2M7VA

Green light-absorbing state of tepixj, an active cyanobacteriochrome domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
165
structure length
165
Chain Sequence
MAAVQLSELRDRQAIFETLVAKGRELLACDRVIVYAFDDNYVGTVVAESVAEGWPQARDQVIEDPCFREHWVEAYRQGRIQATTDIFKAGLTECHLNQLRPLKVRANLVVPMVIDDQLFGLLIAHQASEPRQWQEIEIDQFSELASTGSLVLERLHFLEQTIASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Flexibility Variations Between the Ground and Photoactivated States of a Blue/Green Light-Absorbing Cyanobacteriochrome
rcsb
source organism Thermosynechococcus elongatus
molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis protein
total genus 28
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2m7vA00
2KOIA 2VZWA 2O9BA 2O9CA 4YNRA 1STZA 5HSQA 2W3FA 1MKMA 2W3GA 4IUKA 2ZMFA 2W1TA 1YSQA 5HPFA 2W3EA 4YOFA 4CQHA 3TRCA 2W3HA 5C5KA 4ETZA 4LRYC 1TF1A 2VEAA 4ETXA 3IBRA 4MMNA 3KSGA 3S7NA 3W2ZA 3IBJA 2LB9A 3VV4A 4Y2FA 2VKSA 2O9AA 3NOPC 3S7PA 4O01A 4Q0HA 3ZQ5A 3O5YA 4Q0JA 4QPRA 4ME4A 3MQ0A 4Q0IA 4E04A 4LRZE 4IUHA 2B18A 2HGVA 2QYBA 3C2WA 4DN0A 2W1TB 5AJGA 2O0YA 2Y79A 4IJGA 5I5LA 4GLQA 3MF0A 5K5BA 2OOLA 3CI6A 4Z1WA 4O8GA 5HPIA 4G3WA 1TD5A 3RFBA 2K31A 4BWIA 5DFYA 3OOVA 1VHMA 4GW9A 2W3DA 5L8MA 2M7UA 4Y3IA 5LBRA 2G7UA 2VJWA 2Y8HA 3EEAA 3MMHA 3G6OA 3D3OA 4ZRRA 2M7VA 2KLIA 4LRXC 4R6LA 2XRNA 1F5MA 3OBFA 4MN7A 3S7OA 1ZTUA 2IA2A 1YSPA 3CITA 3E98A 3R4KA 3HCYA 2K2NA 4MCWA 3NOUC 4O0PA 3KSIA 4FOFA 5TJJA 3K2NA 3KO6A 4EU0A 2XSSA 3LFVA 5DFXA 1MC0A 4EUVA 1YKDA 3KSFA 3KSHA 4G3KA 3BJNA 4G3VA 4DMZA 2GX5A 4R70A 4Y5FA 2W1RA 3NOTC 4RQ9A 2LB5A 3E0YA 4PAUA 3DBAA 5HL6A 2XROA 4MDZA 3NHQA 3S7QA 2O99A
chains in the Genus database with same CATH superfamily
1Z09A 5CECA 4ID4A 2Y2JA 2NUTC 1BTLA 4UEYA 2QKPA 1MY8A 3G30A 1YSQA 2G2WA 2VGLS 3CG5A 2A24A 2XFTA 4YOFA 3AGDA 3DWKA 4OPQA 3IBRA 2EWWA 4C75A 4KENB 4HOIA 4KQDA 2HF6A 3JYIA 2HZ5A 4XT2B 4GDNA 3E2LA 3A3JA 4Q0IA 2BTFP 3VFHA 3CPTA 5L07A 3C2WA 3UMDA 4EERA 4WZ5C 2X02A 3BFCA 3TW8A 3VP2A 4EETB 1FSWA 3E4QA 4Y13A 5J8XA 2H0TA 2HDUA 1S4RA 3CI6A 3OPPA 4BENA 3VSLA 4EQIA 4B4XA 2OWHA 4E3LA 2WGVA 2VJWA 3IS2A 2VGLM 4R4SA 3DTEA 4NETA 3PR6A 2VGKA 3B33A 1YSPA 2XLNA 3FWLA 4B9OA 2Y91A 3IX8A 5FA7A 3N8SA 5CGSA 1BLCA 4GZBA 2EFXA 5DFXA 1UWPX 4HJ3A 3BJNA 2ZC7A 3T1XA 3HJIA 3R7WA 4OQGA 3T4SA 3NJAA 3EGXC 3IH9A 5G4ZA 1RP5A 2V9AA 1K4EA 5HX9A 5A92A 4WEKA 1VETA 5HSQA 3O86A 5CHMA 4IUKA 2OLUA 1RGYA 2R78A 1TS8A 4EEUA 2EX2A 2ZMAA 3TSGA 2XD1A 3N8LA 3EOIA 5GHYA 4H6JA 4DDYA 3EGDC 5DTKA 1V9YA 1ACFA 1NWZA 3RTYA 4I3JA 4IBXA 3LICA 3HLWA 1SDNA 4H8RA 2PD7A 5EV0A 5AQAA 4XXRA 2ZQ7A 4F3LA 2O0YA 1FCNA 2Y79A 3SS4A 2ZLYA 1K54C 4UA9A 5HD3A 3MR0A 4MN5A 3Q1FA 3OOVA 1VHMA 1X0OA 2ZM2A 4Y3IA 1LHYA 4HI4A 5HL1A 2PHYA 5HWTA 1S1YA 5GHZA 4BBVA 1W8QA 4HH2A 3NCKA 5DF8A 2M7VA 3G32A 5BOHA 4R3BA 2EX6A 3PBQA 2QJ7A 3CUEA 3VP3A 1Q2QA 4KQRA 4DE2A 2XR0A 3K2NA 3KO6A 3LFVA 2GNXA 3MJQA 4EUVA 5EOEA 3PTEA 3T4KA 1MKIA 1YKDA 5AQBA 2ZM0A 3MKFA 2V2FF 2W1RA 1Y4OA 4JGQA 2V8CA 3LY3A 2HJEA 2XROA 5FQ9A 3C4OA 2KOIA 4K0WA 1E4DA 3LI8A 4MBFA 4ZJ2A 3UE6A 2WKHA 2EXBA 2QWSA 1MKMA 2RL3A 3F1NB 1D7EA 2VK3A 4DF6A 1CI9A 2EX8A 1PZOA 4LRYC 2OWJA 4CJNA 2I9VA 2WUQA 3GECA 3WRTA 4OQ0A 4ZJ3A 4KQQA 1T1CA 2EX9A 4E3IA 3S22A 4O01A 4S2IA 4OLDA 5IHVA 1H8ZA 2VGJA 1N9LA 3MQ0A 1QMEA 4AFIA 4IUHA 5DF9A 5FQMA 3UPOA 3UO9A 2B95A 3RH8B 1MBLA 3UN7A 4OKPA 1SZVA 4KZ8A 3H7WB 1L0EA 2V1AA 2HDSA 2J9OA 1S4SA 4BBTA 1CEFA 5TGFA 5FEGA 1NRFA 3V39A 4FH4A 3G6OA 5U47A 4NXEA 3HLDA 1ESUA 4ZBEA 1E3UA 1F5MA 5EVLA 3W4PA 2DRWA 3L9KA 1J3WA 2HP6A 3VE4A 5CGWA 5D3OA 4CLCA 1H5XA 5FASA 1NRJA 3ZHHA 2ZM8A 3LEQA 1ALQA 5HZHA 4Y15A 2Y4AA 3VFFA 3TG9A 2JCHA 2Z6DA 1QMFA 3UE1A 1HVBA 2PDRA 3OZHA 1LI9A 1FILA 5HWVA 2BASA 4Y0OA 3HLFA 4X53A 5KSCA 1XJ4A 5DJUA 3SOIA 2L1MA 2XF3A 3LIAA 3LR5A 5G18A 4FH2A 3HLBA 5GLCA 1ZC2A 1ONGA 4ETZA 1JVJA 2JBFA 1T1AA 2VEAA 1F2KA 1H8YA 2RCXA 4M3KA 1I5QA 4GHIA 3Q81A 1K57C 5HDSA 1K25A 4OH0A 4EV4A 1GSXA 3T4JA 2VLGA 5A93A 1VEUB 3GRJA 3SH9A 1VB6A 2ZOIA 3IH8A 3ULFA 3BWLA 1XJ2A 3ZG8B 1KE0A 1KGGA 1M6KA 1GHMA 4C3QA 3RFBA 4HJ4A 2ZQ9A 3D3OA 4X68A 4LRXC 1YAXA 3HLEA 4S2OA 4HH3A 1G6AA 2ZQCA 3GDIA 3F1NA 3BQ8A 5TJJA 2WGWB 4JKTA 4R0QA 1WYBA 5AVEA 1N9NA 3NY4A 2WADA 3ZG0A 3PXPA 4G3KA 4R70A 4RA7A 2GJ3A 1IOUA 4R4RA 1SCWA 1CEGA 4OPRA 2Y2MA 4L9FA 1NZOA 1LLBA 3MXRA 3WS1A 3MQQA 3UB9A 4P6ZS 2W3FA 5CEDA 2Y59A 2ZMFA 2Y2PA 4HBUA 5HPFA 4EXOA 5DVAA 4Z9QA 5F68A 4QHCA 2D02A 1PW1A 1NJ4A 3ITBA 3MZEA 3VV4A 3Q7VB 1FOFA 1PI5A 3ZG7B 1BYWA 5E2EA 5DF7A 4QPRA 1YLZA 4LV0A 1LSVA 1YLPA 3BFFA 3IF5A 3BRMA 4MN6A 2XDMA 5DKLA 3JVVA 3FKWA 5KIZA 4DE0A 4QD4A 4HQAA 1I2WA 3IXDA 2A24B 1LT0A 2INWA 4BD1A 2YKFA 3TJZC 4CLCC 4K0XA 3L7HA 2CMNA 5CERA 1BLSA 3A0SA 1DJCA 4PM7A 3VP1A 3ZYTA 3UDXA 2X01A 