2M7VA

Green light-absorbing state of tepixj, an active cyanobacteriochrome domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
165
structure length
165
Chain Sequence
MAAVQLSELRDRQAIFETLVAKGRELLACDRVIVYAFDDNYVGTVVAESVAEGWPQARDQVIEDPCFREHWVEAYRQGRIQATTDIFKAGLTECHLNQLRPLKVRANLVVPMVIDDQLFGLLIAHQASEPRQWQEIEIDQFSELASTGSLVLERLHFLEQTIASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methyl-accepting chemotaxis protein
publication title Structural and Flexibility Variations Between the Ground and Photoactivated States of a Blue/Green Light-Absorbing Cyanobacteriochrome
rcsb
source organism Thermosynechococcus elongatus
molecule tags Signaling protein
total genus 28
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2m7vA00
3R4KA 2O9CA 4Q0HA 3S7NA 3RFBA 4YNRA 2VKSA 2K31A 4GW9A 3D3OA 2W3HA 3EEAA 2LB5A 3KSIA 1YSQA 3NOUC 3LFVA 3W2ZA 4R6LA 4DN0A 3OBFA 5HSQA 4MDZA 2VZWA 4ZRRA 4O01A 2M7UA 2VEAA 1ZTUA 4Q0IA 5L8MA 3E98A 1TD5A 2G7UA 2VJWA 3O5YA 2W3FA 2O0YA 4GLQA 4G3KA 5C5KA 2O9AA 4LRZE 3IBJA 2XROA 3S7OA 2XSSA 4IUKA 2ZMFA 2O9BA 2KLIA 5TJJA 3KSHA 4Z1WA 3ZQ5A 1STZA 2W1RA 2W1TB 1VHMA 2M7VA 3KSGA 2Y8HA 5AJGA 3KO6A 4Q0JA 2GX5A 3S7PA 2LB9A 5LBRA 3OOVA 4O8GA 5HPFA 2W1TA 1YSPA 4YOFA 5DFXA 4EUVA 4MN7A 5HPIA 4Y2FA 3DBAA 1MC0A 4G3WA 4QPRA 4R70A 2QYBA 2W3DA 4MCWA 3E0YA 1F5MA 3IBRA 1TF1A 2Y79A 3BJNA 2B18A 4Y3IA 4FOFA 5HL6A 3CITA 4LRXC 4ETXA 3HCYA 4Y5FA 4PAUA 5DFYA 4CQHA 4IJGA 3G6OA 1YKDA 3KSFA 4EU0A 5K5BA 3TRCA 3NOPC 2K2NA 2XRNA 4LRYC 3VV4A 2KOIA 4RQ9A 3NOTC 4IUHA 4MMNA 3MF0A 1MKMA 4DMZA 2W3GA 4ETZA 4O0PA 3S7QA 3NHQA 5I5LA 4ME4A 2HGVA 2W3EA 2OOLA 3CI6A 3C2WA 4BWIA 3K2NA 4E04A 2O99A 4G3VA 2IA2A 3MMHA 3MQ0A
chains in the Genus database with same CATH superfamily
4JGRA 1W7FA 5FASA 4ZJ3A 2OWJA 3ZVTA 1XFQA 2K7SA 2XEPA 1CI9A 2IWBA 2HF6A 2LB5A 3VP4A 1XA7A 3OCLA 1OTEA 1XX2A 1W5DA 2JC7A 4HJ6A 3DTKA 4EESA 1ZTUA 1TD5A 1PWDA 1EI5A 4I39A 3OPLA 4S2NA 2O9BA 4YWZA 1TEMA 1TVFA 5AJGA 4BBUA 4PMAA 4WYYA 5HD5A 1OPXA 2WKIA 1BYWA 3TJZC 4CJNA 5DFXA 4LFUA 2GZAA 3IF6B 2A49A 1CI8A 1IYQA 2ZC4B 3HUOA 2FH5A 1EWZA 3QP4A 3V5MA 4PHTA 1DJBA 2HPBA 2R78A 5FDSA 5KSHA 4B9OA 1LSXA 4HJ4A 1LL8A 3WRZA 1ESUA 4I38A 4GZBA 1E25A 4PPRA 1NY0A 4OPZA 4PM6A 1S0WA 3VV4A 3H82A 1SHVA 4OQIA 5CEBA 1P0ZA 3LIEA 4H6JA 3JPUA 2Y2PA 4Y15A 3HREA 2VGJA 3FWLA 1YMSA 2RL3A 1CK3A 2O99A 2W0NA 2INWA 2Z6DA 5IT5A 1OTBA 1MBLA 3ZG7B 2J3WA 4E3LA 4OLDA 2I9VA 3BY8A 2Y2IA 2ZBBA 5F68A 2WADA 3QP5A 3ICYA 1IYSA 1YM1A 4C75A 4ZRRA 2XR0A 1T19A 4DJ3A 2P08A 4X68A 4ZJ1A 1K55A 2PR5A 4L0LA 1L0DA 4BMWA 2JHEA 3IWOA 4QB8A 3K3DA 4WELA 3BW6A 2V8CA 4KQOA 1YQSA 2GJ3A 3D72A 2Y2QA 3M2JA 4EXOA 3SH7A 3CAXA 4GJ4A 1U60A 1OT9A 1Z09A 3VFFA 1K56A 2KDKA 1YLPA 1C3BA 1PZPA 2E8JA 4DE2A 1T1AA 1W79A 3A3FA 3UNWA 1JWVA 3SH9A 3A3DA 2X71A 4DJ2A 2J3TC 5G4ZA 2ZQ9A 4HQAA 5GLBA 1XJ2A 3KSFA 3V3SA 1HZOA 3QNCA 4OVDA 1AWIA 1NWZA 3KYQA 1NLYA 3IHBA 1TDGA 4BL3A 2QJ5A 3BFCA 3FKWA 1ACFA 1WA9A 1MKMA 4I3JA 1RP5A 4WM9A 5F6AA 4OP5A 4OOLA 3H82B 5DF8A 1G28A 4OPYA 2XK1A 3O86A 4FH2A 3B33A 1BLHA 2C6WB 5HWVA 1S4SA 3PR6A 2D01A 3F1OA 3HUNA 4P0MA 2HDRA 3QP2A 1X0OA 2K31A 4GW9A 4OOYA 4CLCE 1RCJA 3D3OA 3T1SA 2VV7A 2H28A 1QMEA 1UGUA 3NDGA 1I2SA 1D7EA 3LI8A 4E3NA 4LENA 4MLLA 4BL2A 5TJJA 2ZC6B 4P6ZS 2EWWA 4QHCA 5FSRA 3OC2A 2RCXA 3KO6A 1O7EA 1MWSA 4JF4A 4MBFA 4H8RA 4PM7A 1T18A 3WWXA 2I72A 5HPIA 3B3XA 1MXOA 1BLCA 2W3DA 2XF3A 4NETA 1KE4A 1ERMA 4HJ3A 1NRJA 3IBRA 2ZC5B 4JGPA 1XGIA 3B47A 1SDNA 1BT5A 3BFEA 1OTIA 4DE3A 1PFLA 5KSCA 5CGWA 3LY4A 1CJFA 3C7UA 3PBRA 4CLCC 1T1BA 2WKHA 1YMXA 4HHDA 3WS4A 3IWIA 3FPWA 4OOMA 3W4QA 4Q8IA 1L2SA 3C4OA 2P9VA 4E04A 2QKPA 3T4QA 3F1PB 4MN6A 4OLGA 3R4KA 2O9CA 1BSGA 1BULA 4HESA 3FKVA 1QMFA 3Q1FA 1K25A 3UB7A 5KZHA 3N6IA 1PZOA 4BD0A 3OBFA 5A92A 1SKOA 1O07A 2P04A 2O0YA 3D9YA 4ARZA 4D60A 3RXXA 4L9EA 3AGDA 3N8RA 4Y0TA 3NIAA 4UEYA 4NXGA 3A0SA 4E3JA 4IUKA 4R4RA 3GQZA 3ZGAB 3T1RA 3HLDA 4HH2A 1ONHA 1VHMA 1BLPA 2J9PA 3FG8A 3N4IA 4B4XA 2JE5A 2AVXA 3RJUA 2J80A 2W1TA 4EUVA 4E3KA 1PW8A 4BBVA 3BLSA 2HDQA 4Y2FA 4OP8A 1BZAA 2IWDA 3BY9A 1FIKA 4LCMA 5FI6A 4K0WA 4X56A 2XA7M 2QYBA 2R9XA 3ISGA 4S2IA 3DTIA 1F5MA 1TF1A 3EQUA 4C6YA 4F3LA 3VP1A 2Y2NA 3U2AA 3LYXA 4FCFA 4DDSA 3QHYA 4WEKA 2VGLM 3TRCA 3G32A 2XFSA 4QY5A 2MJ6A 3OLOA 4F94A 4OQHA 2Y91A 1PIOA 3VOLA 4B88A 3MZFA 2ZM0A 4MMNA 2JKRM 3KYZA 2IWCA 2Y55A 3HJKA 3K2NA 4EQIA 5HWWA 1MPLA 3OCNA 1JVJA 1IYPA 2H0TA 4GKUA 4EWFA 2JN7A 1K6RA 2QZ6A 3G2YA 3RFBA 2VKSA 2DMWA 3A3EA 1XP4A 4CLCD 2P9VB 1NZOA 5G4YA 4GN2A 4DE1A 1D06A 1BTLA 5HX9A 2OWHA 4I5SA 1PWCA 5DF9A 1W63M 4IBRA 1LL9A 4S2PA 3E4QA 5JYOA 3P7NA 3JYIA 4DE0A 3L7HA 2ZC7A 2VGKA 3MXQA 5HDCA 4JXVA 5AVFA 1TDLA 3P09A 4ARZB 2WK0A 4R23A 3VMAA 3MQQA 4LCLA 4I3IA 3OZHA 4G3WA 3UE0A 4R70A 4RVAA 