3F1PA

Crystal structure of a high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
FKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endothelial PAS domain-containing protein 1
publication title Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3f1pA00
5HD3A 4EESA 3LI8A 5A8BA 3NOPC 2H28A 3CAXA 4R3AA 2V9AA 4R70A 4JGQA 3E4OA 3IBRA 3NOTC 5F68A 4GHIB 2PYRA 5IU1A 1XFNA 2WKQA 1F98A 4HH3A 2WKPA 1T19A 1UWNX 3VOLA 4GHIA 1S1ZA 4BBUA 2QHKA 4MN5A 4RQ9A 1D7EA 3LI9A 4L9FA 4PKYG 4HHDA 1XJ4A 5HSQA 2VV6A 5KIZA 3H82B 3F1PA 1X0OA 2L4RA 1N9OA 1DP8A 3EEHA 2OOLA 1LSXA 2HV1A 5J4EA 3E4QA 2KX6A 1G28A 2QKPA 4WLAA 3ZQ5A 1N9LA 2INWA 3LICA 4GS9B 5DJTA 4F3LB 2ZOHA 2KDKA 3F1OB 2A24B 2VLGA 4GS9A 3KX0X 2JN7A 3UB8A 3ULFA 4R6LA 3RH8B 4KUKA 2Z6CA 4EETB 1GSWA 2W27A 2L0WA 2PD7A 1TS7A 3VE3A 3BY8A 1LSVA 1KOUA 2D01A 4MN6A 1WA9A 5G4ZA 3LIEA 1D06A 1LT0A 3K3CA 3IS2B 3UB6A 1OT9A 1UWPX 5F6AA 1XFQA 4NXGA 3MFXA 1OTBA 3MJQA 3LUQA 2QJ5A 2J80A 3VE4A 3LYXA 4LRXC 3UE6A 3UMDA 2YKFA 4DJ3A 4JGOA 1DP6A 3LIBA 4EERA 3SW1A 3T50A 2PYPA 3H9WA 4M4XA 3RTYA 4I3JA 1V9YA 2V1BA 5AVEA 3FG8A 5F69A 5IS1A 3E4PA 1DP9A 2M1CA 5DKLA 1GSXA 1OTIA 4JGRA 3F1PB 1F9IA 4EQ1A 2L1MA 5HDDA 4HP9A 4I39A 2Z6DA 1LL8A 3NOUC 1S1YA 3MR0A 5EFWA 4BBTA 1GSVA 2GJ3A 1P0ZA 3LIDA 2JHEA 1TS8A 4HJ6A 2ZOIA 4LLOB 4WUJA 5DJUA 4EW7A 2V0WA 4WL9A 2QWSA 1NWZA 5F5YA 3A0VA 1BYWA 1DRMA 4H6JB 4NXEA 1XJ2A 3EWKA 3PHYA 3NHQA 2VV8A 2PR6A 1VB6A 4H6JA 1P97A 1OJ5A 2VV7A 3GDIA 3F1NA 2VEAA 1XJ3A 5HWWA 4WF0A 4BBVA 5DKKA 1N9NA 4R38A 3MXQA 3LIAA 2YKHA 3LIFA 3FC7A 4WN5A 4YWZA 3GECA 1S4RA 3HJKA 5TBMB 2ZBBA 4HY8A 4LRZE 5J3WA 3C8CA 4JGPA 3H7WA 4E04A 1T1CA 4L9EA 2WKRA 3MQOA 4HIAA 5HDCA 5G4YA 5TBMA 3BY9A 3A0SA 3UMEA 1S66L 3B33A 2OWHA 2K7SA 3P7NA 4I38A 5HD5A 4KUOA 1OTDA 1T1AA 2V0UA 3OLOA 3CLOA 4EEPA 3ICYA 1OT6A 4LPZA 4I5SA 3UB9A 4HP4A 5HWVA 1JNUA 3CWFA 3G6OA 2B02A 1TS6A 2BASA 2P7JA 1OTEA 1UGUA 1T18A 3A0RA 2V1AA 5HDSA 4HI4A 4EXOA 1XJ6A 2CMNA 1S4SA 1MZUA 1LSWA 1T1BA 2R78A 4HOIA 4GW9A 2QJ7A 2I9VA 3H82A 1V9ZA 4I3AA 5HZHA 3F1NB 2D02A 3HJIA 2W0NA 3MQQA 4HQAA 2EA9A 2PR5A 3UB7A 4EEUA 2OWJA 5AVFA 1Y28A 1ODVA 5I5LA 4HNBA 5HWTA 4NXBA 4PKYA 3NJAA 2PD8A 4HJ3A 3K3DA 4KQDA 4NXFA 4B9OA 4F3LA 1EW0A 3F1OA 2A24A 2PHYA 5J7EA 3C2WA 1S67L 4L9GA 4XT2B 1TS0A 3D72A 3PYPA 3H7WB 4HJ4A 4K08A 4I3IA 4XT2A 1OTAA 4HH2A 1OJGA 4LRYC 4GCZA 2PDRA 4DJ2A 3IS2A 3BWLA
chains in the Genus database with same CATH superfamily
2FFYA 2ZC7A 1IOUA 4DF6A 1H8YA 5HD3A 2JKRM 2J3WA 3WS1A 4C6YA 4BQMA 2V9AA 1WE4A 1STZA 3KSIA 4GDNA 4R70A 2V2FF 2ZMVA 4Q8IA 3NOTC 3S7NA 3JVUA 5IU1A 1Y4OA 3DWKA 1O7EA 4DKIA 3G4PA 4EUVA 2UV0E 5J8XA 1F98A 3S7QA 4QY6A 2WKPA 4GHIA 5HAQA 1YM1A 1D7EA 3LI9A 1XGJA 4PKYG 3O5YA 2NUPC 2X01A 4C3QA 4CLCD 3IXBA 1CI8A 5HSQA 2XEPA 3QP2A 4QPRA 4JF4A 1BSGA 1X0OA 1N9OA 4PPRA 2ZC4B 5L07A 5DF8A 3FPVA 3IWIA 3CUEA 4KZ4A 4Q0IA 2KX6A 4IJGA 4QD4A 5FI2A 4DXBA 4WELA 3DTKA 2WYXA 1PFLA 4L0LA 1S0WA 3ZQ5A 3DTMA 1ES3A 2INWA 3UPNA 1M40A 2KDKA 2A24B 3KSGA 3ZG8B 3N8SA 3BEBA 4GS9A 5HPIA 3KX0X 1I2WA 3MMHA 1NLZA 5FQJA 3NIAA 2M7VA 4E3KA 1CEFA 2JKGA 4NKPA 2J3TC 3ZFZA 5FQKA 1TS7A 2WGWB 4R3BA 3HLFA 3ZG7B 4JXGA 4UEYA 3IH8A 5CXWA 3IXDA 3GRJA 3R7WB 3MFXA 2EFUA 1OTBA 3MJQA 2LB9A 4OQGA 4IBXA 1HD8A 2W1TA 4GNUA 4LRXC 1VEUB 4MBFA 3UE6A 1K56A 4S2OA 1P9WA 3UNWA 1SZVA 4M4XA 2QZ6A 4S2PA 3RTYA 5TGFA 5GLAA 2HJEA 1AXBA 3P01A 2ZMFA 4N9KA 1FOFA 5M18A 5AVEA 1NY0A 3VOZA 2J3TD 2M1CA 2XSSA 4GD8A 3ZHHA 4A5RA 1GSXA 1DJBA 1MWRA 4OOYA 3F1PB 5DF7A 4GD6A 2V20A 4I39A 2J9OA 4E3IA 2G2UA 1PZOA 3NOUC 5CX7A 1PW8A 5E2FA 2CC1A 1HTZA 3EQVA 3UDFA 1ZC2A 2R9XA 3PBTA 1L2SA 1W63Q 5TR7A 4LLOB 4QJGA 4QB8A 4PMAA 5DJUA 3IH9A 2GNXA 3G30A 3NDGA 2V0WA 3W8KA 3LEZA 2QWSA 3BQ8A 1K6RA 2HDUA 3CHWP 5F5YA 3A0VA 1BYWA 3N6IA 1DRMA 3EWKA 3PHYA 1RP5A 4PM6A 4B4ZA 4MEZA 3WS5A 3L7HA 2W3HA 1E4DA 4Z1WA 3MS6A 1VB6A 1KE4A 3FV7A 1FCNA 4H6JA 4D2OA 4PM5A 4JXVA 4U3TA 1P97A 1MC0A 5EVEA 3LR0A 5JYPA 5IHVA 5L2FA 2B18A 2XF3A 1BUEA 3FZCA 5FAPA 2KLIA 4II7A 3OCLA 3DTIA 1PNEA 3PBRA 2Y4AA 5HWWA 4IEDA 4WF0A 1L3LA 3ZCZA 1W8QA 3VFHA 4X6TA 3BJNA 5M1AA 4P0MA 3HVFA 3JPUA 2VJWA 5HAIA 4R4RA 1NYYA 5CGWA 1LI9A 1S4RA 2EX8A 4C75A 4OKPA 4E6WA 5TBMB 1KGFA 4OPZA 3C8CA 4KZ9A 3H7WA 1PW1A 5C5KA 3PXPA 4EWFA 4L9EA 3UPOA 4DDSA 2DMWA 5G4YA 2DNSA 3L9KA 3B33A 2OV5A 2JKFA 2XA7S 4IHQA 4NETA 5EOEA 4Q0HA 4S2NA 1T1AA 3ZVWA 3OOVA 5JYOA 2ACGA 3ZDJA 1XP4A 4DMZA 4MLLA 4S2NC 4GJ4A 3QP8A 4FH2A 3Q81A 5EVIB 3OC2A 4IUHA 4MCWA 1UGUA 1T18A 3A0RA 4QU3A 1IKIA 2WZZA 3VSKA 1XJ6A 4OP5A 5DFXA 4OOMA 1ACFA 4X1LA 2WKHA 1WYBA 5CERA 1S4SA 1MZUA 4FTXA 4HOIA 4UA6A 1NZOA 1EWZA 4P85A 2VKSA 4Y2FA 5BOHA 4KZ3A 3NECA 1V9ZA 4S2LA 4CJNA 4E3OA 3KYEA 3F1NB 2W3FA 3HJIA 2W0NA 2ZD8A 5HX9A 3HUMA 4OVDA 2BTFP 2W3EA 5AQ9A 2PR5A 1BT5A 3GMWA 1SKOB 3BFDA 1SDEA 4XUZA 4LCLA 2W3GA 3M6BA 1D1JA 4PKYA 4DN0A 4RA7A 2XLNA 3T4KA 3O3VA 3CPTB 4B9OA 1HZOA 1YSPA 1YLPA 1K4FA 2HP5A 3BLSA 2JKTM 1S67L 1K38A 2WAEA 2XGNA 4GB7A 2WGIA 2XQZA 4L9GA 1GHIA 3PBQA 3MF0A 4K08A 3ZG0A 3WRZA 4XUXA 2IWBA 3FKVA 1YLWA 1ZKJA 1N4OA 4MBHA 1OTAA 3NC8A 3UE3A 4P6ZS 