3F1PA

Crystal structure of a high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
FKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
publication title Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3f1pA00
3MJQA 5AVFA 5HSQA 3T50A 3CAXA 2D01A 4DJ2A 4F3LA 4JGOA 2WKRA 2D02A 1OTEA 4I3IA 2W27A 4HIAA 1S4RA 2PDRA 3E4QA 2PD8A 4BBUA 1T18A 1GSVA 3B33A 4LRXC 4MN5A 5J3WA 1OTBA 4GS9A 3F1OA 4K08A 2KX6A 2KDKA 4GHIB 3GECA 3NHQA 3NOPC 1UWPX 1V9YA 2WKPA 3LIDA 3H7WB 3K3DA 1TS8A 3MQQA 3H82A 2PYPA 3F1NA 1ODVA 4F3LB 5AVEA 1T1AA 4M4XA 1OJ5A 3VE4A 3PHYA 5J7EA 2J80A 3RH8B 3EEHA 1P97A 4GS9B 3UMDA 1S66L 5F69A 2PHYA 5G4ZA 3RTYA 3MXQA 4KUKA 3LIFA 3KX0X 5HD3A 3ICYA 3BY9A 3H82B 4B9OA 1OTIA 3F1NB 4R38A 1GSWA 2K7SA 4HY8A 1MZUA 2M1CA 1S1ZA 1N9OA 1LSXA 3CWFA 1XJ2A 4HJ6A 1TS7A 4XT2A 5KIZA 1UWNX 4L9GA 1TS0A 4EEUA 2VV8A 2CMNA 1LSWA 3HJKA 1XFNA 2V0WA 4LPZA 2H28A 4I3AA 4R70A 5A8BA 3OLOA 1Y28A 1KOUA 1S4SA 1JNUA 4HI4A 1BYWA 4HNBA 5HWWA 2L0WA 2QHKA 3UE6A 2VV6A 1LL8A 2VLGA 4L9FA 4H6JA 4XT2B 4LLOB 5HDSA 3A0RA 5DJUA 1XFQA 2V1AA 5IS1A 5HZHA 3C8CA 3BY8A 1XJ6A 2JHEA 4HHDA 2HV1A 3IS2B 5F68A 3FG8A 4JGQA 4JGPA 3MFXA 1P0ZA 2R78A 3MR0A 4BBTA 4KQDA 5J4EA 2PR6A 2WKQA 4HH2A 3E4PA 1S67L 3A0SA 1LSVA 2PYRA 4HOIA 4H6JB 3K3CA 1WA9A 4WN5A 2V0UA 2QKPA 2QJ7A 4GCZA 3LIBA 4WLAA 1X0OA 2OWJA 1VB6A 2I9VA 4YWZA 3UB9A 5HD5A 3HJIA 4RQ9A 3LICA 3PYPA 1T1CA 2L1MA 3IBRA 1D7EA 3UB8A 4PKYG 4WUJA 2Z6DA 5DKKA 1DRMA 3UMEA 2INWA 3IS2A 1DP8A 4I38A 3MQOA 2ZBBA 4HQAA 1XJ4A 4R6LA 3LI8A 1T19A 5DKLA 3VE3A 2YKHA 3LUQA 4EERA 3UB7A 1S1YA 2B02A 5F5YA 2GJ3A 3D72A 2Z6CA 1V9ZA 4PKYA 3BWLA 1LT0A 5EFWA 1DP9A 2V9AA 1NWZA 1OT9A 1OTDA 1T1BA 3CLOA 3GDIA 3UB6A 1OJGA 5TBMB 2BASA 3EWKA 4LRZE 3H9WA 5HWVA 4HH3A 2VV7A 4WL9A 1N9LA 4I3JA 4WF0A 5G4YA 3ULFA 1D06A 1GSXA 1TS6A 1EW0A 4MN6A 2PR5A 2ZOHA 3LYXA 2A24A 4EQ1A 4I5SA 3SW1A 1XJ3A 3LIEA 2ZOIA 3LI9A 3NOUC 4R3AA 1F9IA 3NOTC 2OOLA 4EETB 4KUOA 3F1PA 5HWTA 2EA9A 5F6AA 4EXOA 2L4RA 1OT6A 3NJAA 4LRYC 1UGUA 3F1OB 4HP9A 4BBVA 4HJ4A 3A0VA 4E04A 2P7JA 2PD7A 3VOLA 3E4OA 2QJ5A 3ZQ5A 4NXEA 4DJ3A 1G28A 2JN7A 2V1BA 2YKFA 4NXGA 2QWSA 5IU1A 2A24B 4NXFA 2W0NA 3FC7A 5HDCA 4NXBA 4HJ3A 1N9NA 4EEPA 1DP6A 3LIAA 4GHIA 2VEAA 2OWHA 5TBMA 3P7NA 4HP4A 3F1PB 4I39A 4JGRA 1F98A 4L9EA 4EESA 1OTAA 5HDDA 3H7WA 3G6OA 5DJTA 4EW7A 5I5LA 4GW9A 3C2WA
chains in the Genus database with same CATH superfamily
5AVFA 5FQMA 3T1SA 4JGOA 4XXRA 1YMSA 5FDSA 1IKIA 4HIAA 1S4RA 4UEYA 3E4QA 3C7UA 1GSVA 4LRXC 4MN5A 4GS9A 4KZ4A 3F1OA 2KX6A 4R3BA 2H0YA 2KDKA 3BFCA 4R3JA 3BW6A 4N1HA 3M2JA 3NHQA 3VOZA 1VETB 2ZQ8A 3FPWA 2WKPA 4FCFA 3V50A 3BLMA 2EXAA 4YINA 5FI7A 4N92A 2Y59A 1ODVA 4JLFA 3IX4A 2Q9NA 1EWZA 4KG2A 1YLYA 5AVEA 1LI0A 4BWIA 4WM9A 2K31A 4M4XA 2V8CA 4RVAA 5E2HA 3LR3A 3VE4A 3PHYA 1LHYA 1IYOA 4GDBA 4R23A 4GS9B 1PRQA 3UMDA 4EBNA 3P09A 2ZM0A 1F5MA 3B42A 3TG9A 1TF1A 1FQGA 2A3UA 3C7VA 3RTYA 4D60A 2RCXA 4X55A 4IUKA 3SS4A 4KUKA 2JBFA 2LB9A 2XD1A 5HD3A 3C4OA 3ICYA 3T4QA 4EBPA 3G30A 1W8YA 1GSWA 3DTMA 1MC0A 3T12B 4FTXA 4PM9A 5K5BA 3A3IA 3ZG7B 1O07A 3B3XA 1MXOA 5HFOA 3S22A 4HJ6A 4XT2A 1ESUA 1KE4A 4GLQA 1UWNX 1TDGA 1GHIA 2WGVA 4L9GA 1NYMA 4HEFA 4MNRA 5U47A 3ZDJA 1WE4A 5D3OA 1GA0A 1LSWA 1PYYA 3O5YA 3VOYA 1VHMA 4Q8IA 4R70A 5A8BA 5DF9A 3OLOA 5CX7A 1XGJA 3OPPA 5AJGA 3RFBA 3NBLA 3GMWA 1JNUA 1HD8A 1LL5A 4HI4A 5CHJA 2UV0E 4JF4A 4MBHA 5HX9A 1CI9A 1F2KA 3MXSA 4CLCD 2VLGA 3SOIA 3EGXC 4H6JA 1J9MA 3MBZA 3T4TA 3BJNA 4MDZA 4XT2B 2OLVA 5HDSA 3LFVA 4AFIA 4Y0OA 1MY8A 4ETZA 1LI9A 1XFQA 2V1AA 5LBRA 5HZHA 3C8CA 3BY8A 5I94A 3IS2B 4N1XA 1W8QA 1SDEA 2JKTI 4JGPA 3ZG0A 1NYYA 1N4OA 1P0ZA 2CC1A 4G3VA 1ZHHB 3UNWA 2WK0A 3PBRA 2LB5A 4HH2A 3BYDA 4WZ5A 1KDWA 4H6JB 2Z2MB 2A2LA 3HL9A 5E2EA 2QKPA 2QJ7A 2I72A 3LIBA 1IKGA 2V2FF 4GJ4A 2O9BA 4B88A 5GHYA 4DDSA 1ES4A 1ES2A 3ITAA 3UB9A 4R4RA 2J3WA 3D4FA 3LICA 1HVBA 2W1TA 3Q7VA 3QHYA 1KE3A 1SCWA 4EUVA 4OH0A 1K54C 5HPIA 2JKRI 3ZFZA 1MBLA 4WZ5C 2WGWB 2Z6DA 3NC8A 5E43A 4QD4A 1DRMA 4QPRA 4WELA 4CLCA 5E2FA 1Z6FA 1CF0A 2ZLYA 2ZBBA 3C4PA 3LI8A 4BQMA 3VE3A 2WAEA 2YKHA 3LUQA 2XD5A 3UB7A 2HPBA 3NECA 4UHUA 5L2FA 4GD8A 2R9XA 1ONGA 3D72A 4QY6A 3VFFA 3SH7A 1V9ZA 4PKYA 3Q7VB 1LT0A 3KSIA 3QP8A 3HREA 4GN2A 2HGVA 1KGFA 3OBFA 3LGOA 4CLCC 1T1BA 1J3WA 2JKTM 2ZM2A 5FEGA 5TBMB 2O99A 1H8MA 1RGZA 1YAXA 3CI6A 3KYQA 2DCFA 2HDQA 3LY4A 2VGLM 4I3JA 4PHTA 3SH8A 4MN6A 2ZL1B 3DTEA 5HAIA 2HDRA 5M18A 1SZVA 3IF6C 5E2GA 2Y2HA 2ZC3B 4ZJ3A 3V67A 1FCOA 4KUOA 3F1PA 3L7HA 4JXVA 1YSQA 5F6AA 2VK3A 4LGWA 1PW1A 1OT6A 2O9CA 3HLDA 3A3EA 1L2SA 4JF5A 4Z1WA 4HP9A 4HJ4A 3A0VA 1U60A 4OOYA 4EQIA 2PD7A 3VOLA 1FSWA 3ZG5A 5FL3A 4RYEA 4PMAA 2OSUA 2NUTC 5FI2A 4NXGA 5EECA 1HZOA 1W5DA 2W0NA 2W3GA 5GL9A 3ZVTA 3QNCA 4NXBA 1N9NA 2XRNA 3UPPA 3TJZC 3LIAA 3O88A 4WMCA 1TDLA 2B5RA 1ERMA 1NLZA 3IXGA 4BLMA 4HP4A 3F1PB 1VEUA 2VGKA 3PBOA 1F98A 4KQQA 4DDYA 4EESA 3H7WA 3AGDA 4X6TA 2EFXA 3GR2A 1WYBA 4GW9A 4JXWA 3MJQA 1MKMA 5HSQA 1E3UA 3CITA 1FR6A 1M40A 4DJ2A 1Z09A 2D02A 3VSKA 4RX3A 4MN7A 2W27A 2P9VB 1H8YA 1BLPA 2PD8A 5GHZA 1T18A 1STZA 3B33A 3A3DA 5JYPA 2XR0A 