1FCNA 5GLAA 3IF6A 3HBRA 2EX8A 1W63Q 3PHYA 3ZG0A 3LGOA 4UQIM 3ZHHA 4RX3A 1TS7A 4MBHA 4KQRA 3DTEA 3WS5A 2QJ7A 5BOHA 1UWNX 3IX3A 1K54A 3IHAA 5CTMA 5IU1A 4S2JA 2KOIA 4F3LB 2EA9A 1GA0A 2EX2A 4QJGA 4IUHA 1DJCA 4QWOA 3S7QA 1JWZA 5IS1A 4O7DA 1HLUP 4BD1A 2JCHA 3T12B 3CHWP 4BENA 4NKPA 3LICA 4FSFA 3DWZA 2HJ9C 4JXGA 3LR5A 5I94A 2OAP1 3LEZA 1Z6FA 4MNRA 4X6TA 3UPPA 2ZD8A 1GCEA 4XUXA 3BRMA 3ZNTA 3G31A 2VJWA 5HAPA 4HEFA 2WGWA 5E2GA 4N1XA 5EPHA 1MWUA 4U0TA 1DJAA 4OQGA 5MC7A 3LR3A 4JXSA 1MKIA 1N9LA 1S1YA 4WN5A 5FEFA 2LB9A 4KUOA 1ERQA 3IQAA 1XKZA 5CXWA 4K08A 3WS1A 1WYCA 4WL9A 2OLUA 2L4RA 2Z6CA 3VOZA 2J8YA 3PBQA 4FTXA 4NEED 3T1XA 4E3IA 3CITA 5TR7A 1BUEA 3BFGA 4IJGA 1L0EA 1W8YA 3RXWA 5CGXA 2HV1A 3LO7A 3PBSA 2VX8A 2XRNA 5EVIB 3NI9A 3NC8A 3T4TA 3C30A 3K3CA 3FZCA 1XJ4A 4PM5A 1K56D 3FPVA 4O0PA 4ME4A 3M6BA 5D3OA 4OONA 4GCZA 5U47A 3MQ0A 2CC1A 3IF5A 4Y13A 4Q0HA 4PKYA 1RGZA 2KX6A 3GSGA 3UN7A 3T4SA 3S1YA 1Y4OA 3LCEA 3CG5A 1ZG6A 3KYEA 3E2KA 1CEFA 5L09A 5IHVA 4B93A 4U3TA 2PRFA 3ZG8B 4O01A 2E8IA 2ZOIA 5HARA 2V20A 5L8MA 3DAVA 3PBOA 2Y2GA 4MBKA 2XD5A 2XH9A 2L1MA 4LRZE 2CMNA 3MR0A 5KMWA 2V1BA 4Z1WA 3C8CA 4KUKA 2HP6A 1K6SA 1KOUA 4WF0A 4FH4A 2OAQ1 3BM6A 4PKYG 4XUZA 2WGWB 1T1CA 2Y2KA 3M6HA 3MQOA 1XPBA 1FR1A 4JKTA 2ZQ8A 4KG5A 5EE8A 3BQAA 1S67L 4R3BA 2ZQAA 3ITAA 3GRJA 3HLWA 2Y2MA 4LV1A 3SS3A 3CLOA 2EX6A 3PTEA 5F69A 3RH8B 5CTNA 4EERA 1Y54A 4IVKA 3BQ8A 2PYRA 2R9WA 4X1MA 3NOTC 2W3GA 4HP4A 4ETZA 5FEGA 5AQBA 1OTDA 2G2UA 4EEPA 4S2OA 5GHZA 3LI9A 5F83A 4HP9A 1KGFA 2V0UA 2HP5A 1LI9A 2Y2JA 1GSXA 3F1PA 3DTMA 2W3HA 2XDMA 3VSLA 4HY8A 4NK3A 4UA7A 3MFXA 3W2ZA 5J3WA 3FV7A 1GSWA 3H7WA 1H0MA 1PW1A 3MSHA 1S4RA 3VP3A 5TFQA 4BJPA 2O9AA 4RYEA 1M6KA 2YKFA 1H8MA 4Y7PA 1YPRA 1N9OA 3IT9A 3IWQA 1E3UA 3HVFA 3ITBA 2OV5A 3TG9A 3WRTA 4WMCD 5E2EA 4O8GA 5L10A 1YSPA 4EBPA 1IEMA 5A8BA 1LL5A 4WZ4A 2XD1A 5GL9A 2XFTA 1XJ6A 4MCWA 1SKFA 5EV0A 5FQQA 2L0WA 1TS8A 1MWRA 5DJUA 5TBMA 2BASA 4KZ9A 3T4KA 3MFDA 2NUPC 4QD4A 1G5UA 2OSUA 3EGXC 1P9RA 3IF6C 3EQVA 3C4PA 1NXYA 3NOPC 2WUQA 1K57A 4R0QA 1A0KA 2WKEA 4WZ5A 2WAEA 1I5QA 3MF0A 3HJIA 2H0YA 5JYPA 4NXFA 1VETA 2V1ZA 3HLCA 4I3AA 2X01A 5HL1A 5DTTA 4UHUA 2PBYA 4GHIB 5G18A 3UMEA 5F5YA 2H5SA 2M1CA 4L9FA 4DF6A 1J3WA 3QNBA 3SH8A 4C3QA 5EECA 1Q2QA 1S6RA 3NOUC 2DNSA 1F98A 4NXEA 3MXSA 3MZEA 2M7UA 2VEAA 3TW8A 1AXBA 3GTCA 4JBFA 1VEUB 1K4FA 5FQMA 2Y4AA 4WMCA 3S7OA 4II7A 2XSSA 2Y2LA 3SOIA 4DXCA 3ZQ5A 4XT2B 3A3JA 3H7WB 2WZZA 1GHMA 1YLYA 3Q07A 4YOFA 3SZTA 4GNUA 4IHQA 4QPRA 3NECA 3CWFA 3LR4A 3MKEA 2JBFA 1CQAA 2Z2MB 1G6AA 2P74A 4FOFA 4LRXC 1L3LA 1OMEA 4N92A 1JTGA 4DDYA 2JKRI 4S2NC 2P7JA 5M19A 1ZKJA 4QY6A 5TBMB 3NJAA 1NLZA 2BLSA 2PD7A 3G2ZA 5M18A 3QP1A 3CZDA 2OOLA 1SZVA 1N9NA 4G3VA 2IA2A 4ZBEA 3UB9A 3LIFA 5CGSA 3ZYTA 3S7NA 5EVID 2PAVP 1VETB 4GB7A 2Q9NA 4DN0A 5CHMA 4L9GA 2ZMAA 4R4SA 5CHUA 1WYBA 1ODVA 4X69A 1CF0A 4YFMA 1LI0A 5C5KA 4NXBA 5CEDA 1W8QA 1XGJA 1L0GA 3IXDA 2PD8A 2PU2A 3KSHA 4B4ZA 2XA7S 2JKFA 3Q7VA 4EBNA 3NCKA 2V9AA 2JKTM 3RTYA 4DXBA 3GECA 5FDHA 3BWLA 3EWKA 4UA6A 4RA7A 1GHIA 5FL3A 1DRMA 2HDUA 5J7EA 1LT0A 3S4XA 5A93A 5AVEA 2B02A 3PAEA 2Y2HA 5HL6A 4ETXA 1H5XA 3HCYA 1K55C 1FILA 4KQQA 1PYYA 4X25A 1YLWA 1RGYA 1PI4A 3G6OA 2EX9A 4KZ8A 1IKIA 2JKGA 4HIAA 4R38A 2DRWA 3PBTA 4PM8A 3U4LP 1Q2PA 2PT7A 3I7JA 5TGFA 3LIBA 3C7VA 2PHYA 3GV9A 4Y0OA 3CUEA 3UB8A 3DW0A 2FZ0A 4KZ3A 3C5AA 2ZQDA 4DMZA 4AFIA 3VE3A 2WAFA 4X53A 5EVIA 5L07A 5DTSA 2V1AA 3G30A 3MZDA 3CI6A 4BWIA 1ESIA 4E3MA 4P87A 5EM0A 1G68A 2PDRA 4N9KA 4GS9A 1XFNA 4P6BA 2ZL1B 4ZTKA 3UPOA 2WYXA 1PWGA 2FFFB 3IX8A 4JF6A 4LV0A 3NULA 2VLGA 3LFVA 3N8SA 1LSWA 5HZHA 1ES3A 1YAXA 1J9MA 5HDDA 5FQ9A 3Q81A 2ZMFA 2KLIA 4KZ5A 4R3AA 1STZA 1N4OA 3FYZA 3WS0A 2VV6A 2M7VA 4GD8A 3HLFA 4UQIS 2EWVA 3S7PA 3D4FA 3JVVA 3DWKA 4BLMA 5CECA 5DF7A 4E3OA 1YLZA 3Q7VB 4LV2A 5DJTA 1XA1A 4KG6A 3A0RA 3W8KA 1E4DA 3NBLA 3UY6A 2A3UA 2PBDP 4EBLA 1EW0A 3EEHA 2GNXA 5CX7A 2V0WA 4XXRA 4HOIA 4LGWA 4GDBA 4KENB 2ACGA 2WGVA 3VOYA 1H8ZA 4PM9A 2BG1A 4JLFA 3H9WA 2HGVA 1K57C 3M2KA 1CEGA 4WZ5C 3SS4A 1DY6A 1TS6A 2VK3A 1DP9A 1VM1A 1N9BA 3N7WA 2ZQCA 2PU4A 3MJQA 1HD8A 1NYMA 5HWTA 5E2HA 3A0VA 5HSQA 4D2OA 1M40A 3UB6A 2OLVA 2HDSA 1V9YA 1KVMA 3F1NB 3IH8A 4GS9B 4U0XA 2W3FA 3V39A 4M3KA 1JNUA 4N1HA 1P97A 4E6XA 5E43A 3TOIA 2XGNA 2H10A 1SDEA 2C5WB 1H8YA 4HBUA 3IXGA 1OJGA 5LBRA 3OOVA 5FQKA 3EGDC 2QPNA 1DP8A 3GDIA 3G35A 5HAIA 5DVAA 4OPQA 3DBAA 1MWTA 2X02A 5HDSA 4CLCB 3VSKA 2DCFA 3BJNA 3FC7A 4EEUA 4WLAA 2V2FF 4Y3IA 1KVLA 3E2LA 3W4OA 5DFYA 2HJEA 4EETB 1NJ4A 4S2MA 3ZCZA 1FCMA 4ID4A 5K5BA 1E3UD 4Y0UA 3UDXA 3OPRA 4Y17A 5AQ9A 2J9OA 3VP0A 2G2WA 5EM1A 3LEQA 1YT4A 5EVEA 1VQQA 1XJ3A 1K0KA 1D1JA 5I5LA 3UO9A 2PYPA 5FAPA 4BQMA 1KGEA 4HNBA 3VFHA 4EW7A 4ZDXA 4K91A 4GHIA 1TS0A 4Z9QA 4ZJ2A 3EEAA 3T4OA 4UAAA 