2M7VA

Green light-absorbing state of tepixj, an active cyanobacteriochrome domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
165
structure length
165
Chain Sequence
b'MAAVQLSELRDRQAIFETLVAKGRELLACDRVIVYAFDDNYVGTVVAESVAEGWPQARDQVIEDPCFREHWVEAYRQGRIQATTDIFKAGLTECHLNQLRPLKVRANLVVPMVIDDQLFGLLIAHQASEPRQWQEIEIDQFSELASTGSLVLERLHFLEQTIASL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methyl-accepting chemotaxis protein
publication title Structural and Flexibility Variations Between the Ground and Photoactivated States of a Blue/Green Light-Absorbing Cyanobacteriochrome
rcsb
source organism Thermosynechococcus elongatus
molecule tags Signaling protein
total genus 28
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2m7vA00
2M7VA 4Z1WA 4E04A 3NHQA 4LRZE 2VZWA 5C5KA 5K5BA 5DFXA 3BJNA 4PAUA 4BWIA 1YSPA 1MC0A 3OBFA 3W2ZA 3CI6A 3ZQ5A 4YOFA 3E98A 1ZTUA 2O9CA 2B18A 4R70A 3S7OA 3KO6A 3S7PA 4Y2FA 2W3DA 3KSFA 5HL6A 3LFVA 4YNRA 1VHMA 2ZMFA 4Q0JA 3KSHA 4MCWA 3G6OA 4MMNA 4O8GA 2W1TA 3O5YA 2Y8HA 1TF1A 1STZA 3VV4A 4Q0HA 3NOTC 4DN0A 5HPIA 2Y79A 4CQHA 4GLQA 5I5LA 3OOVA 4R6LA 2O0YA 4ME4A 3RFBA 2W3EA 4LRYC 5DFYA 3R4KA 2VJWA 2QYBA 2W3FA 4LRXC 4ETZA 4GW9A 3IBJA 2XSSA 3MMHA 2G7UA 4MN7A 3EEAA 4ZRRA 4Y5FA 2HGVA 3K2NA 2W3GA 2KLIA 4G3KA 4IJGA 2M7UA 1MKMA 1YSQA 2O99A 3CITA 2VEAA 2W1RA 4QPRA 2KOIA 2O9AA 2XRNA 3MQ0A 2XROA 2IA2A 4IUHA 3NOUC 3KSIA 4RQ9A 4O0PA 5LBRA 4EUVA 2OOLA 3HCYA 3E0YA 4Q0IA 1TD5A 4MDZA 5L8MA 2O9BA 4EU0A 5HSQA 3KSGA 4IUKA 3TRCA 1F5MA 5AJGA 3C2WA 5HPFA 5TJJA 2LB5A 2LB9A 4Y3IA 4ETXA 3DBAA 4G3WA 4DMZA 2K31A 1YKDA 2W1TB 3S7NA 2W3HA 3NOPC 3IBRA 3S7QA 2K2NA 3D3OA 2VKSA 4G3VA 2GX5A 4FOFA 4O01A 3MF0A
chains in the Genus database with same CATH superfamily
1O7EA 5DF7A 5FQJA 1MWRA 3LIFA 1S1YA 3IHBA 2L0WA 3ZFZA 1IELA 4L9FA 3IXBA 2Q9MA 4CPKA 4WZ4A 2Q0OA 5HL6A 4YNRA 3JPUA 1NZUA 3KSHA 3GECA 3EEHA 2Y8HA 4ZTKA 3V67A 3VV4A 2B5RA 2ZQ9A 3OPLA 4OOMA 4R6LA 5FEFA 4OLDA 4HY8A 3DAVA 3UPOA 2ZBBA 2Y4AA 1K57C 2Z6CA 4LRXC 1OJ5A 5CEBA 4OPYA 3ZGAB 3P7NA 4EBNA 4JPMA 3HLDA 3MBZA 1W63Q 4UHUA 1SZVA 4WZ5A 3OCLA 2PHYA 2KOIA 3OPPA 3V39A 5GHYA 1K4FA 3S22A 4GKUA 4RQ9A 1ZKJA 4JBFA 4KZ7A 2QZ6A 3IF6A 4MDZA 5AJGA 4UA7A 2HDQA 2XH9A 4X1LA 1DY6A 2EX9A 4RVAA 3SS3A 5DKKA 5A92A 4E6XA 3SOIA 1OMEA 4BLMA 1TS6A 2XD1A 3ZG9B 3TE8A 1YLZA 4DKIA 1Y54A 5G4YA 1K6RA 2VZWA 4I3AA 3PBRA 3BJNA 5FEGA 1NJ4A 4IBRA 2B18A 1Q2QA 3SS4A 5EM0A 2ZMAA 4H8RA 1G6AA 4BL2A 3E2LA 4JF6A 5AQAA 3IH8A 1UWNX 4GHIB 2WGWA 3PBSA 4EV4A 1STZA 2ACGA 4OQGA 2P08A 5HWTA 1BLPA 4OPZA 4DF6A 3U4LP 1KDWA 2HDRA 3D4FA 3EEAA 1XFNA 3OPHA 4GN2A 3DWZA 1XGJA 1BT5A 3T4QA 1MKMA 4PPRA 5EVIB 2XA7M 4KUKA 2O9AA 1VEUA 1FILA 2EXAA 3WWXA 4XUXA 3LYXA 1TS8A 1TS0A 