2M7VA

Green light-absorbing state of tepixj, an active cyanobacteriochrome domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
165
structure length
165
Chain Sequence
MAAVQLSELRDRQAIFETLVAKGRELLACDRVIVYAFDDNYVGTVVAESVAEGWPQARDQVIEDPCFREHWVEAYRQGRIQATTDIFKAGLTECHLNQLRPLKVRANLVVPMVIDDQLFGLLIAHQASEPRQWQEIEIDQFSELASTGSLVLERLHFLEQTIASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis protein
publication title Structural and Flexibility Variations Between the Ground and Photoactivated States of a Blue/Green Light-Absorbing Cyanobacteriochrome
rcsb
source organism Thermosynechococcus elongatus
total genus 28
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2m7vA00
3KO6A 4DN0A 4ETZA 4ZRRA 2QYBA 2GX5A 3NOTC 4LRZE 4Y5FA 4Z1WA 5HSQA 3KSFA 2HGVA 3KSIA 3S7NA 3DBAA 2VKSA 2KLIA 2W1TB 4O0PA 4QPRA 2LB5A 3D3OA 4IJGA 3S7PA 3VV4A 2XROA 5HPIA 3EEAA 2KOIA 2O9AA 3G6OA 3E98A 4Q0HA 2W3FA 4ME4A 4R6LA 4G3VA 4G3KA 3W2ZA 4O01A 2W3GA 3BJNA 1VHMA 2OOLA 4EU0A 4RQ9A 3KSHA 4DMZA 2LB9A 2B18A 2W3DA 4EUVA 4MDZA 4Y2FA 3HCYA 2M7VA 2VZWA 4IUHA 2O9BA 3S7QA 5LBRA 1F5MA 4E04A 3O5YA 5HPFA 2G7UA 4LRXC 4YOFA 4CQHA 2W3HA 3NHQA 3S7OA 2O9CA 4GW9A 5AJGA 3CI6A 3NOUC 2K31A 3IBJA 4MMNA 2Y8HA 5I5LA 4Q0IA 2O0YA 4IUKA 3MMHA 5TJJA 5K5BA 4FOFA 1TD5A 3TRCA 5DFYA 4ETXA 5L8MA 3LFVA 3R4KA 3CITA 4MCWA 1STZA 4G3WA 4Q0JA 3MF0A 3KSGA 2XRNA 3RFBA 1YSPA 4BWIA 3K2NA 2VJWA 4LRYC 1TF1A 4R70A 4GLQA 4O8GA 4PAUA 2K2NA 2W1TA 2IA2A 5DFXA 1ZTUA 2ZMFA 1MC0A 2Y79A 1YKDA 4YNRA 3MQ0A 3ZQ5A 3E0YA 3C2WA 4Y3IA 2W3EA 3OBFA 1MKMA 1YSQA 2M7UA 2XSSA 3OOVA 2O99A 2VEAA 5HL6A 2W1RA 4MN7A 3IBRA 3NOPC 5C5KA
chains in the Genus database with same CATH superfamily
3CLOA 3VSLA 2WKQA 3HLEA 1LLBA 4GS9B 3QNCA 2EWWA 2ZOHA 4BL3A 1K56D 4BBTA 1N4OA 4UA6A 4QPRA 3ZVWA 4HEFA 5HPIA 1J9MA 2Y2LA 3H82B 1K56A 1K38A 5TGFA 2I9VA 4P6BA 4S2MA 1HD8A 5GLDA 4Y0UA 1SKOB 3PBSA 2Z2LB 2YKHA 1Z6FA 4S2OA 4Y2FA 2V2FF 4IUHA 3S7QA 1KGGA 1ES3A 2JHEA 4KZ3A 2FZ0A 2WGWB 4JGPA 2PBDP 3LYXA 2PD8A 1NWZA 5FAOA 2J9PA 2JCHA 2XK1A 2HV1A 5EVIA 2EFUA 4FD8A 5FDHA 1DP6A 3RTYA 3WRTA 3PBNA 3DW0A 1P9RA 4DJ2A 4MN6A 1YSPA 4R70A 3ZNYA 3MKFA 5FSRA 4C75A 3OZHA 5HDSA 2Y2KA 1W63M 2HPBA 4BJPA 3IWIA 5FL3A 1C3BA 2H28A 2O99A 1MKIA 1KDSA 3IF6A 4DN0A 4WM9A 1U60A 4ZRRA 1P97A 1KDWA 4Y15A 2GX5A 3KSIA 3D3OA 1PZPA 3BM6A 3N8LA 5AVEA 2PBYA 1YLYA 2IWBA 3QP1A 3NI9A 4FTXA 1IOUA 4KUOA 4D60A 2I72A 3NDGA 5HD3A 1H8MA 3LCEA 5A91A 5FDSA 3PTEA 2P9VA 5FASA 4KZ6A 2WKIA 5EV0A 1ZC2A 4L9GA 5HFOA 1N9NA 3IF6C 4MDZA 4OQGA 2DMWA 4I3AA 2XR0A 4KQOA 3R7WA 3W4QA 3UPOA 1LHYA 3SS4A 4IVIA 2O9CA 4PMAA 2XEPA 3T1QB 3NCKA 3OCLA 5EVLA 4CLCC 4EWFA 4KZAA 1L3LA 1S0WA 2QZ6A 3F1PA 4FOFA 3JVUA 2UWXA 2J8YA 3NJAA 5DFYA 3BFGA 4XXRA 4MBHA 3PBOA 2XDMA 3KSGA 3UMDA 1MWTA 2XRNA 3EGXC 4KZ9A 3F1NA 4FH2A 1FSWA 1WE4A 3ICYA 2JC7A 1K57C 5TR7A 1BLHA 1F98A 3V67A 1AWIA 2Y2JA 4Y13A 1VB6A 1OPXA 3BW6A 1L0GA 3MQ0A 2HP5A 3KYZA 4XUXA 1SZVA 3LO7A 3V39A 4UA9A 1L0FA 4WELA 2BLSA 1G6AA 1YLWA 4ETZA 3UO9A 1K4FA 1RGZA 4GS9A 5DJUA 1DJCA 4PM8A 1IEMA 1H8YA 4YWZA 4OLGA 1J3WA 2EXAA 1M6KA 3ZG0A 4JGQA 4NG2A 4R6LA 5HAIA 5HDCA 1BLCA 4ZBEA 5IU1A 3DWKA 2Q9NA 4O7DA 2ZQ7A 2Y59A 5FEFA 3ISGA 4PPRA 1KGFA 1MWSA 4JBFA 1G28A 2INWA 4HQAA 3LR3A 1M40A 4WZ4A 3GSGA 3T4SA 4B93A 5HWTA 1IYQA 4S2NC 3G2ZA 2G2UA 1EROA 3LR0A 3A0VA 2PYRA 2FH5A 4PM5A 3C7UA 4E6XA 1OTBA 3K3CA 4I3IA 1CI9A 4I3JA 2JN7A 1NRFA 1ES2A 1XFQA 3GDIA 3F1OA 3CITA 1IYOA 2HP6A 4N1XA 1NRJA 2EWVA 4LRYC 4ZJ3A 1I2WA 2W27A 4EERA 1GSWA 4HP4A 3EGDC 3CUEA 3ZNTA 3CAXA 4RYEA 4XT2A 3GMWA 4B9OA 3NIAA 4EEPA 5JYOA 5DVAA 1IYSA 4LV3A 4R38A 3BY9A 3IH9A 3CMZA 3TE8A 1BULA 1D06A 3IX8A 5F83A 3NOTC 4Z1WA 3UB5P 3HLDA 1LSXA 4HNBA 2WUQA 3ITBA 3O86A 3HJIA 3TW8A 4OOLA 3UB8A 1OTIA 3BFFA 2ZQ8A 4IBRA 4L9FA 3IQAA 3SH8A 3SS3A 1N9OA 1JWPA 3IHBA 1YLJA 3BECA 5JYPA 4S2PA 3DAVA 1BLSA 1WYCA 1PWCA 1LL9A 5CEDA 1S1YA 3S1YA 1G68A 4OPQA 4GN2A 1TS0A 4KQDA 5KSHA 3VP3A 4R1GA 4X55A 2XA7S 3OPPA 5M18A 2OLUA 4OQHA 4PKYA 4E6WA 4P87A 2ZC7A 1W8YA 2Y91A 3HREA 5E2EA 1YM1A 5BOHA 1S4SA 4HI4A 3UB6A 4Q8IA 2V8CA 3UN7A 3LI9A 4KG6A 2H0TA 4OKPA 1WA9A 2G2WA 2Y2NA 3UNWA 2MJ6A 5EM0A 4DRTA 4O8GA 2VGKA 1A0KA 3C8CA 5CGWA 2ZM8A 1FSYA 2HP9A 4EV4A 5EVIB 3C5AA 1N9LA 2CMNA 4M3KA 1CF0A 4DXBA 2L1MA 3M6HA 4H8RA 1O07A 3C7VA 1CK3A 3PAEA 2P74A 2WGIA 1TEMA 3BFDA 4X56A 3KYEA 5F69A 4X25A 3N8SA 4O0PA 3L9KA 3E4QA 2XROA 2JE5A 5DTKA 2OV5A 3T4QA 1EW0A 1KGEA 4GKUA 4ESPA 1PFLA 3RH8B 4M4XA 4S2JA 3OPHA 4G3VA 4R0QA 4LCLA 1MPLA 3HLFA 2WZZA 3G30A 4K91A 2ZC3B 3G34A 2B18A 2OLVA 4BL2A 2V1ZA 3CPTA 1PNEA 3VSKA 1K6RA 4K08A 1D7EA 3ZG9B 1ZKJA 2W3HA 2P9VB 3RXWA 4GD8A 3IBJA 3UPNA 1BT5A 3VOLA 1PIOA 3LY3A 5TJJA 5EPHA 3K3DA 3NY4A 1SCWA 3BQAA 5HDDA 4OP5A 1STZA 5FQQA 2OSUA 1VEUA 4UQIS 