A;  2XFT A;  3BM6 A;  3SZT A;  4WZ4 A;  1JWZ A;  2JKR I;  3H7W B;  3A3F A;  2G2W A;  3EWK A;  3UB7 A;  3KYZ A;  4P0M A;  1KDW A;  3D4F A;  3PBS A;  2O9C A;  4LRY C;  3MQQ A;  3VOZ A;  3TSG A;  4I39 A;  4LV1 A;  4GOG A;  5HPI A;  4D2O A;  5HW3 A;  3EQU A;  1ZG6 A;  2PDR A;  3DBA A;  1PZO A;  2D02 A;  1FQG A;  1YKD A;  2I72 A;  1PNE A;  1T19 A;  1KVM A;  1S6R A;  4GN2 A;  3WS2 A;  1TS0 A;  5GLB A;  1AWI A;  2ZOI A;  4DJ2 A;  1K6S A;  3FKV A;  4Y0T A;  1S1Z A;  4OPQ A;  3HBR A;  1JWP A;  4S2N A;  2PBY A;  1MWR A;  4KQQ A;  3IBR A;  5IT5 A;  2K2N A;  2GNX A;  1VM1 A;  5EFW A;  3S7O A;  2P9V B;  4X68 A;  1LI0 A;  2QJ5 A;  5HDS A;  1TVF A;  2OOL A;  2HDQ A;  4B93 A;  1TDG A;  2E8I A;  2XSS A;  4WLA A;  1NLY A;  3HJI A;  4Y15 A;  3VOL A;  1H0M A;  5L07 A;  3G32 A;  3UE3 A;  3MFD A;  4PHT A;  2A24 B;  1YQS A;  1V9Z A;  3MXQ A;  3F1O B;  3MZE A;  1PFL A;  1DJA A;  3VFH A;  4C75 A;  3TOI A;  1H3Q A;  1DJB A;  4DKI A;  4K0W A;  1OTE A;  1OTA A;  1ZG4 A;  2OV5 A;  3EGX C;  3A0V A;  1H5X A;  3R7W A;  1ONH A;  2ZQ7 A;  4S2J A;  1RP5 A;  4Y13 A;  5L09 A;  1E3U A;  4XUZ A;  1KGF A;  4EQ1 A;  3S7P A;  4BEN A;  3D9Y A;  5M19 A;  4JXV A;  4L9E A;  2WKQ A;  3NOT C;  5CX7 A;  2ZQA A;  1T1B A;  2CC1 A;  2VEA A;  1MC0 A;  3A3I A;  4FCF A;  3UDI A;  3E2K A;  5FA7 A;  2LB5 A;  1BUL A;  3CG5 A;  4DDS A;  4BD1 A;  1GSW A;  1TD5 A;  5CEC A;  1WA9 A;  3PBT A;  2PBD P;  2EFX A;  3H82 B;  1MWU A;  3O88 A;  4CLC C;  3IWQ A;  3OPP A;  4BBU A;  5TBM A;  3C30 A;  4HEF A;  3UB6 A;  1L2S A;  4BD0 A;  3LO7 A;  5KSC A;  1ES3 A;  4NEE D;  1D7E A;  2WGI A;  3TE8 A;  4JF6 A;  3BFE A;  3ZQ5 A;  4S2O A;  1VEU A;  2W1T B;  2WKE A;  2Y2K A;  3LID A;  3NY4 A;  1QMF A;  2H10 A;  3LYX A;  2J8Y A;  5FAQ A;  1T1C A;  1PI5 A;  1SKO B;  4Y2F A;  1E4D A;  4DXB A;  3ZHH A;  2EWW A;  4DE3 A;  1VQQ A;  4FOF A;  2JN7 A;  4F3L B;  4WZ5 A;  5E2H A;  1TDL A;  4OQG A;  4X1L A;  5FL3 A;  3GQZ A;  5CER A;  3MKE A;  1LL8 A;  4X56 A;  1OTI A;  2J3T D;  4I5S A;  5G18 A;  3LEQ A;  1W63 Q;  4H8R A;  3EGD C;  4MNR A;  4CLC B;  5J3W A;  4KQO A;  3C4P A;  5F68 A;  4EW7 A;  3VV4 A;  3IT9 A;  4HBT A;  3NI9 A;  1T18 A;  5FDH A;  5I5L A;  3QHY A;  3CIT A;  2Y2J A;  3G4P A;  3UE1 A;  1ZC2 A;  1FIK A;  2WAF A;  2X71 A;  1XGI A;  2A2L A;  5FAT A;  1A0K A;  1GHP A;  2P04 A;  3LR5 A;  2XFS A;  5FI7 A;  1OME A;  4QU3 A;  4E04 A;  3IF5 A;  3IF6 C;  3T4L A;  1M6K A;  3FYZ A;  3IS2 B;  4E3J A;  4YIN A;  3LEZ A;  2J3W A;  4H6J A;  4LV3 A;  3IWO A;  4X69 A;  4IVI A;  1G68 A;  4BMW A;  3NC8 A;  3UE0 A;  2B18 A;  4S2N C;  5A92 A;  2P9V A;  3IX3 A;  3DTM A;  3T1X A;  1HZO A;  4JXS A;  1NY0 A;  1K38 A;  2GDN A;  4KZ4 A;  3G31 A;  2XA7 S;  4HES A;  1UGU A;  3K3D A;  2W3D A;  3V39 A;  5I94 A;  3C8C A;  