3F1PA

Crystal structure of a high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
FKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3f1pA00
1F9IA 5HWVA 1LSWA 4LRZE 3KX0X 1OTBA 3LYXA 3LIEA 1DRMA 2INWA 1OTEA 3H7WB 4HP4A 4L9GA 4MN6A 1KOUA 3IS2B 1D06A 1NWZA 1T19A 3IBRA 2PHYA 1EW0A 3B33A 1GSVA 3E4OA 2YKFA 4YWZA 2A24A 3A0VA 4BBVA 1LL8A 3VOLA 4L9EA 2OWJA 4L9FA 2VEAA 1ODVA 2VV6A 2W27A 4HI4A 5I5LA 1OTAA 1WA9A 1UGUA 1N9OA 3HJKA 1UWPX 3K3CA 3NOUC 1T18A 4GCZA 4WUJA 5HD5A 5TBMA 3UE6A 1D7EA 2V0WA 4NXGA 3VE3A 4HH3A 1T1BA 4HOIA 3H7WA 2GJ3A 5HDDA 3RH8B 3FC7A 2PR6A 5G4ZA 2M1CA 3ICYA 4GS9B 3MJQA 4GW9A 4NXFA 3NOPC 1F98A 2QHKA 4NXEA 3UB6A 3UMDA 4M4XA 2I9VA 4HNBA 1DP9A 3LIAA 5AVFA 2EA9A 2PDRA 5HD3A 3BY9A 3OLOA 4HH2A 1XFNA 2KX6A 3RTYA 1N9NA 4R70A 1LT0A 1S4RA 4JGRA 5HDSA 1V9YA 2PR5A 2L1MA 2V0UA 3H82B 5DJTA 4I3IA 1Y28A 3D72A 3HJIA 1T1AA 1XJ6A 1S67L 5DKKA 3PYPA 3IS2A 3MQQA 4HP9A 5TBMB 4EETB 4PKYA 5HSQA 2H28A 4EERA 3CWFA 3G6OA 3P7NA 2QWSA 3UB7A 4WLAA 1OTDA 1OT6A 2PD8A 5IU1A 5J3WA 5A8BA 2VV7A 1LSVA 1P0ZA 1S1ZA 2ZOHA 3LI8A 4EQ1A 1XJ3A 5EFWA 3LIFA 1XFQA 4HIAA 5IS1A 5KIZA 1XJ4A 4EXOA 3F1NB 4HJ6A 4HY8A 4I5SA 1VB6A 4B9OA 4JGOA 1G28A 2WKRA 4JGQA 5F5YA 3MR0A 2D02A 1UWNX 2JN7A 2P7JA 4LLOB 1S66L 4KQDA 4NXBA 1DP6A 1GSWA 1S1YA 3F1OB 1TS8A 3NOTC 5J4EA 2D01A 5HWTA 3VE4A 2QKPA 4WF0A 5DJUA 2J80A 2V9AA 1BYWA 4HJ4A 4R3AA 5DKLA 5AVEA 4EW7A 3ZQ5A 3CLOA 2OWHA 2K7SA 4LRXC 4R6LA 5F68A 3LIDA 1OJ5A 2WKPA 4K08A 3CAXA 2HV1A 1TS6A 3EWKA 2VLGA 2R78A 3F1PB 4KUKA 4WN5A 4EESA 3GDIA 4HJ3A 2VV8A 4H6JA 4I3JA 3EEHA 1DP8A 5HZHA 2QJ7A 3H9WA 3SW1A 4E04A 2QJ5A 3PHYA 3F1OA 4PKYG 3LUQA 1T1CA 1XJ2A 4JGPA 4EEUA 2B02A 3ULFA 3LI9A 1OTIA 4F3LB 4LPZA 4R38A 2A24B 3A0SA 1X0OA 4MN5A 3MQOA 4GHIA 4XT2B 5HDCA 2Z6CA 4BBUA 4RQ9A 2CMNA 3MXQA 1JNUA 2PYPA 3T50A 4DJ2A 1OJGA 1V9ZA 3F1NA 3MFXA 2KDKA 2YKHA 4H6JB 3K3DA 4I39A 3E4PA 3UMEA 3NHQA 1MZUA 2ZBBA 2V1BA 3GECA 2JHEA 2PYRA 1TS7A 5F6AA 2W0NA 5F69A 2WKQA 3LICA 4DJ3A 4HQAA 5HWWA 4GS9A 2ZOIA 2L4RA 3UB9A 5J7EA 3FG8A 1S4SA 3LIBA 3C2WA 3NJAA 4HHDA 4I38A 1OT9A 3E4QA 4KUOA 2Z6DA 3UB8A 4EEPA 3A0RA 3F1PA 1TS0A 2BASA 2PD7A 2V1AA 1LSXA 4I3AA 4GHIB 3C8CA 1N9LA 4LRYC 1GSXA 3BWLA 4WL9A 4XT2A 2OOLA 5G4YA 2L0WA 3BY8A 4F3LA 1P97A 4BBTA 3H82A
chains in the Genus database with same CATH superfamily
3OPLA 4QWOA 3OPPA 2INWA 3TSGA 1S6RA 5I94A 1TF1A 4FH4A 3T12B 3IBRA 3CPTB 3IX3A 2WGVA 3NY4A 3D4FA 2W3EA 4DF6A 2J3TD 1T18A 1W63M 4KZ5A 5M19A 3UB6A 2M7UA 3MKEA 4QHCA 2H0TA 3CITA 5C5KA 4Q8IA 3V67A 2Y2KA 1DJBA 3N6IA 1F2KA 2HP5A 3UE3A 3SS3A 5IS1A 4X6TA 1H3QA 1BLPA 2PU2A 4B88A 3MKFA 1ZTUA 2Y2QA 3MSHA 3MR0A 1SCWA 4LLOB 3OZHA 5FASA 5FI7A 2QKPA 4O7DA 3C4OA 2W3DA 3KYZA 3IBJA 5EPHA 2R9WA 3IXDA 1AWIA 5FQIA 4DKIA 2QJ5A 4S2KA 1ERMA 2W3GA 2WUQA 1X0OA 1PW1A 4MN5A 3ZNYA 2PYPA 5L10A 2PRFA 3RXXA 2KDKA 4F94A 3KYEA 3EEAA 1GA9A 2JHEA 1TS7A 2PYRA 3MBZA 1M6KA 1PRQA 3Q1FA 4HEFA 2ZOIA 1S4SA 4CQHA 3C2WA 2C6WB 4QB8A 4DJ2A 4GHIB 3CUEC 4R3BA 4X1LA 3NC8A 2P08A 3KSIA 1DRMA 4S2JA 2VK3A 4PPRA 3UE1A 2A3UA 3PBNA 3Q7VB 2VEAA 2A2LA 2VV6A 2W27A 2EFXA 1UWPX 3UE6A 4KG2A 3ZG7B 5EVLA 5FDSA 3BY9A 4WMCD 2XSSA 1YT4A 4UQIS 4R4SA 3ZYTA 1Y28A 2LB9A 1G6AA 1VQQA 3QP4A 1NRJA 4EETB 4KENB 1CEGA 5CXWA 4Y0TA 1XFQA 2ZC4B 1K4FA 4HY8A 2EWVA 5TGFA 5CGWA 2JBFA 5DF8A 1GSWA 3UDIA 3I7JA 5DTKA 1HTZA 3UPPA 1K4EA 2VGLM 4Q0JA 4X55A 2DMWA 3OC2A 1HZOA 4OQGA 2WK0A 4JGPA 1ACFA 5EOEA 3ZG5A 1OJGA 5FATA 3LCEA 4S2NC 5BOHA 1BT5A 2V1BA 2W0NA 2ZQCA 5FQMA 1N9BA 2Z6DA 3T50A 3V3RA 5G4YA 5GL9A 2OOLA 1TEMA 2I72A 5EECA 2XA7S 1LI0A 1I5QA 3H7WB 2ZQ9A 1T19A 1EW0A 4X1MA 1GSVA 1MWTA 3T4OA 4EBPA 4BQMA 4ZJ2A 3HLEA 5E43A 5L2FA 5I5LA 3S22A 1VETB 4NXGA 3V50A 1K6SA 2EXBA 4OQ0A 2PR6A 4EU0A 2VGJA 3LIAA 4XXRA 4KZBA 4U0XA 3IT9A 5DJTA 2A49A 3D72A 3B47A 1ES5A 2XLNA 3PYPA 3RFBA 2KOIA 4C6YA 3IX8A 5HSQA 4R3JA 3A3IA 1S1ZA 1ESIA 5EFWA 1PFLA 2P7JA 2Y2LA 5JYPA 4R3AA 5AVEA 4Y0OA 4GDNA 3BQAA 3S1YA 3ZQ5A 2K7SA 5FAQA 3WRZA 4EESA 1CQAA 3FKVA 3MZFA 4LV1A 5G18A 3M6BA 3C7VA 3F1OA 2Z2MB 4CLCD 2LB5A 4R4RA 1YPRA 1OTIA 1FSYA 4II7A 1AXBA 4S2LA 1JNUA 2ZL1A 2HDUA 4IVKA 3SZTA 1FOFA 3E2KA 5F69A 3GTCA 1P9WA 3OPRA 3QP6A 4NK3A 4IBXA 1CF0A 2VJWA 3LIBA 4KUOA 4BWIA 4JXSA 2BASA 2K31A 2VX8A 4FUWA 3GVBA 5KSCA 4E3LA 4K91A 3VP2A 3NECA 5FQKA 4EWFA 3E4OA 1F5MA 3A0VA 2OWJA 3CMZA 4R23A 3HLWA 3ZGAB 3K3CA 2ZMFA 3OCNA 4UAAA 3SS4A 3NI9A 4OLGA 3MJQA 3UNWA 3W8KA 2PDRA 4NEED 5M18A 4ZTKA 5IHVA 4E3IA 3HCYA 1SHVA 2ZQ7A 1SDEA 3BW6A 3IS2A 1IYQA 3BFEA 4EQ1A 5HPIA 2WAFA 2VGLS 5FI2A 4NETA 4JGOA 3VOZA 1QMFA 2D02A 3MZEA 4JF4A 3VE4A 4ID4A 3TJZC 2IWDA 3MF0A 4KZ6A 1SKOB 2WKPA 3G30A 3CAXA 2V8CA 2VLGA 5HW3A 2QZ6A 4H6JA 5HZHA 1CJFA 2FZ0A 1SZVA 1M40A 4QD4A 4OOMA 3TRCA 4MMNA 1KDWA 1MKIA 4P6ZM 3MQOA 4GHIA 4Q0HA 4MCWA 2PBDP 3U2AA 4OP8A 2O9BA 4H6JB 3BRMA 3NHQA 1MZUA 3VSKA 4HQAA 2L4RA 1W63Q 3C30A 4G3WA 3DTKA 3LR3A 5FEGA 2W1TB 3ZG9B 3T4TA 1LI9A 3D9YA 3H82A 1JWPA 3QHYA 2Y2NA 2QMIA 4N1XA 1OMEA 1JWZA 1ES3A 5EUAA 2O0YA 2G2UA 4GZBA 4Z9QA 1NYMA 1LL8A 1N9OA 1W5DA 4HH3A 3MXSA 5FL3A 3FZCA 1O7EA 4DXCA 