3IT9A 4Y17A 3WS0A 4YNRA 1OJGA 4DJ2A 2ZQ7A 1TDGA 3Q7VA 1SHVA 3IXHA 4LV2A 4BD1A 4QHCA 5A8BA 1PWCA 2H28A 4XXRA 2H0TA 3S4XA 4P6BA 4ETZA 2JBFA 3T1RA 4Y7PA 1W79A 3A3IA 3E4OA 1QMFA 3PAEA 4GHIB 4FUWA 3VFFA 5CGSA 2WKQA 4HH3A 2C5WB 1T19A 5FQ9A 2J8YA 3SH9A 1CK3A 1S1ZA 3MZEA 4MN5A 3HBRA 3U2AA 1F5MA 4U0XA 3PBSA 1NYMA 1VHMA 1NLYA 1XJ4A 3A3EA 4JBFA 3ZGAB 3I7JA 4AFIA 2UWXA 3W4PA 1Z09A 2HV1A 3VP4A 5J4EA 2VA0A 4R3JA 1G28A 2IWCA 4N1HA 2Y91A 1VQQA 1N9LA 1HLUP 5AQBA 4GS9B 5DJTA 4O7DA 4F94A 4F3LB 4PM8A 1ERMA 3F1OB 2JKTI 1GA9A 1XA7A 5A92A 2XK1A 5CHJA 3VMAA 3LFVA 1L0FA 3NI9A 3UB8A 1FCOA 4R6LA 3RH8B 4KUKA 3T1XA 1GSWA 4DE3A 3G2ZA 4CLCA 3AGDA 2W27A 5TJJA 2IA2A 2Y2GA 3R4KA 2MJ6A 3K2NA 3BY8A 2ZL1A 1KGGA 3V50A 4GN2A 5KZHA 4Y5FA 4Y15A 4CLCC 5E2HA 4ZTKA 1M6KA 1EI5A 3IS2B 2XD1A 4ETXA 1UWPX 3TRCA 5F6AA 3IX8A 1PIOA 4KZAA 2QJ5A 2PAVP 4DE1A 2Y2MA 3EEAA 5EV0A 4IUKA 4LV1A 1NJ4A 4JGOA 2HP6A 3DW0A 4X56A 5KMWA 2BG1A 5F83A 2HZ5A 3GQZA 3SH8A 5KSCA 4I3JA 2V1BA 4S2IA 3S7PA 2ZC3B 5IS1A 1DP9A 3N8RA 1AWIA 1KVLA 3IF6B 1OTIA 4JGRA 1F9IA 1KDWA 4GDBA 3WS2A 3WWXA 5FSRA 2Z6DA 4KG6A 4ZAMA 3QP4A 5U47A 5EFWA 4BBTA 4RX3A 2FFFB 1FSYA 2V1ZA 4UHUA 1I5QA 4GKUA 4HJ6A 2ZOIA 4JKTA 1DJCA 1H3QA 3CMZA 3V39A 4KZ5A 2JE5A 2XH9A 1PYYA 4MDZA 5EPHA 3O88A 4ESPA 1CI9A 4H6JB 4NXEA 1XJ2A 5CHMA 3NHQA 2W3DA 1W8YA 2ZQ9A 4CQHA 1TD5A 3ZG9B 3QHYA 4DE2A 3ITAA 5DTTA 2VEAA 4N92A 2ZM2A 4N1XA 3MXRA 1OMEA 2FH5A 3N4IA 1LL9A 4BBVA 1LI0A 1C3BA 4FCFA 2I72A 3A3JA 3T4OA 2O9AA 2Q0OA 4OQIA 1H8ZA 3FKWA 3UDIA 3FC7A 1NRJA 3IQAA 1KVMA 1I2SA 3GECA 4QY5A 3TSGA 1MBLA 2WUQA 1NRFA 4Y3IA 3LR4A 5FI6A 4BJPA 1T1CA 3BY9A 2HDRA 3UMEA 1GA0A 4DDYA 1S66L 4EBPA 2OWHA 2XFSA 3P7NA 3DAVA 3ISGA 5GLCA 3E0YA 5FASA 3TG9A 3V67A 3VV4A 2RL3A 1OTDA 1FILA 3Q07A 4HBUA 1BLCA 1IELA 4LPZA 3V3RA 4HP4A 5HWVA 2ZM0A 1IYPA 5FDHA 4EQIA 4Q0JA 1TS6A 2BASA 2PRFA 1OTEA 3HLEA 1IFQA 2OSUA 3BFGA 5HDSA 4HEFA 4HI4A 1JWZA 1K6SA 4GW9A 2QJ7A 2V8FA 3MBZA 2I9VA 4X68A 5A93A 1LHYA 1GHMA 3EQUA 2GX5A 5FQIA 1WYCA 4Z9QA 3GTCA 3MQQA 4GZBA 1XKZA 1YSQA 2EA9A 2WADA 3CITA 3NBLA 4BL3A 2H10A 2HDSA 1Q2QA 5AVFA 2A3UA 1ODVA 3MKFA 3OPLA 4NXBA 3NJAA 1ES5A 4HJ3A 1PRQA 1TVFA 1EW0A 2A24A 3VOYA 4LGWA 4R4SA 3VP1A 4MBKA 2B5RA 3EOIA 5DTKA 3LR3A 1YLTA 1BZAA 3PTEA 4OPQA 4FH4A 2WAFA 5DTSA 1ESUA 1MWUA 2WGWA 1XPBA 3IWOA 4WEJA 3Q7VB 2AVXA 4HH2A 3E2KA 4LRYC 4LFUA 2Z2MB 3HCYA 3OPHA 4UA9A 4E6XA 4KQQA 3R7WA 3T4SA 2HDQA 3QP5A 4EESA 3LI8A 4X53A 5FAOA 4RYEA 4KZBA 2VK3A 2XROA 3ZVTA 3W4QA 4JXWA 4FD8A 2Y79A 5FI7A 2HF6A 4JLFA 4KQRA 4JF6A 3VP3A 1IKGA 4QWOA 4ZBEA 2VGLS 4BBUA 2VGKA 4RQ9A 4L9FA 3ITBA 2GZAA 2V8CA 2WGVA 2ZMAA 3G32A 4HHDA 4S2JA 3ZNTA 4GLQA 1PI4A 4G3KA 3H82B 5GHZA 3F1PA 3CJMA 1PWGA 2L4RA 3DWZA 1DP8A 2OOLA 1LSXA 4EBNA 3HLCA 2WKIA 5FQQA 1IEMA 3E4QA 5G18A 4PHTA 3N7WA 2NUTC 4H8RA 4PAUA 3T4LA 2M7UA 2VGLM 3UE1A 4UAAA 2EWWA 1YMSA 2A49A 3MQ0A 1XGIA 2X02A 3RFBA 2JN7A 3ULFA 3NDEA 1YLYA 4EETB 1IYQA 3HLDA 2A2LA 5EOOA 5LBRA 3BFFA 3D3OA 1MPLA 2OAQ1 2PD7A 4X1MA 2RCXA 2XRNA 5CGXA 1LSVA 1KOUA 2D01A 4JXSA 3HUNA 4O01A 4BD0A 5M19A 4MN6A 5G4ZA 4EBLA 3LIEA 1BULA 1L0GA 3OPRA 3K3CA 1P9RA 2EFXA 3O87A 5A90A 4BMWA 1XFQA 3PAGA 3MFDA 3IX4A 3C30A 4NG2A 1CF0A 1H5XA 1IYOA 2E8IA 4FOFA 1W63M 2J80A 3VE4A 3Q82A 4WZ5A 1E25A 4B4XA 3UMDA 2YKFA 1DP6A 3LEQA 4EERA 3UDXA 1N9BA 3SW1A 3T50A 3H9WA 2O9BA 2OLVA 4WZ5C 3D4FA 3G31A 1V9YA 3FG8A 5DKLA 3WS4A 5E2EA 5FATA 3MSHA 4BWIA 1OPXA 4WZ4A 2P04A 5HDDA 3D9YA 4HP9A 3FWLA 4WBGA 3SS5A 2Y59A 1LL8A 4PM9A 3MR0A 5EM0A 4K0WA 2K31A 3SS4A 4R0QA 4ZJ1A 3GR2A 2R9WA 2GJ3A 3LIDA 2JHEA 5HW3A 3C38A 4LV0A 2ZC6B 1JTDA 3SH7A 5EVIA 3T4JA 4WUJA 4WL9A 2DCFA 4ZJ2A 4OPYA 5EVIC 3PBNA 3BM6A 1ZG6A 5DF9A 4OLGA 2VV8A 2XR0A 3IBJA 2PR6A 1YPRA 2P9VA 3IX3A 4PM7A 2EXBA 4O0PA 2ZQDA 4Y0OA 3F1NA 4NEED 5GL9A 1XJ3A 2WK0A 4OQ0A 1RGYA 1ZTUA 4D60A 4GOGA 2DRWA 1XX2A 3B3XA 3OZHA 3C7UA 1SDNA 1ES4A 1CEGA 1N9NA 1JWPA 4R38A 4WM9A 3MXQA 3LIAA 3T4QA 3B47A 2W1TB 2ZC5B 2YKHA 3LIFA 4YINA 3HUOA 4WN5A 5TFQA 4YWZA 1J9MA 4ARZA 3GSGA 1E3UD 5EVID 3HLBA 2ZBBA 4HY8A 4LRZE 5J3WA 4X55A 4JGPA 4E04A 1K57C 4KZ8A 5GHYA 3P09A 4M3KA 3G2YA 3VP2A 2Y2HA 3M2KA 1MKIA 1VETA 1NZUA 4I38A 5HARA 1K0KA 5FDSA 3C4PA 2V0UA 3CLOA 4MNRA 3KYQA 3M2JA 3MKEA 2W1RA 3BFCA 5MC7A 2WZXA 1YKDA 3TJZC 3CWFA 4LENA 4UA7A 5EE8A 4ZDXA 3LCEA 3HREA 3OCNA 5FEFA 5L09A 1MY8A 3ZNYA 4EXOA 2O9CA 4HBTA 4KG2A 2Y2KA 1LSWA 1T1BA 4YOFA 4KZ6A 2J9PA 5E43A 1KE0A 1L0EA 2ZQ8A 4ID4A 1W7FA 1YLZA 5IT5A 2OLUA 3CUEC 5HL6A 1YQSA 1CJFA 3UB7A 4EEUA 2Z2LB 2OWJA 4KENB 1Y28A 2Y55A 5EUAA 5I5LA 1YAXA 3GV9A 1MKMA 4HNBA 5DFYA 3LY3A 3K3DA 4KQDA 4F3LA 2JC7A 2PBDP 5AQAA 5AJGA 3F1OA 1YLJA 3RJUA 2PHYA 1ALQA 3LY4A 3T1SA 3C2WA 2C6WB 2ZQAA 3PR6A 2ZLYA 5A91A 3H7WB 3MZDA 3LR5A 4WMCA 4I3IA 2HJ9C 5KSHA 2PBYA 4XT2A 4N9LA 1O07A 3W4OA 4BL2A 3CZDA 4LCMA 2JKRI 2Q9NA 4S2KA 3HLGA 2EWVA 2PDRA 4U0TA 5CRFA 3QNCA 1HVBA 2PT7A 3G34A 3IS2A 4X25A 1U60A 3QP6A 4IVKA 3M6HA 5CEBA 4K91A 3W2ZA 4R1GA 1TDLA 3NOPC 3KSHA 3UE0A 3CAXA 4R3AA 4JGQA 3UPPA 3IBRA 3DBAA 5F68A 2PYRA 5EVLA 1XFNA 3BRMA 1W5DA 4B93A 1G6OA 3KYZA 1UWNX 3VOLA 1FQGA 4DRTA 