3F1PA

Crystal structure of a high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
b'FKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endothelial PAS domain-containing protein 1
publication title Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3f1pA00
3D72A 4I3JA 1D7EA 2V1AA 3F1NA 2A24A 1UWPX 3A0RA 4EERA 3ICYA 3LIBA 3VOLA 4HQAA 2YKFA 3LI8A 4HJ3A 4JGQA 4H6JB 3UB7A 2HV1A 4EETB 3H7WA 2V9AA 3G6OA 2A24B 1XJ2A 2PD8A 5F68A 2WKPA 3ZQ5A 2V0WA 3H7WB 5HWWA 4WLAA 3CAXA 3FC7A 3MXQA 2R78A 3UB8A 5DKLA 2OWHA 1JNUA 4YWZA 4NXBA 4PKYG 2JN7A 4M4XA 2ZBBA 1TS0A 4K08A 3UMEA 5HD5A 4KUKA 1UGUA 3LIEA 3E4PA 3CWFA 5DJTA 1N9LA 1S1ZA 3H82A 4WL9A 1LSXA 4R3AA 1N9OA 1DP8A 4F3LA 1N9NA 2YKHA 5DKKA 1S66L 2KX6A 2WKRA 1DP6A 1XJ4A 2VEAA 3T50A 1XFQA 5IU1A 1MZUA 3PHYA 4F3LB 2L4RA 5HZHA 5HWVA 5HDCA 4B9OA 4HY8A 3SW1A 4XT2A 3PYPA 5J4EA 5F69A 1S4RA 3LIAA 1TS7A 4HJ6A 4GHIA 1WA9A 2QKPA 2ZOIA 4LRXC 2L1MA 4BBVA 4EXOA 4GS9B 4GHIB 2VV6A 1GSXA 5G4ZA 4EESA 4WUJA 1OT9A 3NOUC 2VLGA 1XJ6A 3F1NB 4DJ2A 4HP9A 4LRZE 3P7NA 3IS2A 3LIDA 3MJQA 4NXFA 4R6LA 5G4YA 1LSVA 4I5SA 4HHDA 2L0WA 5DJUA 3LI9A 2PD7A 3FG8A 4DJ3A 1Y28A 4LLOB 5AVEA 2QJ7A 4GCZA 4L9GA 1T19A 1S67L 3A0VA 4HI4A 3EWKA 1ODVA 1OT6A 4KUOA 5F5YA 1TS8A 3VE4A 2INWA 3MQOA 4I39A 2Z6DA 5TBMA 4BBUA 5AVFA 1UWNX 3F1PA 3HJKA 1LL8A 3UB9A 2J80A 4MN5A 1OTIA 4I3IA 2PYRA 1S4SA 2BASA 1BYWA 4BBTA 3NOTC 1LT0A 4GW9A 3MR0A 2H28A 2K7SA 3LUQA 1VB6A 3H82B 4NXEA 5KIZA 4HIAA 1DP9A 3RH8B 1X0OA 2PR5A 1OTBA 1XFNA 1OTDA 1V9YA 1GSWA 3C8CA 3E4OA 3HJIA 5HDDA 1KOUA 4HNBA 4RQ9A 4HP4A 5F6AA 1GSVA 1T1AA 2QWSA 2CMNA 3ULFA 2OOLA 1XJ3A 2Z6CA 3E4QA 3BWLA 3C2WA 4XT2B 4NXGA 3LYXA 1V9ZA 5HWTA 4LRYC 5IS1A 1OTEA 1OJ5A 2V0UA 2PR6A 4H6JA 2W0NA 3UB6A 1D06A 1TS6A 4PKYA 2QHKA 2EA9A 1G28A 2VV7A 5HD3A 2JHEA 4LPZA 4EEUA 1LSWA 5I5LA 1P97A 2M1CA 3EEHA 4HH3A 1F9IA 2OWJA 5HDSA 2D02A 1T18A 4EW7A 3IS2B 3GDIA 2KDKA 4L9EA 3F1OA 3UE6A 4E04A 4EQ1A 2WKQA 4KQDA 5J7EA 3VE3A 2PDRA 3K3DA 3KX0X 4HJ4A 1P0ZA 3NOPC 3F1OB 4WF0A 2QJ5A 2D01A 4JGPA 4WN5A 2V1BA 3MFXA 4JGOA 5TBMB 3K3CA 3F1PB 2B02A 4HH2A 3RTYA 1OTAA 2ZOHA 3BY9A 3NJAA 4EEPA 5A8BA 2I9VA 4I38A 5HSQA 3UMDA 2VV8A 3LICA 3CLOA 3GECA 3IBRA 4L9FA 3MQQA 4R70A 3OLOA 4HOIA 1F98A 3NHQA 3B33A 1OJGA 2PHYA 4I3AA 2PYPA 1T1CA 5J3WA 3LIFA 3H9WA 3BY8A 2W27A 1EW0A 1DRMA 3A0SA 2P7JA 1T1BA 5EFWA 1NWZA 1S1YA 2GJ3A 4GS9A 4MN6A 4R38A 4JGRA
chains in the Genus database with same CATH superfamily
1KGEA 3A3JA 4QJGA 3UNWA 4C75A 1D7EA 2V1AA 3UN7A 1KE4A 3ICYA 3VOLA 1K54C 4RYEA 4JGQA 5U47A 3VP2A 3E2LA 4EETB 5E2GA 1ZTUA 2V9AA 1SKOB 3DAVA 3ZG0A 5AQ7A 2XD1A 4JXVA 3TRCA 4EU0A 2HGVA 5EVID 1S0WA 1C3BA 4FD8A 5HAIA 1YPRA 3ZQ5A 4DE1A 3G32A 2DRWA 3HLCA 3NIAA 1HZOA 4EBLA 4WLAA 3CAXA 1J9MA 1K4EA 3N7WA 5DKLA 3PAGA 4NXBA 3S7PA 4N9KA 3IF6B 2FH5A 1K56A 2J7VA 2JBFA 4LGWA 3PXPA 3E4PA 3MZEA 5HPFA 2Y2LA 4RX3A 1S1ZA 4WL9A 3TJZC 4E3IA 1JWVA 1N9OA 3WS0A 4F3LA 4ETXA 5DKKA 5A93A 2WGWB 4BL2A 3W2ZA 4IUHA 5G18A 3AGDA 1MKIA 4EBNA 1H8ZA 1FILA 3SH7A 3U2AA 5CRFA 3PHYA 4F3LB 1G6OA 3S7OA 3BW6A 2ZC6B 3W4OA 2HPBA 4B93A 4B9OA 4HY8A 4XT2A 4UQIM 1S6RA 5J4EA 1FIKA 2W3FA 4WEJA 5FDHA 4Q8IA 1WA9A 4JXGA 2Y8HA 3RXXA 2ZL1A 1HVBA 3FYZA 4G3KA 3CG5A 2HDSA 5HW3A 4LRXC 5FQJA 3G35A 1NYMA 3IH9A 4BBVA 1VETB 5EOOA 4KQOA 3NCKA 3FKVA 3R7WB 3NOUC 4DDYA 3UDXA 1XJ6A 2AVXA 2ZC7A 1P9RA 3IS2A 4BD1A 4PAUA 2EX8A 2VJWA 4NXFA 4PM7A 3UE0A 1LHYA 4YOFA 1BUEA 1W8YA 4JF5A 4LLOB 5AVEA 3NULA 2QJ7A 3K2NA 1T19A 5GLCA 4U3TA 3BLSA 2WYXA 3VP0A 4Y5FA 1OT6A 1F2KA 5KSCA 2ZQDA 4MBHA 4OPRA 4KUOA 3CUEA 4Y17A 1ESIA 2WKEA 3MQOA 5TBMA 1BTLA 3GSGA 1MPLA 3E2KA 4ARZA 1HTZA 1LL8A 3IXGA 1YMSA 2XA7M 4S2IA 4QU3A 4MN5A 4I3IA 1XP4A 2IWCA 4Q0IA 1QMEA 5HFOA 5FSRA 2DNSA 1IKGA 4GW9A 4FH4A 4ARZB 1YMXA 5HAPA 3Q81A 4CJNA 3WWXA 2ACGA 3H82B 2EX6A 4IBRA 5DVAA 3TW8A 1E4DA 3EQUA 1YLZA 2XD5A 4YNRA 1DP9A 3WS4A 2WKIA 1OTDA 5F83A 1V9YA 3C8CA 5CX7A 2ZM8A 3HJIA 4O0PA 3SS4A 3V67A 4UA6A 4HP4A 3S22A 2QWSA 1NJ4A 2CMNA 4BLMA 2K31A 5GLBA 3S7QA 3KYZA 2J3TC 5AQBA 4WZ4A 1XJ3A 2EX9A 2Z6CA 2G2UA 3E4QA 5EM0A 1NZOA 3HL9A 3DBAA 4GZBA 4X25A 3KSGA 3A3EA 4MDZA 2PR6A 3UB6A 1D06A 5GL9A 2QHKA 3GRJA 3OOVA 1BSGA 2VV7A 4A5RA 1JTDA 4LPZA 5BOHA 4G3WA 1YQSA 2EWVA 3MS6A 2ZC4B 4GN2A 5I5LA 3CUEC 1P97A 3EEHA 3ZG5A 2HJEA 4IVKA 1HD8A 2J3WA 4N1XA 3B3XA 3SH8A 2D02A 3OC2A 3GDIA 4E04A 3IX3A 2Y2KA 2PU2A 2GZAA 2XGNA 4KZ7A 2XA7S 2PDRA 4DRTA 5KSHA 3TG9A 3MQ0A 3NOPC 4WF0A 5JYOA 2D01A 3WS2A 5A91A 4MN7A 5L8MA 2V1BA 3DTMA 2XLNA 4JGOA 4E3MA 3WS5A 3C7UA 5FQMA 4MEZA 3K3CA 2B02A 2EXAA 1CK3A 3CITA 3IWOA 3RTYA 1MC0A 2EFXA 3ZVTA 1STZA 1VEUA 5J8XA 3IXDA 2JKTM 3NJAA 4C6YA 2I9VA 5A92A 2H5SA 3UMDA 1PFLA 3LICA 3IBRA 4R3JA 4OH0A 4QY6A 4BL3A 3MQQA 2Y2MA 1WE4A 2FFYA 3Q07A 2O9CA 4Y0TA 1KVMA 4K0XA 2PHYA 1RCJA 1K0KA 4OP8A 2PYPA 3TE8A 3GQZA 1YKDA 2XQZA 1Q2PA 3IHAA 4FH2A 4OPYA 1NRFA 1NY0A 2Y2JA 4NETA 1NWZA 3HREA 4CLCD 1IYPA 4C3QA 2PT7A 2P9VA 3G34A 1PI4A 2HZ5A 2W3EA 4MBKA 1TEMA 3D72A 3FPVA 2OAP1 3F1NA 2WZZA 2A24A 5FATA 3MXSA 4UEYA 1ES5A 3C4OA 4HQAA 2YKFA 3LI8A 5DTSA 3ZG7B 2ZLYA 2P9VB 3IXHA 3H7WA 