3R7WA 3BLMA 4MDZA 4LLOB 3OPHA 3AGEA 3V3RA 1FSYA 4Q0IA 1H3QA 3E98A 3O5YA 5EUAA 3VE4A 2J7VA 3IBJA 3C38A 3CPTA 2XROA 1ALQA 1VEUA 3ZNYA 3S22A 4X1LA 2W1RA 4KQDA 3QP8A 1GSVA 3KSGA 3VP2A 5FI2A 1PRQA 3HLBA 2A24A 4OH0A 4Q0JA 5DTKA 2GX5A 4OQ0A 3IXBA 4JPMA 1IOUA 4XT2A 5AQ7A 5FI7A 5L2FA 1IYOA 1EROA 2HP9A 5FATA 4KZBA 5F1GA 4P6ZM 3HUMA 3E0YA 3IXHA 2Y79A 1MY8A 4LPZA 2QWSA 4CQHA 5F1FA 3LIDA 3IS2A 4KZ4A 1KDSA 2NUTC 4N9LA 3L9KA 1VB6A 3E4OA 4HH3A 4H6JB 5FAQA 4EU0A 1GHPA 5M1AA 2GDNA 3ZG5A 3NDEA 2ZM8A 4CPKA 4BBTA 3MS6A 2D02A 4KZ7A 5FQJA 5HW3A 3NHQA 2W3EA 4R1GA 4M4XA 3HL9A 1I2WA 5HFOA 3MMHA 4ESPA 3CUEC 3N8LA 3BECA 3G34A 2ZOHA 3UMDA 5EVIC 2XLNA 2VV8A 4DKIA 3EOIA 4HI4A 5CRFA 3MBZA 2EFXA 1MZUA 4KZ6A 1ONGA 4R3JA 2ZM2A 1ZG4A 1K54C 1P9WA 5F82A 1S1ZA 5KIZA 4EV4A 2YKHA 2EXBA 5A91A 3GR2A 2WGIA 3R7WB 4E6WA 3ZFZA 1ES5A 3O87A 1IFQA 3PBNA 2Y8HA 3UB5P 1XXMA 4EUZA 2ZC3B 1OJ5A 2BTFP 3CPTB 2ZQ7A 4NG2A 4WBGA 1YLJA 1HVBA 2A2LA 5A90A 2A24B 3P01A 5CERA 4KG2A 1NYYA 2B18A 5HD3A 3O3VA 3UE1A 4Y5FA 1FSWA 1YLTA 2J3TD 3G4PA 3TSGA 3UPNA 3ZVWA 2WZXA 3LR0A 4S2KA 4LRYC 4MN5A 1V9ZA 3AGFA 1LSVA 5J4EA 4RQ9A 3IS2B 5EFWA 5FAOA 2B95A 3BFFA 5EVLA 3F1OB 2V8FA 3C2WA 4GD6A 3B42A 4IEDA 3SW1A 1ES4A 1NRFA 2PR6A 1IKGA 1SCWA 4QU3A 1BLSA 3UE6A 3MXRA 4JGOA 2W27A 1F9IA 2ZMVA 4IBXA 2EXAA 3KSIA 1YSQA 1K38A 4R6LA 2EFUA 2ZL1A 3JVUA 1KE3A 3V67A 4A5RA 4GOGA 4JGQA 2JKTI 5J8XA 4WEJA 3Q7ZA 4GLQA 4JXWA 5E2FA 4FD8A 3UE3A 2XQZA 4K0XA 1Y28A 1PI5A 3T50A 3PXPA 1HTZA 1NZUA 1FOFA 3CMZA 2WKPA 4JF5A 3OPPA 4RX2A 3HLGA 3MKFA 3NY4A 3PYPA 3WS2A 3UDIA 4GDNA 4IVIA 5GHXA 4UA9A 5GLDA 5CHJA 4YINA 2QMIA 1PNEA 5GHYA 2HZ5A 1KGGA 4PAUA 4HBTA 1FQGA 2Y2OA 3O88A 2WKRA 1YKDA 4KZAA 5AQAA 3W4PA 4EQ1A 5DKKA 1ZHHB 2VGLS 2Z2LB 5HAQA 4LV3A 4ZAMA 3ULFA 5EOOA 4OKPA 4FUWA 3IX4A 4X55A 5GLCA 2WKQA 4S2LA 3E4PA 3V50A 4YNRA 3HLEA 4OPRA 1SKOB 2UWXA 3P98A 4P85A 2FFYA 3CJMA 1OTAA 2VZWA 1ES2A 1K4EA 1FCOA 3KX0X 1F2KA 2G7UA 4G3KA 5DKLA 3T4LA 1FR6A 5FQIA 3F1NA 3QP6A 3SS5A 3BEBA 1JWPA 2ZLYA 2W1TB 1DP6A 2VA0A 2Y59A 1JTDA 3LIAA 3ZDJA 2ZJ9A 3T1QB 5HPFA 3LY3A 5FA7A 3BFDA 2Q0OA 4MN7A 1LHYA 3PAGA 1MC0A 3IH9A 1IELA 1UWPX 2UV0E 1KE0A 4CLCA 1GA9A 1WE4A 3GMWA 4DRTA 5EOEA 3TE8A 3UDFA 3LUQA 1G6OA 2K2NA 3ZG9B 1ZC2A 3T4JA 3GVBA 1OT6A 1KDWA 2Q9MA 3Q82A 4WUJA 2B5RA 2QHKA 4MEZA 3BYDA 1L0FA 1S66L 3A3IA 1LLBA
chains in the Genus database with same CATH topology
4GHIB 4JGRA 2JN7A 2OWJA 5F5YA 3UMEA 2M1CA 4HNBA 1XFQA 4L9FA 3RFBA 2VKSA 4EW7A 2DMWA 2K7SA 4CLCD 4GHIA 1TS0A 3EEAA 2HF6A 2LB5A 3T4OA 5G4YA 3NOUC 3R7WA 1F98A 4NXEA 3OCLA 1D06A 1OTEA 4MDZA 4LLOB 4HJ6A 2M7UA 2VEAA 4EESA 1ZTUA 2OWHA 4Q0IA 1H3QA 4I5SA 3TW8A 3E98A 1TD5A 3O5YA 5DF9A 1W63M 3VE4A 3E4QA 3IBJA 3C38A 3P7NA 2XROA 4I39A 4II7A 3S7OA 2XSSA 2O9BA 3ZQ5A 4YWZA 2W1RA 4XT2B 4KQDA 1GSVA 3KSGA 3MXQA 3H7WB 5AJGA 4BBUA 2A24A 5HDCA 4Q0JA 5AVFA 4ARZB 5HD5A 2GX5A 1OPXA 1IOUA 1BYWA 4XT2A 3TJZC 4YOFA 5DFXA 2GZAA 3MQQA 4I3IA 4IHQA 4G3WA 2FH5A 4QPRA 4R70A 3CWFA 3LR4A 4P6ZM 4PHTA 3E0YA 2Y79A 3PHYA 1W63Q 2R78A 4UQIM 4LPZA 5KSHA 2QWSA 4FOFA 4B9OA 4LRXC 1TS7A 1LSXA 4HJ4A 4CQHA 1LL8A 3LIDA 3IS2A 2JKRI 4I38A 2QJ7A 2NUTC 2P7JA 1VB6A 3E4OA 4HH3A 4H6JB 4EU0A 1UWNX 3VV4A 3H82A 5IU1A 2KOIA 4F3LB 2EA9A 4BBTA 5TBMB 1P0ZA 3NJAA 3LIEA 1NLZA 4H6JA 2D02A 4IUHA 2PD7A 3S7QA 3NHQA 2W3EA 5IS1A 2OOLA 2O99A 1N9NA 4G3VA 2IA2A 2W0NA 2INWA 4M4XA 3UB9A 3MMHA 2Z6DA 3CUEC 4NKPA 3LICA 3LIFA 5IT5A 4FSFA 1OTBA 2HJ9C 2ZOHA 3S7NA 2J3WA 3UMDA 3ZYTA 3LR5A 2VV8A 2OAP1 2I9VA 3BY8A 3EOIA 4HI4A 2ZBBA 5F68A 1MZUA 3ICYA 4DN0A 4L9GA 4ZRRA 1ODVA 1T19A 1P9WA 2VJWA 4DJ3A 2P08A 1S1ZA 5KIZA 5C5KA 4NXBA 2PR5A 2YKHA 4L0LA 4BMWA 2JHEA 3K3DA 4WELA 3BW6A 3R7WB 4KQOA 2PD8A 3KSHA 2GJ3A 3D72A 2XA7S 1IFQA 3PBNA 5MC7A 2V9AA 2JKTM 2Y8HA 3LR3A 3RTYA 4EXOA 3CAXA 4GJ4A 1N9LA 3GECA 1S1YA 4WN5A 2LB9A 1OT9A 4KUOA 1OJ5A 3BWLA 3EWKA 2KDKA 4K08A 5FL3A 1DRMA 5J7EA 1LT0A 2A2LA 1T1AA 4WL9A 2A24B 5AVEA 2L4RA 3P01A 2B02A 2Z6CA 2B18A 3PBQA 5HD3A 4DJ2A 4NEED 5HL6A 3CITA 4ETXA 2J3TC 3HCYA 4Y5FA 2J3TD 4HQAA 5G4ZA 1XJ2A 4IJGA 3G6OA 3KSFA 1NWZA 3KYQA 4HIAA 2HV1A 3PBSA 3LR0A 4R38A 3PBTA 1NLYA 2VX8A 2XRNA 4LRYC 4MN5A 2PT7A 1V9ZA 3LIBA 1LSVA 2PHYA 3UB8A 3CUEA 5J4EA 4RQ9A 2FZ0A 3T4TA 3C30A 2QJ5A 3K3CA 1XJ4A 1WA9A 3IS2B 5EFWA 1MKMA 4DMZA 4AFIA 3VE3A 4I3JA 3FPVA 4O0PA 2V1AA 4ME4A 5F6AA 3F1OB 3CI6A 3C2WA 4BWIA 3B42A 3SW1A 2PR6A 4GCZA 3H82B 4OOLA 3MQ0A 1G28A 3B33A 5HWVA 1S4SA 2PDRA 3PR6A 2D01A 3F1OA 4Q0HA 4GS9A 4PKYA 3UE6A 2KX6A 4JGOA 2W27A 1XFNA 1F9IA 1X0OA 2K31A 4GW9A 2ZMVA 3T4SA 4CLCE 3D3OA 3KSIA 1YSQA 2VLGA 3LFVA 1LSWA 4R6LA 2VV7A 4B93A 2H28A 3JVUA 3V67A 1UGUA 5HZHA 1YAXA 4O01A 4JGQA 2JKTI 2ZOIA 5L8MA 4WEJA 3PBOA 4GLQA 5HDDA 1D7EA 3LI8A 2L1MA 4LRZE 3UE3A 2CMNA 3MR0A 2ZMFA 1Y28A 2KLIA 2V1BA 4R3AA 