4JF5A 2QHKA 5FA7A 4OLDA 4FSFA 2PU2A 3BFEA 1Y54A 4BENA 5CECA 3IF6A 2VV6A 5KIZA 5K5BA 4E3NA 5CTNA 4WMCD 3HL9A 3FYZA 3EEHA 2PU4A 4G3VA 5E2GA 3IF6C 1JTGA 1KE3A 1K55A 3ZG5A 2FZ0A 2QKPA 4WLAA 2EX9A 2KOIA 3SZTA 2O99A 4KG5A 2ZM8A 1FR6A 3LICA 1K55C 1CQAA 1G6AA 1K56D 2ZOHA 3BYDA 1BLPA 1NXYA 4ZJ3A 3VP0A 5I94A 5L8MA 2Y2NA 3NCKA 4OONA 2VLGA 5FEGA 2Y2JA 3JYIA 1PI5A 2Z6CA 3MXSA 4E3JA 2XDMA 3C4OA 2L0WA 2Y2QA 3G35A 3VE3A 3IHBA 5EM1A 1ES2A 3KSFA 4HESA 3C5AA 1WA9A 2ZQCA 5EECA 1D06A 1LT0A 3UB6A 1OT9A 1GCEA 2EX6A 4R23A 4UQIS 3S22A 3SOIA 2VGJA 1ONHA 4NXGA 5L10A 4S2MA 3LUQA 3PBOA 2E8JA 5HAPA 3LYXA 1F2KA 2WKEA 4DJ3A 4OP8A 3DTEA 2Y2OA 3V5MA 5GHXA 3LIBA 4CLCE 2PYPA 3CG5A 2JCHA 4Y0UA 1H0MA 1YMXA 1VEUA 3NY4A 4JPMA 1K25A 2X71A 2HGVA 5F69A 3JVVA 3E4PA 3CI6A 4P87A 2H0YA 5F1FA 1EROA 4B88A 2HP9A 4UQIM 1G68A 3IHAA 4EQ1A 2L1MA 3RXXA 4CPKA 2GDNA 4DE0A 2P74A 4YFMA 1SKFA 1S1YA 3T12B 4IBRA 4OQHA 4NK3A 2OAP1 1MWTA 5CHUA 1GSVA 1FIKA 1P0ZA 2K2NA 4RVAA 2IWDA 1TS8A 1XA1A 4MMNA 2G2WA 2XD5A 1K54A 3IWQA 4EW7A 3NULA 3AGEA 2B95A 2XA7M 3MZFA 3IF5A 1NWZA 3E98A 2BLSA 2P9VB 1K54C 1KGEA 1J3WA 3TW8A 5FAQA 3SS3A 3HLWA 3WRTA 2VX8A 2H5SA 3LO7A 1S6RA 3ZYTA 4X69A 5D3OA 4CLCB 1OJ5A 2VV7A 4Y13A 3TE8A 3LGOA 3GDIA 2ZL1B 2EX2A 4RX2A 5GLBA 1DY6A 1ZHHB 4DXCA 3S1YA 2Y2IA 5CTMA 1H8MA 2Y2PA 5DKKA 1MWSA 4E3LA 3FPWA 4ARZB 1FCMA 1PZPA 2QMIA 1ESIA 3BW6A 4Y0TA 4OOLA 2Y8HA 4K0XA 1YT4A 5F1GA 3HJKA 2G7UA 2EXAA 5FQMA 3A3DA 5DVAA 4EV4A 1BLHA 2WKRA 3MQOA 1VETB 4HIAA 5HDCA 1ZG4A 5TBMA 3N8LA 3B42A 3A0SA 1DJAA 1GHPA 2ZJ9A 1TEMA 3V3SA 2K7SA 3VSLA 4IVIA 5HD5A 1LL5A 3OPPA 3UO9A 4KUOA 3Q1FA 4EU0A 2VZWA 3AGFA 3U4LP 3OLOA 1JWVA 5AQ7A 4EEPA 3ICYA 3T4TA 1OT6A 3S7OA 1IYSA 2QPNA 3A3FA 4WYYA 4ZRRA 3EGDC 4OH0A 4I5SA 5HL1A 3UB9A 1JNUA 3G6OA 2B02A 2Q9MA 3QP1A 3BECA 3UN7A 2P7JA 4P6ZM 1KDSA 2XFTA 3BLMA 4ME4A 2V1AA 1VM1A 1E3UA 1TF1A 4BLMA 2CMNA 3UB5P 1K4EA 5GLDA 3KO6A 3UY6A 1XXMA 2P08A 2R78A 1PWDA 1A0KA 1FR1A 1G5UA 2QYBA 3H82A 2O0YA 4KZ7A 4G3WA 4OPRA 4I3AA 1JVJA 5HZHA 3RXWA 2D02A 1Q2PA 5FL3A 2HPBA 3EGXC 4HQAA 4O8GA 3BQAA 1BLSA 1MXOA 1LLBA 1SCWA 1RGZA 5HWTA 2PD8A 4EUZA 5F82A 3Q7ZA 3P98A 5HPFA 1ERQA 4NXFA 1SKOA 2Y2LA 1Z6FA 3QNBA 5HFOA 5J7EA 3TOIA 1ONGA 3CPTA 3E2LA 3GVBA 1QMEA 4XT2B 1TS0A 4E3MA 3D72A 1K57A 3PYPA 2J7VA 2LB5A 4HJ4A 5CEDA 3O86A 3OBFA 3C7VA 1L0DA 1BTLA 3IXGA 4GCZA 3T1QB 4LV3A 4MN7A 4WEKA 3BWLA 1RCJA 4KQOA 1FSWA
chains in the Genus database with same CATH topology
1IOUA 3R7WA 3T4SA 5HD3A 2JKRM 4EESA 2J3WA 3W2ZA 3LI8A 5A8BA 3NOPC 3KSHA 2H28A 3CAXA 4R3AA 2V9AA 4ETZA 1STZA 3KSIA 4R70A 2XROA 4JGQA 2ZMVA 3E4OA 3IBRA 3NOTC 3DBAA 3JVUA 5F68A 3S7NA 4GHIB 2PYRA 5IU1A 1XFNA 2Y79A 4EUVA 2HF6A 2WKQA 4B93A 1F98A 4HH3A 1G6OA 3KYZA 3S7QA 2WKPA 1T19A 1UWNX 3VOLA 4GHIA 2VGLS 1S1ZA 4BBUA 2QHKA 4MN5A 4RQ9A 1D7EA 3LI9A 4L9FA 4FSFA 3U2AA 4PKYG 1F5MA 3O5YA 2NUPC 3PBSA 2GZAA 4HHDA 4CLCD 4GLQA 4G3KA 1VHMA 1NLYA 1XJ4A 5HSQA 2VV6A 5KIZA 3H82B 3F1PA 4QPRA 5K5BA 1X0OA 2L4RA 1N9OA 1DP8A 4AFIA 3EEHA 2OOLA 3FPVA 1LSXA 4G3VA 2HV1A 3CUEA 5J4EA 3E4QA 4Q0IA 2KX6A 2VA0A 1G28A 2FZ0A 4IJGA 2QKPA 4WLAA 2KOIA 4PHTA 4WELA 2NUTC 2O99A 4PAUA 4L0LA 3T4LA 3ZQ5A 1N9LA 2M7UA 2INWA 3LICA 2VGLM 4GS9B 5DJTA 2EWWA 4F3LB 2ZOHA 2KDKA 3F1OB 2A24B 2JKTI 3KSGA 3MQ0A 5L8MA 2VLGA 3LFVA 4GS9A 5HPIA 3RFBA 3KX0X 2JN7A 3UB8A 3ULFA 4R6LA 3MMHA 3RH8B 1NLZA 4KUKA 2Z6CA 4EETB 1GSWA 2M7VA 2A2LA 4CLCA 4NKPA 5LBRA 2J3TC 2W27A 3D3OA 5TJJA 2L0WA 2IA2A 3R4KA 2MJ6A 2OAQ1 2PD7A 3K2NA 1TS7A 3BY8A 3VE3A 2XRNA 1LSVA 1KOUA 2D01A 3KSFA 4O01A 4Y5FA 4UEYA 4MN6A 4CLCC 1WA9A 5G4ZA 3LIEA 1D06A 1LT0A 3K3CA 3IS2B 3UB6A 1P9RA 1OT9A 4ETXA 1UWPX 4UQIS 3TRCA 5F6AA 4BMWA 3R7WB 1XFQA 4NXGA 3MFXA 3C30A 1OTBA 3MJQA 2LB9A 3LUQA 4FOFA 3PBOA 1W63M 2QJ5A 2J80A 3VE4A 2W1TA 3LYXA 3EEAA 4LRXC 3UE6A 4IUKA 2YKFA 3UMDA 4DJ3A 1P9WA 4JGOA 1DP6A 3LIBA 4EERA 3SW1A 3T50A 4CLCE 2PYPA 3H9WA 4M4XA 3RTYA 2O9BA 2HJEA 3P01A 4I3JA 2ZMFA 1V9YA 2V1BA 5AVEA 2HGVA 3S7PA 3FG8A 5F69A 5IS1A 3JVVA 2J3TD 3E4PA 3CI6A 1DP9A 2M1CA 5DKLA 2XSSA 1GSXA 1OTIA 4BWIA 4UQIM 1OPXA 4JGRA 3F1PB 1F9IA 4EQ1A 2P04A 2L1MA 5HDDA 4HP9A 4I39A 2Z6DA 1LL8A 3NOUC 1S1YA 5CX7A 3MR0A 2OAP1 5EFWA 2K31A 4BBTA 3EQVA 1GSVA 2GJ3A 1P0ZA 2K2NA 3LIDA 2JHEA 3PBTA 3C38A 1TS8A 1W63Q 4HJ6A 2ZOIA 1H3QA 4LLOB 4MMNA 3T4JA 4WUJA 5DJUA 2GNXA 4EW7A 2V0WA 4WL9A 2QWSA 2XA7M 3BQ8A 1NWZA 3E98A 5F5YA 4MDZA 3A0VA 1BYWA 1DRMA 4H6JB 4NXEA 1XJ2A 3EWKA 3PHYA 3PBNA 3TW8A 2W3HA 5DF9A 3NHQA 2W3DA 2VV8A 3IBJA 4Z1WA 2PR6A 2VX8A 1VB6A 3ZYTA 4H6JA 4CLCB 1P97A 1MC0A 4CQHA 1TD5A 1OJ5A 2VV7A 3LR0A 4O0PA 3TE8A 2B18A 3GDIA 3F1NA 1ZHHB 2VEAA 2KLIA 4NEED 4II7A 1XJ3A 3OCLA 3PBRA 2FH5A 1ZTUA 5HWWA 1H8MA 4WF0A 4BBVA 5DKKA 3FPWA 4ARZB 3BJNA 1N9NA 3T4OA 4R38A 2O9AA 3MXQA 3LIAA 3T4QA 3B47A 3BW6A 4OOLA 2W1TB 2YKHA 2VJWA 3LIFA 3FC7A 4WN5A 1NRJA 4YWZA 2Y8HA 3GECA 4ARZA 1S4RA 3HJKA 2G7UA 5TBMB 2ZBBA 4HY8A 4LRZE 5J3WA 3C8CA 4Y3IA 4JGPA 3LR4A 3H7WA 4E04A 5C5KA 3PXPA 1T1CA 4L9EA 2WKRA 3MQOA 4HIAA 5HDCA 4BJPA 2DMWA 5G4YA 3BY9A 5TBMA 3B42A 3A0SA 3UMEA 1S66L 3B33A 2OWHA 2K7SA 2XA7S 