3W4OA 2RL3A 1FIKA 5FA7A 2EFUA 3FPVA 3BFFA 5EM1A 1VEUB 2JCHA 1HLUP 3GECA 3NOPC 2EX6A 4IHQA 4E3NA 1XPBA 3BM6A 3LR5A 4OPZA 1GHPA 2E8JA 4FH2A 1IELA 3H7WB 4DE1A 4O0PA 4OQIA 3C30A 1FR1A 3ZCZA 4X53A 5AQAA 4ZAMA 1XX2A 5HL6A 3VP4A 3F1NA 5CGWA 4CJNA 4NK3A 2W3HA 2EX2A 4Q0HA 1DJBA 5DFYA 3KYEA 2HZ5A 4FH4A 3VSLA 5J7EA 2J80A 1G6OA 2OLUA 1W63M 4MBKA 4KZ3A 5GLCA 4PM6A 5DTKA 5F69A 1BLCA 1P9WA 2PHYA 3NDEA 1XA1A 1BT5A 3UN7A 3B47A 4E3MA 2G2UA 2FFFB 2HP5A 1K56D 5G4ZA 3T4KA 1NJ4A 1ERQA 1RGYA 4DMZA 3MXQA 3CJMA 1IYQA 4Y0TA 4X1MA 3KX0X 2W3EA 5IT5A 3BY9A 4MCWA 3F1NB 4R38A 3N6IA 4M3KA 3OCNA 1QMEA 3S7OA 2M1CA 4OPRA 1S1ZA 2Y2LA 1N9OA 4N9KA 1TD5A 4R0QA 4OPYA 5KIZA 5G18A 4FSFA 1K38A 2VV8A 3UE1A 1YLPA 1XFNA 3UPNA 4LPZA 2HF6A 2VA0A 4L0LA 1K55C 1KOUA 5FAPA 3T4SA 3WS2A 2QZ6A 4MBFA 3UB5P 4PPRA 1XGIA 4E3LA 4FOFA 5EV0A 4HNBA 2XLNA 2L0WA 3AGEA 2QHKA 4OKPA 3UE6A 4YFMA 1KGEA 4DXCA 4G3WA 4X1LA 4KZ8A 4L9FA 3GVBA 2X01A 3MZDA 3DTKA 4MMNA 4GZBA 1CEGA 4Q0JA 1H3QA 4RA7A 2HP6A 4KZ9A 5IS1A 3E2KA 2DNSA 1K56A 1N9BA 1XJ6A 2Y91A 3G35A 3W4PA 3ITBA 2JHEA 3RJUA 5KSHA 1LLBA 1DY6A 3FG8A 3ISGA 2VJWA 4PM7A 3E98A 2E8IA 3IX3A 1K4EA 1I5QA 2PR6A 4KZ6A 2HDUA 2WKIA 3E4PA 3WS0A 5DF7A 5CXWA 1WA9A 1YKDA 4WN5A 4LV3A 3ZG9B 4JPMA 4OP8A 2XK1A 1K57A 4GCZA 3IBJA 1JWZA 1VB6A 4ESPA 2I9VA 1L0EA 1S0WA 5KZHA 4U0TA 2W1RA 3S7QA 2ZC5B 4GKUA 5HAQA 3PAGA 5DFXA 3PYPA 1O7EA 1W63Q 5GHXA 3FKVA 4QY5A 4KQOA 3PTEA 3T4OA 3HVFA 4KZ5A 3VP3A 2ZQ9A 4IVIA 3W2ZA 3JYIA 1MWTA 2ACGA 4WEJA 3V3RA 3UO9A 1JTDA 1ONHA 3E2LA 4IEDA 3IT9A 2FFYA 3IS2A 1DP8A 3WWXA 2EX9A 4EBLA 3M6BA 2ZQ7A 4R6LA 5BOHA 2VGJA 1PNEA 5DKLA 1OPXA 2XROA 4EERA 3IH9A 2WKHA 2XSSA 3D3OA 3MXRA 1C3BA 2HJ9C 2H10A 5TJJA 3FV7A 4GDNA 5FQ9A 4KZ7A 4C3QA 3BWLA 4B93A 4XUZA 4H8RA 1L3LA 1NWZA 1OT9A 3Q07A 1OTDA 4GB7A 3KSFA 1PI4A 5HW3A 1JVJA 4UA6A 5HARA 1G6AA 3HUNA 2BASA 3DWKA 4P0MA 2EX8A 3H9WA 2Y2KA 1AXBA 2QPNA 1VM1A 4P85A 5G4YA 3U2AA 4KZBA 4S2NA 4OONA 1K0KA 4D2OA 1IOUA 5F83A 2A24A 3ZYTA 4EQ1A 2IWDA 5HPFA 4I5SA 1XJ3A 1HTZA 3LIEA 3LI9A 2WGWA 2KOIA 4ARZA 3BQ8A 2Y2NA 3NI9A 5DVAA 5HWTA 4A5RA 4OPQA 2L4RA 2O9AA 1ES3A 3NJAA 4X69A 1K4FA 1K6SA 3R4KA 1DJCA 4BBVA 4E04A 4P6ZS 4YNRA 2EWWA 3E4OA 4HBUA 3M6HA 1PWCA 2XA7M 4KENB 3ZQ5A 3MFDA 1K6RA 2JN7A 2Q0OA 3Q82A 2NUPC 4K91A 1A0KA 5F1GA 5IU1A 5EVIA 2A24B 4NXFA 1NRFA 4JKTA 3QP5A 1ZC2A 4FD8A 5L09A 3L9KA 4ARZB 3BLSA 3S4XA 4GHIA 3T4JA 5TBMA 4OVDA 3PBQA 1YPRA 3O87A 4BD0A 3IH8A 2IWBA 4EUZA 5CHMA 5EM0A 5HDDA 2PT7A 2ZC4B 3C2WA 4G3KA 2ZL1A 3CUEA 2Y4AA 2Y2IA 4Q0IA 3PAEA 1YSPA 4F3LA 2WKRA 1OTEA 4WMCD 4I3IA 2V1ZA 1GCEA 5EVIB 1I2SA 4Y2FA 1MWSA 5EVLA 5J3WA 1TVFA 3UDIA 2P04A 4K08A 1ACFA 4GHIB 1W79A 2Q9MA 3V5MA 4DRTA 2ZMFA 2WZXA 3UE0A 1E3UD 3JVUA 4OQHA 2FH5A 1YLJA 1UWPX 4UQIS 2PU4A 3CUEC 4S2PA 3C5AA 2JE5A 3K3DA 4LENA 3H82A 3KYZA 4F3LB 2A49A 4E6XA 2ZQDA 4YOFA 4Y3IA 1H0MA 1FCMA 2KLIA 3C38A 3RH8B 3EEHA 5M19A 3HCYA 5MC7A 1E25A 3M2KA 3O86A 5EVEA 3R7WB 4ZBEA 5CECA 2P9VA 4XUXA 3LIFA 2BLSA 4S2IA 3PXPA 3H82B 3JVVA 3W8KA 4B9OA 3PBTA 1IFQA 2K7SA 1MZUA 3TRCA 2Y79A 4LV1A 4CPKA 1XJ2A 1NLYA 3KSGA 5A90A 1CQAA 3KO6A 4QB8A 3IQAA 3N8LA 1Y4OA 1NZOA 3LR4A 1TS0A 4EEUA 2X02A 4NEED 1ZG4A 4U0XA 2CMNA 2DRWA 3HJKA 2V0WA 4DE3A 4GNUA 4K0XA 1Y28A 3IXDA 1M6KA 1BUEA 3QNBA 5AQ7A 2M7VA 3PR6A 4IUHA 3CHWP 2J7VA 2QYBA 1PW8A 1FSYA 2ZC6B 3MKEA 3CMZA 2VV6A 2WADA 5JYOA 1LL8A 3W4QA 5FASA 3IXHA 4U3TA 3DWZA 4ME4A 4LLOB 2VKSA 1CK3A 3OCLA 1FOFA 4N9LA 1BTLA 3HLGA 1ALQA 3FZCA 1PIOA 3N4IA 2HV1A 3EQUA 5F68A 3AGFA 3PBNA 3T1XA 1BSGA 3MFXA 3MR0A 2R78A 1L0DA 3WS5A 1KVMA 4KQDA 3MSHA 4ZRRA 3EGDC 3Q81A 5KSCA 4K0WA 4E3OA 3UDFA 3GRJA 1ES5A 1LSVA 2C5WB 4HOIA 1YT4A 2Y2JA 5TGFA 4Z9QA 3N7WA 2V0UA 5AQ9A 1ZKJA 2Y8HA 4Y17A 1X0OA 2DMWA 2PRFA 3LEZA 5DTSA 5CERA 2W3DA 1KGGA 5CGXA 3P98A 2GNXA 3G32A 4RX2A 4E6WA 3FWLA 2XH9A 2V8FA 2XF3A 3ZGAB 1RCJA 5GLBA 1YMXA 3G2ZA 4PKYG 4ZJ2A 4WUJA 3ZG8B 1Q2QA 2HJEA 4OP5A 4B4XA 4E3KA 4X68A 1Q2PA 3QP1A 1NY0A 3E0YA 5FQQA 5FDHA 4EV4A 5EOOA 3BFEA 1G68A 3SS5A 4I38A 3MS6A 3MQOA 4HQAA 5GLAA 5CTNA 3NIAA 1DJAA 3SS3A 4C75A 1T19A 4QWOA 5CHUA 4PM8A 4BD1A 5F5YA 2XFTA 1SHVA 4OQGA 3RXWA 5EUAA 1ZTUA 4BL2A 2X71A 1E4DA 3VMAA 3BFDA 2V9AA 5A91A 5FQIA 3DAVA 1FILA 1H8ZA 1ZG6A 4MLLA 3UB6A 1OJGA 3Q7ZA 3V39A 5DF8A 3EWKA 3MZFA 4LRZE 3VP1A 3VV4A 1PFLA 4WBGA 5HWVA 4WL9A 1N9LA 1D06A 1GSXA 1TS6A 2PR5A 3LYXA 3TSGA 3TW8A 1XA7A 3QP2A 3UDXA 3SW1A 4PM5A 2XDMA 2ZOIA 5GLDA 3HLCA 4NKPA 4R3AA 2M7UA 2WAFA 2Y2GA 2OOLA 4EETB 1MKIA 2ZQAA 2UWXA 4BL3A 4EXOA 2JKGA 4ETXA 3WRTA 2ZD8A 1UGUA 3T1QB 3F1OB 4P6BA 1KVLA 2PBDP 2JC7A 2P7JA 4S2OA 1SKOA 2BTFP 2QJ5A 3SH9A 4BJPA 4NXEA 1G28A 4KQRA 4R1GA 3G2YA 1PWGA 1OMEA 4ZDXA 2V1BA 1MPLA 3VFHA 2JKFA 1JTGA 2QWSA 5CTMA 3SZTA 5L8MA 3FC7A 4S2KA 5M1AA 3HUMA 4EEPA 4EU0A 3HLEA 4JBFA 1K57C 4QHCA 5J8XA 2VX8A 4I39A 2ZMAA 2Y2QA 1H5XA 4F94A 4JGRA 4L9EA 2GZAA 1CJFA 4O8GA 5EVID 3G6OA 5DJTA 3IWOA 1SKOB 2WUQA 2HDSA 1BLHA 1VQQA 3T50A 3CAXA 2D01A 4LV0A 1YLWA 3Q1FA 1PZPA 3D9YA 2PU2A 3NDGA 3NCKA 4II7A 2PDRA 2Y2MA 4BBUA 4ZTKA 3EQVA 5FQKA 1OTBA 2Z2LB 3CPTA 1JWVA 1IEMA 2WKEA 1P9RA 2P08A 