3G6OA 4OVDA 4L0LA 2A24B 5IHVA 2ZM2A 4WMCD 3EGXC 1PZOA 2O9BA 3P01A 3VV4A 5F1FA 2H0TA 2JE5A 3H7WB 1K54A 4KZ9A 1CEFA 2ZC5B 1DY6A 4IHQA 3M6HA 2X71A 4B88A 1FCOA 3V50A 3BEBA 2Y4AA 4PKYG 1PRQA 4FSFA 2EWWA 1PZPA 1W79A 1XA7A 3MBZA 1TS0A 4IBXA 4K08A 4M3KA 3BFGA 3VFFA 3T1SA 3HBRA 2FZ0A 3HLEA 4JXSA 2XK1A 3GVBA 2W1TB 5L09A 3CWFA 1N9LA 3N8RA 2Y2HA 5E43A 2J8YA 3OPHA 3ZFZA 1IKIA 1WYCA 1LSXA 2VGJA 4R3AA 2B5RA 4HEFA 4PMAA 5I94A 1BULA 3W8KA 3D3OA 4EUVA 2YKHA 1S66L 2KX6A 3G4PA 1XJ4A 1FSYA 5M19A 3AGEA 1H3QA 3T50A 3ZNYA 5IU1A 4CLCE 5CGSA 5DTKA 4E3LA 2L4RA 3NBLA 5CHMA 3HLBA 4NK3A 1FCMA 4PM9A 5TJJA 2HF6A 3VP4A 2HDRA 4HBTA 1K38A 1W5DA 3M2KA 4KZ4A 3MFDA 1Z09A 3UO9A 3PYPA 2JC7A 5K5BA 4X68A 4HJ6A 5DF9A 4GHIA 2JKRM 3L9KA 4KZAA 1NYYA 3QHYA 4LCMA 1TDLA 1SKFA 3BQAA 1IOUA 4EXOA 4GS9B 3OCNA 1IYOA 5HX9A 3O3VA 4GHIB 2V8CA 5KMWA 3M6BA 1SCWA 1ZHHB 4P0MA 1H8YA 4LRZE 3DWKA 4XXRA 2EXBA 3CI6A 4X69A 1LSVA 1L3LA 1EWZA 5DJUA 3MXRA 2PD7A 3IBJA 2R9WA 1Y28A 1L0GA 4PM6A 2JCHA 5EV0A 4GCZA 4L9GA 2P04A 3JPUA 2Y2PA 3A0VA 4HI4A 1ODVA 4P85A 4ZTKA 2WAFA 4GD6A 3PBQA 1BT5A 4UA9A 3QNCA 4WM9A 1ERMA 5GLDA 1KGFA 2Z6DA 1I2SA 4BBUA 1UWNX 5HL1A 4KG2A 3FZCA 1SZVA 3MZDA 2HP5A 2PBYA 2X01A 1VQQA 1OTIA 4DMZA 4GD8A 4DE3A 2PYRA 4P6BA 1K55C 4X1MA 3NOTC 3BFFA 2V1ZA 3MR0A 3DWZA 1E3UD 3BFCA 2C6WB 3T4SA 1GA0A 3A3IA 2BG1A 1GCEA 4GB7A 5EVIC 2PRFA 5FI6A 3HLWA 5FI2A 4LV3A 3SH9A 1CF0A 4OOYA 2PR5A 1XFNA 3PAEA 1GSWA 1G68A 3E4OA 2O9AA 5HDDA 3MKEA 1PW8A 4RQ9A 1O7EA 5CEDA 5FQIA 2Y2GA 1K56D 3LCEA 4ZBEA 3ULFA 5EOEA 2JKTI 2HP9A 4Y2FA 4MNRA 5HAQA 1YSQA 3QNBA 2WZXA 4JF4A 3SZTA 4XT2B 4KZ8A 1F5MA 1MWRA 3UPPA 3LYXA 4IEDA 4KQQA 4IUKA 3L7HA 4YFMA 2ZD8A 3IWIA 1XXMA 1OJ5A 2GDNA 4QY5A 3LEZA 4H6JA 4UHUA 4EUZA 5FASA 4MBFA 4S2LA 3BRMA 1HLUP 3T4OA 2ZL1B 4B4ZA 4FUWA 3HCYA 4Y15A 4BWIA 4LV0A 5HD3A 2QPNA 3ZNTA 2Y2IA 1LSWA 3LFVA 2M1CA 4II7A 4X55A 1FR6A 4HH3A 3GV9A 3IT9A 5EPHA 1T18A 3C38A 2XEPA 4OQGA 3IS2B 3S1YA 4S2KA 2KDKA 1GHIA 4L9EA 3F1OA 3T12B 4EQ1A 4DDSA 2R9XA 2WGIA 3QP5A 5J7EA 3FKWA 2RL3A 5GLAA 4WBGA 1LI9A 1CQAA 3OZHA 2J9PA 1PYYA 3NC8A 2A3UA 1P0ZA 2K2NA 2V8FA 3F1OB 3G31A 1K57A 2QJ5A 2Y91A 4JGPA 2ZQ9A 4WN5A 5GHYA 2Y2NA 5TBMB 2C5WB 2DMWA 4P87A 4ZJ2A 1SHVA 1OTAA 3IQAA 1FR1A 4QWOA 2QZ6A 2ZMAA 1RP5A 2WKHA 1LL9A 4EEPA 5A8BA 4I38A 3A3DA 3LR3A 5FI7A 2H10A 5CERA 3V5MA 4JKTA 4DE2A 3M2JA 1PWGA 4HOIA 5FEGA 1BLCA 4WYYA 3LGOA 4DF6A 5CECA 4ZRRA 4OQIA 4EWFA 5CEBA 4QD4A 1W7FA 2Y55A 3QP1A 4MCWA 1TVFA 2W27A 1EW0A 1ONGA 4K0WA 5GHXA 1S1YA 3RJUA 3C7VA 3MMHA 3WS1A 4R4RA 4R38A 4Q0HA 3VMAA 4WZ5A 5EE8A 3GTCA 4S2OA 5M1AA 1UWPX 4K91A 3KYQA 4EERA 3LIBA 4KZ5A 3ZHHA 4HJ3A 2Q9NA 4GNUA 4D2OA 1LL5A 3VOZA 1I2WA 2JKRI 1K57C 1JWPA 5F68A 2WKPA 5DTTA 1Y54A 3SS3A 3ZCZA 4KZBA 5HWWA 5LBRA 4X6TA 3NECA 5E2EA 3BLMA 2XFSA 1KDSA 1VHMA 1JNUA 3LR4A 2FFFB 4Y0OA 3RFBA 4M4XA 1YSPA 3UMEA 3NDEA 4S2NA 4XUZA 1G6AA 3CHWP 4FCFA 3IWQA 3BM6A 5DJTA 4QHCA 4BJPA 3G2ZA 2P08A 3QP8A 1DP8A 4KG5A 1A0KA 1SDEA 4CLCA 1PWDA 3LO7A 1N9NA 3LY4A 3O88A 4DKIA 1YLYA 1VEUB 1DP6A 1YLTA 1QMFA 1EROA 2KOIA 1MZUA 4EV4A 4WZ5C 2W3GA 5HZHA 2E8JA 2QYBA 2M7VA 5HWVA 5HDCA 3HUOA 3GR2A 3UB5P 1CJFA 1MKMA 4E3KA 1NLYA 3BFEA 3IF5A 5F69A 2EFUA 2G7UA 3LIAA 1IYQA 5JYPA 1TS7A 2XF3A 5CTMA 2QKPA 4DXBA 3BYDA 2WUQA 5FL3A 4E3NA 3FPWA 2L1MA 2XFTA 3UE1A 2WGVA 4R23A 4EESA 2VLGA 5DFYA 3F1NB 4DJ2A 1JVJA 3P7NA 3MJQA 3LIDA 5L07A 4OPZA 3S7NA 4OONA 4S2NC 4NG2A 3N8SA 4HHDA 2L0WA 4X56A 3LI9A 5IT5A 3HLDA 3FG8A 2HP6A 4DJ3A 4QPRA 1BLSA 1MBLA 3PBOA 3ZDJA 2A49A 4Z9QA 1S67L 3EWKA 4CLCC 5CXWA 3PBRA 1RGZA 1TS8A 5F5YA 2O99A 3VE4A 2INWA 1XGJA 3O86A 4JXWA 3OCLA 3F1PA 1NLZA 2J80A 2I72A 3VSKA 2XDMA 1BYWA 4BBTA 3MSHA 4Q0JA 2Q0OA 4GJ4A 1O07A 1N4OA 3EQVA 3PBTA 1W8QA 3A3FA 3RH8B 3D9YA 4DXCA 1X0OA 1OTBA 2VGKA 1FQGA 3DW0A 1N9BA 1K55A 4HNBA 4R4SA 3T1RA 1AWIA 4QB8A 2V2FF 3DTIA 1GSVA 1T1AA 4GDNA 4N9LA 3PBNA 5EVIA 1PI5A 4IJGA 4B4XA 3JYIA 4RVAA 1XX2A 1KGGA 3ZVWA 1FCNA 5CHUA 1YT4A 3NDGA 3BWLA 4WELA 3LR0A 2DCFA 5D3OA 5EVIB 1V9ZA 5HWTA 4EBPA 5IS1A 3KSIA 1OTEA 4OQHA 4BQMA 3MF0A 1KVLA 4IVIA 5MC7A 4N92A 1SKOA 2EA9A 1G5UA 4GOGA 3BQ8A 1MWUA 4ETZA 4EEUA 3FV7A 4D60A 2E8IA 2Q9MA 4Y7PA 2O0YA 4PM5A 2A2LA 4YINA 1F9IA 2OWJA 2ZM0A 2JKGA 3PBSA 4X1LA 2ZMVA 4R1GA 1E3UA 3TSGA 3UE6A 3Q82A 2LB9A 3MKFA 2WKQA 4FTXA 3IF6A 2JKFA 3UPNA 3PTEA 4HJ4A 1XKZA 4CPKA 1ES4A 2LB5A 3RXWA 4DN0A 4DE0A 4E3JA 3CJMA 3NY4A 4S2MA 5FA7A 1H5XA 3OPPA 3UDFA 3W4PA 5L10A 2EX2A 3VSLA 2UWXA 1ESUA 1XA1A 4HBUA 2ZOHA 2WGWA 4OOMA 3ZG9B 4LV2A 1YLWA 2GNXA 3PR6A 2HDUA 1ZKJA 1JTGA 5HSQA 2X02A 3GECA 4L9FA 1ZC2A 4R70A 1BLPA 3OLOA 1IEMA 1M40A 3T4JA 3QP4A 2H0YA 5TR7A 3NHQA 3B33A 2XR0A 2OAQ1 5DFXA 2PBDP 3ISGA 1NZUA 4H8RA 4CQHA 1ES3A 1T1CA 3H9WA 3BY8A 3DTEA 1I5QA 4LCLA 3C4PA 2VA0A 1DRMA 3KO6A 1MWTA 3A0SA 4OP5A 2M7UA 2P7JA 3JVVA 4Y13A 2XROA 5EFWA 2GJ3A 2HJ9C 2PAVP 4NKPA 1VETA 3UE3A 4MN6A 4JGRA 4X53A 2ZC3B 1ZG6A 2WADA 3R7WA 3T1QB 4I3JA 4E3OA 1YM1A 5M18A 1IFQA 1OMEA 3A0RA 3IF6C 4R3BA 1GHPA 4Y0UA 5CHJA 2ZQCA 5TGFA 4H6JB 2VX8A 3SS5A 4XUXA 3UB7A 2W3DA 2HV1A 1MY8A 5F82A 3AGFA 1Y4OA 1XJ2A 2J9OA 2PD8A 3U4LP 