2OLU A;  1RGY A;  3DTE A;  1YSQ A;  1SCW A;  4DRT A;  4JXG A;  4NXB A;  5EVE A;  1TS8 A;  5L2F A;  1OTB A;  1N9O A;  2BAS A;  2HF6 A;  3N8L A;  3OCL A;  1JTD A;  2Q9N A;  3U2A A;  3WS5 A;  5F83 A;  4Q0J A;  4RX3 A;  1WYB A;  1DY6 A;  5TR7 A;  1XJ4 A;  2VK3 A;  1F2K A;  4OQH A;  5TGF A;  1CI9 A;  3CLO A;  3G34 A;  5GL9 A;  1FOF A;  4GD8 A;  1P97 A;  1ES4 A;  3T50 A;  3MFX A;  2OWJ A;  3OC2 A;  2PR6 A;  2WKH A;  2Y55 A;  3F1P A;  3FC7 A;  3HRE A;  3E2L A;  3PBQ A;  1ESU A;  5EM0 A;  1G6A A;  4JF5 A;  4WUJ A;  2O0Y A;  5CGX A;  2UV0 E;  4RVA A;  3H82 A;  1F98 A;  3SH7 A;  4QY6 A;  5GLC A;  3U4L P;  3OOV A;  1S66 L;  1H8Y A;  4RA7 A;  4QB8 A;  5GLD A;  1LSX A;  4OP5 A;  4KZ7 A;  2P08 A;  1YM1 A;  4LFU A;  3OLO A;  2M7V A;  3HLE A;  4ID4 A;  3TRC A;  5GHX A;  3GMW A;  2VGJ A;  1CI8 A;  2OLV A;  3R7W B;  2VA0 A;  1IYQ A;  1I5Q A;  2WKI A;  3S1Y A;  3T4S A;  1JVJ A;  1YLT A;  4HJ6 A;  5BOH A;  3QP2 A;  3HLC A;  2R9X A;  3L9K A;  5F82 A;  3PHY A;  3MSH A;  3UB8 A;  2Y2G A;  1FCN A;  4E3M A;  1BTL A;  2V8C A;  4Q8I A;  2J9P A;  2ZC5 B;  4I3A A;  5DF8 A;  4PM6 A;  4ETX A;  4KZ6 A;  4JGP A;  1FIL A;  5EOO A;  5AQA A;  5HFO A;  4IHQ A;  1XGJ A;  3V67 A;  4HJ3 A;  4KEN B;  2Y2O A;  4N9L A;  3B33 A;  3LI8 A;  4GLQ A;  3IXB A;  4JGR A;  2J3T C;  3MXS A;  5MC7 A;  5IS1 A;  5KZH A;  1NYY A;  3D3O A;  2Z6C A;  4Y3I A;  2Y2L A;  4LV0 A;  2K31 A;  4M3K A;  4ZRR A;  5DJT A;  2HPB A;  4YNR A;  4WM9 A;  3EEA A;  1VEU B;  4PM7 A;  3LUQ A;  3V3R A;  2WYX A;  4X55 A;  3QNB A;  3WRT A;  1FCM A;  4WEL A;  1SHV A;  4QJG A;  4IUK A;  5HWT A;  2OSU A;  4EEU A;  3M6B A;  4EU0 A;  1OT6 A;  4F94 A;  1J9M A;  3N8S A;  3MBZ A;  3WS0 A;  2XA7 M;  4P6B A;  4OQI A;  4ARZ A;  2Y91 A;  3UO9 A;  2HV1 A;  1YSP A;  4RYE A;  1HVB A;  5GLA A;  3UDF A;  2HZ5 A;  3G35 A;  4LGW A;  1LI9 A;  5FI6 A;  4JF4 A;  3VMA A;  2C5W B;  2XGN A;  4LEN A;  2MJ6 A;  2QHK A;  4S2L A;  4Y17 A;  1KGE A;  2NUP C;  3N4I A;  4HBU A;  1CEF A;  3HL9 A;  4UHU A;  1K4E A;  3BY9 A;  3HLW A;  3S22 A;  5L8M A;  5E2F A;  2Y2M A;  4X53 A;  2XF3 A;  2V1Z A;  3GTC A;  1IOU A;  3GDI A;  2VLG A;  1MZU A;  3OCN A;  3W4O A;  3BJN A;  1W7F A;  1GA0 A;  3M2K A;  4N92 A;  4BJP A;  1Z6F A;  3SS5 A;  4UAA A;  2V9A A;  2WUQ A;  5HWV A;  1L0D A;  1YLP A;  3EQV A;  3B42 A;  1OT9 A;  4CQH A;  2JKF A;  2W1R A;  4H6J B;  5CHM A;  3K3C A;  4HP9 A;  2OAP 1;  3HUN A;  5EPH A;  3W2Z A;  3ZG9 B;  2JBF A;  3QNC A;  3PBN A;  3LR3 A;  1CJF A;  2Z6D A;  2VGK A;  5E2G A;  4Q0I A;  3SH9 A;  2XEP A;  3LY3 A;  4EQI A;  2BTF P;  3QP4 A;  4EUV A;  3NJA A;  3AGD A;  4O01 A;  2FFF B;  2WK0 A;  1YLJ A;  3PBR A;  2UWX A;  3T4Q A;  3ZNT A;  3CUE A;  4BL3 A;  1IYP A;  4ZBE A;  3C7V A;  5HSQ A;  1XFN A;  3UB9 A;  3BEB A;  5HD3 