4IHQA 3P7NA 4I38A 3E0YA 4Q0HA 3V67A 5HD5A 4KUOA 3VV4A 1OTDA 4EU0A 1T1AA 2VZWA 2V0UA 3OOVA 3OLOA 3CLOA 3KYQA 4EEPA 3ICYA 2W1RA 3T4TA 1OT6A 3S7OA 4ZRRA 3EGDC 5MC7A 4LPZA 4I5SA 4DMZA 3UB9A 1YKDA 4HP4A 5HWVA 3TJZC 4GJ4A 1JNUA 3CWFA 3G6OA 2B02A 4Q0JA 1TS6A 2BASA 3OC2A 4IUHA 2P7JA 4MCWA 1OTEA 1UGUA 1T18A 4P6ZM 1IFQA 3A0RA 3OCNA 4ME4A 2V1AA 5HDSA 4HI4A 1TF1A 1XJ6A 4EXOA 5DFXA 2CMNA 2O9CA 4OOMA 3KO6A 1S4SA 1MZUA 1LSWA 1T1BA 2P08A 4YOFA 2R78A 4HOIA 4GW9A 2QJ7A 2VKSA 2I9VA 4Y2FA 2QYBA 3H82A 1V9ZA 3EQUA 2O0YA 4G3WA 2GX5A 4I3AA 5HZHA 3F1NB 2D02A 2W3FA 5FL3A 3HJIA 2W0NA 3EGXC 3MQQA 4HQAA 5IT5A 2W3EA 4O8GA 1YSQA 2EA9A 3CITA 3CUEC 2PR5A 5HL6A 3UB7A 4EEUA 3BQAA 2OWJA 5AVFA 1Y28A 1ODVA 5I5LA 1YAXA 2W3GA 1MKMA 4HNBA 4DN0A 4PKYA 4NXBA 5DFYA 3NJAA 5HWTA 2PD8A 4HJ3A 3K3DA 3T4KA 5HPFA 4KQDA 4NXFA 4B9OA 4F3LA 5AJGA 1EW0A 3F1OA 2A24A 1YSPA 2PHYA 5J7EA 2JKTM 3C2WA 1S67L 3EOIA 3LR3A 4L9GA 4XT2B 1TS0A 3PR6A 3D72A 3PYPA 3H7WB 2LB5A 3LR5A 4HJ4A 3PBQA 3MF0A 4K08A 4I3IA 2HJ9C 5KSHA 3OBFA 4XT2A 1OTAA 4WEJA 3UE3A 4P6ZS 2JKRI 4HH2A 4YNRA 1OJGA 2EWVA 4LRYC 4GCZA 2PDRA 4DJ2A 3HCYA 2PT7A 3IS2A 4MN7A 4WEKA 3BWLA 4KQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HD3 A;  4EES A;  3LI8 A;  5A8B A;  3NOP C;  2H28 A;  3CAX A;  4R3A A;  2V9A A;  4R70 A;  4JGQ A;  3E4O A;  3IBR A;  3NOT C;  5F68 A;  4GHI B;  2PYR A;  5IU1 A;  1XFN A;  2WKQ A;  1F98 A;  4HH3 A;  2WKP A;  1T19 A;  1UWN X;  3VOL A;  4GHI A;  1S1Z A;  4BBU A;  2QHK A;  4MN5 A;  4RQ9 A;  1D7E A;  3LI9 A;  4L9F A;  4PKY G;  4HHD A;  1XJ4 A;  5HSQ A;  2VV6 A;  5KIZ A;  3H82 B;  3F1P A;  1X0O A;  2L4R A;  1N9O A;  1DP8 A;  3EEH A;  2OOL A;  1LSX A;  2HV1 A;  5J4E A;  3E4Q A;  2KX6 A;  1G28 A;  2QKP A;  4WLA A;  3ZQ5 A;  1N9L A;  2INW A;  3LIC A;  4GS9 B;  5DJT A;  4F3L B;  2ZOH A;  2KDK A;  3F1O B;  2A24 B;  2VLG A;  4GS9 A;  3KX0 X;  2JN7 A;  3UB8 A;  3ULF A;  4R6L A;  3RH8 B;  4KUK A;  2Z6C A;  4EET B;  1GSW A;  2W27 A;  2L0W A;  2PD7 A;  1TS7 A;  3VE3 A;  3BY8 A;  1LSV A;  1KOU A;  2D01 A;  4MN6 A;  1WA9 A;  5G4Z A;  3LIE A;  1D06 A;  1LT0 A;  3K3C A;  3IS2 B;  3UB6 A;  1OT9 A;  1UWP X;  5F6A A;  1XFQ A;  4NXG A;  3MFX A;  1OTB A;  3MJQ A;  3LUQ A;  2QJ5 A;  2J80 A;  3VE4 A;  3LYX A;  4LRX C;  3UE6 A;  3UMD A;  2YKF A;  4DJ3 A;  4JGO A;  1DP6 A;  3LIB A;  4EER A;  3SW1 A;  3T50 A;  2PYP A;  3H9W A;  4M4X A;  3RTY A;  4I3J A;  1V9Y A;  2V1B A;  5AVE A;  3FG8 A;  5F69 A;  5IS1 A;  3E4P A;  1DP9 A;  2M1C A;  5DKL A;  1GSX A;  1OTI A;  4JGR A;  3F1P B;  1F9I A;  4EQ1 A;  2L1M A;  5HDD A;  4HP9 A;  4I39 A;  2Z6D A;  1LL8 A;  3NOU C;  1S1Y A;  3MR0 A;  5EFW A;  4BBT A;  1GSV A;  2GJ3 A;  1P0Z A;  3LID A;  2JHE A;  1TS8 A;  4HJ6 A;  2ZOI A;  4LLO B;  4WUJ A;  5DJU A;  4EW7 A;  2V0W A;  4WL9 A;  2QWS A;  1NWZ A;  5F5Y A;  3A0V A;  1BYW A;  1DRM A;  4H6J B;  4NXE A;  1XJ2 A;  3EWK A;  3PHY A;  3NHQ A;  2VV8 A;  2PR6 A;  1VB6 A;  4H6J A;  1P97 A;  1OJ5 A;  2VV7 A;  3GDI A;  3F1N A;  2VEA A;  1XJ3 A;  5HWW A;  4WF0 A;  4BBV A;  5DKK A;  1N9N A;  4R38 A;  3MXQ A;  3LIA A;  2YKH A;  3LIF A;  3FC7 A;  4WN5 A;  4YWZ A;  3GEC A;  1S4R A;  3HJK A;  5TBM B;  2ZBB A;  4HY8 A;  4LRZ E;  5J3W A;  3C8C A;  4JGP A;  3H7W A;  4E04 A;  1T1C A;  4L9E A;  2WKR A;  3MQO A;  4HIA A;  5HDC A;  5G4Y A;  5TBM A;  3BY9 A;  3A0S A;  3UME A;  1S66 L;  3B33 A;  2OWH A;  2K7S A;  3P7N A;  4I38 A;  5HD5 A;  4KUO A;  1OTD A;  1T1A A;  2V0U A;  3OLO A;  3CLO A;  4EEP A;  3ICY A;  1OT6 A;  4LPZ A;  4I5S A;  3UB9 A;  4HP4 A;  5HWV A;  1JNU A;  3CWF A;  3G6O A;  2B02 A;  1TS6 A;  2BAS A;  2P7J A;  1OTE A;  1UGU A;  1T18 A;  3A0R A;  2V1A A;  5HDS A;  4HI4 A;  4EXO A;  1XJ6 A;  2CMN A;  1S4S A;  1MZU A;  1LSW A;  1T1B A;  2R78 A;  4HOI A;  4GW9 A;  2QJ7 A;  2I9V A;  3H82 A;  1V9Z A;  4I3A A;  5HZH A;  3F1N B;  2D02 A;  3HJI A;  2W0N A;  3MQQ A;  4HQA A;  2EA9 A;  2PR5 A;  3UB7 A;  4EEU A;  2OWJ A;  5AVF A;  1Y28 A;  1ODV A;  5I5L A;  4HNB A;  5HWT A;  4NXB A;  4PKY A;  3NJA A;  2PD8 A;  4HJ3 A;  3K3D A;  4KQD A;  4NXF A;  4B9O A;  4F3L A;  1EW0 A;  3F1O A;  2A24 A;  2PHY A;  5J7E A;  3C2W A;  1S67 L;  4L9G A;  4XT2 B;  1TS0 A;  3D72 A;  3PYP A;  3H7W B;  4HJ4 A;  4K08 A;  4I3I A;  4XT2 A;  1OTA A;  4HH2 A;  1OJG A;  4LRY C;  4GCZ A;  2PDR A;  4DJ2 A;  3IS2 A;  3BWL A; 
#chains in the Genus database with same CATH topology