1V9YA 3OPRA 1L0FA 3LIDA 4CQHA 4OOMA 4HESA 1IYSA 2XA7S 1JWPA 3UPOA 2FZ0A 3U4LP 1TS8A 3MQQA 3QP6A 2PYPA 3IWQA 1D1JA 3PBSA 2Y2OA 5CEDA 1T1AA 2VZWA 2H5SA 1OJ5A 2G7UA 2WGIA 1BZAA 3OPLA 3EEAA 3OC2A 1CI8A 1P97A 3CPTB 1FCNA 3IXBA 3P01A 1S66L 4S2NC 1XP4A 1K54A 3DBAA 3S7PA 3G4PA 5FI6A 2PBYA 2J9OA 5CRFA 4UAAA 2B95A 4O01A 4JXSA 2H0TA 2ZQCA 4KG5A 1OTIA 1AWIA 2O0YA 3LEQA 4HY8A 3ZVWA 2XQZA 2P74A 4BMWA 2IA2A 4NETA 5TFQA 1LSXA 3LO7A 3CWFA 5EOEA 4JF6A 2OV5A 2ZJ9A 3HLWA 4IVKA 3S1YA 4UA9A 1TS7A 3I7JA 3ZNYA 2PAVP 4Y13A 2WYXA 5L10A 2OAP1 2Y55A 3IWIA 2VGLS 1CEFA 3TE8A 3G34A 5EVIC 3UY6A 3OZHA 1SKFA 4P6ZM 2H28A 4I3AA 3BECA 1S6RA 3WRZA 2B18A 4WYYA 1S4SA 4E3IA 4LCMA 3HUOA 4Y7PA 1XKZA 3ZHHA 4ID4A 5EE8A 1BYWA 3MF0A 3GSGA 3UE3A 1EROA 5HWWA 2W1TB 4X25A 5FATA 3RXXA 3LCEA 2HP9A 3R7WA 1YQSA 3CG5A 2ZM8A 3IF6A 2GDNA 5KMWA 2K2NA 3DW0A 3HLFA 3A0RA 1MWUA 4IBXA 5TR7A 5DJUA 2J9PA 4C6YA 4CLCB 3IX8A 3BFGA 4HHDA 1KE0A 5F1FA 1PZOA 4JGQA 3QP4A 4P87A 3S7NA 4QJGA 3GTCA 3GV9A 3DTIA 4GOGA 4EWFA 1G5UA 4BBTA 5J4EA 3VP0A 4DXBA 3MMHA 5FEFA 2WKQA 4E3JA 1S67L 1GHMA 3A0SA 1K25A 3OOVA 2PYRA 1BULA 3K3CA 3IF6B 1RP5A 4R4SA 2V20A 4S2LA 4WLAA 4ZJ1A 2OWJA 4Y5FA 4UQIM 4YWZA 4O7DA 4OLDA 5HD5A 4CLCE 2JKRM 3HBRA 4DE0A 3HJIA 4RQ9A 1YLZA 4OQ0A 2ZC7A 1T1CA 2L1MA 4PAUA 3IBRA 2QMIA 1TEMA 4LV2A 1D7EA 4GD6A 3UB8A 4LCLA 3NY4A 4UA7A 3GQZA 5DKKA 3LY3A 2C6WB 4QU3A 3UMEA 2J3TD 2WZZA 2INWA 3FYZA 5HL1A 1ESIA 3CZDA 1XJ4A 5C5KA 2GX5A 4IJGA 5FAQA 3WS4A 1S1YA 2B02A 1YM1A 5CGSA 4S2MA 2GJ3A 2EXBA 3VP2A 3LR0A 3HLBA 1GA9A 2Z6CA 5FAOA 2EWVA 5IHVA 3KSHA 4DN0A 2ZMVA 5FQJA 5A92A 5HAPA 4LFUA 3BEBA 1DP9A 5EFWA 3MQ0A 3OPHA 1I2WA 2J8YA 5EPHA 1W7FA 5CEBA 3CLOA 1WYCA 3GDIA 1PWDA 3EOIA 3MZEA 1L0GA 3NULA 3MKFA 3N8RA 4HH3A 2VV7A 3ULFA 4WF0A 1EW0A 4BENA 1XXMA 2ZOHA 1IYPA 3IHBA 3A3FA 1SDNA 3T4LA 3N8SA 2Y2PA 1NZUA 2AVXA 4HBTA 2XFSA 4Y15A 3NOUC 1F9IA 3NOTC 3TOIA 4MEZA 4DKIA 2EA9A 3T1RA 4NG2A 4LRYC 2XGNA 2IWCA 2R9WA 2W3FA 4X56A 4OLGA 2MJ6A 3JPUA 2XEPA 4FUWA 4KG6A 5L07A 3O3VA 3WS1A 4WEKA 1MWRA 5DTTA 1QMFA 1Y54A 1NRJA 1NXYA 4DJ3A 3A3JA 1EI5A 5AQBA 2OAQ1 4IBRA 2YKFA 4S2JA 4B4ZA 1LL9A 4DE2A 3BQAA 1PI5A 2G2WA 3G31A 3IHAA 5FSRA 5HDCA 4OOLA 4HJ3A 1K55A 3IF5A 1DP6A 5A93A 3V3SA 4WZ4A 2BG1A 3FKWA 2VEAA 1YLTA 2OWHA 3K2NA 3P7NA 1BLSA 1VETA 1OTAA 2J3TC 3BRMA 4DF6A 4JXGA 4KZAA 3ZNTA 1KDSA 4EW7A 5F82A 5I5LA 4Y0UA
chains in the Genus database with same CATH topology
3MJQA 5AVFA 3CUEA 1MKMA 5HSQA 3T50A 3CAXA 2D01A 4Q0IA 3CITA 4DJ2A 1YSPA 4F3LA 4JGOA 2WKRA 2D02A 1OTEA 4I3IA 4MN7A 2W27A 4II7A 4HIAA 4Y2FA 1S4RA 4UEYA 2PDRA 3E4QA 2PD8A 4BBUA 1T18A 1STZA 1GSVA 3B33A 3EQVA 4LRXC 4MN5A 5J3WA 1OTBA 4GS9A 3F1OA 2P04A 4K08A 2KX6A 2KDKA 4GHIB 3BW6A 3FPVA 2ZMFA 3GECA 3NHQA 3NOPC 1P9RA 4IHQA 3JVUA 2FH5A 1UWPX 2P08A 3LR5A 3FPWA 1V9YA 2WKPA 4UQIS 3CUEC 3LIDA 4CQHA 4OOMA 3H7WB 4O0PA 2XA7S 3C30A 2FZ0A 3K3DA 1TS8A 3MQQA 3H82A 2PYPA 5HL6A 3F1NA 3PBSA 1ODVA 3KYZA 2W3HA 4F3LB 5AVEA 4BWIA 1T1AA 2K31A 2VZWA 4M4XA 4Q0HA 4YOFA 1OJ5A 3LR3A 4Y3IA 5DFYA 3VE4A 2G7UA 3PHYA 2KLIA 3C38A 3EEAA 5J7EA 2J80A 3RH8B 1G6OA 3EEHA 3OC2A 1W63M 1P97A 4GS9B 3UMDA 1F5MA 3P01A 1S66L 3B42A 5F69A 1P9WA 2PHYA 3HCYA 5MC7A 3B47A 3DBAA 3S7PA 1TF1A 3R7WB 5G4ZA 3RTYA 3T4KA 4DMZA 3MXQA 4IUKA 4KUKA 4O01A 3LIFA 2LB9A 3KX0X 2W3EA 5IT5A 5HD3A 3PXPA 3ICYA 3T4QA 3BY9A 3H82B 3JVVA 4MCWA 1OTIA 4B9OA 3F1NB 4R38A 3PBTA 2O0YA 1GSWA 1IFQA 2K7SA 4HY8A 1MZUA 1MC0A 3TRCA 3OCNA 3S7OA 2M1CA 4BMWA 2Y79A 1S1ZA 2IA2A 5K5BA 1N9OA 1LSXA 3CWFA 1TD5A 1XJ2A 1NLYA 3KSGA 4HJ6A 1TS7A 3KO6A 4XT2A 5KIZA 4FSFA 4GLQA 1UWNX 2OAP1 3LR4A 1TS0A 4L9GA 4EEUA 2VV8A 4NEED 2VGLS 3TE8A 2CMNA 1LSWA 3HJKA 3O5YA 1XFNA 2V0WA 4LPZA 4P6ZM 2H28A 1VHMA 4I3AA 4R70A 5A8BA 5DF9A 2HF6A 2VA0A 3OLOA 4L0LA 1Y28A 1KOUA 2B18A 5CX7A 1S4SA 5AJGA 3RFBA 3T4SA 2M7VA 1JNUA 3PR6A 4IUHA 2QYBA 4HI4A 1BYWA 3MF0A 4FOFA 3UE3A 4HNBA 5HWWA 2L0WA 2QHKA 3UE6A 2W1TB 2VV6A 1LL8A 4CLCD 4G3WA 3R7WA 2VLGA 4L9FA 3EGXC 4H6JA 3T4TA 3BJNA 4MDZA 4MMNA 2K2NA 4XT2B 4ME4A 4LLOB 5HDSA 3LFVA 1H3QA 4Q0JA 4AFIA 2VKSA 3A0RA 3OCLA 4ETZA 5DJUA 1XFQA 2V1AA 5IS1A 4CLCB 5LBRA 5HZHA 3C8CA 3BY8A 1XJ6A 2JHEA 4HHDA 2HV1A 3EQUA 3IS2B 5F68A 5KSHA 2JKTI 3PBNA 3FG8A 4JGQA 4JGPA 2VJWA 3S7NA 3E98A 3MFXA 1P0ZA 2R78A 3MR0A 4G3VA 1ZHHB 4BBTA 4KQDA 5J4EA 4ZRRA 2PR6A 3EGDC 3PBRA 3MMHA 2LB5A 2WKQA 4HH2A 3E4PA 1S67L 3A0SA 1LSVA 3OOVA 2PYRA 4HOIA 4H6JB 3K3CA 2A2LA 1WA9A 1YKDA 4WN5A 2V0UA 2QKPA 2QJ7A 2Y8HA 4GCZA 3IBJA 3LIBA 4WLAA 1X0OA 2DMWA 2OWJA 1VB6A 4Y5FA 2I9VA 4GJ4A 2O9BA 4UQIM 4YWZA 3UB9A 2W1RA 3S7QA 2W3DA 5HD5A 4CLCE 2JKRM 2GNXA 5DFXA 2J3WA 3HJIA 4RQ9A 3LICA 3PYPA 1T1CA 1W63Q 2L1MA 2W1TA 4PAUA 3IBRA 4KQOA 1D7EA 3T4OA 3UB8A 4PKYG 4WUJA 4EUVA 5HPIA 2JKRI 2HJEA 2Z6DA 3W2ZA 5DKKA 3E0YA 1DRMA 4QPRA 4WEJA 4WELA 4CLCA 3UMEA 2J3TD 2INWA 3IS2A 1DP8A 4I38A 3MQOA 2ZBBA 4HQAA 1XJ4A 5C5KA 2GX5A 4R6LA 3LI8A 1T19A 5DKLA 3VE3A 2YKHA 4IJGA 1OPXA 3LUQA 2XROA 4EERA 3UB7A 1S1YA 2B02A 5F5YA 2XSSA 3D3OA 2GJ3A 3LR0A 2HJ9C 5TJJA 3D72A 1ZTUA 2Z6CA 1V9ZA 4PKYA 2EWVA 3BWLA 4B93A 1LT0A 3KSIA 3KSHA 