3F1PA

Crystal structure of a high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
FKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3f1pA00
1GSWA 5DKKA 4GHIA 2VV6A 1XJ3A 3NOPC 4NXFA 4F3LA 1WA9A 1S1ZA 2R78A 4HH3A 1TS7A 3GDIA 4H6JA 4HJ4A 3ICYA 3NOTC 2L1MA 4HHDA 1BYWA 4HIAA 2ZOIA 4L9FA 4XT2B 1OTEA 2YKHA 3LIEA 5DJTA 2KDKA 5J4EA 3FC7A 2WKQA 3VOLA 2L4RA 3F1OA 3LYXA 2H28A 3PYPA 4GW9A 2OOLA 1XJ4A 4RQ9A 2CMNA 1MZUA 1N9LA 2EA9A 4DJ3A 3BWLA 5I5LA 1EW0A 3A0RA 4L9GA 1S4RA 2VEAA 3A0VA 4HQAA 4BBVA 2PD8A 1DP9A 1TS8A 2V1BA 1T1AA 3CLOA 3CWFA 4LRXC 5J7EA 1S66L 4LPZA 3NOUC 1F9IA 4WN5A 2A24B 1NWZA 3F1PB 2VV8A 5DKLA 3UMDA 1S1YA 3F1NB 1V9YA 2QWSA 3LICA 3LUQA 4HH2A 4LRZE 3C2WA 1V9ZA 4HJ6A 1DP8A 1UWNX 2VLGA 4HP9A 1T1CA 4HNBA 2W0NA 4YWZA 1S4SA 3E4PA 5HDCA 2KX6A 1LSWA 3IS2B 1VB6A 1GSVA 1Y28A 2Z6CA 4NXGA 2P7JA 4L9EA 5HD5A 4WUJA 3E4QA 4I3IA 4LLOB 3UB9A 5IU1A 3VE4A 2PHYA 5TBMA 3KX0X 1OJGA 2QHKA 4EESA 1LSXA 3H7WA 3H9WA 3PHYA 4NXBA 1T19A 2B02A 1OTBA 4JGQA 3MXQA 4R3AA 1T18A 3MJQA 3T50A 1DP6A 1XJ6A 5HZHA 3LIDA 1XJ2A 2J80A 4EXOA 1TS6A 4K08A 5KIZA 5F6AA 4GS9B 1OT6A 3ULFA 4NXEA 4I3AA 1LT0A 2D01A 3F1NA 3LIBA 3B33A 4EQ1A 1P97A 4I38A 3G6OA 4E04A 4EEUA 2HV1A 2PDRA 3VE3A 3OLOA 3ZQ5A 3MQOA 4HI4A 3UB8A 3D72A 1LSVA 1OTDA 3LI9A 4WL9A 3MFXA 4HJ3A 4EEPA 4JGPA 3BY8A 3CAXA 3EEHA 3SW1A 5HWVA 4F3LB 5HWTA 2I9VA 2M1CA 2V1AA 4GCZA 4HOIA 4GHIB 2GJ3A 3RTYA 1KOUA 5IS1A 3P7NA 1LL8A 5HDDA 2V0WA 3H82A 5F5YA 4JGOA 3UE6A 4EW7A 5HDSA 2INWA 2OWJA 3HJIA 3LIAA 4MN5A 2VV7A 4R70A 4M4XA 1JNUA 2PR5A 4XT2A 4EERA 5J3WA 5HWWA 2L0WA 4BBTA 3A0SA 1G28A 5G4YA 3F1OB 2OWHA 3MR0A 3H82B 3LIFA 2BASA 4R38A 1UWPX 4GS9A 3LI8A 3HJKA 1XFNA 3K3CA 5HD3A 3IBRA 4HY8A 1D7EA 2QJ5A 2JN7A 1F98A 4KUKA 1P0ZA 5AVFA 1T1BA 2PYPA 2D02A 4PKYA 2Z6DA 4KQDA 4HP4A 4I3JA 3NJAA 2V0UA 4I5SA 3H7WB 4LRYC 3MQQA 3NHQA 3EWKA 4H6JB 5TBMB 3GECA 1N9OA 1S67L 4PKYG 1UGUA 1XFQA 4BBUA 1N9NA 2ZBBA 3FG8A 3IS2A 4B9OA 2A24A 3F1PA 2PYRA 5DJUA 2YKFA 3UB6A 1OJ5A 2WKPA 5F69A 2ZOHA 5F68A 1ODVA 4WLAA 3C8CA 5G4ZA 2JHEA 2PR6A 1GSXA 3BY9A 2WKRA 3RH8B 2QJ7A 1X0OA 2V9AA 3K3DA 3UMEA 1OT9A 4KUOA 2K7SA 4JGRA 4I39A 4MN6A 5EFWA 5HSQA 1OTAA 2W27A 1TS0A 3E4OA 4R6LA 1DRMA 2QKPA 1D06A 2PD7A 5AVEA 4DJ2A 5A8BA 4WF0A 1OTIA 3UB7A 4EETB
chains in the Genus database with same CATH superfamily
1J3WA 4JF5A 1WYCA 1M6KA 1BLCA 4HIAA 5L8MA 2V8FA 3AGEA 4OH0A 3IWQA 3LYXA 2JKGA 3PYPA 4Z9QA 2OSUA 2JKTM 1TEMA 2FH5A 4X69A 4HQAA 4NETA 5JYOA 2XR0A 2VGKA 2WZXA 5M18A 3NECA 2PBDP 3C4OA 1V9YA 4DXCA 1CJFA 3C38A 4LRZE 3BECA 3V3RA 5JYPA 1AWIA 4GD8A 3T4SA 5CEDA 1TVFA 4DMZA 4Y7PA 4GDNA 4I3IA 4R0QA 4EBPA 4WEKA 4LENA 5CECA 1XGJA 5EVIC 1XJ6A 3UPPA 5AQ7A 5F6AA 4NXEA 1JWZA 3G6OA 1ZHHB 2Q0OA 3MXRA 4PM8A 5IHVA 1GHMA 4G3VA 3MFXA 3N8RA 3ITAA 5J8XA 3CI6A 1ZKJA 3SW1A 4QU3A 4EERA 4MN5A 2K31A 2HDQA 4OLDA 5I94A 3EQVA 3QP2A 4X1LA 1FQGA 3PBOA 3GR2A 4KZ9A 4KZ4A 1F98A 1YSPA 2VK3A 4H6JB 1MWUA 3ZHHA 3GRJA 1UGUA 3SZTA 3PBNA 1CEFA 5GL9A 3C8CA 3IX3A 3ZYTA 3DWKA 1DRMA 4DDSA 5HPIA 1W8YA 5A8BA 2XD5A 4JLFA 1PW8A 4PMAA 5DTSA 1MC0A 3NOPC 3R4KA 3WS4A 1WA9A 1NRFA 2L1MA 2YKHA 3LIEA 3VSLA 1BSGA 1JTGA 3T1SA 2WYXA 5DF8A 3OBFA 2UV0E 2Y91A 4ZDXA 4IEDA 3W4OA 2XD1A 2G7UA 1S66L 4PM5A 3UDIA 3ZG9B 4EUZA 4UQIM 3VP0A 2AVXA 1LSWA 1FOFA 2JKTI 4LLOB 3UB9A 3N6IA 2WKEA 3TRCA 1CF0A 3FPVA 3G2ZA 3IHAA 4JKTA 4FD8A 1YMSA 1VQQA 2EFXA 2BTFP 4WZ5C 2ZMFA 3G30A 3EQUA 3P7NA 4Y2FA 4HBUA 4S2NA 4WZ4A 4B88A 3LCEA 3NBLA 1CK3A 1O07A 5AJGA 3K3CA 1QMEA 1D7EA 1P0ZA 2V0UA 5HAPA 1DJBA 3B47A 3FG8A 1YLWA 3IXGA 1W7FA 2C5WB 4QHCA 4UQIS 5HPFA 4Y15A 1PNEA 3UMEA 4WYYA 3RXXA 4ID4A 4O7DA 3R7WA 4OPZA 1IKIA 4UEYA 1F5MA 4FTXA 1KE4A 3ICYA 4UA7A 1BYWA 5FQQA 5IT5A 1XJ4A 1EW0A 1TDLA 3WS1A 4IBRA 3VP1A 3K2NA 3IHBA 3HLCA 3C5AA 4LV0A 4HJ6A 1VETA 2VKSA 2FFFB 1S4SA 4XUXA 2W1RA 2KX6A 4OKPA 4Y0OA 1Y28A 4WUJA 5EOEA 4CLCD 1EI5A 2XFSA 3HUOA 4EESA 1LSXA 4NXBA 3W8KA 3HREA 4P85A 3T50A 3LIDA 4JXWA 4I3AA 4O0PA 2Y2KA 5DFYA 5F83A 3ZQ5A 3EOIA 2Y79A 1LSVA 4OPYA 3BY8A 3KYZA 3FZCA 4E3MA 1ALQA 1C3BA 4BBTA 3BFEA 3H82B 1XFNA 5AQ9A 4E3JA 1K38A 3O87A 1WYBA 3ZVWA 2D02A 4KQDA 4B4ZA 3O86A 1S6RA 1IYSA 4WLAA 3BFCA 3EEAA 3T4OA 5IS1A 4MN6A 3T4LA 2P74A 3C30A 4II7A 2J3TC 5CEBA 3NOTC 5CGXA 3OPRA 5DJTA 2XSSA 3WRZA 3CHWP 2CMNA 3BWLA 2ZM2A 2WADA 3A0VA 1JVJA 1Q2PA 3T4JA 2VGJA 1NLYA 2H5SA 1V9ZA 3E98A 3ZG8B 1UWNX 3V50A 5C5KA 1VB6A 3UDFA 3ZDJA 3QNBA 2R9XA 3H7WA 3HLDA 1HVBA 3VFFA 1MKIA 3RJUA 2VGLM 5E2EA 4Z1WA 4EXOA 1I2WA 4JF6A 4ARZB 1MKMA 2XEPA 3OLOA 4HI4A 5CRFA 3S1YA 4JGPA 3EEHA 4GCZA 3GQZA 5HDSA 5L2FA 4KZ3A 5DF9A 2QZ6A 4Y3IA 2OWHA 2HZ5A 3T4KA 2J7VA 3RXWA 4OQ0A 1YKDA 1NZUA 2Y2LA 2NUTC 4I5SA 4EUVA 3NHQA 1VETB 4P6BA 3ZG0A 3QP5A 1N9NA 2JKFA 3ZNTA 3BQAA 4JBFA 3B3XA 2V9AA 5HSQA 3OOVA 1IOUA 1VM1A 4GDBA 4DJ2A 5HAQA 4X1MA 5FI6A 3VMAA 2ZL1B 4FCFA 1G68A 4S2PA 1KE3A 4NKPA 1HTZA 5D3OA 1N9LA 1XP4A 1KGGA 2A3UA 3Q81A 1CEGA 2X01A 1DJCA 1E3UD 5FAPA 2HDRA 3VSKA 3C2WA 4S2NC 4X55A 5FI7A 2XGNA 4ESPA 4OONA 4KZ5A 4HESA 3E4QA 3JYIA 5IU1A 3GVBA 3NC8A 3H9WA 4OPQA 3JVVA 3G35A 2B02A 1MBLA 