3LR4A 3F1PA 3T1QB 4E3KA 4WMCA 1PFLA 2P04A 4R1GA 2GX5A 2VV7A 4NK3A 2LB5A 2WK0A 5HL6A 5F82A 3IT9A 4LLOB 5AQ7A 4WUJA 1PZPA 3QP5A 4R38A 4LV2A 2P74A 3NULA 5EVIC 5EPHA 1NLYA 4KQOA 1YLWA 2WGIA 4BMWA 2XGNA 2WZXA 3FKVA 2LB9A 4Y2FA 1TS7A 2Y2KA 2OV5A 3O3VA 3LIBA 2Q0OA 1VETB 3OLOA 2WKQA 1KE3A 2B5RA 5FAPA 2VV8A 4GN2A 1XXMA 5KMWA 3CLOA 4HNBA 5FQKA 2EA9A 3LIDA 1DRMA 3BQAA 3FYZA 5EVID 2L0WA 4R6LA 2XRNA 3RJUA 3UPNA 4OOLA 5TBMB 2P9VA 3NDGA 4RVAA 2WAFA 2WGWA 1E3UD 3IX4A 3SW1A 1IFQA 2PR6A 2VA0A 3MZFA 1P9RA 3BFGA 3KSFA 2E8IA 3ZDJA 2AVXA 2PU2A 3NOTC 4CLCD 4JLFA 5FATA 4KZ7A 3ICYA 3G34A 4OQHA 1CF0A 4Q8IA 3C7UA 3CUEC 5EVEA 5E43A 4KG6A 5EOOA 1OPXA 1XJ3A 4YNRA 1S0WA 1CQAA 3MZDA 2BG1A 4EWFA 1N9BA 2W3GA 3DWZA 5I94A 2ZQDA 5F1GA 3ZVWA 5FEFA 3C5AA 1W5DA 4B88A 2EFUA 3KSGA 5FAQA 1OT6A 5HD5A 4CPKA 1BSGA 2H10A 5EUAA 5CTMA 4JGRA 4X69A 5DTSA 4EBNA 3LUQA 4E6XA 5JYOA 1F9IA 5FDSA 1Y54A 3VOLA 2W1TB 1XFQA 1K6SA 3TOIA 4B4ZA 1XGIA 3KYEA 4PM9A 2ZD8A 4NEED 4IJGA 3EQVA 3JVUA 1O7EA 4G3WA 4WL9A 1ZHHB 1SKOA 4EEPA 1CI8A 2K31A 4DXBA 2W3DA 2M7UA 4R3AA 4KZBA 2C6WB 4Y0UA 5FI6A 5EM0A 4JF6A 4HP9A 2J8YA 1K55A 4X1MA 3DAVA 3VOYA 1LSWA 3G35A 4U0TA 4U3TA 2BLSA 5M19A 3I7JA 4GB7A 4O0PA 4EBLA 4YWZA 3V5MA 4L9GA 2XA7M 1MC0A 1HLUP 3BY9A 1XFNA 3M2KA 5GLDA 1PNEA 1YLJA 1LI0A 4LGWA 1K55C 3PAGA 4WN5A 3DW0A 4HJ6A 2JKTI 4II7A 1ERMA 2R9WA 4DKIA 3WWXA 3NI9A 4LCLA 4Y0TA 1K56A 4ZDXA 1XP4A 4P87A 1OT9A 1W63Q 1PI4A 5EM1A 2Q9MA 4S2MA 5E2HA 3UB7A 3UMEA 3MQOA 4OQIA 3CHWP 4HIAA 4DDSA 5FL3A 4WZ5A 3UDFA 3HL9A 3VP0A 5CHJA 4GCZA 3DTIA 3QP1A 4FTXA 2XK1A 4WELA 1T19A 3FPVA 3Q07A 4OOYA 2HP9A 4HBTA 5GLBA 3LIEA 3F1OB 3GR2A 1FSYA 5AVFA 2Z2LB 2J80A 4LV3A 1EW0A 3MF0A 4O8GA 4P6BA 4KG2A 2WKRA 4DXCA 1KVMA 3LO7A 5L8MA 4GHIB 3T12B 3CAXA 3QP6A 4FSFA 4KZ5A 1JTGA 3CITA 1BLHA 1VEUA 3R4KA 4BLMA 1E25A 1T1BA 1CK3A 2WAEA 4BL2A 3A3DA 3IF6B 3KSHA 1SHVA 3HLGA 4RQ9A 4WMCD 3ZCZA 4PAUA 1J9MA 3OPLA 2ACGA 3MFDA 3MSHA 2GZAA 4QB8A 3E4PA 4LFUA 4PKYG 5FSRA 1ZG4A 2FFYA 2Z2MB 5L10A 3SS5A 4A5RA 5CHUA 1ZG6A 3IWQA 3T1SA 2FZ0A 1YT4A 2W1TA 5JYPA 3HVFA 2E8JA 2B02A 1ODVA 4NXFA 3QHYA 2W3HA 1IYOA 4WZ4A 4GKUA 2JN7A 4S2PA 1BULA 3UPPA 1RGZA 1JTDA 3QP4A 1YMXA 3KYZA 4M4XA 3OCNA 4XT2A 1L0DA 3D72A 2XA7S 3IXHA 5FQJA 5AJGA 4N9LA 2J3WA 4N1HA 4DJ2A 4OONA 4GLQA 4QWOA 4R23A 4MBKA 1SKOB 1ES4A 3PBTA 1OJGA 3PAEA 4GW9A 1BT5A 2K7SA 3P01A 3IS2B 1XKZA 2ZQ8A 1JWZA 1DJBA 1BZAA 3M6HA 4MEZA 5KSHA 2KX6A 1MWSA 5EVIA 4U0XA 5EE8A 5A90A 4HEFA 4EU0A 3B42A 2PD8A 2QMIA 3PHYA 4GJ4A 3AGEA 4JXGA 2IWDA 2ZQAA 1GA0A 3BLSA 3A3FA 2PRFA 4Y5FA 5J4EA 2PYPA 3A3EA 1GSVA 4GNUA 4P0MA 1NY0A 4BJPA 3HUOA 1S67L 2ZC3B 1G68A 2HPBA 1P9WA 2O9BA 1S66L 2D01A 1FCMA 2PBDP 2PYRA 4OP5A 3QP2A 1L0GA 2I72A 5CX7A 5GL9A 4EBPA 1NYMA 1W63M 1IYPA 5A91A 4L0LA 4CLCE 1AXBA 4H6JB 1TF1A 1MWTA 5L09A 4X6TA 1XX2A 3BM6A 1UWNX 5CGXA 2VKSA 3KX0X 1SDEA 4KG5A 5E2GA 3C8CA 5HDDA 1OJ5A 1AWIA 3V67A 1L0FA 4GDBA 3CZDA 2OSUA 5EECA 1ES5A 1KVLA 4YINA 3HJKA 3H82A 5EVIB 2OOLA 3G31A 2HJ9C 2QZ6A 3LYXA 3UNWA 2ZC5B 1IYSA 5LBRA 3EEAA 5HDCA 4JXVA 5F6AA 1D1JA 2IWBA 3N4IA 2QPNA 5L2FA 4WEJA 2XFSA 3S7OA 2IA2A 1G28A 3V50A 3N6IA 4NXBA 3HCYA 5AQ9A 4QU3A 3GTCA 3KSIA 5A8BA 1TDLA 4KZ4A 2XSSA 2J3TD 2JKGA 3A0VA 5KZHA 3PYPA 4S2JA 5E2FA 3LEZA 5HAQA 3NC8A 5M18A 4PMAA 4MDZA 1MZUA 5MC7A 4GD8A 3FZCA 4ESPA 3ZFZA 3MXQA 2VZWA 5CRFA 2XQZA 4EESA 2P9VB 1OMEA 1KDWA 4S2LA 4NKPA 3FPWA 1ZKJA 1DP8A 1FR6A 1K56D 5FI7A 2JE5A 3NDEA 3VMAA 1T18A 5CXWA 2HDQA 2H28A 2Y2OA 4JPMA 2ZC6B 3HBRA 1O07A 2A3UA 3IWOA 3D4FA 3UY6A 3S7PA 5FQQA 3IX3A 3LGOA 1SKFA 3P09A 1K57A 4KZ9A 4DJ3A 3F1PB 5F83A 3UE0A 3GVBA 1IKIA 2ZC4B 2HGVA 5F1FA 3PBRA 4OLGA 1WYCA 3UB6A 5J7EA 1KDSA 3OCLA 1TD5A 1NZUA 5DJTA 3MBZA 2J7VA 2WZZA 2KLIA 1VQQA 2Y2GA 2XEPA 1ZTUA 3E98A 1PW8A 4NXGA 1P0ZA 2FH5A 4CLCB 4JBFA 4IVIA 1NYYA 4OP8A 1GHPA 4P6ZM 1UGUA 3SH8A 2QJ5A 3ITAA 3P98A 4X56A 3CWFA 2DNSA 3HLCA 1W8YA 2JC7A 1LL5A 1VM1A 1H8MA 5HWWA 2O9CA 3ZNTA 3T4LA 1STZA 2ZL1B 3GMWA 5IS1A 4GD6A 3MKEA 3MS6A 2W3EA 2G2UA 2QHKA 1LL8A 3LR3A 5DTTA 3H82B 3TRCA 3ZVTA 4MMNA 4WYYA 5HAPA 3SS3A 2Y2LA 3SH7A 1DJAA 4RYEA 5GHXA 3GV9A 5DKKA 4LV1A 4ME4A 2Y55A 1FQGA 2WYXA 3DTMA 1YQSA 2VX8A 1HZOA 4BD0A 3PBSA 2A49A 3HUNA 3NECA 3K3CA 5DFYA 2PBYA 1MPLA 4XUXA 4DE1A 1BUEA 4E6WA 5HFOA 4ZRRA 3PBOA 1FCOA 4MN7A 3JPUA 3C38A 4NG2A 3ISGA 2Y2IA 4X25A 2V8FA 1U60A 1L3LA 3VE3A 1HTZA 4BBUA 1S6RA 2YKHA 4C6YA 4MBHA 4KZ3A 5IT5A 2ZMVA 1C3BA 1ES2A 1W7FA 3LR0A 1N4OA 2Y2QA 4KUKA 4UHUA 4UQIS 3IWIA 2V1ZA 1D06A 2ZOHA 1EWZA 3FG8A 2O99A 1YLYA 1M40A 3LCEA 4BL3A 4PKYA 3U4LP 2CC1A 5J3WA 2W27A 1OTDA 2J3TC 3A0RA 3IXGA 1L2SA 3CMZA 1K54A 1OTBA 4LCMA 5G4YA 1KE4A 4FD8A 4X55A 3HREA 3VSKA 5TFQA 3ZGAB 4QY5A 1YMSA 3KYQA 2JKRI 2Q9NA 2DCFA 5CEBA 3ZQ5A 4E3JA 4HP4A 2J9PA 5EFWA 2Y2HA 2B18A 3WS2A 