4IVIA 2Q0OA 1LHYA 3LR0A 4JGRA 4IUKA 5IT5A 2PR5A 2L1MA 4PMAA 3ZNTA 2HP9A 3BEBA 4X53A 1XA7A 3T4QA 4DE3A 3TG9A 3G6OA 5EE8A 2QWSA 4QU3A 1OTDA 1LL9A 1P0ZA 1MKMA 1PNEA 2GDNA 4KG5A 1K56D 5K5BA 1NJ4A 2Q9NA 1XPBA 2H10A 2Y2OA 3QP2A 1YLZA 1S66L 3AGEA 2UWXA 3G2YA 3BFCA 5LBRA 4BL3A 3LIDA 2HV1A 4QJGA 3P09A 4Y15A 1DP8A 4OONA 2WZZA 1YKDA 3LY4A 1PZPA 4WEJA 1PWGA 3MXQA 2XEPA 1FR1A 5FQ9A 2WKQA 4IHQA 3V5MA 2CC1A 4XUZA 1G6OA 2IWCA 1RGZA 3O86A 1LSXA 1N9LA 1LLBA 2M7VA 1PWDA 3W4PA 4LENA 5A92A 3IS2B 4BD0A 3IQAA 3QP5A 5F82A 4WZ4A 2AVXA 2XGNA 3UN7A 1ZKJA 4WL9A 1ALQA 2V0WA 2XRNA 3IXHA 4OQHA 4HOIA 3H7WA 3IWQA 2FFYA 3WS0A 1JTDA 5AVFA 2Y4AA 1W8QA 5HL1A 1G5UA 2XROA 4UQIM 5L8MA 4ETXA 2JKGA 4BLMA 3VFHA 2WKEA 5HPFA 2PU4A 2P74A 3UB7A 2DCFA 4UA7A 2J9PA 4DXBA 1XJ3A 4HIAA 3BM6A 3UO9A 5GHXA 1G28A 3C5AA 4G3VA 1Z09A 1S1YA 3NOTC 5J4EA 3G2ZA 4PM9A 2K2NA 5AQ7A 1WYCA 4E3KA 2Y2MA 1FILA 4CLCA 2VV8A 4UHUA 3OBFA 3BFDA 4PM8A 4KZ3A 5KSHA 4E04A 4OLDA 4F3LB 4LPZA 3IWOA 4AFIA 5A93A 5HDCA 2B18A 4X56A 2WYXA 4DJ3A 2EX6A 2MJ6A 1HVBA 1OT9A 4EEPA 4X25A 2XH9A 3F1PA 4E3OA 4RYEA 1VETA 4E3MA 3PR6A 3ZFZA 3HJKA 2HJ9C 4LRZE 1K55C 3IXBA 1C3BA 4QPRA 3T4KA 5EM1A 3MXRA 4UA9A 5L07A 1OTAA 4ZJ1A 5HD5A 3GV9A 3W4QA 1IFQA 4R0QA 3T4SA 3C4PA 2OSUA 3KSHA 2Y2PA 5DF9A 3BQ8A 3T1QB 1IYPA 5E2HA 1P9RA 4FH2A 4OPQA 1XJ6A 3S4XA 1ES2A 4KZAA 2EX8A 3Q7ZA 4Y7PA 4Y2FA 4CLCB 2PBYA 1XKZA 3MQ0A 4EXOA 5HX9A 5GLBA 3LO7A 2J9OA 2WZXA 2WKIA 4UA6A 2G2WA 1JWVA 4JXWA 4OPRA 2OWHA 2PT7A 4K08A 3F1PB 4DDYA 4HJ3A 4KZ7A 3M6HA 1H0MA 4EBNA 1BLSA 2XQZA 4FCFA 4R38A 1FR6A 3M2KA 3HUMA 2W1TA 1YM1A 4BBUA 1V9ZA 5EOOA 4OH0A 5HL6A 4ZJ3A 4RVAA 1Q2PA 3WRTA 2VZWA 1WE4A 3UB8A 1YLYA 4B4XA 2V1AA 4LRYC 1PZOA 4WMCA 3ZDJA 2X71A 2W3HA 3LIEA 1IOUA 4MLLA 1L0FA 1KOUA 1D06A 1KDSA 3NULA 2PHYA 4CLCE 3G35A 4LFUA 4BBVA 4L9EA 4L9FA 1MXOA 3FPVA 5DTTA 2KLIA 5DF7A 1H8ZA 1D7EA 3K2NA 1SDNA 3BLSA 4OOYA 4KG6A 4MBHA 3D3OA 4YFMA 3VV4A 1MC0A 4BMWA 2XDMA 3ICYA 1FQGA 2GX5A 2I9VA 4DRTA 1KGFA 3BFGA 1MPLA 4Z1WA 3HJIA 1FCMA 3CWFA 4YNRA 3P7NA 2J3TC 1VEUA 1CK3A 5HAPA 2ZOHA 3LI8A 3O5YA 5FSRA 1K6RA 1BSGA 4HBUA 2R9XA 5GLCA 2BLSA 4I5SA 3N8LA 3U4LP 2J3WA 5F5YA 2JN7A 4NXBA 2D01A 3VSLA 1FIKA 1EROA 2DNSA 2Y2IA 1SKFA 2Y8HA 2H0YA 3PXPA 4PM5A 3CUEA 4E6XA 3ZHHA 2CMNA 2Y79A 3F1NA 3K3DA 4JF5A 5F6AA 2V8FA 4LV0A 1L3LA 4C75A 4IBRA 5JYOA 4I38A 4I3AA 3G31A 3WWXA 5AQ9A 3N4IA 5HDDA 4BBTA 5HWVA 3N8RA 3S7PA 3W4OA 1NZOA 3WS1A 2ZL1B 1NXYA 2A24A 1J3WA 3ZG0A 5DVAA 4WUJA 5TBMA 5E2GA 2EFUA 5CGSA 2M1CA 3NOPC 4GOGA 4PM6A 4M4XA 4HNBA 3KO6A 2KX6A 4EERA 4ZAMA 4CLCC 3VOYA 3HLFA 1E4DA 1ZC2A 4O01A 3R4KA 4WELA 5F1GA 3Q07A 1PWCA 2ZM2A 4GLQA 4GJ4A 1NY0A 4S2NA 1K0KA 1GHMA 1EWZA 5CECA 1I2SA 4LCMA 3F1OB 1TS8A 4PAUA 3HL9A 5TJJA 2XFTA 5EVIA 2NUPC 1ONGA 2ZM8A 1OJ5A 1JTGA 4BJPA 3PTEA 2Y55A 3B42A 3FKWA 1VM1A 1RP5A 4ZRRA 4GD8A 4ME4A 4XUXA 3EQVA 2G7UA 1YMXA 4RQ9A 2Y2JA 1K55A 4MEZA 3UMEA 1W79A 3HREA 3GR2A 4X68A 1SKOA 4F3LA 1L2SA 2WGWA 4OPZA 4S2OA 2ZM0A 4M3KA 1TDLA 3CHWP 1K54C 4WBGA 4KQOA 3EOIA 3ZCZA 1IEMA 2VA0A 2ZQAA 5EV0A 4S2MA 3KYQA 2JKTM 5CEBA 2OV5A 2JE5A 1PW8A 4GW9A 4K0WA 2WADA 3CPTA 3IX4A 3PBTA 4HH2A 2UV0E 3IHBA 3HLGA 5HARA 4R70A 1LT0A 3AGDA 1T1AA 4U3TA 5DKKA 3L9KA 1D1JA 1LL5A 4EBLA 5EVID 2OAP1 3Q7VA 5J3WA 5EVIC 4GN2A 1LSVA 4C3QA 4OVDA 5CHMA 2WKHA 4B93A 2NUTC 5FA7A 5CTNA 3F1NB 4FD8A 4B9OA 1YLTA 2EX9A 3N7WA 1PI5A 1RCJA 3FPWA 1NLZA 3JVVA 5J8XA 2V9AA 5DKLA 2ZC6B 2XD5A 2V20A 1ESUA 1XP4A 4UEYA 5MC7A 4IEDA 3LUQA 2WGWB 4MDZA 1A0KA 4Y0UA 4JF6A 2ZQDA 3QP8A 3VMAA 2HZ5A 2JKTI 5FI6A 5CERA 5HWWA 4GS9A 1O07A 1KE0A 3BFFA 3HLDA 5A8BA 1TDGA 3E4QA 2FH5A 4P0MA 5DFXA 1TS0A 5EVIB 3JYIA 4X69A 5HD3A 3VP3A 5F1FA 4GB7A 5U47A 3LYXA 4EUVA 3ZG8B 2HJEA 5TR7A 5E2FA 3R7WA 3GMWA 1WA9A 1N4OA 3IXGA 3NOUC 2Z2LB 1L0EA 4E3JA 3NCKA 5KZHA 4KZ8A 3M2JA 3DTMA 5A90A 2EA9A 2Y2HA 3OLOA 3S7QA 2IWBA 1XFNA 3KSGA 1JVJA 4OQIA 5TBMB 3Q81A 2H28A 2X01A 2HPBA 1VHMA 3JPUA 1XJ4A 5GLAA 1HLUP 2WKRA 3UY6A 3G4PA 2OLVA 3MS6A 4KQRA 3CLOA 3ITBA 4R6LA 3PAEA 1TD5A 3HVFA 4H8RA 4CJNA 1TS6A 4IJGA 1S0WA 1YLJA 1KVMA 4JLFA 2O9CA 3FV7A 4OP5A 2ZD8A 2Y59A 4MBKA 4I39A 3GECA 1U60A 3HUOA 3ITAA 4ESPA 1KGGA 1ZG4A 4N1HA 4FSFA 3VE3A 2L0WA 2J8YA 1LSWA 3A3JA 3C7UA 3S7OA 2W1RA 3LGOA 5EM0A 4DE0A 4L9GA 3HLCA 1ONHA 2PAVP 1BLCA 4O0PA 2ZJ9A 3SH9A 1CEFA 2OLUA 3DBAA 1PYYA 3GQZA 3VOLA 1ZHHB 4HI4A 3FYZA 4GCZA 3MFDA 5CX7A 3SW1A 3TW8A 1E3UD 4EV4A 3RH8B 1EI5A 1KE3A 1YMSA 3B3XA 1FCOA 4LGWA 3CZDA 3EQUA 1MWRA 3IF6B 3RTYA 2WGIA 1DY6A 2V0UA 3L7HA 5D3OA 3CJMA 1YAXA 4ETZA 2XR0A 3T1SA 3HBRA 4L0LA 3MZDA 1ERQA 5HFOA 3SS5A 3WS5A 4WLAA 2FFFB 2XK1A 3IWIA 3PBOA 5CTMA 1Z6FA 2XFSA 1I2WA 4OKPA 3PAGA 2X02A 2EX2A 1IKIA 1DP6A 3DTEA 5DJUA 3IH8A 4A5RA 4OOLA 2EXAA 4GD6A 1MY8A 4K0XA 1CI8A 3BLMA 3UDXA 4DMZA 2QJ7A 3Q82A 3PHYA 4KZ9A 5GLDA 3ULFA 1XGIA 1W8YA 3QNBA 3UPOA 3JVUA 5FAPA 2HF6A 3AGFA 2YKHA 3P98A 3E4PA 3SH8A 1YSPA 4BD1A 3NJAA 3A0RA 2PD7A 5TFQA 3BY8A 1P97A 1H5XA 1QMEA 4NKPA 1OTBA 1OTEA 4HP4A 4DE1A 3OPHA 2B5RA 3W2ZA 3HLBA 1H8MA 1VEUB 4YWZA 3QP1A 2JC7A 2RL3A 2VGKA 1ODVA 2GZAA 1T1BA 2GJ3A 4EQIA 