2L4RA 3VMAA 1Y54A 4D2OA 4N9LA 3W4OA 1KE3A 3C2WA 3MQQA 5HWVA 4KQRA 3HUOA 2HZ5A 1IYPA 1SDNA 2Z2MB 3F1NB 4I39A 4ARZA 1SHVA 4PM9A 4IBXA 3JVVA 3LIBA 3S7NA 3T50A 3NDEA 2ZOIA 3CWFA 5CHMA 4LGWA 5FQMA 3G6OA 4DDYA 3ITAA 3RJUA 1ERMA 2PD7A 3JPUA 4G3KA 1W8QA 1NY0A 4WZ5C 3EEHA 4IVKA 2ZL1A 4WLAA 1HLUP 5GL9A 4OONA 3WS0A 3MXSA 4HIAA 2ZJ9A 5EUAA 3MFXA 3VOYA 1XA1A 4R3AA 2QJ5A 1OMEA 5EE8A 4R4SA 4GW9A 1T18A 3LICA 1NYYA 3BLMA 5EECA 5FI7A 5HL1A 2DRWA 1RP5A 4NK3A 4WN5A 4R3BA 1BYWA 4N1HA 5A8BA 4BMWA 3TRCA 5HX9A 3G32A 4N92A 1VETA 5EVID 1W63Q 5CHJA 4OH0A 1TF1A 1K0KA 3ZG8B 3WS4A 2HDQA 1KE0A 4QD4A 1UGUA 2Y55A 2WAEA 5HWWA 2V1AA 1NLYA 3OPLA 4Y7PA 5GHXA 2P7JA 5HZHA 5FI2A 1QMEA 3SOIA 3F1OB 4FSFA 5M19A 1IKIA 4GJ4A 5CX7A 3M2KA 4OLDA 5CEBA 4ZDXA 2R9WA 4XT2B 3QP8A 2XD5A 1XJ2A 2VA0A 4EQIA 3P98A 5EVIC 1RCJA 3TOIA 1NZUA 4O01A 4JF6A 1K55A 3BJNA 1JWZA 2GDNA 3IXHA 4CPKA 3HLWA 5CHUA 1LSWA 2R9XA 2VGLS 3IS2B 3P01A 3KSHA 3PXPA 2LB9A 2PR5A 1K54A 2Z6DA 4S2IA 2PAVP 4X69A 1JTGA 3U4LP 2KX6A 3S22A 3CI6A 5DF9A 5I5LA 3ZG7B 3BLSA 4A5RA 5E2GA 1ZG4A 1ES4A 3V50A 5HAPA 2Y2MA 5AQ9A 2VLGA 3L7HA 4MN5A 2Y2GA 3N6IA 4K0WA 3CZDA 1NLZA 1GHPA 3FPWA 4Y17A 3LEQA 2XA7M 2VGJA 3IX3A 1YLPA 4EESA 4BD0A 4HBUA 4GCZA 5GHYA 4E3OA 3H7WA 1MWUA 1TS6A 1ODVA 1MKMA 5HL6A 2W1RA 4N9KA 2DNSA 3T1SA 3PBRA 1F9IA 2XD1A 4Y5FA 3KSFA 2HGVA 3GTCA 2WADA 1JNUA 4DXCA 4B88A 3UY6A 1MWRA 2HF6A 3TJZC 4Q0HA 4DJ3A 5HAQA 3W2ZA 1MY8A 4QY6A 3GECA 1ERQA 3UDXA 1MXOA 5HW3A 1YMSA 4WUJA 3PYPA 1PZOA 4FUWA 3LR4A 4EBLA 3A3IA 2OWHA 2YKFA 1VQQA 3IH8A 1NZOA 4GOGA 4E04A 3ZHHA 1ZHHB 3UB9A 3A3JA 5EFWA 4II7A 5AQ7A 5AQBA 4JXWA 4KZ5A 1N9BA 1ES5A 1OTDA 2JKGA 2BTFP 1FR1A 1L0EA 5GLBA 2QKPA 4MLLA 3MFDA 3CPTB 1GA0A 3DTKA 5L8MA 4WMCA 2ZM2A 5J4EA 3P7NA 4WBGA 2Y2OA 3IWQA 3FYZA 3IXBA 2ZQDA 1CEGA 2XGNA 2J9OA 3VP4A 1S67L 1XPBA 3IT9A 5HARA 3PBQA 4C6YA 3OOVA 3HVFA 2H10A 1KOUA 1GCEA 1VEUB 3MR0A 3CG5A 1YMXA 4OPRA 4KUKA 1DRMA 4P85A 2KLIA 5EVEA 1NXYA 3NC8A 3MSHA 3A3EA 3MXRA 4GB7A 3S7PA 2P04A 3QP6A 4XUZA 1Z09A 4ME4A 3CHWP 5G4YA 4JGOA 3Q7VA 3RXXA 3VOZA 5F82A 1LL5A 1OT6A 4RX2A 4HJ3A 3BFCA 2R78A 4ARZB 1K6SA 1T1BA 4EU0A 3IS2A 5EOEA 5FQ9A 4ZJ1A 3ZDJA 2JKFA 3FV7A 5G18A 2HJ9C 1T1AA 2M7VA 1Q2QA 4FCFA 2A24B 3CUEC 4HESA 3OLOA 3O87A 3A0SA 4GDBA 3NOUC 2ZL1B 2ZC4B 3TG9A 3LIEA 3MZFA 1S1ZA 1SDEA 2QJ7A 4HH3A 4L9EA 2ZM0A 4X6TA 2GZAA 1BSGA 2XLNA 4G3WA 3MF0A 3B33A 3P09A 4KENB 4F3LB 2ZC6B 2VV6A 3LIAA 3WWXA 1GHIA 5AVFA 1MBLA 1ZTUA 2EX9A 2ZMFA 2Y79A 5D3OA 5L07A 2B5RA 1AXBA 5L2FA 1K25A 3SW1A 2ZQAA 1DJBA 3A3DA 5A92A 1XA7A 1VETB 3HL9A 3ZFZA 4LRZE 1UWNX 4PM7A 2VKSA 3MZEA 3FC7A 1PW1A 3Q7ZA 3BFEA 3VV4A 3FG8A 2KOIA 2O9AA 2W3FA 4EW7A 4DDSA 1O7EA 3T1RA 1I5QA 1Y28A 1LSVA 5FQKA 4GD6A 4UAAA 1ONHA 4DE0A 2Y2IA 2ZBBA 5L09A 2IWDA 2V8FA 3EQVA 3GR2A 2O9BA 1X0OA 1LL8A 4EEUA 2ZD8A 4GHIA 3HBRA 2FFYA 1P9WA 1ALQA 1GSXA 2L0WA 2NUTC 5DTTA 3NHQA 1SKFA 2WAFA 4NETA 1FCNA 3PBTA 4MBFA 5FEGA 2A2LA 2JKRI 3T4KA 2WKPA 4HJ4A 2PR6A 3KX0X 2VGLM 3NULA 3NBLA 5CECA 1BLPA 2ZMAA 1VM1A 4Q0JA 5DF8A 3FPVA 4WYYA 2CC1A 4HOIA 4UA7A 2W1TA 4LV1A 4JPMA 3PAGA 3HLBA 3SZTA 2H5SA 4H6JA 2M1CA 1YKDA 5IT5A 5DTSA 2ZQCA 3OBFA 5J8XA 1OTAA 4ZAMA 2V20A 4CLCB 4OOYA 4MN7A 1V9ZA 1XGJA 5DKKA 3OCNA 4B4XA 4LFUA 2PU4A 3D9YA 4Y0OA 5F5YA 1L2SA 3BWLA 3SH7A 3H7WB 4QWOA 2ACGA 1GA9A 4NXBA 4E3NA 3UDIA 5KZHA 3V3SA 3E4PA 5DJTA 3O88A 1PYYA 3V3RA 5EOOA 2OOLA 4RQ9A 4DKIA 2Q9MA 3G31A 5CRFA 4ZTKA 3N4IA 2E8JA 3C30A 2C6WB 3TSGA 3PHYA 4EUZA 5GLAA 2KDKA 2WKHA 2A24A 3MQOA 4KG5A 3MXQA 3MJQA 3T4TA 3GV9A 1H5XA 4YINA 4MMNA 2Y8HA 3LIFA 5G4ZA 4NXEA 2Y4AA 4MBKA 4IUKA 1TS7A 1FCOA 2V1BA 3B42A 3MMHA 4JXGA 1CI8A 2XFSA 4DF6A 2A3UA 3CJMA 3M2JA 4U0XA 4MCWA 1W79A 4BD1A 3O3VA 4F3LA 4S2KA 5E43A 4BWIA 3ZG5A 5CTNA 1CQAA 4R3JA 5TBMA 4UHUA 1LI0A 1XFNA 3BY8A 1MC0A 3AGDA 4GNUA 2WKEA 2W3EA 2P08A 1YSQA 1XJ6A 1HZOA 2XFTA 5A93A 5CTMA 3E2KA 3IBRA 3MS6A 1FIKA 3WS5A 1ESUA 2H0YA 3UPPA 1IELA 5HSQA 3N7WA 2JKTI 4RVAA 1FOFA 2EFXA 3N8RA 4IJGA 4JKTA 1OJGA 3DTMA 4U3TA 2X01A 2HDUA 5CXWA 3ULFA 4WEKA 3QP5A 5E2FA 5CGSA 1WYBA 2ZQ9A 3FKWA 2RCXA 3KYQA 4KZ7A 1CEFA 2OWJA 2XQZA 3ZVTA 4PM6A 4OP8A 4EBPA 3UE0A 3Q1FA 2V0UA 1XJ3A 3Q81A 5FI6A 3OPRA 5LBRA 5CGXA 1T1CA 2PYPA 2QMIA 5HPFA 3Q7VB 4YFMA 2OAP1 2IWCA 4CQHA 4EQ1A 4QHCA 5F6AA 3C4PA 4WL9A 4EBNA 4BLMA 3Q82A 4OQIA 5K5BA 3LGOA 3FWLA 2A49A 4BENA 3T4LA 3WS1A 2B95A 2WZXA 5HD5A 2AVXA 3G35A 3VE4A 5FQIA 3JYIA 1TDGA 1K4EA 1E25A 4KZ8A 4CLCD 5DFXA 1HVBA 3SH9A 1K55C 5I94A 2J3TD 1H0MA 4PHTA 3HUMA 2VEAA 1K54C 3MKEA 4CLCA 3NOPC 1NJ4A 5C5KA 2C5WB 5F68A 2WKRA 2FFFB 1D1JA 4UEYA 4E3LA 3DBAA 1XP4A 1UWPX 5IHVA 1YQSA 3VP2A 2Y2QA 5DF7A 3WS2A 4OPYA 3IXGA 1ONGA 1K57A 3UMEA 2J3WA 4HY8A 3VE3A 1HTZA 3DWZA 2D02A 3IWOA 4P0MA 4X1LA 2PU2A 3UDFA 1ACFA 4NKPA 2J3TC 2HJEA 2ZC5B 4L0LA 