A;  3CMZ A;  5FQ9 A;  3DW0 A;  5M18 A;  1N9L A;  1Y54 A;  1BZA A;  5AQB A;  5FDS A;  3LGO A;  1VET A;  3NCK A;  1UWP X;  1OJG A;  1H8M A;  2WGV A;  3P09 A;  2HP9 A;  4PAU A;  3B3X A;  3JVU A;  4MCW A;  4NXF A;  1S4R A;  1NXY A;  4L0L A;  1MKI A;  4ZAM A;  5FQJ A;  2DNS A;  2PAV P;  2KOI A;  3NDG A;  2HGV A;  4BWI A;  5EEC A;  4FTX A;  1YLZ A;  4IJG A;  3UME A;  3FPV A;  2V0U A;  2ZC6 B;  4KG6 A;  2W3H A;  1YMS A;  2QWS A;  3F1P B;  1TF1 A;  4G3K A;  1BYW A;  2W3E A;  1XP4 A;  2HDR A;  3PXP A;  4DN0 A;  1L0E A;  4G3W A;  2PYR A;  3HVF A;  3FZC A;  3C4O A;  4GNU A;  2Y4A A;  2GJ3 A;  3E4P A;  4KZ3 A;  2QMI A;  4Y5F A;  3V5M A;  2Y8H A;  5J4E A;  3UNW A;  2I9V A;  1W8Q A;  2FH5 A;  4MN7 A;  3LIC A;  4K0X A;  4L9G A;  1KGG A;  1MXO A;  4KZ5 A;  4Z1W A;  4PMA A;  4NXG A;  3UB5 P;  4R3B A;  5CTN A;  4N1X A;  2XDM A;  4O0P A;  4OPY A;  4R4S A;  4KZ9 A;  4IED A;  4PM9 A;  3QP6 A;  4R6L A;  5A8B A;  3MQ0 A;  3C5A A;  1N9N A;  1S67 L;  4FSF A;  3VP2 A;  3GV9 A;  1Z09 A;  2BLS A;  1K57 A;  2X01 A;  1L0F A;  4BBT A;  5JYO A;  3VP4 A;  1K25 A;  3O86 A;  1VHM A;  3MMH A;  2ZOH A;  5DTS A;  3QP1 A;  3VP1 A;  4GHI A;  3SOI A;  3RH8 B;  3IX4 A;  4QHC A;  4NG2 A;  4DJ3 A;  3VP3 A;  4FUW A;  5EV0 A;  5E2E A;  1I2S A;  3KSH A;  4S2K A;  1WE4 A;  1V9Y A;  1NLZ A;  2ZMV A;  1X0O A;  4GB7 A;  3IHB A;  2JKR M;  3Q81 A;  1PW8 A;  3E0Y A;  4R3A A;  5EUA A;  1O07 A;  4R23 A;  4O8G A;  1S0W A;  3HLD A;  5HL1 A;  1K55 A;  1Y4O A;  3K2N A;  4YFM A;  4B4Z A;  3T1S A;  1GCE A;  4ESP A;  3JPU A;  3ZG5 A;  3NOU C;  2ZC4 B;  3ZNY A;  4CLC E;  3T4J A;  3HLG A;  3F1N A;  1SKF A;  4G3V A;  4EBN A;  2QPN A;  3G30 A;  5CGW A;  3GRJ A;  2PD7 A;  1SDE A;  5FAO A;  3SH8 A;  4OH0 A;  1LSV A;  2VZW A;  5JYP A;  4C6Y A;  4FH2 A;  4EBP A;  4Y7P A;  1MKM A;  1GA9 A;  4ARZ B;  3KSI A;  1FR1 A;  3A3J A;  2ZC7 A;  5CTM A;  1XFQ A;  3WS1 A;  3C2W A;  2LB9 A;  2Q0O A;  5DTT A;  5EVI D;  1ES5 A;  3A0S A;  3L7H A;  3CJM A;  4D60 A;  1XPB A;  4EER A;  4S2P A;  1FCO A;  1H8Z A;  5EVI A;  4A5R A;  3RJU A;  2P74 A;  1EW0 A;  4EWF A;  3BEC A;  3S7N A;  4MBF A;  3CPT A;  4LRZ E;  1KDS A;  5M1A A;  1NYM A;  2M1C A;  1ODV A;  5FEG A;  4EUZ A;  1ERO A;  4NET A;  1YPR A;  3MJQ A;  4I3I A;  5DFY A;  2JE5 A;  3IX8 A;  5A90 A;  4BBV A;  1HLU P;  4ETZ A;  2XH9 A;  2EA9 A;  1YLY A;  3T12 B;  4PPR A;  1BT5 A;  5G4Y A;  3KO6 A;  1PIO A;  2XLN A;  3EEH A;  4QD4 A;  1BLH A;  3MQO A;  2VJW A;  1K0K A;  4C3Q A;  2W0N A;  5AJG A;  5DVA A;  5GHY A;  4YWZ A;  1OPX A;  3OZH A;  3ZDJ A;  2XRO A;  3C38 A;  4ZTK A;  4WYY A;  1L3L A;  4K08 A;  2PYP A;  3VE3 A;  4XT2 A;  2EX8 A;  4QWO A;  2GZA A;  4DMZ A;  3S4X A;  1WYC A;  1CK3 A;  3GVB A;  2Y2H A;  5FEF A;  1IFQ A;  2WKR A;  3P7N A;  1KE0 