2PU4A 4JF6A 3IHBA 3UPOA 1L0DA 2V0WA 4RX2A 3SOIA 4PM8A 1K4FA 5E2HA 3FC7A 1ES2A 3MXQA 2R78A 3UB8A 3LY3A 3KSHA 5HARA 4JBFA 2OWHA 1L0EA 5FQ9A 4YWZA 2OSUA 3P09A 2JN7A 1KE3A 2HDQA 2XRNA 1YLJA 3HLFA 1P9WA 5CTNA 3HLGA 2ZBBA 2KLIA 2J3TD 5HD5A 4KUKA 1UGUA 3LIEA 1ONHA 1K25A 1PWCA 4F94A 4O01A 3Q7VA 3H82A 2MJ6A 2IWDA 3IXBA 3O5YA 3KYEA 3G2YA 1XGIA 3B47A 1NXYA 1KE0A 2WKRA 3BJNA 2Y59A 2VEAA 2NUPC 3Q7VB 3O87A 1XFQA 5EVLA 5AQAA 2IA2A 4R0QA 5EUAA 4UQIS 1WYBA 1ERQA 5DF7A 1Q2QA 1PIOA 2ZQ8A 2OLVA 4GKUA 5FEFA 1K6RA 2VGLM 3SW1A 4P6ZM 1D1JA 4ME4A 3CPTA 4BMWA 3LEQA 3V3SA 1S4RA 3W4QA 1Z6FA 4OPQA 1J3WA 4MLLA 1OPXA 5EM1A 1ZG4A 2ZOIA 3HVFA 3CPTB 4OOLA 4ZDXA 5HL6A 3EOIA 5CGXA 2ZQ7A 2VK3A 2VV6A 1GSXA 4UAAA 4S2JA 1L2SA 1DJCA 2BTFP 4GDBA 5G4ZA 3WRTA 4WUJA 1OT9A 1TDGA 3N6IA 1TF1A 1SDNA 4HP9A 5CGWA 2ZQAA 4ZJ1A 3CZDA 4R6LA 4ZJ3A 1AXBA 5G4YA 3E0YA 4I5SA 1L0FA 3TOIA 2VZWA 1VM1A 4U0TA 3B42A 4LENA 5F1GA 3DTKA 3IH8A 5A90A 3KSFA 5E2FA 4OKPA 1GHMA 5FAPA 1BLHA 4LFUA 2ZMFA 3ZGAB 1M6KA 1LLBA 4O8GA 4I39A 3E98A 3UDIA 2G2WA 5AVFA 3HJKA 3T4QA 1RGYA 2P74A 3UB9A 3FWLA 2ZJ9A 3UY6A 1S4SA 3WRZA 3ITAA 2BASA 2OLUA 1MWSA 4FOFA 3MZFA 1LT0A 1YLPA 2H28A 1PW1A 2VKSA 3VOYA 1TD5A 1ALQA 2XH9A 2K7SA 3LUQA 3JVUA 4S2PA 1VB6A 2Z2LB 4OLDA 4NXEA 2GX5A 3T4LA 4MMNA 5KIZA 4HIAA 4ZAMA 3C30A 2VGLS 2QMIA 4CLCB 3GMWA 4P6ZS 4PPRA 4KZ3A 1IYSA 4RA7A 1XPBA 3I7JA 2B18A 2BLSA 4O7DA 4WEKA 1KOUA 5F6AA 1CEGA 3BECA 2CC1A 3S4XA 2RCXA 5FDSA 4U0XA 4WMCA 3VP1A 2OOLA 5KZHA 1CI8A 4PHTA 3EEAA 3NI9A 1W63Q 2UV0E 3OPRA 3R4KA 3C2WA 4Y3IA 4NXGA 2WK0A 3G30A 1JWZA 2Y79A 3LR5A 4LRYC 4E6WA 3IX4A 3IX8A 1DJBA 2V0UA 4HESA 2W0NA 1TS6A 3ZYTA 4PKYA 1W63M 1G28A 2JHEA 3Q7ZA 3D4FA 1GA9A 3HUNA 1IELA 3V39A 4UA7A 3BFDA 5L2FA 5FQKA 3C5AA 4NEED 5TFQA 3QP6A 5HDSA 1CI9A 4ID4A 2OV5A 4ESPA 3VP3A 3EGDC 4EW7A 4JLFA 4LV1A 3V3RA 2Y2OA 3N8LA 4KZ6A 1H0MA 4JPMA 4KQDA 4Z1WA 5HPIA 3Q1FA 5GHZA 1K6SA 3VE3A 1H8MA 1KDWA 4KQRA 3K3DA 4EQIA 2WAEA 3HUMA 1EI5A 3KX0X 2V20A 2W1TA 3N4IA 1ACFA 3ITBA 1NRJA 2B95A 2XSSA 2Y2QA 1BZAA 1PNEA 3MFXA 4OQ0A 3T1XA 3F1PB 4HH2A 1DJAA 4OLGA 2NUTC 3CMZA 4N1HA 1U60A 3BY9A 2W3HA 3QP2A 4KENB 1LI0A 4GLQA 4E6XA 5EECA 3OPLA 3OBFA 2VV8A 2IWBA 1E25A 4KG6A 3CLOA 1YAXA 3P98A 5AJGA 1F98A 1OJGA 1FSWA 5FAQA 4I3AA 4AFIA 5DF8A 5J3WA 3LIFA 5EVEA 3T4TA 1MXOA 3ZG8B 1FOFA 4G3VA 4BENA 3T4KA 5AQ9A 2W1RA 3VFHA 5FAOA 5FQQA 1T1BA 5C5KA 4GS9A 4BD0A 2Z2MB
chains in the Genus database with same CATH topology
2PT7A 2W3EA 3R7WA 3D72A 4I3JA 3FPVA 1D7EA 2OAP1 2V1AA 1IFQA 3F1NA 2A24A 1UWPX 4UEYA 3A0RA 3KYQA 4EERA 3ICYA 3LIBA 3VOLA 4HQAA 2YKFA 3LI8A 4HJ3A 4JGQA 4H6JB 2VX8A 3UB7A 2W3DA 2HV1A 4EETB 3H7WA 1ZTUA 2V9AA 3G6OA 4L0LA 3TRCA 2A24B 2JKRI 1XJ2A 4EU0A 2PD8A 2HGVA 3EGXC 5F68A 2O9BA 2WKPA 3ZQ5A 3P01A 3VV4A 2V0WA 3H7WB 5HWWA 5LBRA 4WLAA 3CAXA 3FC7A 3MXQA 2R78A 4IHQA 3UB8A 3KSHA 5DKLA 2OWHA 1VHMA 1JNUA 4YWZA 4NXBA 3LR4A 3S7PA 4PKYG 2FH5A 2JN7A 4FSFA 2EWWA 2XRNA 3RFBA 1P9WA 4M4XA 2ZBBA 2KLIA 1TS0A 1YSPA 4K08A 3UMEA 2J3TD 5HD5A 4KUKA 1UGUA 3LIEA 2FZ0A 3PXPA 3E4PA 2W1TB 3CWFA 5HPFA 5DJTA 4BJPA 1N9LA 1S1ZA 4O01A 3H82A 2MJ6A 4WL9A 3TJZC 1LSXA 4R3AA 1N9OA 3O5YA 2P08A 1DP8A 4F3LA 4CLCA 3B47A 3D3OA 1N9NA 4ETXA 4EUVA 2YKHA 5DKKA 1S66L 2KX6A 2WKRA 1DP6A 1XJ4A 3BJNA 2VEAA 3W2ZA 4IUHA 2NUPC 1H3QA 2KOIA 3T50A 1XFQA 5IU1A 1MZUA 4CLCE 2IA2A 3U2AA 3PHYA 4UQIS 4F3LB 2L4RA 2W3GA 1G6OA 3S7OA 5HZHA 5TJJA 3BW6A 2QYBA 2HF6A 2M7VA 5HWVA 5HDCA 1MKMA 4B93A 4B9OA 4HY8A 2VGLM 1NLYA 4XT2A 4UQIM 3SW1A 4P6ZM 4ME4A 3PYPA 5J4EA 4BMWA 2W3FA 5F69A 5K5BA 2G7UA 1S4RA 3LIAA 4WEJA 1TS7A 1OPXA 4HJ6A 5DF9A 4GHIA 2JKRM 1WA9A 2Y8HA 2QKPA 4G3KA 2ZOIA 5FL3A 4LRXC 3FPWA 2L1MA 4OOLA 3BQAA 4BBVA 5HL6A 3EOIA 1IOUA 4EXOA 4GS9B 3OCNA 4GHIB 2VV6A 1GSXA 4KQOA 5G4ZA 4EESA 4WUJA 3R7WB 1OT9A 1ZHHB 3NOUC 2VLGA 5DFYA 1XJ6A 3F1NB 1TF1A 4DJ2A 4HP9A 1P9RA 4LRZE 3P7NA 3IS2A 3LIDA 3MJQA 4PAUA 3S7NA 3CI6A 2VJWA 4NXFA 4R6LA 5G4YA 3E0YA 1LSVA 4I5SA 4HHDA 2L0WA 5DJUA 3LI9A 5IT5A 2PD7A 3FG8A 4YOFA 3IBJA 2VZWA 4DJ3A 1Y28A 4QPRA 3B42A 4LLOB 5AVEA 2QJ7A 3K2NA 4GCZA 3PBOA 4L9GA 1T19A 2P04A 3KSFA 1S67L 3A0VA 4HI4A 3EWKA 1ODVA 4Y5FA 1OT6A 4CLCC 2ZMFA 3PBRA 3PBQA 4KUOA 1TS8A 5F5YA 2O99A 3CUEA 3VE4A 2INWA 3MQOA 4O8GA 4I39A 3E98A 2Z6DA 5TBMA 4BBUA 5AVFA 3OCLA 1UWNX 3F1PA 3HJKA 3T4QA 4ARZA 1LL8A 3UB9A 1NLZA 2XA7M 2J80A 4MN5A 1OTIA 4DMZA 4I3IA 2PYRA 1S4SA 4Q0IA 2BASA 1BYWA 4BBTA 4FOFA 4Q0JA 3NOTC 1LT0A 4GW9A 3MR0A 4GJ4A 2H28A 2VKSA 4ARZB 3T4SA 3EQVA 1TD5A 3PBTA 2K7SA 3LUQA 3JVUA 1VB6A 3H82B 4NXEA 2GX5A 3T4LA 4MMNA 5KIZA 3TW8A 4HIAA 3EQUA 4YNRA 3C30A 1DP9A 3RH8B 2VGLS 4CLCB 4P6ZS 1X0OA 2PR5A 1OTBA 1XFNA 1OTDA 1V9YA 1GSWA 3C8CA 3E4OA 2O9AA 5CX7A 2B18A 3HJIA 4O0PA 4WEKA 5HDDA 1KOUA 4HNBA 3V67A 4RQ9A 4HP4A 5F6AA 1GSVA 1T1AA 2QWSA 3PBNA 2CMNA 4IJGA 2K31A 3ULFA 3S7QA 3KYZA 2JKTI 2J3TC 4Y2FA 2OOLA 1XJ3A 2Z6CA 3E4QA 1YSQA 4PHTA 3EEAA 1W63Q 3BWLA 4WELA 3LR0A 3R4KA 3C2WA 4Y3IA 4XT2B 3DBAA 1F5MA 4NXGA 3LYXA 1V9ZA 5HWTA 2Y79A 3LR5A 4LRYC 4IUKA 5IS1A 3KSIA 3KSGA 1OTEA 4MDZA 1OJ5A 2V0UA 2PR6A 4H6JA 3MF0A 2W0NA 3T4OA 