4DN0A 2ZMVA 2HGVA 5EFWA 1DP9A 2V9AA 3MQ0A 3OBFA 1NWZA 4CLCC 1OT9A 1OTDA 1T1BA 3KSFA 3CLOA 2JKTM 3GDIA 3EOIA 3UB6A 1OJGA 5TBMB 2O99A 2BASA 1H8MA 3EWKA 1YAXA 4LRZE 3CI6A 3H9WA 3KYQA 3VV4A 5HWVA 4HH3A 2VV7A 2VGLM 1N9LA 4I3JA 4WF0A 4WL9A 5G4YA 3U2AA 3ULFA 1D06A 1GSXA 4PHTA 1TS6A 1EW0A 4MN6A 2PR5A 2ZOHA 3LYXA 1IOUA 2A24A 3ZYTA 4EQ1A 5HPFA 3TW8A 4I5SA 3SW1A 1XJ3A 3T4LA 3LIEA 2ZOIA 3LI9A 2KOIA 4ARZA 3BQ8A 3NOUC 4NKPA 4R3AA 1F9IA 3NOTC 2M7UA 2OOLA 3V67A 4EETB 4KUOA 3F1PA 5HWTA 2EA9A 1YSQA 5F6AA 4EXOA 2L4RA 4ETXA 2O9AA 1OT6A 3NJAA 2O9CA 4LRYC 3R4KA 2W3FA 1UGUA 4Z1WA 2MJ6A 3F1OB 4HP9A 4BBVA 4HJ4A 3A0VA 4WEKA 4E04A 2P7JA 4P6ZS 4YNRA 2EWWA 2PD7A 3VOLA 3E4OA 2QJ5A 2XA7M 3ZQ5A 1NRJA 4BJPA 4NXEA 4DJ3A 5FL3A 1G28A 2JN7A 2OAQ1 2NUPC 2V1BA 2NUTC 2YKFA 3BQAA 4NXGA 2QWSA 5IU1A 2A24B 4NXFA 5L8MA 2W0NA 2W3GA 3FC7A 5HDCA 4OOLA 4NXBA 4HJ3A 1N9NA 4EEPA 4ARZB 4EU0A 1DP6A 2XRNA 3TJZC 3LIAA 4GHIA 3T4JA 2VEAA 2OWHA 3K2NA 5TBMA 3P7NA 1NLZA 4HP4A 3F1PB 2VX8A 4I39A 3PBQA 3PBOA 4JGRA 1F98A 4L9EA 2GZAA 4EESA 1OTAA 2J3TC 4O8GA 5HDDA 3H7WA 3G6OA 5DJTA 4EW7A 2PT7A 5I5LA 4GW9A 3C2WA 4G3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MJQ A;  5AVF A;  5HSQ A;  3T50 A;  3CAX A;  2D01 A;  4DJ2 A;  4F3L A;  4JGO A;  2WKR A;  2D02 A;  1OTE A;  4I3I A;  2W27 A;  4HIA A;  1S4R A;  2PDR A;  3E4Q A;  2PD8 A;  4BBU A;  1T18 A;  1GSV A;  3B33 A;  4LRX C;  4MN5 A;  5J3W A;  1OTB A;  4GS9 A;  3F1O A;  4K08 A;  2KX6 A;  2KDK A;  4GHI B;  3GEC A;  3NHQ A;  3NOP C;  1UWP X;  1V9Y A;  2WKP A;  3LID A;  3H7W B;  3K3D A;  1TS8 A;  3MQQ A;  3H82 A;  2PYP A;  3F1N A;  1ODV A;  4F3L B;  5AVE A;  1T1A A;  4M4X A;  1OJ5 A;  3VE4 A;  3PHY A;  5J7E A;  2J80 A;  3RH8 B;  3EEH A;  1P97 A;  4GS9 B;  3UMD A;  1S66 L;  5F69 A;  2PHY A;  5G4Z A;  3RTY A;  3MXQ A;  4KUK A;  3LIF A;  3KX0 X;  5HD3 A;  3ICY A;  3BY9 A;  3H82 B;  4B9O A;  1OTI A;  3F1N B;  4R38 A;  1GSW A;  2K7S A;  4HY8 A;  1MZU A;  2M1C A;  1S1Z A;  1N9O A;  1LSX A;  3CWF A;  1XJ2 A;  4HJ6 A;  1TS7 A;  4XT2 A;  5KIZ A;  1UWN X;  4L9G A;  1TS0 A;  4EEU A;  2VV8 A;  2CMN A;  1LSW A;  3HJK A;  1XFN A;  2V0W A;  4LPZ A;  2H28 A;  4I3A A;  4R70 A;  5A8B A;  3OLO A;  1Y28 A;  1KOU A;  1S4S A;  1JNU A;  4HI4 A;  1BYW A;  4HNB A;  5HWW A;  2L0W A;  2QHK A;  3UE6 A;  2VV6 A;  1LL8 A;  2VLG A;  4L9F A;  4H6J A;  4XT2 B;  4LLO B;  5HDS A;  3A0R A;  5DJU A;  1XFQ A;  2V1A A;  5IS1 A;  5HZH A;  3C8C A;  3BY8 A;  1XJ6 A;  2JHE A;  4HHD A;  2HV1 A;  3IS2 B;  5F68 A;  3FG8 A;  4JGQ A;  4JGP A;  3MFX A;  1P0Z A;  2R78 A;  3MR0 A;  4BBT A;  4KQD A;  5J4E A;  2PR6 A;  2WKQ A;  4HH2 A;  3E4P A;  1S67 L;  3A0S A;  1LSV A;  2PYR A;  4HOI A;  4H6J B;  3K3C A;  1WA9 A;  4WN5 A;  2V0U A;  2QKP A;  2QJ7 A;  4GCZ A;  3LIB A;  4WLA A;  1X0O A;  2OWJ A;  1VB6 A;  2I9V A;  4YWZ A;  3UB9 A;  5HD5 A;  3HJI A;  4RQ9 A;  3LIC A;  3PYP A;  1T1C A;  2L1M A;  3IBR A;  1D7E A;  3UB8 A;  4PKY G;  4WUJ A;  2Z6D A;  5DKK A;  1DRM A;  3UME A;  2INW A;  3IS2 A;  1DP8 A;  4I38 A;  3MQO A;  2ZBB A;  4HQA A;  1XJ4 A;  4R6L A;  3LI8 A;  1T19 A;  5DKL A;  3VE3 A;  2YKH A;  3LUQ A;  4EER A;  3UB7 A;  1S1Y A;  2B02 A;  5F5Y A;  2GJ3 A;  3D72 A;  2Z6C A;  1V9Z A;  4PKY A;  3BWL A;  1LT0 A;  5EFW A;  1DP9 A;  2V9A A;  1NWZ A;  1OT9 A;  1OTD A;  1T1B A;  3CLO A;  3GDI A;  3UB6 A;  1OJG A;  5TBM B;  2BAS A;  3EWK A;  4LRZ E;  3H9W A;  5HWV A;  4HH3 A;  2VV7 A;  4WL9 A;  1N9L A;  4I3J A;  4WF0 A;  5G4Y A;  3ULF A;  1D06 A;  1GSX A;  1TS6 A;  1EW0 A;  4MN6 A;  2PR5 A;  2ZOH A;  3LYX A;  2A24 A;  4EQ1 A;  4I5S A;  3SW1 A;  1XJ3 A;  3LIE A;  2ZOI A;  3LI9 A;  3NOU C;  4R3A A;  1F9I A;  3NOT C;  2OOL A;  4EET B;  4KUO A;  3F1P A;  5HWT A;  2EA9 A;  5F6A A;  4EXO A;  2L4R A;  1OT6 A;  3NJA A;  4LRY C;  1UGU A;  3F1O B;  4HP9 A;  4BBV A;  4HJ4 A;  3A0V A;  4E04 A;  2P7J A;  2PD7 A;  3VOL A;  3E4O A;  2QJ5 A;  3ZQ5 A;  4NXE A;  4DJ3 A;  1G28 A;  2JN7 A;  2V1B A;  2YKF A;  4NXG A;  2QWS A;  5IU1 A;  2A24 B;  4NXF A;  2W0N A;  3FC7 A;  5HDC A;  4NXB A;  4HJ3 A;  1N9N A;  4EEP A;  1DP6 A;  3LIA A;  4GHI A;  2VEA A;  2OWH A;  5TBM A;  3P7N A;  4HP4 A;  3F1P B;  4I39 A;  4JGR A;  1F98 A;  4L9E A;  4EES A;  1OTA A;  5HDD A;  3H7W A;  3G6O A;  5DJT A;  4EW7 A;  5I5L A;  4GW9 A;  3C2W A; 
#chains in the Genus database with same CATH topology