4E3NA 1XJ4A 4UQIM 2P9VA 4O0PA 3B33A 1HZOA 5CHUA 5CXWA 2ZL1A 5HZHA 2WKRA 4UA9A 5FI7A 4OOYA 3GV9A 3Q07A 3UB7A 4S2PA 5M18A 1K55C 4EQIA 4X68A 2V1BA 4QB8A 2K2NA 2OAP1 1NYYA 5DTTA 3CAXA 2J3WA 1N4OA 3QP8A 4DXCA 1ES2A 1SKFA 4KQOA 2L1MA 4KZ3A 1TVFA 3K3CA 4S2NA 3ZHHA 4GS9A 1L3LA 3F1OA 3H7WA 2J7VA 2O9CA 3A0VA 3KO6A 3S7OA 3OC2A 3G35A 2W3DA 4KG6A 4H6JB 5FQKA 3Q7VB 5EOOA 1S4SA 3PYPA 2R78A 3UB5P 1D7EA 3FPWA 4OQIA 1H8YA 4Q8IA 2BASA 4LRYC 3FZCA 3HUOA 2OWJA 2W3FA 1M6KA 1F9IA 3NDGA 4BD0A 3RH8B 4BENA 4HH2A 3C7VA 2A24B 4HP4A 3C8CA 2VEAA 4Y7PA 1IYQA 2JCHA 1EI5A 3RJUA 3G34A 2KX6A 1W5DA 1CK3A 4JXSA 3VE3A 1X0OA 3IWIA 3HLWA 1XJ3A 4Z9QA 3SZTA 3CLOA 5L10A 5L09A 1SHVA 4G3WA 5EE8A 4CLCE 1FR6A 5EPHA 2J3TD 4RA7A 3CHWP 3ITAA 4OVDA 4E3KA 1DJBA 3R7WA 2VKSA 2Y2IA 5EOEA 4LV2A 3QP5A 4HBUA 4LV0A 2B02A 4JXWA 2MJ6A 4X6TA 5EUAA 3CG5A 3VSKA 3ZVWA 1N9LA 3O87A 3LR3A 3T1QB 1J3WA 3T4LA 4R23A 4GD6A 3HLEA 3T4JA 1Y4OA 4WBGA 4LLOB 5HDCA 1L2SA 2J8YA 1TDLA 4QHCA 2G2UA 3UE1A 5BOHA 4EBLA 1T1BA 4WZ5C 1P9WA 1GSVA 4L0LA 3TJZC 4P87A 4EERA 1YLPA 3NJAA 4B88A 3IF6C 4LPZA 4GZBA 3T50A 2DCFA 3UE0A 5EECA 2HP9A 3QP6A 4ARZB 2H10A 3WRTA 3V5MA 1G68A 3F1NB 5F1FA 2JHEA 3G4PA 2M7UA 3ZNTA 3N6IA 5DVAA 1S0WA 4Y0TA 2JKFA 3UB8A 2PYRA 2IWCA 5AQ9A 3GQZA 3GVBA 1HD8A 4QJGA 4NXBA 1TD5A 4X25A 5CEDA 1GA9A 4EETB 4BBUA 2I72A 4XT2B 4EBPA 1F2KA 3FC7A 5L2FA 3C30A 1PWGA 3HJKA 3BW6A 3ZCZA 2XFSA 2P7JA 4WL9A 4G3VA 3O3VA 4DJ2A 1W63M 1ZG6A 2Y2KA 3H82A 2QMIA 3IHAA 4WN5A 4II7A 1GHIA 1YLYA 1W8QA 2PDRA 1IEMA 5EVEA 1IKIA 3TSGA 1JTGA 4RYEA 3CUEA 1E3UA 4PMAA 2FZ0A 4O8GA 2QWSA 2XEPA 4EEUA 2XA7S 1GHPA 2EWVA 5TR7A 1YMSA 3G32A 1W7FA 4UQIS 5MC7A 3V3RA 3CMZA 3QHYA 5E2GA 3BM6A 1E3UD 3EGDC 5CGXA 2DNSA 2XSSA 3MMHA 2ZC4B 4ZRRA 3BFDA 4WM9A 3SS5A 3G30A 4HBTA 2FH5A 3Q81A 5CERA 1ES3A 2X01A 3T4KA 2XRNA 1NXYA 1XJ6A 1D1JA 4R3BA 4PKYG 4S2NC 3ZG0A 1FQGA 1H8MA 1MWTA 3FKVA 5TFQA 4JF5A 4EUVA 1EROA 1VETB 5KSHA 1S6RA 2KDKA 5HSQA 3MZFA 5CTMA 2DMWA 3IQAA 1PZOA 4E3JA 2W1TB 2WKPA 3D3OA 1FOFA 1QMFA 2R9WA 4B9OA 5HWWA 1O07A 2M7VA 3LO7A 4MBKA 1DJCA 4PM9A 4S2IA 1OTDA 5DFXA 2JC7A 1YSPA 4PHTA 4PM7A 1LL9A 1ONHA 5F68A 4AFIA 3CI6A 2H0TA 2ZD8A 4U0TA 3TOIA 4X53A 4HOIA 3N8LA 1TEMA 3LI9A 1V9ZA 2L4RA 2UV0E 3T4OA 3S7PA 4JXVA 4HESA 2VGKA 4LV3A 3HLCA 4UA6A 2XLNA 4Q0JA 4MCWA 3G6OA 3BYDA 2VGJA 3BQAA 3MKEA 1BLHA 2J3TC 2Z2MB 2JKRI 3V3SA 4D2OA 3JYIA 4S2JA 4M3KA 2ZOIA 5DTKA 4CQHA 4JGOA 1BYWA 1ESIA 3ITBA 3SH7A 3QP4A 2XGNA 1ZHHB 3Q82A 4E3IA 1CJFA 4GDNA 1HLUP 3IBJA 1PW8A 1DRMA 2PU4A 3EQUA 1YQSA 3SW1A 2E8JA 2HGVA 2OLVA 1RGZA 1MWSA 3VE4A 4R38A 3C4PA 2VGLS 3IX8A 3MQ0A 5GHXA 1KGFA 2IA2A 2NUPC 5TBMA 1L0GA 2X71A 4Q0IA 3IXGA 4HP9A 5FL3A 3KSGA 1ODVA 4IUKA 1F5MA 2GJ3A 3EQVA 5HPFA 3GRJA 4DMZA 1LHYA 2IWDA 2QPNA 3EWKA 