1YLTA 4DN0A 4Y7PA 2UV0E 3R7WB 3UB5P 2WKPA 1I2SA 4IVKA 1K4FA 4WM9A 1Y28A 2VV6A 1DP9A 2H0YA 2OAQ1 5FAOA 4E3NA 3FC7A 3S1YA 4KZ6A 4QJGA 3T4TA 1OTIA 2IWCA 1TS6A 3EQUA 4MCWA 1PWCA 4HESA 2PU4A 3K3DA 1EI5A 4FOFA 4O7DA 2C5WB 3VP4A 4MNRA 5HARA 2DMWA 4HY8A 1LL9A 3PBNA 3OPRA 4KUOA 3E0YA 3DTKA 2JKFA 1K6RA 4ARZB 5IU1A 3GSGA 3IXBA 3Q82A 1IYQA 1MWUA 1IEMA 4JF5A 4D2OA 3QP8A 5F5YA 1MWRA 5HAIA 2PT7A 4L9EA 3G2ZA 3RXWA 1N9OA 3RXXA 5C5KA 1TVFA 1JWPA 2EWVA 1BLPA 3W2ZA 4WF0A 2O9AA 3B3XA 1PRQA 3M2JA 4N9KA 2PR5A 3WS4A 4D60A 1JNUA 4UA7A 1GCEA 4E04A 3QNCA 2QYBA 3BLMA 1XA1A 2UWXA 3W8KA 2JKRM 4UQIM 5K5BA 2JHEA 1GSWA 4Z1WA 5HPIA 2Y2NA 1MXOA 3WS5A 4ZTKA 4PM5A 1HD8A 4N1XA 3U2AA 4XUZA 1XGJA 1KOUA 3OBFA 3LY4A 3OPHA 5TBMA 4RX2A 1TEMA 4B93A 2ZBBA 1KGFA 2OAP1 1W79A 3TE8A 2L4RA 1JWVA 2HP5A 4GS9A 3FV7A 2WKIA 3SZTA 2EXAA 3E2KA 2P08A 4IEDA 1V9ZA 3T4QA 1PYYA 4RX3A 3IHBA 3NHQA 2V20A 3BYDA 4ZAMA 1TS0A 2JKTM 3H9WA 4OPZA 1FR1A 3G4PA 1S1ZA 3W4OA 3UDIA 1EROA 2KDKA 3H7WA 4N92A 4UAAA 5M1AA 1XJ6A 4S2NC 4CQHA 1F98A 4ZJ1A 2XD5A 4KZAA 2FFFB 2P7JA 1K38A 3UE3A 2XH9A 3T1RA 2M1CA 3G2YA 1FIKA 4BQMA 1PIOA 2V1BA 3BY8A 3BFDA 3EWKA 1ESIA 4OVDA 1H3QA 3V3SA 2A2LA 3HUMA 3M6BA 4E3MA 3P7NA 4WLAA 4JGPA 5HW3A 3CPTB 3IQAA 1Z6FA 4YFMA 3GQZA 4IBRA 1YM1A 4JXSA 5GLAA 3C7VA 4LPZA 3N8RA 4I39A 1DP6A 3UB8A 3AGFA 3ZNYA 4BWIA 4P85A 3MXSA 3BECA 2Y8HA 3MMHA 2PAVP 4PM8A 3IF6A 5TR7A 1OTAA 4I3AA 3N7WA 4OPYA 1XA7A 2HV1A 3QNBA 5FI2A 1CJFA 1KGEA 2V0UA 4I3IA 4OOMA 3LI9A 3BW6A 3NOUC 1NLZA 4EW7A 3V3RA 4LENA 1GA9A 4Y17A 4GOGA 1RCJA 3S4XA 4G3VA 4ARZA 4E3OA 4HHDA 1OTEA 4PPRA 4UA6A 2NUPC 2WKEA 3C30A 3IF6C 2MJ6A 5FDHA 4I5SA 1NXYA 2HDRA 1G5UA 2V0WA 4R3JA 1IELA 1P97A 4DRTA 1GHIA 1PWGA 1Q2PA 3C4PA 4PHTA 4JXWA 2W0NA 2GDNA 3W4QA 3A3IA 4QY6A 4IHQA 3NBLA 1WE4A 4WBGA 4ETXA 1YPRA 3S7NA 3IBJA 3BFEA 3D9YA 3B47A 3NOPC 3ZG5A 2H5SA 3O87A 4Q0HA 3O5YA 4Q0JA 4JGOA 3O88A 4X1LA 4LRZE 4EQ1A 3F1OA 1IKGA 3BEBA 5F69A 4S2KA 3EEHA 5FQIA 4FUWA 2OLVA 2ZL1A 4S2NA 3MFXA 5I5LA 1H0MA 4F3LB 4K91A 4DE3A 3NIAA 1XPBA 4MLLA 2G7UA 3IHAA 1TDGA 5CTNA 4I38A 3T4OA 1DY6A 1A0KA 2Z6CA 4F94A 1ES3A 1ERQA 4PM6A 2ZJ9A 3Q7ZA 2K2NA 4K08A 1WA9A 3ZG9B 1PWDA 4GS9B 4JF4A 4EUZA 3WS0A 2X71A 3Q7VA 3VOZA 4DMZA 2R9XA 1G6OA 3CJMA 3DBAA 3T50A 1K0KA 4FCFA 3E4OA 3LIFA 3WRZA 1LSXA 3OC2A 3S7QA 1ONHA
chains in the Genus database with same CATH topology
4PKYA 5J3WA 2NUTC 2W27A 1OTDA 3MQQA 3UB9A 4P6ZS 2J3TC 3A0RA 2W3FA 4UEYA 2FZ0A 2QKPA 1OTBA 2ZMFA 5G4YA 2W1TA 1YSQA 2VGLS 4EXOA 5HPFA 2B02A 1ODVA 2A24A 4YOFA 5F68A 4NXFA 2W3HA 2D02A 2JN7A 3IBRA 3KYQA 2EWWA 2JKRI 3VV4A 4HOIA 4KQDA 2HF6A 1BYWA 4XT2B 3ZQ5A 3KYZA 4HP4A 4M4XA 4QPRA 3OCNA 4XT2A 5EFWA 1LSVA 4Q0IA 3D72A 2B18A 2XA7S 3C2WA 3UMDA 4EERA 4MN6A 4DN0A 5AJGA 5DKLA 3JVVA 2J3WA 3R7WB 3TW8A 5KIZA 2WKPA 3E4QA 4EETB 4DJ2A 4GLQA 3PBTA 1S4RA 3CI6A 4HQAA 1Y28A 1OJGA 2A24B 1LT0A 2INWA 2VV6A 2YKFA 3TJZC 1DP9A 2OAQ1 4GW9A 2OWHA 3IS2A 2VJWA 3FC7A 2VGLM 4CLCC 2K7SA 3P01A 2CMNA 3IS2B 3T4TA 1OTIA 3PR6A 3A0SA 3B33A 1YSPA 1TS6A 5KSHA 3ZYTA 4B9OA 2KX6A 3EQUA 4MCWA 3K3DA 3LR4A 4FOFA 3F1PA 4EU0A 5DFXA 1UWPX 4HJ3A 3B42A 2DMWA 2PD8A 3PHYA 4GJ4A 2P04A 4HY8A 3BJNA 3PBNA 2GX5A 4Y5FA 2VV7A 3HJIA 2PYPA 4KUOA 3R7WA 2LB5A 5J4EA 3E0YA 1GSVA 4ARZB 5HL6A 5IU1A 4BJPA 3T4SA 3NJAA 3EGXC 5G4ZA 1S67L 2V9AA 4LLOB 1P9WA 2O9BA 1S66L 4WEKA 2D01A 5F5YA 5HSQA 2PYRA 4WUJA 2PT7A 4IUKA 4L9EA 5CX7A 2R78A 1W63M 4R38A 1TS8A 4L0LA 4EEUA 1N9OA 4CLCE 5C5KA 1NLYA 4KQOA 4H6JB 1TF1A 3EOIA 2EWVA 4BMWA 3W2ZA 4H6JA 4WF0A 2LB9A 1UWNX 4Y2FA 2VKSA 3KX0X 3EGDC 1TS7A 2O9AA 3C8CA 5HDDA 1OJ5A 1V9YA 1NWZA 2PR5A 3RTYA 1JNUA 4I3JA 3LICA 3V67A 3LIBA 4E04A 2QYBA 3OLOA 2WKQA 2PD7A 3HJKA 4F3LA 2O0YA 2JKRM 2Y79A 3H82A 2VV8A 4UQIM 5K5BA 2JHEA 1GSWA 2OOLA 4Z1WA 5HPIA 5HD3A 3MR0A 2HJ9C 4MN5A 3OOVA 1VHMA 3LYXA 3CLOA 1X0OA 4Y3IA 4HNBA 5LBRA 4HI4A 3EEAA 2PHYA 2EA9A 1S1YA 1DRMA 3LIDA 5HDCA 5HWTA 3BQAA 3U2AA 4BBVA 4HH2A 5F6AA 2L0WA 2M7VA 4R6LA 3PBQA 4WEJA 1KOUA 2QJ7A 2XRNA 3OBFA 3CUEA 4OOLA 3S7OA 5TBMB 2IA2A 1G28A 4NXBA 5TBMA 3HCYA 4B93A 2ZBBA 3KSIA 3K2NA 5A8BA 3SW1A 2OAP1 1IFQA 3KO6A 2PR6A 2VA0A 2XSSA 3LFVA 2GNXA 1P9RA 3MJQA 2J3TD 4EUVA 3A0VA 3TE8A 2L4RA 3T4KA 3PYPA 4GS9A 1YKDA 3KSFA 3NOTC 2W1RA 4CLCD 2P08A 1V9ZA 3T4QA 3ICYA 4JGQA 2HJEA 2XROA 4MDZA 1MZUA 3NHQA 5MC7A 2KOIA 3MXQA 1TS0A 2JKTM 3H9WA 3LI8A 2VZWA 3CUEC 1S1ZA 1OPXA 1XJ3A 4YNRA 3UE6A 4EESA 2KDKA 4NKPA 2QWSA 3H7WA 1MKMA 3FPWA 2W3GA 3F1NB 1XJ6A 1D7EA 1DP8A 4CQHA 1F98A 1T18A 4LRYC 2OWJA 2H28A 2I9VA 2P7JA 3GECA 3KSGA 1OT6A 5HD5A 3UE3A 2M1CA 3S7PA 1T1CA 4O01A 2V1BA 3BY8A 3EWKA 4JGRA 4DJ3A 1H3QA 2A2LA 3F1PB 3LUQA 1N9LA 3P7NA 4WLAA 3MQ0A 4JGPA 4AFIA 4IUHA 1F9IA 2HGVA 5DF9A 3PBRA 3RH8B 3VOLA 2W1TB 1XFQA 3UB6A 4NEED 4IJGA 5J7EA 3H7WB 3EQVA 3JVUA 