5MC7A 3UB6A 1D06A 1TS6A 3ZYTA 4PKYA 2QHKA 2EA9A 3HCYA 3OOVA 1W63M 4BWIA 1G28A 2VV7A 5HD3A 2JHEA 3BQ8A 4LPZA 4G3WA 4EEUA 4ETZA 2EWVA 1LSWA 5I5LA 2O0YA 3CUEC 3LFVA 1P97A 3EEHA 2A2LA 2M1CA 4II7A 2HJEA 4NEED 4HH3A 1F9IA 2OWJA 2J3WA 5HDSA 3PBSA 2D02A 1T18A 3EGDC 3C38A 3OC2A 4EW7A 3IS2B 3GDIA 2ZMVA 2KDKA 4L9EA 3F1OA 3UE6A 4E04A 2LB9A 4EQ1A 2WKQA 4KQDA 4Z1WA 5J7EA 5HPIA 2GZAA 3VE3A 2XA7S 2PDRA 1H8MA 3K3DA 5KSHA 3KX0X 4HJ4A 2LB5A 3MQ0A 1P0ZA 2K2NA 3F1OB 3NOPC 4WF0A 2W1TA 4DN0A 2QJ5A 2D01A 1NRJA 4JGPA 2XSSA 4MN7A 4WN5A 5L8MA 2V1BA 3MFXA 4JGOA 5TBMB 2DMWA 3K3CA 3F1PB 2B02A 3CITA 4HH2A 3RTYA 1MC0A 1OTAA 2NUTC 1STZA 2ZOHA 3BY9A 2W3HA 2JKTM 4OOMA 3NJAA 2GNXA 3PR6A 4GLQA 4EEPA 5A8BA 2I9VA 4I38A 3LR3A 5HSQA 3UMDA 3OBFA 2VV8A 3LICA 3CLOA 3GECA 1YAXA 3IBRA 4L9FA 3MQQA 4R70A 5AJGA 3OLOA 4HOIA 3T4JA 1F98A 2O9CA 3NHQA 3B33A 1OJGA 2PHYA 2OAQ1 5DFXA 4I3AA 4CQHA 2PYPA 4ZRRA 1T1CA 4AFIA 5J3WA 3TE8A 3LIFA 3H9WA 3T4TA 1YKDA 4G3VA 4MCWA 3BY8A 2W27A 1EW0A 3T4KA 2VA0A 1DRMA 3KO6A 2W1RA 3A0SA 2M7UA 3JVVA 2P7JA 1T1BA 2XROA 5C5KA 5EFWA 1NWZA 1S1YA 2GJ3A 2HJ9C 4NKPA 3UE3A 4CLCD 3MMHA 4GS9A 4MN6A 4R38A 4JGRA 4Q0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D72 A;  4I3J A;  1D7E A;  2V1A A;  3F1N A;  2A24 A;  1UWP X;  3A0R A;  4EER A;  3ICY A;  3LIB A;  3VOL A;  4HQA A;  2YKF A;  3LI8 A;  4HJ3 A;  4JGQ A;  4H6J B;  3UB7 A;  2HV1 A;  4EET B;  3H7W A;  2V9A A;  3G6O A;  2A24 B;  1XJ2 A;  2PD8 A;  5F68 A;  2WKP A;  3ZQ5 A;  2V0W A;  3H7W B;  5HWW A;  4WLA A;  3CAX A;  3FC7 A;  3MXQ A;  2R78 A;  3UB8 A;  5DKL A;  2OWH A;  1JNU A;  4YWZ A;  4NXB A;  4PKY G;  2JN7 A;  4M4X A;  2ZBB A;  1TS0 A;  4K08 A;  3UME A;  5HD5 A;  4KUK A;  1UGU A;  3LIE A;  3E4P A;  3CWF A;  5DJT A;  1N9L A;  1S1Z A;  3H82 A;  4WL9 A;  1LSX A;  4R3A A;  1N9O A;  1DP8 A;  4F3L A;  1N9N A;  2YKH A;  5DKK A;  1S66 L;  2KX6 A;  2WKR A;  1DP6 A;  1XJ4 A;  2VEA A;  3T50 A;  1XFQ A;  5IU1 A;  1MZU A;  3PHY A;  4F3L B;  2L4R A;  5HZH A;  5HWV A;  5HDC A;  4B9O A;  4HY8 A;  3SW1 A;  4XT2 A;  3PYP A;  5J4E A;  5F69 A;  1S4R A;  3LIA A;  1TS7 A;  4HJ6 A;  4GHI A;  1WA9 A;  2QKP A;  2ZOI A;  4LRX C;  2L1M A;  4BBV A;  4EXO A;  4GS9 B;  4GHI B;  2VV6 A;  1GSX A;  5G4Z A;  4EES A;  4WUJ A;  1OT9 A;  3NOU C;  2VLG A;  1XJ6 A;  3F1N B;  4DJ2 A;  4HP9 A;  4LRZ E;  3P7N A;  3IS2 A;  3LID A;  3MJQ A;  4NXF A;  4R6L A;  5G4Y A;  1LSV A;  4I5S A;  4HHD A;  2L0W A;  5DJU A;  3LI9 A;  2PD7 A;  3FG8 A;  4DJ3 A;  1Y28 A;  4LLO B;  5AVE A;  2QJ7 A;  4GCZ A;  4L9G A;  1T19 A;  1S67 L;  3A0V A;  4HI4 A;  3EWK A;  1ODV A;  1OT6 A;  4KUO A;  5F5Y A;  1TS8 A;  3VE4 A;  2INW A;  3MQO A;  4I39 A;  2Z6D A;  5TBM A;  4BBU A;  5AVF A;  1UWN X;  3F1P A;  3HJK A;  1LL8 A;  3UB9 A;  2J80 A;  4MN5 A;  1OTI A;  4I3I A;  2PYR A;  1S4S A;  2BAS A;  1BYW A;  4BBT A;  3NOT C;  1LT0 A;  4GW9 A;  3MR0 A;  2H28 A;  2K7S A;  3LUQ A;  1VB6 A;  3H82 B;  4NXE A;  5KIZ A;  4HIA A;  1DP9 A;  3RH8 B;  1X0O A;  2PR5 A;  1OTB A;  1XFN A;  1OTD A;  1V9Y A;  1GSW A;  3C8C A;  3E4O A;  3HJI A;  5HDD A;  1KOU A;  4HNB A;  4RQ9 A;  4HP4 A;  5F6A A;  1GSV A;  1T1A A;  2QWS A;  2CMN A;  3ULF A;  2OOL A;  1XJ3 A;  2Z6C A;  3E4Q A;  3BWL A;  3C2W A;  4XT2 B;  4NXG A;  3LYX A;  1V9Z A;  5HWT A;  4LRY C;  5IS1 A;  1OTE A;  1OJ5 A;  2V0U A;  2PR6 A;  4H6J A;  2W0N A;  3UB6 A;  1D06 A;  1TS6 A;  4PKY A;  2QHK A;  2EA9 A;  1G28 A;  2VV7 A;  5HD3 A;  2JHE A;  4LPZ A;  4EEU A;  1LSW A;  5I5L A;  1P97 A;  2M1C A;  3EEH A;  4HH3 A;  1F9I A;  2OWJ A;  5HDS A;  2D02 A;  1T18 A;  4EW7 A;  3IS2 B;  3GDI A;  2KDK A;  4L9E A;  3F1O A;  3UE6 A;  4E04 A;  4EQ1 A;  2WKQ A;  4KQD A;  5J7E A;  3VE3 A;  2PDR A;  3K3D A;  3KX0 X;  4HJ4 A;  1P0Z A;  3NOP C;  3F1O B;  4WF0 A;  2QJ5 A;  2D01 A;  4JGP A;  4WN5 A;  2V1B A;  3MFX A;  4JGO A;  5TBM B;  3K3C A;  3F1P B;  2B02 A;  4HH2 A;  3RTY A;  1OTA A;  2ZOH A;  3BY9 A;  3NJA A;  4EEP A;  5A8B A;  2I9V A;  4I38 A;  5HSQ A;  3UMD A;  2VV8 A;  3LIC A;  3CLO A;  3GEC A;  3IBR A;  4L9F A;  3MQQ A;  4R70 A;  3OLO A;  4HOI A;  1F98 A;  3NHQ A;  3B33 A;  1OJG A;  2PHY A;  4I3A A;  2PYP A;  1T1C A;  5J3W A;  3LIF A;  3H9W A;  3BY8 A;  2W27 A;  1EW0 A;  1DRM A;  3A0S A;  2P7J A;  1T1B A;  5EFW A;  1NWZ A;  1S1Y A;  2GJ3 A;  4GS9 A;  4MN6 A;  4R38 A;  4JGR A; 
#chains in the Genus database with same CATH topology