 5AVF A;  5FQM A;  3T1S A;  4JGO A;  4XXR A;  1YMS A;  5FDS A;  1IKI A;  4HIA A;  1S4R A;  4UEY A;  3E4Q A;  3C7U A;  1GSV A;  4LRX C;  4MN5 A;  4GS9 A;  4KZ4 A;  3F1O A;  2KX6 A;  4R3B A;  2H0Y A;  2KDK A;  3BFC A;  4R3J A;  3BW6 A;  4N1H A;  3M2J A;  3NHQ A;  3VOZ A;  1VET B;  2ZQ8 A;  3FPW A;  2WKP A;  4FCF A;  3V50 A;  3BLM A;  2EXA A;  4YIN A;  5FI7 A;  4N92 A;  2Y59 A;  1ODV A;  4JLF A;  3IX4 A;  2Q9N A;  1EWZ A;  4KG2 A;  1YLY A;  5AVE A;  1LI0 A;  4BWI A;  4WM9 A;  2K31 A;  4M4X A;  2V8C A;  4RVA A;  5E2H A;  3LR3 A;  3VE4 A;  3PHY A;  1LHY A;  1IYO A;  4GDB A;  4R23 A;  4GS9 B;  1PRQ A;  3UMD A;  4EBN A;  3P09 A;  2ZM0 A;  1F5M A;  3B42 A;  3TG9 A;  1TF1 A;  1FQG A;  2A3U A;  3C7V A;  3RTY A;  4D60 A;  2RCX A;  4X55 A;  4IUK A;  3SS4 A;  4KUK A;  2JBF A;  2LB9 A;  2XD1 A;  5HD3 A;  3C4O A;  3ICY A;  3T4Q A;  4EBP A;  3G30 A;  1W8Y A;  1GSW A;  3DTM A;  1MC0 A;  3T12 B;  4FTX A;  4PM9 A;  5K5B A;  3A3I A;  3ZG7 B;  1O07 A;  3B3X A;  1MXO A;  5HFO A;  3S22 A;  4HJ6 A;  4XT2 A;  1ESU A;  1KE4 A;  4GLQ A;  1UWN X;  1TDG A;  1GHI A;  2WGV A;  4L9G A;  1NYM A;  4HEF A;  4MNR A;  5U47 A;  3ZDJ A;  1WE4 A;  5D3O A;  1GA0 A;  1LSW A;  1PYY A;  3O5Y A;  3VOY A;  1VHM A;  4Q8I A;  4R70 A;  5A8B A;  5DF9 A;  3OLO A;  5CX7 A;  1XGJ A;  3OPP A;  5AJG A;  3RFB A;  3NBL A;  3GMW A;  1JNU A;  1HD8 A;  1LL5 A;  4HI4 A;  5CHJ A;  2UV0 E;  4JF4 A;  4MBH A;  5HX9 A;  1CI9 A;  1F2K A;  3MXS A;  4CLC D;  2VLG A;  3SOI A;  3EGX C;  4H6J A;  1J9M A;  3MBZ A;  3T4T A;  3BJN A;  4MDZ A;  4XT2 B;  2OLV A;  5HDS A;  3LFV A;  4AFI A;  4Y0O A;  1MY8 A;  4ETZ A;  1LI9 A;  1XFQ A;  2V1A A;  5LBR A;  5HZH A;  3C8C A;  3BY8 A;  5I94 A;  3IS2 B;  4N1X A;  1W8Q A;  1SDE A;  2JKT I;  4JGP A;  3ZG0 A;  1NYY A;  1N4O A;  1P0Z A;  2CC1 A;  4G3V A;  1ZHH B;  3UNW A;  2WK0 A;  3PBR A;  2LB5 A;  4HH2 A;  3BYD A;  4WZ5 A;  1KDW A;  4H6J B;  2Z2M B;  2A2L A;  3HL9 A;  5E2E A;  2QKP A;  2QJ7 A;  2I72 A;  3LIB A;  1IKG A;  2V2F F;  4GJ4 A;  2O9B A;  4B88 A;  5GHY A;  4DDS A;  1ES4 A;  1ES2 A;  3ITA A;  3UB9 A;  4R4R A;  2J3W A;  3D4F A;  3LIC A;  1HVB A;  2W1T A;  3Q7V A;  3QHY A;  1KE3 A;  1SCW A;  4EUV A;  4OH0 A;  1K54 C;  5HPI A;  2JKR I;  3ZFZ A;  1MBL A;  4WZ5 C;  2WGW B;  2Z6D A;  3NC8 A;  5E43 A;  4QD4 A;  1DRM A;  4QPR A;  4WEL A;  4CLC A;  5E2F A;  1Z6F A;  1CF0 A;  2ZLY A;  2ZBB A;  3C4P A;  3LI8 A;  4BQM A;  3VE3 A;  2WAE A;  2YKH A;  3LUQ A;  2XD5 A;  3UB7 A;  2HPB A;  3NEC A;  4UHU A;  5L2F A;  4GD8 A;  2R9X A;  1ONG A;  3D72 A;  4QY6 A;  3VFF A;  3SH7 A;  1V9Z A;  4PKY A;  3Q7V B;  1LT0 A;  3KSI A;  3QP8 A;  3HRE A;  4GN2 A;  2HGV A;  1KGF A;  3OBF A;  3LGO A;  4CLC C;  1T1B A;  1J3W A;  2JKT M;  2ZM2 A;  5FEG A;  5TBM B;  2O99 A;  1H8M A;  1RGZ A;  1YAX A;  3CI6 A;  3KYQ A;  2DCF A;  2HDQ A;  3LY4 A;  2VGL M;  4I3J A;  4PHT A;  3SH8 A;  4MN6 A;  2ZL1 B;  3DTE A;  5HAI A;  2HDR A;  5M18 A;  1SZV A;  3IF6 C;  5E2G A;  2Y2H A;  2ZC3 B;  4ZJ3 A;  3V67 A;  1FCO A;  4KUO A;  3F1P A;  3L7H A;  4JXV A;  1YSQ A;  5F6A A;  2VK3 A;  4LGW A;  1PW1 A;  1OT6 A;  2O9C A;  3HLD A;  3A3E A;  1L2S A;  4JF5 A;  4Z1W A;  4HP9 A;  4HJ4 A;  3A0V A;  1U60 A;  4OOY A;  4EQI A;  2PD7 A;  3VOL A;  1FSW A;  3ZG5 A;  5FL3 A;  4RYE A;  4PMA A;  2OSU A;  2NUT C;  5FI2 A;  4NXG A;  5EEC A;  1HZO A;  1W5D A;  2W0N A;  2W3G A;  5GL9 A;  3ZVT A;  3QNC A;  4NXB A;  1N9N A;  2XRN A;  3UPP A;  3TJZ C;  3LIA A;  3O88 A;  4WMC A;  1TDL A;  2B5R A;  1ERM A;  1NLZ A;  3IXG A;  4BLM A;  4HP4 A;  3F1P B;  1VEU A;  2VGK A;  3PBO A;  1F98 A;  4KQQ A;  4DDY A;  4EES A;  3H7W A;  3AGD A;  4X6T A;  2EFX A;  3GR2 A;  1WYB A;  4GW9 A;  4JXW A;  3MJQ A;  1MKM A;  5HSQ A;  1E3U A;  3CIT A;  1FR6 A;  1M40 A;  4DJ2 A;  1Z09 A;  2D02 A;  3VSK A;  4RX3 A;  4MN7 A;  2W27 A;  2P9V B;  1H8Y A;  1BLP A;  2PD8 A;  5GHZ A;  1T18 A;  1STZ A;  3B33 A;  3A3D A;  5JYP A;  2XR0 A;  3W4O A;  2RL3 A;  1FIK A;  5FA7 A;  2EFU A;  3FPV A;  3BFF A;  5EM1 A;  1VEU B;  2JCH A;  1HLU P;  3GEC A;  3NOP C;  2EX6 A;  4IHQ A;  4E3N A;  1XPB A;  3BM6 A;  3LR5 A;  4OPZ A;  1GHP A;  2E8J A;  4FH2 A;  1IEL A;  3H7W B;  4DE1 A;  4O0P A;  4OQI A;  3C30 A;  1FR1 A;  3ZCZ A;  4X53 A;  5AQA A;  4ZAM A;  1XX2 A;  5HL6 A;  3VP4 A;  3F1N A;  5CGW A;  4CJN A;  4NK3 A;  2W3H A;  2EX2 A;  4Q0H A;  1DJB A;  5DFY A;  3KYE A;  2HZ5 A;  4FH4 A;  3VSL A;  5J7E A;  2J80 A;  1G6O A;  2OLU A;  1W63 M;  4MBK A;  4KZ3 A;  5GLC A;  4PM6 A;  5DTK A;  5F69 A;  1BLC A;  1P9W A;  2PHY A;  3NDE A;  1XA1 A;  1BT5 A;  3UN7 A;  3B47 A;  4E3M A;  2G2U A;  2FFF B;  2HP5 A;  1K56 D;  5G4Z A;  3T4K A;  1NJ4 A;  1ERQ A;  1RGY A;  4DMZ A;  3MXQ A;  3CJM A;  1IYQ A;  4Y0T A;  4X1M A;  3KX0 X;  2W3E A;  5IT5 A;  3BY9 A;  4MCW A;  3F1N B;  4R38 A;  3N6I A;  4M3K A;  3OCN A;  1QME A;  3S7O A;  2M1C A;  4OPR A;  1S1Z A;  2Y2L A;  1N9O A;  4N9K A;  1TD5 A;  4R0Q A;  4OPY A;  5KIZ A;  5G18 A;  4FSF A;  1K38 A;  2VV8 A;  3UE1 A;  1YLP A;  1XFN A;  3UPN A;  4LPZ A;  2HF6 A;  2VA0 A;  4L0L A;  1K55 C;  1KOU A;  5FAP A;  3T4S A;  3WS2 A;  2QZ6 A;  4MBF A;  3UB5 P;  4PPR A;  1XGI A;  4E3L A;  4FOF A;  5EV0 A;  4HNB A;  2XLN A;  2L0W A;  3AGE A;  2QHK A;  4OKP A;  3UE6 A;  4YFM A;  1KGE A;  4DXC A;  4G3W A;  4X1L A;  4KZ8 A;  4L9F A;  3GVB A;  2X01 A;  3MZD A;  3DTK A;  4MMN A;  4GZB A;  1CEG A;  4Q0J A;  1H3Q A;  4RA7 A;  2HP6 A;  4KZ9 A;  5IS1 A;  3E2K A;  2DNS A;  1K56 A;  1N9B A;  1XJ6 A;  2Y91 A;  3G35 A;  3W4P A;  3ITB A;  2JHE A;  3RJU A;  5KSH A;  1LLB A;  1DY6 A;  3FG8 A;  3ISG A;  2VJW A;  4PM7 A;  3E98 A;  2E8I A;  3IX3 A;  1K4E A;  