4NXGA 5EVLA 3C5AA 2A3UA 2ZC5B 1XA7A 1SCWA 2WGIA 4DRTA 4N1XA 5A90A 5J3WA 4HEFA 1S66L 3OBFA 1NLYA 1P97A 3HLGA 5EM1A 4S2LA 5HX9A 4ZDXA 4GB7A 3E98A 3DWKA 4LV1A 4ZBEA 4OPQA 2WAFA 5F1GA 1IYPA 1HTZA 2Y2NA 5CECA 1FSWA 3MSHA 1LSWA 2ZJ9A 2ZM8A 4LFUA 2OV5A 3AGEA 2Y2LA 5E2FA 2Y2MA 5HPIA 4EEPA 1YLWA 3ICYA 2VV6A 2W3EA 3UO9A 3T4TA 3W4PA 3ZG8B 4UEYA 1LSVA 2PT7A 3HLBA 2VX8A 4PM5A 5FAPA 2PBYA 3CITA 3HLFA 2Y2JA 3QNBA 2PAVP 3M2JA 3GTCA 2E8IA 4YWZA 3DTEA 3E0YA 4NXFA 2WKQA 5FQMA 4EU0A 5E43A 2OLUA 1CQAA 4I5SA 2WKEA 4QU3A 3QNCA 3T1RA 3CUEC 2QKPA 2W3HA 2W27A 4KZ6A 2WGWB 1KVMA 1S4RA 1LL5A 2ZQAA 3ZNYA 4KZAA 3BY9A 3AGFA 5A91A 2V20A 1I2SA 3M6BA 2Y59A 4IVIA 4A5RA 1ZTUA 1MKIA 1K54C 1RP5A 4CJNA 3KYZA 5AQ7A 1XP4A 3UPPA 3GSGA 4BL3A 1VHMA 4KQQA 4ESPA 2ZMFA 1VEUB 4OP5A 1LI9A 3LIEA 3WS5A 4EUZA 1PWCA 3QP2A 2P9VB 4FH4A 2FFYA 3RTYA 1ACFA 2ZL1B 4N1HA 4U0XA 1H0MA 4GLQA 4QY6A 1ALQA 5CGWA 3LUQA 3MFDA 2PBDP 3NY4A 1Z09A 2JN7A 4ETZA 2PD8A 2BLSA 2EX8A 3A0RA 5DF8A 2ZM0A 3K2NA 2KLIA 4FD8A 1YSQA 3LIDA 4WUJA 4OPRA 4FUWA 3L7HA 3BLSA 3NIAA 4GS9B 2UWXA 3F1OB 4S2KA 4NG2A 3H7WB 2EX2A 4IUHA 4OQ0A 3IH9A 2VV8A 5TJJA 2XK1A 5HWVA 4DE0A 3IBRA 3W8KA 1VQQA 2VLGA 4GDBA 3B42A 4LENA 3PAEA 2RL3A 5GLAA 1N9OA 1Q2PA 3Q7ZA 4HH3A 2ZMVA 4BWIA 1IYSA 4R3JA 3NBLA 4OQHA 3IS2A 4HI4A 3KYEA 4CLCA 3KSFA 5EV0A 3PXPA 4K0XA 2D02A 3TG9A 3LY3A 2VGLM 3O5YA 2ZQ7A 4F3LA 1YPRA 3OCNA 4I3JA 5I5LA 3OOVA 1GSXA 2Y91A 3LEZA 4NETA 3LR5A 4S2MA 1KOUA 4HHDA 4EWFA 3RFBA 1S1ZA 1PZPA 4CLCD 3IXHA 4WYYA 2M1CA 3VP4A 2HPBA 2ZQCA 5F82A 5KZHA 2J9PA 1FR1A 3R7WB 5HAPA 3UDXA 4QY5A 4IBXA 3I7JA 3CJMA 3QP1A 1Y28A 1DJAA 3ZVTA 4Y17A 4E3LA 1XJ2A 4ZJ1A 4BBVA 2HJEA 3GDIA 4XXRA 2GDNA 4R4SA 1NWZA 4NK3A 3LR0A 2LB5A 3DBAA 2EWWA 4FTXA 4JGQA 3OLOA 3F1PA 3FYZA 4X55A 4BD1A 2JBFA 5IU1A 4OLGA 3O88A 3WS1A 5HDDA 3C4OA 2OWHA 3B47A 2H28A 5J7EA 4HJ3A 5C5KA 5HW3A 4GOGA 2RCXA 2ZC3B 5HAIA 3W2ZA 4I3IA 3PHYA 4KZ5A 4PKYA 3E4QA 3T1XA 1TS7A 1AWIA 5EFWA 3LIAA 1SKOA 3BFGA 3FWLA 1BLSA 5E2HA 2R9XA 3UE3A 4MMNA 2V9AA 5FDHA 5FASA 4DDSA 1H5XA 4P6ZM 1VB6A 4GNUA 5M1AA 3DTKA 5J4EA 2HP6A 2O0YA 4ME4A 4M4XA 4LCLA 2ZQDA 4RX2A 1FSYA 1K38A 3NCKA 5F83A 2G7UA 2EFUA 4R3AA 1EWZA 4KZ9A 4C6YA 1SDNA 4K08A 1MY8A 1Z6FA 5CGSA 3H82B 1OJGA 3VP1A 2PRFA 2WUQA 4L9GA 3FKWA 1NRJA 2WGVA 5FQ9A 2XROA 5F6AA 3ULFA 5M19A 5LBRA 4E6WA 1BUEA 1C3BA 1K54A 3RXWA 1AXBA 1KE0A 3UB9A 3MS6A 2DRWA 2FFFB 3C2WA 1H8ZA 1EW0A 3S4XA 5CX7A 2WK0A 3PBTA 2QJ5A 1W79A 2JKTI 2PYPA 3W4OA 4GCZA 4P6BA 2GX5A 4O01A 4HIAA 3ZG5A 3Q1FA 3EGXC 3IXDA 3BWLA 5K5BA 3M2KA 5HD5A 4DDYA 3RXXA 1BZAA 4NKPA 5CHMA 4K0WA 5HFOA 5A93A 3CPTA 3UE6A 1BULA 3FV7A 1G5UA 4OH0A 2V8CA 2Z2LB 5DKLA 5G4ZA 3A0SA 5CTNA 5FI6A 3VP0A 4DJ3A 5FQQA 1U60A 5GL9A 1E25A 4OP8A 2P04A 5HARA 1XXMA 4X56A 