 1KGE A;  3A3J A;  4QJG A;  3UNW A;  4C75 A;  1D7E A;  2V1A A;  3UN7 A;  1KE4 A;  3ICY A;  3VOL A;  1K54 C;  4RYE A;  4JGQ A;  5U47 A;  3VP2 A;  3E2L A;  4EET B;  5E2G A;  1ZTU A;  2V9A A;  1SKO B;  3DAV A;  3ZG0 A;  5AQ7 A;  2XD1 A;  4JXV A;  3TRC A;  4EU0 A;  2HGV A;  5EVI D;  1S0W A;  1C3B A;  4FD8 A;  5HAI A;  1YPR A;  3ZQ5 A;  4DE1 A;  3G32 A;  2DRW A;  3HLC A;  3NIA A;  1HZO A;  4EBL A;  4WLA A;  3CAX A;  1J9M A;  1K4E A;  3N7W A;  5DKL A;  3PAG A;  4NXB A;  3S7P A;  4N9K A;  3IF6 B;  2FH5 A;  1K56 A;  2J7V A;  2JBF A;  4LGW A;  3PXP A;  3E4P A;  3MZE A;  5HPF A;  2Y2L A;  4RX3 A;  1S1Z A;  4WL9 A;  3TJZ C;  4E3I A;  1JWV A;  1N9O A;  3WS0 A;  4F3L A;  4ETX A;  5DKK A;  5A93 A;  2WGW B;  4BL2 A;  3W2Z A;  4IUH A;  5G18 A;  3AGD A;  1MKI A;  4EBN A;  1H8Z A;  1FIL A;  3SH7 A;  3U2A A;  5CRF A;  3PHY A;  4F3L B;  1G6O A;  3S7O A;  3BW6 A;  2ZC6 B;  3W4O A;  2HPB A;  4B93 A;  4B9O A;  4HY8 A;  4XT2 A;  4UQI M;  1S6R A;  5J4E A;  1FIK A;  2W3F A;  4WEJ A;  5FDH A;  4Q8I A;  1WA9 A;  4JXG A;  2Y8H A;  3RXX A;  2ZL1 A;  1HVB A;  3FYZ A;  4G3K A;  3CG5 A;  2HDS A;  5HW3 A;  4LRX C;  5FQJ A;  3G35 A;  1NYM A;  3IH9 A;  4BBV A;  1VET B;  5EOO A;  4KQO A;  3NCK A;  3FKV A;  3R7W B;  3NOU C;  4DDY A;  3UDX A;  1XJ6 A;  2AVX A;  2ZC7 A;  1P9R A;  3IS2 A;  4BD1 A;  4PAU A;  2EX8 A;  2VJW A;  4NXF A;  4PM7 A;  3UE0 A;  1LHY A;  4YOF A;  1BUE A;  1W8Y A;  4JF5 A;  4LLO B;  5AVE A;  3NUL A;  2QJ7 A;  3K2N A;  1T19 A;  5GLC A;  4U3T A;  3BLS A;  2WYX A;  3VP0 A;  4Y5F A;  1OT6 A;  1F2K A;  5KSC A;  2ZQD A;  4MBH A;  4OPR A;  4KUO A;  3CUE A;  4Y17 A;  1ESI A;  2WKE A;  3MQO A;  5TBM A;  1BTL A;  3GSG A;  1MPL A;  3E2K A;  4ARZ A;  1HTZ A;  1LL8 A;  3IXG A;  1YMS A;  2XA7 M;  4S2I A;  4QU3 A;  4MN5 A;  4I3I A;  1XP4 A;  2IWC A;  4Q0I A;  1QME A;  5HFO A;  5FSR A;  2DNS A;  1IKG A;  4GW9 A;  4FH4 A;  4ARZ B;  1YMX A;  5HAP A;  3Q81 A;  4CJN A;  3WWX A;  2ACG A;  3H82 B;  2EX6 A;  4IBR A;  5DVA A;  3TW8 A;  1E4D A;  3EQU A;  1YLZ A;  2XD5 A;  4YNR A;  1DP9 A;  3WS4 A;  2WKI A;  1OTD A;  5F83 A;  1V9Y A;  3C8C A;  5CX7 A;  2ZM8 A;  3HJI A;  4O0P A;  3SS4 A;  3V67 A;  4UA6 A;  4HP4 A;  3S22 A;  2QWS A;  1NJ4 A;  2CMN A;  4BLM A;  2K31 A;  5GLB A;  3S7Q A;  3KYZ A;  2J3T C;  5AQB A;  4WZ4 A;  1XJ3 A;  2EX9 A;  2Z6C A;  2G2U A;  3E4Q A;  5EM0 A;  1NZO A;  3HL9 A;  3DBA A;  4GZB A;  4X25 A;  3KSG A;  3A3E A;  4MDZ A;  2PR6 A;  3UB6 A;  1D06 A;  5GL9 A;  2QHK A;  3GRJ A;  3OOV A;  1BSG A;  2VV7 A;  4A5R A;  1JTD A;  4LPZ A;  5BOH A;  4G3W A;  1YQS A;  2EWV A;  3MS6 A;  2ZC4 B;  4GN2 A;  5I5L A;  3CUE C;  1P97 A;  3EEH A;  3ZG5 A;  2HJE A;  4IVK A;  1HD8 A;  2J3W A;  4N1X A;  3B3X A;  3SH8 A;  2D02 A;  3OC2 A;  3GDI A;  4E04 A;  3IX3 A;  2Y2K A;  2PU2 A;  2GZA A;  2XGN A;  4KZ7 A;  2XA7 S;  2PDR A;  4DRT A;  5KSH A;  3TG9 A;  3MQ0 A;  3NOP C;  4WF0 A;  5JYO A;  2D01 A;  3WS2 A;  5A91 A;  4MN7 A;  5L8M A;  2V1B A;  3DTM A;  2XLN A;  4JGO A;  4E3M A;  3WS5 A;  3C7U A;  5FQM A;  4MEZ A;  3K3C A;  2B02 A;  2EXA A;  1CK3 A;  3CIT A;  3IWO A;  3RTY A;  1MC0 A;  2EFX A;  3ZVT A;  1STZ A;  1VEU A;  5J8X A;  3IXD A;  2JKT M;  3NJA A;  4C6Y A;  2I9V A;  5A92 A;  2H5S A;  3UMD A;  1PFL A;  3LIC A;  3IBR A;  4R3J A;  4OH0 A;  4QY6 A;  4BL3 A;  3MQQ A;  2Y2M A;  1WE4 A;  2FFY A;  3Q07 A;  2O9C A;  4Y0T A;  1KVM A;  4K0X A;  2PHY A;  1RCJ A;  1K0K A;  4OP8 A;  2PYP A;  3TE8 A;  3GQZ A;  1YKD A;  2XQZ A;  1Q2P A;  3IHA A;  4FH2 A;  4OPY A;  1NRF A;  1NY0 A;  2Y2J A;  4NET A;  1NWZ A;  3HRE A;  4CLC D;  1IYP A;  4C3Q A;  2PT7 A;  2P9V A;  3G34 A;  1PI4 A;  2HZ5 A;  2W3E A;  4MBK A;  1TEM A;  3D72 A;  3FPV A;  2OAP 1;  3F1N A;  2WZZ A;  2A24 A;  5FAT A;  3MXS A;  4UEY A;  1ES5 A;  3C4O A;  4HQA A;  2YKF A;  3LI8 A;  5DTS A;  3ZG7 B;  2ZLY A;  2P9V B;  3IXH A;  3H7W A;  3G6O A;  4OVD A;  4L0L A;  2A24 B;  5IHV A;  2ZM2 A;  4WMC D;  3EGX C;  1PZO A;  2O9B A;  3P01 A;  3VV4 A;  5F1F A;  2H0T A;  2JE5 A;  3H7W B;  1K54 A;  4KZ9 A;  1CEF A;  2ZC5 B;  1DY6 A;  4IHQ A;  3M6H A;  2X71 A;  4B88 A;  1FCO A;  3V50 A;  3BEB A;  2Y4A A;  4PKY G;  1PRQ A;  4FSF A;  2EWW A;  1PZP A;  1W79 A;  1XA7 A;  3MBZ A;  1TS0 A;  4IBX A;  4K08 A;  4M3K A;  3BFG A;  3VFF A;  3T1S A;  3HBR A;  2FZ0 A;  3HLE A;  4JXS A;  2XK1 A;  3GVB A;  2W1T B;  5L09 A;  3CWF A;  1N9L A;  3N8R A;  2Y2H A;  5E43 A;  2J8Y A;  3OPH A;  3ZFZ A;  1IKI A;  1WYC A;  1LSX A;  2VGJ A;  4R3A A;  2B5R A;  4HEF A;  4PMA A;  5I94 A;  1BUL A;  3W8K A;  3D3O A;  4EUV A;  2YKH A;  1S66 L;  2KX6 A;  3G4P A;  1XJ4 A;  1FSY A;  5M19 A;  3AGE A;  1H3Q A;  3T50 A;  3ZNY A;  5IU1 A;  4CLC E;  5CGS A;  5DTK A;  4E3L A;  2L4R A;  3NBL A;  5CHM A;  3HLB A;  4NK3 A;  1FCM A;  4PM9 A;  5TJJ A;  2HF6 A;  3VP4 A;  2HDR A;  4HBT A;  1K38 A;  1W5D A;  3M2K A;  4KZ4 A;  3MFD A;  1Z09 A;  3UO9 A;  3PYP A;  2JC7 A;  5K5B A;  4X68 A;  4HJ6 A;  5DF9 A;  4GHI A;  2JKR M;  3L9K A;  4KZA A;  1NYY A;  3QHY A;  4LCM A;  1TDL A;  1SKF A;  3BQA A;  1IOU A;  4EXO A;  4GS9 B;  3OCN A;  1IYO A;  5HX9 A;  3O3V A;  4GHI B;  2V8C A;  5KMW A;  3M6B A;  1SCW A;  1ZHH B;  4P0M A;  1H8Y A;  4LRZ E;  3DWK A;  4XXR A;  2EXB A;  3CI6 A;  4X69 A;  1LSV A;  1L3L A;  1EWZ A;  5DJU A;  3MXR A;  2PD7 A;  3IBJ A;  2R9W A;  1Y28 A;  1L0G A;  4PM6 A;  2JCH A;  5EV0 A;  4GCZ A;  4L9G A;  2P04 A;  3JPU A;  2Y2P A;  3A0V A;  4HI4 A;  1ODV A;  4P85 A;  4ZTK A;  2WAF A;  4GD6 A;  3PBQ A;  1BT5 A;  4UA9 A;  3QNC A;  4WM9 A;  1ERM A;  5GLD A;  1KGF A;  2Z6D A;  1I2S A;  4BBU A;  1UWN X;  5HL1 A;  4KG2 A;  3FZC A;  1SZV A;  