2V1AA 4G3WA 4LPZA 4WL9A 3OCLA 1DP6A 1ZHHB 4I39A 3UB8A 1S4SA 1TD5A 4BBTA 4EEPA 2K31A 4BWIA 2W3DA 2M7UA 5DJTA 2Y8HA 3MMHA 3G6OA 4R3AA 4NXEA 1OTAA 4I3AA 2KLIA 4HP9A 1F5MA 2HV1A 1ZTUA 3E98A 1LSWA 2V0UA 4NXGA 4I3IA 3VE4A 1P0ZA 3LI9A 2FH5A 4OOMA 4CLCB 3BW6A 3NOUC 4O0PA 1NLZA 4EW7A 4YWZA 4CLCA 1NRJA 4L9GA 2XA7M 1MC0A 3BY9A 1XFNA 4P6ZM 5HZHA 4G3VA 4ARZA 4HHDA 1OTEA 1UGUA 2Z6DA 2PDRA 2QJ5A 2NUPC 4WN5A 3C30A 3CWFA 4HJ6A 2JKTI 4II7A 5HWVA 2MJ6A 2BASA 4I5SA 2V0WA 1H8MA 5HWWA 1P97A 2O9CA 3T4LA 1STZA 5IS1A 1XJ4A 5DJUA 4PHTA 1OT9A 1W63Q 2W0NA 2L1MA 3LIAA 3LR5A 2W3EA 2QHKA 3LR3A 1LL8A 3H82B 3TRCA 3UB7A 4IHQA 3UMEA 4ETZA 3MQOA 1T1AA 2VEAA 4ETXA 4HIAA 4MMNA 3S7NA 4GHIA 5FL3A 3IBJA 3B47A 3NOPC 4GCZA 4Q0HA 5HDSA 4WELA 3O5YA 4Q0JA 1T19A 3FPVA 5DKKA 4JGOA 1GSXA 4ME4A 3T4JA 2VLGA 3LIEA 4LRZE 4EQ1A 3F1OA 5F69A 2VX8A 3EEHA 1VB6A 3F1OB 5AVFA 2ZOIA 2J80A 3PBSA 3ULFA 3BWLA 1XJ2A 3MFXA 5I5LA 1EW0A 4F3LB 3MF0A 4O8GA 3K3CA 2WKRA 3RFBA 5DFYA 5L8MA 4GHIB 4HJ4A 2G7UA 3CAXA 3D3OA 4I38A 3T4OA 4ZRRA 4FSFA 3PBOA 4LRXC 2Z6CA 1YAXA 4MN7A 3C38A 3CITA 3R4KA 4HH3A 1T1BA 2K2NA 4K08A 3VE3A 3GDIA 3F1NA 1WA9A 3BQ8A 5TJJA 4BBUA 5AVEA 1N9NA 4GS9B 2YKHA 3KSHA 5IT5A 2ZMVA 3PXPA 4G3KA 4DMZA 4R70A 2GJ3A 4RQ9A 1G6OA 1IOUA 3LR0A 4PAUA 4KUKA 3DBAA 3T50A 4UQIS 1D06A 3E4OA 2GZAA 3LIFA 1LSXA 2ZOHA 3FG8A 3OC2A 4L9FA 3E4PA 3S7QA 4PKYG 2O99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOI A;  2VZW A;  2O9B A;  2O9C A;  4YNR A;  1STZ A;  5HSQ A;  2W3F A;  1MKM A;  2W3G A;  4IUK A;  2ZMF A;  2W1T A;  1YSQ A;  5HPF A;  2W3E A;  4YOF A;  4CQH A;  3TRC A;  2W3H A;  5C5K A;  4ETZ A;  4LRY C;  1TF1 A;  2VEA A;  4ETX A;  3IBR A;  4MMN A;  3KSG A;  3S7N A;  3W2Z A;  3IBJ A;  2LB9 A;  3VV4 A;  4Y2F A;  2VKS A;  2O9A A;  3NOP C;  3S7P A;  4O01 A;  4Q0H A;  3ZQ5 A;  3O5Y A;  4Q0J A;  4QPR A;  4ME4 A;  3MQ0 A;  4Q0I A;  4E04 A;  4LRZ E;  4IUH A;  2B18 A;  2HGV A;  2QYB A;  3C2W A;  4DN0 A;  2W1T B;  5AJG A;  2O0Y A;  2Y79 A;  4IJG A;  5I5L A;  4GLQ A;  3MF0 A;  5K5B A;  2OOL A;  3CI6 A;  4Z1W A;  4O8G A;  5HPI A;  4G3W A;  1TD5 A;  3RFB A;  2K31 A;  4BWI A;  5DFY A;  3OOV A;  1VHM A;  4GW9 A;  2W3D A;  5L8M A;  2M7U A;  4Y3I A;  5LBR A;  2G7U A;  2VJW A;  2Y8H A;  3EEA A;  3MMH A;  3G6O A;  3D3O A;  4ZRR A;  2M7V A;  2KLI A;  4LRX C;  4R6L A;  2XRN A;  1F5M A;  3OBF A;  4MN7 A;  3S7O A;  1ZTU A;  2IA2 A;  1YSP A;  3CIT A;  3E98 A;  3R4K A;  3HCY A;  2K2N A;  4MCW A;  3NOU C;  4O0P A;  3KSI A;  4FOF A;  5TJJ A;  3K2N A;  3KO6 A;  4EU0 A;  2XSS A;  3LFV A;  5DFX A;  1MC0 A;  4EUV A;  1YKD A;  3KSF A;  3KSH A;  4G3K A;  3BJN A;  4G3V A;  4DMZ A;  2GX5 A;  4R70 A;  4Y5F A;  2W1R A;  3NOT C;  4RQ9 A;  2LB5 A;  3E0Y A;  4PAU A;  3DBA A;  5HL6 A;  2XRO A;  4MDZ A;  3NHQ A;  3S7Q A;  2O99 A; 
#chains in the Genus database with same CATH topology
 1Z09 A;  5CEC A;  4ID4 A;  2Y2J A;  2NUT C;  1BTL A;  4UEY A;  2QKP A;  1MY8 A;  3G30 A;  1YSQ A;  2G2W A;  2VGL S;  3CG5 A;  2A24 A;  2XFT A;  4YOF A;  3AGD A;  3DWK A;  4OPQ A;  3IBR A;  2EWW A;  4C75 A;  4KEN B;  4HOI A;  4KQD A;  2HF6 A;  3JYI A;  2HZ5 A;  4XT2 B;  4GDN A;  3E2L A;  3A3J A;  4Q0I A;  2BTF P;  3VFH A;  3CPT A;  5L07 A;  3C2W A;  3UMD A;  4EER A;  4WZ5 C;  2X02 A;  3BFC A;  3TW8 A;  3VP2 A;  4EET B;  1FSW A;  3E4Q A;  4Y13 A;  5J8X A;  2H0T A;  2HDU A;  1S4R A;  3CI6 A;  3OPP A;  4BEN A;  3VSL A;  4EQI A;  4B4X A;  2OWH A;  4E3L A;  2WGV A;  2VJW A;  3IS2 A;  2VGL M;  4R4S A;  3DTE A;  4NET A;  3PR6 A;  2VGK A;  3B33 A;  1YSP A;  2XLN A;  3FWL A;  4B9O A;  2Y91 A;  3IX8 A;  5FA7 A;  3N8S A;  5CGS A;  1BLC A;  4GZB A;  2EFX A;  5DFX A;  1UWP X;  4HJ3 A;  3BJN A;  2ZC7 A;  3T1X A;  3HJI A;  3R7W A;  4OQG A;  3T4S A;  3NJA A;  3EGX C;  3IH9 A;  5G4Z A;  1RP5 A;  2V9A A;  1K4E A;  5HX9 A;  5A92 A;  4WEK A;  1VET A;  5HSQ A;  3O86 A;  5CHM A;  4IUK A;  2OLU A;  1RGY A;  2R78 A;  1TS8 A;  4EEU A;  2EX2 A;  2ZMA A;  3TSG A;  2XD1 A;  3N8L A;  3EOI A;  5GHY A;  4H6J A;  4DDY A;  3EGD C;  5DTK A;  1V9Y A;  1ACF A;  1NWZ A;  3RTY A;  4I3J A;  4IBX A;  3LIC A;  3HLW A;  1SDN A;  4H8R A;  2PD7 A;  5EV0 A;  5AQA A;  4XXR A;  2ZQ7 A;  4F3L A;  2O0Y A;  1FCN A;  2Y79 A;  3SS4 A;  2ZLY A;  1K54 C;  4UA9 A;  5HD3 A;  3MR0 A;  4MN5 A;  3Q1F A;  3OOV A;  1VHM A;  1X0O A;  2ZM2 A;  4Y3I A;  1LHY A;  4HI4 A;  5HL1 A;  2PHY A;  5HWT A;  1S1Y A;  5GHZ A;  4BBV A;  1W8Q A;  4HH2 A;  3NCK A;  5DF8 A;  2M7V A;  3G32 A;  5BOH A;  4R3B A;  2EX6 A;  3PBQ A;  2QJ7 A;  3CUE A;  3VP3 A;  1Q2Q A;  4KQR A;  4DE2 A;  2XR0 A;  3K2N A;  3KO6 A;  3LFV A;  2GNX A;  3MJQ A;  4EUV A;  5EOE A;  3PTE A;  3T4K A;  1MKI A;  1YKD A;  5AQB A;  2ZM0 A;  3MKF A;  