4KZ8A 4KQDA 4P85A 3N8RA 1NZOA 1HVBA 1WA9A 2QYBA 2AVXA 3G2ZA 4KQRA 1P9RA 2WAEA 3IF5A 2W3GA 1F98A 2J9OA 4OKPA 1H3QA 1LLBA 3FPVA 2HF6A 2W1RA 4QPRA 2D01A 1K25A 3MQOA 2VV7A 3VFFA 1GCEA 4MNRA 4WF0A 1ZC2A 1PRQA 4EQ1A 1XX2A 3NDEA 3UMDA 3A3IA 1DP8A 3DTIA 4Y3IA 4CLCC 5AQBA 5D3OA 1NLZA 1YKDA 3UN7A 3GR2A 1PWDA 4X1MA 1LI0A 3BQ8A 2PD7A 3HL9A 5GLDA 4KENB 1YM1A 4KG2A 3T12B 5L07A 2P74A 1YAXA 5E2EA 1IFQA 3DW0A 1MC0A 4ID4A 1FCOA 1T1CA 4ZJ2A 3PTEA 3TW8A 3MZDA 4MLLA 4O7DA 4N9KA 3G2YA 4QWOA 3MKFA 1JWZA 4E3MA 5TBMB 2WYXA 4ZJ3A 1L0DA 4KG5A 5JYOA 2IWBA 3MQQA 1KVLA 2VA0A 3EOIA 2EFXA 3KX0X 2C6WB 1K6SA 2WKHA 3NC8A 3L9KA 4FSFA 1ONGA 1XFQA 2H5SA 3P09A 3UMEA 4R1GA 3BLMA 1ES4A 3LI8A 1MBLA 1PIOA 3IF6B 1L0FA 1ES5A 2OSUA 4GHIA 1XGIA 3FG8A 2PR5A 3WS2A 5J8XA 3BFCA 4ZAMA 4WELA 1KGEA 5IHVA 1LSXA 2O9BA 2INWA 1PFLA 4XUZA 2W0NA 2ZQ8A 3MR0A 1OTAA 3NULA 1CI9A 3HVFA 1JVJA 1WYCA 3D72A 3S7NA 1PNEA 3S7QA 1MPLA 4EW7A 1JNUA 3NECA 4IHQA 2ZC7A 4JKTA 3MXRA 3B3XA 2Y2PA 3LY4A 1UWPX 1D06A 4P6ZS 1NY0A 2HDUA 4OONA 4E04A 3NI9A 2V8FA 5F69A 4LRZE 3ISGA 5EVIA 1BTLA 3N7WA 2WZZA 1JWPA 3OPRA 5KMWA 4YOFA 1CEGA 4KUOA 5FI2A 4R0QA 1L0EA 2V0WA 3C7UA 1FCMA 3BECA 1K0KA 3WS4A 1N9NA 4Y0UA 5EVID 2EX6A 1V9YA 3ZYTA 1J9MA 3LICA 5GLCA 3S1YA 3NOTC 1KDSA 4R4RA 4HQAA 5CHJA 1DP9A 2X02A 3PBOA 3R4KA 1MWUA 1BLCA 2ZC6B 4GW9A 1IYOA 1JTDA 5KSCA 3JVUA 4NXEA 3W4QA 2JKTM 1IOUA 5HAQA 2WZXA 4BJPA 2A49A 4H6JA 3Q7VA 1W8YA 3WS0A 5FAQA 4YFMA 2WKIA 3NOUC 2BTFP 4NEED 4B4ZA 3HCYA 4DE3A 1OT6A 3PAGA 5HD3A 4PM6A 3MXQA 2K31A 4JLFA 1OTEA 1GA0A 3BFEA 1YLTA 2V1ZA 3NOPC 4I38A 1LL8A 4F94A 1KE4A 4X69A 5DJUA 5GHZA 5FDSA 4DE1A 1PW1A 4D60A 2A24A 3VMAA 5IT5A 1N9BA 3WRZA 3CZDA 3NHQA 1T1AA 2ZLYA 2OAQ1 1YLJA 2HV1A 2Y2QA 1PI5A 5HDSA 4B4XA 4BQMA 3LR4A 1KGGA 3A3EA 2V1AA 4HNBA 2EA9A 2YKHA 1LT0A 1ERQA 4HJ4A 4Y2FA 4Y13A 2HJ9C 3LFVA 5FATA 2JKRM 3IWQA 3D9YA 5CRFA 3LGOA 4JGRA 2V0UA 1G6OA 3P01A 3A3FA 4C75A 2WADA 2H0YA 4WLAA 2CC1A 3O86A 4P0MA 4PM8A 4L9EA 1IKGA 4YINA 5U47A 3BY8A 5IS1A 2K7SA 4B93A 2XDMA 4GJ4A 1FCNA 1ERMA 1G28A 1A0KA 1CI8A 2O99A 1QMEA 1RGYA 2HP5A 3ZDJA 3T1SA 1E4DA 1I5QA 3VOLA 4IVKA 3IX3A 4MBFA 2HZ5A 3IS2B 1VM1A 3GMWA 4KZ4A 1PYYA 3E4PA 2Y55A 1CF0A 4CLCB 1MZUA 5DF9A 3UDIA 4ETXA 1MXOA 3JVVA 1K57A 3BEBA 3MFXA 1NRFA 4JF4A 5JYPA 2GNXA 5FAOA 1UGUA 3IX4A 4ARZA 2QJ7A 4MN6A 4F3LB 5FQIA 3F1NA 1SDEA 3MF0A 1NYMA 4WEJA 3PBNA 4Z1WA 3MXSA 1ESUA 3A3JA 4BBTA 3K3DA 2C5WB 4PAUA 2G2WA 2PU2A 3AGDA 4DE2A 4R70A 5AVEA 4JXGA 4JGPA 3VP3A 4K91A 4WMCA 4XT2A 1M40A 4UAAA 2A2LA 1YMXA 4N9LA 2QHKA 5GLBA 3VFHA 4C3QA 4Q0HA 1XKZA 3MZEA 3LIBA 2VK3A 1K56A 2CMNA 2XFTA 3A3DA 2GZAA 3C38A 3LEQA 3BRMA 4WMCD 2EXBA 2VJWA 4EESA 1KE3A 3F1PB 1OTIA 1GHMA 3LCEA 1CEFA 2V2FF 3UPNA 2Y2GA 4Y15A 4G3KA 3UNWA 4IJGA 