1I5Q A;  2PR6 A;  4KZ6 A;  2HDU A;  2WKI A;  3E4P A;  3WS0 A;  5DF7 A;  5CXW A;  1WA9 A;  1YKD A;  4WN5 A;  4LV3 A;  3ZG9 B;  4JPM A;  4OP8 A;  2XK1 A;  1K57 A;  4GCZ A;  3IBJ A;  1JWZ A;  1VB6 A;  4ESP A;  2I9V A;  1L0E A;  1S0W A;  5KZH A;  4U0T A;  2W1R A;  3S7Q A;  2ZC5 B;  4GKU A;  5HAQ A;  3PAG A;  5DFX A;  3PYP A;  1O7E A;  1W63 Q;  5GHX A;  3FKV A;  4QY5 A;  4KQO A;  3PTE A;  3T4O A;  3HVF A;  4KZ5 A;  3VP3 A;  2ZQ9 A;  4IVI A;  3W2Z A;  3JYI A;  1MWT A;  2ACG A;  4WEJ A;  3V3R A;  3UO9 A;  1JTD A;  1ONH A;  3E2L A;  4IED A;  3IT9 A;  2FFY A;  3IS2 A;  1DP8 A;  3WWX A;  2EX9 A;  4EBL A;  3M6B A;  2ZQ7 A;  4R6L A;  5BOH A;  2VGJ A;  1PNE A;  5DKL A;  1OPX A;  2XRO A;  4EER A;  3IH9 A;  2WKH A;  2XSS A;  3D3O A;  3MXR A;  1C3B A;  2HJ9 C;  2H10 A;  5TJJ A;  3FV7 A;  4GDN A;  5FQ9 A;  4KZ7 A;  4C3Q A;  3BWL A;  4B93 A;  4XUZ A;  4H8R A;  1L3L A;  1NWZ A;  1OT9 A;  3Q07 A;  1OTD A;  4GB7 A;  3KSF A;  1PI4 A;  5HW3 A;  1JVJ A;  4UA6 A;  5HAR A;  1G6A A;  3HUN A;  2BAS A;  3DWK A;  4P0M A;  2EX8 A;  3H9W A;  2Y2K A;  1AXB A;  2QPN A;  1VM1 A;  4P85 A;  5G4Y A;  3U2A A;  4KZB A;  4S2N A;  4OON A;  1K0K A;  4D2O A;  1IOU A;  5F83 A;  2A24 A;  3ZYT A;  4EQ1 A;  2IWD A;  5HPF A;  4I5S A;  1XJ3 A;  1HTZ A;  3LIE A;  3LI9 A;  2WGW A;  2KOI A;  4ARZ A;  3BQ8 A;  2Y2N A;  3NI9 A;  5DVA A;  5HWT A;  4A5R A;  4OPQ A;  2L4R A;  2O9A A;  1ES3 A;  3NJA A;  4X69 A;  1K4F A;  1K6S A;  3R4K A;  1DJC A;  4BBV A;  4E04 A;  4P6Z S;  4YNR A;  2EWW A;  3E4O A;  4HBU A;  3M6H A;  1PWC A;  2XA7 M;  4KEN B;  3ZQ5 A;  3MFD A;  1K6R A;  2JN7 A;  2Q0O A;  3Q82 A;  2NUP C;  4K91 A;  1A0K A;  5F1G A;  5IU1 A;  5EVI A;  2A24 B;  4NXF A;  1NRF A;  4JKT A;  3QP5 A;  1ZC2 A;  4FD8 A;  5L09 A;  3L9K A;  4ARZ B;  3BLS A;  3S4X A;  4GHI A;  3T4J A;  5TBM A;  4OVD A;  3PBQ A;  1YPR A;  3O87 A;  4BD0 A;  3IH8 A;  2IWB A;  4EUZ A;  5CHM A;  5EM0 A;  5HDD A;  2PT7 A;  2ZC4 B;  3C2W A;  4G3K A;  2ZL1 A;  3CUE A;  2Y4A A;  2Y2I A;  4Q0I A;  3PAE A;  1YSP A;  4F3L A;  2WKR A;  1OTE A;  4WMC D;  4I3I A;  2V1Z A;  1GCE A;  5EVI B;  1I2S A;  4Y2F A;  1MWS A;  5EVL A;  5J3W A;  1TVF A;  3UDI A;  2P04 A;  4K08 A;  1ACF A;  4GHI B;  1W79 A;  2Q9M A;  3V5M A;  4DRT A;  2ZMF A;  2WZX A;  3UE0 A;  1E3U D;  3JVU A;  4OQH A;  2FH5 A;  1YLJ A;  1UWP X;  4UQI S;  2PU4 A;  3CUE C;  4S2P A;  3C5A A;  2JE5 A;  3K3D A;  4LEN A;  3H82 A;  3KYZ A;  4F3L B;  2A49 A;  4E6X A;  2ZQD A;  4YOF A;  4Y3I A;  1H0M A;  1FCM A;  2KLI A;  3C38 A;  3RH8 B;  3EEH A;  5M19 A;  3HCY A;  5MC7 A;  1E25 A;  3M2K A;  3O86 A;  5EVE A;  3R7W B;  4ZBE A;  5CEC A;  2P9V A;  4XUX A;  3LIF A;  2BLS A;  4S2I A;  3PXP A;  3H82 B;  3JVV A;  3W8K A;  4B9O A;  3PBT A;  1IFQ A;  2K7S A;  1MZU A;  3TRC A;  2Y79 A;  4LV1 A;  4CPK A;  1XJ2 A;  1NLY A;  3KSG A;  5A90 A;  1CQA A;  3KO6 A;  4QB8 A;  3IQA A;  3N8L A;  1Y4O A;  1NZO A;  3LR4 A;  1TS0 A;  4EEU A;  2X02 A;  4NEE D;  1ZG4 A;  4U0X A;  2CMN A;  2DRW A;  3HJK A;  2V0W A;  4DE3 A;  4GNU A;  4K0X A;  1Y28 A;  3IXD A;  1M6K A;  1BUE A;  3QNB A;  5AQ7 A;  2M7V A;  3PR6 A;  4IUH A;  3CHW P;  2J7V A;  2QYB A;  1PW8 A;  1FSY A;  2ZC6 B;  3MKE A;  3CMZ A;  2VV6 A;  2WAD A;  5JYO A;  1LL8 A;  3W4Q A;  5FAS A;  3IXH A;  4U3T A;  3DWZ A;  4ME4 A;  4LLO B;  2VKS A;  1CK3 A;  3OCL A;  1FOF A;  4N9L A;  1BTL A;  3HLG A;  1ALQ A;  3FZC A;  1PIO A;  3N4I A;  2HV1 A;  3EQU A;  5F68 A;  3AGF A;  3PBN A;  3T1X A;  1BSG A;  3MFX A;  3MR0 A;  2R78 A;  1L0D A;  3WS5 A;  1KVM A;  4KQD A;  3MSH A;  4ZRR A;  3EGD C;  3Q81 A;  5KSC A;  4K0W A;  4E3O A;  3UDF A;  3GRJ A;  1ES5 A;  1LSV A;  2C5W B;  4HOI A;  1YT4 A;  2Y2J A;  5TGF A;  4Z9Q A;  3N7W A;  2V0U A;  5AQ9 A;  1ZKJ A;  2Y8H A;  4Y17 A;  1X0O A;  2DMW A;  2PRF A;  3LEZ A;  5DTS A;  5CER A;  2W3D A;  1KGG A;  5CGX A;  3P98 A;  2GNX A;  3G32 A;  4RX2 A;  4E6W A;  3FWL A;  2XH9 A;  2V8F A;  2XF3 A;  3ZGA B;  1RCJ A;  5GLB A;  1YMX A;  3G2Z A;  4PKY G;  4ZJ2 A;  4WUJ A;  3ZG8 B;  1Q2Q A;  2HJE A;  4OP5 A;  4B4X A;  4E3K A;  4X68 A;  1Q2P A;  3QP1 A;  1NY0 A;  3E0Y A;  5FQQ A;  5FDH A;  4EV4 A;  5EOO A;  3BFE A;  1G68 A;  3SS5 A;  4I38 A;  3MS6 A;  3MQO A;  4HQA A;  5GLA A;  5CTN A;  3NIA A;  1DJA A;  3SS3 A;  4C75 A;  1T19 A;  4QWO A;  5CHU A;  4PM8 A;  4BD1 A;  5F5Y A;  2XFT A;  1SHV A;  4OQG A;  3RXW A;  5EUA A;  1ZTU A;  4BL2 A;  2X71 A;  1E4D A;  3VMA A;  3BFD A;  2V9A A;  5A91 A;  5FQI A;  3DAV A;  1FIL A;  1H8Z A;  1ZG6 A;  4MLL A;  3UB6 A;  1OJG A;  3Q7Z A;  3V39 A;  5DF8 A;  3EWK A;  3MZF A;  4LRZ E;  3VP1 A;  3VV4 A;  1PFL A;  4WBG A;  5HWV A;  4WL9 A;  1N9L A;  1D06 A;  1GSX A;  1TS6 A;  2PR5 A;  3LYX A;  3TSG A;  3TW8 A;  1XA7 A;  3QP2 A;  3UDX A;  3SW1 A;  4PM5 A;  2XDM A;  2ZOI A;  5GLD A;  3HLC A;  4NKP A;  4R3A A;  2M7U A;  2WAF A;  2Y2G A;  2OOL A;  4EET B;  1MKI A;  2ZQA A;  2UWX A;  4BL3 A;  4EXO A;  2JKG A;  4ETX A;  3WRT A;  2ZD8 A;  1UGU A;  3T1Q B;  3F1O B;  4P6B A;  