A;  1KE3 A;  3LFV A;  2H28 A;  3AGE A;  1BUE A;  2Y2Q A;  5HD5 A;  1SDN A;  2R78 A;  5FQI A;  5U47 A;  4MBK A;  1Y28 A;  1KE4 A;  1VET B;  4NK3 A;  2HJ9 C;  2BG1 A;  2XQZ A;  4CJN A;  3H9W A;  2WZX A;  3C7U A;  5HWW A;  3BFF A;  5CGS A;  2VX8 A;  3Q82 A;  3ULF A;  4R70 A;  4PM8 A;  1NWZ A;  1K4F A;  1K57 C;  4GZB A;  2IWB A;  4XXR A;  2ZC3 B;  4EEP A;  3FKW A;  2HDU A;  2ZM2 A;  4IBX A;  2GX5 A;  4KQD A;  5F6A A;  2H5S A;  4WZ5 C;  2HP5 A;  2EX9 A;  3HUM A;  4UEY A;  5DFX A;  1DRM A;  4HH3 A;  5CEB A;  5HAQ A;  3G2Z A;  4JLF A;  3BRM A;  2IA2 A;  1U60 A;  3BQ8 A;  4OOY A;  2QKP A;  1L0G A;  2O99 A;  3M6H A;  4WEJ A;  1GHM A;  4HP4 A;  3Q7V A;  4B88 A;  4MLL A;  3ZVW A;  4QPR A;  1ONG A;  4OOL A;  5KMW A;  4EET B;  2V8F A;  3PYP A;  4UA9 A;  3O3V A;  1J3W A;  1C3B A;  1K55 C;  2J9O A;  3LY4 A;  3MZD A;  4X1M A;  3E98 A;  3ISG A;  3ZG8 B;  4JPM A;  1OJ5 A;  3ZG0 A;  3BW6 A;  3LIB A;  1W8Y A;  4RQ9 A;  3W8K A;  2IWC A;  2PR5 A;  2ZQC A;  3BLM A;  3A0R A;  4FH4 A;  3QP8 A;  1ZHH B;  5DKL A;  3ITB A;  4N1H A;  3T4T A;  4GJ4 A;  3G2Y A;  1QME A;  1NZO A;  4KZB A;  4E6X A;  5K5B A;  4GS9 A;  4HY8 A;  3UY6 A;  4OPR A;  5EOE A;  5DTK A;  1Q2Q A;  5F69 A;  4GHI B;  1FSW A;  3ITA A;  1D06 A;  4LRX C;  4OLD A;  4OQ0 A;  3BYD A;  3KSF A;  5CHU A;  1BLP A;  3RFB A;  1PW1 A;  4MN5 A;  1YMX A;  3KX0 X;  3CWF A;  3A3E A;  5DJU A;  5FQQ A;  3OPH A;  4E3I A;  2J7V A;  4GW9 A;  1ALQ A;  1N4O A;  5FSR A;  3IHA A;  3VE4 A;  1HD8 A;  2PHY A;  4S2M A;  1DP9 A;  1LL5 A;  4U0X A;  1MBL A;  2CMN A;  4WBG A;  3G6O A;  1PWG A;  1UWN X;  3HUO A;  2WZZ A;  1NJ4 A;  4L9F A;  4ZDX A;  2PRF A;  4EBL A;  4E3N A;  1NZU A;  3F1N B;  4GKU A;  2PU4 A;  5AQ7 A;  3VFF A;  4PM5 A;  3MXR A;  4OON A;  5EE8 A;  2Q9M A;  4ZJ2 A;  1GSV A;  4P85 A;  2J80 A;  4MDZ A;  3UN7 A;  3N8R A;  1DP8 A;  1N9B A;  1ERQ A;  3WS4 A;  2PD8 A;  3E4Q A;  5A93 A;  4II7 A;  4LPZ A;  3DAV A;  3IF6 A;  1K6R A;  3SW1 A;  5CXW A;  1LSW A;  4HIA A;  2DMW A;  3T4K A;  2XD5 A;  3S7Q A;  2JCH A;  1W63 M;  3B47 A;  2X02 A;  4OOM A;  1XJ6 A;  3JYI A;  2VGL S;  2C6W B;  4LV2 A;  5CRF A;  1ES2 A;  1MWS A;  1TEM A;  5EVI B;  1KVL A;  3NIA A;  3T4O A;  3Q7Z A;  5DF9 A;  3UPP A;  5KSH A;  1TS7 A;  1F5M A;  3CPT B;  4N9K A;  1K56 D;  2HP6 A;  3QP5 A;  1NRJ A;  2DCF A;  2KX6 A;  2Y2N A;  3DTI A;  3P98 A;  1K56 A;  2VV8 A;  4LCM A;  2L1M A;  3T1Q B;  2ZQ8 A;  3EOI A;  1BSG A;  1XX2 A;  3NBL A;  5FQK A;  4BLM A;  2Y79 A;  4OLG A;  3ZCZ A;  3TG9 A;  3W4Q A;  2EFU A;  3PAG A;  5J8X A;  4HI4 A;  4B4X A;  1ESI A;  3HLB A;  1MPL A;  4I3J A;  4S2I A;  4BL2 A;  2L0W A;  3O87 A;  4WEK A;  4DF6 A;  5A91 A;  4LLO B;  2ZL1 A;  4WN5 A;  1E3U D;  3LIE A;  4JGO A;  2HJE A;  1BLS A;  3A3D A;  3W4P A;  3WWX A;  