3WRZA 3IXDA 4KQQA 3I7JA 4OPZA 5FA7A 3B3XA 5EM1A 5KIZA 4DE3A 2D01A 3O5YA 1GSVA 1NYMA 2XH9A 3G4PA 2WYXA 2QPNA 3NECA 2GNXA 3VP0A 4P6ZS 4QU3A 1YLZA 2JKRM 4Q0IA 1PWGA 4IHQA 3M6BA 3EWKA 4QJGA 2Y2HA 3U2AA 1TD5A 1H3QA 4C3QA 3BYDA 4WF0A 4PKYG 3OC2A 4GHIB 4B4ZA 5MC7A 3DTEA 1FILA 3S4XA 4E3IA 4WMCD 5KSCA 4X53A 1PWDA 1FR6A 2W0NA 4S2NA 4JLFA 3QP4A 3VFFA 4NEED 4FH4A 3B47A 2DCFA 3H82A 3KO6A 4JF5A 4CLCE 2QYBA 3T4JA 1V9YA 4R23A 2PDRA 1W7FA 1MZUA 3IF5A 1Q2PA 2W1TB 1SKOA 5L10A 1F2KA 1YLTA 3FZCA 2PT7A 4H6JB 1EWZA 4R4RA 3PR6A 3EEAA 2J80A 2WGWA 3W4PA 3UE6A 2V0WA 4LENA 3UE1A 2EXBA 1FQGA 1PI5A 3LEZA 4AFIA 1EI5A 4LCMA 1PW8A 4RA7A 3GQZA 1PRQA 2GJ3A 3IHAA 3BQ8A 5F1GA 2BASA 5F1FA 1OT9A 5J3WA 4QY5A 2BG1A 4LV0A 2JBFA 1TVFA 4UQIM 4MEZA 4I5SA 5U47A 4EETB 3T12B 1OTEA 3E4OA 1Y4OA 2ZMVA 4DE1A 3VFHA 5AJGA 4HH2A 5FQJA 4HHDA 5A90A 2QHKA 2XF3A 2UV0E 1DP9A 3GRJA 4WEJA 1YT4A 1L0DA 4ETXA 1P0ZA 2VV7A 2K7SA 3E2LA 2EX8A 4LV2A 1XKZA 2QWSA 4GLQA 5DKLA 2K2NA 5GLCA 4EXOA 1LT0A 3BEBA 3QP2A 1BUEA 4E3KA 4RX3A 2EX6A 2XSSA 4F94A 2WGVA 1KVMA 4NXGA 4QB8A 2JKTM 1S4RA 3LY4A 1BZAA 2VX8A 1G5UA 1LI9A 3HUNA 2RL3A 2PHYA 1E3UD 3T4OA 2J7VA 2WK0A 5TBMB 4ID4A 1DJAA 4BBVA 5TFQA 1W5DA 1E3UA 2VV8A 4IEDA 2V9AA 2W3GA 3EOIA 3VP1A 4KZBA 4X1MA 1I2SA 3LI8A 4DMZA 3UB7A 2W3DA 4EUVA 4GDNA 4S2LA 3HCYA 4E3MA 4HJ6A 5IS1A 1T19A 1XX2A 3HLCA 3ZCZA 3LR5A 2ZLYA 3A0RA 3V5MA 3D72A 1IKGA 2Y2PA 4ZJ2A 4LRXC 2B02A 1S66L 4MNRA 3DTIA 1QMFA 1ESIA 4I38A 4E3JA 4OQ0A 3AGEA 4JXVA 2O0YA 3HLGA 3MBZA 4HP9A 3D4FA 1YPRA 1XGIA 3R4KA 3SS5A 4U0TA 3K2NA 2VJWA 4Y0TA 3W8KA 4CJNA 4OOMA 5GHZA 5FAPA 2PRFA 4OVDA 1XJ4A 4JXSA 3MZDA 3ZQ5A 2NUPC 3E0YA 1CJFA 4KG2A 4Y3IA 1DP8A 2HDSA 5CERA 3QNBA 5FATA 3GVBA 3IF6B 2EX2A 5KMWA 2HDRA 4DE2A 5J7EA 2LB5A 3ZGAB 2Z6CA 3IX4A 1GHMA 3E98A 3UE3A 4BBUA 3AGFA 1VHMA 4KZ4A 2Q0OA 3Q07A 1XXMA 2X71A 1TDLA 2VZWA 5E2HA 1F5MA 3HJKA 4BQMA 3QHYA 3T1XA 1BTLA 4GZBA 1YAXA 1KVLA 1E4DA 3LUQA 3H9WA 4JGRA 3R7WB 4JF4A 2G7UA 5FAQA 4YOFA 2EA9A 3EQUA 3S7OA 1OJ5A 1PI4A 2X02A 2VK3A 2K31A 1IFQA 1DY6A 3FKVA 1S6RA 3C38A 4X68A 4K0XA 3F1PB 3ZYTA 4WZ5A 2E8IA 5M1AA 4HBTA 3LFVA 3BRMA 1JVJA 4LPZA 1FCMA 2OAQ1 3RFBA 1RGYA 1JTDA 4PAUA 3C4OA 4LLOB 3LIDA 1JWVA 1ZG6A 1TS8A 4NXFA 2IA2A 4Z9QA 1KE4A 4YNRA 4P6ZM 3A3FA 1H8ZA 2M7UA 1G6OA 3G2YA 5AQAA
chains in the Genus database with same CATH topology
3CLOA 2WKQA 5F68A 3MR0A 4GS9B 2WKRA 2EWWA 2ZOHA 4UEYA 5F69A 4BBTA 4KUKA 1DRMA 3DBAA 2KLIA 1UWPX 4O0PA 4QPRA 3E4QA 3S7PA 2XROA 2P04A 3T4QA 5HPIA 1EW0A 4ME4A 5G4YA 4JGOA 3H82B 3RH8B 3UMEA 4M4XA 2J3WA 4G3VA 4HY8A 3VE3A 1OT6A 4HJ3A 2R78A 2I9VA 4ARZB 2D02A 1T1BA 4EU0A 3IS2A 3PBSA 2B18A 2HJ9C 2YKHA 2J3TC 4NKPA 2HJEA 1T1AA 4Y2FA 4L0LA 2M7VA 4IUHA 3S7QA 2JHEA 2FZ0A 4JGPA 4K08A 5KIZA 2D01A 3O5YA 1D7EA 1GSVA 2A24B 3CUEC 3OLOA 3LYXA 2PD8A 2W3HA 1NWZA 3A0SA 2GNXA 3NOUC 4P6ZS 2JKRM 3IBJA 4Q0IA 4IHQA 3LIEA 3VOLA 2HV1A 3EWKA 5TJJA 3U2AA 1S1ZA 3K3DA 1TD5A 1H3QA 2QJ7A 4HH3A 4L9EA 4PKYG 4WF0A 3BQAA 1DP6A 3OC2A 5HDDA 3RTYA 3PBNA 4GHIB 5MC7A 1P9RA 2GZAA 1STZA 4G3WA 3MF0A 3B33A 4DJ2A 4F3LB 4MN6A 4UQIS 1YSPA 3LIAA 2L4RA 2VV6A 4R70A 5AVFA 1ZTUA 2W0NA 5HDSA 2ZMFA 2Y79A 1W63M 3C2WA 3MQQA 4BJPA 4NEED 5HWVA 3SW1A 3B47A 3H82A 5FL3A 2H28A 2O99A 3KO6A 4DN0A 4I39A 4ZRRA 2QYBA 1P97A 3F1NB 4ARZA 3T4JA 1V9YA 2GX5A 4CLCE 4LRZE 1UWNX 2PDRA 3JVVA 3LIBA 3KSIA 3S7NA 2VKSA 1MZUA 2W1TB 3FC7A 3T50A 3D3OA 2PT7A 2ZOIA 4H6JB 3VV4A 5AVEA 3PR6A 3CWFA 3EEAA 2J80A 3FG8A 2KOIA 2O9AA 3G6OA 2W3FA 3UE6A 4EW7A 1IOUA 4KUOA 2V0WA 2PD7A 5HD3A 1H8MA 4AFIA 4G3KA 1Y28A 2GJ3A 1LSVA 3EEHA 4WLAA 3BQ8A 4L9GA 2BASA 1N9NA 2ZBBA 1OT9A 5J3WA 4HIAA 3EQVA 4MDZA 2O9BA 4UQIM 1X0OA 2DMWA 1LL8A 4I3AA 4EEUA 3MFXA 4I5SA 4GHIA 4KQOA 4EETB 4R3AA 2QJ5A 1OTEA 3R7WA 1P9WA 3E4OA 2ZMVA 1GSXA 2L0WA 2NUTC 3NHQA 2O9CA 4GW9A 5AJGA 4HH2A 1T18A 4HHDA 3LICA 3PBTA 2QHKA 3OCLA 2A2LA 4CLCC 2JKRI 1DP9A 3T4KA 2WKPA 3F1PA 4FOFA 4WEJA 4HJ4A 3JVUA 4WN5A 2PR6A 1BYWA 3NJAA 5A8BA 4BMWA 3TRCA 5DFYA 4ETXA 3KX0X 2VGLM 3PBOA 1P0ZA 2VV7A 2K7SA 1W63Q 4Q0JA 3KSGA 3UMDA 3FPVA 2XRNA 3EGXC 3F1NA 3ICYA 1TF1A 2QWSA 4GLQA 4HOIA 5DKLA 1F98A 2K2NA 3V67A 2W1TA 4EXOA 1UGUA 1VB6A 1OPXA 4H6JA 1LT0A 2M1CA 3BW6A 1YKDA 5IT5A 3MQ0A 5HWWA 2V1AA 3KYZA 1NLYA 3OBFA 2P7JA 5HZHA 2XSSA 4WELA 1OTAA 3F1OB 4NXGA 4CLCB 4MN7A 1V9ZA 4FSFA 5DKKA 2JKTM 1S4RA 4ETZA 3OCNA 2VX8A 4GS9A 2PHYA 5DJUA 5F5YA 3T4OA 4GJ4A 5CX7A 3BWLA 5TBMB 4YWZA 4BBVA 3H7WB 4JGQA 4XT2B 4NXBA 4R6LA 1XJ2A 2VA0A 3E4PA 5DJTA 2VV8A 4O01A 5HDCA 2V9AA 2W3GA 3BJNA 5IU1A 1LSWA 3EOIA 2OOLA 2VGLS 3IS2B 4RQ9A 3NOPC 3P01A 3KSHA 3LI8A 3PXPA 4DMZA 2LB9A 2W3DA 2PR5A 3UB7A 4EUVA 2Z6DA 3C30A 1G28A 3HCYA 2INWA 4HQAA 4HJ6A 3LR3A 5IS1A 1T19A 3PHYA 3LR5A 3T4SA 4B93A 5HWTA 2KDKA 3A0RA 3D72A 2A24A 3MQOA 4LRXC 3MXQA 2B02A 