3DAVA 4Y3IA 4JBFA 5AJGA 1DP9A 3V3SA 1K57C 5AQAA 4LCLA 2QPNA 1YLWA 4YOFA 2O99A 1Y4OA 4ARZA 4E3NA 1S67L 3UPNA 3MQQA 4HP9A 3DTIA 4E6WA 4MBFA 1BULA 4HESA 3PBQA 1L0GA 4RX2A 2HDSA 3LIFA 5KIZA 5M1AA 4KQQA 4HJ6A 4GKUA 1WYBA 1IYOA 2GNXA 1K54A 1E25A 1G68A 1E3UA 2ZC7A 1BZAA 1BYWA 1KVLA 4B4ZA 1YSQA 4KZ4A 4LV3A 4ZBEA 4I3JA 3EEHA 4CPKA 4LV2A 1DJCA 3LR4A 4PKYG 4S2PA 2ZC5B 2A24B 2ZLYA 3GSGA 4XT2B 4PM7A 2Z6CA 1PIOA 3DWZA 5GHZA 3T1XA 3OCLA 3MFXA 1XA1A 2Q9MA 4O8GA 3WS2A 2EWWA 4EEUA 3LEZA 3GRJA 5J7EA 4PHTA 3CG5A 4JXVA 3NIAA 4HBTA 5DTSA 4WN5A 3V39A 5EVEA 5HAIA 3KX0X 3KSFA 5CRFA 4MN6A 3VFFA 5CHUA 3VP0A 2WAEA 5CHJA 1ZG6A 2P9VB 4DE2A 4EUZA 1NYYA 2YKFA 2C5WB 1Y54A 4D2OA 3BYDA 2ACGA 4NG2A 1XXMA 2W3FA 3UMDA 3P01A 2JKRM 1NRFA 4BENA 4I3IA 3TE8A 3BECA 3RJUA 2E8IA 3PBRA 4PKYA 4JKTA 3LY3A 3ZVWA 1FSWA 4WM9A 1OT6A 4N9KA 3A3DA 4G3KA 1GHIA 2JCHA 4OPYA 2JKRI 4P6BA 1OPXA 3G32A 3IF6A 3UE0A 1MBLA 2O9AA 4LRXC 4RX3A 3O87A 2Y2GA 3EGXC 4ARZB 3GDIA 3E2LA 3E98A 4QY6A 1BUEA 5AQBA 4MNRA 1BLHA 2RCXA 2ZMVA 1XJ2A 4Y5FA 2B02A 5CEDA 2H5SA 4JXGA 4D60A 3RXWA 2DRWA 3ZVTA 3LICA 3R7WB 3QNCA 5F83A 3UB9A 4WEKA 3BWLA 4P85A 1K25A 5DFYA 1KE4A 1HD8A 3A3FA 1NWZA 2VKSA 1IYSA 2HGVA 1MWSA 3B33A 4DN0A 3CI6A 3IHAA 3T4JA 1TVFA 3UDFA 1UGUA 4GNUA 1K57A 2B95A 3FC7A 2P04A 1YQSA 4GS9B 4NXFA 1J9MA 3T4LA 4P87A 3VP4A 3SOIA 3C38A 3LEQA 1PI4A 1GCEA 1N9NA 2Y91A 4BL2A 2JKFA 1IKGA 3EGDC 3E0YA 3LR5A 4WYYA 4RA7A 5IU1A 1H8YA 2VV7A 3SH7A 1Q2QA 5A91A 3NDEA 3O3VA 1L0DA 2XD1A 1NLYA 3NDGA 4JGQA 1UWNX 4KQDA 5HWTA 2J80A 4HJ4A 5F68A 2QYBA 3EWKA 4KUKA 1ES4A 2R78A 3OOVA 2XF3A 4YINA 2HDRA 4Y13A 3H9WA 3T1RA 1RGYA 1IELA 1T1CA 2P9VA 1BTLA 2V2FF 2V1ZA 4GDBA 5GHYA 4R1GA 3VP1A 5FQJA 1YLPA 3LFVA 2ZBBA 1XGJA 3O88A 5FDHA 1W7FA 1K38A 2BTFP 2OAQ1 1F9IA 4WZ5C 5FEFA 4S2IA 1GHPA 4IUHA 5KMWA 4MN7A 5FQQA 1NZUA 4ZDXA 5HAQA 5L09A 5CGXA 4Y17A 3HUNA 3IH9A 4N9LA 5G4ZA 1F98A 2HDQA 3ISGA 3WS4A 1DJAA 2QHKA 4NXEA 3DWKA 5HDSA 1S4RA 2HP6A 4Q0IA 1V9YA 3H82B 2E8JA 3BJNA 3DW0A 4FOFA 1GA0A 2ZC3B 2PD8A 2IA2A 1CI9A 2ZMAA 3A3EA 1VB6A 4QY5A 1FCNA 3TOIA 3MMHA 3UB5P 4WF0A 1MWUA 4EW7A 3NBLA 5E2EA 1KGEA 1K56A 4P6ZS 3S7NA 4JPMA 3PBSA 1STZA 3LI9A 3A0SA 2J7VA 2BG1A 4DDSA 2XA7M 4WZ5A 2ZQ8A 1XX2A 3IF6C 3G34A 4N92A 3IF5A 4FTXA 3FG8A 5FAOA 4HHDA 3N8SA 4XT2A 3C8CA 1GSXA 4U0TA 3FWLA
chains in the Genus database with same CATH topology
5HWVA 4NKPA 1OTBA 2INWA 1OTEA 4HP4A 3S7PA 1TF1A 3IBRA 3W2ZA 1H8MA 2O0YA 4YWZA 2A24A 2W3EA 1LL8A 1ODVA 2J3TD 1N9OA 1T18A 4WUJA 5TBMA 1W63M 2GZAA 4HH3A 1T1BA 5FL3A 2GJ3A 4Y3IA 2M1CA 3NOPC 5AJGA 3UB6A 4M4XA 4HNBA 1DP9A 2M7UA 3KO6A 2KX6A 4YOFA 3LR0A 4EERA 2O99A 4JGRA 4IUKA 4CLCC 5IT5A 2PR5A 2L1MA 4ARZA 1S67L 4O01A 3CITA 5C5KA 3MQQA 4HP9A 3R4KA 3T4QA 3V67A 4WELA 3G6OA 2QWSA 1OTDA 3PBQA 4GLQA 4GJ4A 1P0ZA 1MKMA 3LIFA 3UE3A 5IS1A 5KIZA 1H3QA 5K5BA 4HJ6A 1ZTUA 3MR0A 4LLOB 1S66L 2GNXA 3F1OB 1TS8A 4PAUA 2QKPA 5TJJA 1BYWA 5LBRA 2NUPC 3LIDA 1OJ5A 1YSQA 2HV1A 2W3DA 3KYZA 4BJPA 3IBJA 4I3JA 3B42A 3EEHA 1DP8A 2QJ5A 3LR4A 4ZRRA 1YKDA 4PKYG 2W3GA 4ME4A 2A24B 1X0OA 4MN5A 3EQVA 4WEJA 2G7UA 4XT2B 2Z6CA 4RQ9A 3MXQA 2PYPA 3OCLA 3MFXA 2KDKA 3UMEA 4O8GA 2EWWA 3EEAA 4EEUA 2JHEA 2PYRA 1TS7A 2WKQA 4IHQA 5J7EA 2ZOIA 4PHTA 1S4SA 1G6OA 4CQHA 3C2WA 4F3LA 4WN5A 4DJ2A 1LSXA 4GHIB 3CUEC 1N9LA 2M7VA 3KX0X 2P08A 3KSFA 3KSIA 1DRMA 4MN6A 3IS2B 4KQOA 3EOIA 2VA0A 2YKFA 3KYQA 3PBNA 2JKTM 2VEAA 2A2LA 2VV6A 2W27A 4WL9A 1UWPX 3UE6A 2V0WA 2XRNA 4HOIA 3H7WA 2W3FA 4GW9A 3UMDA 5AVFA 3P01A 3BY9A 3PBTA 2XSSA 4HH2A 4UQIS 2JKRM 4R70A 1LT0A 2XROA 4UQIM 4I3IA 3ZYTA 5L8MA 1Y28A 2LB9A 3TE8A 1T1AA 4ETXA 5DKKA 1NRJA 3PBRA 4PKYA 4EETB 5HPFA 3UB7A 2OAP1 1OT6A 5J3WA 1LSVA 4B93A 1XJ3A 1XFQA 2NUTC 4HIAA 3F1NB 4HY8A 2EWVA 4B9OA 4G3KA 1G28A 2JKRI 4G3VA 1OPXA 1GSWA 1S1YA 3FPWA 3NOTC 1NLZA 5J4EA 3JVVA 2V9AA 5DKLA 2O9AA 4LRXC 2K2NA 2VGLM 3EGXC 4Q0JA 2DMWA 3OC2A 4ARZB 3GDIA 4CLCA 2VV8A 3OBFA 3E98A 5KSHA 2ZMVA 4UEYA 4E04A 5MC7A 3LUQA 1XJ2A 4JGPA 4MDZA 4Y5FA 2B02A 4F3LB 4LPZA 4AFIA 5HDCA 2B18A 1OJGA 2V1BA 2W0NA 2JKTI 4DJ3A 3LICA 3R7WB 5HWWA 4GS9A 2MJ6A 3UB9A 5A8BA 1OT9A 3E4QA 4EEPA 2Z6DA 2FH5A 5DFXA 3F1PA 3T50A 1TS0A 4WEKA 5G4YA 3BWLA 2OOLA 3PR6A 3HJKA 5HD3A 5DFYA 2HJ9C 2XA7S 4LRZE 3LYXA 4EUVA 3H7WB 1NWZA 1T19A 2VKSA 2HGVA 2HJEA 1EW0A 4QPRA 3B33A 1GSVA 3CI6A 3R7WA 3T4KA 3T4OA 4DN0A 3T4JA 5I5LA 1OTAA 1WA9A 1UGUA 3NOUC 5HD5A 4NXGA 3FC7A 2PR6A 1IFQA 2P04A 4GS9B 4NXFA 4EU0A 3T4SA 3T4LA 3KSHA 3LIAA 5DF9A 2EA9A 3C38A 3BQ8A 3OLOA 3S7QA 1XFNA 3KSGA 1P9RA 1N9NA 5DJTA 3D72A 3B47A 1XJ6A 3PYPA 3RFBA 5TBMB 2KOIA 5HSQA 2H28A 3EGDC 3E0YA 3LR5A 5IU1A 2VV7A 4Y2FA 1S1ZA 1VHMA 5EFWA 4CLCB 3MQ0A 1XJ4A 4EXOA 1NLYA 2WKRA 4JGQA 1UWNX 2P7JA 4KQDA 5HWTA 2J80A 4HJ4A 4R3AA 5AVEA 3BQAA 3ZQ5A 3CLOA 2OWHA 2K7SA 4R6LA 2QYBA 5F68A 1TD5A 2PT7A 4K08A 3EWKA 3F1PB 1TS6A 4KUKA 4IJGA 2R78A 3OOVA 4EESA 4HJ3A 2O9CA 3H9WA 3F1OA 4CLCD 1T1CA 2LB5A 1OTIA 4R38A 4II7A 2W1TA 4BBUA 1JNUA 1V9ZA 4I39A 3LFVA 5HL6A 2ZBBA 3GECA 5F69A 1P9WA 2VJWA 3LIBA 4KUOA 4BWIA 2VZWA 3UB8A 2BASA 2V1AA 4FSFA 2OAQ1 4LRYC 2K31A 