2J80A 1ZC2A 3C7UA 3F1NA 4XUZA 4B93A 4N1XA 4EEUA 2PDRA 1BZAA 1K4FA 2ZC7A 1SCWA 4GKUA 3MQOA 3D72A 4PPRA 1OTDA 4WL9A 2ZQ7A 3IF6A 3HLWA 5A91A 2RCXA 2A49A 1MY8A 4C75A 1CQAA 4OQHA 5EV0A 3IQAA 4BQMA 2PT7A 5GLBA 1YM1A 5HX9A 3D4FA 4Q0IA 4LRYC 3MQQA 3NDEA 3IWOA 3EWKA 3MS6A 5TBMB 3GECA 1S67L 3KSHA 3FKWA 2YKFA 3LEZA 3V67A 2H0TA 5CTNA 1K56A 4ZBEA 3E2LA 3KSIA 1SKOB 2E8JA 3BM6A 5J4EA 3L7HA 4DE0A 3MKFA 3T4TA 1ZG6A 3BEBA 3UNWA 4NEED 4BBVA 3G2YA 4MCWA 3NULA 4CLCC 1PIOA 3F1PB 3LY3A 2I72A 4IVIA 3LICA 4HH2A 4DF6A 4C3QA 2VLGA 3LGOA 4FH2A 4IJGA 4O01A 2O99A 1IYPA 3UMDA 1L2SA 2P7JA 5HD5A 1FSWA 3VE4A 2WGWB 4ZRRA 4Q0JA 1YQSA 3G32A 3IBJA 1OTBA 2DRWA 2X02A 1L0FA 3NY4A 1IEMA 3DTIA 4R3JA 3IXBA 1PWDA 4CJNA 3VE3A 4BLMA 4FUWA 1GA9A 4EEPA 2J3WA 2ZL1A 4IVKA 4KQRA 1KVMA 2GJ3A 5CGSA 4JGOA 3W4QA 1KGFA 4DE2A 3LFVA 3VOYA 1IELA 3OCNA 2KOIA 4E3OA 4R23A 5HD3A 4WBGA 2QJ5A 4GLQA 2HDUA 4BJPA 3M2JA 4YFMA 5CERA 3UE0A 4ZJ3A 3S4XA 3WS0A 3JVUA 2HP9A 4GN2A 2ZC3B 1D1JA 4HBTA 1X0OA 5FAOA 5DF7A 4N1HA 5AQBA 1YMXA 3FV7A 1MPLA 1HLUP 3GTCA 5DKKA 2VV6A 1XJ3A 3FWLA 1E3UA 4H6JA 4XXRA 2KDKA 4WELA 5FQIA 2W3EA 4UAAA 5HARA 2V2FF 4EWFA 4FOFA 3I7JA 2PD8A 3M6BA 1NWZA 4MDZA 4WMCA 2W0NA 4MMNA 3A3DA 3W4PA 5TBMA 5FDSA 4KZ8A 5E2FA 4E6XA 2Y2OA 4OQGA 1ESUA 4ZJ1A 4EU0A 1AXBA 4HEFA 2HP5A 1P97A 1K6RA 1L0EA 3ZCZA 4OOYA 2JE5A 4CLCA 1O7EA 3LI9A 4CLCB 2V20A 2B18A 3DTMA 2IWCA 2OV5A 2LB5A 4HOIA 3CMZA 1KOUA 4KG5A 1LL8A 5EVEA 4E3KA 2INWA 1ZG4A 1FR6A 1NJ4A 1G28A 2PBYA 3QP8A 1G5UA 2KLIA 2ZM8A 1ES5A 2WAEA 5K5BA 2PYPA 2DNSA 2UWXA 5CTMA 2WZZA 2XROA 1NY0A 2ZBBA 3WRTA 1FILA 5F68A 3RFBA 3O5YA 2QMIA 5F1GA 2QJ7A 3FYZA 2FZ0A 1W8QA 3V39A 1BLPA 1BUEA 2Z2LB 3UO9A 1GCEA 1YT4A 2DCFA 4N9LA 4QY6A 2QPNA 4IHQA 4GHIA 1L3LA 4BL3A 4YNRA 3L9KA 4L9FA 1DY6A 1K4EA 3F1OA 1E4DA 4DJ3A 2Y8HA 2VEAA 3IX4A 2P9VB 3IF5A 4IUKA 5DKLA 2A24B 4ZAMA 5DTTA 1S1YA 3MKEA 2ZQCA 3ISGA 5HDCA 1FCMA 5L07A 4L9EA 4X68A 4UA6A 2EX2A 4MEZA 5FA7A 2HPBA 5L10A 1K25A 4OPRA 1OT6A 2C6WB 3PBRA 3LR0A 3Q1FA 1ES4A 1SKFA 1K55A 1PWGA 2XK1A 3G34A 5HWTA 4E3IA 1SDEA 3N4IA 4MBFA 5HDDA 2V0WA 4EW7A 2J8YA 3HL9A 4N9KA 2WUQA 4FH4A 3P09A 3NCKA 4GS9A 3MF0A 3IBRA 2ZLYA 4HY8A 5EVIB 5GHYA 3V3SA 4KZ6A 2EX6A 5FSRA 3VFHA 2Z6DA 3Q82A 2VZWA 4PHTA 4FSFA 3DBAA 4B9OA 3HLGA 3ITBA 4MBHA 2WKPA 4DE1A 1GSXA 2Y55A 3SH9A 2ZMVA 4R6LA 5TR7A 1K55C 2ZQDA 2VGLS 1BULA 4AFIA 4EETB 3TOIA 2ZD8A 3PAGA 3EGDC 3UN7A 4XT2B 3TE8A 4P6ZM 4X53A 3SS3A 3CG5A 4GD6A 1M40A 1FIKA 5FQJA 5EPHA 3CLOA 1T1AA 4WN5A 4S2KA 3ZGAB 2XRNA 2GX5A 1CI8A 1RCJA 4GNUA 4NG2A 1PI4A 1ES3A 2ACGA 3KX0X 3LY4A 5M19A 1K54C 1Z09A 2W3DA 1ACFA 1T18A 4X25A 1XX2A 3E2KA 3ZNYA 4DE3A 2OAQ1 1IYOA 3HUMA 4K0XA 1K57C 4DRTA 2ZJ9A 1GHPA 1JWVA 3A3FA 1YLJA 2EWVA 4E3LA 3NDGA 4DKIA 1SDNA 1Y54A 4KQOA 4M3KA 5TJJA 4O8GA 3S22A 4CQHA 2Q9NA 4BD0A 1T1BA 5F1FA 2Y2GA 1TDGA 4N92A 1LHYA 3CPTB 3UY6A 2W1TB 1ODVA 1YLZA 5G4ZA 2PR6A 4MNRA 5KSHA 1OTAA 2W27A 3S7NA 5MC7A 1YAXA 4QB8A 2XH9A 3KSGA 1GSWA 4DN0A 3T4QA 4EV4A 1OPXA 4HJ4A 3GDIA 5DVAA 1H8MA 1NYMA 3QP6A 2O0YA 2WKQA 1ONGA 2H28A 1HZOA 3DW0A 4JXVA 4L9GA 4KZBA 4YINA 2GNXA 4BENA 4OQIA 3NOUC 1IYQA 4P0MA 2W3HA 3LR5A 5HFOA 4RYEA 2VX8A 2XF3A 4RA7A 1H8YA 5F82A 2PHYA 4R1GA 3IXDA 3KSFA 4JGQA 4R3AA 3QNCA 3KO6A 5HZHA 1XJ2A 1U60A 1GHIA 3ULFA 1NLZA 2R9WA 1W63M 5TGFA 5EE8A 1LI0A 5CHJA 1K54A 4S2MA 2O9CA 3MZDA 3HBRA 4HJ3A 3CAXA 1DJAA 4G3KA 2H0YA 2W3GA 3LIAA 3WS5A 3HJIA 1JTDA 3TJZC 5G4YA 4BMWA 3PR6A 3O3VA 2ZMAA 1F2KA 1BLSA 4DXBA 3C4PA 3BRMA 4HP4A 4X56A 5M1AA 3IH8A 3HLEA 4PKYG 3SS5A 1YLPA 3F1PA 2PYRA 1BLHA 3HVFA 2ZOHA 3G31A 1ERQA 2WKRA 4LV2A 2XA7M 3A3EA 1OT9A 2J9PA 4KUOA 4QY5A 5EFWA 4IBXA 3M6HA 5FASA 1BT5A 5AVEA 3W2ZA 4WF0A 3VP2A 1XKZA 1OTEA 1PZOA 5I5LA 3OPPA 4KZ7A 1TS8A 3OC2A 3MXSA 3OPHA 2VV8A 2PRFA 2ZC4B 1KGEA 3LEQA 1QMFA 1DP8A 3GSGA 4ZJ2A 2EX9A 1T1CA 1SKOA 2DMWA 5CHMA 2WKIA 3MQ0A 3DWZA 4OOLA 3N8LA 3MXQA 4K91A 1S0WA 4MLLA 2M7VA 2Y2NA 2Q9MA 4GB7A 2HV1A 4OP5A 5DTKA 2GZAA 4P87A 3HLBA 1I5QA 3TSGA 2VA0A 4U0TA 3CUEA 2WK0A 5HWVA 1EROA 3EGXC 5FL3A 5F5YA 2W3FA 1ONHA 3UB5P 2VV7A 1JNUA 2HJEA 5J3WA 1MWRA 2JBFA 3A0SA 3P98A 4ETZA 2B95A 4NK3A 5CX7A 4IUHA 3N7WA 3Q7VB 4PKYA 4C6YA 2Y2PA 1XA1A 3U2AA 3B42A 1PW1A 1TF1A 4BWIA 1CI9A 1LLBA 5A92A 3IF6C 2ZQAA 3HCYA 2QKPA 3LR3A 2EWWA 3V5MA 3UPOA 2Y59A 4S2OA 1OTIA 2XFTA 5EM1A 4F3LA 3ZG7B 4HHDA 3MMHA 4G3WA 4S2JA 4GW9A 3MFDA 3WS2A 3A0RA 4WZ5A 1MXOA 1E25A 4LPZA 1F9IA 4X6TA 3UPNA 1Y4OA 1N4OA 1W63Q 2J3TD 2WGIA 4F94A 4NXGA 4JF4A 4LCLA 5HL1A 1RP5A 3IWIA 1T19A 5EUAA 1WE4A 4LFUA 4OP8A 3OCLA 1P9RA 3E0YA 3T12B 3PXPA 2JKRI 5FI2A 2I9VA 3ZG5A 4GHIB 3MZEA 1Z6FA 3QHYA 2WGVA 5KSCA 2PR5A 5EECA 2L0WA 1OMEA 3F1OB 2OLVA 4WMCD 1K56D 1K0KA 3BJNA 1K6SA 4H8RA 2A24A 3T1XA 3UB6A 3MBZA 5F69A 3CPTA 4UA9A 2JHEA 3CJMA 5KMWA 4I39A 4OOMA 3AGFA 1MWTA 3UB7A 2R78A 3PBTA 1STZA 4Q8IA 2WGWA 3IXHA 5FATA 3DTEA 4S2IA 1IKGA 2OOLA 2PU4A 3ZFZA 4R3BA 1S4RA 3MSHA 2V1BA 4OVDA 1H0MA 3OPLA 1W5DA 3CITA 3LUQA 4KENB 5HW3A 4LCMA 4CLCE 4UHUA 3S7QA 3Q7VA 3E4PA 5KZHA 5EVIA 2OLUA 2HJ9C 2HGVA 3PHYA 5A93A 1SHVA 2BLSA 2P9VA 1I2SA 1MWSA 1LT0A 