2V2F F;  2W1R A;  1Y4O A;  4JGQ A;  2V8C A;  3LY3 A;  2HJE A;  2XRO A;  5FQ9 A;  3C4O A;  2KOI A;  4K0W A;  1E4D A;  3LI8 A;  4MBF A;  4ZJ2 A;  3UE6 A;  2WKH A;  2EXB A;  2QWS A;  1MKM A;  2RL3 A;  3F1N B;  1D7E A;  2VK3 A;  4DF6 A;  1CI9 A;  2EX8 A;  1PZO A;  4LRY C;  2OWJ A;  4CJN A;  2I9V A;  2WUQ A;  3GEC A;  3WRT A;  4OQ0 A;  4ZJ3 A;  4KQQ A;  1T1C A;  2EX9 A;  4E3I A;  3S22 A;  4O01 A;  4S2I A;  4OLD A;  5IHV A;  1H8Z A;  2VGJ A;  1N9L A;  3MQ0 A;  1QME A;  4AFI A;  4IUH A;  5DF9 A;  5FQM A;  3UPO A;  3UO9 A;  2B95 A;  3RH8 B;  1MBL A;  3UN7 A;  4OKP A;  1SZV A;  4KZ8 A;  3H7W B;  1L0E A;  2V1A A;  2HDS A;  2J9O A;  1S4S A;  4BBT A;  1CEF A;  5TGF A;  5FEG A;  1NRF A;  3V39 A;  4FH4 A;  3G6O A;  5U47 A;  4NXE A;  3HLD A;  1ESU A;  4ZBE A;  1E3U A;  1F5M A;  5EVL A;  3W4P A;  2DRW A;  3L9K A;  1J3W A;  2HP6 A;  3VE4 A;  5CGW A;  5D3O A;  4CLC A;  1H5X A;  5FAS A;  1NRJ A;  3ZHH A;  2ZM8 A;  3LEQ A;  1ALQ A;  5HZH A;  4Y15 A;  2Y4A A;  3VFF A;  3TG9 A;  2JCH A;  2Z6D A;  1QMF A;  3UE1 A;  1HVB A;  2PDR A;  3OZH A;  1LI9 A;  1FIL A;  5HWV A;  2BAS A;  4Y0O A;  3HLF A;  4X53 A;  5KSC A;  1XJ4 A;  5DJU A;  3SOI A;  2L1M A;  2XF3 A;  3LIA A;  3LR5 A;  5G18 A;  4FH2 A;  3HLB A;  5GLC A;  1ZC2 A;  1ONG A;  4ETZ A;  1JVJ A;  2JBF A;  1T1A A;  2VEA A;  1F2K A;  1H8Y A;  2RCX A;  4M3K A;  1I5Q A;  4GHI A;  3Q81 A;  1K57 C;  5HDS A;  1K25 A;  4OH0 A;  4EV4 A;  1GSX A;  3T4J A;  2VLG A;  5A93 A;  1VEU B;  3GRJ A;  3SH9 A;  1VB6 A;  2ZOI A;  3IH8 A;  3ULF A;  3BWL A;  1XJ2 A;  3ZG8 B;  1KE0 A;  1KGG A;  1M6K A;  1GHM A;  4C3Q A;  3RFB A;  4HJ4 A;  2ZQ9 A;  3D3O A;  4X68 A;  4LRX C;  1YAX A;  3HLE A;  4S2O A;  4HH3 A;  1G6A A;  2ZQC A;  3GDI A;  3F1N A;  3BQ8 A;  5TJJ A;  2WGW B;  4JKT A;  4R0Q A;  1WYB A;  5AVE A;  1N9N A;  3NY4 A;  2WAD A;  3ZG0 A;  3PXP A;  4G3K A;  4R70 A;  4RA7 A;  2GJ3 A;  1IOU A;  4R4R A;  1SCW A;  1CEG A;  4OPR A;  2Y2M A;  4L9F A;  1NZO A;  1LLB A;  3MXR A;  3WS1 A;  3MQQ A;  3UB9 A;  4P6Z S;  2W3F A;  5CED A;  2Y59 A;  2ZMF A;  2Y2P A;  4HBU A;  5HPF A;  4EXO A;  5DVA A;  4Z9Q A;  5F68 A;  4QHC A;  2D02 A;  1PW1 A;  1NJ4 A;  3ITB A;  3MZE A;  3VV4 A;  3Q7V B;  1FOF A;  1PI5 A;  3ZG7 B;  1BYW A;  5E2E A;  5DF7 A;  4QPR A;  1YLZ A;  4LV0 A;  1LSV A;  1YLP A;  3BFF A;  3IF5 A;  3BRM A;  4MN6 A;  2XDM A;  5DKL A;  3JVV A;  3FKW A;  5KIZ A;  4DE0 A;  4QD4 A;  4HQA A;  1I2W A;  3IXD A;  2A24 B;  1LT0 A;  2INW A;  4BD1 A;  2YKF A;  3TJZ C;  4CLC C;  4K0X A;  3L7H A;  2CMN A;  5CER A;  1BLS A;  3A0S A;  1DJC A;  4PM7 A;  3VP1 A;  3ZYT A;  3UDX A;  2X01 A;  3LR4 A;  3F1P A;  3T1Q B;  4E3K A;  4WMC A;  1PFL A;  2P04 A;  4R1G A;  2GX5 A;  2VV7 A;  4NK3 A;  2LB5 A;  2WK0 A;  5HL6 A;  5F82 A;  3IT9 A;  4LLO B;  5AQ7 A;  4WUJ A;  1PZP A;  3QP5 A;  4R38 A;  4LV2 A;  2P74 A;  3NUL A;  5EVI C;  5EPH A;  1NLY A;  4KQO A;  1YLW A;  2WGI A;  4BMW A;  2XGN A;  2WZX A;  3FKV A;  2LB9 A;  4Y2F A;  1TS7 A;  2Y2K A;  2OV5 A;  3O3V A;  3LIB A;  2Q0O A;  1VET B;  3OLO A;  2WKQ A;  1KE3 A;  2B5R A;  5FAP A;  2VV8 A;  4GN2 A;  1XXM A;  5KMW A;  3CLO A;  4HNB A;  5FQK A;  2EA9 A;  3LID A;  1DRM A;  3BQA A;  3FYZ A;  5EVI D;  2L0W A;  4R6L A;  2XRN A;  3RJU A;  3UPN A;  4OOL A;  5TBM B;  2P9V A;  3NDG A;  4RVA A;  2WAF A;  2WGW A;  1E3U D;  3IX4 A;  3SW1 A;  1IFQ A;  2PR6 A;  2VA0 A;  3MZF A;  1P9R A;  3BFG A;  3KSF A;  2E8I A;  3ZDJ A;  2AVX A;  2PU2 A;  3NOT C;  4CLC D;  4JLF A;  5FAT A;  4KZ7 A;  3ICY A;  3G34 A;  4OQH A;  1CF0 A;  4Q8I A;  3C7U A;  3CUE C;  5EVE A;  5E43 A;  4KG6 A;  5EOO A;  1OPX A;  1XJ3 A;  4YNR A;  1S0W A;  1CQA A;  3MZD A;  2BG1 A;  4EWF A;  1N9B A;  2W3G A;  3DWZ A;  5I94 A;  2ZQD A;  5F1G A;  3ZVW A;  5FEF A;  3C5A A;  1W5D A;  4B88 A;  2EFU A;  3KSG A;  5FAQ A;  1OT6 A;  5HD5 A;  4CPK A;  1BSG A;  2H10 A;  5EUA A;  5CTM A;  4JGR A;  4X69 A;  5DTS A;  4EBN A;  3LUQ A;  4E6X A;  5JYO A;  1F9I A;  5FDS A;  1Y54 A;  3VOL A;  2W1T B;  1XFQ A;  1K6S A;  3TOI A;  4B4Z A;  1XGI A;  3KYE A;  4PM9 A;  2ZD8 A;  4NEE D;  4IJG A;  3EQV A;  3JVU A;  1O7E A;  4G3W A;  4WL9 A;  1ZHH B;  1SKO A;  4EEP A;  1CI8 A;  2K31 A;  4DXB A;  2W3D A;  2M7U A;  4R3A A;  4KZB A;  2C6W B;  4Y0U A;  5FI6 A;  5EM0 A;  4JF6 A;  4HP9 A;  2J8Y A;  1K55 A;  4X1M A;  3DAV A;  3VOY A;  1LSW A;  3G35 A;  4U0T A;  4U3T A;  2BLS A;  5M19 A;  3I7J A;  4GB7 A;  4O0P A;  4EBL A;  4YWZ A;  3V5M A;  4L9G A;  2XA7 M;  1MC0 A;  1HLU P;  3BY9 A;  1XFN A;  3M2K A;  5GLD A;  1PNE A;  1YLJ A;  1LI0 A;  4LGW A;  1K55 C;  3PAG A;  4WN5 A;  3DW0 A;  4HJ6 A;  2JKT I;  4II7 A;  1ERM A;  2R9W A;  4DKI A;  3WWX A;  3NI9 A;  4LCL A;  4Y0T A;  1K56 