3MJQA 1K56D 1OT9A 5FSRA 2BG1A 4DXBA 1JWVA 5EVIC 1I2WA 5F5YA 2Y2HA 1S67L 5HL1A 3P98A 3T4SA 5G18A 3M6HA 5L8MA 3E2KA 2B95A 1P0ZA 1SKOB 1YT4A 1ZG4A 2ZOHA 3UDFA 4Y0OA 1BSGA 1T19A 2ZM2A 4S2OA 4WEKA 4MBHA 1OTBA 2XF3A 2Z6DA 3HUMA 4HJ6A 4FH2A 3VOZA 1PI4A 4LCMA 4LGWA 3PBQA 1OPXA 2XQZA 5DTSA 3SH8A 1T18A 5FA7A 3VOYA 3OZHA 1WYBA 4N92A 2XD5A 3U2AA 3ZQ5A 2HDSA 2JE5A 2YKFA 3HJIA 1VETA 4E3OA 3V50A 3VSLA 3IT9A 1TDGA 1FIKA 1K55A 5A8BA 4OOLA 2J80A 2W1TA 3HUNA 1TF1A 3HBRA 5KIZA 4DN0A 2PR6A 4EXOA 2Y79A 5DJTA 2Y2OA 3ZG7B 3BFFA 3N8SA 2NUTC 4BMWA 5DFYA 1GSWA 3E4OA 2I9VA 4I39A 4MN7A 3IWOA 4Y5FA 1DP6A 2Q9NA 2JKGA 4QD4A 4RX3A 3UY6A 1XA1A 4GD8A 2XR0A 1WE4A 3H9WA 1RCJA 3SH9A 5I94A 1K4EA 3KSIA 4MEZA 4U3TA 3CPTB 2OOLA 1XPBA 4IEDA 3G31A 3DTMA 5AVFA 4FCFA 3TRCA 3KYQA 3UB6A 3N4IA 2LB9A 5TGFA 3PR6A 3CWFA 4MN5A 4KZBA 3HREA 3VP2A 4FOFA
chains in the Genus database with same CATH topology
3B42A 4E04A 5F69A 3H82A 1N9OA 4LRZE 4WN5A 4II7A 4HH3A 2ZMVA 3LIFA 4BWIA 1S1YA 2L0WA 2PDRA 4L9FA 4YOFA 3IS2A 4KUOA 4HI4A 4CLCA 2V0WA 3KSFA 3PXPA 5HL6A 4YNRA 2D02A 3CUEA 1N9NA 3KSHA 2FZ0A 4O8GA 2QWSA 3GECA 2VGLM 1V9YA 3ZYTA 3EEHA 3O5YA 2XA7S 2Y8HA 3LICA 4EEUA 2EWVA 4F3LA 3VV4A 3V67A 3NOTC 3OCNA 4HQAA 4OOMA 4UQIS 5MC7A 1DP9A 4I3JA 5I5LA 3OOVA 1GSXA 4R6LA 3LR5A 1KOUA 3PBOA 4HHDA 4HY8A 3RFBA 1S1ZA 4CLCD 2M1CA 2ZBBA 3R4KA 3EGDC 2Z6CA 4LRXC 1OJ5A 4GW9A 2XSSA 3MMHA 4ZRRA 3R7WB 3JVUA 4NXEA 3P7NA 1IOUA 2FH5A 2JKTM 1W63Q 1Y28A 4BJPA 3OCLA 2PHYA 4H6JA 2KOIA 3T4KA 2XRNA 1XJ6A 4PKYG 1XJ2A 4BBVA 2HJEA 1H8MA 3GDIA 3NOUC 4NEED 4RQ9A 4EUVA 3HCYA 5KSHA 1NWZA 1OT6A 4MDZA 5HSQA 2KDKA 3LR0A 5AJGA 2LB5A 3DBAA 5HD3A 2DMWA 3MXQA 2K31A 2EWWA 4JGQA 3OLOA 1OTEA 3F1PA 2W1TB 4I38A 3NOPC 5DKKA 1LL8A 2WKPA 5IU1A 3D3OA 1TS6A 5HDDA 4B9OA 2OWHA 3TE8A 5DJUA 5HWWA 3B47A 2M7VA 2A24A 2H28A 5G4YA 5IT5A 5J7EA 3NHQA 4HJ3A 1OTDA 2VZWA 5C5KA 4I3AA 3PBRA 1T1AA 5DFXA 4DJ2A 3BJNA 1YSPA 4PHTA 2OAQ1 2HV1A 5F68A 5HDSA 3W2ZA 4I3IA 4AFIA 3PHYA 3LR4A 3CI6A 4PKYA 3E4QA 2B18A 1TS7A 4HOIA 2V1AA 4HNBA 2EA9A 2YKHA 3LI9A 5EFWA 1LT0A 1V9ZA 3LIAA 2L4RA 3T4OA 4HJ4A 3S7PA 4Y2FA 2HJ9C 3LFVA 2JKRM 3UE3A 4Q0JA 4MMNA 4MCWA 3G6OA 3BQAA 2V9AA 2J3TC 1UWNX 4GHIB 3PBSA 4JGRA 4P6ZM 2JKRI 1STZA 1VB6A 2V0UA 1G6OA 3P01A 5J4EA 2P08A 5HWTA 2ZOIA 4WLAA 4CQHA 4JGOA 1BYWA 2O0YA 4ME4A 4L9EA 4M4XA 1ZHHB 3BY8A 5IS1A 3IBJA 2K7SA 2G7UA 4R3AA 3EEAA 1XFNA 1DRMA 4B93A 3EQUA 4GJ4A 3SW1A 3T4QA 2HGVA 4K08A 1G28A 5HZHA 1MKMA 2O99A 3H82B 1OJGA 2XA7M 4KUKA 2O9AA 3VE4A 4L9GA 1NRJA 4R38A 2VGLS 3MQ0A 2XROA 3LYXA 2IA2A 1TS8A 1TS0A 3VOLA 1XJ4A 5F6AA 4UQIM 2NUPC 3ULFA 5TBMA 4O0PA 3IS2B 5LBRA 3B33A 3E4PA 4Q0IA 4HP9A 3UB9A 2WKRA 3KSGA 1ODVA 4IUKA 5FL3A 1F5MA 1MZUA 2GJ3A 3C2WA 3EQVA 4P6ZS 5DF9A 1EW0A 