2D01A 1RGZA 3B33A 1PRQA 1ZTUA 5E2HA 1Q2QA 3GMWA 4KQQA 3U4LP 1PWCA 3PTEA 2HDSA 2XQZA 3UE1A 4F3LB 3RTYA 2X71A 3T1QB 3QP4A 4XT2A 5HWWA 4LV3A 1HD8A 1KE0A 2PAVP 5FAQA 4R38A 3HJKA 3MZFA 4U3TA 3R7WB 2ZM0A 2EX8A 2JN7A 3DTKA 4KZAA 5E43A 3IH9A 1NXYA 4BBUA 4S2LA 3A3IA 1OJ5A 3IT9A 2Y2MA 2VJWA 4PM6A 3PBSA 2LB9A 3VP4A 4JGRA 3S7OA 2PD7A 3WWXA 3QP1A 5EM0A 3UDXA 4Y0UA 4QPRA 2Y2JA 1TS7A 4RX3A 1NRJA 1XGIA 3FC7A 2Y2IA 2L4RA 3FPWA 4RQ9A 2E8IA 2JCHA 4E3NA 1K57A 4OLGA 4B4XA 4R4RA 3TG9A 4CPKA 3A3JA 1VHMA 2O9AA 4BD1A 3HUNA 3KYQA 4MN7A 1YPRA 4R4SA 3IS2B 4LGWA 2XA7S 1FSYA 2OAP1 3KYEA 1LL5A 3BFFA 1DP6A 3JPUA 1EWZA 4K08A 5GLDA 5KIZA 3ZVTA 4EQ1A 2HP6A 2XLNA 2FFYA 2WKHA 2V1AA 5GHXA 5FQKA 4Y5FA 2Y2HA 3T1RA 3LIFA 3C7VA 1TD5A 4ZTKA 4MBKA 4L0LA 1J9MA 4WM9A 3NJAA 1PZPA 1PYYA 4JXSA 4RVAA 3BLSA 3IF6B 3LR4A 3BQ8A 1XPBA 5DJUA 4JXGA 4QJGA 1H3QA 1FR1A 2G2WA 5GLCA 1D06A 2MJ6A 2XDMA 1G6AA 1H8ZA 1ESIA 3P01A 1KDSA 4GOGA 2B5RA 4HH3A 1S1ZA 2ZC6B 4QD4A 2IWDA 2ZOIA 5BOHA 1RGYA 3M2KA 3VOLA 3SH8A 3LO7A 2EA9A 1MZUA 5EVID 2JC7A 3SH7A 1N9BA 4EBLA 5FEFA 3SS4A 5LBRA 3O88A 1XA7A 4HP9A 1NYYA 4KG6A 4GZBA 4YWZA 3BLMA 1PI5A 2Z6CA 3S7PA 1OJGA 2QHKA 3MJQA 1KVLA 4GS9B 3NI9A 3LIBA 4I38A 1YSQA 5EOOA 1ES2A 2K2NA 3FKVA 2IA2A 5FQMA 1SZVA 1YLTA 5GLAA 2RL3A 5AQAA 4YOFA 4R70A 4A5RA 1G6OA 4JPMA 5HL6A 3Q07A 4U0XA 2O9BA 3MR0A 5CGWA 3LI8A 5DFXA 3VOZA 1JWPA 1L0DA 5AVFA 3H7WB 4PM9A 1ERMA 1BTLA 1XFQA 5CXWA 3IS2A 1XXMA 4ARZA 2BG1A 2NUPC 2M7UA 4E6WA 4Q0HA 2ZQ8A 2K7SA 4D60A 1KDWA 3E4OA 4EBNA 1YLYA 2WAFA 4RX2A 4EQIA 2W1TA 2ZC5B 2A2LA 2EFUA 1L0GA 3VP3A 1PFLA 4NXFA 2IWBA 1IFQA 1NZOA 2CC1A 3SOIA 2V1ZA 3G4PA 3UE3A 3CUEC 2EXAA 3CZDA 4P6ZS 1DP9A 4LRXC 3CWFA 5J7EA 3PBQA 2Z2MB 3F1NB 3OZHA 2QWSA 3PAEA 3GV9A 2ZQ9A 4LV1A 4Y17A 5HAIA 4HNBA 1P9WA 4K0WA 1GSVA 4QWOA 3BYDA 2Y4AA 4Y13A 5EVLA 5E2GA 1TS6A 4DDYA 3BW6A 2Y2QA 5FDHA 1H5XA 3IX8A 3D9YA 2J9OA 2V8CA 3NIAA 5GHZA 3UB8A 4Y0TA 2P04A 3DAVA 4BL2A 3D3OA 2M1CA 3H82A 5G18A 2JKRM 3UE6A 2OWJA 5A90A 4M4XA 1FCNA 4PAUA 3AGDA 1A0KA 4ME4A 5CHUA 2BASA 2P08A 1GA0A 1UWPX 3BFDA 2PU2A 4PM7A 2G2UA 4D2OA 5TFQA 4KUKA 4KG2A 4I3JA 3VV4A 3N8SA 3BFGA 2EXBA 1N9OA 2HF6A 2H10A 1LI9A 1VEUA 4GJ4A 4ETXA 1W79A 5FQ9A 3HLFA 3Q7ZA 1VEUB 5L09A 3BY9A 3RH8B 4E04A 3K3DA 2QYBA 3TW8A 2GDNA 1TS0A 1LL9A 5U47A 1FCOA 4WEJA 5FEGA
chains in the Genus database with same CATH topology
2R78A 3PBTA 1STZA 3EGDC 4HIAA 4XT2B 4NKPA 4P6ZM 3TE8A 5L8MA 3LYXA 3PYPA 2OOLA 2JKTM 1N9LA 2FH5A 1S4RA 4HQAA 2V1BA 3CLOA 1T1AA 4WN5A 1V9YA 2XRNA 2GX5A 3CITA 3C38A 3LUQA 4LRZE 3C2WA 4CLCE 3T4SA 3S7QA 4DMZA 3E4PA 3E4QA 4I3IA 2HJ9C 5IU1A 2HGVA 3KX0X 4WEKA 3H9WA 3PHYA 3JVVA 2B02A 2W3DA 1T18A 1XJ6A 2J80A 5F6AA 4NXEA 1LT0A 2D01A 3F1NA 3B33A 4B93A 1ZTUA 3G6OA 4EEUA 2OAQ1 1ZHHB 2PDRA 3MQOA 3D72A 1OTDA 4G3VA 4WL9A 3MFXA 4F3LB 3CI6A 3RTYA 3SW1A 2EWVA 4EERA 4MN5A 2K31A 4XT2A 5HWWA 3EQVA 4KQOA 4R38A 5TJJA 3HJKA 4O8GA 4CQHA 3R7WB 3PBOA 2JN7A 2PT7A 1F98A 1T1BA 4Q0IA 4LRYC 3MQQA 1YSPA 3EWKA 4H6JB 5TBMB 3GECA 1S67L 1UGUA 3KSHA 4BBUA 3PBNA 2W1TB 2YKFA 1OJ5A 1ODVA 5G4ZA 3C8CA 2PR6A 2VJWA 3PBSA 2LB9A 5KSHA 4JGRA 3S7OA 3ZYTA 1OTAA 2W27A 3V67A 1DRMA 3S7NA 2PD7A 5HPIA 5MC7A 1YAXA 5A8BA 3KSGA 1GSWA 1MC0A 4QPRA 4DN0A 3NOPC 3R4KA 3KSIA 3T4QA 1WA9A 1OPXA 4HJ4A 1TS7A 3GDIA 1NRJA 2L1MA 1H8MA 5J4EA 2YKHA 3LIEA 3FC7A 2O0YA 2WKQA 2L4RA 2H28A 3OBFA 3T4TA 3FPWA 4RQ9A 4L9GA 2G7UA 4NEED 2GNXA 4BBVA 1VHMA 2O9AA 1S66L 4MCWA 3NOUC 4CLCC 3F1PB 3KYQA 4MN7A 2W3HA 3LR5A 3LICA 4HH2A 4UQIM 2VLGA 4O01A 4IJGA 2O99A 2VX8A 1LSWA 3IS2B 3UMDA 2XA7S 2P7JA 5HD5A 2JKTI 2OAP1 4LLOB 3UB9A 3VE4A 4ZRRA 2PHYA 4Q0JA 3IBJA 3KSFA 3TRCA 1OTBA 4JGQA 4R3AA 3KO6A 1DP6A 3FPVA 5HZHA 1XJ2A 4K08A 5KIZA 3ULFA 4EQ1A 1NLZA 3VE3A 1W63M 2ZMFA 2O9CA 4EEPA 4HJ3A 2J3WA 3CAXA 3EQUA 2V1AA 4G3KA 2GJ3A 3P7NA 2W3GA 4Y2FA 4JGOA 4Y5FA 3LIAA 3HJIA 3LFVA 3TJZC 5G4YA 4BMWA 3LIFA 3OCNA 1TD5A 2KOIA 3PR6A 5AJGA 3K3CA 5HD3A 1D7EA 2QJ5A 4GLQA 4L0LA 4BJPA 1P0ZA 4HP4A 3NJAA 2V0UA 4PKYG 3B47A 3LR4A 3BQ8A 3FG8A 3JVUA 3F1PA 2PYRA 5DJUA 2ZOHA 4UQIS 2WKRA 5HPFA 1X0OA 2XA7M 3UMEA 1OT9A 4KUOA 5EFWA 1H3QA 1D06A 2MJ6A 3R7WA 5AVEA 3W2ZA 4WF0A 4UEYA 5DKKA 1F5MA 2VV6A 3P01A 1XJ3A 4HH3A 1S1ZA 4H6JA 3ICYA 1BYWA 2ZOIA 1OTEA 5IT5A 2KDKA 4WELA 2W3EA 3VOLA 1XJ4A 2EA9A 1MZUA 5I5LA 4FOFA 1EW0A 2PD8A 1TS8A 3OC2A 1NWZA 2VV8A 3K2NA 4MDZA 4HJ6A 1DP8A 5LBRA 2VKSA 4HP9A 1T1CA 2DMWA 2W0NA 4MMNA 1S4SA 4YWZA 2W1RA 2KX6A 2Z6CA 1Y28A 4WUJA 4CLCD 5TBMA 3S7PA 1OJGA 2QHKA 4EESA 3MQ0A 1LSXA 4OOLA 4NXBA 3MXQA 3MJQA 3T50A 3LIDA 4EU0A 4GS9B 2M7VA 4I3AA 4O0PA 3LIBA 1P97A 4I38A 1YSQA 5DFYA 2HV1A 2GZAA 4CLCA 3ZQ5A 3EOIA 2Y79A 1LSVA 2K2NA 3LI9A 4CLCB 2VA0A 3CUEA 3BY8A 2B18A 3KYZA 2IA2A 5HWVA 3EGXC 2LB5A 4HOIA 5FL3A 1KOUA 1LL8A 5F5YA 2W3FA 4YOFA 2INWA 4R70A 2VV7A 1JNUA 2HJEA 1G6OA 5J3WA 4BBTA 3A0SA 1G28A 5HL6A 4ETZA 2O9BA 3MR0A 5CX7A 3H82B 4IUHA 3LI8A 5DFXA 1XFNA 2KLIA 5AVFA 5K5BA 2PYPA 4PKYA 2D02A 4KQDA 3U2AA 2XROA 3H7WB 3B42A 1TF1A 1XFQA 2ZBBA 3IS2A 4BWIA 4ARZA 5F68A 3O5YA 4WLAA 3RFBA 3EEAA 2NUPC 3T4OA 2QJ7A 2M7UA 4Q0HA 