4IVK A;  5FI2 A;  1AXB A;  4X6T A;  2JHE A;  3GSG A;  4ZJ3 A;  2JKT I;  3UMD A;  5HPF A;  4UQI S;  3NHQ A;  4DE0 A;  4R0Q A;  3P01 A;  3TW8 A;  4XT2 B;  1NRF A;  4P6Z S;  3D72 A;  1PRQ A;  3BY8 A;  3OPL A;  3MS6 A;  3GR2 A;  3BLS A;  3RXW A;  2EX6 A;  4ZJ1 A;  4FD8 A;  1CQA A;  2XK1 A;  1HTZ A;  1ZKJ A;  3ZYT A;  1MWT A;  1DJC A;  2NUT C;  3OPR A;  3VSK A;  3BQA A;  1YLW A;  1XA1 A;  3IXG A;  1CF0 A;  2EWV A;  3JVV A;  5F1F A;  1Q2P A;  4WF0 A;  4M4X A;  4CPK A;  2ZBB A;  5F1G A;  5HX9 A;  4Z9Q A;  2KLI A;  3SS3 A;  1IEL A;  2WGW A;  5AVF A;  2PU2 A;  3LIA A;  3PAE A;  4YOF A;  4BQM A;  4I38 A;  2ACG A;  2E8J A;  1M40 A;  1XXM A;  2ZJ9 A;  5TFQ A;  4IUH A;  4GCZ A;  3MZF A;  4HQA A;  1PWC A;  3IXH A;  5TJJ A;  4EES A;  2D01 A;  3CI6 A;  1GSX A;  4U0T A;  3LI9 A;  2OAQ 1;  5J7E A;  4WL9 A;  5DKK A;  4EXO A;  1PI4 A;  1XKZ A;  2ZD8 A;  3Q7V B;  4JXW A;  4IBR A;  3KYQ A;  4DE2 A;  1G5U A;  3CHW P;  5IHV A;  3TJZ C;  2VV7 A;  2O9B A;  2AVX A;  2Z2L B;  4KG2 A;  5HAR A;  2R9W A;  3BFG A;  4UA7 A;  3IH8 A;  3H7W A;  1T1A A;  3NDE A;  4OKP A;  4HOI A;  3MF0 A;  2VGL M;  2V2F F;  1DP6 A;  4E3L A;  3N6I A;  2IWD A;  4E3K A;  4HJ4 A;  2HDS A;  1GHI A;  1XA7 A;  1JTG A;  3VOY A;  4GS9 B;  4O7D A;  2EXA A;  3HCY A;  3FG8 A;  3WRZ A;  1K54 A;  1JNU A;  2JKG A;  3UPO A;  1F9I A;  3NUL A;  2FFY A;  3LR4 A;  3BWL A;  5FAP A;  2B02 A;  4QY5 A;  1XJ3 A;  5IU1 A;  3FPW A;  5DF7 A;  3MKF A;  2ZM0 A;  1G28 A;  4MMN A;  2QYB A;  3HLF A;  3PTE A;  2PT7 A;  2W3G A;  2ZMA A;  4HHD A;  3GEC A;  1O7E A;  2V1B A;  4NXE A;  3V3S A;  2V0W A;  1IYS A;  4GDN A;  3CUE C;  3UPN A;  1W79 A;  1IKI A;  1PZP A;  5D3O A;  1LT0 A;  4JGQ A;  1SZV A;  3I7J A;  2ZLY A;  1PWD A;  4GDB A;  1LLB A;  2A24 A;  3F1O A;  4K91 A;  2XD1 A;  3FV7 A;  5FQM A;  4LCL A;  4XUX A;  1E25 A;  3ZGA B;  4DE1 A;  5HZH A;  3NOP C;  4UQI M;  1ZTU A;  4JKT A;  3OBF A;  1MY8 A;  2G2U A;  4R38 A;  5HDC A;  5G4Z A;  4P6Z M;  2RCX A;  4MBH A;  1P9W A;  3BFD A;  3IF6 B;  3DWZ A;  2Z2M B;  1XJ2 A;  2H0Y A;  3T1R A;  5CHJ A;  1FSY A;  3PBO A;  2JKT M;  3ICY A;  3RXX A;  4OVD A;  2ZM8 A;  1W5D A;  4PKY A;  3ZFZ A;  3M2J A;  2H0T A;  3AGF A;  4UA6 A;  2XRN A;  1IYO A;  5EM1 A;  1EWZ A;  5HAP A;  2P7J A;  5KIZ A;  3LIF A;  2Y2I A;  1P0Z A;  5FAS A;  3O5Y A;  2XR0 A;  3IWI A;  4KUO A;  3VP0 A;  3E4O A;  3KYE A;  2V20 A;  5HDD A;  2WAE A;  3IH9 A;  4Q0H A;  3CZD A;  2A49 A;  4Y0O A; 
#chains in the Genus database with same CATH homology