A;  4ZDX A;  1XP4 A;  4P87 A;  1OT9 A;  1W63 Q;  1PI4 A;  5EM1 A;  2Q9M A;  4S2M A;  5E2H A;  3UB7 A;  3UME A;  3MQO A;  4OQI A;  3CHW P;  4HIA A;  4DDS A;  5FL3 A;  4WZ5 A;  3UDF A;  3HL9 A;  3VP0 A;  5CHJ A;  4GCZ A;  3DTI A;  3QP1 A;  4FTX A;  2XK1 A;  4WEL A;  1T19 A;  3FPV A;  3Q07 A;  4OOY A;  2HP9 A;  4HBT A;  5GLB A;  3LIE A;  3F1O B;  3GR2 A;  1FSY A;  5AVF A;  2Z2L B;  2J80 A;  4LV3 A;  1EW0 A;  3MF0 A;  4O8G A;  4P6B A;  4KG2 A;  2WKR A;  4DXC A;  1KVM A;  3LO7 A;  5L8M A;  4GHI B;  3T12 B;  3CAX A;  3QP6 A;  4FSF A;  4KZ5 A;  1JTG A;  3CIT A;  1BLH A;  1VEU A;  3R4K A;  4BLM A;  1E25 A;  1T1B A;  1CK3 A;  2WAE A;  4BL2 A;  3A3D A;  3IF6 B;  3KSH A;  1SHV A;  3HLG A;  4RQ9 A;  4WMC D;  3ZCZ A;  4PAU A;  1J9M A;  3OPL A;  2ACG A;  3MFD A;  3MSH A;  2GZA A;  4QB8 A;  3E4P A;  4LFU A;  4PKY G;  5FSR A;  1ZG4 A;  2FFY A;  2Z2M B;  5L10 A;  3SS5 A;  4A5R A;  5CHU A;  1ZG6 A;  3IWQ A;  3T1S A;  2FZ0 A;  1YT4 A;  2W1T A;  5JYP A;  3HVF A;  2E8J A;  2B02 A;  1ODV A;  4NXF A;  3QHY A;  2W3H A;  1IYO A;  4WZ4 A;  4GKU A;  2JN7 A;  4S2P A;  1BUL A;  3UPP A;  1RGZ A;  1JTD A;  3QP4 A;  1YMX A;  3KYZ A;  4M4X A;  3OCN A;  4XT2 A;  1L0D A;  3D72 A;  2XA7 S;  3IXH A;  5FQJ A;  5AJG A;  4N9L A;  2J3W A;  4N1H A;  4DJ2 A;  4OON A;  4GLQ A;  4QWO A;  4R23 A;  4MBK A;  1SKO B;  1ES4 A;  3PBT A;  1OJG A;  3PAE A;  4GW9 A;  1BT5 A;  2K7S A;  3P01 A;  3IS2 B;  1XKZ A;  2ZQ8 A;  1JWZ A;  1DJB A;  1BZA A;  3M6H A;  4MEZ A;  5KSH A;  2KX6 A;  1MWS A;  5EVI A;  4U0X A;  5EE8 A;  5A90 A;  4HEF A;  4EU0 A;  3B42 A;  2PD8 A;  2QMI A;  3PHY A;  4GJ4 A;  3AGE A;  4JXG A;  2IWD A;  2ZQA A;  1GA0 A;  3BLS A;  3A3F A;  2PRF A;  4Y5F A;  5J4E A;  2PYP A;  3A3E A;  1GSV A;  4GNU A;  4P0M A;  1NY0 A;  4BJP A;  3HUO A;  1S67 L;  2ZC3 B;  1G68 A;  2HPB A;  1P9W A;  2O9B A;  1S66 L;  2D01 A;  1FCM A;  2PBD P;  2PYR A;  4OP5 A;  3QP2 A;  1L0G A;  2I72 A;  5CX7 A;  5GL9 A;  4EBP A;  1NYM A;  1W63 M;  1IYP A;  5A91 A;  4L0L A;  4CLC E;  1AXB A;  4H6J B;  1TF1 A;  1MWT A;  5L09 A;  4X6T A;  1XX2 A;  3BM6 A;  1UWN X;  5CGX A;  2VKS A;  3KX0 X;  1SDE A;  4KG5 A;  5E2G A;  3C8C A;  5HDD A;  1OJ5 A;  1AWI A;  3V67 A;  1L0F A;  4GDB A;  3CZD A;  2OSU A;  5EEC A;  1ES5 A;  1KVL A;  4YIN A;  3HJK A;  3H82 A;  5EVI B;  2OOL A;  3G31 A;  2HJ9 C;  2QZ6 A;  3LYX A;  3UNW A;  2ZC5 B;  1IYS A;  5LBR A;  3EEA A;  5HDC A;  4JXV A;  5F6A A;  1D1J A;  2IWB A;  3N4I A;  2QPN A;  5L2F A;  4WEJ A;  2XFS A;  3S7O A;  2IA2 A;  1G28 A;  3V50 A;  3N6I A;  4NXB A;  3HCY A;  5AQ9 A;  4QU3 A;  3GTC A;  3KSI A;  5A8B A;  1TDL A;  4KZ4 A;  2XSS A;  2J3T D;  2JKG A;  3A0V A;  5KZH A;  3PYP A;  4S2J A;  5E2F A;  3LEZ A;  5HAQ A;  3NC8 A;  5M18 A;  4PMA A;  4MDZ A;  1MZU A;  5MC7 A;  4GD8 A;  3FZC A;  4ESP A;  3ZFZ A;  3MXQ A;  2VZW A;  5CRF A;  2XQZ A;  4EES A;  2P9V B;  1OME A;  1KDW A;  4S2L A;  4NKP A;  3FPW A;  1ZKJ A;  1DP8 A;  1FR6 A;  1K56 D;  5FI7 A;  2JE5 A;  3NDE A;  3VMA A;  1T18 A;  5CXW A;  2HDQ A;  2H28 A;  2Y2O A;  4JPM A;  2ZC6 B;  3HBR A;  1O07 A;  2A3U A;  3IWO A;  3D4F A;  3UY6 A;  3S7P A;  5FQQ A;  3IX3 A;  3LGO A;  1SKF A;  3P09 A;  1K57 A;  4KZ9 A;  4DJ3 A;  3F1P B;  5F83 A;  3UE0 A;  3GVB A;  1IKI A;  2ZC4 B;  2HGV A;  5F1F A;  3PBR A;  4OLG A;  1WYC A;  3UB6 A;  5J7E A;  1KDS A;  3OCL A;  1TD5 A;  1NZU A;  5DJT A;  3MBZ A;  2J7V A;  2WZZ A;  2KLI A;  1VQQ A;  2Y2G A;  2XEP A;  1ZTU A;  3E98 A;  1PW8 A;  4NXG A;  1P0Z A;  2FH5 A;  4CLC B;  4JBF A;  4IVI A;  1NYY A;  4OP8 A;  1GHP A;  4P6Z M;  1UGU A;  3SH8 A;  2QJ5 A;  3ITA A;  3P98 A;  4X56 A;  3CWF A;  2DNS A;  3HLC A;  1W8Y A;  2JC7 A;  1LL5 A;  1VM1 A;  1H8M A;  5HWW A;  2O9C A;  3ZNT A;  3T4L A;  1STZ A;  2ZL1 B;  3GMW A;  5IS1 A;  4GD6 A;  3MKE A;  3MS6 A;  2W3E A;  2G2U A;  2QHK A;  1LL8 A;  3LR3 A;  5DTT A;  3H82 B;  3TRC A;  3ZVT A;  4MMN A;  4WYY A;  5HAP A;  3SS3 A;  2Y2L A;  3SH7 A;  1DJA A;  4RYE A;  5GHX A;  3GV9 A;  5DKK A;  4LV1 A;  4ME4 A;  2Y55 A;  1FQG A;  2WYX A;  3DTM A;  1YQS A;  2VX8 A;  1HZO A;  4BD0 A;  3PBS A;  2A49 A;  3HUN A;  3NEC A;  3K3C A;  5DFY A;  2PBY A;  1MPL A;  4XUX A;  4DE1 A;  1BUE A;  4E6W A;  5HFO A;  4ZRR A;  3PBO A;  1FCO A;  4MN7 A;  3JPU A;  3C38 A;  4NG2 A;  3ISG A;  2Y2I A;  4X25 A;  2V8F A;  1U60 A;  1L3L A;  3VE3 A;  1HTZ A;  4BBU A;  1S6R A;  2YKH A;  4C6Y A;  4MBH A;  4KZ3 A;  5IT5 A;  2ZMV A;  1C3B A;  1ES2 A;  1W7F A;  3LR0 A;  1N4O A;  2Y2Q A;  4KUK A;  4UHU A;  4UQI S;  3IWI A;  2V1Z A;  1D06 A;  2ZOH A;  1EWZ A;  3FG8 A;  2O99 A;  1YLY A;  1M40 A;  3LCE A;  4BL3 A;  4PKY A;  3U4L P;  2CC1 A;  5J3W A;  2W27 A;  1OTD A;  2J3T C;  3A0R A;  