5IS1A 2FZ0A 2K7SA 4MN6A 3T4LA 3HCYA 3E4OA 3C30A 2QKPA 3LR3A 2EWWA 1OTIA 2W1TA 4IHQA 4II7A 4GHIA 2A2LA 2J3TC 4NXFA 4F3LA 4YNRA 4L9FA 3NOTC 1IFQA 4HHDA 5DJTA 2XSSA 3MMHA 4G3WA 3F1OA 4GW9A 3UE3A 3CUEC 2CMNA 4DJ3A 3BWLA 3A0RA 2Y8HA 2VEAA 3A0VA 4P6ZS 3T4JA 1DP9A 4LRXC 3CWFA 5J7EA 3PBQA 4IUKA 4LPZA 1F9IA 5DKLA 2A24B 1NLYA 1S1YA 3F1NB 2QWSA 1V9ZA 3E98A 1UWNX 4HNBA 2J3TD 1W63Q 1P9WA 5HDCA 5C5KA 4NXGA 1VB6A 1GSVA 4L9EA 3H7WA 1T19A 2VGLM 4Z1WA 4EXOA 1TS6A 4ARZB 3BW6A 1OT6A 1MKMA 3PBRA 3LR0A 3OCLA 1P9RA 3OLOA 3E0YA 4HI4A 3UB8A 2P04A 3PXPA 2JKRI 4JGPA 3EEHA 5HWTA 3D3OA 2I9VA 2M1CA 4GCZA 4GHIB 5HDDA 2V0WA 3H82A 2JKRM 3UE6A 4EW7A 5HDSA 2OWJA 4M4XA 2PR5A 5DF9A 2L0WA 4PAUA 4Y3IA 4ME4A 3F1OB 2OWHA 2BASA 2P08A 1UWPX 4GS9A 3T4KA 3MF0A 3IBRA 1YKDA 4HY8A 4KUKA 2NUTC 2Z6DA 4I3JA 3BJNA 4I5SA 3VV4A 4EUVA 3NHQA 2VZWA 4PHTA 1N9OA 2HF6A 4FSFA 4GJ4A 4ETXA 3DBAA 1N9NA 4B9OA 2A24A 3UB6A 5F69A 2WKPA 3BQAA 2JHEA 3BY9A 1GSXA 3RH8B 4E04A 2V9AA 3K3DA 2QYBA 5HSQA 4I39A 4OOMA 2ZMVA 3TW8A 3OOVA 1TS0A 1IOUA 4R6LA 4WEJA 4DJ2A 2VGLS 4AFIA 3UB7A 4EETB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSW A;  5DKK A;  4GHI A;  2VV6 A;  1XJ3 A;  3NOP C;  4NXF A;  4F3L A;  1WA9 A;  1S1Z A;  2R78 A;  4HH3 A;  1TS7 A;  3GDI A;  4H6J A;  4HJ4 A;  3ICY A;  3NOT C;  2L1M A;  4HHD A;  1BYW A;  4HIA A;  2ZOI A;  4L9F A;  4XT2 B;  1OTE A;  2YKH A;  3LIE A;  5DJT A;  2KDK A;  5J4E A;  3FC7 A;  2WKQ A;  3VOL A;  2L4R A;  3F1O A;  3LYX A;  2H28 A;  3PYP A;  4GW9 A;  2OOL A;  1XJ4 A;  4RQ9 A;  2CMN A;  1MZU A;  1N9L A;  2EA9 A;  4DJ3 A;  3BWL A;  5I5L A;  1EW0 A;  3A0R A;  4L9G A;  1S4R A;  2VEA A;  3A0V A;  4HQA A;  4BBV A;  2PD8 A;  1DP9 A;  1TS8 A;  2V1B A;  1T1A A;  3CLO A;  3CWF A;  4LRX C;  5J7E A;  1S66 L;  4LPZ A;  3NOU C;  1F9I A;  4WN5 A;  2A24 B;  1NWZ A;  3F1P B;  2VV8 A;  5DKL A;  3UMD A;  1S1Y A;  3F1N B;  1V9Y A;  2QWS A;  3LIC A;  3LUQ A;  4HH2 A;  4LRZ E;  3C2W A;  1V9Z A;  4HJ6 A;  1DP8 A;  1UWN X;  2VLG A;  4HP9 A;  1T1C A;  4HNB A;  2W0N A;  4YWZ A;  1S4S A;  3E4P A;  5HDC A;  2KX6 A;  1LSW A;  3IS2 B;  1VB6 A;  1GSV A;  1Y28 A;  2Z6C A;  4NXG A;  2P7J A;  4L9E A;  5HD5 A;  4WUJ A;  3E4Q A;  4I3I A;  4LLO B;  3UB9 A;  5IU1 A;  3VE4 A;  2PHY A;  5TBM A;  3KX0 X;  1OJG A;  2QHK A;  4EES A;  1LSX A;  3H7W A;  3H9W A;  3PHY A;  4NXB A;  1T19 A;  2B02 A;  1OTB A;  4JGQ A;  3MXQ A;  4R3A A;  1T18 A;  3MJQ A;  3T50 A;  1DP6 A;  1XJ6 A;  5HZH A;  3LID A;  1XJ2 A;  2J80 A;  4EXO A;  1TS6 A;  4K08 A;  5KIZ A;  5F6A A;  4GS9 B;  1OT6 A;  3ULF A;  4NXE A;  4I3A A;  1LT0 A;  2D01 A;  3F1N A;  3LIB A;  3B33 A;  4EQ1 A;  1P97 A;  4I38 A;  3G6O A;  4E04 A;  4EEU A;  2HV1 A;  2PDR A;  3VE3 A;  3OLO A;  3ZQ5 A;  3MQO A;  4HI4 A;  3UB8 A;  3D72 A;  1LSV A;  1OTD A;  3LI9 A;  4WL9 A;  3MFX A;  4HJ3 A;  4EEP A;  4JGP A;  3BY8 A;  3CAX A;  3EEH A;  3SW1 A;  5HWV A;  4F3L B;  5HWT A;  2I9V A;  2M1C A;  2V1A A;  4GCZ A;  4HOI A;  4GHI B;  2GJ3 A;  3RTY A;  1KOU A;  5IS1 A;  3P7N A;  1LL8 A;  5HDD A;  2V0W A;  3H82 A;  5F5Y A;  4JGO A;  3UE6 A;  4EW7 A;  5HDS A;  2INW A;  2OWJ A;  3HJI A;  3LIA A;  4MN5 A;  2VV7 A;  4R70 A;  4M4X A;  1JNU A;  2PR5 A;  4XT2 A;  4EER A;  5J3W A;  5HWW A;  2L0W A;  4BBT A;  3A0S A;  1G28 A;  5G4Y A;  3F1O B;  2OWH A;  3MR0 A;  3H82 B;  3LIF A;  2BAS A;  4R38 A;  1UWP X;  4GS9 A;  3LI8 A;  3HJK A;  1XFN A;  3K3C A;  5HD3 A;  3IBR A;  4HY8 A;  1D7E A;  2QJ5 A;  2JN7 A;  1F98 A;  4KUK A;  1P0Z A;  5AVF A;  1T1B A;  2PYP A;  2D02 A;  4PKY A;  2Z6D A;  4KQD A;  4HP4 A;  4I3J A;  3NJA A;  2V0U A;  4I5S A;  3H7W B;  4LRY C;  3MQQ A;  3NHQ A;  3EWK A;  4H6J B;  5TBM B;  3GEC A;  1N9O A;  1S67 L;  4PKY G;  1UGU A;  1XFQ A;  4BBU A;  1N9N A;  2ZBB A;  3FG8 A;  3IS2 A;  4B9O A;  2A24 A;  3F1P A;  2PYR A;  5DJU A;  2YKF A;  3UB6 A;  1OJ5 A;  2WKP A;  5F69 A;  2ZOH A;  5F68 A;  1ODV A;  4WLA A;  3C8C A;  5G4Z A;  2JHE A;  2PR6 A;  1GSX A;  3BY9 A;  2WKR A;  3RH8 B;  2QJ7 A;  1X0O A;  2V9A A;  3K3D A;  3UME A;  1OT9 A;  4KUO A;  2K7S A;  4JGR A;  4I39 A;  4MN6 A;  5EFW A;  5HSQ A;  1OTA A;  2W27 A;  1TS0 A;  3E4O A;  4R6L A;  1DRM A;  2QKP A;  1D06 A;  2PD7 A;  5AVE A;  4DJ2 A;  5A8B A;  4WF0 A;  1OTI A;  3UB7 A;  4EET B; 
#chains in the Genus database with same CATH topology