3MZD A;  2HP5 A;  2PBY A;  2X01 A;  1VQQ A;  1OTI A;  4DMZ A;  4GD8 A;  4DE3 A;  2PYR A;  4P6B A;  1K55 C;  4X1M A;  3NOT C;  3BFF A;  2V1Z A;  3MR0 A;  3DWZ A;  1E3U D;  3BFC A;  2C6W B;  3T4S A;  1GA0 A;  3A3I A;  2BG1 A;  1GCE A;  4GB7 A;  5EVI C;  2PRF A;  5FI6 A;  3HLW A;  5FI2 A;  4LV3 A;  3SH9 A;  1CF0 A;  4OOY A;  2PR5 A;  1XFN A;  3PAE A;  1GSW A;  1G68 A;  3E4O A;  2O9A A;  5HDD A;  3MKE A;  1PW8 A;  4RQ9 A;  1O7E A;  5CED A;  5FQI A;  2Y2G A;  1K56 D;  3LCE A;  4ZBE A;  3ULF A;  5EOE A;  2JKT I;  2HP9 A;  4Y2F A;  4MNR A;  5HAQ A;  1YSQ A;  3QNB A;  2WZX A;  4JF4 A;  3SZT A;  4XT2 B;  4KZ8 A;  1F5M A;  1MWR A;  3UPP A;  3LYX A;  4IED A;  4KQQ A;  4IUK A;  3L7H A;  4YFM A;  2ZD8 A;  3IWI A;  1XXM A;  1OJ5 A;  2GDN A;  4QY5 A;  3LEZ A;  4H6J A;  4UHU A;  4EUZ A;  5FAS A;  4MBF A;  4S2L A;  3BRM A;  1HLU P;  3T4O A;  2ZL1 B;  4B4Z A;  4FUW A;  3HCY A;  4Y15 A;  4BWI A;  4LV0 A;  5HD3 A;  2QPN A;  3ZNT A;  2Y2I A;  1LSW A;  3LFV A;  2M1C A;  4II7 A;  4X55 A;  1FR6 A;  4HH3 A;  3GV9 A;  3IT9 A;  5EPH A;  1T18 A;  3C38 A;  2XEP A;  4OQG A;  3IS2 B;  3S1Y A;  4S2K A;  2KDK A;  1GHI A;  4L9E A;  3F1O A;  3T12 B;  4EQ1 A;  4DDS A;  2R9X A;  2WGI A;  3QP5 A;  5J7E A;  3FKW A;  2RL3 A;  5GLA A;  4WBG A;  1LI9 A;  1CQA A;  3OZH A;  2J9P A;  1PYY A;  3NC8 A;  2A3U A;  1P0Z A;  2K2N A;  2V8F A;  3F1O B;  3G31 A;  1K57 A;  2QJ5 A;  2Y91 A;  4JGP A;  2ZQ9 A;  4WN5 A;  5GHY A;  2Y2N A;  5TBM B;  2C5W B;  2DMW A;  4P87 A;  4ZJ2 A;  1SHV A;  1OTA A;  3IQA A;  1FR1 A;  4QWO A;  2QZ6 A;  2ZMA A;  1RP5 A;  2WKH A;  1LL9 A;  4EEP A;  5A8B A;  4I38 A;  3A3D A;  3LR3 A;  5FI7 A;  2H10 A;  5CER A;  3V5M A;  4JKT A;  4DE2 A;  3M2J A;  1PWG A;  4HOI A;  5FEG A;  1BLC A;  4WYY A;  3LGO A;  4DF6 A;  5CEC A;  4ZRR A;  4OQI A;  4EWF A;  5CEB A;  4QD4 A;  1W7F A;  2Y55 A;  3QP1 A;  4MCW A;  1TVF A;  2W27 A;  1EW0 A;  1ONG A;  4K0W A;  5GHX A;  1S1Y A;  3RJU A;  3C7V A;  3MMH A;  3WS1 A;  4R4R A;  4R38 A;  4Q0H A;  3VMA A;  4WZ5 A;  5EE8 A;  3GTC A;  4S2O A;  5M1A A;  1UWP X;  4K91 A;  3KYQ A;  4EER A;  3LIB A;  4KZ5 A;  3ZHH A;  4HJ3 A;  2Q9N A;  4GNU A;  4D2O A;  1LL5 A;  3VOZ A;  1I2W A;  2JKR I;  1K57 C;  1JWP A;  5F68 A;  2WKP A;  5DTT A;  1Y54 A;  3SS3 A;  3ZCZ A;  4KZB A;  5HWW A;  5LBR A;  4X6T A;  3NEC A;  5E2E A;  3BLM A;  2XFS A;  1KDS A;  1VHM A;  1JNU A;  3LR4 A;  2FFF B;  4Y0O A;  3RFB A;  4M4X A;  1YSP A;  3UME A;  3NDE A;  4S2N A;  4XUZ A;  1G6A A;  3CHW P;  4FCF A;  3IWQ A;  3BM6 A;  5DJT A;  4QHC A;  4BJP A;  3G2Z A;  2P08 A;  3QP8 A;  1DP8 A;  4KG5 A;  1A0K A;  1SDE A;  4CLC A;  1PWD A;  3LO7 A;  1N9N A;  3LY4 A;  3O88 A;  4DKI A;  1YLY A;  1VEU B;  1DP6 A;  1YLT A;  1QMF A;  1ERO A;  2KOI A;  1MZU A;  4EV4 A;  4WZ5 C;  2W3G A;  5HZH A;  2E8J A;  2QYB A;  2M7V A;  5HWV A;  5HDC A;  3HUO A;  3GR2 A;  3UB5 P;  1CJF A;  1MKM A;  4E3K A;  1NLY A;  3BFE A;  3IF5 A;  5F69 A;  2EFU A;  2G7U A;  3LIA A;  1IYQ A;  5JYP A;  1TS7 A;  2XF3 A;  5CTM A;  2QKP A;  4DXB A;  3BYD A;  2WUQ A;  5FL3 A;  4E3N A;  3FPW A;  2L1M A;  2XFT A;  3UE1 A;  2WGV A;  4R23 A;  4EES A;  2VLG A;  5DFY A;  3F1N B;  4DJ2 A;  1JVJ A;  3P7N A;  3MJQ A;  3LID A;  5L07 A;  4OPZ A;  3S7N A;  4OON A;  4S2N C;  4NG2 A;  3N8S A;  4HHD A;  2L0W A;  4X56 A;  3LI9 A;  5IT5 A;  3HLD A;  3FG8 A;  2HP6 A;  4DJ3 A;  4QPR A;  1BLS A;  1MBL A;  3PBO A;  3ZDJ A;  2A49 A;  4Z9Q A;  1S67 L;  3EWK A;  4CLC C;  5CXW A;  3PBR A;  1RGZ A;  1TS8 A;  5F5Y A;  2O99 A;  3VE4 A;  2INW A;  1XGJ A;  3O86 A;  4JXW A;  3OCL A;  3F1P A;  1NLZ A;  2J80 A;  2I72 A;  3VSK A;  2XDM A;  1BYW A;  4BBT A;  3MSH A;  4Q0J A;  2Q0O A;  4GJ4 A;  1O07 A;  1N4O A;  3EQV A;  3PBT A;  1W8Q A;  3A3F A;  3RH8 B;  3D9Y A;  4DXC A;  1X0O A;  1OTB A;  2VGK A;  1FQG A;  3DW0 A;  1N9B A;  1K55 A;  4HNB A;  4R4S A;  3T1R A;  1AWI A;  4QB8 A;  2V2F F;  3DTI A;  1GSV A;  1T1A A;  4GDN A;  4N9L A;  3PBN A;  5EVI A;  1PI5 A;  4IJG A;  4B4X A;  3JYI A;  4RVA A;  1XX2 A;  1KGG A;  3ZVW A;  1FCN A;  5CHU A;  1YT4 A;  3NDG A;  3BWL A;  4WEL A;  3LR0 A;  2DCF A;  5D3O A;  5EVI B;  1V9Z A;  5HWT A;  4EBP A;  5IS1 A;  3KSI A;  1OTE A;  4OQH A;  4BQM A;  3MF0 A;  1KVL A;  4IVI A;  5MC7 A;  4N92 A;  1SKO A;  2EA9 A;  1G5U A;  4GOG A;  3BQ8 A;  1MWU A;  4ETZ A;  4EEU A;  3FV7 A;  4D60 A;  2E8I A;  2Q9M A;  4Y7P A;  2O0Y A;  4PM5 A;  2A2L A;  4YIN A;  1F9I A;  2OWJ A;  2ZM0 A;  2JKG A;  3PBS A;  4X1L A;  2ZMV A;  4R1G A;  1E3U A;  3TSG A;  3UE6 A;  3Q82 A;  2LB9 A;  3MKF A;  2WKQ A;  4FTX A;  3IF6 A;  2JKF A;  3UPN A;  3PTE A;  4HJ4 A;  1XKZ A;  4CPK A;  1ES4 A;  2LB5 A;  3RXW A;  4DN0 A;  4DE0 A;  4E3J A;  3CJM A;  3NY4 A;  4S2M A;  5FA7 A;  1H5X A;  3OPP A;  3UDF A;  3W4P A;  5L10 A;  2EX2 A;  3VSL A;  2UWX A;  1ESU A;  1XA1 A;  4HBU A;  2ZOH A;  2WGW A;  4OOM A;  3ZG9 B;  4LV2 A;  1YLW A;  2GNX A;  3PR6 A;  2HDU A;  1ZKJ A;  1JTG A;  5HSQ A;  2X02 A;  3GEC A;  4L9F A;  1ZC2 A;  4R70 A;  1BLP A;  