 2JC7 A;  3OPH A;  4E3I A;  4QU3 A;  2J7V A;  2ZC6 B;  4KG6 A;  1ALQ A;  1RGZ A;  3LCE A;  1N4O A;  2B5R A;  5FSR A;  3IF5 A;  3SS4 A;  3IF6 C;  3IHA A;  3V50 A;  1YMS A;  3FWL A;  1HD8 A;  4DDY A;  4S2M A;  4DXC A;  1LL5 A;  1M6K A;  1XP4 A;  2HDR A;  1MBL A;  3FYZ A;  4U0X A;  5GHZ A;  4WBG A;  1L0E A;  3HVF A;  4E3J A;  4YIN A;  1PWG A;  3LEZ A;  3FZC A;  1JWV A;  3C4O A;  3HUO A;  2Y4A A;  4GNU A;  4LV3 A;  2WZZ A;  4KZ3 A;  1NJ4 A;  4E6W A;  3IWO A;  4ZDX A;  4X69 A;  4IVI A;  2QMI A;  5EVL A;  1G68 A;  4EBL A;  4E3N A;  3NC8 A;  4KZ8 A;  3UE0 A;  1NZU A;  1LL9 A;  5E43 A;  3V5M A;  4GKU A;  2PU4 A;  4S2N C;  5AQ7 A;  5HAI A;  3VFF A;  4PM5 A;  3MXR A;  5A92 A;  2P9V A;  4OON A;  5EE8 A;  3DTM A;  3UNW A;  2Q9M A;  2Y59 A;  4ZJ2 A;  1IKG A;  1HZO A;  4JXS A;  1W8Q A;  4P85 A;  2A3U A;  1NY0 A;  4K0X A;  4RX2 A;  3DWK A;  3UN7 A;  1KGG A;  1MXO A;  3N8R A;  4JBF A;  1N9B A;  4KZ5 A;  1ERQ A;  4KG5 A;  3WS4 A;  2QZ6 A;  4PMA A;  4OP8 A;  1K38 A;  2Y2P A;  5A93 A;  3UDX A;  2GDN A;  4R3B A;  4KZ4 A;  5CTN A;  3IF6 A;  1K6R A;  3G31 A;  1FR6 A;  4Y0U A;  4HES A;  4N1X A;  5CXW A;  2XDM A;  2XD5 A;  4OPY A;  4R4S A;  3IXD A;  3V39 A;  4R3J A;  4KZ9 A;  5I94 A;  2JCH A;  2OLU A;  4IED A;  4PM9 A;  2X02 A;  1RGY A;  4OOM A;  3JYI A;  3C5A A;  2ZQD A;  1SCW A;  4DRT A;  4FSF A;  2C6W B;  4JXG A;  4LV2 A;  5CRF A;  3GV9 A;  3VP2 A;  2BLS A;  3BFC A;  2EXB A;  5L2F A;  1ES2 A;  1I2W A;  1MWS A;  3N8L A;  1K57 A;  2X01 A;  1TEM A;  1L0F A;  5JYO A;  3VP4 A;  5EVI B;  3OCL A;  1K25 A;  1KVL A;  1JTD A;  3O86 A;  4P87 A;  4E3O A;  2EX2 A;  3NIA A;  5DTS A;  3Q7Z A;  5DF9 A;  3UPP A;  5CED A;  2Q9N A;  5KSH A;  3VP1 A;  3SOI A;  4N9K A;  3WS5 A;  5F83 A;  1K56 D;  3ZG7 B;  4QHC A;  2HP6 A;  4RX3 A;  4EV4 A;  1WYB A;  2DCF A;  1DY6 A;  2Y2N A;  5TR7 A;  4OPZ A;  3VP3 A;  3P98 A;  2WGW B;  4OQH A;  1K56 A;  5E2E A;  5TGF A;  1I2S A;  1CI9 A;  4LCM A;  3G34 A;  5GL9 A;  4S2K A;  1FOF A;  2ZQ8 A;  1WE4 A;  4GD8 A;  4KZA A;  4GB7 A;  1BSG A;  1RCJ A;  1ES4 A;  2ZQ9 A;  1XX2 A;  3IHB A;  3N7W A;  3NBL A;  2RL3 A;  4R1G A;  3Q81 A;  1PW8 A;  3OC2 A;  3VSL A;  5FQK A;  2WKH A;  2DRW A;  4BLM A;  2Y55 A;  5EUA A;  1ERM A;  1O07 A;  4R23 A;  4OLG A;  3ZCZ A;  1S0W A;  3TG9 A;  3HLD A;  3HRE A;  3W4Q A;  4WMC D;  3E2L A;  1K54 C;  5HL1 A;  2EFU A;  3PAG A;  1K55 A;  4B4Z A;  4YFM A;  3PBQ A;  5J8X A;  1ESU A;  1G6A A;  4JF5 A;  1GCE A;  4B4X A;  3ZG5 A;  1ESI A;  4MEZ A;  3HLB A;  4WMC A;  1BLC A;  1MPL A;  4S2I A;  4U3T A;  2ZC4 B;  5AQ9 A;  5CGX A;  3ZNY A;  4BL2 A;  3O87 A;  4WEK A;  4RVA A;  4DF6 A;  5A91 A;  1IEM A;  3Q1F A;  4KQR A;  5EVI C;  1E3U D;  3HLG A;  3SH7 A;  4GD6 A;  4QY6 A;  1SKF A;  1CEG A;  2WAD A;  5GLC A;  4EBN A;  3ZVT A;  2QPN A;  3G30 A;  5CGW A;  3GRJ A;  3IQA A;  1H8Y A;  1BLS A;  3A3D A;  4R4R A;  4RA7 A;  3W4P A;  4IVK A;  1SDE A;  5FI2 A;  3WWX A;  5FAO A;  1LHY A;  1AXB A;  4QB8 A;  4OH0 A;  4X6T A;  5GLD A;  4OP5 A;  3SH8 A;  1EI5 A;  3GSG A;  4KZ7 