 1J3W A;  4JF5 A;  1WYC A;  1M6K A;  1BLC A;  4HIA A;  5L8M A;  2V8F A;  3AGE A;  4OH0 A;  3IWQ A;  3LYX A;  2JKG A;  3PYP A;  4Z9Q A;  2OSU A;  2JKT M;  1TEM A;  2FH5 A;  4X69 A;  4HQA A;  4NET A;  5JYO A;  2XR0 A;  2VGK A;  2WZX A;  5M18 A;  3NEC A;  2PBD P;  3C4O A;  1V9Y A;  4DXC A;  1CJF A;  3C38 A;  4LRZ E;  3BEC A;  3V3R A;  5JYP A;  1AWI A;  4GD8 A;  3T4S A;  5CED A;  1TVF A;  4DMZ A;  4Y7P A;  4GDN A;  4I3I A;  4R0Q A;  4EBP A;  4WEK A;  4LEN A;  5CEC A;  1XGJ A;  5EVI C;  1XJ6 A;  3UPP A;  5AQ7 A;  5F6A A;  4NXE A;  1JWZ A;  3G6O A;  1ZHH B;  2Q0O A;  3MXR A;  4PM8 A;  5IHV A;  1GHM A;  4G3V A;  3MFX A;  3N8R A;  3ITA A;  5J8X A;  3CI6 A;  1ZKJ A;  3SW1 A;  4QU3 A;  4EER A;  4MN5 A;  2K31 A;  2HDQ A;  4OLD A;  5I94 A;  3EQV A;  3QP2 A;  4X1L A;  1FQG A;  3PBO A;  3GR2 A;  4KZ9 A;  4KZ4 A;  1F98 A;  1YSP A;  2VK3 A;  4H6J B;  1MWU A;  3ZHH A;  3GRJ A;  1UGU A;  3SZT A;  3PBN A;  1CEF A;  5GL9 A;  3C8C A;  3IX3 A;  3ZYT A;  3DWK A;  1DRM A;  4DDS A;  5HPI A;  1W8Y A;  5A8B A;  2XD5 A;  4JLF A;  1PW8 A;  4PMA A;  5DTS A;  1MC0 A;  3NOP C;  3R4K A;  3WS4 A;  1WA9 A;  1NRF A;  2L1M A;  2YKH A;  3LIE A;  3VSL A;  1BSG A;  1JTG A;  3T1S A;  2WYX A;  5DF8 A;  3OBF A;  2UV0 E;  2Y91 A;  4ZDX A;  4IED A;  3W4O A;  2XD1 A;  2G7U A;  1S66 L;  4PM5 A;  3UDI A;  3ZG9 B;  4EUZ A;  4UQI M;  3VP0 A;  2AVX A;  1LSW A;  1FOF A;  2JKT I;  4LLO B;  3UB9 A;  3N6I A;  2WKE A;  3TRC A;  1CF0 A;  3FPV A;  3G2Z A;  3IHA A;  4JKT A;  4FD8 A;  1YMS A;  1VQQ A;  2EFX A;  2BTF P;  4WZ5 C;  2ZMF A;  3G30 A;  3EQU A;  3P7N A;  4Y2F A;  4HBU A;  4S2N A;  4WZ4 A;  4B88 A;  3LCE A;  3NBL A;  1CK3 A;  1O07 A;  5AJG A;  3K3C A;  1QME A;  1D7E A;  1P0Z A;  2V0U A;  5HAP A;  1DJB A;  3B47 A;  3FG8 A;  1YLW A;  3IXG A;  1W7F A;  2C5W B;  4QHC A;  4UQI S;  5HPF A;  4Y15 A;  1PNE A;  3UME A;  4WYY A;  3RXX A;  4ID4 A;  4O7D A;  3R7W A;  4OPZ A;  1IKI A;  4UEY A;  1F5M A;  4FTX A;  1KE4 A;  3ICY A;  4UA7 A;  1BYW A;  5FQQ A;  5IT5 A;  1XJ4 A;  1EW0 A;  1TDL A;  3WS1 A;  4IBR A;  3VP1 A;  3K2N A;  3IHB A;  3HLC A;  3C5A A;  4LV0 A;  4HJ6 A;  1VET A;  2VKS A;  2FFF B;  1S4S A;  4XUX A;  2W1R A;  2KX6 A;  4OKP A;  4Y0O A;  1Y28 A;  4WUJ A;  5EOE A;  4CLC D;  1EI5 A;  2XFS A;  3HUO A;  4EES A;  1LSX A;  4NXB A;  3W8K A;  3HRE A;  4P85 A;  3T50 A;  3LID A;  4JXW A;  4I3A A;  4O0P A;  2Y2K A;  5DFY A;  5F83 A;  3ZQ5 A;  3EOI A;  2Y79 A;  1LSV A;  4OPY A;  3BY8 A;  3KYZ A;  3FZC A;  4E3M A;  1ALQ A;  1C3B A;  4BBT A;  3BFE A;  3H82 B;  1XFN A;  5AQ9 A;  4E3J A;  1K38 A;  3O87 A;  1WYB A;  3ZVW A;  2D02 A;  4KQD A;  4B4Z A;  3O86 A;  1S6R A;  1IYS A;  4WLA A;  3BFC A;  3EEA A;  3T4O A;  5IS1 A;  4MN6 A;  3T4L A;  2P74 A;  3C30 A;  4II7 A;  2J3T C;  5CEB A;  3NOT C;  5CGX A;  3OPR A;  5DJT A;  2XSS A;  3WRZ A;  3CHW P;  2CMN A;  3BWL A;  2ZM2 A;  2WAD A;  3A0V A;  1JVJ A;  1Q2P A;  3T4J A;  2VGJ A;  1NLY A;  2H5S A;  1V9Z A;  3E98 A;  3ZG8 B;  1UWN X;  3V50 A;  5C5K A;  1VB6 A;  3UDF A;  3ZDJ A;  3QNB A;  2R9X A;  3H7W A;  3HLD A;  1HVB A;  3VFF A;  1MKI A;  3RJU A;  2VGL M;  5E2E A;  4Z1W A;  4EXO A;  1I2W A;  4JF6 A;  4ARZ B;  1MKM A;  2XEP A;  3OLO A;  4HI4 A;  5CRF A;  3S1Y A;  4JGP A;  3EEH A;  4GCZ A;  3GQZ A;  5HDS A;  5L2F A;  4KZ3 A;  5DF9 A;  2QZ6 A;  4Y3I A;  2OWH A;  2HZ5 A;  3T4K A;  2J7V A;  3RXW A;  4OQ0 A;  1YKD A;  1NZU A;  2Y2L A;  2NUT C;  4I5S A;  4EUV A;  3NHQ A;  1VET B;  4P6B A;  3ZG0 A;  3QP5 A;  1N9N A;  2JKF A;  3ZNT A;  3BQA A;  4JBF A;  3B3X A;  2V9A A;  5HSQ A;  3OOV A;  1IOU A;  1VM1 A;  4GDB A;  4DJ2 A;  5HAQ A;  4X1M A;  5FI6 A;  3VMA A;  2ZL1 B;  4FCF A;  1G68 A;  4S2P A;  1KE3 A;  4NKP A;  1HTZ A;  5D3O A;  1N9L A;  1XP4 A;  1KGG A;  2A3U A;  3Q81 A;  1CEG A;  2X01 A;  1DJC A;  1E3U D;  5FAP A;  2HDR A;  3VSK A;  3C2W A;  4S2N C;  4X55 A;  5FI7 A;  2XGN A;  4ESP A;  4OON A;  4KZ5 A;  4HES A;  3E4Q A;  3JYI A;  5IU1 A;  3GVB A;  3NC8 A;  3H9W A;  4OPQ A;  3JVV A;  3G35 A;  2B02 A;  1MBL A;  2J80 A;  1ZC2 A;  3C7U A;  3F1N A;  4XUZ A;  4B93 A;  4N1X A;  4EEU A;  2PDR A;  1BZA A;  1K4F A;  2ZC7 A;  1SCW A;  4GKU A;  3MQO A;  3D72 A;  4PPR A;  1OTD A;  4WL9 A;  2ZQ7 A;  3IF6 A;  3HLW A;  5A91 A;  2RCX A;  2A49 A;  1MY8 A;  4C75 A;  1CQA A;  4OQH A;  5EV0 A;  3IQA A;  4BQM A;  2PT7 A;  5GLB A;  1YM1 A;  5HX9 A;  3D4F A;  4Q0I A;  4LRY C;  3MQQ A;  3NDE A;  3IWO A;  3EWK A;  3MS6 A;  5TBM B;  3GEC A;  1S67 L;  3KSH A;  3FKW A;  2YKF A;  3LEZ A;  3V67 A;  2H0T A;  5CTN A;  1K56 A;  4ZBE A;  3E2L A;  3KSI A;  1SKO B;  2E8J A;  3BM6 A;  5J4E A;  3L7H A;  4DE0 A;  3MKF A;  3T4T A;  1ZG6 A;  3BEB A;  3UNW A;  4NEE D;  4BBV A;  3G2Y A;  4MCW A;  3NUL A;  4CLC C;  1PIO A;  3F1P B;  3LY3 A;  2I72 A;  4IVI A;  3LIC A;  4HH2 A;  4DF6 A;  4C3Q A;  2VLG A;  3LGO A;  4FH2 A;  4IJG A;  4O01 A;  2O99 A;  1IYP A;  3UMD A;  1L2S A;  2P7J A;  5HD5 A;  1FSW A;  3VE4 A;  2WGW B;  4ZRR A;  4Q0J A;  1YQS A;  3G32 A;  3IBJ A;  1OTB A;  2DRW A;  2X02 A;  1L0F A;  3NY4 A;  1IEM A;  3DTI A;  4R3J A;  3IXB A;  1PWD A;  4CJN A;  3VE3 A;  4BLM A;  4FUW A;  1GA9 A;  4EEP A;  2J3W A;  2ZL1 A;  4IVK A;  4KQR A;  1KVM A;  2GJ3 A;  5CGS A;  4JGO A;  3W4Q A;  1KGF A;  4DE2 A;  3LFV A;  3VOY A;  1IEL A;  3OCN A;  2KOI A;  4E3O A;  4R23 A;  5HD3 A;  4WBG A;  2QJ5 A;  4GLQ A;  2HDU A;  4BJP A;  3M2J A;  4YFM A;  5CER A;  3UE0 A;  4ZJ3 A;  3S4X A;  3WS0 A;  3JVU A;  2HP9 A;  4GN2 A;  2ZC3 B;  1D1J A;  4HBT A;  1X0O A;  5FAO A;  5DF7 A;  4N1H A;  5AQB A;  1YMX A;  3FV7 A;  1MPL A;  1HLU P;  3GTC A;  5DKK A;  2VV6 A;  1XJ3 A;  3FWL A;  1E3U A;  4H6J A;  4XXR A;  2KDK A;  