 2FFY A;  2ZC7 A;  1IOU A;  4DF6 A;  1H8Y A;  5HD3 A;  2JKR M;  2J3W A;  3WS1 A;  4C6Y A;  4BQM A;  2V9A A;  1WE4 A;  1STZ A;  3KSI A;  4GDN A;  4R70 A;  2V2F F;  2ZMV A;  4Q8I A;  3NOT C;  3S7N A;  3JVU A;  5IU1 A;  1Y4O A;  3DWK A;  1O7E A;  4DKI A;  3G4P A;  4EUV A;  2UV0 E;  5J8X A;  1F98 A;  3S7Q A;  4QY6 A;  2WKP A;  4GHI A;  5HAQ A;  1YM1 A;  1D7E A;  3LI9 A;  1XGJ A;  4PKY G;  3O5Y A;  2NUP C;  2X01 A;  4C3Q A;  4CLC D;  3IXB A;  1CI8 A;  5HSQ A;  2XEP A;  3QP2 A;  4QPR A;  4JF4 A;  1BSG A;  1X0O A;  1N9O A;  4PPR A;  2ZC4 B;  5L07 A;  5DF8 A;  3FPV A;  3IWI A;  3CUE A;  4KZ4 A;  4Q0I A;  2KX6 A;  4IJG A;  4QD4 A;  5FI2 A;  4DXB A;  4WEL A;  3DTK A;  2WYX A;  1PFL A;  4L0L A;  1S0W A;  3ZQ5 A;  3DTM A;  1ES3 A;  2INW A;  3UPN A;  1M40 A;  2KDK A;  2A24 B;  3KSG A;  3ZG8 B;  3N8S A;  3BEB A;  4GS9 A;  5HPI A;  3KX0 X;  1I2W A;  3MMH A;  1NLZ A;  5FQJ A;  3NIA A;  2M7V A;  4E3K A;  1CEF A;  2JKG A;  4NKP A;  2J3T C;  3ZFZ A;  5FQK A;  1TS7 A;  2WGW B;  4R3B A;  3HLF A;  3ZG7 B;  4JXG A;  4UEY A;  3IH8 A;  5CXW A;  3IXD A;  3GRJ A;  3R7W B;  3MFX A;  2EFU A;  1OTB A;  3MJQ A;  2LB9 A;  4OQG A;  4IBX A;  1HD8 A;  2W1T A;  4GNU A;  4LRX C;  1VEU B;  4MBF A;  3UE6 A;  1K56 A;  4S2O A;  1P9W A;  3UNW A;  1SZV A;  4M4X A;  2QZ6 A;  4S2P A;  3RTY A;  5TGF A;  5GLA A;  2HJE A;  1AXB A;  3P01 A;  2ZMF A;  4N9K A;  1FOF A;  5M18 A;  5AVE A;  1NY0 A;  3VOZ A;  2J3T D;  2M1C A;  2XSS A;  4GD8 A;  3ZHH A;  4A5R A;  1GSX A;  1DJB A;  1MWR A;  4OOY A;  3F1P B;  5DF7 A;  4GD6 A;  2V20 A;  4I39 A;  2J9O A;  4E3I A;  2G2U A;  1PZO A;  3NOU C;  5CX7 A;  1PW8 A;  5E2F A;  2CC1 A;  1HTZ A;  3EQV A;  3UDF A;  1ZC2 A;  2R9X A;  3PBT A;  1L2S A;  1W63 Q;  5TR7 A;  4LLO B;  4QJG A;  4QB8 A;  4PMA A;  5DJU A;  3IH9 A;  2GNX A;  3G30 A;  3NDG A;  2V0W A;  3W8K A;  3LEZ A;  2QWS A;  3BQ8 A;  1K6R A;  2HDU A;  3CHW P;  5F5Y A;  3A0V A;  1BYW A;  3N6I A;  1DRM A;  3EWK A;  3PHY A;  1RP5 A;  4PM6 A;  4B4Z A;  4MEZ A;  3WS5 A;  3L7H A;  2W3H A;  1E4D A;  4Z1W A;  3MS6 A;  1VB6 A;  1KE4 A;  3FV7 A;  1FCN A;  4H6J A;  4D2O A;  4PM5 A;  4JXV A;  4U3T A;  1P97 A;  1MC0 A;  5EVE A;  3LR0 A;  5JYP A;  5IHV A;  5L2F A;  2B18 A;  2XF3 A;  1BUE A;  3FZC A;  5FAP A;  2KLI A;  4II7 A;  3OCL A;  3DTI A;  1PNE A;  3PBR A;  2Y4A A;  5HWW A;  4IED A;  4WF0 A;  1L3L A;  3ZCZ A;  1W8Q A;  3VFH A;  4X6T A;  3BJN A;  5M1A A;  4P0M A;  3HVF A;  3JPU A;  2VJW A;  5HAI A;  4R4R A;  1NYY A;  5CGW A;  1LI9 A;  1S4R A;  2EX8 A;  4C75 A;  4OKP A;  4E6W A;  5TBM B;  1KGF A;  4OPZ A;  3C8C A;  4KZ9 A;  3H7W A;  1PW1 A;  5C5K A;  3PXP A;  4EWF A;  4L9E A;  3UPO A;  4DDS A;  2DMW A;  5G4Y A;  2DNS A;  3L9K A;  3B33 A;  2OV5 A;  2JKF A;  2XA7 S;  4IHQ A;  4NET A;  5EOE A;  4Q0H A;  4S2N A;  1T1A A;  3ZVW A;  3OOV A;  5JYO A;  2ACG A;  3ZDJ A;  1XP4 A;  4DMZ A;  4MLL A;  4S2N C;  4GJ4 A;  3QP8 A;  4FH2 A;  3Q81 A;  5EVI B;  3OC2 A;  4IUH A;  4MCW A;  1UGU A;  1T18 A;  3A0R A;  4QU3 A;  1IKI A;  2WZZ A;  3VSK A;  1XJ6 A;  4OP5 A;  5DFX A;  4OOM A;  1ACF A;  4X1L A;  2WKH A;  1WYB A;  5CER A;  1S4S A;  1MZU A;  4FTX A;  4HOI A;  4UA6 A;  1NZO A;  1EWZ A;  4P85 A;  2VKS A;  4Y2F A;  5BOH A;  4KZ3 A;  3NEC A;  1V9Z A;  4S2L A;  4CJN A;  4E3O A;  3KYE A;  3F1N B;  2W3F A;  3HJI A;  2W0N A;  2ZD8 A;  5HX9 A;  3HUM A;  4OVD A;  2BTF P;  2W3E A;  5AQ9 A;  2PR5 A;  1BT5 A;  3GMW A;  1SKO B;  3BFD A;  1SDE A;  4XUZ A;  4LCL A;  2W3G A;  3M6B A;  1D1J A;  4PKY A;  4DN0 A;  4RA7 A;  2XLN A;  3T4K A;  3O3V A;  3CPT B;  4B9O A;  1HZO A;  1YSP A;  1YLP A;  1K4F A;  2HP5 A;  3BLS A;  2JKT M;  1S67 L;  1K38 A;  2WAE A;  2XGN A;  4GB7 A;  2WGI A;  2XQZ A;  4L9G A;  1GHI A;  3PBQ A;  3MF0 A;  4K08 A;  3ZG0 A;  3WRZ A;  4XUX A;  2IWB A;  3FKV A;  1YLW A;  1ZKJ A;  1N4O A;  4MBH A;  1OTA A;  3NC8 A;  3UE3 A;  4P6Z S;  3IT9 A;  4Y17 A;  3WS0 A;  4YNR A;  1OJG A;  4DJ2 A;  2ZQ7 A;  1TDG A;  3Q7V A;  1SHV A;  3IXH A;  4LV2 A;  4BD1 A;  4QHC A;  5A8B A;  1PWC A;  2H28 A;  4XXR A;  2H0T A;  3S4X A;  4P6B A;  4ETZ A;  2JBF A;  3T1R A;  4Y7P A;  1W79 A;  3A3I A;  3E4O A;  1QMF A;  3PAE A;  4GHI B;  4FUW A;  3VFF A;  5CGS A;  2WKQ A;  4HH3 A;  2C5W B;  1T19 A;  5FQ9 A;  2J8Y A;  3SH9 A;  1CK3 A;  1S1Z A;  3MZE A;  4MN5 A;  3HBR A;  3U2A A;  1F5M A;  4U0X A;  3PBS A;  1NYM A;  1VHM A;  1NLY A;  1XJ4 A;  3A3E A;  4JBF A;  3ZGA B;  3I7J A;  4AFI A;  2UWX A;  3W4P A;  1Z09 A;  2HV1 A;  3VP4 A;  5J4E A;  2VA0 A;  4R3J A;  1G28 A;  2IWC A;  4N1H A;  2Y91 A;  1VQQ A;  1N9L A;  1HLU P;  5AQB A;  4GS9 B;  5DJT A;  4O7D A;  4F94 A;  4F3L B;  4PM8 A;  1ERM A;  3F1O B;  2JKT I;  1GA9 A;  1XA7 A;  5A92 A;  2XK1 A;  5CHJ A;  3VMA A;  3LFV A;  1L0F A;  3NI9 A;  3UB8 A;  1FCO A;  4R6L A;  3RH8 B;  4KUK A;  3T1X A;  1GSW A;  4DE3 A;  3G2Z A;  4CLC A;  3AGD A;  2W27 A;  5TJJ A;  2IA2 A;  2Y2G A;  3R4K A;  2MJ6 A;  3K2N A;  3BY8 A;  2ZL1 A;  1KGG A;  3V50 A;  4GN2 A;  5KZH A;  4Y5F A;  4Y15 A;  4CLC C;  5E2H A;  4ZTK A;  1M6K A;  1EI5 A;  3IS2 B;  2XD1 A;  4ETX A;  1UWP X;  3TRC A;  5F6A A;  3IX8 A;  1PIO A;  4KZA A;  2QJ5 A;  2PAV P;  4DE1 A;  2Y2M A;  3EEA A;  5EV0 A;  4IUK A;  4LV1 A;  1NJ4 A;  4JGO A;  2HP6 A;  3DW0 A;  4X56 A;  5KMW A;  2BG1 A;  5F83 A;  2HZ5 A;  3GQZ A;  3SH8 A;  5KSC A;  4I3J A;  2V1B A;  4S2I A;  3S7P A;  2ZC3 B;  5IS1 A;  1DP9 A;  3N8R A;  1AWI A;  1KVL A;  3IF6 B;  1OTI A;  4JGR A;  1F9I A;  1KDW A;  4GDB A;  3WS2 A;  3WWX A;  5FSR A;  2Z6D A;  4KG6 A;  4ZAM A;  3QP4 A;  5U47 A;  5EFW A;  4BBT A;  4RX3 A;  2FFF B;  1FSY A;  2V1Z A;  4UHU A;  1I5Q A;  