3VE3A 2VX8A 2L0WA 1F9IA 1LSWA 3S7OA 2W1RA 2W3HA 3LIEA 4L9GA 1IOUA 1KOUA 1D06A 4O0PA 2PHYA 4CLCE 4IUHA 3E4OA 1F5MA 3DBAA 4MN7A 3A0VA 4BBVA 3VOLA 1ZHHB 2OWJA 4L9EA 4L9FA 4HI4A 3FPVA 2KLIA 3K3CA 4GCZA 2ZMFA 3OCNA 5CX7A 3SW1A 1D7EA 3K2NA 3TW8A 5HDDA 3VV4A 3D3OA 3RH8B 1MC0A 5G4ZA 4BMWA 3ICYA 3MJQA 1F98A 2QHKA 4NXEA 2GX5A 2I9VA 3EQUA 2PDRA 4NEED 3RTYA 5HDSA 1S4RA 4Q0IA 1V9YA 2V0UA 3H82B 1YAXA 4Z1WA 3BJNA 3HJIA 3HCYA 4ETZA 3BW6A 3IS2A 4FOFA 4L0LA 3CWFA 4YNRA 3P7NA 2J3TC 4WLAA 2PD8A 2ZOHA 3PBOA 3LI8A 4EQ1A 5HPIA 2IA2A 3O5YA 2VGLS 4I5SA 1VB6A 4JGOA 2J3WA 5F5YA 2D02A 2JN7A 4NXBA 3MMHA 1DP6A 2D01A 3VE4A 4WF0A 5DJUA 4EW7A 4OOLA 3TJZC 3MF0A 2WKPA 3CAXA 2VLGA 4H6JA 2Y8HA 5HZHA 4DMZA 2QJ7A 2FZ0A 4P6ZS 3S7NA 3PXPA 4OOMA 3PHYA 3TRCA 4MMNA 3PBSA 1STZA 3CUEA 3LI9A 3ULFA 3A0SA 4P6ZM 3JVUA 3MQOA 2HF6A 4GHIA 4Q0HA 2CMNA 4MCWA 2Y79A 3U2AA 2XA7M 3F1NA 2O9BA 2YKHA 4H6JB 3K3DA 3E4PA 3NHQA 1MZUA 5F6AA 4HQAA 2L4RA 3FG8A 1W63Q 1YSPA 3NJAA 4HHDA 3C30A 4G3WA 4I38A 3A0RA 3LR3A 4I3AA 2PD7A 4XT2A 2W1TB 3C8CA 3T4TA 1GSXA 3BY8A 1P97A 4BBTA 3H82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9I A;  5HWV A;  1LSW A;  4LRZ E;  3KX0 X;  1OTB A;  3LYX A;  3LIE A;  1DRM A;  2INW A;  1OTE A;  3H7W B;  4HP4 A;  4L9G A;  4MN6 A;  1KOU A;  3IS2 B;  1D06 A;  1NWZ A;  1T19 A;  3IBR A;  2PHY A;  1EW0 A;  3B33 A;  1GSV A;  3E4O A;  2YKF A;  4YWZ A;  2A24 A;  3A0V A;  4BBV A;  1LL8 A;  3VOL A;  4L9E A;  2OWJ A;  4L9F A;  2VEA A;  1ODV A;  2VV6 A;  2W27 A;  4HI4 A;  5I5L A;  1OTA A;  1WA9 A;  1UGU A;  1N9O A;  3HJK A;  1UWP X;  3K3C A;  3NOU C;  1T18 A;  4GCZ A;  4WUJ A;  5HD5 A;  5TBM A;  3UE6 A;  1D7E A;  2V0W A;  4NXG A;  3VE3 A;  4HH3 A;  1T1B A;  4HOI A;  3H7W A;  2GJ3 A;  5HDD A;  3RH8 B;  3FC7 A;  2PR6 A;  5G4Z A;  2M1C A;  3ICY A;  4GS9 B;  3MJQ A;  4GW9 A;  4NXF A;  3NOP C;  1F98 A;  2QHK A;  4NXE A;  3UB6 A;  3UMD A;  4M4X A;  2I9V A;  4HNB A;  1DP9 A;  3LIA A;  5AVF A;  2EA9 A;  2PDR A;  5HD3 A;  3BY9 A;  3OLO A;  4HH2 A;  1XFN A;  2KX6 A;  3RTY A;  1N9N A;  4R70 A;  1LT0 A;  1S4R A;  4JGR A;  5HDS A;  1V9Y A;  2PR5 A;  2L1M A;  2V0U A;  3H82 B;  5DJT A;  4I3I A;  1Y28 A;  3D72 A;  3HJI A;  1T1A A;  1XJ6 A;  1S67 L;  5DKK A;  3PYP A;  3IS2 A;  3MQQ A;  4HP9 A;  5TBM B;  4EET B;  4PKY A;  5HSQ A;  2H28 A;  4EER A;  3CWF A;  3G6O A;  3P7N A;  2QWS A;  3UB7 A;  4WLA A;  1OTD A;  1OT6 A;  2PD8 A;  5IU1 A;  5J3W A;  5A8B A;  2VV7 A;  1LSV A;  1P0Z A;  1S1Z A;  2ZOH A;  3LI8 A;  4EQ1 A;  1XJ3 A;  5EFW A;  3LIF A;  1XFQ A;  4HIA A;  5IS1 A;  5KIZ A;  1XJ4 A;  4EXO A;  3F1N B;  4HJ6 A;  4HY8 A;  4I5S A;  1VB6 A;  4B9O A;  4JGO A;  1G28 A;  2WKR A;  4JGQ A;  5F5Y A;  3MR0 A;  2D02 A;  1UWN X;  2JN7 A;  2P7J A;  4LLO B;  1S66 L;  4KQD A;  4NXB A;  1DP6 A;  1GSW A;  1S1Y A;  3F1O B;  1TS8 A;  3NOT C;  5J4E A;  2D01 A;  5HWT A;  3VE4 A;  2QKP A;  4WF0 A;  5DJU A;  2J80 A;  2V9A A;  1BYW A;  4HJ4 A;  4R3A A;  5DKL A;  5AVE A;  4EW7 A;  3ZQ5 A;  3CLO A;  2OWH A;  2K7S A;  4LRX C;  4R6L A;  5F68 A;  3LID A;  1OJ5 A;  2WKP A;  4K08 A;  3CAX A;  2HV1 A;  1TS6 A;  3EWK A;  2VLG A;  2R78 A;  3F1P B;  4KUK A;  4WN5 A;  4EES A;  3GDI A;  4HJ3 A;  2VV8 A;  4H6J A;  4I3J A;  3EEH A;  1DP8 A;  5HZH A;  2QJ7 A;  3H9W A;  3SW1 A;  4E04 A;  2QJ5 A;  3PHY A;  3F1O A;  4PKY G;  3LUQ A;  1T1C A;  1XJ2 A;  4JGP A;  4EEU A;  2B02 A;  3ULF A;  3LI9 A;  1OTI A;  4F3L B;  4LPZ A;  4R38 A;  2A24 B;  3A0S A;  1X0O A;  4MN5 A;  3MQO A;  4GHI A;  4XT2 B;  5HDC A;  2Z6C A;  4BBU A;  4RQ9 A;  2CMN A;  3MXQ A;  1JNU A;  2PYP A;  3T50 A;  4DJ2 A;  1OJG A;  1V9Z A;  3F1N A;  3MFX A;  2KDK A;  2YKH A;  4H6J B;  3K3D A;  4I39 A;  3E4P A;  3UME A;  3NHQ A;  1MZU A;  2ZBB A;  2V1B A;  3GEC A;  2JHE A;  2PYR A;  1TS7 A;  5F6A A;  2W0N A;  5F69 A;  2WKQ A;  3LIC A;  4DJ3 A;  4HQA A;  5HWW A;  4GS9 A;  2ZOI A;  2L4R A;  3UB9 A;  5J7E A;  3FG8 A;  1S4S A;  3LIB A;  3C2W A;  3NJA A;  4HHD A;  4I38 A;  1OT9 A;  3E4Q A;  4KUO A;  2Z6D A;  3UB8 A;  4EEP A;  3A0R A;  3F1P A;  1TS0 A;  2BAS A;  2PD7 A;  2V1A A;  1LSX A;  4I3A A;  4GHI B;  3C8C A;  1N9L A;  4LRY C;  1GSX A;  3BWL A;  4WL9 A;  4XT2 A;  2OOL A;  5G4Y A;  2L0W A;  3BY8 A;  4F3L A;  1P97 A;  4BBT A;  3H82 A; 
#chains in the Genus database with same CATH topology