3OLO A;  1IEM A;  1M40 A;  3T4J A;  3QP4 A;  2H0Y A;  5TR7 A;  3NHQ A;  3B33 A;  2XR0 A;  2OAQ 1;  5DFX A;  2PBD P;  3ISG A;  1NZU A;  4H8R A;  4CQH A;  1ES3 A;  1T1C A;  3H9W A;  3BY8 A;  3DTE A;  1I5Q A;  4LCL A;  3C4P A;  2VA0 A;  1DRM A;  3KO6 A;  1MWT A;  3A0S A;  4OP5 A;  2M7U A;  2P7J A;  3JVV A;  4Y13 A;  2XRO A;  5EFW A;  2GJ3 A;  2HJ9 C;  2PAV P;  4NKP A;  1VET A;  3UE3 A;  4MN6 A;  4JGR A;  4X53 A;  2ZC3 B;  1ZG6 A;  2WAD A;  3R7W A;  3T1Q B;  4I3J A;  4E3O A;  1YM1 A;  5M18 A;  1IFQ A;  1OME A;  3A0R A;  3IF6 C;  4R3B A;  1GHP A;  4Y0U A;  5CHJ A;  2ZQC A;  5TGF A;  4H6J B;  2VX8 A;  3SS5 A;  4XUX A;  3UB7 A;  2W3D A;  2HV1 A;  1MY8 A;  5F82 A;  3AGF A;  1Y4O A;  1XJ2 A;  2J9O A;  2PD8 A;  3U4L P;  2PU4 A;  4JF6 A;  3IHB A;  3UPO A;  1L0D A;  2V0W A;  4RX2 A;  3SOI A;  4PM8 A;  1K4F A;  5E2H A;  3FC7 A;  1ES2 A;  3MXQ A;  2R78 A;  3UB8 A;  3LY3 A;  3KSH A;  5HAR A;  4JBF A;  2OWH A;  1L0E A;  5FQ9 A;  4YWZ A;  2OSU A;  3P09 A;  2JN7 A;  1KE3 A;  2HDQ A;  2XRN A;  1YLJ A;  3HLF A;  1P9W A;  5CTN A;  3HLG A;  2ZBB A;  2KLI A;  2J3T D;  5HD5 A;  4KUK A;  1UGU A;  3LIE A;  1ONH A;  1K25 A;  1PWC A;  4F94 A;  4O01 A;  3Q7V A;  3H82 A;  2MJ6 A;  2IWD A;  3IXB A;  3O5Y A;  3KYE A;  3G2Y A;  1XGI A;  3B47 A;  1NXY A;  1KE0 A;  2WKR A;  3BJN A;  2Y59 A;  2VEA A;  2NUP C;  3Q7V B;  3O87 A;  1XFQ A;  5EVL A;  5AQA A;  2IA2 A;  4R0Q A;  5EUA A;  4UQI S;  1WYB A;  1ERQ A;  5DF7 A;  1Q2Q A;  1PIO A;  2ZQ8 A;  2OLV A;  4GKU A;  5FEF A;  1K6R A;  2VGL M;  3SW1 A;  4P6Z M;  1D1J A;  4ME4 A;  3CPT A;  4BMW A;  3LEQ A;  3V3S A;  1S4R A;  3W4Q A;  1Z6F A;  4OPQ A;  1J3W A;  4MLL A;  1OPX A;  5EM1 A;  1ZG4 A;  2ZOI A;  3HVF A;  3CPT B;  4OOL A;  4ZDX A;  5HL6 A;  3EOI A;  5CGX A;  2ZQ7 A;  2VK3 A;  2VV6 A;  1GSX A;  4UAA A;  4S2J A;  1L2S A;  1DJC A;  2BTF P;  4GDB A;  5G4Z A;  3WRT A;  4WUJ A;  1OT9 A;  1TDG A;  3N6I A;  1TF1 A;  1SDN A;  4HP9 A;  5CGW A;  2ZQA A;  4ZJ1 A;  3CZD A;  4R6L A;  4ZJ3 A;  1AXB A;  5G4Y A;  3E0Y A;  4I5S A;  1L0F A;  3TOI A;  2VZW A;  1VM1 A;  4U0T A;  3B42 A;  4LEN A;  5F1G A;  3DTK A;  3IH8 A;  5A90 A;  3KSF A;  5E2F A;  4OKP A;  1GHM A;  5FAP A;  1BLH A;  4LFU A;  2ZMF A;  3ZGA B;  1M6K A;  1LLB A;  4O8G A;  4I39 A;  3E98 A;  3UDI A;  2G2W A;  5AVF A;  3HJK A;  3T4Q A;  1RGY A;  2P74 A;  3UB9 A;  3FWL A;  2ZJ9 A;  3UY6 A;  1S4S A;  3WRZ A;  3ITA A;  2BAS A;  2OLU A;  1MWS A;  4FOF A;  3MZF A;  1LT0 A;  1YLP A;  2H28 A;  1PW1 A;  2VKS A;  3VOY A;  1TD5 A;  1ALQ A;  2XH9 A;  2K7S A;  3LUQ A;  3JVU A;  4S2P A;  1VB6 A;  2Z2L B;  4OLD A;  4NXE A;  2GX5 A;  3T4L A;  4MMN A;  5KIZ A;  4HIA A;  4ZAM A;  3C30 A;  2VGL S;  2QMI A;  4CLC B;  3GMW A;  4P6Z S;  4PPR A;  4KZ3 A;  1IYS A;  4RA7 A;  1XPB A;  3I7J A;  2B18 A;  2BLS A;  4O7D A;  4WEK A;  1KOU A;  5F6A A;  1CEG A;  3BEC A;  2CC1 A;  3S4X A;  2RCX A;  5FDS A;  4U0X A;  4WMC A;  3VP1 A;  2OOL A;  5KZH A;  1CI8 A;  4PHT A;  3EEA A;  3NI9 A;  1W63 Q;  2UV0 E;  3OPR A;  3R4K A;  3C2W A;  4Y3I A;  4NXG A;  2WK0 A;  3G30 A;  1JWZ A;  2Y79 A;  3LR5 A;  4LRY C;  4E6W A;  3IX4 A;  3IX8 A;  1DJB A;  2V0U A;  4HES A;  2W0N A;  1TS6 A;  3ZYT A;  4PKY A;  1W63 M;  1G28 A;  2JHE A;  3Q7Z A;  3D4F A;  1GA9 A;  3HUN A;  1IEL A;  3V39 A;  4UA7 A;  3BFD A;  5L2F A;  5FQK A;  3C5A A;  4NEE D;  5TFQ A;  3QP6 A;  5HDS A;  1CI9 A;  4ID4 A;  2OV5 A;  4ESP A;  3VP3 A;  3EGD C;  4EW7 A;  4JLF A;  4LV1 A;  3V3R A;  2Y2O A;  3N8L A;  4KZ6 A;  1H0M A;  4JPM A;  4KQD A;  4Z1W A;  5HPI A;  3Q1F A;  5GHZ A;  1K6S A;  3VE3 A;  1H8M A;  1KDW A;  4KQR A;  3K3D A;  4EQI A;  2WAE A;  3HUM A;  1EI5 A;  3KX0 X;  2V20 A;  2W1T A;  3N4I A;  1ACF A;  3ITB A;  1NRJ A;  2B95 A;  2XSS A;  2Y2Q A;  1BZA A;  1PNE A;  3MFX A;  4OQ0 A;  3T1X A;  3F1P B;  4HH2 A;  1DJA A;  4OLG A;  2NUT C;  3CMZ A;  4N1H A;  1U60 A;  3BY9 A;  2W3H A;  3QP2 A;  4KEN B;  1LI0 A;  4GLQ A;  4E6X A;  5EEC A;  3OPL A;  3OBF A;  2VV8 A;  2IWB A;  1E25 A;  4KG6 A;  3CLO A;  1YAX A;  3P98 A;  5AJG A;  1F98 A;  1OJG A;  1FSW A;  5FAQ A;  4I3A A;  4AFI A;  5DF8 A;  5J3W A;  3LIF A;  5EVE A;  3T4T A;  1MXO A;  3ZG8 B;  1FOF A;  4G3V A;  4BEN A;  3T4K A;  5AQ9 A;  2W1R A;  3VFH A;  5FAO A;  5FQQ A;  1T1B A;  5C5K A;  4GS9 A;  4BD0 A;  2Z2M B; 
#chains in the Genus database with same CATH homology