3MJQA 1S66L 3T4TA 2KX6A 3LR0A 3A0VA 3CI6A 5DF9A 2PYRA 4I38A 2FH5A 4MMNA 2Y8HA 5I5LA 3LIFA 5G4ZA 4NXEA 2O0YA 1OTBA 4IUKA 1TS7A 2V1BA 3B42A 3K3CA 3MMHA 4I3IA 4I3JA 4HP9A 2VLGA 2JN7A 4MN5A 3R4KA 1XFQA 3GDIA 3F1OA 3CITA 4MCWA 1NLZA 1NRJA 2EWVA 4F3LA 3FPWA 3K2NA 4BWIA 2VJWA 4LRYC 2W27A 2XA7M 4EERA 1GSWA 4EESA 4HP4A 3EGDC 5TBMA 4OOMA 3CUEA 1XFNA 3BY8A 1MC0A 1XJ4A 3CAXA 4GCZA 3ZQ5A 2NUPC 3E0YA 3H7WA 4XT2A 1TS6A 4Y3IA 1ODVA 2W3EA 2P08A 4B9OA 1MKMA 1YSQA 1XJ6A 1DP8A 4EEPA 5HL6A 2W1RA 3IBRA 3PBRA 4R38A 1F9IA 3BY9A 3TE8A 1D06A 3NOTC 4Y5FA 4Z1WA 5HSQA 3KSFA 2JKTI 1LSXA 2HGVA 5J7EA 2LB5A 4HNBA 1JNUA 3HJIA 4IJGA 1OJGA 2Z6CA 2HF6A 3TW8A 4OOLA 3UB8A 1OTIA 3TJZC 4Q0HA 3E98A 3ULFA 4WEKA 4L9FA 4DJ3A 1N9OA 3UE3A 3W2ZA 3KYQA 3GECA 4BBUA 1VHMA 2OWJA 4WUJA 1S1YA 3PYPA 3LR4A 1TS0A 2V0UA 4KQDA 5KSHA 1XJ3A 2VZWA 2OWHA 2YKFA 5LBRA 1F5MA 3HJKA 4E04A 2XA7S 1T1CA 1ZHHB 1YAXA 3LUQA 3H9WA 2PYPA 4JGRA 3R7WB 5HPFA 3UB9A 2G7UA 2OAP1 4PKYA 4YOFA 4CQHA 2EA9A 3EQUA 4EQ1A 5EFWA 4II7A 3S7OA 1OJ5A 5F6AA 1OTDA 4WL9A 2K31A 1IFQA 2QKPA 3C38A 1S4SA 4HI4A 3ZYTA 3F1PB 5K5BA 3UB6A 3LI9A 5L8MA 3LFVA 5J4EA 4LPZA 3P7NA 1WA9A 2OAQ1 2MJ6A 3T4LA 3RFBA 5HD5A 4O8GA 4PAUA 3VE4A 4LLOB 3LIDA 3C8CA 1TS8A 4NXFA 2IA2A 4CLCD 5DFXA 1S67L 2J3TD 4YNRA 4P6ZM 3PBQA 1N9LA 2CMNA 2M7UA 1G6OA 4PHTA 2L1MA 3OOVA 2VEAA 4CLCA 1KOUA 5C5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KO6 A;  4DN0 A;  4ETZ A;  4ZRR A;  2QYB A;  2GX5 A;  3NOT C;  4LRZ E;  4Y5F A;  4Z1W A;  5HSQ A;  3KSF A;  2HGV A;  3KSI A;  3S7N A;  3DBA A;  2VKS A;  2KLI A;  2W1T B;  4O0P A;  4QPR A;  2LB5 A;  3D3O A;  4IJG A;  3S7P A;  3VV4 A;  2XRO A;  5HPI A;  3EEA A;  2KOI A;  2O9A A;  3G6O A;  3E98 A;  4Q0H A;  2W3F A;  4ME4 A;  4R6L A;  4G3V A;  4G3K A;  3W2Z A;  4O01 A;  2W3G A;  3BJN A;  1VHM A;  2OOL A;  4EU0 A;  4RQ9 A;  3KSH A;  4DMZ A;  2LB9 A;  2B18 A;  2W3D A;  4EUV A;  4MDZ A;  4Y2F A;  3HCY A;  2M7V A;  2VZW A;  4IUH A;  2O9B A;  3S7Q A;  5LBR A;  1F5M A;  4E04 A;  3O5Y A;  5HPF A;  2G7U A;  4LRX C;  4YOF A;  4CQH A;  2W3H A;  3NHQ A;  3S7O A;  2O9C A;  4GW9 A;  5AJG A;  3CI6 A;  3NOU C;  2K31 A;  3IBJ A;  4MMN A;  2Y8H A;  5I5L A;  4Q0I A;  2O0Y A;  4IUK A;  3MMH A;  5TJJ A;  5K5B A;  4FOF A;  1TD5 A;  3TRC A;  5DFY A;  4ETX A;  5L8M A;  3LFV A;  3R4K A;  3CIT A;  4MCW A;  1STZ A;  4G3W A;  4Q0J A;  3MF0 A;  3KSG A;  2XRN A;  3RFB A;  1YSP A;  4BWI A;  3K2N A;  2VJW A;  4LRY C;  1TF1 A;  4R70 A;  4GLQ A;  4O8G A;  4PAU A;  2K2N A;  2W1T A;  2IA2 A;  5DFX A;  1ZTU A;  2ZMF A;  1MC0 A;  2Y79 A;  1YKD A;  4YNR A;  3MQ0 A;  3ZQ5 A;  3E0Y A;  3C2W A;  4Y3I A;  2W3E A;  3OBF A;  1MKM A;  1YSQ A;  2M7U A;  2XSS A;  3OOV A;  2O99 A;  2VEA A;  5HL6 A;  2W1R A;  4MN7 A;  3IBR A;  3NOP C;  5C5K A; 
#chains in the Genus database with same CATH topology
 3CLO A;  3VSL A;  2WKQ A;  3HLE A;  1LLB A;  4GS9 B;  3QNC A;  2EWW A;  2ZOH A;  4BL3 A;  1K56 D;  4BBT A;  1N4O A;  4UA6 A;  4QPR A;  3ZVW A;  4HEF A;  5HPI A;  1J9M A;  2Y2L A;  3H82 B;  1K56 A;  1K38 A;  5TGF A;  2I9V A;  4P6B A;  4S2M A;  1HD8 A;  5GLD A;  4Y0U A;  1SKO B;  3PBS A;  2Z2L B;  2YKH A;  1Z6F A;  4S2O A;  4Y2F A;  2V2F F;  4IUH A;  3S7Q A;  1KGG A;  1ES3 A;  2JHE A;  4KZ3 A;  2FZ0 A;  2WGW B;  4JGP A;  2PBD P;  3LYX A;  2PD8 A;  1NWZ A;  5FAO A;  2J9P A;  2JCH A;  2XK1 A;  2HV1 A;  5EVI A;  2EFU A;  4FD8 A;  5FDH A;  1DP6 A;  3RTY A;  3WRT A;  3PBN A;  3DW0 A;  1P9R A;  4DJ2 A;  4MN6 A;  1YSP A;  4R70 A;  3ZNY A;  3MKF A;  5FSR A;  4C75 A;  3OZH A;  5HDS A;  2Y2K A;  1W63 M;  2HPB A;  4BJP A;  3IWI A;  5FL3 A;  1C3B A;  2H28 A;  2O99 A;  1MKI A;  1KDS A;  3IF6 A;  4DN0 A;  4WM9 A;  1U60 A;  4ZRR A;  1P97 A;  1KDW A;  4Y15 A;  2GX5 A;  3KSI A;  3D3O A;  1PZP A;  3BM6 A;  3N8L A;  5AVE A;  2PBY A;  1YLY A;  2IWB A;  3QP1 A;  3NI9 A;  4FTX A;  1IOU A;  4KUO A;  4D60 A;  2I72 A;  3NDG A;  5HD3 A;  1H8M A;  3LCE A;  5A91 A;  5FDS A;  3PTE A;  2P9V A;  5FAS A;  4KZ6 A;  2WKI A;  5EV0 A;  1ZC2 A;  4L9G A;  5HFO A;  1N9N A;  3IF6 C;  4MDZ A;  4OQG A;  2DMW A;  4I3A A;  2XR0 A;  4KQO A;  3R7W A;  3W4Q A;  3UPO A;  1LHY A;  3SS4 A;  4IVI A;  2O9C A;  4PMA A;  2XEP A;  3T1Q B;  3NCK A;  3OCL A;  5EVL A;  4CLC C;  4EWF A;  4KZA A;  1L3L A;  1S0W A;  2QZ6 A;  3F1P A;  4FOF A;  3JVU A;  2UWX A;  2J8Y A;  3NJA A;  5DFY A;  3BFG A;  4XXR A;  4MBH A;  3PBO A;  2XDM A;  3KSG A;  3UMD A;  1MWT A;  2XRN A;  3EGX C;  4KZ9 A;  3F1N A;  4FH2 A;  1FSW A;  1WE4 A;  3ICY A;  2JC7 A;  1K57 C;  5TR7 A;  1BLH A;  1F98 A;  3V67 A;  1AWI A;  2Y2J A;  4Y13 A;  1VB6 A;  1OPX A;  3BW6 A;  1L0G A;  3MQ0 A;  2HP5 A;  3KYZ A;  4XUX A;  1SZV A;  3LO7 A;  3V39 A;  4UA9 