4CLCB 5HPFA 4ETXA 3JVVA 3UB7A 4DMZA 3MFXA 5CX7A 3PBTA 2QJ5A 2GNXA 3EWKA 1UGUA 4NXGA 2V1BA 4ARZA 2JKTI 2QJ7A 4MN6A 4F3LB 2PYPA 2K2NA 2OAP1 4GCZA 2GX5A 4O01A 3F1NA 3CAXA 3MF0A 4HIAA 2J3WA 4WEJA 3PBNA 3EGXC 4KQOA 4Z1WA 2L1MA 3BWLA 5K5BA 5HD5A 4BBTA 3K3DA 4PAUA 5J3WA 3K3CA 1S66L 4GS9A 3OBFA 3F1OA 4NKPA 1NLYA 1P97A 3H7WA 3E98A 2O9CA 3UE6A 4R70A 5AVEA 4JGPA 3A0VA 3KO6A 3S7OA 3OC2A 5DKLA 2W3DA 4XT2A 5G4ZA 4H6JB 3A0SA 1LSWA 2A2LA 1S4SA 2QHKA 3PYPA 4DJ3A 4Q0HA 2P04A 2R78A 5HPIA 4EEPA 3LIBA 2CMNA 2VV6A 3ICYA 4KQDA 1D7EA 3FPWA 2GZAA 3C38A 2BASA 2W3EA 4LRYC 2VJWA 4EESA 1WA9A 2OWJA 3F1PB 3T4TA 1OTIA 2QYBA 2W3FA 4UEYA 1F9IA 1P9RA 3RH8B 1LSVA 2PT7A 4HH2A 2VX8A 2W3GA 1F98A 4G3KA 4IJGA 2A24B 4HP4A 3C8CA 3MJQA 1H3QA 3CITA 1OT9A 2VEAA 3FPVA 2HF6A 2W1RA 4QPRA 2D01A 3MQOA 2VV7A 5F5YA 2KX6A 1S67L 4WF0A 3VE3A 4YWZA 4EQ1A 1X0OA 3E0YA 3T4SA 4NXFA 2WKQA 3UMDA 5L8MA 4EU0A 1P0ZA 1XJ3A 1DP8A 2ZOHA 4I5SA 3CLOA 4Y3IA 1T19A 4G3WA 4CLCC 4CLCE 1NLZA 4WEKA 1YKDA 1OTBA 2J3TD 2Z6DA 3CUEC 2QKPA 2W3HA 2W27A 4HJ6A 3BQ8A 2PD7A 1S4RA 3R7WA 2VKSA 3PBQA 1OPXA 3BY9A 2B02A 2MJ6A 1YAXA 1T18A 1IFQA 1N9LA 3LR3A 1MC0A 3T4LA 1T1CA 3U2AA 3ZQ5A 2YKFA 1ZTUA 3T4JA 3TW8A 3HJIA 3KYZA 4LLOB 5HDCA 1VHMA 1T1BA 5A8BA 2ZMFA 4OOLA 2J80A 2W1TA 3LIEA 1P9WA 1GSVA 4L0LA 1TF1A 5KIZA 4DN0A 5TBMB 2PR6A 3TJZC 3RTYA 4EXOA 2Y79A 5DJTA 4EERA 3NJAA 4GLQA 2NUTC 4LPZA 3MQQA 2VA0A 4BMWA 3EOIA 5DFYA 3T50A 1GSWA 3KX0X 3LUQA 3E4OA 2I9VA 2JN7A 4ETZA 4I39A 4ARZB 2PD8A 4FSFA 4MN7A 1XFQA 4Y5FA 1DP6A 3A0RA 3F1NB 3UMEA 3K2NA 2KLIA 2JHEA 2M7UA 1YSQA 3LIDA 4WUJA 3LI8A 3H9WA 4GS9B 3F1OB 4GHIA 3H7WB 3UB8A 4IUHA 2PYRA 3FG8A 3KSIA 2PR5A 2OOLA 4NXBA 4WELA 1TD5A 1LSXA 2O9BA 2INWA 2VV8A 5AVFA 3TRCA 3KYQA 2W0NA 3UB6A 4BBUA 4EETB 3MR0A 2LB9A 5TJJA 3PR6A 4XT2B 3CWFA 1OTAA 3FC7A 5HWVA 4MN5A 3C30A 3D72A 3S7NA 3HJKA 3BW6A 3IBRA 3S7QA 2P7JA 4EW7A 1JNUA 4IHQA 4WL9A 4G3VA 4FOFA 1UWPX 2VLGA 1D06A 1W63M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7V A;  4Z1W A;  4E04 A;  3NHQ A;  4LRZ E;  2VZW A;  5C5K A;  5K5B A;  5DFX A;  3BJN A;  4PAU A;  4BWI A;  1YSP A;  1MC0 A;  3OBF A;  3W2Z A;  3CI6 A;  3ZQ5 A;  4YOF A;  3E98 A;  1ZTU A;  2O9C A;  2B18 A;  4R70 A;  3S7O A;  3KO6 A;  3S7P A;  4Y2F A;  2W3D A;  3KSF A;  5HL6 A;  3LFV A;  4YNR A;  1VHM A;  2ZMF A;  4Q0J A;  3KSH A;  4MCW A;  3G6O A;  4MMN A;  4O8G A;  2W1T A;  3O5Y A;  2Y8H A;  1TF1 A;  1STZ A;  3VV4 A;  4Q0H A;  3NOT C;  4DN0 A;  5HPI A;  2Y79 A;  4CQH A;  4GLQ A;  5I5L A;  3OOV A;  4R6L A;  2O0Y A;  4ME4 A;  3RFB A;  2W3E A;  4LRY C;  5DFY A;  3R4K A;  2VJW A;  2QYB A;  2W3F A;  4LRX C;  4ETZ A;  4GW9 A;  3IBJ A;  2XSS A;  3MMH A;  2G7U A;  4MN7 A;  3EEA A;  4ZRR A;  4Y5F A;  2HGV A;  3K2N