A;  4ZJ3 A;  5JYP A;  4C6Y A;  1YM1 A;  4FH2 A;  3Q07 A;  4DE0 A;  4R0Q A;  4EBP A;  1YT4 A;  1PYY A;  2XFT A;  4Y7P A;  3BM6 A;  1GA9 A;  1NRF A;  3HLE A;  4ID4 A;  1FR1 A;  4WZ4 A;  3A3J A;  1JWZ A;  2ZC7 A;  3OPL A;  5CTM A;  5GHX A;  3GMW A;  3A3F A;  2VGJ A;  3GR2 A;  3WS1 A;  1CI8 A;  2G2W A;  2OLV A;  3BLS A;  3RXW A;  2EX6 A;  4ZJ1 A;  4FD8 A;  4P0M A;  1IYQ A;  1I5Q A;  2WKI A;  5DTT A;  1KDW A;  3D4F A;  3PBS A;  5EVI D;  1ES5 A;  3S1Y A;  2XK1 A;  1JVJ A;  1HTZ A;  1YLT A;  1ZKJ A;  3CJM A;  1XPB A;  1MWT A;  3VOZ A;  1DJC A;  3OPR A;  4S2P A;  3VSK A;  3TSG A;  5BOH A;  1FCO A;  3HLC A;  4GOG A;  1H8Z A;  4LV1 A;  5EVI A;  1YLW A;  2R9X A;  1XA1 A;  3IXG A;  4A5R A;  5F82 A;  4D2O A;  3RJU A;  2Y2G A;  5HW3 A;  2P74 A;  1FCN A;  1ZG6 A;  3EQU A;  4E3M A;  1BTL A;  1PZO A;  1FQG A;  4EWF A;  4Q8I A;  3BEC A;  5F1F A;  4MBF A;  2I72 A;  1Q2P A;  2J9P A;  2ZC5 B;  1KDS A;  1KVM A;  5M1A A;  5DF8 A;  4PM6 A;  1S6R A;  4CPK A;  4GN2 A;  3WS2 A;  5GLB A;  1K6S A;  4KZ6 A;  5F1G A;  3FKV A;  1NYM A;  4Z9Q A;  5HX9 A;  3SS3 A;  1IEL A;  2WGW A;  2PU2 A;  4EUZ A;  5EOO A;  3PAE A;  4Y0T A;  5AQA A;  4OPQ A;  4BQM A;  1ERO A;  4NET A;  5HFO A;  3HBR A;  1JWP A;  1XGJ A;  2JE5 A;  4KEN B;  2Y2O A;  4N9L A;  4S2N A;  2PBY A;  1M40 A;  1MWR A;  1XXM A;  3IXB A;  2ZJ9 A;  5TFQ A;  4KQQ A;  5A90 A;  1VM1 A;  3MXS A;  3MZF A;  1PWC A;  2P9V B;  2XH9 A;  5KZH A;  1NYY A;  1YLY A;  3IXH A;  1LI0 A;  4X68 A;  4PPR A;  1TVF A;  4U0T A;  2HDQ A;  1BT5 A;  2Y2L A;  4LV0 A;  1TDG A;  2E8I A;  1PIO A;  2XLN A;  4M3K A;  4QD4 A;  1BLH A;  2HPB A;  1PI4 A;  3G32 A;  3UE3 A;  3MFD A;  1XKZ A;  4WM9 A;  2ZD8 A;  4C3Q A;  3Q7V B;  1YQS A;  4JXW A;  4PM7 A;  3V3R A;  4IBR A;  2WYX A;  3MZE A;  5DVA A;  4X55 A;  5GHY A;  3QNB A;  4DE2 A;  1DJA A;  3VFH A;  4C75 A;  3WRT A;  1FCM A;  3TOI A;  4WEL A;  1SHV A;  3OZH A;  5IHV A;  3ZDJ A;  1DJB A;  4QJG A;  4ZTK A;  2OSU A;  4DKI A;  3M6B A;  2Z2L B;  4K0W A;  4WYY A;  4F94 A;  4KG2 A;  5HAR A;  1J9M A;  3N8S A;  3MBZ A;  2EX8 A;  3WS0 A;  2R9W A;  4P6B A;  4OQI A;  3S4X A;  1ZG4 A;  3BFG A;  1WYC A;  2Y91 A;  4UA7 A;  3IH8 A;  2OV5 A;  3UO9 A;  3NDE A;  1CK3 A;  3GVB A;  1H5X A;  2Y2H A;  4OKP A;  1ONH A;  2ZQ7 A;  4RYE A;  1RP5 A;  4S2J A;  1HVB A;  5GLA A;  3UDF A;  1KE0 A;  4E3L A;  1E3U A;  1KE3 A;  2V2F F;  4XUZ A;  3N6I A;  1KGF A;  3AGE A;  2IWD A;  1BUE A;  4BEN A;  2Y2Q A;  5M19 A;  1SDN A;  4E3K A;  3G35 A;  4JXV A;  2HDS A;  5FQI A;  1LI9 A;  1GHI A;  1XA7 A;  1JTG A;  5U47 A;  3VOY A;  5FI6 A;  4JF4 A;  4MBK A;  1KE4 A;  4NK3 A;  4O7D A;  2BG1 A;  2EXA A;  3VMA A;  2ZQA A;  2XQZ A;  2C5W B;  4CJN A;  2XGN A;  4LEN A;  3WRZ A;  2CC1 A;  1K54 A;  4S2L A;  3A3I A;  4FCF A;  