3IXG A;  1L2S A;  3CMZ A;  1K54 A;  1OTB A;  4LCM A;  5G4Y A;  1KE4 A;  4FD8 A;  4X55 A;  3HRE A;  3VSK A;  5TFQ A;  3ZGA B;  4QY5 A;  1YMS A;  3KYQ A;  2JKR I;  2Q9N A;  2DCF A;  5CEB A;  3ZQ5 A;  4E3J A;  4HP4 A;  2J9P A;  5EFW A;  2Y2H A;  2B18 A;  3WS2 A;  1YLT A;  4DN0 A;  4Y7P A;  2UV0 E;  3R7W B;  3UB5 P;  2WKP A;  1I2S A;  4IVK A;  1K4F A;  4WM9 A;  1Y28 A;  2VV6 A;  1DP9 A;  2H0Y A;  2OAQ 1;  5FAO A;  4E3N A;  3FC7 A;  3S1Y A;  4KZ6 A;  4QJG A;  3T4T A;  1OTI A;  2IWC A;  1TS6 A;  3EQU A;  4MCW A;  1PWC A;  4HES A;  2PU4 A;  3K3D A;  1EI5 A;  4FOF A;  4O7D A;  2C5W B;  3VP4 A;  4MNR A;  5HAR A;  2DMW A;  4HY8 A;  1LL9 A;  3PBN A;  3OPR A;  4KUO A;  3E0Y A;  3DTK A;  2JKF A;  1K6R A;  4ARZ B;  5IU1 A;  3GSG A;  3IXB A;  3Q82 A;  1IYQ A;  1MWU A;  1IEM A;  4JF5 A;  4D2O A;  3QP8 A;  5F5Y A;  1MWR A;  5HAI A;  2PT7 A;  4L9E A;  3G2Z A;  3RXW A;  1N9O A;  3RXX A;  5C5K A;  1TVF A;  1JWP A;  2EWV A;  1BLP A;  3W2Z A;  4WF0 A;  2O9A A;  3B3X A;  1PRQ A;  3M2J A;  4N9K A;  2PR5 A;  3WS4 A;  4D60 A;  1JNU A;  4UA7 A;  1GCE A;  4E04 A;  3QNC A;  2QYB A;  3BLM A;  1XA1 A;  2UWX A;  3W8K A;  2JKR M;  4UQI M;  5K5B A;  2JHE A;  1GSW A;  4Z1W A;  5HPI A;  2Y2N A;  1MXO A;  3WS5 A;  4ZTK A;  4PM5 A;  1HD8 A;  4N1X A;  3U2A A;  4XUZ A;  1XGJ A;  1KOU A;  3OBF A;  3LY4 A;  3OPH A;  5TBM A;  4RX2 A;  1TEM A;  4B93 A;  2ZBB A;  1KGF A;  2OAP 1;  1W79 A;  3TE8 A;  2L4R A;  1JWV A;  2HP5 A;  4GS9 A;  3FV7 A;  2WKI A;  3SZT A;  2EXA A;  3E2K A;  2P08 A;  4IED A;  1V9Z A;  3T4Q A;  1PYY A;  4RX3 A;  3IHB A;  3NHQ A;  2V20 A;  3BYD A;  4ZAM A;  1TS0 A;  2JKT M;  3H9W A;  4OPZ A;  1FR1 A;  3G4P A;  1S1Z A;  3W4O A;  3UDI A;  1ERO A;  2KDK A;  3H7W A;  4N92 A;  4UAA A;  5M1A A;  1XJ6 A;  4S2N C;  4CQH A;  1F98 A;  4ZJ1 A;  2XD5 A;  4KZA A;  2FFF B;  2P7J A;  1K38 A;  3UE3 A;  2XH9 A;  3T1R A;  2M1C A;  3G2Y A;  1FIK A;  4BQM A;  1PIO A;  2V1B A;  3BY8 A;  3BFD A;  3EWK A;  1ESI A;  4OVD A;  1H3Q A;  3V3S A;  2A2L A;  3HUM A;  3M6B A;  4E3M A;  3P7N A;  4WLA A;  4JGP A;  5HW3 A;  3CPT B;  3IQA A;  1Z6F A;  4YFM A;  3GQZ A;  4IBR A;  1YM1 A;  4JXS A;  5GLA A;  3C7V A;  4LPZ A;  3N8R A;  4I39 A;  1DP6 A;  3UB8 A;  3AGF A;  3ZNY A;  4BWI A;  4P85 A;  3MXS A;  3BEC A;  2Y8H A;  3MMH A;  2PAV P;  4PM8 A;  3IF6 A;  5TR7 A;  1OTA A;  4I3A A;  3N7W A;  4OPY A;  1XA7 A;  2HV1 A;  3QNB A;  5FI2 A;  1CJF A;  1KGE A;  2V0U A;  4I3I A;  4OOM A;  3LI9 A;  3BW6 A;  3NOU C;  1NLZ A;  4EW7 A;  3V3R A;  4LEN A;  1GA9 A;  4Y17 A;  4GOG A;  1RCJ A;  3S4X A;  4G3V A;  4ARZ A;  4E3O A;  4HHD A;  1OTE A;  4PPR A;  4UA6 A;  2NUP C;  2WKE A;  3C30 A;  3IF6 C;  2MJ6 A;  5FDH A;  4I5S A;  1NXY A;  2HDR A;  1G5U A;  2V0W A;  4R3J A;  1IEL A;  1P97 A;  4DRT A;  1GHI A;  1PWG A;  1Q2P A;  3C4P A;  4PHT A;  4JXW A;  2W0N A;  2GDN A;  3W4Q A;  3A3I A;  4QY6 A;  4IHQ A;  3NBL A;  1WE4 A;  4WBG A;  4ETX A;  1YPR A;  3S7N A;  3IBJ A;  3BFE A;  3D9Y A;  3B47 A;  3NOP C;  3ZG5 A;  2H5S A;  3O87 A;  4Q0H A;  3O5Y A;  4Q0J A;  4JGO A;  3O88 A;  4X1L A;  4LRZ E;  4EQ1 A;  3F1O A;  1IKG A;  3BEB A;  5F69 A;  4S2K A;  3EEH A;  5FQI A;  4FUW A;  2OLV A;  2ZL1 A;  4S2N A;  3MFX A;  5I5L A;  1H0M A;  4F3L B;  4K91 A;  4DE3 A;  3NIA A;  1XPB A;  4MLL A;  2G7U A;  3IHA A;  1TDG A;  5CTN A;  4I38 A;  3T4O A;  1DY6 A;  1A0K A;  2Z6C A;  4F94 A;  1ES3 A;  1ERQ A;  4PM6 A;  2ZJ9 A;  3Q7Z A;  2K2N A;  4K08 A;  1WA9 A;  3ZG9 B;  1PWD A;  4GS9 B;  4JF4 A;  4EUZ A;  3WS0 A;  2X71 A;  3Q7V A;  3VOZ A;  4DMZ A;  2R9X A;  1G6O A;  3CJM A;  3DBA A;  3T50 A;  1K0K A;  4FCF A;  3E4O A;  3LIF A;  3WRZ A;  1LSX A;  3OC2 A;  3S7Q A;  1ONH A; 
#chains in the Genus database with same CATH homology
 4PKY A;  5J3W A;  2NUT C;  2W27 A;  1OTD A;  3MQQ A;  3UB9 A;  4P6Z S;  2J3T C;  3A0R A;  2W3F A;  4UEY A;  2FZ0 A;  2QKP A;  1OTB A;  2ZMF A;  5G4Y A;  2W1T A;  1YSQ A;  2VGL S;  4EXO A;  5HPF A;  2B02 A;  1ODV A;  2A24 A;  4YOF A;  5F68 A;  4NXF A;  2W3H A;  2D02 A;  2JN7 A;  3IBR A;  3KYQ A;  2EWW A;  2JKR I;  3VV4 A;  4HOI A;  4KQD A;  2HF6 A;  1BYW A;  4XT2 B;  3ZQ5 A;  3KYZ A;  4HP4 A;  4M4X A;  4QPR A;  3OCN A;  4XT2 A;  5EFW A;  1LSV A;  4Q0I A;  3D72 A;  2B18 A;  2XA7 S;  3C2W A;  3UMD A;  4EER A;  4MN6 A;  4DN0 A;  5AJG A;  5DKL A;  3JVV A;  2J3W A;  3R7W B;  3TW8 A;  5KIZ A;  2WKP A;  3E4Q A;  4EET B;  4DJ2 A;  4GLQ A;  3PBT A;  1S4R A;  3CI6 A;  4HQA A;  1Y28 A;  1OJG A;  2A24 B;  1LT0 A;  2INW A;  2VV6 A;  2YKF A;  3TJZ C;  1DP9 A;  2OAQ 1;  4GW9 A;  2OWH A;  3IS2 A;  2VJW A;  3FC7 A;  2VGL M;  4CLC C;  2K7S A;  3P01 A;  2CMN A;  3IS2 B;  3T4T A;  1OTI A;  3PR6 A;  3A0S A;  3B33 