A;  1L0F A;  4WEL A;  2BLS A;  1G6A A;  1YLW A;  4ETZ A;  3UO9 A;  1K4F A;  1RGZ A;  4GS9 A;  5DJU A;  1DJC A;  4PM8 A;  1IEM A;  1H8Y A;  4YWZ A;  4OLG A;  1J3W A;  2EXA A;  1M6K A;  3ZG0 A;  4JGQ A;  4NG2 A;  4R6L A;  5HAI A;  5HDC A;  1BLC A;  4ZBE A;  5IU1 A;  3DWK A;  2Q9N A;  4O7D A;  2ZQ7 A;  2Y59 A;  5FEF A;  3ISG A;  4PPR A;  1KGF A;  1MWS A;  4JBF A;  1G28 A;  2INW A;  4HQA A;  3LR3 A;  1M40 A;  4WZ4 A;  3GSG A;  3T4S A;  4B93 A;  5HWT A;  1IYQ A;  4S2N C;  3G2Z A;  2G2U A;  1ERO A;  3LR0 A;  3A0V A;  2PYR A;  2FH5 A;  4PM5 A;  3C7U A;  4E6X A;  1OTB A;  3K3C A;  4I3I A;  1CI9 A;  4I3J A;  2JN7 A;  1NRF A;  1ES2 A;  1XFQ A;  3GDI A;  3F1O A;  3CIT A;  1IYO A;  2HP6 A;  4N1X A;  1NRJ A;  2EWV A;  4LRY C;  4ZJ3 A;  1I2W A;  2W27 A;  4EER A;  1GSW A;  4HP4 A;  3EGD C;  3CUE A;  3ZNT A;  3CAX A;  4RYE A;  4XT2 A;  3GMW A;  4B9O A;  3NIA A;  4EEP A;  5JYO A;  5DVA A;  1IYS A;  4LV3 A;  4R38 A;  3BY9 A;  3IH9 A;  3CMZ A;  3TE8 A;  1BUL A;  1D06 A;  3IX8 A;  5F83 A;  3NOT C;  4Z1W A;  3UB5 P;  3HLD A;  1LSX A;  4HNB A;  2WUQ A;  3ITB A;  3O86 A;  3HJI A;  3TW8 A;  4OOL A;  3UB8 A;  1OTI A;  3BFF A;  2ZQ8 A;  4IBR A;  4L9F A;  3IQA A;  3SH8 A;  3SS3 A;  1N9O A;  1JWP A;  3IHB A;  1YLJ A;  3BEC A;  5JYP A;  4S2P A;  3DAV A;  1BLS A;  1WYC A;  1PWC A;  1LL9 A;  5CED A;  1S1Y A;  3S1Y A;  1G68 A;  4OPQ A;  4GN2 A;  1TS0 A;  4KQD A;  5KSH A;  3VP3 A;  4R1G A;  4X55 A;  2XA7 S;  3OPP A;  5M18 A;  2OLU A;  4OQH A;  4PKY A;  4E6W A;  4P87 A;  2ZC7 A;  1W8Y A;  2Y91 A;  3HRE A;  5E2E A;  1YM1 A;  5BOH A;  1S4S A;  4HI4 A;  3UB6 A;  4Q8I A;  2V8C A;  3UN7 A;  3LI9 A;  4KG6 A;  2H0T A;  4OKP A;  1WA9 A;  2G2W A;  2Y2N A;  3UNW A;  2MJ6 A;  5EM0 A;  4DRT A;  4O8G A;  2VGK A;  1A0K A;  3C8C A;  5CGW A;  2ZM8 A;  1FSY A;  2HP9 A;  4EV4 A;  5EVI B;  3C5A A;  1N9L A;  2CMN A;  4M3K A;  1CF0 A;  4DXB A;  2L1M A;  3M6H A;  4H8R A;  1O07 A;  3C7V A;  1CK3 A;  3PAE A;  2P74 A;  2WGI A;  1TEM A;  3BFD A;  4X56 A;  3KYE A;  5F69 A;  4X25 A;  3N8S A;  4O0P A;  3L9K A;  3E4Q A;  2XRO A;  2JE5 A;  5DTK A;  2OV5 A;  3T4Q A;  1EW0 A;  1KGE A;  4GKU A;  4ESP A;  1PFL A;  3RH8 B;  4M4X A;  4S2J A;  3OPH A;  4G3V A;  4R0Q A;  4LCL A;  1MPL A;  3HLF A;  2WZZ A;  3G30 A;  4K91 A;  2ZC3 B;  3G34 A;  2B18 A;  2OLV A;  4BL2 A;  2V1Z A;  3CPT A;  1PNE A;  3VSK A;  1K6R A;  4K08 A;  1D7E A;  3ZG9 B;  1ZKJ A;  2W3H A;  2P9V B;  3RXW A;  4GD8 A;  3IBJ A;  3UPN A;  1BT5 A;  3VOL A;  1PIO A;  3LY3 A;  5TJJ A;  5EPH A;  3K3D A;  3NY4 A;  1SCW A;  3BQA A;  5HDD A;  4OP5 A;  1STZ A;  5FQQ A;  2OSU A;  1VEU A;  4UQI S;  2L4R A;  3VMA A;  1Y54 A;  4D2O A;  4N9L A;  3W4O A;  1KE3 A;  3C2W A;  3MQQ A;  5HWV A;  4KQR A;  3HUO A;  2HZ5 A;  1IYP A;  1SDN A;  2Z2M B;  3F1N B;  4I39 A;  4ARZ A;  1SHV A;  4PM9 A;  4IBX A;  3JVV A;  3LIB A;  3S7N A;  3T50 A;  3NDE A;  2ZOI A;  3CWF A;  5CHM A;  4LGW A;  5FQM A;  3G6O A;  4DDY A;  3ITA A;  3RJU A;  1ERM A;  2PD7 A;  3JPU A;  4G3K A;  1W8Q A;  1NY0 A;  4WZ5 C;  3EEH A;  4IVK A;  2ZL1 A;  4WLA A;  1HLU P;  5GL9 A;  4OON A;  3WS0 A;  3MXS A;  4HIA A;  2ZJ9 A;  5EUA A;  3MFX A;  3VOY A;  1XA1 A;  4R3A A;  2QJ5 A;  1OME A;  5EE8 A;  4R4S A;  4GW9 A;  1T18 A;  3LIC A;  1NYY A;  3BLM A;  5EEC A;  5FI7 A;  5HL1 A;  2DRW A;  1RP5 A;  4NK3 A;  4WN5 A;  4R3B A;  1BYW A;  4N1H A;  5A8B A;  4BMW A;  3TRC A;  5HX9 A;  3G32 A;  4N92 A;  1VET A;  5EVI D;  1W63 Q;  5CHJ A;  4OH0 A;  1TF1 A;  1K0K A;  3ZG8 B;  3WS4 A;  2HDQ A;  1KE0 A;  4QD4 A;  1UGU A;  2Y55 A;  2WAE A;  5HWW A;  2V1A A;  1NLY A;  3OPL A;  4Y7P A;  5GHX A;  2P7J A;  5HZH A;  5FI2 A;  1QME A;  3SOI A;  3F1O B;  4FSF A;  5M19 A;  1IKI A;  4GJ4 A;  5CX7 A;  3M2K A;  4OLD A;  5CEB A;  4ZDX A;  2R9W A;  4XT2 B;  3QP8 A;  2XD5 A;  1XJ2 A;  2VA0 A;  4EQI A;  3P98 A;  5EVI C;  1RCJ A;  3TOI A;  1NZU A;  4O01 A;  4JF6 A;  1K55 A;  3BJN A;  1JWZ A;  2GDN A;  3IXH A;  4CPK A;  3HLW A;  5CHU A;  1LSW A;  2R9X A;  2VGL S;  3IS2 B;  3P01 A;  3KSH A;  3PXP A;  2LB9 A;  2PR5 A;  1K54 A;  2Z6D A;  4S2I A;  2PAV P;  4X69 A;  1JTG A;  3U4L P;  2KX6 A;  3S22 A;  3CI6 A;  5DF9 A;  5I5L A;  3ZG7 B;  3BLS A;  4A5R A;  5E2G A;  1ZG4 A;  1ES4 A;  3V50 A;  5HAP A;  2Y2M A;  5AQ9 A;  2VLG A;  3L7H A;  4MN5 A;  2Y2G A;  3N6I A;  4K0W A;  3CZD A;  1NLZ A;  1GHP A;  3FPW A;  4Y17 A;  3LEQ A;  2XA7 M;  2VGJ A;  3IX3 A;  1YLP A;  4EES A;  4BD0 A;  4HBU A;  4GCZ A;  5GHY A;  4E3O A;  3H7W A;  1MWU A;  1TS6 A;  1ODV A;  1MKM A;  5HL6 A;  2W1R A;  4N9K A;  2DNS A;  3T1S A;  3PBR A;  1F9I A;  2XD1 A;  4Y5F A;  3KSF A;  2HGV A;  3GTC A;  2WAD A;  1JNU A;  4DXC A;  4B88 A;  3UY6 A;  1MWR