2WZX A;  3UDI A;  3UPO A;  1KGE A;  3E2K A;  3C7U A;  2FFY A;  3N4I A;  4HBU A;  5FA7 A;  1CEF A;  3HL9 A;  3BFF A;  5CGS A;  4UHU A;  1BUL A;  3CG5 A;  3Q82 A;  4BD1 A;  4DDS A;  1K4E A;  3HLW A;  5FAP A;  4PM8 A;  5CEC A;  3S22 A;  3PBT A;  1K4F A;  2EFX A;  4QY5 A;  5E2F A;  2Y2M A;  4X53 A;  5DF7 A;  2XF3 A;  2V1Z A;  3GTC A;  1K57 C;  3MKF A;  2ZM0 A;  1MWU A;  3O88 A;  4GZB A;  3IWQ A;  3OCN A;  2IWB A;  3OPP A;  4XXR A;  2ZC3 B;  3HLF A;  5FI7 A;  3W4O A;  3PTE A;  3FKW A;  1W7F A;  2HDU A;  1GA0 A;  2ZMA A;  2ZM2 A;  4HEF A;  4IBX A;  3M2K A;  4N92 A;  4BJP A;  1O7E A;  1Z6F A;  2H5S A;  3SS5 A;  4UAA A;  4WZ5 C;  2HP5 A;  2EX9 A;  3HUM A;  1L2S A;  3V3S A;  2WUQ A;  1IYS A;  1L0D A;  1YLP A;  3EQV A;  3LO7 A;  4GDN A;  4BD0 A;  5CEB A;  5HAQ A;  5KSC A;  3UPN A;  1W79 A;  1ES3 A;  1IKI A;  1PZP A;  2WGI A;  3G2Z A;  4JLF A;  3I7J A;  3BRM A;  5D3O A;  1U60 A;  2ZLY A;  4OOY A;  5CHM A;  4JF6 A;  1PWD A;  3BFE A;  1L0G A;  3M6H A;  4S2O A;  4WEJ A;  1GHM A;  4GDB A;  3HUN A;  1LLB A;  5EPH A;  3Q7V A;  4B88 A;  3ZG9 B;  2WKE A;  2JBF A;  3QNC A;  2Y2K A;  4MLL A;  3ZVW A;  3PBN A;  4K91 A;  2XD1 A;  3NY4 A;  3FV7 A;  5FQM A;  4LCL A;  1ONG A;  1QMF A;  2VGK A;  2H10 A;  4OOL A;  4XUX A;  5E2G A;  5KMW A;  1E25 A;  2J8Y A;  3ZGA B;  4UA9 A;  3O3V A;  4DE1 A;  3SH9 A;  2XEP A;  1C3B A;  5FAQ A;  3LY3 A;  4JKT A;  1PI5 A;  1MY8 A;  4EQI A;  1K55 C;  2J9O A;  3LY4 A;  3MZD A;  2G2U A;  1E4D A;  3AGD A;  2FFF B;  2RCX A;  3ISG A;  3ZHH A;  4MBH A;  4JPM A;  3ZG8 B;  4DXB A;  2WK0 A;  1YLJ A;  3BFD A;  3ZG0 A;  3IF6 B;  4DE3 A;  3PBR A;  1VQQ A;  3DWZ A;  1W8Y A;  2UWX A;  4WZ5 A;  3W8K A;  5E2H A;  2Z2M B;  2IWC A;  3ZNT A;  1TDL A;  4OQG A;  2H0Y A;  3GQZ A;  1IYP A;  2ZQC A;  3BLM A;  5CER A;  4BL3 A;  4ZBE A;  5CHJ A;  3C7V A;  1FSY A;  3MKE A;  4FH4 A;  3PBO A;  3RXX A;  4X56 A;  3BEB A;  4OVD A;  2ZM8 A;  1W5D A;  3CMZ A;  5FQ9 A;  3DW0 A;  5M18 A;  5G18 A;  3ITB A;  4N1H A;  1Y54 A;  1BZA A;  3M2J A;  4H8R A;  5AQB A;  3ZFZ A;  3G2Y A;  1QME A;  2H0T A;  3AGF A;  4MNR A;  4UA6 A;  1NZO A;  1IYO A;  4KQO A;  3C4P A;  4KZB A;  1EWZ A;  4E6X A;  5HAP A;  3UY6 A;  4OPR A;  2Y2I A;  3NCK A;  5EOE A;  5DTK A;  3IT9 A;  4HBT A;  1Q2Q A;  2WGV A;  3NI9 A;  1FSW A;  2HP9 A;  3ITA A;  3P09 A;  5FDH A;  5FAS A;  3QHY A;  3B3X A;  4OLD A;  4OQ0 A;  2XR0 A;  3BYD A;  2Y2J A;  3IWI A;  3VP0 A;  5CHU A;  1BLP A;  1NXY A;  3G4P A;  3UE1 A;  1ZC2 A;  4L0L A;  2WAF A;  2X71 A;  1XGI A;  2V20 A;  1MKI A;  1PW1 A;  4ZAM A;  5FQJ A;  2DNS A;  5FAT A;  2WAE A;  3NDG A;  1YMX A;  5EEC A;  3IH9 A;  1GHP A;  1YLZ A;  2XFS A;  3A3E A;  3CZD A;  2A49 A;  1OME A;  4Y0O A;  5FQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...