4GKU A;  4HJ6 A;  2ZOI A;  4JKT A;  1DJC A;  1H3Q A;  3CMZ A;  3V39 A;  4KZ5 A;  2JE5 A;  2XH9 A;  1PYY A;  4MDZ A;  5EPH A;  3O88 A;  4ESP A;  1CI9 A;  4H6J B;  4NXE A;  1XJ2 A;  5CHM A;  3NHQ A;  2W3D A;  1W8Y A;  2ZQ9 A;  4CQH A;  1TD5 A;  3ZG9 B;  3QHY A;  4DE2 A;  3ITA A;  5DTT A;  2VEA A;  4N92 A;  2ZM2 A;  4N1X A;  3MXR A;  1OME A;  2FH5 A;  3N4I A;  1LL9 A;  4BBV A;  1LI0 A;  1C3B A;  4FCF A;  2I72 A;  3A3J A;  3T4O A;  2O9A A;  2Q0O A;  4OQI A;  1H8Z A;  3FKW A;  3UDI A;  3FC7 A;  1NRJ A;  3IQA A;  1KVM A;  1I2S A;  3GEC A;  4QY5 A;  3TSG A;  1MBL A;  2WUQ A;  1NRF A;  4Y3I A;  3LR4 A;  5FI6 A;  4BJP A;  1T1C A;  3BY9 A;  2HDR A;  3UME A;  1GA0 A;  4DDY A;  1S66 L;  4EBP A;  2OWH A;  2XFS A;  3P7N A;  3DAV A;  3ISG A;  5GLC A;  3E0Y A;  5FAS A;  3TG9 A;  3V67 A;  3VV4 A;  2RL3 A;  1OTD A;  1FIL A;  3Q07 A;  4HBU A;  1BLC A;  1IEL A;  4LPZ A;  3V3R A;  4HP4 A;  5HWV A;  2ZM0 A;  1IYP A;  5FDH A;  4EQI A;  4Q0J A;  1TS6 A;  2BAS A;  2PRF A;  1OTE A;  3HLE A;  1IFQ A;  2OSU A;  3BFG A;  5HDS A;  4HEF A;  4HI4 A;  1JWZ A;  1K6S A;  4GW9 A;  2QJ7 A;  2V8F A;  3MBZ A;  2I9V A;  4X68 A;  5A93 A;  1LHY A;  1GHM A;  3EQU A;  2GX5 A;  5FQI A;  1WYC A;  4Z9Q A;  3GTC A;  3MQQ A;  4GZB A;  1XKZ A;  1YSQ A;  2EA9 A;  2WAD A;  3CIT A;  3NBL A;  4BL3 A;  2H10 A;  2HDS A;  1Q2Q A;  5AVF A;  2A3U A;  1ODV A;  3MKF A;  3OPL A;  4NXB A;  3NJA A;  1ES5 A;  4HJ3 A;  1PRQ A;  1TVF A;  1EW0 A;  2A24 A;  3VOY A;  4LGW A;  4R4S A;  3VP1 A;  4MBK A;  2B5R A;  3EOI A;  5DTK A;  3LR3 A;  1YLT A;  1BZA A;  3PTE A;  4OPQ A;  4FH4 A;  2WAF A;  5DTS A;  1ESU A;  1MWU A;  2WGW A;  1XPB A;  3IWO A;  4WEJ A;  3Q7V B;  2AVX A;  4HH2 A;  3E2K A;  4LRY C;  4LFU A;  2Z2M B;  3HCY A;  3OPH A;  4UA9 A;  4E6X A;  4KQQ A;  3R7W A;  3T4S A;  2HDQ A;  3QP5 A;  4EES A;  3LI8 A;  4X53 A;  5FAO A;  4RYE A;  4KZB A;  2VK3 A;  2XRO A;  3ZVT A;  3W4Q A;  4JXW A;  4FD8 A;  2Y79 A;  5FI7 A;  2HF6 A;  4JLF A;  4KQR A;  4JF6 A;  3VP3 A;  1IKG A;  4QWO A;  4ZBE A;  2VGL S;  4BBU A;  2VGK A;  4RQ9 A;  4L9F A;  3ITB A;  2GZA A;  2V8C A;  2WGV A;  2ZMA A;  3G32 A;  4HHD A;  4S2J A;  3ZNT A;  4GLQ A;  1PI4 A;  4G3K A;  3H82 B;  5GHZ A;  3F1P A;  3CJM A;  1PWG A;  2L4R A;  3DWZ A;  1DP8 A;  2OOL A;  1LSX A;  4EBN A;  3HLC A;  2WKI A;  5FQQ A;  1IEM A;  3E4Q A;  5G18 A;  4PHT A;  3N7W A;  2NUT C;  4H8R A;  4PAU A;  3T4L A;  2M7U A;  2VGL M;  3UE1 A;  4UAA A;  2EWW A;  1YMS A;  2A49 A;  3MQ0 A;  1XGI A;  2X02 A;  3RFB A;  2JN7 A;  3ULF A;  3NDE A;  1YLY A;  4EET B;  1IYQ A;  3HLD A;  2A2L A;  5EOO A;  5LBR A;  3BFF A;  3D3O A;  1MPL A;  2OAQ 1;  2PD7 A;  4X1M A;  2RCX A;  2XRN A;  5CGX A;  1LSV A;  1KOU A;  2D01 A;  4JXS A;  3HUN A;  4O01 A;  4BD0 A;  5M19 A;  4MN6 A;  5G4Z A;  4EBL A;  3LIE A;  1BUL A;  1L0G A;  3OPR A;  3K3C A;  1P9R A;  2EFX A;  3O87 A;  5A90 A;  4BMW A;  1XFQ A;  3PAG A;  3MFD A;  3IX4 A;  3C30 A;  4NG2 A;  1CF0 A;  1H5X A;  1IYO A;  2E8I A;  4FOF A;  1W63 M;  2J80 A;  3VE4 A;  3Q82 A;  4WZ5 A;  1E25 A;  4B4X A;  3UMD A;  2YKF A;  1DP6 A;  3LEQ A;  4EER A;  3UDX A;  1N9B A;  3SW1 A;  3T50 A;  3H9W A;  2O9B A;  2OLV A;  4WZ5 C;  3D4F A;  3G31 A;  1V9Y A;  3FG8 A;  5DKL A;  3WS4 A;  5E2E A;  5FAT A;  3MSH A;  4BWI A;  1OPX A;  4WZ4 A;  2P04 A;  5HDD A;  3D9Y A;  4HP9 A;  3FWL A;  4WBG A;  3SS5 A;  2Y59 A;  1LL8 A;  4PM9 A;  3MR0 A;  5EM0 A;  4K0W A;  2K31 A;  3SS4 A;  4R0Q A;  4ZJ1 A;  3GR2 A;  2R9W A;  2GJ3 A;  3LID A;  2JHE A;  5HW3 A;  3C38 A;  4LV0 A;  2ZC6 B;  1JTD A;  3SH7 A;  5EVI A;  3T4J A;  4WUJ A;  4WL9 A;  2DCF A;  4ZJ2 A;  4OPY A;  5EVI C;  3PBN A;  3BM6 A;  1ZG6 A;  5DF9 A;  4OLG A;  2VV8 A;  2XR0 A;  3IBJ A;  2PR6 A;  1YPR A;  2P9V A;  3IX3 A;  4PM7 A;  2EXB A;  4O0P A;  2ZQD A;  4Y0O A;  3F1N A;  4NEE D;  5GL9 A;  1XJ3 A;  2WK0 A;  4OQ0 A;  1RGY A;  1ZTU A;  4D60 A;  4GOG A;  2DRW A;  1XX2 A;  3B3X A;  3OZH A;  3C7U A;  1SDN A;  1ES4 A;  1CEG A;  1N9N A;  1JWP A;  4R38 A;  4WM9 A;  3MXQ A;  3LIA A;  3T4Q A;  3B47 A;  2W1T B;  2ZC5 B;  2YKH A;  3LIF A;  4YIN A;  3HUO A;  4WN5 A;  5TFQ A;  4YWZ A;  1J9M A;  4ARZ A;  3GSG A;  1E3U D;  5EVI D;  3HLB A;  2ZBB A;  4HY8 A;  4LRZ E;  5J3W A;  4X55 A;  4JGP A;  4E04 A;  1K57 C;  4KZ8 A;  5GHY A;  3P09 A;  4M3K A;  3G2Y A;  3VP2 A;  2Y2H A;  3M2K A;  1MKI A;  1VET A;  1NZU A;  4I38 A;  5HAR A;  1K0K A;  5FDS A;  3C4P A;  2V0U A;  3CLO A;  4MNR A;  3KYQ A;  3M2J A;  3MKE A;  2W1R A;  3BFC A;  5MC7 A;  2WZX A;  1YKD A;  3TJZ C;  3CWF A;  4LEN A;  4UA7 A;  5EE8 A;  4ZDX A;  3LCE A;  3HRE A;  3OCN A;  5FEF A;  5L09 A;  1MY8 A;  3ZNY A;  4EXO A;  2O9C A;  4HBT A;  4KG2 A;  2Y2K A;  1LSW A;  1T1B A;  4YOF A;  4KZ6 A;  2J9P A;  5E43 A;  1KE0 A;  1L0E A;  2ZQ8 A;  4ID4 A;  1W7F A;  1YLZ A;  5IT5 A;  2OLU A;  3CUE C;  5HL6 A;  1YQS A;  1CJF A;  3UB7 A;  4EEU A;  2Z2L B;  2OWJ A;  4KEN B;  1Y28 A;  2Y55 A;  5EUA A;  5I5L A;  1YAX A;  3GV9 A;  1MKM A;  4HNB A;  5DFY A;  3LY3 A;  