 2PT7 A;  2W3E A;  3R7W A;  3D72 A;  4I3J A;  3FPV A;  1D7E A;  2OAP 1;  2V1A A;  1IFQ A;  3F1N A;  2A24 A;  1UWP X;  4UEY A;  3A0R A;  3KYQ A;  4EER A;  3ICY A;  3LIB A;  3VOL A;  4HQA A;  2YKF A;  3LI8 A;  4HJ3 A;  4JGQ A;  4H6J B;  2VX8 A;  3UB7 A;  2W3D A;  2HV1 A;  4EET B;  3H7W A;  1ZTU A;  2V9A A;  3G6O A;  4L0L A;  3TRC A;  2A24 B;  2JKR I;  1XJ2 A;  4EU0 A;  2PD8 A;  2HGV A;  3EGX C;  5F68 A;  2O9B A;  2WKP A;  3ZQ5 A;  3P01 A;  3VV4 A;  2V0W A;  3H7W B;  5HWW A;  5LBR A;  4WLA A;  3CAX A;  3FC7 A;  3MXQ A;  2R78 A;  4IHQ A;  3UB8 A;  3KSH A;  5DKL A;  2OWH A;  1VHM A;  1JNU A;  4YWZ A;  4NXB A;  3LR4 A;  3S7P A;  4PKY G;  2FH5 A;  2JN7 A;  4FSF A;  2EWW A;  2XRN A;  3RFB A;  1P9W A;  4M4X A;  2ZBB A;  2KLI A;  1TS0 A;  1YSP A;  4K08 A;  3UME A;  2J3T D;  5HD5 A;  4KUK A;  1UGU A;  3LIE A;  2FZ0 A;  3PXP A;  3E4P A;  2W1T B;  3CWF A;  5HPF A;  5DJT A;  4BJP A;  1N9L A;  1S1Z A;  4O01 A;  3H82 A;  2MJ6 A;  4WL9 A;  3TJZ C;  1LSX A;  4R3A A;  1N9O A;  3O5Y A;  2P08 A;  1DP8 A;  4F3L A;  4CLC A;  3B47 A;  3D3O A;  1N9N A;  4ETX A;  4EUV A;  2YKH A;  5DKK A;  1S66 L;  2KX6 A;  2WKR A;  1DP6 A;  1XJ4 A;  3BJN A;  2VEA A;  3W2Z A;  4IUH A;  2NUP C;  1H3Q A;  2KOI A;  3T50 A;  1XFQ A;  5IU1 A;  1MZU A;  4CLC E;  2IA2 A;  3U2A A;  3PHY A;  4UQI S;  4F3L B;  2L4R A;  2W3G A;  1G6O A;  3S7O A;  5HZH A;  5TJJ A;  3BW6 A;  2QYB A;  2HF6 A;  2M7V A;  5HWV A;  5HDC A;  1MKM A;  4B93 A;  4B9O A;  4HY8 A;  2VGL M;  1NLY A;  4XT2 A;  4UQI M;  3SW1 A;  4P6Z M;  4ME4 A;  3PYP A;  5J4E A;  4BMW A;  2W3F A;  5F69 A;  5K5B A;  2G7U A;  1S4R A;  3LIA A;  4WEJ A;  1TS7 A;  1OPX A;  4HJ6 A;  5DF9 A;  4GHI A;  2JKR M;  1WA9 A;  2Y8H A;  2QKP A;  4G3K A;  2ZOI A;  5FL3 A;  4LRX C;  3FPW A;  2L1M A;  4OOL A;  3BQA A;  4BBV A;  5HL6 A;  3EOI A;  1IOU A;  4EXO A;  4GS9 B;  3OCN A;  4GHI B;  2VV6 A;  1GSX A;  4KQO A;  5G4Z A;  4EES A;  4WUJ A;  3R7W B;  1OT9 A;  1ZHH B;  3NOU C;  2VLG A;  5DFY A;  1XJ6 A;  3F1N B;  1TF1 A;  4DJ2 A;  4HP9 A;  1P9R A;  4LRZ E;  3P7N A;  3IS2 A;  3LID A;  3MJQ A;  4PAU A;  3S7N A;  3CI6 A;  2VJW A;  4NXF A;  4R6L A;  5G4Y A;  3E0Y A;  1LSV A;  4I5S A;  4HHD A;  2L0W A;  5DJU A;  3LI9 A;  5IT5 A;  2PD7 A;  3FG8 A;  4YOF A;  3IBJ A;  2VZW A;  4DJ3 A;  1Y28 A;  4QPR A;  3B42 A;  4LLO B;  5AVE A;  2QJ7 A;  3K2N A;  4GCZ A;  3PBO A;  4L9G A;  1T19 A;  2P04 A;  3KSF A;  1S67 L;  3A0V A;  4HI4 A;  3EWK A;  1ODV A;  4Y5F A;  1OT6 A;  4CLC C;  2ZMF A;  3PBR A;  3PBQ A;  4KUO A;  1TS8 A;  5F5Y A;  2O99 A;  3CUE A;  3VE4 A;  2INW A;  3MQO A;  4O8G A;  4I39 A;  3E98 A;  2Z6D A;  5TBM A;  4BBU A;  5AVF A;  3OCL A;  1UWN X;  3F1P A;  3HJK A;  3T4Q A;  4ARZ A;  1LL8 A;  3UB9 A;  1NLZ A;  2XA7 M;  2J80 A;  4MN5 A;  1OTI A;  4DMZ A;  4I3I A;  2PYR A;  1S4S A;  4Q0I A;  2BAS A;  1BYW A;  4BBT A;  4FOF A;  4Q0J A;  3NOT C;  1LT0 A;  4GW9 A;  3MR0 A;  4GJ4 A;  2H28 A;  2VKS A;  4ARZ B;  3T4S A;  3EQV A;  1TD5 A;  3PBT A;  2K7S A;  3LUQ A;  3JVU A;  1VB6 A;  3H82 B;  4NXE A;  2GX5 A;  3T4L A;  4MMN A;  5KIZ A;  3TW8 A;  4HIA A;  3EQU A;  4YNR A;  3C30 A;  1DP9 A;  3RH8 B;  2VGL S;  4CLC B;  4P6Z S;  1X0O A;  2PR5 A;  1OTB A;  1XFN A;  1OTD A;  1V9Y A;  1GSW A;  3C8C A;  3E4O A;  2O9A A;  5CX7 A;  2B18 A;  3HJI A;  4O0P A;  4WEK A;  5HDD A;  1KOU A;  4HNB A;  3V67 A;  4RQ9 A;  4HP4 A;  5F6A A;  1GSV A;  1T1A A;  2QWS A;  3PBN A;  2CMN A;  4IJG A;  2K31 A;  3ULF A;  3S7Q A;  3KYZ A;  2JKT I;  2J3T C;  4Y2F A;  2OOL A;  1XJ3 A;  2Z6C A;  3E4Q A;  1YSQ A;  4PHT A;  3EEA A;  1W63 Q;  3BWL A;  4WEL A;  3LR0 A;  3R4K A;  3C2W A;  4Y3I A;  4XT2 B;  3DBA A;  1F5M A;  4NXG A;  3LYX A;  1V9Z A;  5HWT A;  2Y79 A;  3LR5 A;  4LRY C;  4IUK A;  5IS1 A;  3KSI A;  3KSG A;  1OTE A;  4MDZ A;  1OJ5 A;  2V0U A;  2PR6 A;  4H6J A;  3MF0 A;  2W0N A;  3T4O A;  5MC7 A;  3UB6 A;  1D06 A;  1TS6 A;  3ZYT A;  4PKY A;  2QHK A;  2EA9 A;  3HCY A;  3OOV A;  1W63 M;  4BWI A;  1G28 A;  2VV7 A;  5HD3 A;  2JHE A;  3BQ8 A;  4LPZ A;  4G3W A;  4EEU A;  4ETZ A;  2EWV A;  1LSW A;  5I5L A;  2O0Y A;  3CUE C;  3LFV A;  1P97 A;  3EEH A;  2A2L A;  2M1C A;  4II7 A;  2HJE A;  4NEE D;  4HH3 A;  1F9I A;  2OWJ A;  2J3W A;  5HDS A;  3PBS A;  2D02 A;  1T18 A;  3EGD C;  3C38 A;  3OC2 A;  4EW7 A;  3IS2 B;  3GDI A;  2ZMV A;  2KDK A;  4L9E A;  3F1O A;  3UE6 A;  4E04 A;  2LB9 A;  4EQ1 A;  2WKQ A;  4KQD A;  4Z1W A;  5J7E A;  5HPI A;  2GZA A;  3VE3 A;  2XA7 S;  2PDR A;  1H8M A;  3K3D A;  5KSH A;  3KX0 X;  4HJ4 A;  2LB5 A;  3MQ0 A;  1P0Z A;  2K2N A;  3F1O B;  3NOP C;  4WF0 A;  2W1T A;  4DN0 A;  2QJ5 A;  2D01 A;  1NRJ A;  4JGP A;  2XSS A;  4MN7 A;  4WN5 A;  5L8M A;  2V1B A;  3MFX A;  4JGO A;  5TBM B;  2DMW A;  3K3C A;  3F1P B;  2B02 A;  3CIT A;  4HH2 A;  3RTY A;  1MC0 A;  1OTA A;  2NUT C;  1STZ A;  2ZOH A;  3BY9 A;  2W3H A;  2JKT M;  4OOM A;  3NJA A;  2GNX A;  3PR6 A;  4GLQ A;  4EEP A;  5A8B A;  2I9V A;  4I38 A;  3LR3 A;  5HSQ A;  3UMD A;  3OBF A;  2VV8 A;  3LIC A;  3CLO A;  3GEC A;  1YAX A;  3IBR A;  4L9F A;  3MQQ A;  4R70 A;  5AJG A;  3OLO A;  4HOI A;  3T4J A;  1F98 A;  2O9C A;  3NHQ A;  3B33 A;  1OJG A;  2PHY A;  2OAQ 1;  5DFX A;  4I3A A;  4CQH A;  2PYP A;  4ZRR A;  1T1C A;  4AFI A;  5J3W A;  3TE8 A;  3LIF A;  3H9W A;  3T4T A;  1YKD A;  4G3V A;  4MCW A;  3BY8 A;  2W27 A;  1EW0 A;  3T4K A;  2VA0 A;  1DRM A;  3KO6 A;  2W1R A;  3A0S A;  2M7U A;  3JVV A;  2P7J A;  1T1B A;  2XRO A;  5C5K A;  5EFW A;  1NWZ A;  1S1Y A;  2GJ3 A;  2HJ9 C;  4NKP A;  3UE3 A;  4CLC D;  3MMH A;  4GS9 A;  4MN6 A;  4R38 A;  4JGR A;  4Q0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...