A;  2HF6 A;  3TJZ C;  4Q0H A;  4DJ3 A;  5HAQ A;  3W2Z A;  1MY8 A;  4QY6 A;  3GEC A;  1ERQ A;  3UDX A;  1MXO A;  5HW3 A;  1YMS A;  4WUJ A;  3PYP A;  1PZO A;  4FUW A;  3LR4 A;  4EBL A;  3A3I A;  2OWH A;  2YKF A;  1VQQ A;  3IH8 A;  1NZO A;  4GOG A;  4E04 A;  3ZHH A;  1ZHH B;  3UB9 A;  3A3J A;  5EFW A;  4II7 A;  5AQ7 A;  5AQB A;  4JXW A;  4KZ5 A;  1N9B A;  1ES5 A;  1OTD A;  2JKG A;  2BTF P;  1FR1 A;  1L0E A;  5GLB A;  2QKP A;  4MLL A;  3MFD A;  3CPT B;  1GA0 A;  3DTK A;  5L8M A;  4WMC A;  2ZM2 A;  5J4E A;  3P7N A;  4WBG A;  2Y2O A;  3IWQ A;  3FYZ A;  3IXB A;  2ZQD A;  1CEG A;  2XGN A;  2J9O A;  3VP4 A;  1S67 L;  1XPB A;  3IT9 A;  5HAR A;  3PBQ A;  4C6Y A;  3OOV A;  3HVF A;  2H10 A;  1KOU A;  1GCE A;  1VEU B;  3MR0 A;  3CG5 A;  1YMX A;  4OPR A;  4KUK A;  1DRM A;  4P85 A;  2KLI A;  5EVE A;  1NXY A;  3NC8 A;  3MSH A;  3A3E A;  3MXR A;  4GB7 A;  3S7P A;  2P04 A;  3QP6 A;  4XUZ A;  1Z09 A;  4ME4 A;  3CHW P;  5G4Y A;  4JGO A;  3Q7V A;  3RXX A;  3VOZ A;  5F82 A;  1LL5 A;  1OT6 A;  4RX2 A;  4HJ3 A;  3BFC A;  2R78 A;  4ARZ B;  1K6S A;  1T1B A;  4EU0 A;  3IS2 A;  5EOE A;  5FQ9 A;  4ZJ1 A;  3ZDJ A;  2JKF A;  3FV7 A;  5G18 A;  2HJ9 C;  1T1A A;  2M7V A;  1Q2Q A;  4FCF A;  2A24 B;  3CUE C;  4HES A;  3OLO A;  3O87 A;  3A0S A;  4GDB A;  3NOU C;  2ZL1 B;  2ZC4 B;  3TG9 A;  3LIE A;  3MZF A;  1S1Z A;  1SDE A;  2QJ7 A;  4HH3 A;  4L9E A;  2ZM0 A;  4X6T A;  2GZA A;  1BSG A;  2XLN A;  4G3W A;  3MF0 A;  3B33 A;  3P09 A;  4KEN B;  4F3L B;  2ZC6 B;  2VV6 A;  3LIA A;  3WWX A;  1GHI A;  5AVF A;  1MBL A;  1ZTU A;  2EX9 A;  2ZMF A;  2Y79 A;  5D3O A;  5L07 A;  2B5R A;  1AXB A;  5L2F A;  1K25 A;  3SW1 A;  2ZQA A;  1DJB A;  3A3D A;  5A92 A;  1XA7 A;  1VET B;  3HL9 A;  3ZFZ A;  4LRZ E;  1UWN X;  4PM7 A;  2VKS A;  3MZE A;  3FC7 A;  1PW1 A;  3Q7Z A;  3BFE A;  3VV4 A;  3FG8 A;  2KOI A;  2O9A A;  2W3F A;  4EW7 A;  4DDS A;  1O7E A;  3T1R A;  1I5Q A;  1Y28 A;  1LSV A;  5FQK A;  4GD6 A;  4UAA A;  1ONH A;  4DE0 A;  2Y2I A;  2ZBB A;  5L09 A;  2IWD A;  2V8F A;  3EQV A;  3GR2 A;  2O9B A;  1X0O A;  1LL8 A;  4EEU A;  2ZD8 A;  4GHI A;  3HBR A;  2FFY A;  1P9W A;  1ALQ A;  1GSX A;  2L0W A;  2NUT C;  5DTT A;  3NHQ A;  1SKF A;  2WAF A;  4NET A;  1FCN A;  3PBT A;  4MBF A;  5FEG A;  2A2L A;  2JKR I;  3T4K A;  2WKP A;  4HJ4 A;  2PR6 A;  3KX0 X;  2VGL M;  3NUL A;  3NBL A;  5CEC A;  1BLP A;  2ZMA A;  1VM1 A;  4Q0J A;  5DF8 A;  3FPV A;  4WYY A;  2CC1 A;  4HOI A;  4UA7 A;  2W1T A;  4LV1 A;  4JPM A;  3PAG A;  3HLB A;  3SZT A;  2H5S A;  4H6J A;  2M1C A;  1YKD A;  5IT5 A;  5DTS A;  2ZQC A;  3OBF A;  5J8X A;  1OTA A;  4ZAM A;  2V20 A;  4CLC B;  4OOY A;  4MN7 A;  1V9Z A;  1XGJ A;  5DKK A;  3OCN A;  4B4X A;  4LFU A;  2PU4 A;  3D9Y A;  4Y0O A;  5F5Y A;  1L2S A;  3BWL A;  3SH7 A;  3H7W B;  4QWO A;  2ACG A;  1GA9 A;  4NXB A;  4E3N A;  3UDI A;  5KZH A;  3V3S A;  3E4P A;  5DJT A;  3O88 A;  1PYY A;  3V3R A;  5EOO A;  2OOL A;  4RQ9 A;  4DKI A;  2Q9M A;  3G31 A;  5CRF A;  4ZTK A;  3N4I A;  2E8J A;  3C30 A;  2C6W B;  3TSG A;  3PHY A;  4EUZ A;  5GLA A;  2KDK A;  2WKH A;  2A24 A;  3MQO A;  4KG5 A;  3MXQ A;  3MJQ A;  3T4T A;  3GV9 A;  1H5X A;  4YIN A;  4MMN A;  2Y8H A;  3LIF A;  5G4Z A;  4NXE A;  2Y4A A;  4MBK A;  4IUK A;  1TS7 A;  1FCO A;  2V1B A;  3B42 A;  3MMH A;  4JXG A;  1CI8 A;  2XFS A;  4DF6 A;  2A3U A;  3CJM A;  3M2J A;  4U0X A;  4MCW A;  1W79 A;  4BD1 A;  3O3V A;  4F3L A;  4S2K A;  5E43 A;  4BWI A;  3ZG5 A;  5CTN A;  1CQA A;  4R3J A;  5TBM A;  4UHU A;  1LI0 A;  1XFN A;  3BY8 A;  1MC0 A;  3AGD A;  4GNU A;  2WKE A;  2W3E A;  2P08 A;  1YSQ A;  1XJ6 A;  1HZO A;  2XFT A;  5A93 A;  5CTM A;  3E2K A;  3IBR A;  3MS6 A;  1FIK A;  3WS5 A;  1ESU A;  2H0Y A;  3UPP A;  1IEL A;  5HSQ A;  3N7W A;  2JKT I;  4RVA A;  1FOF A;  2EFX A;  3N8R A;  4IJG A;  4JKT A;  1OJG A;  3DTM A;  4U3T A;  2X01 A;  2HDU A;  5CXW A;  3ULF A;  4WEK A;  3QP5 A;  5E2F A;  5CGS A;  1WYB A;  2ZQ9 A;  3FKW A;  2RCX A;  3KYQ A;  4KZ7 A;  1CEF A;  2OWJ A;  2XQZ A;  3ZVT A;  4PM6 A;  4OP8 A;  4EBP A;  3UE0 A;  3Q1F A;  2V0U A;  1XJ3 A;  3Q81 A;  5FI6 A;  3OPR A;  5LBR A;  5CGX A;  1T1C A;  2PYP A;  2QMI A;  5HPF A;  3Q7V B;  4YFM A;  2OAP 1;  2IWC A;  4CQH A;  4EQ1 A;  4QHC A;  5F6A A;  3C4P A;  4WL9 A;  4EBN A;  4BLM A;  3Q82 A;  4OQI A;  5K5B A;  3LGO A;  3FWL A;  2A49 A;  4BEN A;  3T4L A;  3WS1 A;  2B95 A;  2WZX A;  5HD5 A;  2AVX A;  3G35 A;  3VE4 A;  5FQI A;  3JYI A;  1TDG A;  1K4E A;  1E25 A;  4KZ8 A;  4CLC D;  5DFX A;  1HVB A;  3SH9 A;  1K55 C;  5I94 A;  2J3T D;  1H0M A;  4PHT A;  3HUM A;  2VEA A;  1K54 C;  3MKE A;  4CLC A;  3NOP C;  1NJ4 A;  5C5K A;  2C5W B;  5F68 A;  2WKR A;  2FFF B;  1D1J A;  4UEY A;  4E3L