1KVL A;  2PBD P;  2JC7 A;  2P7J A;  4S2O A;  1SKO A;  2BTF P;  2QJ5 A;  3SH9 A;  4BJP A;  4NXE A;  1G28 A;  4KQR A;  4R1G A;  3G2Y A;  1PWG A;  1OME A;  4ZDX A;  2V1B A;  1MPL A;  3VFH A;  2JKF A;  1JTG A;  2QWS A;  5CTM A;  3SZT A;  5L8M A;  3FC7 A;  4S2K A;  5M1A A;  3HUM A;  4EEP A;  4EU0 A;  3HLE A;  4JBF A;  1K57 C;  4QHC A;  5J8X A;  2VX8 A;  4I39 A;  2ZMA A;  2Y2Q A;  1H5X A;  4F94 A;  4JGR A;  4L9E A;  2GZA A;  1CJF A;  4O8G A;  5EVI D;  3G6O A;  5DJT A;  3IWO A;  1SKO B;  2WUQ A;  2HDS A;  1BLH A;  1VQQ A;  3T50 A;  3CAX A;  2D01 A;  4LV0 A;  1YLW A;  3Q1F A;  1PZP A;  3D9Y A;  2PU2 A;  3NDG A;  3NCK A;  4II7 A;  2PDR A;  2Y2M A;  4BBU A;  4ZTK A;  3EQV A;  5FQK A;  1OTB A;  2Z2L B;  3CPT A;  1JWV A;  1IEM A;  2WKE A;  1P9R A;  2P08 A;  1V9Y A;  3OPR A;  1L0F A;  3LID A;  4CQH A;  4OOM A;  4HES A;  1IYS A;  2XA7 S;  1JWP A;  3UPO A;  2FZ0 A;  3U4L P;  1TS8 A;  3MQQ A;  3QP6 A;  2PYP A;  3IWQ A;  1D1J A;  3PBS A;  2Y2O A;  5CED A;  1T1A A;  2VZW A;  2H5S A;  1OJ5 A;  2G7U A;  2WGI A;  1BZA A;  3OPL A;  3EEA A;  3OC2 A;  1CI8 A;  1P97 A;  3CPT B;  1FCN A;  3IXB A;  3P01 A;  1S66 L;  4S2N C;  1XP4 A;  1K54 A;  3DBA A;  3S7P A;  3G4P A;  5FI6 A;  2PBY A;  2J9O A;  5CRF A;  4UAA A;  2B95 A;  4O01 A;  4JXS A;  2H0T A;  2ZQC A;  4KG5 A;  1OTI A;  1AWI A;  2O0Y A;  3LEQ A;  4HY8 A;  3ZVW A;  2XQZ A;  2P74 A;  4BMW A;  2IA2 A;  4NET A;  5TFQ A;  1LSX A;  3LO7 A;  3CWF A;  5EOE A;  4JF6 A;  2OV5 A;  2ZJ9 A;  3HLW A;  4IVK A;  3S1Y A;  4UA9 A;  1TS7 A;  3I7J A;  3ZNY A;  2PAV P;  4Y13 A;  2WYX A;  5L10 A;  2OAP 1;  2Y55 A;  3IWI A;  2VGL S;  1CEF A;  3TE8 A;  3G34 A;  5EVI C;  3UY6 A;  3OZH A;  1SKF A;  4P6Z M;  2H28 A;  4I3A A;  3BEC A;  1S6R A;  3WRZ A;  2B18 A;  4WYY A;  1S4S A;  4E3I A;  4LCM A;  3HUO A;  4Y7P A;  1XKZ A;  3ZHH A;  4ID4 A;  5EE8 A;  1BYW A;  3MF0 A;  3GSG A;  3UE3 A;  1ERO A;  5HWW A;  2W1T B;  4X25 A;  5FAT A;  3RXX A;  3LCE A;  2HP9 A;  3R7W A;  1YQS A;  3CG5 A;  2ZM8 A;  3IF6 A;  2GDN A;  5KMW A;  2K2N A;  3DW0 A;  3HLF A;  3A0R A;  1MWU A;  4IBX A;  5TR7 A;  5DJU A;  2J9P A;  4C6Y A;  4CLC B;  3IX8 A;  3BFG A;  4HHD A;  1KE0 A;  5F1F A;  1PZO A;  4JGQ A;  3QP4 A;  4P87 A;  3S7N A;  4QJG A;  3GTC A;  3GV9 A;  3DTI A;  4GOG A;  4EWF A;  1G5U A;  4BBT A;  5J4E A;  3VP0 A;  4DXB A;  3MMH A;  5FEF A;  2WKQ A;  4E3J A;  1S67 L;  1GHM A;  3A0S A;  1K25 A;  3OOV A;  2PYR A;  1BUL A;  3K3C A;  3IF6 B;  1RP5 A;  4R4S A;  2V20 A;  4S2L A;  4WLA A;  4ZJ1 A;  2OWJ A;  4Y5F A;  4UQI M;  4YWZ A;  4O7D A;  4OLD A;  5HD5 A;  4CLC E;  2JKR M;  3HBR A;  4DE0 A;  3HJI A;  4RQ9 A;  1YLZ A;  4OQ0 A;  2ZC7 A;  1T1C A;  2L1M A;  4PAU A;  3IBR A;  2QMI A;  1TEM A;  4LV2 A;  1D7E A;  4GD6 A;  3UB8 A;  4LCL A;  3NY4 A;  4UA7 A;  3GQZ A;  5DKK A;  3LY3 A;  2C6W B;  4QU3 A;  3UME A;  2J3T D;  2WZZ A;  2INW A;  3FYZ A;  5HL1 A;  1ESI A;  3CZD A;  1XJ4 A;  5C5K A;  2GX5 A;  4IJG A;  5FAQ A;  3WS4 A;  1S1Y A;  2B02 A;  1YM1 A;  5CGS A;  4S2M A;  2GJ3 A;  2EXB A;  3VP2 A;  3LR0 A;  3HLB A;  1GA9 A;  2Z6C A;  5FAO A;  2EWV A;  5IHV A;  3KSH A;  4DN0 A;  2ZMV A;  5FQJ A;  5A92 A;  5HAP A;  4LFU A;  3BEB A;  1DP9 A;  5EFW A;  3MQ0 A;  3OPH A;  1I2W A;  2J8Y A;  5EPH A;  1W7F A;  5CEB A;  3CLO A;  1WYC A;  3GDI A;  1PWD A;  3EOI A;  3MZE A;  1L0G A;  3NUL A;  3MKF A;  3N8R A;  4HH3 A;  2VV7 A;  3ULF A;  4WF0 A;  1EW0 A;  4BEN A;  1XXM A;  2ZOH A;  1IYP A;  3IHB A;  3A3F A;  1SDN A;  3T4L A;  3N8S A;  2Y2P A;  1NZU A;  2AVX A;  4HBT A;  2XFS A;  4Y15 A;  3NOU C;  1F9I A;  3NOT C;  3TOI A;  4MEZ A;  4DKI A;  2EA9 A;  3T1R A;  4NG2 A;  4LRY C;  2XGN A;  2IWC A;  2R9W A;  2W3F A;  4X56 A;  4OLG A;  2MJ6 A;  3JPU A;  2XEP A;  4FUW A;  4KG6 A;  5L07 A;  3O3V A;  3WS1 A;  4WEK A;  1MWR A;  5DTT A;  1QMF A;  1Y54 A;  1NRJ A;  1NXY A;  4DJ3 A;  3A3J A;  1EI5 A;  5AQB A;  2OAQ 1;  4IBR A;  2YKF A;  4S2J A;  4B4Z A;  1LL9 A;  4DE2 A;  3BQA A;  1PI5 A;  2G2W A;  3G31 A;  3IHA A;  5FSR A;  5HDC A;  4OOL A;  4HJ3 A;  1K55 A;  3IF5 A;  1DP6 A;  5A93 A;  3V3S A;  4WZ4 A;  2BG1 A;  3FKW A;  2VEA A;  1YLT A;  2OWH A;  3K2N A;  3P7N A;  1BLS A;  1VET A;  1OTA A;  2J3T C;  3BRM A;  4DF6 A;  4JXG A;  4KZA A;  3ZNT A;  1KDS A;  4EW7 A;  5F82 A;  5I5L A;  4Y0U A; 
#chains in the Genus database with same CATH homology