A;  2W3G A;  2KLI A;  4G3K A;  4IJG A;  2M7U A;  1MKM A;  1YSQ A;  2O99 A;  3CIT A;  2VEA A;  2W1R A;  4QPR A;  2KOI A;  2O9A A;  2XRN A;  3MQ0 A;  2XRO A;  2IA2 A;  4IUH A;  3NOU C;  3KSI A;  4RQ9 A;  4O0P A;  5LBR A;  4EUV A;  2OOL A;  3HCY A;  3E0Y A;  4Q0I A;  1TD5 A;  4MDZ A;  5L8M A;  2O9B A;  4EU0 A;  5HSQ A;  3KSG A;  4IUK A;  3TRC A;  1F5M A;  5AJG A;  3C2W A;  5HPF A;  5TJJ A;  2LB5 A;  2LB9 A;  4Y3I A;  4ETX A;  3DBA A;  4G3W A;  4DMZ A;  2K31 A;  1YKD A;  2W1T B;  3S7N A;  2W3H A;  3NOP C;  3IBR A;  3S7Q A;  2K2N A;  3D3O A;  2VKS A;  4G3V A;  2GX5 A;  4FOF A;  4O01 A;  3MF0 A; 
#chains in the Genus database with same CATH topology
 1O7E A;  5DF7 A;  5FQJ A;  1MWR A;  3LIF A;  1S1Y A;  3IHB A;  2L0W A;  3ZFZ A;  1IEL A;  4L9F A;  3IXB A;  2Q9M A;  4CPK A;  4WZ4 A;  2Q0O A;  5HL6 A;  4YNR A;  3JPU A;  1NZU A;  3KSH A;  3GEC A;  3EEH A;  2Y8H A;  4ZTK A;  3V67 A;  3VV4 A;  2B5R A;  2ZQ9 A;  3OPL A;  4OOM A;  4R6L A;  5FEF A;  4OLD A;  4HY8 A;  3DAV A;  3UPO A;  2ZBB A;  2Y4A A;  1K57 C;  2Z6C A;  4LRX C;  1OJ5 A;  5CEB A;  4OPY A;  3ZGA B;  3P7N A;  4EBN A;  4JPM A;  3HLD A;  3MBZ A;  1W63 Q;  4UHU A;  1SZV A;  4WZ5 A;  3OCL A;  2PHY A;  2KOI A;  3OPP A;  3V39 A;  5GHY A;  1K4F A;  3S22 A;  4GKU A;  4RQ9 A;  1ZKJ A;  4JBF A;  4KZ7 A;  2QZ6 A;  3IF6 A;  4MDZ A;  5AJG A;  4UA7 A;  2HDQ A;  2XH9 A;  4X1L A;  1DY6 A;  2EX9 A;  4RVA A;  3SS3 A;  5DKK A;  5A92 A;  4E6X A;  3SOI A;  1OME A;  4BLM A;  1TS6 A;  2XD1 A;  3ZG9 B;  3TE8 A;  1YLZ A;  4DKI A;  1Y54 A;  5G4Y A;  1K6R A;  2VZW A;  4I3A A;  3PBR A;  3BJN A;  5FEG A;  1NJ4 A;  4IBR A;  2B18 A;  1Q2Q A;  3SS4 A;  5EM0 A;  2ZMA A;  4H8R A;  1G6A A;  4BL2 A;  3E2L A;  4JF6 A;  5AQA A;  3IH8 A;  1UWN X;  4GHI B;  2WGW A;  3PBS A;  4EV4 A;  1STZ A;  2ACG A;  4OQG A;  2P08 A;  5HWT A;  1BLP A;  4OPZ A;  4DF6 A;  3U4L P;  1KDW A;  2HDR A;  3D4F A;  3EEA A;  1XFN A;  3OPH A;  4GN2 A;  3DWZ A;  1XGJ A;  1BT5 A;  3T4Q A;  1MKM A;  4PPR A;  5EVI B;  2XA7 M;  4KUK A;  2O9A A;  1VEU A;  1FIL A;  2EXA A;  3WWX A;  4XUX A;  3LYX A;  1TS8 A;  1TS0 A;  4E3N A;  1XJ4 A;  4UQI M;  2P9V A;  4O0P A;  3B33 A;  1HZO A;  5CHU A;  5CXW A;  2ZL1 A;  5HZH A;  2WKR A;  4UA9 A;  5FI7 A;  4OOY A;  3GV9 A;  3Q07 A;  3UB7 A;  4S2P A;  5M18 A;  1K55 C;  4EQI A;  4X68 A;  2V1B A;  4QB8 A;  2K2N A;  2OAP 1;  1NYY A;  5DTT A;  3CAX A;  2J3W A;  1N4O A;  3QP8 A;  4DXC A;  1ES2 A;  1SKF A;  4KQO A;  2L1M A;  4KZ3 A;  1TVF A;  3K3C A;  4S2N A;  3ZHH A;  4GS9 A;  1L3L A;  3F1O A;  3H7W A;  2J7V A;  2O9C A;  3A0V A;  3KO6 A;  3S7O A;  3OC2 A;  3G35 A;  2W3D A;  4KG6 A;  4H6J B;  5FQK A;  3Q7V B;  5EOO A;  1S4S A;  3PYP A;  2R78 