 3OPL A;  4QWO A;  3OPP A;  2INW A;  3TSG A;  1S6R A;  5I94 A;  1TF1 A;  4FH4 A;  3T12 B;  3IBR A;  3CPT B;  3IX3 A;  2WGV A;  3NY4 A;  3D4F A;  2W3E A;  4DF6 A;  2J3T D;  1T18 A;  1W63 M;  4KZ5 A;  5M19 A;  3UB6 A;  2M7U A;  3MKE A;  4QHC A;  2H0T A;  3CIT A;  5C5K A;  4Q8I A;  3V67 A;  2Y2K A;  1DJB A;  3N6I A;  1F2K A;  2HP5 A;  3UE3 A;  3SS3 A;  5IS1 A;  4X6T A;  1H3Q A;  1BLP A;  2PU2 A;  4B88 A;  3MKF A;  1ZTU A;  2Y2Q A;  3MSH A;  3MR0 A;  1SCW A;  4LLO B;  3OZH A;  5FAS A;  5FI7 A;  2QKP A;  4O7D A;  3C4O A;  2W3D A;  3KYZ A;  3IBJ A;  5EPH A;  2R9W A;  3IXD A;  1AWI A;  5FQI A;  4DKI A;  2QJ5 A;  4S2K A;  1ERM A;  2W3G A;  2WUQ A;  1X0O A;  1PW1 A;  4MN5 A;  3ZNY A;  2PYP A;  5L10 A;  2PRF A;  3RXX A;  2KDK A;  4F94 A;  3KYE A;  3EEA A;  1GA9 A;  2JHE A;  1TS7 A;  2PYR A;  3MBZ A;  1M6K A;  1PRQ A;  3Q1F A;  4HEF A;  2ZOI A;  1S4S A;  4CQH A;  3C2W A;  2C6W B;  4QB8 A;  4DJ2 A;  4GHI B;  3CUE C;  4R3B A;  4X1L A;  3NC8 A;  2P08 A;  3KSI A;  1DRM A;  4S2J A;  2VK3 A;  4PPR A;  3UE1 A;  2A3U A;  3PBN A;  3Q7V B;  2VEA A;  2A2L A;  2VV6 A;  2W27 A;  2EFX A;  1UWP X;  3UE6 A;  4KG2 A;  3ZG7 B;  5EVL A;  5FDS A;  3BY9 A;  4WMC D;  2XSS A;  1YT4 A;  4UQI S;  4R4S A;  3ZYT A;  1Y28 A;  2LB9 A;  1G6A A;  1VQQ A;  3QP4 A;  1NRJ A;  4EET B;  4KEN B;  1CEG A;  5CXW A;  4Y0T A;  1XFQ A;  2ZC4 B;  1K4F A;  4HY8 A;  2EWV A;  5TGF A;  5CGW A;  2JBF A;  5DF8 A;  1GSW A;  3UDI A;  3I7J A;  5DTK A;  1HTZ A;  3UPP A;  1K4E A;  2VGL M;  4Q0J A;  4X55 A;  2DMW A;  3OC2 A;  1HZO A;  4OQG A;  2WK0 A;  4JGP A;  1ACF A;  5EOE A;  3ZG5 A;  1OJG A;  5FAT A;  3LCE A;  4S2N C;  5BOH A;  1BT5 A;  2V1B A;  2W0N A;  2ZQC A;  5FQM A;  1N9B A;  2Z6D A;  3T50 A;  3V3R A;  5G4Y A;  5GL9 A;  2OOL A;  1TEM A;  2I72 A;  5EEC A;  2XA7 S;  1LI0 A;  1I5Q A;  3H7W B;  2ZQ9 A;  1T19 A;  1EW0 A;  4X1M A;  1GSV A;  1MWT A;  3T4O A;  4EBP A;  4BQM A;  4ZJ2 A;  3HLE A;  5E43 A;  5L2F A;  5I5L A;  3S22 A;  1VET B;  4NXG A;  3V50 A;  1K6S A;  2EXB A;  4OQ0 A;  2PR6 A;  4EU0 A;  2VGJ A;  3LIA A;  4XXR A;  4KZB A;  4U0X A;  3IT9 A;  5DJT A;  2A49 A;  3D72 A;  3B47 A;  1ES5 A;  2XLN A;  3PYP A;  3RFB A;  2KOI A;  4C6Y A;  3IX8 A;  5HSQ A;  4R3J A;  3A3I A;  1S1Z A;  1ESI A;  5EFW A;  1PFL A;  2P7J A;  2Y2L A;  5JYP A;  4R3A A;  5AVE A;  4Y0O A;  4GDN A;  3BQA A;  3S1Y A;  3ZQ5 A;  2K7S A;  5FAQ A;  3WRZ A;  4EES A;  1CQA A;  3FKV A;  3MZF A;  4LV1 A;  5G18 A;  3M6B A;  3C7V A;  3F1O A;  2Z2M B;  4CLC D;  2LB5 A;  4R4R A;  1YPR A;  1OTI A;  1FSY A;  4II7 A;  1AXB A;  4S2L A;  1JNU A;  2ZL1 A;  2HDU A;  4IVK A;  3SZT A;  1FOF A;  3E2K A;  5F69 A;  3GTC A;  1P9W A;  3OPR A;  3QP6 A;  4NK3 A;  4IBX A;  1CF0 A;  2VJW A;  3LIB A;  4KUO A;  4BWI A;  4JXS A;  2BAS A;  2K31 A;  2VX8 A;  4FUW A;  3GVB A;  5KSC A;  4E3L A;  4K91 A;  3VP2 A;  3NEC A;  5FQK A;  4EWF A;  3E4O A;  1F5M A;  3A0V A;  2OWJ A;  3CMZ A;  4R23 A;  3HLW A;  3ZGA B;  3K3C A;  2ZMF A;  3OCN A;  4UAA A;  3SS4 A;  3NI9 A;  4OLG A;  3MJQ A;  3UNW A;  3W8K A;  2PDR A;  4NEE D;  5M18 A;  4ZTK A;  5IHV A;  4E3I A;  3HCY A;  1SHV A;  2ZQ7 A;  1SDE A;  3BW6 A;  3IS2 A;  1IYQ A;  3BFE A;  4EQ1 A;  5HPI A;  2WAF A;  2VGL S;  5FI2 A;  4NET A;  4JGO A;  3VOZ A;  1QMF A;  2D02 A;  3MZE A;  4JF4 A;  3VE4 A;  4ID4 A;  3TJZ C;  2IWD A;  3MF0 A;  4KZ6 A;  1SKO B;  2WKP A;  3G30 A;  3CAX A;  2V8C A;  2VLG A;  5HW3 A;  2QZ6 A;  4H6J A;  5HZH A;  1CJF A;  2FZ0 A;  1SZV A;  1M40 A;  4QD4 A;  4OOM A;  3TRC A;  4MMN A;  1KDW A;  1MKI A;  4P6Z M;  3MQO A;  4GHI A;  4Q0H A;  4MCW A;  2PBD P;  3U2A A;  4OP8 A;  2O9B A;  4H6J B;  3BRM A;  3NHQ A;  1MZU A;  3VSK A;  4HQA A;  2L4R A;  1W63 Q;  3C30 A;  4G3W A;  3DTK A;  3LR3 A;  5FEG A;  2W1T B;  3ZG9 B;  3T4T A;  1LI9 A;  3D9Y A;  3H82 A;  1JWP A;  3QHY A;  2Y2N A;  2QMI A;  4N1X A;  1OME A;  1JWZ A;  1ES3 A;  5EUA A;  2O0Y A;  2G2U A;  4GZB A;  4Z9Q A;  1NYM A;  1LL8 A;  1N9O A;  1W5D A;  4HH3 A;  3MXS A;  5FL3 A;  3FZC A;  1O7E A;  4DXC A;  4IVI A;  2Q0O A;  1LHY A;  3LR0 A;  4JGR A;  4IUK A;  5IT5 A;  2PR5 A;  2L1M A;  4PMA A;  3ZNT A;  2HP9 A;  3BEB A;  4X53 A;  1XA7 A;  3T4Q A;  4DE3 A;  3TG9 A;  3G6O A;  5EE8 A;  2QWS A;  4QU3 A;  1OTD A;  1LL9 A;  1P0Z A;  1MKM A;  1PNE A;  2GDN A;  4KG5 A;  1K56 D;  5K5B A;  1NJ4 A;  2Q9N A;  1XPB A;  2H10 A;  2Y2O A;  3QP2 A;  1YLZ A;  1S66 L;  3AGE A;  2UWX A;  3G2Y A;  3BFC A;  5LBR A;  4BL3 A;  3LID A;  2HV1 A;  4QJG A;  3P09 A;  4Y15 A;  1DP8 A;  4OON A;  2WZZ A;  1YKD A;  3LY4 A;  1PZP A;  4WEJ A;  1PWG A;  3MXQ A;  2XEP A;  1FR1 A;  5FQ9 A;  2WKQ A;  4IHQ A;  3V5M A;  2CC1 A;  4XUZ A;  1G6O A;  2IWC A;  1RGZ A;  3O86 A;  1LSX A;  1N9L A;  1LLB A;  2M7V A;  1PWD A;  3W4P A;  4LEN A;  5A92 A;  3IS2 B;  4BD0 A;  3IQA A;  3QP5 A;  5F82 A;  4WZ4 A;  2AVX A;  2XGN A;  3UN7 A;  1ZKJ A;  4WL9 A;  1ALQ A;  2V0W A;  2XRN A;  3IXH A;  4OQH A;  4HOI A;  3H7W A;  3IWQ A;  2FFY A;  3WS0 A;  1JTD A;  5AVF A;  2Y4A A;  1W8Q A;  5HL1 A;  1G5U A;  2XRO A;  4UQI M;  5L8M A;  4ETX A;  2JKG A;  4BLM A;  3VFH A;  2WKE A;  5HPF A;  2PU4 A;  2P74 A;  3UB7 A;  2DCF A;  4UA7 A;  2J9P A;  4DXB A;  1XJ3 A;  4HIA A;  3BM6 A;  3UO9 A;  5GHX A;  1G28 A;  3C5A A;  4G3V A;  1Z09 A;  1S1Y A;  3NOT C;  5J4E A;  3G2Z A;  4PM9 A;  2K2N A;  5AQ7 A;  1WYC A;  4E3K A;  2Y2M A;  1FIL A;  4CLC A;  2VV8 A;  4UHU A;  3OBF A;  3BFD A;  4PM8 A;  4KZ3 A;  5KSH A;  4E04 A;  4OLD A;  4F3L B;  4LPZ A;  3IWO A;  4AFI A;  5A93 A;  5HDC A;  2B18 A;  4X56 A;  2WYX A;  4DJ3 A;  2EX6 A;  2MJ6 A;  1HVB A;  1OT9 A;  4EEP A;  4X25 A;  2XH9 A;  3F1P A;  4E3O A;  4RYE A;  1VET A;  4E3M A;  