3K3D A;  4KQD A;  4F3L A;  2JC7 A;  2PBD P;  5AQA A;  5AJG A;  3F1O A;  1YLJ A;  3RJU A;  2PHY A;  1ALQ A;  3LY4 A;  3T1S A;  3C2W A;  2C6W B;  2ZQA A;  3PR6 A;  2ZLY A;  5A91 A;  3H7W B;  3MZD A;  3LR5 A;  4WMC A;  4I3I A;  2HJ9 C;  5KSH A;  2PBY A;  4XT2 A;  4N9L A;  1O07 A;  3W4O A;  4BL2 A;  3CZD A;  4LCM A;  2JKR I;  2Q9N A;  4S2K A;  3HLG A;  2EWV A;  2PDR A;  4U0T A;  5CRF A;  3QNC A;  1HVB A;  2PT7 A;  3G34 A;  3IS2 A;  4X25 A;  1U60 A;  3QP6 A;  4IVK A;  3M6H A;  5CEB A;  4K91 A;  3W2Z A;  4R1G A;  1TDL A;  3NOP C;  3KSH A;  3UE0 A;  3CAX A;  4R3A A;  4JGQ A;  3UPP A;  3IBR A;  3DBA A;  5F68 A;  2PYR A;  5EVL A;  1XFN A;  3BRM A;  1W5D A;  4B93 A;  1G6O A;  3KYZ A;  1UWN X;  3VOL A;  1FQG A;  4DRT A;  4JF5 A;  2QHK A;  5FA7 A;  4OLD A;  4FSF A;  2PU2 A;  3BFE A;  1Y54 A;  4BEN A;  5CEC A;  3IF6 A;  2VV6 A;  5KIZ A;  5K5B A;  4E3N A;  5CTN A;  4WMC D;  3HL9 A;  3FYZ A;  3EEH A;  2PU4 A;  4G3V A;  5E2G A;  3IF6 C;  1JTG A;  1KE3 A;  1K55 A;  3ZG5 A;  2FZ0 A;  2QKP A;  4WLA A;  2EX9 A;  2KOI A;  3SZT A;  2O99 A;  4KG5 A;  2ZM8 A;  1FR6 A;  3LIC A;  1K55 C;  1CQA A;  1G6A A;  1K56 D;  2ZOH A;  3BYD A;  1BLP A;  1NXY A;  4ZJ3 A;  3VP0 A;  5I94 A;  5L8M A;  2Y2N A;  3NCK A;  4OON A;  2VLG A;  5FEG A;  2Y2J A;  3JYI A;  1PI5 A;  2Z6C A;  3MXS A;  4E3J A;  2XDM A;  3C4O A;  2L0W A;  2Y2Q A;  3G35 A;  3VE3 A;  3IHB A;  5EM1 A;  1ES2 A;  3KSF A;  4HES A;  3C5A A;  1WA9 A;  2ZQC A;  5EEC A;  1D06 A;  1LT0 A;  3UB6 A;  1OT9 A;  1GCE A;  2EX6 A;  4R23 A;  4UQI S;  3S22 A;  3SOI A;  2VGJ A;  1ONH A;  4NXG A;  5L10 A;  4S2M A;  3LUQ A;  3PBO A;  2E8J A;  5HAP A;  3LYX A;  1F2K A;  2WKE A;  4DJ3 A;  4OP8 A;  3DTE A;  2Y2O A;  3V5M A;  5GHX A;  3LIB A;  4CLC E;  2PYP A;  3CG5 A;  2JCH A;  4Y0U A;  1H0M A;  1YMX A;  1VEU A;  3NY4 A;  4JPM A;  1K25 A;  2X71 A;  2HGV A;  5F69 A;  3JVV A;  3E4P A;  3CI6 A;  4P87 A;  2H0Y A;  5F1F A;  1ERO A;  4B88 A;  2HP9 A;  4UQI M;  1G68 A;  3IHA A;  4EQ1 A;  2L1M A;  3RXX A;  4CPK A;  2GDN A;  4DE0 A;  2P74 A;  4YFM A;  1SKF A;  1S1Y A;  3T12 B;  4IBR A;  4OQH A;  4NK3 A;  2OAP 1;  1MWT A;  5CHU A;  1GSV A;  1FIK A;  1P0Z A;  2K2N A;  4RVA A;  2IWD A;  1TS8 A;  1XA1 A;  4MMN A;  2G2W A;  2XD5 A;  1K54 A;  3IWQ A;  4EW7 A;  3NUL A;  3AGE A;  2B95 A;  2XA7 M;  3MZF A;  3IF5 A;  1NWZ A;  3E98 A;  2BLS A;  2P9V B;  1K54 C;  1KGE A;  1J3W A;  3TW8 A;  5FAQ A;  3SS3 A;  3HLW A;  3WRT A;  2VX8 A;  2H5S A;  3LO7 A;  1S6R A;  3ZYT A;  4X69 A;  5D3O A;  4CLC B;  1OJ5 A;  2VV7 A;  4Y13 A;  3TE8 A;  3LGO A;  3GDI A;  2ZL1 B;  2EX2 A;  4RX2 A;  5GLB A;  1DY6 A;  1ZHH B;  4DXC A;  3S1Y A;  2Y2I A;  5CTM A;  1H8M A;  2Y2P A;  5DKK A;  1MWS A;  4E3L A;  3FPW A;  4ARZ B;  1FCM A;  1PZP A;  2QMI A;  1ESI A;  3BW6 A;  4Y0T A;  4OOL A;  2Y8H A;  4K0X A;  1YT4 A;  5F1G A;  3HJK A;  2G7U A;  2EXA A;  5FQM A;  3A3D A;  5DVA A;  4EV4 A;  1BLH A;  2WKR A;  3MQO A;  1VET B;  4HIA A;  5HDC A;  1ZG4 A;  5TBM A;  3N8L A;  3B42 A;  3A0S A;  1DJA A;  1GHP A;  2ZJ9 A;  1TEM A;  3V3S A;  2K7S A;  3VSL A;  4IVI A;  5HD5 A;  1LL5 A;  3OPP A;  3UO9 A;  4KUO A;  3Q1F A;  4EU0 A;  2VZW A;  3AGF A;  3U4L P;  3OLO A;  1JWV A;  5AQ7 A;  4EEP A;  3ICY A;  3T4T A;  1OT6 A;  3S7O A;  1IYS A;  2QPN A;  3A3F A;  4WYY A;  4ZRR A;  3EGD C;  4OH0 A;  4I5S A;  5HL1 A;  3UB9 A;  1JNU A;  3G6O A;  2B02 A;  2Q9M A;  3QP1 A;  3BEC A;  3UN7 A;  2P7J A;  4P6Z M;  1KDS A;  2XFT A;  3BLM A;  4ME4 A;  2V1A A;  1VM1 A;  1E3U A;  1TF1 A;  4BLM A;  2CMN A;  3UB5 P;  1K4E A;  5GLD A;  3KO6 A;  3UY6 A;  1XXM A;  2P08 A;  2R78 A;  1PWD A;  1A0K A;  1FR1 A;  1G5U A;  2QYB A;  3H82 A;  2O0Y A;  4KZ7 A;  4G3W A;  4OPR A;  4I3A A;  1JVJ A;  5HZH A;  3RXW A;  2D02 A;  1Q2P A;  5FL3 A;  2HPB A;  3EGX C;  4HQA A;  4O8G A;  3BQA A;  1BLS A;  1MXO A;  1LLB A;  1SCW A;  1RGZ A;  5HWT A;  2PD8 A;  4EUZ A;  5F82 A;  3Q7Z A;  3P98 A;  5HPF A;  1ERQ A;  4NXF A;  1SKO A;  2Y2L A;  1Z6F A;  3QNB A;  5HFO A;  5J7E A;  3TOI A;  1ONG A;  3CPT A;  3E2L A;  3GVB A;  1QME A;  4XT2 B;  1TS0 A;  4E3M A;  3D72 A;  1K57 A;  3PYP A;  2J7V A;  2LB5 A;  4HJ4 A;  5CED A;  3O86 A;  3OBF A;  3C7V A;  1L0D A;  1BTL A;  3IXG A;  4GCZ A;  3T1Q B;  4LV3 A;  4MN7 A;  4WEK A;  3BWL A;  1RCJ A;  4KQO A;  1FSW A; 
#chains in the Genus database with same CATH homology