4Z1WA 5TJJA 1STZA 3C8CA 4KUKA 2VV6A 3T50A 4P6ZS 1KOUA 2EWWA 3PXPA 4WF0A 2OAQ1 2M7VA 3OC2A 3KO6A 4UQIS 4PKYG 1T1CA 2EWVA 2WKPA 3S7PA 1T18A 3MQOA 3JVVA 5HPIA 3BQAA 1S67L 3PYPA 5DJTA 3A0RA 2W3DA 4HJ3A 1NRJA 3IBRA 4JGPA 3B47A 1EW0A 1OTIA 4PAUA 3CLOA 3EEHA 2GNXA 5CX7A 2WKRA 1YKDA 2V0WA 5F69A 3RH8B 4EERA 4HOIA 3PBRA 4EQ1A 3BQ8A 5DKKA 1ZHHB 2VGLS 4CLCC 2PYRA 1T1BA 3NOTC 3ULFA 4HHDA 2W3GA 4HP4A 3FPWA 4OOMA 4ETZA 1OTDA 3H9WA 2HGVA 4EEPA 4E04A 2QKPA 3T4QA 3LI9A 2WKQA 4HP9A 3F1PB 1TS6A 4MN6A 1DP9A 2V0UA 3R4KA 2O9CA 3E4PA 4YNRA 1GSXA 3F1PA 2W3HA 3UB7A 3MJQA 4HY8A 5HWTA 3MFXA 3W2ZA 1OTAA 3OBFA 5J3WA 3A0VA 5HSQA 3UB6A 2VZWA 1V9YA 1GSWA 3F1NB 4GS9B 2P04A 3H7WA 3KX0X 2W3FA 2G7UA 2O0YA 4G3KA 1S4RA 4ARZA 1JNUA 5DKLA 3T4LA 4L9EA 4BJPA 1P97A 2O9AA 4UEYA 4NXGA 3F1NA 2YKFA 3A0SA 1H8MA 4IUKA 1N9OA 4HH2A 2W1TB 1VHMA 1DP6A 3FG8A 2VA0A 3LIAA 1OJGA 5LBRA 3OOVA 2J80A 4O8GA 5HPFA 2W1TA 1YSPA 3EGDC 3GDIA 1DP8A 4EUVA 4MN7A 4BBVA 5A8BA 4Y2FA 3DBAA 1MC0A 5HDSA 3BY9A 1UWPX 2XA7M 4CLCB 1XJ6A 2QYBA 4MCWA 1F5MA 2L0WA 1TF1A 3BJNA 3FC7A 3EQUA 1TS8A 4WLAA 4EEUA 5DJUA 4Y3IA 4F3LA 5TBMA 4CLCA 2BASA 3T4KA 5DFYA 2HJEA 4EETB 2NUPC 3TE8A 3EGXC 3U2AA 1P9RA 3LUQA 3LYXA 5K5BA 3EQVA 4WEKA 2VGLM 3TRCA 3NOPC 1G6OA 2K2NA 3T4JA 2MJ6A 1OT6A 3OLOA 3VOLA 4WUJA 2QHKA 4MMNA 2JKRM 3MF0A 3HJIA 1XJ3A 3KYZA 4NXFA 4I3AA 5I5LA 3HJKA 2PYPA 1S66L 3K2NA 5HWWA 3OCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R4K A;  2O9C A;  4Q0H A;  3S7N A;  3RFB A;  4YNR A;  2VKS A;  2K31 A;  4GW9 A;  3D3O A;  2W3H A;  3EEA A;  2LB5 A;  3KSI A;  1YSQ A;  3NOU C;  3LFV A;  3W2Z A;  4R6L A;  4DN0 A;  3OBF A;  5HSQ A;  4MDZ A;  2VZW A;  4ZRR A;  4O01 A;  2M7U A;  2VEA A;  1ZTU A;  4Q0I A;  5L8M A;  3E98 A;  1TD5 A;  2G7U A;  2VJW A;  3O5Y A;  2W3F A;  2O0Y A;  4GLQ A;  4G3K A;  5C5K A;  2O9A A;  4LRZ E;  3IBJ A;  2XRO A;  3S7O A;  2XSS A;  4IUK A;  2ZMF A;  2O9B A;  2KLI A;  5TJJ A;  3KSH A;  4Z1W A;  3ZQ5 A;  1STZ A;  2W1R A;  2W1T B;  1VHM A;  2M7V A;  3KSG A;  2Y8H A;  5AJG A;  3KO6 A;  4Q0J A;  2GX5 A;  3S7P A;  2LB9 A;  5LBR A;  3OOV A;  4O8G A;  5HPF A;  2W1T A;  1YSP A;  4YOF A;  5DFX A;  4EUV A;  4MN7 A;  5HPI A;  4Y2F A;  3DBA A;  1MC0 A;  4G3W A;  4QPR A;  4R70 A;  2QYB A;  2W3D A;  4MCW A;  3E0Y A;  1F5M A;  3IBR A;  1TF1 A;  2Y79 A;  3BJN A;  2B18 A;  4Y3I A;  4FOF A;  5HL6 A;  3CIT A;  4LRX C;  4ETX A;  3HCY A;  4Y5F A;  4PAU A;  5DFY A;  4CQH A;  4IJG A;  3G6O A;  1YKD A;  3KSF A;  4EU0 A;  5K5B A;  3TRC A;  3NOP C;  2K2N A;  2XRN A;  4LRY C;  3VV4 A;  2KOI A;  4RQ9 A;  3NOT C;  4IUH A;  4MMN A;  3MF0 A;  1MKM A;  4DMZ A;  2W3G A;  4ETZ A;  4O0P A;  3S7Q A;  3NHQ A;  5I5L A;  4ME4 A;  2HGV A;  2W3E A;  2OOL A;  3CI6 A;  3C2W A;  4BWI A;  3K2N A;  4E04 A;  2O99 A;  4G3V A;  2IA2 A;  3MMH A;  3MQ0 A; 
#chains in the Genus database with same CATH topology
 4JGR A;  1W7F A;  5FAS A;  4ZJ3 A;  2OWJ A;  3ZVT A;  1XFQ A;  2K7S A;  2XEP A;  1CI9 A;  2IWB A;  2HF6 A;  2LB5 A;  3VP4 A;  1XA7 A;  3OCL A;  1OTE A;  1XX2 A;  1W5D A;  2JC7 A;  4HJ6 A;  3DTK A;  4EES A;  1ZTU A;  1TD5 A;  1PWD A;  1EI5 A;  4I39 A;  3OPL A;  4S2N A;  2O9B A;  4YWZ A;  1TEM A;  1TVF A;  5AJG A;  4BBU A;  4PMA A;  4WYY A;  5HD5 A;  1OPX A;  2WKI A;  1BYW A;  3TJZ C;  4CJN A;  5DFX A;  4LFU A;  2GZA A;  3IF6 B;  2A49 A;  1CI8 A;  1IYQ A;  2ZC4 B;  3HUO A;  2FH5 A;  1EWZ A;  3QP4 A;  3V5M A;  4PHT A;  1DJB A;  2HPB A;  2R78 A;  5FDS A;  5KSH A;  4B9O A;  1LSX A;  4HJ4 A;  1LL8 A;  3WRZ A;  1ESU A;  4I38 A;  4GZB A;  1E25 A;  4PPR A;  1NY0 A;  4OPZ A;  4PM6 A;  1S0W A;  3VV4 A;  3H82 A;  1SHV A;  4OQI A;  5CEB A;  1P0Z A;  3LIE A;  4H6J A;  3JPU A;  2Y2P A;  4Y15 A;  3HRE A;  2VGJ A;  3FWL A;  1YMS A;  2RL3 A;  1CK3 A;  2O99 A;  2W0N A;  2INW A;  2Z6D A;  5IT5 A;  1OTB A;  1MBL A;  3ZG7 B;  2J3W A;  4E3L A;  4OLD A;  2I9V A;  3BY8 A;  2Y2I A;  2ZBB A;  5F68 A;  2WAD A;  3QP5 A;  3ICY A;  1IYS A;  1YM1 A;  4C75 A;  4ZRR A;  2XR0 A;  1T19 A;  4DJ3 A;  2P08 A;  4X68 A;  4ZJ1 A;  1K55 A;  2PR5 A;  4L0L A;  1L0D A;  4BMW A;  2JHE A;  3IWO A;  4QB8 A;  3K3D A;  4WEL A;  3BW6 A;  2V8C A;  4KQO A;  1YQS A;  2GJ3 A;  3D72 A;  2Y2Q A;  3M2J A;  4EXO A;  3SH7 A;  3CAX A;  4GJ4 A;  1U60 A;  1OT9 A;  1Z09 A;  3VFF A;  1K56 A;  2KDK A;  1YLP A;  1C3B A;  1PZP A;  2E8J A;  4DE2 A;  1T1A A;  1W79 A;  3A3F A;  3UNW A;  1JWV A;  3SH9 A;  3A3D A;  2X71 A;  4DJ2 A;  2J3T C;  5G4Z A;  2ZQ9 A;  4HQA A;  5GLB A;  1XJ2 A;  3KSF A;  3V3S A;  1HZO A;  3QNC A;  4OVD A;  1AWI A;  1NWZ A;  3KYQ A;  1NLY A;  3IHB A;  1TDG A;  4BL3 A;  2QJ5 A;  3BFC A;  3FKW A;  1ACF A;  1WA9 A;  1MKM A;  4I3J A;  1RP5 A;  4WM9 A;  5F6A A;  4OP5 A;  4OOL