3PR6 A;  3ZFZ A;  3HJK A;  2HJ9 C;  4LRZ E;  1K55 C;  3IXB A;  1C3B A;  4QPR A;  3T4K A;  5EM1 A;  3MXR A;  4UA9 A;  5L07 A;  1OTA A;  4ZJ1 A;  5HD5 A;  3GV9 A;  3W4Q A;  1IFQ A;  4R0Q A;  3T4S A;  3C4P A;  2OSU A;  3KSH A;  2Y2P A;  5DF9 A;  3BQ8 A;  3T1Q B;  1IYP A;  5E2H A;  1P9R A;  4FH2 A;  4OPQ A;  1XJ6 A;  3S4X A;  1ES2 A;  4KZA A;  2EX8 A;  3Q7Z A;  4Y7P A;  4Y2F A;  4CLC B;  2PBY A;  1XKZ A;  3MQ0 A;  4EXO A;  5HX9 A;  5GLB A;  3LO7 A;  2J9O A;  2WZX A;  2WKI A;  4UA6 A;  2G2W A;  1JWV A;  4JXW A;  4OPR A;  2OWH A;  2PT7 A;  4K08 A;  3F1P B;  4DDY A;  4HJ3 A;  4KZ7 A;  3M6H A;  1H0M A;  4EBN A;  1BLS A;  2XQZ A;  4FCF A;  4R38 A;  1FR6 A;  3M2K A;  3HUM A;  2W1T A;  1YM1 A;  4BBU A;  1V9Z A;  5EOO A;  4OH0 A;  5HL6 A;  4ZJ3 A;  4RVA A;  1Q2P A;  3WRT A;  2VZW A;  1WE4 A;  3UB8 A;  1YLY A;  4B4X A;  2V1A A;  4LRY C;  1PZO A;  4WMC A;  3ZDJ A;  2X71 A;  2W3H A;  3LIE A;  1IOU A;  4MLL A;  1L0F A;  1KOU A;  1D06 A;  1KDS A;  3NUL A;  2PHY A;  4CLC E;  3G35 A;  4LFU A;  4BBV A;  4L9E A;  4L9F A;  1MXO A;  3FPV A;  5DTT A;  2KLI A;  5DF7 A;  1H8Z A;  1D7E A;  3K2N A;  1SDN A;  3BLS A;  4OOY A;  4KG6 A;  4MBH A;  3D3O A;  4YFM A;  3VV4 A;  1MC0 A;  4BMW A;  2XDM A;  3ICY A;  1FQG A;  2GX5 A;  2I9V A;  4DRT A;  1KGF A;  3BFG A;  1MPL A;  4Z1W A;  3HJI A;  1FCM A;  3CWF A;  4YNR A;  3P7N A;  2J3T C;  1VEU A;  1CK3 A;  5HAP A;  2ZOH A;  3LI8 A;  3O5Y A;  5FSR A;  1K6R A;  1BSG A;  4HBU A;  2R9X A;  5GLC A;  2BLS A;  4I5S A;  3N8L A;  3U4L P;  2J3W A;  5F5Y A;  2JN7 A;  4NXB A;  2D01 A;  3VSL A;  1FIK A;  1ERO A;  2DNS A;  2Y2I A;  1SKF A;  2Y8H A;  2H0Y A;  3PXP A;  4PM5 A;  3CUE A;  4E6X A;  3ZHH A;  2CMN A;  2Y79 A;  3F1N A;  3K3D A;  4JF5 A;  5F6A A;  2V8F A;  4LV0 A;  1L3L A;  4C75 A;  4IBR A;  5JYO A;  4I38 A;  4I3A A;  3G31 A;  3WWX A;  5AQ9 A;  3N4I A;  5HDD A;  4BBT A;  5HWV A;  3N8R A;  3S7P A;  3W4O A;  1NZO A;  3WS1 A;  2ZL1 B;  1NXY A;  2A24 A;  1J3W A;  3ZG0 A;  5DVA A;  4WUJ A;  5TBM A;  5E2G A;  2EFU A;  5CGS A;  2M1C A;  3NOP C;  4GOG A;  4PM6 A;  4M4X A;  4HNB A;  3KO6 A;  2KX6 A;  4EER A;  4ZAM A;  4CLC C;  3VOY A;  3HLF A;  1E4D A;  1ZC2 A;  4O01 A;  3R4K A;  4WEL A;  5F1G A;  3Q07 A;  1PWC A;  2ZM2 A;  4GLQ A;  4GJ4 A;  1NY0 A;  4S2N A;  1K0K A;  1GHM A;  1EWZ A;  5CEC A;  1I2S A;  4LCM A;  3F1O B;  1TS8 A;  4PAU A;  3HL9 A;  5TJJ A;  2XFT A;  5EVI A;  2NUP C;  1ONG A;  2ZM8 A;  1OJ5 A;  1JTG A;  4BJP A;  3PTE A;  2Y55 A;  3B42 A;  3FKW A;  1VM1 A;  1RP5 A;  4ZRR A;  4GD8 A;  4ME4 A;  4XUX A;  3EQV A;  2G7U A;  1YMX A;  4RQ9 A;  2Y2J A;  1K55 A;  4MEZ A;  3UME A;  1W79 A;  3HRE A;  3GR2 A;  4X68 A;  1SKO A;  4F3L A;  1L2S A;  2WGW A;  4OPZ A;  4S2O A;  2ZM0 A;  4M3K A;  1TDL A;  3CHW P;  1K54 C;  4WBG A;  4KQO A;  3EOI A;  3ZCZ A;  1IEM A;  2VA0 A;  2ZQA A;  5EV0 A;  4S2M A;  3KYQ A;  2JKT M;  5CEB A;  2OV5 A;  2JE5 A;  1PW8 A;  4GW9 A;  4K0W A;  2WAD A;  3CPT A;  3IX4 A;  3PBT A;  4HH2 A;  2UV0 E;  3IHB A;  3HLG A;  5HAR A;  4R70 A;  1LT0 A;  3AGD A;  1T1A A;  4U3T A;  5DKK A;  3L9K A;  1D1J A;  1LL5 A;  4EBL A;  5EVI D;  2OAP 1;  3Q7V A;  5J3W A;  5EVI C;  4GN2 A;  1LSV A;  4C3Q A;  4OVD A;  5CHM A;  2WKH A;  4B93 A;  2NUT C;  5FA7 A;  5CTN A;  3F1N B;  4FD8 A;  4B9O A;  1YLT A;  2EX9 A;  3N7W A;  1PI5 A;  1RCJ A;  3FPW A;  1NLZ A;  3JVV A;  5J8X A;  2V9A A;  5DKL A;  2ZC6 B;  2XD5 A;  2V20 A;  1ESU A;  1XP4 A;  4UEY A;  5MC7 A;  4IED A;  3LUQ A;  2WGW B;  4MDZ A;  1A0K A;  4Y0U A;  4JF6 A;  2ZQD A;  3QP8 A;  3VMA A;  2HZ5 A;  2JKT I;  5FI6 A;  5CER A;  5HWW A;  4GS9 A;  1O07 A;  1KE0 A;  3BFF A;  3HLD A;  5A8B A;  1TDG A;  3E4Q A;  2FH5 A;  4P0M A;  5DFX A;  1TS0 A;  5EVI B;  3JYI A;  4X69 A;  5HD3 A;  3VP3 A;  5F1F A;  4GB7 A;  5U47 A;  3LYX A;  4EUV A;  3ZG8 B;  2HJE A;  5TR7 A;  5E2F A;  3R7W A;  3GMW A;  1WA9 A;  1N4O A;  3IXG A;  3NOU C;  2Z2L B;  1L0E A;  4E3J A;  3NCK A;  5KZH A;  4KZ8 A;  3M2J A;  3DTM A;  5A90 A;  2EA9 A;  2Y2H A;  3OLO A;  3S7Q A;  2IWB A;  1XFN A;  3KSG A;  1JVJ A;  4OQI A;  5TBM B;  3Q81 A;  2H28 A;  2X01 A;  2HPB A;  1VHM A;  3JPU A;  1XJ4 A;  5GLA A;  1HLU P;  2WKR A;  3UY6 A;  3G4P A;  2OLV A;  3MS6 A;  4KQR A;  3CLO A;  3ITB A;  4R6L A;  3PAE A;  1TD5 A;  3HVF A;  4H8R A;  4CJN A;  1TS6 A;  4IJG A;  1S0W A;  1YLJ A;  1KVM A;  4JLF A;  2O9C A;  3FV7 A;  4OP5 A;  2ZD8 A;  2Y59 A;  4MBK A;  4I39 A;  3GEC A;  1U60 A;  3HUO A;  3ITA A;  4ESP A;  1KGG A;  1ZG4 A;  4N1H A;  4FSF A;  3VE3 A;  2L0W A;  2J8Y A;  1LSW A;  3A3J A;  3C7U A;  3S7O A;  2W1R A;  3LGO A;  5EM0 A;  4DE0 A;  4L9G A;  3HLC A;  1ONH A;  2PAV P;  1BLC A;  4O0P A;  2ZJ9 A;  3SH9 A;  1CEF A;  2OLU A;  3DBA A;  1PYY A;  3GQZ A;  3VOL A;  1ZHH B;  4HI4 A;  3FYZ A;  4GCZ A;  3MFD A;  5CX7 A;  3SW1 A;  3TW8 A;  1E3U D;  4EV4 A;  3RH8 B;  1EI5 A;  1KE3 A;  1YMS A;  3B3X A;  1FCO A;  4LGW A;  3CZD A;  3EQU A;  1MWR A;  3IF6 B;  3RTY A;  2WGI A;  1DY6 A;  2V0U A;  3L7H