 1IOU A;  3R7W A;  3T4S A;  5HD3 A;  2JKR M;  4EES A;  2J3W A;  3W2Z A;  3LI8 A;  5A8B A;  3NOP C;  3KSH A;  2H28 A;  3CAX A;  4R3A A;  2V9A A;  4ETZ A;  1STZ A;  3KSI A;  4R70 A;  2XRO A;  4JGQ A;  2ZMV A;  3E4O A;  3IBR A;  3NOT C;  3DBA A;  3JVU A;  5F68 A;  3S7N A;  4GHI B;  2PYR A;  5IU1 A;  1XFN A;  2Y79 A;  4EUV A;  2HF6 A;  2WKQ A;  4B93 A;  1F98 A;  4HH3 A;  1G6O A;  3KYZ A;  3S7Q A;  2WKP A;  1T19 A;  1UWN X;  3VOL A;  4GHI A;  2VGL S;  1S1Z A;  4BBU A;  2QHK A;  4MN5 A;  4RQ9 A;  1D7E A;  3LI9 A;  4L9F A;  4FSF A;  3U2A A;  4PKY G;  1F5M A;  3O5Y A;  2NUP C;  3PBS A;  2GZA A;  4HHD A;  4CLC D;  4GLQ A;  4G3K A;  1VHM A;  1NLY A;  1XJ4 A;  5HSQ A;  2VV6 A;  5KIZ A;  3H82 B;  3F1P A;  4QPR A;  5K5B A;  1X0O A;  2L4R A;  1N9O A;  1DP8 A;  4AFI A;  3EEH A;  2OOL A;  3FPV A;  1LSX A;  4G3V A;  2HV1 A;  3CUE A;  5J4E A;  3E4Q A;  4Q0I A;  2KX6 A;  2VA0 A;  1G28 A;  2FZ0 A;  4IJG A;  2QKP A;  4WLA A;  2KOI A;  4PHT A;  4WEL A;  2NUT C;  2O99 A;  4PAU A;  4L0L A;  3T4L A;  3ZQ5 A;  1N9L A;  2M7U A;  2INW A;  3LIC A;  2VGL M;  4GS9 B;  5DJT A;  2EWW A;  4F3L B;  2ZOH A;  2KDK A;  3F1O B;  2A24 B;  2JKT I;  3KSG A;  3MQ0 A;  5L8M A;  2VLG A;  3LFV A;  4GS9 A;  5HPI A;  3RFB A;  3KX0 X;  2JN7 A;  3UB8 A;  3ULF A;  4R6L A;  3MMH A;  3RH8 B;  1NLZ A;  4KUK A;  2Z6C A;  4EET B;  1GSW A;  2M7V A;  2A2L A;  4CLC A;  4NKP A;  5LBR A;  2J3T C;  2W27 A;  3D3O A;  5TJJ A;  2L0W A;  2IA2 A;  3R4K A;  2MJ6 A;  2OAQ 1;  2PD7 A;  3K2N A;  1TS7 A;  3BY8 A;  3VE3 A;  2XRN A;  1LSV A;  1KOU A;  2D01 A;  3KSF A;  4O01 A;  4Y5F A;  4UEY A;  4MN6 A;  4CLC C;  1WA9 A;  5G4Z A;  3LIE A;  1D06 A;  1LT0 A;  3K3C A;  3IS2 B;  3UB6 A;  1P9R A;  1OT9 A;  4ETX A;  1UWP X;  4UQI S;  3TRC A;  5F6A A;  4BMW A;  3R7W B;  1XFQ A;  4NXG A;  3MFX A;  3C30 A;  1OTB A;  3MJQ A;  2LB9 A;  3LUQ A;  4FOF A;  3PBO A;  1W63 M;  2QJ5 A;  2J80 A;  3VE4 A;  2W1T A;  3LYX A;  3EEA A;  4LRX C;  3UE6 A;  4IUK A;  2YKF A;  3UMD A;  4DJ3 A;  1P9W A;  4JGO A;  1DP6 A;  3LIB A;  4EER A;  3SW1 A;  3T50 A;  4CLC E;  2PYP A;  3H9W A;  4M4X A;  3RTY A;  2O9B A;  2HJE A;  3P01 A;  4I3J A;  2ZMF A;  1V9Y A;  2V1B A;  5AVE A;  2HGV A;  3S7P A;  3FG8 A;  5F69 A;  5IS1 A;  3JVV A;  2J3T D;  3E4P A;  3CI6 A;  1DP9 A;  2M1C A;  5DKL A;  2XSS A;  1GSX A;  1OTI A;  4BWI A;  4UQI M;  1OPX A;  4JGR A;  3F1P B;  1F9I A;  4EQ1 A;  2P04 A;  2L1M A;  5HDD A;  4HP9 A;  4I39 A;  2Z6D A;  1LL8 A;  3NOU C;  1S1Y A;  5CX7 A;  3MR0 A;  2OAP 1;  5EFW A;  2K31 A;  4BBT A;  3EQV A;  1GSV A;  2GJ3 A;  1P0Z A;  2K2N A;  3LID A;  2JHE A;  3PBT A;  3C38 A;  1TS8 A;  1W63 Q;  4HJ6 A;  2ZOI A;  1H3Q A;  4LLO B;  4MMN A;  3T4J A;  4WUJ A;  5DJU A;  2GNX A;  4EW7 A;  2V0W A;  4WL9 A;  2QWS A;  2XA7 M;  3BQ8 A;  1NWZ A;  3E98 A;  5F5Y A;  4MDZ A;  3A0V A;  1BYW A;  1DRM A;  4H6J B;  4NXE A;  1XJ2 A;  3EWK A;  3PHY A;  3PBN A;  3TW8 A;  2W3H A;  5DF9 A;  3NHQ A;  2W3D A;  2VV8 A;  3IBJ A;  4Z1W A;  2PR6 A;  2VX8 A;  1VB6 A;  3ZYT A;  4H6J A;  4CLC B;  1P97 A;  1MC0 A;  4CQH A;  1TD5 A;  1OJ5 A;  2VV7 A;  3LR0 A;  4O0P A;  3TE8 A;  2B18 A;  3GDI A;  3F1N A;  1ZHH B;  2VEA A;  2KLI A;  4NEE D;  4II7 A;  1XJ3 A;  3OCL A;  3PBR A;  2FH5 A;  1ZTU A;  5HWW A;  1H8M A;  4WF0 A;  4BBV A;  5DKK A;  3FPW A;  4ARZ B;  3BJN A;  1N9N A;  3T4O A;  4R38 A;  2O9A A;  3MXQ A;  3LIA A;  3T4Q A;  3B47 A;  3BW6 A;  4OOL A;  2W1T B;  2YKH A;  2VJW A;  3LIF A;  3FC7 A;  4WN5 A;  1NRJ A;  4YWZ A;  2Y8H A;  3GEC A;  4ARZ A;  1S4R A;  3HJK A;  2G7U A;  5TBM B;  2ZBB A;  4HY8 A;  4LRZ E;  5J3W A;  3C8C A;  4Y3I A;  4JGP A;  3LR4 A;  3H7W A;  4E04 A;  5C5K A;  3PXP A;  1T1C A;  4L9E A;  2WKR A;  3MQO A;  4HIA A;  5HDC A;  4BJP A;  2DMW A;  5G4Y A;  3BY9 A;  5TBM A;  3B42 A;  3A0S A;  3UME A;  1S66 L;  3B33 A;  2OWH A;  2K7S A;  2XA7 S;  4IHQ A;  3P7N A;  4I38 A;  3E0Y A;  4Q0H A;  3V67 A;  5HD5 A;  4KUO A;  3VV4 A;  1OTD A;  4EU0 A;  1T1A A;  2VZW A;  2V0U A;  3OOV A;  3OLO A;  3CLO A;  3KYQ A;  4EEP A;  3ICY A;  2W1R A;  3T4T A;  1OT6 A;  3S7O A;  4ZRR A;  3EGD C;  5MC7 A;  4LPZ A;  4I5S A;  4DMZ A;  3UB9 A;  1YKD A;  4HP4 A;  5HWV A;  3TJZ C;  4GJ4 A;  1JNU A;  3CWF A;  3G6O A;  2B02 A;  4Q0J A;  1TS6 A;  2BAS A;  3OC2 A;  4IUH A;  2P7J A;  4MCW A;  1OTE A;  1UGU A;  1T18 A;  4P6Z M;  1IFQ A;  3A0R A;  3OCN A;  4ME4 A;  2V1A A;  5HDS A;  4HI4 A;  1TF1 A;  1XJ6 A;  4EXO A;  5DFX A;  2CMN A;  2O9C A;  4OOM A;  3KO6 A;  1S4S A;  1MZU A;  1LSW A;  1T1B A;  2P08 A;  4YOF A;  2R78 A;  4HOI A;  4GW9 A;  2QJ7 A;  2VKS A;  2I9V A;  4Y2F A;  2QYB A;  3H82 A;  1V9Z A;  3EQU A;  2O0Y A;  4G3W A;  2GX5 A;  4I3A A;  5HZH A;  3F1N B;  2D02 A;  2W3F A;  5FL3 A;  3HJI A;  2W0N A;  3EGX C;  3MQQ A;  4HQA A;  5IT5 A;  2W3E A;  4O8G A;  1YSQ A;  2EA9 A;  3CIT A;  3CUE C;  2PR5 A;  5HL6 A;  3UB7 A;  4EEU A;  3BQA A;  2OWJ A;  5AVF A;  1Y28 A;  1ODV A;  5I5L A;  1YAX A;  2W3G A;  1MKM A;  4HNB A;  4DN0 A;  4PKY A;  4NXB A;  5DFY A;  3NJA A;  5HWT A;  2PD8 A;  4HJ3 A;  3K3D A;  3T4K A;  5HPF A;  4KQD A;  4NXF A;  4B9O A;  4F3L A;  5AJG A;  1EW0 A;  3F1O A;  2A24 A;  1YSP A;  2PHY A;  5J7E A;  2JKT M;  3C2W A;  1S67 L;  3EOI A;  3LR3 A;  4L9G A;  4XT2 B;  1TS0 A;  3PR6 A;  3D72 A;  3PYP A;  3H7W B;  2LB5 A;  3LR5 A;  4HJ4 A;  3PBQ A;  3MF0 A;  4K08 A;  4I3I A;  2HJ9 C;  5KSH A;  3OBF A;  4XT2 A;  1OTA A;  4WEJ A;  3UE3 A;  4P6Z S;  2JKR I;  4HH2 A;  4YNR A;  1OJG A;  2EWV A;  4LRY C;  4GCZ A;  2PDR A;  4DJ2 A;  3HCY A;  2PT7 A;  3IS2 A;  4MN7 A;  4WEK A;  3BWL A;  4KQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...