A;  3H82 B;  5DF8 A;  1G28 A;  4OPY A;  2XK1 A;  3O86 A;  4FH2 A;  3B33 A;  1BLH A;  2C6W B;  5HWV A;  1S4S A;  3PR6 A;  2D01 A;  3F1O A;  3HUN A;  4P0M A;  2HDR A;  3QP2 A;  1X0O A;  2K31 A;  4GW9 A;  4OOY A;  4CLC E;  1RCJ A;  3D3O A;  3T1S A;  2VV7 A;  2H28 A;  1QME A;  1UGU A;  3NDG A;  1I2S A;  1D7E A;  3LI8 A;  4E3N A;  4LEN A;  4MLL A;  4BL2 A;  5TJJ A;  2ZC6 B;  4P6Z S;  2EWW A;  4QHC A;  5FSR A;  3OC2 A;  2RCX A;  3KO6 A;  1O7E A;  1MWS A;  4JF4 A;  4MBF A;  4H8R A;  4PM7 A;  1T18 A;  3WWX A;  2I72 A;  5HPI A;  3B3X A;  1MXO A;  1BLC A;  2W3D A;  2XF3 A;  4NET A;  1KE4 A;  1ERM A;  4HJ3 A;  1NRJ A;  3IBR A;  2ZC5 B;  4JGP A;  1XGI A;  3B47 A;  1SDN A;  1BT5 A;  3BFE A;  1OTI A;  4DE3 A;  1PFL A;  5KSC A;  5CGW A;  3LY4 A;  1CJF A;  3C7U A;  3PBR A;  4CLC C;  1T1B A;  2WKH A;  1YMX A;  4HHD A;  3WS4 A;  3IWI A;  3FPW A;  4OOM A;  3W4Q A;  4Q8I A;  1L2S A;  3C4O A;  2P9V A;  4E04 A;  2QKP A;  3T4Q A;  3F1P B;  4MN6 A;  4OLG A;  3R4K A;  2O9C A;  1BSG A;  1BUL A;  4HES A;  3FKV A;  1QMF A;  3Q1F A;  1K25 A;  3UB7 A;  5KZH A;  3N6I A;  1PZO A;  4BD0 A;  3OBF A;  5A92 A;  1SKO A;  1O07 A;  2P04 A;  2O0Y A;  3D9Y A;  4ARZ A;  4D60 A;  3RXX A;  4L9E A;  3AGD A;  3N8R A;  4Y0T A;  3NIA A;  4UEY A;  4NXG A;  3A0S A;  4E3J A;  4IUK A;  4R4R A;  3GQZ A;  3ZGA B;  3T1R A;  3HLD A;  4HH2 A;  1ONH A;  1VHM A;  1BLP A;  2J9P A;  3FG8 A;  3N4I A;  4B4X A;  2JE5 A;  2AVX A;  3RJU A;  2J80 A;  2W1T A;  4EUV A;  4E3K A;  1PW8 A;  4BBV A;  3BLS A;  2HDQ A;  4Y2F A;  4OP8 A;  1BZA A;  2IWD A;  3BY9 A;  1FIK A;  4LCM A;  5FI6 A;  4K0W A;  4X56 A;  2XA7 M;  2QYB A;  2R9X A;  3ISG A;  4S2I A;  3DTI A;  1F5M A;  1TF1 A;  3EQU A;  4C6Y A;  4F3L A;  3VP1 A;  2Y2N A;  3U2A A;  3LYX A;  4FCF A;  4DDS A;  3QHY A;  4WEK A;  2VGL M;  3TRC A;  3G32 A;  2XFS A;  4QY5 A;  2MJ6 A;  3OLO A;  4F94 A;  4OQH A;  2Y91 A;  1PIO A;  3VOL A;  4B88 A;  3MZF A;  2ZM0 A;  4MMN A;  2JKR M;  3KYZ A;  2IWC A;  2Y55 A;  3HJK A;  3K2N A;  4EQI A;  5HWW A;  1MPL A;  3OCN A;  1JVJ A;  1IYP A;  2H0T A;  4GKU A;  4EWF A;  2JN7 A;  1K6R A;  2QZ6 A;  3G2Y A;  3RFB A;  2VKS A;  2DMW A;  3A3E A;  1XP4 A;  4CLC D;  2P9V B;  1NZO A;  5G4Y A;  4GN2 A;  4DE1 A;  1D06 A;  1BTL A;  5HX9 A;  2OWH A;  4I5S A;  1PWC A;  5DF9 A;  1W63 M;  4IBR A;  1LL9 A;  4S2P A;  3E4Q A;  5JYO A;  3P7N A;  3JYI A;  4DE0 A;  3L7H A;  2ZC7 A;  2VGK A;  3MXQ A;  5HDC A;  4JXV A;  5AVF A;  1TDL A;  3P09 A;  4ARZ B;  2WK0 A;  4R23 A;  3VMA A;  3MQQ A;  4LCL A;  4I3I A;  3OZH A;  4G3W A;  3UE0 A;  4R70 A;  4RVA A;  1FCN A;  5GLA A;  3IF6 A;  3HBR A;  2EX8 A;  1W63 Q;  3PHY A;  3ZG0 A;  3LGO A;  4UQI M;  3ZHH A;  4RX3 A;  1TS7 A;  4MBH A;  4KQR A;  3DTE A;  3WS5 A;  2QJ7 A;  5BOH A;  1UWN X;  3IX3 A;  1K54 A;  3IHA A;  5CTM A;  5IU1 A;  4S2J A;  2KOI A;  4F3L B;  2EA9 A;  1GA0 A;  2EX2 A;  4QJG A;  4IUH A;  1DJC A;  4QWO A;  3S7Q A;  1JWZ A;  5IS1 A;  4O7D A;  1HLU P;  4BD1 A;  2JCH A;  3T12 B;  3CHW P;  4BEN A;  4NKP A;  3LIC A;  4FSF A;  3DWZ A;  2HJ9 C;  4JXG A;  3LR5 A;  5I94 A;  2OAP 1;  3LEZ A;  1Z6F A;  4MNR A;  4X6T A;  3UPP A;  2ZD8 A;  1GCE A;  4XUX A;  3BRM A;  3ZNT A;  3G31 A;  2VJW A;  5HAP A;  4HEF A;  2WGW A;  5E2G A;  4N1X A;  5EPH A;  1MWU A;  4U0T A;  1DJA A;  4OQG A;  5MC7 A;  3LR3 A;  4JXS A;  1MKI A;  1N9L A;  1S1Y A;  4WN5 A;  5FEF A;  2LB9 A;  4KUO A;  1ERQ A;  3IQA A;  1XKZ A;  5CXW A;  4K08 A;  3WS1 A;  1WYC A;  4WL9 A;  2OLU A;  2L4R A;  2Z6C A;  3VOZ A;  2J8Y A;  3PBQ A;  4FTX A;  4NEE D;  3T1X A;  4E3I A;  3CIT A;  5TR7 A;  1BUE A;  3BFG A;  4IJG A;  1L0E A;  1W8Y A;  3RXW A;  5CGX A;  2HV1 A;  3LO7 A;  3PBS A;  2VX8 A;  2XRN A;  5EVI B;  3NI9 A;  3NC8 A;  3T4T A;  3C30 A;  3K3C A;  3FZC A;  1XJ4 A;  4PM5 A;  1K56 D;  3FPV A;  4O0P A;  4ME4 A;  3M6B A;  5D3O A;  4OON A;  4GCZ A;  5U47 A;  3MQ0 A;  2CC1 A;  3IF5 A;  4Y13 A;  4Q0H A;  4PKY A;  1RGZ A;  2KX6 A;  3GSG A;  3UN7 A;  3T4S A;  3S1Y A;  1Y4O A;  3LCE A;  3CG5 A;  1ZG6 A;  3KYE A;  3E2K A;  1CEF A;  5L09 A;  5IHV A;  4B93 A;  4U3T A;  2PRF A;  3ZG8 B;  4O01 A;  2E8I A;  2ZOI A;  5HAR A;  2V20 A;  5L8M A;  3DAV A;  3PBO A;  2Y2G A;  4MBK A;  2XD5 A;  2XH9 A;  2L1M A;  4LRZ E;  2CMN A;  3MR0 A;  5KMW A;  2V1B A;  4Z1W A;  3C8C A;  4KUK A;  2HP6 A;  1K6S A;  1KOU A;  4WF0 A;  4FH4 A;  2OAQ 1;  3BM6 A;  4PKY G;  4XUZ A;  2WGW B;  1T1C A;  2Y2K A;  3M6H A;  3MQO A;  1XPB A;  1FR1 A;  4JKT A;  2ZQ8 A;  4KG5 A;  5EE8 A;  3BQA A;  1S67 L;  4R3B A;  2ZQA A;  3ITA A;  3GRJ A;  3HLW A;  2Y2M A;  4LV1 A;  3SS3 A;  3CLO A;  2EX6 A;  3PTE A;  5F69 A;  3RH8 B;  5CTN A;  4EER A;  1Y54 A;  4IVK A;  3BQ8 A;  2PYR A;  