4WEL A;  5FQI A;  2W3E A;  4UAA A;  5HAR A;  2V2F F;  4EWF A;  4FOF A;  3I7J A;  2PD8 A;  3M6B A;  1NWZ A;  4MDZ A;  4WMC A;  2W0N A;  4MMN A;  3A3D A;  3W4P A;  5TBM A;  5FDS A;  4KZ8 A;  5E2F A;  4E6X A;  2Y2O A;  4OQG A;  1ESU A;  4ZJ1 A;  4EU0 A;  1AXB A;  4HEF A;  2HP5 A;  1P97 A;  1K6R A;  1L0E A;  3ZCZ A;  4OOY A;  2JE5 A;  4CLC A;  1O7E A;  3LI9 A;  4CLC B;  2V20 A;  2B18 A;  3DTM A;  2IWC A;  2OV5 A;  2LB5 A;  4HOI A;  3CMZ A;  1KOU A;  4KG5 A;  1LL8 A;  5EVE A;  4E3K A;  2INW A;  1ZG4 A;  1FR6 A;  1NJ4 A;  1G28 A;  2PBY A;  3QP8 A;  1G5U A;  2KLI A;  2ZM8 A;  1ES5 A;  2WAE A;  5K5B A;  2PYP A;  2DNS A;  2UWX A;  5CTM A;  2WZZ A;  2XRO A;  1NY0 A;  2ZBB A;  3WRT A;  1FIL A;  5F68 A;  3RFB A;  3O5Y A;  2QMI A;  5F1G A;  2QJ7 A;  3FYZ A;  2FZ0 A;  1W8Q A;  3V39 A;  1BLP A;  1BUE A;  2Z2L B;  3UO9 A;  1GCE A;  1YT4 A;  2DCF A;  4N9L A;  4QY6 A;  2QPN A;  4IHQ A;  4GHI A;  1L3L A;  4BL3 A;  4YNR A;  3L9K A;  4L9F A;  1DY6 A;  1K4E A;  3F1O A;  1E4D A;  4DJ3 A;  2Y8H A;  2VEA A;  3IX4 A;  2P9V B;  3IF5 A;  4IUK A;  5DKL A;  2A24 B;  4ZAM A;  5DTT A;  1S1Y A;  3MKE A;  2ZQC A;  3ISG A;  5HDC A;  1FCM A;  5L07 A;  4L9E A;  4X68 A;  4UA6 A;  2EX2 A;  4MEZ A;  5FA7 A;  2HPB A;  5L10 A;  1K25 A;  4OPR A;  1OT6 A;  2C6W B;  3PBR A;  3LR0 A;  3Q1F A;  1ES4 A;  1SKF A;  1K55 A;  1PWG A;  2XK1 A;  3G34 A;  5HWT A;  4E3I A;  1SDE A;  3N4I A;  4MBF A;  5HDD A;  2V0W A;  4EW7 A;  2J8Y A;  3HL9 A;  4N9K A;  2WUQ A;  4FH4 A;  3P09 A;  3NCK A;  4GS9 A;  3MF0 A;  3IBR A;  2ZLY A;  4HY8 A;  5EVI B;  5GHY A;  3V3S A;  4KZ6 A;  2EX6 A;  5FSR A;  3VFH A;  2Z6D A;  3Q82 A;  2VZW A;  4PHT A;  4FSF A;  3DBA A;  4B9O A;  3HLG A;  3ITB A;  4MBH A;  2WKP A;  4DE1 A;  1GSX A;  2Y55 A;  3SH9 A;  2ZMV A;  4R6L A;  5TR7 A;  1K55 C;  2ZQD A;  2VGL S;  1BUL A;  4AFI A;  4EET B;  3TOI A;  2ZD8 A;  3PAG A;  3EGD C;  3UN7 A;  4XT2 B;  3TE8 A;  4P6Z M;  4X53 A;  3SS3 A;  3CG5 A;  4GD6 A;  1M40 A;  1FIK A;  5FQJ A;  5EPH A;  3CLO A;  1T1A A;  4WN5 A;  4S2K A;  3ZGA B;  2XRN A;  2GX5 A;  1CI8 A;  1RCJ A;  4GNU A;  4NG2 A;  1PI4 A;  1ES3 A;  2ACG A;  3KX0 X;  3LY4 A;  5M19 A;  1K54 C;  1Z09 A;  2W3D A;  1ACF A;  1T18 A;  4X25 A;  1XX2 A;  3E2K A;  3ZNY A;  4DE3 A;  2OAQ 1;  1IYO A;  3HUM A;  4K0X A;  1K57 C;  4DRT A;  2ZJ9 A;  1GHP A;  1JWV A;  3A3F A;  1YLJ A;  2EWV A;  4E3L A;  3NDG A;  4DKI A;  1SDN A;  1Y54 A;  4KQO A;  4M3K A;  5TJJ A;  4O8G A;  3S22 A;  4CQH A;  2Q9N A;  4BD0 A;  1T1B A;  5F1F A;  2Y2G A;  1TDG A;  4N92 A;  1LHY A;  3CPT B;  3UY6 A;  2W1T B;  1ODV A;  1YLZ A;  5G4Z A;  2PR6 A;  4MNR A;  5KSH A;  1OTA A;  2W27 A;  3S7N A;  5MC7 A;  1YAX A;  4QB8 A;  2XH9 A;  3KSG A;  1GSW A;  4DN0 A;  3T4Q A;  4EV4 A;  1OPX A;  4HJ4 A;  3GDI A;  5DVA A;  1H8M A;  1NYM A;  3QP6 A;  2O0Y A;  2WKQ A;  1ONG A;  2H28 A;  1HZO A;  3DW0 A;  4JXV A;  4L9G A;  4KZB A;  4YIN A;  2GNX A;  4BEN A;  4OQI A;  3NOU C;  1IYQ A;  4P0M A;  2W3H A;  3LR5 A;  5HFO A;  4RYE A;  2VX8 A;  2XF3 A;  4RA7 A;  1H8Y A;  5F82 A;  2PHY A;  4R1G A;  3IXD A;  3KSF A;  4JGQ A;  4R3A A;  3QNC A;  3KO6 A;  5HZH A;  1XJ2 A;  1U60 A;  1GHI A;  3ULF A;  1NLZ A;  2R9W A;  1W63 M;  5TGF A;  5EE8 A;  1LI0 A;  5CHJ A;  1K54 A;  4S2M A;  2O9C A;  3MZD A;  3HBR A;  4HJ3 A;  3CAX A;  1DJA A;  4G3K A;  2H0Y A;  2W3G A;  3LIA A;  3WS5 A;  3HJI A;  1JTD A;  3TJZ C;  5G4Y A;  4BMW A;  3PR6 A;  3O3V A;  2ZMA A;  1F2K A;  1BLS A;  4DXB A;  3C4P A;  3BRM A;  4HP4 A;  4X56 A;  5M1A A;  3IH8 A;  3HLE A;  4PKY G;  3SS5 A;  1YLP A;  3F1P A;  2PYR A;  1BLH A;  3HVF A;  2ZOH A;  3G31 A;  1ERQ A;  2WKR A;  4LV2 A;  2XA7 M;  3A3E A;  1OT9 A;  2J9P A;  4KUO A;  4QY5 A;  5EFW A;  4IBX A;  3M6H A;  5FAS A;  1BT5 A;  5AVE A;  3W2Z A;  4WF0 A;  3VP2 A;  1XKZ A;  1OTE A;  1PZO A;  5I5L A;  3OPP A;  4KZ7 A;  1TS8 A;  3OC2 A;  3MXS A;  3OPH A;  2VV8 A;  2PRF A;  2ZC4 B;  1KGE A;  3LEQ A;  1QMF A;  1DP8 A;  3GSG A;  4ZJ2 A;  2EX9 A;  1T1C A;  1SKO A;  2DMW A;  5CHM A;  2WKI A;  3MQ0 A;  3DWZ A;  4OOL A;  3N8L A;  3MXQ A;  4K91 A;  1S0W A;  4MLL A;  2M7V A;  2Y2N A;  2Q9M A;  4GB7 A;  2HV1 A;  4OP5 A;  5DTK A;  2GZA A;  4P87 A;  3HLB A;  1I5Q A;  3TSG A;  2VA0 A;  4U0T A;  3CUE A;  2WK0 A;  5HWV A;  1ERO A;  3EGX C;  5FL3 A;  5F5Y A;  2W3F A;  1ONH A;  3UB5 P;  2VV7 A;  1JNU A;  2HJE A;  5J3W A;  1MWR A;  2JBF A;  3A0S A;  3P98 A;  4ETZ A;  2B95 A;  4NK3 A;  5CX7 A;  4IUH A;  3N7W A;  3Q7V B;  4PKY A;  4C6Y A;  2Y2P A;  1XA1 A;  3U2A A;  3B42 A;  1PW1 A;  1TF1 A;  4BWI A;  1CI9 A;  1LLB A;  5A92 A;  3IF6 C;  2ZQA A;  3HCY A;  2QKP A;  3LR3 A;  2EWW A;  3V5M A;  3UPO A;  2Y59 A;  4S2O A;  1OTI A;  2XFT A;  5EM1 A;  4F3L A;  3ZG7 B;  4HHD A;  3MMH A;  4G3W A;  4S2J A;  4GW9 A;  3MFD A;  3WS2 A;  3A0R A;  4WZ5 A;  1MXO A;  1E25 A;  4LPZ A;  1F9I A;  4X6T A;  3UPN A;  1Y4O A;  1N4O A;  1W63 Q;  2J3T D;  2WGI A;  4F94 A;  4NXG A;  4JF4 A;  4LCL A;  5HL1 A;  1RP5 A;  3IWI A;  1T19 