A;  3DBA A;  1XP4 A;  1UWP X;  5IHV A;  1YQS A;  3VP2 A;  2Y2Q A;  5DF7 A;  3WS2 A;  4OPY A;  3IXG A;  1ONG A;  1K57 A;  3UME A;  2J3W A;  4HY8 A;  3VE3 A;  1HTZ A;  3DWZ A;  2D02 A;  3IWO A;  4P0M A;  4X1L A;  2PU2 A;  3UDF A;  1ACF A;  4NKP A;  2J3T C;  2HJE A;  2ZC5 B;  4L0L A;  3WRZ A;  3IXD A;  4KQQ A;  3I7J A;  4OPZ A;  5FA7 A;  3B3X A;  5EM1 A;  5KIZ A;  4DE3 A;  2D01 A;  3O5Y A;  1GSV A;  1NYM A;  2XH9 A;  3G4P A;  2WYX A;  2QPN A;  3NEC A;  2GNX A;  3VP0 A;  4P6Z S;  4QU3 A;  1YLZ A;  2JKR M;  4Q0I A;  1PWG A;  4IHQ A;  3M6B A;  3EWK A;  4QJG A;  2Y2H A;  3U2A A;  1TD5 A;  1H3Q A;  4C3Q A;  3BYD A;  4WF0 A;  4PKY G;  3OC2 A;  4GHI B;  4B4Z A;  5MC7 A;  3DTE A;  1FIL A;  3S4X A;  4E3I A;  4WMC D;  5KSC A;  4X53 A;  1PWD A;  1FR6 A;  2W0N A;  4S2N A;  4JLF A;  3QP4 A;  3VFF A;  4NEE D;  4FH4 A;  3B47 A;  2DCF A;  3H82 A;  3KO6 A;  4JF5 A;  4CLC E;  2QYB A;  3T4J A;  1V9Y A;  4R23 A;  2PDR A;  1W7F A;  1MZU A;  3IF5 A;  1Q2P A;  2W1T B;  1SKO A;  5L10 A;  1F2K A;  1YLT A;  3FZC A;  2PT7 A;  4H6J B;  1EWZ A;  4R4R A;  3PR6 A;  3EEA A;  2J80 A;  2WGW A;  3W4P A;  3UE6 A;  2V0W A;  4LEN A;  3UE1 A;  2EXB A;  1FQG A;  1PI5 A;  3LEZ A;  4AFI A;  1EI5 A;  4LCM A;  1PW8 A;  4RA7 A;  3GQZ A;  1PRQ A;  2GJ3 A;  3IHA A;  3BQ8 A;  5F1G A;  2BAS A;  5F1F A;  1OT9 A;  5J3W A;  4QY5 A;  2BG1 A;  4LV0 A;  2JBF A;  1TVF A;  4UQI M;  4MEZ A;  4I5S A;  5U47 A;  4EET B;  3T12 B;  1OTE A;  3E4O A;  1Y4O A;  2ZMV A;  4DE1 A;  3VFH A;  5AJG A;  4HH2 A;  5FQJ A;  4HHD A;  5A90 A;  2QHK A;  2XF3 A;  2UV0 E;  1DP9 A;  3GRJ A;  4WEJ A;  1YT4 A;  1L0D A;  4ETX A;  1P0Z A;  2VV7 A;  2K7S A;  3E2L A;  2EX8 A;  4LV2 A;  1XKZ A;  2QWS A;  4GLQ A;  5DKL A;  2K2N A;  5GLC A;  4EXO A;  1LT0 A;  3BEB A;  3QP2 A;  1BUE A;  4E3K A;  4RX3 A;  2EX6 A;  2XSS A;  4F94 A;  2WGV A;  1KVM A;  4NXG A;  4QB8 A;  2JKT M;  1S4R A;  3LY4 A;  1BZA A;  2VX8 A;  1G5U A;  1LI9 A;  3HUN A;  2RL3 A;  2PHY A;  1E3U D;  3T4O A;  2J7V A;  2WK0 A;  5TBM B;  4ID4 A;  1DJA A;  4BBV A;  5TFQ A;  1W5D A;  1E3U A;  2VV8 A;  4IED A;  2V9A A;  2W3G A;  3EOI A;  3VP1 A;  4KZB A;  4X1M A;  1I2S A;  3LI8 A;  4DMZ A;  3UB7 A;  2W3D A;  4EUV A;  4GDN A;  4S2L A;  3HCY A;  4E3M A;  4HJ6 A;  5IS1 A;  1T19 A;  1XX2 A;  3HLC A;  3ZCZ A;  3LR5 A;  2ZLY A;  3A0R A;  3V5M A;  3D72 A;  1IKG A;  2Y2P A;  4ZJ2 A;  4LRX C;  2B02 A;  1S66 L;  4MNR A;  3DTI A;  1QMF A;  1ESI A;  4I38 A;  4E3J A;  4OQ0 A;  3AGE A;  4JXV A;  2O0Y A;  3HLG A;  3MBZ A;  4HP9 A;  3D4F A;  1YPR A;  1XGI A;  3R4K A;  3SS5 A;  4U0T A;  3K2N A;  2VJW A;  4Y0T A;  3W8K A;  4CJN A;  4OOM A;  5GHZ A;  5FAP A;  2PRF A;  4OVD A;  1XJ4 A;  4JXS A;  3MZD A;  3ZQ5 A;  2NUP C;  3E0Y A;  1CJF A;  4KG2 A;  4Y3I A;  1DP8 A;  2HDS A;  5CER A;  3QNB A;  5FAT A;  3GVB A;  3IF6 B;  2EX2 A;  5KMW A;  2HDR A;  4DE2 A;  5J7E A;  2LB5 A;  3ZGA B;  2Z6C A;  3IX4 A;  1GHM A;  3E98 A;  3UE3 A;  4BBU A;  3AGF A;  1VHM A;  4KZ4 A;  2Q0O A;  3Q07 A;  1XXM A;  2X71 A;  1TDL A;  2VZW A;  5E2H A;  1F5M A;  3HJK A;  4BQM A;  3QHY A;  3T1X A;  1BTL A;  4GZB A;  1YAX A;  1KVL A;  1E4D A;  3LUQ A;  3H9W A;  4JGR A;  3R7W B;  4JF4 A;  2G7U A;  5FAQ A;  4YOF A;  2EA9 A;  3EQU A;  3S7O A;  1OJ5 A;  1PI4 A;  2X02 A;  2VK3 A;  2K31 A;  1IFQ A;  1DY6 A;  3FKV A;  1S6R A;  3C38 A;  4X68 A;  4K0X A;  3F1P B;  3ZYT A;  4WZ5 A;  2E8I A;  5M1A A;  4HBT A;  3LFV A;  3BRM A;  1JVJ A;  4LPZ A;  1FCM A;  2OAQ 1;  3RFB A;  1RGY A;  1JTD A;  4PAU A;  3C4O A;  4LLO B;  3LID A;  1JWV A;  1ZG6 A;  1TS8 A;  4NXF A;  2IA2 A;  4Z9Q A;  1KE4 A;  4YNR A;  4P6Z M;  3A3F A;  1H8Z A;  2M7U A;  1G6O A;  3G2Y A;  5AQA A; 
#chains in the Genus database with same CATH homology
 3CLO A;  2WKQ A;  5F68 A;  3MR0 A;  4GS9 B;  2WKR A;  2EWW A;  2ZOH A;  4UEY A;  5F69 A;  4BBT A;  4KUK A;  1DRM A;  3DBA A;  2KLI A;  1UWP X;  4O0P A;  4QPR A;  3E4Q A;  3S7P A;  2XRO A;  2P04 A;  3T4Q A;  5HPI A;  1EW0 A;  4ME4 A;  5G4Y A;  4JGO A;  3H82 B;  3RH8 B;  3UME A;  4M4X A;  2J3W A;  4G3V A;  4HY8 A;  3VE3 A;  1OT6 A;  4HJ3 A;  2R78 A;  2I9V A;  4ARZ B;  2D02 A;  1T1B A;  4EU0 A;  3IS2 A;  3PBS A;  2B18 A;  2HJ9 C;  2YKH A;  2J3T C;  4NKP A;  2HJE A;  1T1A A;  4Y2F A;  4L0L A;  2M7V A;  4IUH A;  3S7Q A;  2JHE A;  2FZ0 A;  4JGP A;  4K08 A;  5KIZ A;  2D01 A;  3O5Y A;  1D7E A;  1GSV A;  2A24 B;  3CUE C;  3OLO A;  3LYX A;  2PD8 A;  2W3H A;  1NWZ A;  3A0S A;  2GNX A;  3NOU C;  4P6Z S;  2JKR M;  3IBJ A;  4Q0I A;  4IHQ A;  3LIE A;  3VOL A;  2HV1 A;  3EWK A;  5TJJ A;  3U2A A;  1S1Z A;  3K3D A;  1TD5 A;  1H3Q A;  2QJ7 A;  4HH3 A;  4L9E A;  4PKY G;  4WF0 A;  3BQA A;  1DP6 A;  3OC2 A;  5HDD