A;  1YSP A;  1TS6 A;  5KSH A;  3ZYT A;  4B9O A;  2KX6 A;  3EQU A;  4MCW A;  3K3D A;  3LR4 A;  4FOF A;  3F1P A;  4EU0 A;  5DFX A;  1UWP X;  4HJ3 A;  3B42 A;  2DMW A;  2PD8 A;  3PHY A;  4GJ4 A;  2P04 A;  4HY8 A;  3BJN A;  3PBN A;  2GX5 A;  4Y5F A;  2VV7 A;  3HJI A;  2PYP A;  4KUO A;  3R7W A;  2LB5 A;  5J4E A;  3E0Y A;  1GSV A;  4ARZ B;  5HL6 A;  5IU1 A;  4BJP A;  3T4S A;  3NJA A;  3EGX C;  5G4Z A;  1S67 L;  2V9A A;  4LLO B;  1P9W A;  2O9B A;  1S66 L;  4WEK A;  2D01 A;  5F5Y A;  5HSQ A;  2PYR A;  4WUJ A;  2PT7 A;  4IUK A;  4L9E A;  5CX7 A;  2R78 A;  1W63 M;  4R38 A;  1TS8 A;  4L0L A;  4EEU A;  1N9O A;  4CLC E;  5C5K A;  1NLY A;  4KQO A;  4H6J B;  1TF1 A;  3EOI A;  2EWV A;  4BMW A;  3W2Z A;  4H6J A;  4WF0 A;  2LB9 A;  1UWN X;  4Y2F A;  2VKS A;  3KX0 X;  3EGD C;  1TS7 A;  2O9A A;  3C8C A;  5HDD A;  1OJ5 A;  1V9Y A;  1NWZ A;  2PR5 A;  3RTY A;  1JNU A;  4I3J A;  3LIC A;  3V67 A;  3LIB A;  4E04 A;  2QYB A;  3OLO A;  2WKQ A;  2PD7 A;  3HJK A;  4F3L A;  2O0Y A;  2JKR M;  2Y79 A;  3H82 A;  2VV8 A;  4UQI M;  5K5B A;  2JHE A;  1GSW A;  2OOL A;  4Z1W A;  5HPI A;  5HD3 A;  3MR0 A;  2HJ9 C;  4MN5 A;  3OOV A;  1VHM A;  3LYX A;  3CLO A;  1X0O A;  4Y3I A;  4HNB A;  5LBR A;  4HI4 A;  3EEA A;  2PHY A;  2EA9 A;  1S1Y A;  1DRM A;  3LID A;  5HDC A;  5HWT A;  3BQA A;  3U2A A;  4BBV A;  4HH2 A;  5F6A A;  2L0W A;  2M7V A;  4R6L A;  3PBQ A;  4WEJ A;  1KOU A;  2QJ7 A;  2XRN A;  3OBF A;  3CUE A;  4OOL A;  3S7O A;  5TBM B;  2IA2 A;  1G28 A;  4NXB A;  5TBM A;  3HCY A;  4B93 A;  2ZBB A;  3KSI A;  3K2N A;  5A8B A;  3SW1 A;  2OAP 1;  1IFQ A;  3KO6 A;  2PR6 A;  2VA0 A;  2XSS A;  3LFV A;  2GNX A;  1P9R A;  3MJQ A;  2J3T D;  4EUV A;  3A0V A;  3TE8 A;  2L4R A;  3T4K A;  3PYP A;  4GS9 A;  1YKD A;  3KSF A;  3NOT C;  2W1R A;  4CLC D;  2P08 A;  1V9Z A;  3T4Q A;  3ICY A;  4JGQ A;  2HJE A;  2XRO A;  4MDZ A;  1MZU A;  3NHQ A;  5MC7 A;  2KOI A;  3MXQ A;  1TS0 A;  2JKT M;  3H9W A;  3LI8 A;  2VZW A;  3CUE C;  1S1Z A;  1OPX A;  1XJ3 A;  4YNR A;  3UE6 A;  4EES A;  2KDK A;  4NKP A;  2QWS A;  3H7W A;  1MKM A;  3FPW A;  2W3G A;  3F1N B;  1XJ6 A;  1D7E A;  1DP8 A;  4CQH A;  1F98 A;  1T18 A;  4LRY C;  2OWJ A;  2H28 A;  2I9V A;  2P7J A;  3GEC A;  3KSG A;  1OT6 A;  5HD5 A;  3UE3 A;  2M1C A;  3S7P A;  1T1C A;  4O01 A;  2V1B A;  3BY8 A;  3EWK A;  4JGR A;  4DJ3 A;  1H3Q A;  2A2L A;  3F1P B;  3LUQ A;  1N9L A;  3P7N A;  4WLA A;  3MQ0 A;  4JGP A;  4AFI A;  4IUH A;  1F9I A;  2HGV A;  5DF9 A;  3PBR A;  3RH8 B;  3VOL A;  2W1T B;  1XFQ A;  3UB6 A;  4NEE D;  4IJG A;  5J7E A;  3H7W B;  3EQV A;  3JVU A;  2V1A A;  4G3W A;  4LPZ A;  4WL9 A;  3OCL A;  1DP6 A;  1ZHH B;  4I39 A;  3UB8 A;  1S4S A;  1TD5 A;  4BBT A;  4EEP A;  2K31 A;  4BWI A;  2W3D A;  2M7U A;  5DJT A;  2Y8H A;  3MMH A;  3G6O A;  4R3A A;  4NXE A;  1OTA A;  4I3A A;  2KLI A;  4HP9 A;  1F5M A;  2HV1 A;  1ZTU A;  3E98 A;  1LSW A;  2V0U A;  4NXG A;  4I3I A;  3VE4 A;  1P0Z A;  3LI9 A;  2FH5 A;  4OOM A;  4CLC B;  3BW6 A;  3NOU C;  4O0P A;  1NLZ A;  4EW7 A;  4YWZ A;  4CLC A;  1NRJ A;  4L9G A;  2XA7 M;  1MC0 A;  3BY9 A;  1XFN A;  4P6Z M;  5HZH A;  4G3V A;  4ARZ A;  4HHD A;  1OTE A;  1UGU A;  2Z6D A;  2PDR A;  2QJ5 A;  2NUP C;  4WN5 A;  3C30 A;  3CWF A;  4HJ6 A;  2JKT I;  4II7 A;  5HWV A;  2MJ6 A;  2BAS A;  4I5S A;  2V0W A;  1H8M A;  5HWW A;  1P97 A;  2O9C A;  3T4L A;  1STZ A;  5IS1 A;  1XJ4 A;  5DJU A;  4PHT A;  1OT9 A;  1W63 Q;  2W0N A;  2L1M A;  3LIA A;  3LR5 A;  2W3E A;  2QHK A;  3LR3 A;  1LL8 A;  3H82 B;  3TRC A;  3UB7 A;  4IHQ A;  3UME A;  4ETZ A;  3MQO A;  1T1A A;  2VEA A;  4ETX A;  4HIA A;  4MMN A;  3S7N A;  4GHI A;  5FL3 A;  3IBJ A;  3B47 A;  3NOP C;  4GCZ A;  4Q0H A;  5HDS A;  4WEL A;  3O5Y A;  4Q0J A;  1T19 A;  3FPV A;  5DKK A;  4JGO A;  1GSX A;  4ME4 A;  3T4J A;  2VLG A;  3LIE A;  4LRZ E;  4EQ1 A;  3F1O A;  5F69 A;  2VX8 A;  3EEH A;  1VB6 A;  3F1O B;  5AVF A;  2ZOI A;  2J80 A;  3PBS A;  3ULF A;  3BWL A;  1XJ2 A;  3MFX A;  5I5L A;  1EW0 A;  4F3L B;  3MF0 A;  4O8G A;  3K3C A;  2WKR A;  3RFB A;  5DFY A;  5L8M A;  4GHI B;  4HJ4 A;  2G7U A;  3CAX A;  3D3O A;  4I38 A;  3T4O A;  4ZRR A;  4FSF A;  3PBO A;  4LRX C;  2Z6C A;  1YAX A;  4MN7 A;  3C38 A;  3CIT A;  3R4K A;  4HH3 A;  1T1B A;  2K2N A;  4K08 A;  3VE3 A;  3GDI A;  3F1N A;  1WA9 A;  3BQ8 A;  5TJJ A;  4BBU A;  5AVE A;  1N9N A;  4GS9 B;  2YKH A;  3KSH A;  5IT5 A;  2ZMV A;  3PXP A;  4G3K A;  4DMZ A;  4R70 A;  2GJ3 A;  4RQ9 A;  1G6O A;  1IOU A;  3LR0 A;  4PAU A;  4KUK A;  3DBA A;  3T50 A;  4UQI S;  1D06 A;  3E4O A;  2GZA A;  3LIF A;  1LSX A;  2ZOH A;  3FG8 A;  3OC2 A;  4L9F A;  3E4P A;  3S7Q A;  4PKY G;  2O99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...