A;  5EUA A;  1WE4 A;  4LFU A;  4OP8 A;  3OCL A;  1P9R A;  3E0Y A;  3T12 B;  3PXP A;  2JKR I;  5FI2 A;  2I9V A;  3ZG5 A;  4GHI B;  3MZE A;  1Z6F A;  3QHY A;  2WGV A;  5KSC A;  2PR5 A;  5EEC A;  2L0W A;  1OME A;  3F1O B;  2OLV A;  4WMC D;  1K56 D;  1K0K A;  3BJN A;  1K6S A;  4H8R A;  2A24 A;  3T1X A;  3UB6 A;  3MBZ A;  5F69 A;  3CPT A;  4UA9 A;  2JHE A;  3CJM A;  5KMW A;  4I39 A;  4OOM A;  3AGF A;  1MWT A;  3UB7 A;  2R78 A;  3PBT A;  1STZ A;  4Q8I A;  2WGW A;  3IXH A;  5FAT A;  3DTE A;  4S2I A;  1IKG A;  2OOL A;  2PU4 A;  3ZFZ A;  4R3B A;  1S4R A;  3MSH A;  2V1B A;  4OVD A;  1H0M A;  3OPL A;  1W5D A;  3CIT A;  3LUQ A;  4KEN B;  5HW3 A;  4LCM A;  4CLC E;  4UHU A;  3S7Q A;  3Q7V A;  3E4P A;  5KZH A;  5EVI A;  2OLU A;  2HJ9 C;  2HGV A;  3PHY A;  5A93 A;  1SHV A;  2BLS A;  2P9V A;  1I2S A;  1MWS A;  1LT0 A;  2D01 A;  1RGZ A;  3B33 A;  1PRQ A;  1ZTU A;  5E2H A;  1Q2Q A;  3GMW A;  4KQQ A;  3U4L P;  1PWC A;  3PTE A;  2HDS A;  2XQZ A;  3UE1 A;  4F3L B;  3RTY A;  2X71 A;  3T1Q B;  3QP4 A;  4XT2 A;  5HWW A;  4LV3 A;  1HD8 A;  1KE0 A;  2PAV P;  5FAQ A;  4R38 A;  3HJK A;  3MZF A;  4U3T A;  3R7W B;  2ZM0 A;  2EX8 A;  2JN7 A;  3DTK A;  4KZA A;  5E43 A;  3IH9 A;  1NXY A;  4BBU A;  4S2L A;  3A3I A;  1OJ5 A;  3IT9 A;  2Y2M A;  2VJW A;  4PM6 A;  3PBS A;  2LB9 A;  3VP4 A;  4JGR A;  3S7O A;  2PD7 A;  3WWX A;  3QP1 A;  5EM0 A;  3UDX A;  4Y0U A;  4QPR A;  2Y2J A;  1TS7 A;  4RX3 A;  1NRJ A;  1XGI A;  3FC7 A;  2Y2I A;  2L4R A;  3FPW A;  4RQ9 A;  2E8I A;  2JCH A;  4E3N A;  1K57 A;  4OLG A;  4B4X A;  4R4R A;  3TG9 A;  4CPK A;  3A3J A;  1VHM A;  2O9A A;  4BD1 A;  3HUN A;  3KYQ A;  4MN7 A;  1YPR A;  4R4S A;  3IS2 B;  4LGW A;  2XA7 S;  1FSY A;  2OAP 1;  3KYE A;  1LL5 A;  3BFF A;  1DP6 A;  3JPU A;  1EWZ A;  4K08 A;  5GLD A;  5KIZ A;  3ZVT A;  4EQ1 A;  2HP6 A;  2XLN A;  2FFY A;  2WKH A;  2V1A A;  5GHX A;  5FQK A;  4Y5F A;  2Y2H A;  3T1R A;  3LIF A;  3C7V A;  1TD5 A;  4ZTK A;  4MBK A;  4L0L A;  1J9M A;  4WM9 A;  3NJA A;  1PZP A;  1PYY A;  4JXS A;  4RVA A;  3BLS A;  3IF6 B;  3LR4 A;  3BQ8 A;  1XPB A;  5DJU A;  4JXG A;  4QJG A;  1H3Q A;  1FR1 A;  2G2W A;  5GLC A;  1D06 A;  2MJ6 A;  2XDM A;  1G6A A;  1H8Z A;  1ESI A;  3P01 A;  1KDS A;  4GOG A;  2B5R A;  4HH3 A;  1S1Z A;  2ZC6 B;  4QD4 A;  2IWD A;  2ZOI A;  5BOH A;  1RGY A;  3M2K A;  3VOL A;  3SH8 A;  3LO7 A;  2EA9 A;  1MZU A;  5EVI D;  2JC7 A;  3SH7 A;  1N9B A;  4EBL A;  5FEF A;  3SS4 A;  5LBR A;  3O88 A;  1XA7 A;  4HP9 A;  1NYY A;  4KG6 A;  4GZB A;  4YWZ A;  3BLM A;  1PI5 A;  2Z6C A;  3S7P A;  1OJG A;  2QHK A;  3MJQ A;  1KVL A;  4GS9 B;  3NI9 A;  3LIB A;  4I38 A;  1YSQ A;  5EOO A;  1ES2 A;  2K2N A;  3FKV A;  2IA2 A;  5FQM A;  1SZV A;  1YLT A;  5GLA A;  2RL3 A;  5AQA A;  4YOF A;  4R70 A;  4A5R A;  1G6O A;  4JPM A;  5HL6 A;  3Q07 A;  4U0X A;  2O9B A;  3MR0 A;  5CGW A;  3LI8 A;  5DFX A;  3VOZ A;  1JWP A;  1L0D A;  5AVF A;  3H7W B;  4PM9 A;  1ERM A;  1BTL A;  1XFQ A;  5CXW A;  3IS2 A;  1XXM A;  4ARZ A;  2BG1 A;  2NUP C;  2M7U A;  4E6W A;  4Q0H A;  2ZQ8 A;  2K7S A;  4D60 A;  1KDW A;  3E4O A;  4EBN A;  1YLY A;  2WAF A;  4RX2 A;  4EQI A;  2W1T A;  2ZC5 B;  2A2L A;  2EFU A;  1L0G A;  3VP3 A;  1PFL A;  4NXF A;  2IWB A;  1IFQ A;  1NZO A;  2CC1 A;  3SOI A;  2V1Z A;  3G4P A;  3UE3 A;  3CUE C;  2EXA A;  3CZD A;  4P6Z S;  1DP9 A;  4LRX C;  3CWF A;  5J7E A;  3PBQ A;  2Z2M B;  3F1N B;  3OZH A;  2QWS A;  3PAE A;  3GV9 A;  2ZQ9 A;  4LV1 A;  4Y17 A;  5HAI A;  4HNB A;  1P9W A;  4K0W A;  1GSV A;  4QWO A;  3BYD A;  2Y4A A;  4Y13 A;  5EVL A;  5E2G A;  1TS6 A;  4DDY A;  3BW6 A;  2Y2Q A;  5FDH A;  1H5X A;  3IX8 A;  3D9Y A;  2J9O A;  2V8C A;  3NIA A;  5GHZ A;  3UB8 A;  4Y0T A;  2P04 A;  3DAV A;  4BL2 A;  3D3O A;  2M1C A;  3H82 A;  5G18 A;  2JKR M;  3UE6 A;  2OWJ A;  5A90 A;  4M4X A;  1FCN A;  4PAU A;  3AGD A;  1A0K A;  4ME4 A;  5CHU A;  2BAS A;  2P08 A;  1GA0 A;  1UWP X;  3BFD A;  2PU2 A;  4PM7 A;  2G2U A;  4D2O A;  5TFQ A;  4KUK A;  4KG2 A;  4I3J A;  3VV4 A;  3N8S A;  3BFG A;  2EXB A;  1N9O A;  2HF6 A;  2H10 A;  1LI9 A;  1VEU A;  4GJ4 A;  4ETX A;  1W79 A;  5FQ9 A;  3HLF A;  3Q7Z A;  1VEU B;  5L09 A;  3BY9 A;  3RH8 B;  4E04 A;  3K3D A;  2QYB A;  3TW8 A;  2GDN A;  1TS0 A;  1LL9 A;  5U47 A;  1FCO A;  4WEJ A;  5FEG A; 
#chains in the Genus database with same CATH homology