 3MJQ A;  5AVF A;  3CUE A;  1MKM A;  5HSQ A;  3T50 A;  3CAX A;  2D01 A;  4Q0I A;  3CIT A;  4DJ2 A;  1YSP A;  4F3L A;  4JGO A;  2WKR A;  2D02 A;  1OTE A;  4I3I A;  4MN7 A;  2W27 A;  4II7 A;  4HIA A;  4Y2F A;  1S4R A;  4UEY A;  2PDR A;  3E4Q A;  2PD8 A;  4BBU A;  1T18 A;  1STZ A;  1GSV A;  3B33 A;  3EQV A;  4LRX C;  4MN5 A;  5J3W A;  1OTB A;  4GS9 A;  3F1O A;  2P04 A;  4K08 A;  2KX6 A;  2KDK A;  4GHI B;  3BW6 A;  3FPV A;  2ZMF A;  3GEC A;  3NHQ A;  3NOP C;  1P9R A;  4IHQ A;  3JVU A;  2FH5 A;  1UWP X;  2P08 A;  3LR5 A;  3FPW A;  1V9Y A;  2WKP A;  4UQI S;  3CUE C;  3LID A;  4CQH A;  4OOM A;  3H7W B;  4O0P A;  2XA7 S;  3C30 A;  2FZ0 A;  3K3D A;  1TS8 A;  3MQQ A;  3H82 A;  2PYP A;  5HL6 A;  3F1N A;  3PBS A;  1ODV A;  3KYZ A;  2W3H A;  4F3L B;  5AVE A;  4BWI A;  1T1A A;  2K31 A;  2VZW A;  4M4X A;  4Q0H A;  4YOF A;  1OJ5 A;  3LR3 A;  4Y3I A;  5DFY A;  3VE4 A;  2G7U A;  3PHY A;  2KLI A;  3C38 A;  3EEA A;  5J7E A;  2J80 A;  3RH8 B;  1G6O A;  3EEH A;  3OC2 A;  1W63 M;  1P97 A;  4GS9 B;  3UMD A;  1F5M A;  3P01 A;  1S66 L;  3B42 A;  5F69 A;  1P9W A;  2PHY A;  3HCY A;  5MC7 A;  3B47 A;  3DBA A;  3S7P A;  1TF1 A;  3R7W B;  5G4Z A;  3RTY A;  3T4K A;  4DMZ A;  3MXQ A;  4IUK A;  4KUK A;  4O01 A;  3LIF A;  2LB9 A;  3KX0 X;  2W3E A;  5IT5 A;  5HD3 A;  3PXP A;  3ICY A;  3T4Q A;  3BY9 A;  3H82 B;  3JVV A;  4MCW A;  1OTI A;  4B9O A;  3F1N B;  4R38 A;  3PBT A;  2O0Y A;  1GSW A;  1IFQ A;  2K7S A;  4HY8 A;  1MZU A;  1MC0 A;  3TRC A;  3OCN A;  3S7O A;  2M1C A;  4BMW A;  2Y79 A;  1S1Z A;  2IA2 A;  5K5B A;  1N9O A;  1LSX A;  3CWF A;  1TD5 A;  1XJ2 A;  1NLY A;  3KSG A;  4HJ6 A;  1TS7 A;  3KO6 A;  4XT2 A;  5KIZ A;  4FSF A;  4GLQ A;  1UWN X;  2OAP 1;  3LR4 A;  1TS0 A;  4L9G A;  4EEU A;  2VV8 A;  4NEE D;  2VGL S;  3TE8 A;  2CMN A;  1LSW A;  3HJK A;  3O5Y A;  1XFN A;  2V0W A;  4LPZ A;  4P6Z M;  2H28 A;  1VHM A;  4I3A A;  4R70 A;  5A8B A;  5DF9 A;  2HF6 A;  2VA0 A;  3OLO A;  4L0L A;  1Y28 A;  1KOU A;  2B18 A;  5CX7 A;  1S4S A;  5AJG A;  3RFB A;  3T4S A;  2M7V A;  1JNU A;  3PR6 A;  4IUH A;  2QYB A;  4HI4 A;  1BYW A;  3MF0 A;  4FOF A;  3UE3 A;  4HNB A;  5HWW A;  2L0W A;  2QHK A;  3UE6 A;  2W1T B;  2VV6 A;  1LL8 A;  4CLC D;  4G3W A;  3R7W A;  2VLG A;  4L9F A;  3EGX C;  4H6J A;  3T4T A;  3BJN A;  4MDZ A;  4MMN A;  2K2N A;  4XT2 B;  4ME4 A;  4LLO B;  5HDS A;  3LFV A;  1H3Q A;  4Q0J A;  4AFI A;  2VKS A;  3A0R A;  3OCL A;  4ETZ A;  5DJU A;  1XFQ A;  2V1A A;  5IS1 A;  4CLC B;  5LBR A;  5HZH A;  3C8C A;  3BY8 A;  1XJ6 A;  2JHE A;  4HHD A;  2HV1 A;  3EQU A;  3IS2 B;  5F68 A;  5KSH A;  2JKT I;  3PBN A;  3FG8 A;  4JGQ A;  4JGP A;  2VJW A;  3S7N A;  3E98 A;  3MFX A;  1P0Z A;  2R78 A;  3MR0 A;  4G3V A;  1ZHH B;  4BBT A;  4KQD A;  5J4E A;  4ZRR A;  2PR6 A;  3EGD C;  3PBR A;  3MMH A;  2LB5 A;  2WKQ A;  4HH2 A;  3E4P A;  1S67 L;  3A0S A;  1LSV A;  3OOV A;  2PYR A;  4HOI A;  4H6J B;  3K3C A;  2A2L A;  1WA9 A;  1YKD A;  4WN5 A;  2V0U A;  2QKP A;  2QJ7 A;  2Y8H A;  4GCZ A;  3IBJ A;  3LIB A;  4WLA A;  1X0O A;  2DMW A;  2OWJ A;  1VB6 A;  4Y5F A;  2I9V A;  4GJ4 A;  2O9B A;  4UQI M;  4YWZ A;  3UB9 A;  2W1R A;  3S7Q A;  2W3D A;  5HD5 A;  4CLC E;  2JKR M;  2GNX A;  5DFX A;  2J3W A;  3HJI A;  4RQ9 A;  3LIC A;  3PYP A;  1T1C A;  1W63 Q;  2L1M A;  2W1T A;  4PAU A;  3IBR A;  4KQO A;  1D7E A;  3T4O A;  3UB8 A;  4PKY G;  4WUJ A;  4EUV A;  5HPI A;  2JKR I;  2HJE A;  2Z6D A;  3W2Z A;  5DKK A;  3E0Y A;  1DRM A;  4QPR A;  4WEJ A;  4WEL A;  4CLC A;  3UME A;  2J3T D;  2INW A;  3IS2 A;  1DP8 A;  4I38 A;  3MQO A;  2ZBB A;  4HQA A;  1XJ4 A;  5C5K A;  2GX5 A;  4R6L A;  3LI8 A;  1T19 A;  5DKL A;  3VE3 A;  2YKH A;  4IJG A;  1OPX A;  3LUQ A;  2XRO A;  4EER A;  3UB7 A;  1S1Y A;  2B02 A;  5F5Y A;  2XSS A;  3D3O A;  2GJ3 A;  3LR0 A;  2HJ9 C;  5TJJ A;  3D72 A;  1ZTU A;  2Z6C A;  1V9Z A;  4PKY A;  2EWV A;  3BWL A;  4B93 A;  1LT0 A;  3KSI A;  3KSH A;  4DN0 A;  2ZMV A;  2HGV A;  5EFW A;  1DP9 A;  2V9A A;  3MQ0 A;  3OBF A;  1NWZ A;  4CLC C;  1OT9 A;  1OTD A;  1T1B A;  3KSF A;  3CLO A;  2JKT M;  3GDI A;  3EOI A;  3UB6 A;  1OJG A;  5TBM B;  2O99 A;  2BAS A;  1H8M A;  3EWK A;  1YAX A;  4LRZ E;  3CI6 A;  3H9W A;  3KYQ A;  3VV4 A;  5HWV A;  4HH3 A;  2VV7 A;  2VGL M;  1N9L A;  4I3J A;  4WF0 A;  4WL9 A;  5G4Y A;  3U2A A;  3ULF A;  1D06 A;  1GSX A;  4PHT A;  1TS6 A;  1EW0 A;  4MN6 A;  2PR5 A;  2ZOH A;  3LYX A;  1IOU A;  2A24 A;  3ZYT A;  4EQ1 A;  5HPF A;  3TW8 A;  4I5S A;  3SW1 A;  1XJ3 A;  3T4L A;  3LIE A;  2ZOI A;  3LI9 A;  2KOI A;  4ARZ A;  3BQ8 A;  3NOU C;  4NKP A;  4R3A A;  1F9I A;  3NOT C;  2M7U A;  2OOL A;  3V67 A;  4EET B;  4KUO A;  3F1P A;  5HWT A;  2EA9 A;  1YSQ A;  5F6A A;  4EXO A;  2L4R A;  4ETX A;  2O9A A;  1OT6 A;  3NJA A;  2O9C A;  4LRY C;  3R4K A;  2W3F A;  1UGU A;  4Z1W A;  2MJ6 A;  3F1O B;  4HP9 A;  4BBV A;  4HJ4 A;  3A0V A;  4WEK A;  4E04 A;  2P7J A;  4P6Z S;  4YNR A;  2EWW A;  2PD7 A;  3VOL A;  3E4O A;  2QJ5 A;  2XA7 M;  3ZQ5 A;  1NRJ A;  4BJP A;  4NXE A;  4DJ3 A;  5FL3 A;  1G28 A;  2JN7 A;  2OAQ 1;  2NUP C;  2V1B A;  2NUT C;  2YKF A;  3BQA A;  4NXG A;  2QWS A;  5IU1 A;  2A24 B;  4NXF A;  5L8M A;  2W0N A;  2W3G A;  3FC7 A;  5HDC A;  4OOL A;  4NXB A;  4HJ3 A;  1N9N A;  4EEP A;  4ARZ B;  4EU0 A;  1DP6 A;  2XRN A;  3TJZ C;  3LIA A;  4GHI A;  3T4J A;  2VEA A;  2OWH A;  3K2N A;  5TBM A;  3P7N A;  1NLZ A;  4HP4 A;  3F1P B;  2VX8 A;  4I39 A;  3PBQ A;  3PBO A;  4JGR A;  1F98 A;  4L9E A;  2GZA A;  4EES A;  1OTA A;  2J3T C;  4O8G A;  5HDD A;  3H7W A;  3G6O A;  5DJT A;  4EW7 A;  2PT7 A;  5I5L A;  4GW9 A;  3C2W A;  4G3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...