2R9W A;  4X1M A;  3NOT C;  2W3G A;  4HP4 A;  4ETZ A;  5FEG A;  5AQB A;  1OTD A;  2G2U A;  4EEP A;  4S2O A;  5GHZ A;  3LI9 A;  5F83 A;  4HP9 A;  1KGF A;  2V0U A;  2HP5 A;  1LI9 A;  2Y2J A;  1GSX A;  3F1P A;  3DTM A;  2W3H A;  2XDM A;  3VSL A;  4HY8 A;  4NK3 A;  4UA7 A;  3MFX A;  3W2Z A;  5J3W A;  3FV7 A;  1GSW A;  3H7W A;  1H0M A;  1PW1 A;  3MSH A;  1S4R A;  3VP3 A;  5TFQ A;  4BJP A;  2O9A A;  4RYE A;  1M6K A;  2YKF A;  1H8M A;  4Y7P A;  1YPR A;  1N9O A;  3IT9 A;  3IWQ A;  1E3U A;  3HVF A;  3ITB A;  2OV5 A;  3TG9 A;  3WRT A;  4WMC D;  5E2E A;  4O8G A;  5L10 A;  1YSP A;  4EBP A;  1IEM A;  5A8B A;  1LL5 A;  4WZ4 A;  2XD1 A;  5GL9 A;  2XFT A;  1XJ6 A;  4MCW A;  1SKF A;  5EV0 A;  5FQQ A;  2L0W A;  1TS8 A;  1MWR A;  5DJU A;  5TBM A;  2BAS A;  4KZ9 A;  3T4K A;  3MFD A;  2NUP C;  4QD4 A;  1G5U A;  2OSU A;  3EGX C;  1P9R A;  3IF6 C;  3EQV A;  3C4P A;  1NXY A;  3NOP C;  2WUQ A;  1K57 A;  4R0Q A;  1A0K A;  2WKE A;  4WZ5 A;  2WAE A;  1I5Q A;  3MF0 A;  3HJI A;  2H0Y A;  5JYP A;  4NXF A;  1VET A;  2V1Z A;  3HLC A;  4I3A A;  2X01 A;  5HL1 A;  5DTT A;  4UHU A;  2PBY A;  4GHI B;  5G18 A;  3UME A;  5F5Y A;  2H5S A;  2M1C A;  4L9F A;  4DF6 A;  1J3W A;  3QNB A;  3SH8 A;  4C3Q A;  5EEC A;  1Q2Q A;  1S6R A;  3NOU C;  2DNS A;  1F98 A;  4NXE A;  3MXS A;  3MZE A;  2M7U A;  2VEA A;  3TW8 A;  1AXB A;  3GTC A;  4JBF A;  1VEU B;  1K4F A;  5FQM A;  2Y4A A;  4WMC A;  3S7O A;  4II7 A;  2XSS A;  2Y2L A;  3SOI A;  4DXC A;  3ZQ5 A;  4XT2 B;  3A3J A;  3H7W B;  2WZZ A;  1GHM A;  1YLY A;  3Q07 A;  4YOF A;  3SZT A;  4GNU A;  4IHQ A;  4QPR A;  3NEC A;  3CWF A;  3LR4 A;  3MKE A;  2JBF A;  1CQA A;  2Z2M B;  1G6A A;  2P74 A;  4FOF A;  4LRX C;  1L3L A;  1OME A;  4N92 A;  1JTG A;  4DDY A;  2JKR I;  4S2N C;  2P7J A;  5M19 A;  1ZKJ A;  4QY6 A;  5TBM B;  3NJA A;  1NLZ A;  2BLS A;  2PD7 A;  3G2Z A;  5M18 A;  3QP1 A;  3CZD A;  2OOL A;  1SZV A;  1N9N A;  4G3V A;  2IA2 A;  4ZBE A;  3UB9 A;  3LIF A;  5CGS A;  3ZYT A;  3S7N A;  5EVI D;  2PAV P;  1VET B;  4GB7 A;  2Q9N A;  4DN0 A;  5CHM A;  4L9G A;  2ZMA A;  4R4S A;  5CHU A;  1WYB A;  1ODV A;  4X69 A;  1CF0 A;  4YFM A;  1LI0 A;  5C5K A;  4NXB A;  5CED A;  1W8Q A;  1XGJ A;  1L0G A;  3IXD A;  2PD8 A;  2PU2 A;  3KSH A;  4B4Z A;  2XA7 S;  2JKF A;  3Q7V A;  4EBN A;  3NCK A;  2V9A A;  2JKT M;  3RTY A;  4DXB A;  3GEC A;  5FDH A;  3BWL A;  3EWK A;  4UA6 A;  4RA7 A;  1GHI A;  5FL3 A;  1DRM A;  2HDU A;  5J7E A;  1LT0 A;  3S4X A;  5A93 A;  5AVE A;  2B02 A;  3PAE A;  2Y2H A;  5HL6 A;  4ETX A;  1H5X A;  3HCY A;  1K55 C;  1FIL A;  4KQQ A;  1PYY A;  4X25 A;  1YLW A;  1RGY A;  1PI4 A;  3G6O A;  2EX9 A;  4KZ8 A;  1IKI A;  2JKG A;  4HIA A;  4R38 A;  2DRW A;  3PBT A;  4PM8 A;  3U4L P;  1Q2P A;  2PT7 A;  3I7J A;  5TGF A;  3LIB A;  3C7V A;  2PHY A;  3GV9 A;  4Y0O A;  3CUE A;  3UB8 A;  3DW0 A;  2FZ0 A;  4KZ3 A;  3C5A A;  2ZQD A;  4DMZ A;  4AFI A;  3VE3 A;  2WAF A;  4X53 A;  5EVI A;  5L07 A;  5DTS A;  2V1A A;  3G30 A;  3MZD A;  3CI6 A;  4BWI A;  1ESI A;  4E3M A;  4P87 A;  5EM0 A;  1G68 A;  2PDR A;  4N9K A;  4GS9 A;  1XFN A;  4P6B A;  2ZL1 B;  4ZTK A;  3UPO A;  2WYX A;  1PWG A;  2FFF B;  3IX8 A;  4JF6 A;  4LV0 A;  3NUL A;  2VLG A;  3LFV A;  3N8S A;  1LSW A;  5HZH A;  1ES3 A;  1YAX A;  1J9M A;  5HDD A;  5FQ9 A;  3Q81 A;  2ZMF A;  2KLI A;  4KZ5 A;  4R3A A;  1STZ A;  1N4O A;  3FYZ A;  3WS0 A;  2VV6 A;  2M7V A;  4GD8 A;  3HLF A;  4UQI S;  2EWV A;  3S7P A;  3D4F A;  3JVV A;  3DWK A;  4BLM A;  5CEC A;  5DF7 A;  4E3O A;  1YLZ A;  3Q7V B;  4LV2 A;  5DJT A;  1XA1 A;  4KG6 A;  3A0R A;  3W8K A;  1E4D A;  3NBL A;  3UY6 A;  2A3U A;  2PBD P;  4EBL A;  1EW0 A;  3EEH A;  2GNX A;  5CX7 A;  2V0W A;  4XXR A;  4HOI A;  4LGW A;  4GDB A;  4KEN B;  2ACG A;  2WGV A;  3VOY A;  1H8Z A;  4PM9 A;  2BG1 A;  4JLF A;  3H9W A;  2HGV A;  1K57 C;  3M2K A;  1CEG A;  4WZ5 C;  3SS4 A;  1DY6 A;  1TS6 A;  2VK3 A;  1DP9 A;  1VM1 A;  1N9B A;  3N7W A;  2ZQC A;  2PU4 A;  3MJQ A;  1HD8 A;  1NYM A;  5HWT A;  5E2H A;  3A0V A;  5HSQ A;  4D2O A;  1M40 A;  3UB6 A;  2OLV A;  2HDS A;  1V9Y A;  1KVM A;  3F1N B;  3IH8 A;  4GS9 B;  4U0X A;  2W3F A;  3V39 A;  4M3K A;  1JNU A;  4N1H A;  1P97 A;  4E6X A;  5E43 A;  3TOI A;  2XGN A;  2H10 A;  1SDE A;  2C5W B;  1H8Y A;  4HBU A;  3IXG A;  1OJG A;  5LBR A;  3OOV A;  5FQK A;  3EGD C;  2QPN A;  1DP8 A;  3GDI A;  3G35 A;  5HAI A;  5DVA A;  4OPQ A;  3DBA A;  1MWT A;  2X02 A;  5HDS A;  4CLC B;  3VSK A;  2DCF A;  3BJN A;  3FC7 A;  4EEU A;  4WLA A;  2V2F F;  4Y3I A;  1KVL A;  3E2L A;  3W4O A;  5DFY A;  2HJE A;  4EET B;  1NJ4 A;  4S2M A;  3ZCZ A;  1FCM A;  4ID4 A;  5K5B A;  1E3U D;  4Y0U A;  3UDX A;  3OPR A;  4Y17 A;  5AQ9 A;  2J9O A;  3VP0 A;  2G2W A;  