 2R78 A;  3PBT A;  1STZ A;  3EGD C;  4HIA A;  4XT2 B;  4NKP A;  4P6Z M;  3TE8 A;  5L8M A;  3LYX A;  3PYP A;  2OOL A;  2JKT M;  1N9L A;  2FH5 A;  1S4R A;  4HQA A;  2V1B A;  3CLO A;  1T1A A;  4WN5 A;  1V9Y A;  2XRN A;  2GX5 A;  3CIT A;  3C38 A;  3LUQ A;  4LRZ E;  3C2W A;  4CLC E;  3T4S A;  3S7Q A;  4DMZ A;  3E4P A;  3E4Q A;  4I3I A;  2HJ9 C;  5IU1 A;  2HGV A;  3KX0 X;  4WEK A;  3H9W A;  3PHY A;  3JVV A;  2B02 A;  2W3D A;  1T18 A;  1XJ6 A;  2J80 A;  5F6A A;  4NXE A;  1LT0 A;  2D01 A;  3F1N A;  3B33 A;  4B93 A;  1ZTU A;  3G6O A;  4EEU A;  2OAQ 1;  1ZHH B;  2PDR A;  3MQO A;  3D72 A;  1OTD A;  4G3V A;  4WL9 A;  3MFX A;  4F3L B;  3CI6 A;  3RTY A;  3SW1 A;  2EWV A;  4EER A;  4MN5 A;  2K31 A;  4XT2 A;  5HWW A;  3EQV A;  4KQO A;  4R38 A;  5TJJ A;  3HJK A;  4O8G A;  4CQH A;  3R7W B;  3PBO A;  2JN7 A;  2PT7 A;  1F98 A;  1T1B A;  4Q0I A;  4LRY C;  3MQQ A;  1YSP A;  3EWK A;  4H6J B;  5TBM B;  3GEC A;  1S67 L;  1UGU A;  3KSH A;  4BBU A;  3PBN A;  2W1T B;  2YKF A;  1OJ5 A;  1ODV A;  5G4Z A;  3C8C A;  2PR6 A;  2VJW A;  3PBS A;  2LB9 A;  5KSH A;  4JGR A;  3S7O A;  3ZYT A;  1OTA A;  2W27 A;  3V67 A;  1DRM A;  3S7N A;  2PD7 A;  5HPI A;  5MC7 A;  1YAX A;  5A8B A;  3KSG A;  1GSW A;  1MC0 A;  4QPR A;  4DN0 A;  3NOP C;  3R4K A;  3KSI A;  3T4Q A;  1WA9 A;  1OPX A;  4HJ4 A;  1TS7 A;  3GDI A;  1NRJ A;  2L1M A;  1H8M A;  5J4E A;  2YKH A;  3LIE A;  3FC7 A;  2O0Y A;  2WKQ A;  2L4R A;  2H28 A;  3OBF A;  3T4T A;  3FPW A;  4RQ9 A;  4L9G A;  2G7U A;  4NEE D;  2GNX A;  4BBV A;  1VHM A;  2O9A A;  1S66 L;  4MCW A;  3NOU C;  4CLC C;  3F1P B;  3KYQ A;  4MN7 A;  2W3H A;  3LR5 A;  3LIC A;  4HH2 A;  4UQI M;  2VLG A;  4O01 A;  4IJG A;  2O99 A;  2VX8 A;  1LSW A;  3IS2 B;  3UMD A;  2XA7 S;  2P7J A;  5HD5 A;  2JKT I;  2OAP 1;  4LLO B;  3UB9 A;  3VE4 A;  4ZRR A;  2PHY A;  4Q0J A;  3IBJ A;  3KSF A;  3TRC A;  1OTB A;  4JGQ A;  4R3A A;  3KO6 A;  1DP6 A;  3FPV A;  5HZH A;  1XJ2 A;  4K08 A;  5KIZ A;  3ULF A;  4EQ1 A;  1NLZ A;  3VE3 A;  1W63 M;  2ZMF A;  2O9C A;  4EEP A;  4HJ3 A;  2J3W A;  3CAX A;  3EQU A;  2V1A A;  4G3K A;  2GJ3 A;  3P7N A;  2W3G A;  4Y2F A;  4JGO A;  4Y5F A;  3LIA A;  3HJI A;  3LFV A;  3TJZ C;  5G4Y A;  4BMW A;  3LIF A;  3OCN A;  1TD5 A;  2KOI A;  3PR6 A;  5AJG A;  3K3C A;  5HD3 A;  1D7E A;  2QJ5 A;  4GLQ A;  4L0L A;  4BJP A;  1P0Z A;  4HP4 A;  3NJA A;  2V0U A;  4PKY G;  3B47 A;  3LR4 A;  3BQ8 A;  3FG8 A;  3JVU A;  3F1P A;  2PYR A;  5DJU A;  2ZOH A;  4UQI S;  2WKR A;  5HPF A;  1X0O A;  2XA7 M;  3UME A;  1OT9 A;  4KUO A;  5EFW A;  1H3Q A;  1D06 A;  2MJ6 A;  3R7W A;  5AVE A;  3W2Z A;  4WF0 A;  4UEY A;  5DKK A;  1F5M A;  2VV6 A;  3P01 A;  1XJ3 A;  4HH3 A;  1S1Z A;  4H6J A;  3ICY A;  1BYW A;  2ZOI A;  1OTE A;  5IT5 A;  2KDK A;  4WEL A;  2W3E A;  3VOL A;  1XJ4 A;  2EA9 A;  1MZU A;  5I5L A;  4FOF A;  1EW0 A;  2PD8 A;  1TS8 A;  3OC2 A;  1NWZ A;  2VV8 A;  3K2N A;  4MDZ A;  4HJ6 A;  1DP8 A;  5LBR A;  2VKS A;  4HP9 A;  1T1C A;  2DMW A;  2W0N A;  4MMN A;  1S4S A;  4YWZ A;  2W1R A;  2KX6 A;  2Z6C A;  1Y28 A;  4WUJ A;  4CLC D;  5TBM A;  3S7P A;  1OJG A;  2QHK A;  4EES A;  3MQ0 A;  1LSX A;  4OOL A;  4NXB A;  3MXQ A;  3MJQ A;  3T50 A;  3LID A;  4EU0 A;  4GS9 B;  2M7V A;  4I3A A;  4O0P A;  3LIB A;  1P97 A;  4I38 A;  1YSQ A;  5DFY A;  2HV1 A;  2GZA A;  4CLC A;  3ZQ5 A;  3EOI A;  2Y79 A;  1LSV A;  2K2N A;  3LI9 A;  4CLC B;  2VA0 A;  3CUE A;  3BY8 A;  2B18 A;  3KYZ A;  2IA2 A;  5HWV A;  3EGX C;  2LB5 A;  4HOI A;  5FL3 A;  1KOU A;  1LL8 A;  5F5Y A;  2W3F A;  4YOF A;  2INW A;  4R70 A;  2VV7 A;  1JNU A;  2HJE A;  1G6O A;  5J3W A;  4BBT A;  3A0S A;  1G28 A;  5HL6 A;  4ETZ A;  2O9B A;  3MR0 A;  5CX7 A;  3H82 B;  4IUH A;  3LI8 A;  5DFX A;  1XFN A;  2KLI A;  5AVF A;  5K5B A;  2PYP A;  4PKY A;  2D02 A;  4KQD A;  3U2A A;  2XRO A;  3H7W B;  3B42 A;  1TF1 A;  1XFQ A;  2ZBB A;  3IS2 A;  4BWI A;  4ARZ A;  5F68 A;  3O5Y A;  4WLA A;  3RFB A;  3EEA A;  2NUP C;  3T4O A;  2QJ7 A;  2M7U A;  4Q0H A;  5IS1 A;  2FZ0 A;  2K7S A;  4MN6 A;  3T4L A;  3HCY A;  3E4O A;  3C30 A;  2QKP A;  3LR3 A;  2EWW A;  1OTI A;  2W1T A;  4IHQ A;  4II7 A;  4GHI A;  2A2L A;  2J3T C;  4NXF A;  4F3L A;  4YNR A;  4L9F A;  3NOT C;  1IFQ A;  4HHD A;  5DJT A;  2XSS A;  3MMH A;  4G3W A;  3F1O A;  4GW9 A;  3UE3 A;  3CUE C;  2CMN A;  4DJ3 A;  3BWL A;  3A0R A;  2Y8H A;  2VEA A;  3A0V A;  4P6Z S;  3T4J A;  1DP9 A;  4LRX C;  3CWF A;  5J7E A;  3PBQ A;  4IUK A;  4LPZ A;  1F9I A;  5DKL A;  2A24 B;  1NLY A;  1S1Y A;  3F1N B;  2QWS A;  1V9Z A;  3E98 A;  1UWN X;  4HNB A;  2J3T D;  1W63 Q;  1P9W A;  5HDC A;  5C5K A;  4NXG A;  1VB6 A;  1GSV A;  4L9E A;  3H7W A;  1T19 A;  2VGL M;  4Z1W A;  4EXO A;  1TS6 A;  4ARZ B;  3BW6 A;  1OT6 A;  1MKM A;  3PBR A;  3LR0 A;  3OCL A;  1P9R A;  3OLO A;  3E0Y A;  4HI4 A;  3UB8 A;  2P04 A;  3PXP A;  2JKR I;  4JGP A;  3EEH A;  5HWT A;  3D3O A;  2I9V A;  2M1C A;  4GCZ A;  4GHI B;  5HDD A;  2V0W A;  3H82 A;  2JKR M;  3UE6 A;  4EW7 A;  5HDS A;  2OWJ A;  4M4X A;  2PR5 A;  5DF9 A;  2L0W A;  4PAU A;  4Y3I A;  4ME4 A;  3F1O B;  2OWH A;  2BAS A;  2P08 A;  1UWP X;  4GS9 A;  3T4K A;  3MF0 A;  3IBR A;  1YKD A;  4HY8 A;  4KUK A;  2NUT C;  2Z6D A;  4I3J A;  3BJN A;  4I5S A;  3VV4 A;  4EUV A;  3NHQ A;  2VZW A;  4PHT A;  1N9O A;  2HF6 A;  4FSF A;  4GJ4 A;  4ETX A;  3DBA A;  1N9N A;  4B9O A;  2A24 A;  3UB6 A;  5F69 A;  2WKP A;  3BQA A;  2JHE A;  3BY9 A;  1GSX A;  3RH8 B;  4E04 A;  2V9A A;  3K3D A;  2QYB A;  5HSQ A;  4I39 A;  4OOM A;  2ZMV A;  3TW8 A;  3OOV A;  1TS0 A;  1IOU A;  4R6L A;  4WEJ A;  4DJ2 A;  2VGL S;  4AFI A;  3UB7 A;  4EET B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...