A;  5D3O A;  3CJM A;  1YAX A;  4ETZ A;  2XR0 A;  3T1S A;  3HBR A;  4L0L A;  3MZD A;  1ERQ A;  5HFO A;  3SS5 A;  3WS5 A;  4WLA A;  2FFF B;  2XK1 A;  3IWI A;  3PBO A;  5CTM A;  1Z6F A;  2XFS A;  1I2W A;  4OKP A;  3PAG A;  2X02 A;  2EX2 A;  1IKI A;  1DP6 A;  3DTE A;  5DJU A;  3IH8 A;  4A5R A;  4OOL A;  2EXA A;  4GD6 A;  1MY8 A;  4K0X A;  1CI8 A;  3BLM A;  3UDX A;  4DMZ A;  2QJ7 A;  3Q82 A;  3PHY A;  4KZ9 A;  5GLD A;  3ULF A;  1XGI A;  1W8Y A;  3QNB A;  3UPO A;  3JVU A;  5FAP A;  2HF6 A;  3AGF A;  2YKH A;  3P98 A;  3E4P A;  3SH8 A;  1YSP A;  4BD1 A;  3NJA A;  3A0R A;  2PD7 A;  5TFQ A;  3BY8 A;  1P97 A;  1H5X A;  1QME A;  4NKP A;  1OTB A;  1OTE A;  4HP4 A;  4DE1 A;  3OPH A;  2B5R A;  3W2Z A;  3HLB A;  1H8M A;  1VEU B;  4YWZ A;  3QP1 A;  2JC7 A;  2RL3 A;  2VGK A;  1ODV A;  2GZA A;  1T1B A;  2GJ3 A;  4EQI A;  3DAV A;  4Y3I A;  4JBF A;  5AJG A;  1DP9 A;  3V3S A;  1K57 C;  5AQA A;  4LCL A;  2QPN A;  1YLW A;  4YOF A;  2O99 A;  1Y4O A;  4ARZ A;  4E3N A;  1S67 L;  3UPN A;  3MQQ A;  4HP9 A;  3DTI A;  4E6W A;  4MBF A;  1BUL A;  4HES A;  3PBQ A;  1L0G A;  4RX2 A;  2HDS A;  3LIF A;  5KIZ A;  5M1A A;  4KQQ A;  4HJ6 A;  4GKU A;  1WYB A;  1IYO A;  2GNX A;  1K54 A;  1E25 A;  1G68 A;  1E3U A;  2ZC7 A;  1BZA A;  1BYW A;  1KVL A;  4B4Z A;  1YSQ A;  4KZ4 A;  4LV3 A;  4ZBE A;  4I3J A;  3EEH A;  4CPK A;  4LV2 A;  1DJC A;  3LR4 A;  4PKY G;  4S2P A;  2ZC5 B;  2A24 B;  2ZLY A;  3GSG A;  4XT2 B;  4PM7 A;  2Z6C A;  1PIO A;  3DWZ A;  5GHZ A;  3T1X A;  3OCL A;  3MFX A;  1XA1 A;  2Q9M A;  4O8G A;  3WS2 A;  2EWW A;  4EEU A;  3LEZ A;  3GRJ A;  5J7E A;  4PHT A;  3CG5 A;  4JXV A;  3NIA A;  4HBT A;  5DTS A;  4WN5 A;  3V39 A;  5EVE A;  5HAI A;  3KX0 X;  3KSF A;  5CRF A;  4MN6 A;  3VFF A;  5CHU A;  3VP0 A;  2WAE A;  5CHJ A;  1ZG6 A;  2P9V B;  4DE2 A;  4EUZ A;  1NYY A;  2YKF A;  2C5W B;  1Y54 A;  4D2O A;  3BYD A;  2ACG A;  4NG2 A;  1XXM A;  2W3F A;  3UMD A;  3P01 A;  2JKR M;  1NRF A;  4BEN A;  4I3I A;  3TE8 A;  3BEC A;  3RJU A;  2E8I A;  3PBR A;  4PKY A;  4JKT A;  3LY3 A;  3ZVW A;  1FSW A;  4WM9 A;  1OT6 A;  4N9K A;  3A3D A;  4G3K A;  1GHI A;  2JCH A;  4OPY A;  2JKR I;  4P6B A;  1OPX A;  3G32 A;  3IF6 A;  3UE0 A;  1MBL A;  2O9A A;  4LRX C;  4RX3 A;  3O87 A;  2Y2G A;  3EGX C;  4ARZ B;  3GDI A;  3E2L A;  3E98 A;  4QY6 A;  1BUE A;  5AQB A;  4MNR A;  1BLH A;  2RCX A;  2ZMV A;  1XJ2 A;  4Y5F A;  2B02 A;  5CED A;  2H5S A;  4JXG A;  4D60 A;  3RXW A;  2DRW A;  3ZVT A;  3LIC A;  3R7W B;  3QNC A;  5F83 A;  3UB9 A;  4WEK A;  3BWL A;  4P85 A;  1K25 A;  5DFY A;  1KE4 A;  1HD8 A;  3A3F A;  1NWZ A;  2VKS A;  1IYS A;  2HGV A;  1MWS A;  3B33 A;  4DN0 A;  3CI6 A;  3IHA A;  3T4J A;  1TVF A;  3UDF A;  1UGU A;  4GNU A;  1K57 A;  2B95 A;  3FC7 A;  2P04 A;  1YQS A;  4GS9 B;  4NXF A;  1J9M A;  3T4L A;  4P87 A;  3VP4 A;  3SOI A;  3C38 A;  3LEQ A;  1PI4 A;  1GCE A;  1N9N A;  2Y91 A;  4BL2 A;  2JKF A;  1IKG A;  3EGD C;  3E0Y A;  3LR5 A;  4WYY A;  4RA7 A;  5IU1 A;  1H8Y A;  2VV7 A;  3SH7 A;  1Q2Q A;  5A91 A;  3NDE A;  3O3V A;  1L0D A;  2XD1 A;  1NLY A;  3NDG A;  4JGQ A;  1UWN X;  4KQD A;  5HWT A;  2J80 A;  4HJ4 A;  5F68 A;  2QYB A;  3EWK A;  4KUK A;  1ES4 A;  2R78 A;  3OOV A;  2XF3 A;  4YIN A;  2HDR A;  4Y13 A;  3H9W A;  3T1R A;  1RGY A;  1IEL A;  1T1C A;  2P9V A;  1BTL A;  2V2F F;  2V1Z A;  4GDB A;  5GHY A;  4R1G A;  3VP1 A;  5FQJ A;  1YLP A;  3LFV A;  2ZBB A;  1XGJ A;  3O88 A;  5FDH A;  1W7F A;  1K38 A;  2BTF P;  2OAQ 1;  1F9I A;  4WZ5 C;  5FEF A;  4S2I A;  1GHP A;  4IUH A;  5KMW A;  4MN7 A;  5FQQ A;  1NZU A;  4ZDX A;  5HAQ A;  5L09 A;  5CGX A;  4Y17 A;  3HUN A;  3IH9 A;  4N9L A;  5G4Z A;  1F98 A;  2HDQ A;  3ISG A;  3WS4 A;  1DJA A;  2QHK A;  4NXE A;  3DWK A;  5HDS A;  1S4R A;  2HP6 A;  4Q0I A;  1V9Y A;  3H82 B;  2E8J A;  3BJN A;  3DW0 A;  4FOF A;  1GA0 A;  2ZC3 B;  2PD8 A;  2IA2 A;  1CI9 A;  2ZMA A;  3A3E A;  1VB6 A;  4QY5 A;  1FCN A;  3TOI A;  3MMH A;  3UB5 P;  4WF0 A;  1MWU A;  4EW7 A;  3NBL A;  5E2E A;  1KGE A;  1K56 A;  4P6Z S;  3S7N A;  4JPM A;  3PBS A;  1STZ A;  3LI9 A;  3A0S A;  2J7V A;  2BG1 A;  4DDS A;  2XA7 M;  4WZ5 A;  2ZQ8 A;  1XX2 A;  3IF6 C;  3G34 A;  4N92 A;  3IF5 A;  4FTX A;  3FG8 A;  5FAO A;  4HHD A;  3N8S A;  4XT2 A;  3C8C A;  1GSX A;  4U0T A;  3FWL A; 
#chains in the Genus database with same CATH homology