5EM1 A;  3LEQ A;  1YT4 A;  5EVE A;  1VQQ A;  1XJ3 A;  1K0K A;  1D1J A;  5I5L A;  3UO9 A;  2PYP A;  5FAP A;  4BQM A;  1KGE A;  4HNB A;  3VFH A;  4EW7 A;  4ZDX A;  4K91 A;  4GHI A;  1TS0 A;  4Z9Q A;  4ZJ2 A;  3EEA A;  3T4O A;  4UAA A;  3R7W A;  3BLM A;  4MDZ A;  4LLO B;  3OPH A;  3AGE A;  3V3R A;  1FSY A;  4Q0I A;  1H3Q A;  3E98 A;  3O5Y A;  5EUA A;  3VE4 A;  2J7V A;  3IBJ A;  3C38 A;  3CPT A;  2XRO A;  1ALQ A;  1VEU A;  3ZNY A;  3S22 A;  4X1L A;  2W1R A;  4KQD A;  3QP8 A;  1GSV A;  3KSG A;  3VP2 A;  5FI2 A;  1PRQ A;  3HLB A;  2A24 A;  4OH0 A;  4Q0J A;  5DTK A;  2GX5 A;  4OQ0 A;  3IXB A;  4JPM A;  1IOU A;  4XT2 A;  5AQ7 A;  5FI7 A;  5L2F A;  1IYO A;  1ERO A;  2HP9 A;  5FAT A;  4KZB A;  5F1G A;  4P6Z M;  3HUM A;  3E0Y A;  3IXH A;  2Y79 A;  1MY8 A;  4LPZ A;  2QWS A;  4CQH A;  5F1F A;  3LID A;  3IS2 A;  4KZ4 A;  1KDS A;  2NUT C;  4N9L A;  3L9K A;  1VB6 A;  3E4O A;  4HH3 A;  4H6J B;  5FAQ A;  4EU0 A;  1GHP A;  5M1A A;  2GDN A;  3ZG5 A;  3NDE A;  2ZM8 A;  4CPK A;  4BBT A;  3MS6 A;  2D02 A;  4KZ7 A;  5FQJ A;  5HW3 A;  3NHQ A;  2W3E A;  4R1G A;  4M4X A;  3HL9 A;  1I2W A;  5HFO A;  3MMH A;  4ESP A;  3CUE C;  3N8L A;  3BEC A;  3G34 A;  2ZOH A;  3UMD A;  5EVI C;  2XLN A;  2VV8 A;  4DKI A;  3EOI A;  4HI4 A;  5CRF A;  3MBZ A;  2EFX A;  1MZU A;  4KZ6 A;  1ONG A;  4R3J A;  2ZM2 A;  1ZG4 A;  1K54 C;  1P9W A;  5F82 A;  1S1Z A;  5KIZ A;  4EV4 A;  2YKH A;  2EXB A;  5A91 A;  3GR2 A;  2WGI A;  3R7W B;  4E6W A;  3ZFZ A;  1ES5 A;  3O87 A;  1IFQ A;  3PBN A;  2Y8H A;  3UB5 P;  1XXM A;  4EUZ A;  2ZC3 B;  1OJ5 A;  2BTF P;  3CPT B;  2ZQ7 A;  4NG2 A;  4WBG A;  1YLJ A;  1HVB A;  2A2L A;  5A90 A;  2A24 B;  3P01 A;  5CER A;  4KG2 A;  1NYY A;  2B18 A;  5HD3 A;  3O3V A;  3UE1 A;  4Y5F A;  1FSW A;  1YLT A;  2J3T D;  3G4P A;  3TSG A;  3UPN A;  3ZVW A;  2WZX A;  3LR0 A;  4S2K A;  4LRY C;  4MN5 A;  1V9Z A;  3AGF A;  1LSV A;  5J4E A;  4RQ9 A;  3IS2 B;  5EFW A;  5FAO A;  2B95 A;  3BFF A;  5EVL A;  3F1O B;  2V8F A;  3C2W A;  4GD6 A;  3B42 A;  4IED A;  3SW1 A;  1ES4 A;  1NRF A;  2PR6 A;  1IKG A;  1SCW A;  4QU3 A;  1BLS A;  3UE6 A;  3MXR A;  4JGO A;  2W27 A;  1F9I A;  2ZMV A;  4IBX A;  2EXA A;  3KSI A;  1YSQ A;  1K38 A;  4R6L A;  2EFU A;  2ZL1 A;  3JVU A;  1KE3 A;  3V67 A;  4A5R A;  4GOG A;  4JGQ A;  2JKT I;  5J8X A;  4WEJ A;  3Q7Z A;  4GLQ A;  4JXW A;  5E2F A;  4FD8 A;  3UE3 A;  2XQZ A;  4K0X A;  1Y28 A;  1PI5 A;  3T50 A;  3PXP A;  1HTZ A;  1NZU A;  1FOF A;  3CMZ A;  2WKP A;  4JF5 A;  3OPP A;  4RX2 A;  3HLG A;  3MKF A;  3NY4 A;  3PYP A;  3WS2 A;  3UDI A;  4GDN A;  4IVI A;  5GHX A;  4UA9 A;  5GLD A;  5CHJ A;  4YIN A;  2QMI A;  1PNE A;  5GHY A;  2HZ5 A;  1KGG A;  4PAU A;  4HBT A;  1FQG A;  2Y2O A;  3O88 A;  2WKR A;  1YKD A;  4KZA A;  5AQA A;  3W4P A;  4EQ1 A;  5DKK A;  1ZHH B;  2VGL S;  2Z2L B;  5HAQ A;  4LV3 A;  4ZAM A;  3ULF A;  5EOO A;  4OKP A;  4FUW A;  3IX4 A;  4X55 A;  5GLC A;  2WKQ A;  4S2L A;  3E4P A;  3V50 A;  4YNR A;  3HLE A;  4OPR A;  1SKO B;  2UWX A;  3P98 A;  4P85 A;  2FFY A;  3CJM A;  1OTA A;  2VZW A;  1ES2 A;  1K4E A;  1FCO A;  3KX0 X;  1F2K A;  2G7U A;  4G3K A;  5DKL A;  3T4L A;  1FR6 A;  5FQI A;  3F1N A;  3QP6 A;  3SS5 A;  3BEB A;  1JWP A;  2ZLY A;  2W1T B;  1DP6 A;  2VA0 A;  2Y59 A;  1JTD A;  3LIA A;  3ZDJ A;  2ZJ9 A;  3T1Q B;  5HPF A;  3LY3 A;  5FA7 A;  3BFD A;  2Q0O A;  4MN7 A;  1LHY A;  3PAG A;  1MC0 A;  3IH9 A;  1IEL A;  1UWP X;  2UV0 E;  1KE0 A;  4CLC A;  1GA9 A;  1WE4 A;  3GMW A;  4DRT A;  5EOE A;  3TE8 A;  3UDF A;  3LUQ A;  1G6O A;  2K2N A;  3ZG9 B;  1ZC2 A;  3T4J A;  3GVB A;  1OT6 A;  1KDW A;  2Q9M A;  3Q82 A;  4WUJ A;  2B5R A;  2QHK A;  4MEZ A;  3BYD A;  1L0F A;  1S66 L;  3A3I A;  1LLB A; 
#chains in the Genus database with same CATH homology
 4GHI B;  4JGR A;  2JN7 A;  2OWJ A;  5F5Y A;  3UME A;  2M1C A;  4HNB A;  1XFQ A;  4L9F A;  3RFB A;  2VKS A;  4EW7 A;  2DMW A;  2K7S A;  4CLC D;  4GHI A;  1TS0 A;  3EEA A;  2HF6 A;  2LB5 A;  3T4O A;  5G4Y A;  3NOU C;  3R7W A;  1F98 A;  4NXE A;  3OCL A;  1D06 A;  1OTE A;  4MDZ A;  4LLO B;  4HJ6 A;  2M7U A;  2VEA A;  4EES A;  1ZTU A;  2OWH A;  4Q0I A;  1H3Q A;  4I5S A;  3TW8 A;  3E98 A;  1TD5 A;  3O5Y A;  5DF9 A;  1W63 M;  3VE4 A;  3E4Q A;  3IBJ A;  3C38 A;  3P7N A;  2XRO A;  4I39 A;  4II7 A;  3S7O A;  2XSS A;  2O9B A;  3ZQ5 A;  4YWZ A;  2W1R A;  4XT2 B;  4KQD A;  1GSV A;  3KSG A;  3MXQ A;  3H7W B;  5AJG A;  4BBU A;  2A24 A;  5HDC A;  4Q0J A;  5AVF A;  4ARZ B;  5HD5 A;  2GX5 A;  1OPX A;  1IOU A;  1BYW A;  4XT2 A;  3TJZ C;  4YOF A;  5DFX A;  2GZA A;  3MQQ A;  4I3I A;  4IHQ A;  4G3W A;  2FH5 A;  4QPR A;  4R70 A;  3CWF A;  3LR4 A;  4P6Z M;  4PHT A;  3E0Y A;  2Y79 A;  3PHY A;  1W63 Q;  2R78 