A;  3RTY A;  3PBN A;  4GHI B;  5MC7 A;  1P9R A;  2GZA A;  1STZ A;  4G3W A;  3MF0 A;  3B33 A;  4DJ2 A;  4F3L B;  4MN6 A;  4UQI S;  1YSP A;  3LIA A;  2L4R A;  2VV6 A;  4R70 A;  5AVF A;  1ZTU A;  2W0N A;  5HDS A;  2ZMF A;  2Y79 A;  1W63 M;  3C2W A;  3MQQ A;  4BJP A;  4NEE D;  5HWV A;  3SW1 A;  3B47 A;  3H82 A;  5FL3 A;  2H28 A;  2O99 A;  3KO6 A;  4DN0 A;  4I39 A;  4ZRR A;  2QYB A;  1P97 A;  3F1N B;  4ARZ A;  3T4J A;  1V9Y A;  2GX5 A;  4CLC E;  4LRZ E;  1UWN X;  2PDR A;  3JVV A;  3LIB A;  3KSI A;  3S7N A;  2VKS A;  1MZU A;  2W1T B;  3FC7 A;  3T50 A;  3D3O A;  2PT7 A;  2ZOI A;  4H6J B;  3VV4 A;  5AVE A;  3PR6 A;  3CWF A;  3EEA A;  2J80 A;  3FG8 A;  2KOI A;  2O9A A;  3G6O A;  2W3F A;  3UE6 A;  4EW7 A;  1IOU A;  4KUO A;  2V0W A;  2PD7 A;  5HD3 A;  1H8M A;  4AFI A;  4G3K A;  1Y28 A;  2GJ3 A;  1LSV A;  3EEH A;  4WLA A;  3BQ8 A;  4L9G A;  2BAS A;  1N9N A;  2ZBB A;  1OT9 A;  5J3W A;  4HIA A;  3EQV A;  4MDZ A;  2O9B A;  4UQI M;  1X0O A;  2DMW A;  1LL8 A;  4I3A A;  4EEU A;  3MFX A;  4I5S A;  4GHI A;  4KQO A;  4EET B;  4R3A A;  2QJ5 A;  1OTE A;  3R7W A;  1P9W A;  3E4O A;  2ZMV A;  1GSX A;  2L0W A;  2NUT C;  3NHQ A;  2O9C A;  4GW9 A;  5AJG A;  4HH2 A;  1T18 A;  4HHD A;  3LIC A;  3PBT A;  2QHK A;  3OCL A;  2A2L A;  4CLC C;  2JKR I;  1DP9 A;  3T4K A;  2WKP A;  3F1P A;  4FOF A;  4WEJ A;  4HJ4 A;  3JVU A;  4WN5 A;  2PR6 A;  1BYW A;  3NJA A;  5A8B A;  4BMW A;  3TRC A;  5DFY A;  4ETX A;  3KX0 X;  2VGL M;  3PBO A;  1P0Z A;  2VV7 A;  2K7S A;  1W63 Q;  4Q0J A;  3KSG A;  3UMD A;  3FPV A;  2XRN A;  3EGX C;  3F1N A;  3ICY A;  1TF1 A;  2QWS A;  4GLQ A;  4HOI A;  5DKL A;  1F98 A;  2K2N A;  3V67 A;  2W1T A;  4EXO A;  1UGU A;  1VB6 A;  1OPX A;  4H6J A;  1LT0 A;  2M1C A;  3BW6 A;  1YKD A;  5IT5 A;  3MQ0 A;  5HWW A;  2V1A A;  3KYZ A;  1NLY A;  3OBF A;  2P7J A;  5HZH A;  2XSS A;  4WEL A;  1OTA A;  3F1O B;  4NXG A;  4CLC B;  4MN7 A;  1V9Z A;  4FSF A;  5DKK A;  2JKT M;  1S4R A;  4ETZ A;  3OCN A;  2VX8 A;  4GS9 A;  2PHY A;  5DJU A;  5F5Y A;  3T4O A;  4GJ4 A;  5CX7 A;  3BWL A;  5TBM B;  4YWZ A;  4BBV A;  3H7W B;  4JGQ A;  4XT2 B;  4NXB A;  4R6L A;  1XJ2 A;  2VA0 A;  3E4P A;  5DJT A;  2VV8 A;  4O01 A;  5HDC A;  2V9A A;  2W3G A;  3BJN A;  5IU1 A;  1LSW A;  3EOI A;  2OOL A;  2VGL S;  3IS2 B;  4RQ9 A;  3NOP C;  3P01 A;  3KSH A;  3LI8 A;  3PXP A;  4DMZ A;  2LB9 A;  2W3D A;  2PR5 A;  3UB7 A;  4EUV A;  2Z6D A;  3C30 A;  1G28 A;  3HCY A;  2INW A;  4HQA A;  4HJ6 A;  3LR3 A;  5IS1 A;  1T19 A;  3PHY A;  3LR5 A;  3T4S A;  4B93 A;  5HWT A;  2KDK A;  3A0R A;  3D72 A;  2A24 A;  3MQO A;  4LRX C;  3MXQ A;  2B02 A;  3MJQ A;  1S66 L;  3T4T A;  2KX6 A;  3LR0 A;  3A0V A;  3CI6 A;  5DF9 A;  2PYR A;  4I38 A;  2FH5 A;  4MMN A;  2Y8H A;  5I5L A;  3LIF A;  5G4Z A;  4NXE A;  2O0Y A;  1OTB A;  4IUK A;  1TS7 A;  2V1B A;  3B42 A;  3K3C A;  3MMH A;  4I3I A;  4I3J A;  4HP9 A;  2VLG A;  2JN7 A;  4MN5 A;  3R4K A;  1XFQ A;  3GDI A;  3F1O A;  3CIT A;  4MCW A;  1NLZ A;  1NRJ A;  2EWV A;  4F3L A;  3FPW A;  3K2N A;  4BWI A;  2VJW A;  4LRY C;  2W27 A;  2XA7 M;  4EER A;  1GSW A;  4EES A;  4HP4 A;  3EGD C;  5TBM A;  4OOM A;  3CUE A;  1XFN A;  3BY8 A;  1MC0 A;  1XJ4 A;  3CAX A;  4GCZ A;  3ZQ5 A;  2NUP C;  3E0Y A;  3H7W A;  4XT2 A;  1TS6 A;  4Y3I A;  1ODV A;  2W3E A;  2P08 A;  4B9O A;  1MKM A;  1YSQ A;  1XJ6 A;  1DP8 A;  4EEP A;  5HL6 A;  2W1R A;  3IBR A;  3PBR A;  4R38 A;  1F9I A;  3BY9 A;  3TE8 A;  1D06 A;  3NOT C;  4Y5F A;  4Z1W A;  5HSQ A;  3KSF A;  2JKT I;  1LSX A;  2HGV A;  5J7E A;  2LB5 A;  4HNB A;  1JNU A;  3HJI A;  4IJG A;  1OJG A;  2Z6C A;  2HF6 A;  3TW8 A;  4OOL A;  3UB8 A;  1OTI A;  3TJZ C;  4Q0H A;  3E98 A;  3ULF A;  4WEK A;  4L9F A;  4DJ3 A;  1N9O A;  3UE3 A;  3W2Z A;  3KYQ A;  3GEC A;  4BBU A;  1VHM A;  2OWJ A;  4WUJ A;  1S1Y A;  3PYP A;  3LR4 A;  1TS0 A;  2V0U A;  4KQD A;  5KSH A;  1XJ3 A;  2VZW A;  2OWH A;  2YKF A;  5LBR A;  1F5M A;  3HJK A;  4E04 A;  2XA7 S;  1T1C A;  1ZHH B;  1YAX A;  3LUQ A;  3H9W A;  2PYP A;  4JGR A;  3R7W B;  5HPF A;  3UB9 A;  2G7U A;  2OAP 1;  4PKY A;  4YOF A;  4CQH A;  2EA9 A;  3EQU A;  4EQ1 A;  5EFW A;  4II7 A;  3S7O A;  1OJ5 A;  5F6A A;  1OTD A;  4WL9 A;  2K31 A;  1IFQ A;  2QKP A;  3C38 A;  1S4S A;  4HI4 A;  3ZYT A;  3F1P B;  5K5B A;  3UB6 A;  3LI9 A;  5L8M A;  3LFV A;  5J4E A;  4LPZ A;  3P7N A;  1WA9 A;  2OAQ 1;  2MJ6 A;  3T4L A;  3RFB A;  5HD5 A;  4O8G A;  4PAU A;  3VE4 A;  4LLO B;  3LID A;  3C8C A;  1TS8 A;  4NXF A;  2IA2 A;  4CLC D;  5DFX A;  1S67 L;  2J3T D;  4YNR A;  4P6Z M;  3PBQ A;  1N9L A;  2CMN A;  2M7U A;  1G6O A;  4PHT A;  2L1M A;  3OOV A;  2VEA A;  4CLC A;  1KOU A;  5C5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...