 5HWV A;  4NKP A;  1OTB A;  2INW A;  1OTE A;  4HP4 A;  3S7P A;  1TF1 A;  3IBR A;  3W2Z A;  1H8M A;  2O0Y A;  4YWZ A;  2A24 A;  2W3E A;  1LL8 A;  1ODV A;  2J3T D;  1N9O A;  1T18 A;  4WUJ A;  5TBM A;  1W63 M;  2GZA A;  4HH3 A;  1T1B A;  5FL3 A;  2GJ3 A;  4Y3I A;  2M1C A;  3NOP C;  5AJG A;  3UB6 A;  4M4X A;  4HNB A;  1DP9 A;  2M7U A;  3KO6 A;  2KX6 A;  4YOF A;  3LR0 A;  4EER A;  2O99 A;  4JGR A;  4IUK A;  4CLC C;  5IT5 A;  2PR5 A;  2L1M A;  4ARZ A;  1S67 L;  4O01 A;  3CIT A;  5C5K A;  3MQQ A;  4HP9 A;  3R4K A;  3T4Q A;  3V67 A;  4WEL A;  3G6O A;  2QWS A;  1OTD A;  3PBQ A;  4GLQ A;  4GJ4 A;  1P0Z A;  1MKM A;  3LIF A;  3UE3 A;  5IS1 A;  5KIZ A;  1H3Q A;  5K5B A;  4HJ6 A;  1ZTU A;  3MR0 A;  4LLO B;  1S66 L;  2GNX A;  3F1O B;  1TS8 A;  4PAU A;  2QKP A;  5TJJ A;  1BYW A;  5LBR A;  2NUP C;  3LID A;  1OJ5 A;  1YSQ A;  2HV1 A;  2W3D A;  3KYZ A;  4BJP A;  3IBJ A;  4I3J A;  3B42 A;  3EEH A;  1DP8 A;  2QJ5 A;  3LR4 A;  4ZRR A;  1YKD A;  4PKY G;  2W3G A;  4ME4 A;  2A24 B;  1X0O A;  4MN5 A;  3EQV A;  4WEJ A;  2G7U A;  4XT2 B;  2Z6C A;  4RQ9 A;  3MXQ A;  2PYP A;  3OCL A;  3MFX A;  2KDK A;  3UME A;  4O8G A;  2EWW A;  3EEA A;  4EEU A;  2JHE A;  2PYR A;  1TS7 A;  2WKQ A;  4IHQ A;  5J7E A;  2ZOI A;  4PHT A;  1S4S A;  1G6O A;  4CQH A;  3C2W A;  4F3L A;  4WN5 A;  4DJ2 A;  1LSX A;  4GHI B;  3CUE C;  1N9L A;  2M7V A;  3KX0 X;  2P08 A;  3KSF A;  3KSI A;  1DRM A;  4MN6 A;  3IS2 B;  4KQO A;  3EOI A;  2VA0 A;  2YKF A;  3KYQ A;  3PBN A;  2JKT M;  2VEA A;  2A2L A;  2VV6 A;  2W27 A;  4WL9 A;  1UWP X;  3UE6 A;  2V0W A;  2XRN A;  4HOI A;  3H7W A;  2W3F A;  4GW9 A;  3UMD A;  5AVF A;  3P01 A;  3BY9 A;  3PBT A;  2XSS A;  4HH2 A;  4UQI S;  2JKR M;  4R70 A;  1LT0 A;  2XRO A;  4UQI M;  4I3I A;  3ZYT A;  5L8M A;  1Y28 A;  2LB9 A;  3TE8 A;  1T1A A;  4ETX A;  5DKK A;  1NRJ A;  3PBR A;  4PKY A;  4EET B;  5HPF A;  3UB7 A;  2OAP 1;  1OT6 A;  5J3W A;  1LSV A;  4B93 A;  1XJ3 A;  1XFQ A;  2NUT C;  4HIA A;  3F1N B;  4HY8 A;  2EWV A;  4B9O A;  4G3K A;  1G28 A;  2JKR I;  4G3V A;  1OPX A;  1GSW A;  1S1Y A;  3FPW A;  3NOT C;  1NLZ A;  5J4E A;  3JVV A;  2V9A A;  5DKL A;  2O9A A;  4LRX C;  2K2N A;  2VGL M;  3EGX C;  4Q0J A;  2DMW A;  3OC2 A;  4ARZ B;  3GDI A;  4CLC A;  2VV8 A;  3OBF A;  3E98 A;  5KSH A;  2ZMV A;  4UEY A;  4E04 A;  5MC7 A;  3LUQ A;  1XJ2 A;  4JGP A;  4MDZ A;  4Y5F A;  2B02 A;  4F3L B;  4LPZ A;  4AFI A;  5HDC A;  2B18 A;  1OJG A;  2V1B A;  2W0N A;  2JKT I;  4DJ3 A;  3LIC A;  3R7W B;  5HWW A;  4GS9 A;  2MJ6 A;  3UB9 A;  5A8B A;  1OT9 A;  3E4Q A;  4EEP A;  2Z6D A;  2FH5 A;  5DFX A;  3F1P A;  3T50 A;  1TS0 A;  4WEK A;  5G4Y A;  3BWL A;  2OOL A;  3PR6 A;  3HJK A;  5HD3 A;  5DFY A;  2HJ9 C;  2XA7 S;  4LRZ E;  3LYX A;  4EUV A;  3H7W B;  1NWZ A;  1T19 A;  2VKS A;  2HGV A;  2HJE A;  1EW0 A;  4QPR A;  3B33 A;  1GSV A;  3CI6 A;  3R7W A;  3T4K A;  3T4O A;  4DN0 A;  3T4J A;  5I5L A;  1OTA A;  1WA9 A;  1UGU A;  3NOU C;  5HD5 A;  4NXG A;  3FC7 A;  2PR6 A;  1IFQ A;  2P04 A;  4GS9 B;  4NXF A;  4EU0 A;  3T4S A;  3T4L A;  3KSH A;  3LIA A;  5DF9 A;  2EA9 A;  3C38 A;  3BQ8 A;  3OLO A;  3S7Q A;  1XFN A;  3KSG A;  1P9R A;  1N9N A;  5DJT A;  3D72 A;  3B47 A;  1XJ6 A;  3PYP A;  3RFB A;  5TBM B;  2KOI A;  5HSQ A;  2H28 A;  3EGD C;  3E0Y A;  3LR5 A;  5IU1 A;  2VV7 A;  4Y2F A;  1S1Z A;  1VHM A;  5EFW A;  4CLC B;  3MQ0 A;  1XJ4 A;  4EXO A;  1NLY A;  2WKR A;  4JGQ A;  1UWN X;  2P7J A;  4KQD A;  5HWT A;  2J80 A;  4HJ4 A;  4R3A A;  5AVE A;  3BQA A;  3ZQ5 A;  3CLO A;  2OWH A;  2K7S A;  4R6L A;  2QYB A;  5F68 A;  1TD5 A;  2PT7 A;  4K08 A;  3EWK A;  3F1P B;  1TS6 A;  4KUK A;  4IJG A;  2R78 A;  3OOV A;  4EES A;  4HJ3 A;  2O9C A;  3H9W A;  3F1O A;  4CLC D;  1T1C A;  2LB5 A;  1OTI A;  4R38 A;  4II7 A;  2W1T A;  4BBU A;  1JNU A;  1V9Z A;  4I39 A;  3LFV A;  5HL6 A;  2ZBB A;  3GEC A;  5F69 A;  1P9W A;  2VJW A;  3LIB A;  4KUO A;  4BWI A;  2VZW A;  3UB8 A;  2BAS A;  2V1A A;  4FSF A;  2OAQ 1;  4LRY C;  2K31 A;  3VE3 A;  2VX8 A;  2L0W A;  1F9I A;  1LSW A;  3S7O A;  2W1R A;  2W3H A;  3LIE A;  4L9G A;  1IOU A;  1KOU A;  1D06 A;  4O0P A;  2PHY A;  4CLC E;  4IUH A;  3E4O A;  1F5M A;  3DBA A;  4MN7 A;  3A0V A;  4BBV A;  3VOL A;  1ZHH B;  2OWJ A;  4L9E A;  4L9F A;  4HI4 A;  3FPV A;  2KLI A;  3K3C A;  4GCZ A;  2ZMF A;  3OCN A;  5CX7 A;  3SW1 A;  1D7E A;  3K2N A;  3TW8 A;  5HDD A;  3VV4 A;  3D3O A;  3RH8 B;  1MC0 A;  5G4Z A;  4BMW A;  3ICY A;  3MJQ A;  1F98 A;  2QHK A;  4NXE A;  2GX5 A;  2I9V A;  3EQU A;  2PDR A;  4NEE D;  3RTY A;  5HDS A;  1S4R A;  4Q0I A;  1V9Y A;  2V0U A;  3H82 B;  1YAX A;  4Z1W A;  3BJN A;  3HJI A;  3HCY A;  4ETZ A;  3BW6 A;  3IS2 A;  4FOF A;  4L0L A;  3CWF A;  4YNR A;  3P7N A;  2J3T C;  4WLA A;  2PD8 A;  2ZOH A;  3PBO A;  3LI8 A;  4EQ1 A;  5HPI A;  2IA2 A;  3O5Y A;  2VGL S;  4I5S A;  1VB6 A;  4JGO A;  2J3W A;  5F5Y A;  2D02 A;  2JN7 A;  4NXB A;  3MMH A;  1DP6 A;  2D01 A;  3VE4 A;  4WF0 A;  5DJU A;  4EW7 A;  4OOL A;  3TJZ C;  3MF0 A;  2WKP A;  3CAX A;  2VLG A;  4H6J A;  2Y8H A;  5HZH A;  4DMZ A;  2QJ7 A;  2FZ0 A;  4P6Z S;  3S7N A;  3PXP A;  4OOM A;  3PHY A;  3TRC A;  4MMN A;  3PBS A;  1STZ A;  3CUE A;  3LI9 A;  3ULF A;  3A0S A;  4P6Z M;  3JVU A;  3MQO A;  2HF6 A;  4GHI A;  4Q0H A;  2CMN A;  4MCW A;  2Y79 A;  3U2A A;  2XA7 M;  3F1N A;  2O9B A;  2YKH A;  4H6J B;  3K3D A;  3E4P A;  3NHQ A;  1MZU A;  5F6A A;  4HQA A;  2L4R A;  3FG8 A;  1W63 Q;  1YSP A;  3NJA A;  4HHD A;  3C30 A;  4G3W A;  4I38 A;  3A0R A;  3LR3 A;  4I3A A;  2PD7 A;  4XT2 A;  2W1T B;  3C8C A;  3T4T A;  1GSX A;  3BY8 A;  1P97 A;  4BBT A;  3H82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...