A;  4UQI M;  4LPZ A;  5KSH A;  2QWS A;  4FOF A;  4B9O A;  4LRX C;  1TS7 A;  1LSX A;  4HJ4 A;  4CQH A;  1LL8 A;  3LID A;  3IS2 A;  2JKR I;  4I38 A;  2QJ7 A;  2NUT C;  2P7J A;  1VB6 A;  3E4O A;  4HH3 A;  4H6J B;  4EU0 A;  1UWN X;  3VV4 A;  3H82 A;  5IU1 A;  2KOI A;  4F3L B;  2EA9 A;  4BBT A;  5TBM B;  1P0Z A;  3NJA A;  3LIE A;  1NLZ A;  4H6J A;  2D02 A;  4IUH A;  2PD7 A;  3S7Q A;  3NHQ A;  2W3E A;  5IS1 A;  2OOL A;  2O99 A;  1N9N A;  4G3V A;  2IA2 A;  2W0N A;  2INW A;  4M4X A;  3UB9 A;  3MMH A;  2Z6D A;  3CUE C;  4NKP A;  3LIC A;  3LIF A;  5IT5 A;  4FSF A;  1OTB A;  2HJ9 C;  2ZOH A;  3S7N A;  2J3W A;  3UMD A;  3ZYT A;  3LR5 A;  2VV8 A;  2OAP 1;  2I9V A;  3BY8 A;  3EOI A;  4HI4 A;  2ZBB A;  5F68 A;  1MZU A;  3ICY A;  4DN0 A;  4L9G A;  4ZRR A;  1ODV A;  1T19 A;  1P9W A;  2VJW A;  4DJ3 A;  2P08 A;  1S1Z A;  5KIZ A;  5C5K A;  4NXB A;  2PR5 A;  2YKH A;  4L0L A;  4BMW A;  2JHE A;  3K3D A;  4WEL A;  3BW6 A;  3R7W B;  4KQO A;  2PD8 A;  3KSH A;  2GJ3 A;  3D72 A;  2XA7 S;  1IFQ A;  3PBN A;  5MC7 A;  2V9A A;  2JKT M;  2Y8H A;  3LR3 A;  3RTY A;  4EXO A;  3CAX A;  4GJ4 A;  1N9L A;  3GEC A;  1S1Y A;  4WN5 A;  2LB9 A;  1OT9 A;  4KUO A;  1OJ5 A;  3BWL A;  3EWK A;  2KDK A;  4K08 A;  5FL3 A;  1DRM A;  5J7E A;  1LT0 A;  2A2L A;  1T1A A;  4WL9 A;  2A24 B;  5AVE A;  2L4R A;  3P01 A;  2B02 A;  2Z6C A;  2B18 A;  3PBQ A;  5HD3 A;  4DJ2 A;  4NEE D;  5HL6 A;  3CIT A;  4ETX A;  2J3T C;  3HCY A;  4Y5F A;  2J3T D;  4HQA A;  5G4Z A;  1XJ2 A;  4IJG A;  3G6O A;  3KSF A;  1NWZ A;  3KYQ A;  4HIA A;  2HV1 A;  3PBS A;  3LR0 A;  4R38 A;  3PBT A;  1NLY A;  2VX8 A;  2XRN A;  4LRY C;  4MN5 A;  2PT7 A;  1V9Z A;  3LIB A;  1LSV A;  2PHY A;  3UB8 A;  3CUE A;  5J4E A;  4RQ9 A;  2FZ0 A;  3T4T A;  3C30 A;  2QJ5 A;  3K3C A;  1XJ4 A;  1WA9 A;  3IS2 B;  5EFW A;  1MKM A;  4DMZ A;  4AFI A;  3VE3 A;  4I3J A;  3FPV A;  4O0P A;  2V1A A;  4ME4 A;  5F6A A;  3F1O B;  3CI6 A;  3C2W A;  4BWI A;  3B42 A;  3SW1 A;  2PR6 A;  4GCZ A;  3H82 B;  4OOL A;  3MQ0 A;  1G28 A;  3B33 A;  5HWV A;  1S4S A;  2PDR A;  3PR6 A;  2D01 A;  3F1O A;  4Q0H A;  4GS9 A;  4PKY A;  3UE6 A;  2KX6 A;  4JGO A;  2W27 A;  1XFN A;  1F9I A;  1X0O A;  2K31 A;  4GW9 A;  2ZMV A;  3T4S A;  4CLC E;  3D3O A;  3KSI A;  1YSQ A;  2VLG A;  3LFV A;  1LSW A;  4R6L A;  2VV7 A;  4B93 A;  2H28 A;  3JVU A;  3V67 A;  1UGU A;  5HZH A;  1YAX A;  4O01 A;  4JGQ A;  2JKT I;  2ZOI A;  5L8M A;  4WEJ A;  3PBO A;  4GLQ A;  5HDD A;  1D7E A;  3LI8 A;  2L1M A;  4LRZ E;  3UE3 A;  2CMN A;  3MR0 A;  2ZMF A;  1Y28 A;  2KLI A;  2V1B A;  4R3A A;  4Z1W A;  5TJJ A;  1STZ A;  3C8C A;  4KUK A;  2VV6 A;  3T50 A;  4P6Z S;  1KOU A;  2EWW A;  3PXP A;  4WF0 A;  2OAQ 1;  2M7V A;  3OC2 A;  3KO6 A;  4UQI S;  4PKY G;  1T1C A;  2EWV A;  2WKP A;  3S7P A;  1T18 A;  3MQO A;  3JVV A;  5HPI A;  3BQA A;  1S67 L;  3PYP A;  5DJT A;  3A0R A;  2W3D A;  4HJ3 A;  1NRJ A;  3IBR A;  4JGP A;  3B47 A;  1EW0 A;  1OTI A;  4PAU A;  3CLO A;  3EEH A;  2GNX A;  5CX7 A;  2WKR A;  1YKD A;  2V0W A;  5F69 A;  3RH8 B;  4EER A;  4HOI A;  3PBR A;  4EQ1 A;  3BQ8 A;  5DKK A;  1ZHH B;  2VGL S;  4CLC C;  2PYR A;  1T1B A;  3NOT C;  3ULF A;  4HHD A;  2W3G A;  4HP4 A;  3FPW A;  4OOM A;  4ETZ A;  1OTD A;  3H9W A;  2HGV A;  4EEP A;  4E04 A;  2QKP A;  3T4Q A;  3LI9 A;  2WKQ A;  4HP9 A;  3F1P B;  1TS6 A;  4MN6 A;  1DP9 A;  2V0U A;  3R4K A;  2O9C A;  3E4P A;  4YNR A;  1GSX A;  3F1P A;  2W3H A;  3UB7 A;  3MJQ A;  4HY8 A;  5HWT A;  3MFX A;  3W2Z A;  1OTA A;  3OBF A;  5J3W A;  3A0V A;  5HSQ A;  3UB6 A;  2VZW A;  1V9Y A;  1GSW A;  3F1N B;  4GS9 B;  2P04 A;  3H7W A;  3KX0 X;  2W3F A;  2G7U A;  2O0Y A;  4G3K A;  1S4R A;  4ARZ A;  1JNU A;  5DKL A;  3T4L A;  4L9E A;  4BJP A;  1P97 A;  2O9A A;  4UEY A;  4NXG A;  3F1N A;  2YKF A;  3A0S A;  1H8M A;  4IUK A;  1N9O A;  4HH2 A;  2W1T B;  1VHM A;  1DP6 A;  3FG8 A;  2VA0 A;  3LIA A;  1OJG A;  5LBR A;  3OOV A;  2J80 A;  4O8G A;  5HPF A;  2W1T A;  1YSP A;  3EGD C;  3GDI A;  1DP8 A;  4EUV A;  4MN7 A;  4BBV A;  5A8B A;  4Y2F A;  3DBA A;  1MC0 A;  5HDS A;  3BY9 A;  1UWP X;  2XA7 M;  4CLC B;  1XJ6 A;  2QYB A;  4MCW A;  1F5M A;  2L0W A;  1TF1 A;  3BJN A;  3FC7 A;  3EQU A;  1TS8 A;  4WLA A;  4EEU A;  5DJU A;  4Y3I A;  4F3L A;  5TBM A;  4CLC A;  2BAS A;  3T4K A;  5DFY A;  2HJE A;  4EET B;  2NUP C;  3TE8 A;  3EGX C;  3U2A A;  1P9R A;  3LUQ A;  3LYX A;  5K5B A;  3EQV A;  4WEK A;  2VGL M;  3TRC A;  3NOP C;  1G6O A;  2K2N A;  3T4J A;  2MJ6 A;  1OT6 A;  3OLO A;  3VOL A;  4WUJ A;  2QHK A;  4MMN A;  2JKR M;  3MF0 A;  3HJI A;  1XJ3 A;  3KYZ A;  4NXF A;  4I3A A;  5I5L A;  3HJK A;  2PYP A;  1S66 L;  3K2N A;  5HWW A;  3OCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...