A;  3UB5 P;  1D7E A;  3FPW A;  4OQI A;  1H8Y A;  4Q8I A;  2BAS A;  4LRY C;  3FZC A;  3HUO A;  2OWJ A;  2W3F A;  1M6K A;  1F9I A;  3NDG A;  4BD0 A;  3RH8 B;  4BEN A;  4HH2 A;  3C7V A;  2A24 B;  4HP4 A;  3C8C A;  2VEA A;  4Y7P A;  1IYQ A;  2JCH A;  1EI5 A;  3RJU A;  3G34 A;  2KX6 A;  1W5D A;  1CK3 A;  4JXS A;  3VE3 A;  1X0O A;  3IWI A;  3HLW A;  1XJ3 A;  4Z9Q A;  3SZT A;  3CLO A;  5L10 A;  5L09 A;  1SHV A;  4G3W A;  5EE8 A;  4CLC E;  1FR6 A;  5EPH A;  2J3T D;  4RA7 A;  3CHW P;  3ITA A;  4OVD A;  4E3K A;  1DJB A;  3R7W A;  2VKS A;  2Y2I A;  5EOE A;  4LV2 A;  3QP5 A;  4HBU A;  4LV0 A;  2B02 A;  4JXW A;  2MJ6 A;  4X6T A;  5EUA A;  3CG5 A;  3VSK A;  3ZVW A;  1N9L A;  3O87 A;  3LR3 A;  3T1Q B;  1J3W A;  3T4L A;  4R23 A;  4GD6 A;  3HLE A;  3T4J A;  1Y4O A;  4WBG A;  4LLO B;  5HDC A;  1L2S A;  2J8Y A;  1TDL A;  4QHC A;  2G2U A;  3UE1 A;  5BOH A;  4EBL A;  1T1B A;  4WZ5 C;  1P9W A;  1GSV A;  4L0L A;  3TJZ C;  4P87 A;  4EER A;  1YLP A;  3NJA A;  4B88 A;  3IF6 C;  4LPZ A;  4GZB A;  3T50 A;  2DCF A;  3UE0 A;  5EEC A;  2HP9 A;  3QP6 A;  4ARZ B;  2H10 A;  3WRT A;  3V5M A;  1G68 A;  3F1N B;  5F1F A;  2JHE A;  3G4P A;  2M7U A;  3ZNT A;  3N6I A;  5DVA A;  1S0W A;  4Y0T A;  2JKF A;  3UB8 A;  2PYR A;  2IWC A;  5AQ9 A;  3GQZ A;  3GVB A;  1HD8 A;  4QJG A;  4NXB A;  1TD5 A;  4X25 A;  5CED A;  1GA9 A;  4EET B;  4BBU A;  2I72 A;  4XT2 B;  4EBP A;  1F2K A;  3FC7 A;  5L2F A;  3C30 A;  1PWG A;  3HJK A;  3BW6 A;  3ZCZ A;  2XFS A;  2P7J A;  4WL9 A;  4G3V A;  3O3V A;  4DJ2 A;  1W63 M;  1ZG6 A;  2Y2K A;  3H82 A;  2QMI A;  3IHA A;  4WN5 A;  4II7 A;  1GHI A;  1YLY A;  1W8Q A;  2PDR A;  1IEM A;  5EVE A;  1IKI A;  3TSG A;  1JTG A;  4RYE A;  3CUE A;  1E3U A;  4PMA A;  2FZ0 A;  4O8G A;  2QWS A;  2XEP A;  4EEU A;  2XA7 S;  1GHP A;  2EWV A;  5TR7 A;  1YMS A;  3G32 A;  1W7F A;  4UQI S;  5MC7 A;  3V3R A;  3CMZ A;  3QHY A;  5E2G A;  3BM6 A;  1E3U D;  3EGD C;  5CGX A;  2DNS A;  2XSS A;  3MMH A;  2ZC4 B;  4ZRR A;  3BFD A;  4WM9 A;  3SS5 A;  3G30 A;  4HBT A;  2FH5 A;  3Q81 A;  5CER A;  1ES3 A;  2X01 A;  3T4K A;  2XRN A;  1NXY A;  1XJ6 A;  1D1J A;  4R3B A;  4PKY G;  4S2N C;  3ZG0 A;  1FQG A;  1H8M A;  1MWT A;  3FKV A;  5TFQ A;  4JF5 A;  4EUV A;  1ERO A;  1VET B;  5KSH A;  1S6R A;  2KDK A;  5HSQ A;  3MZF A;  5CTM A;  2DMW A;  3IQA A;  1PZO A;  4E3J A;  2W1T B;  2WKP A;  3D3O A;  1FOF A;  1QMF A;  2R9W A;  4B9O A;  5HWW A;  1O07 A;  2M7V A;  3LO7 A;  4MBK A;  1DJC A;  4PM9 A;  4S2I A;  1OTD A;  5DFX A;  2JC7 A;  1YSP A;  4PHT A;  4PM7 A;  1LL9 A;  1ONH A;  5F68 A;  4AFI A;  3CI6 A;  2H0T A;  2ZD8 A;  4U0T A;  3TOI A;  4X53 A;  4HOI A;  3N8L A;  1TEM A;  3LI9 A;  1V9Z A;  2L4R A;  2UV0 E;  3T4O A;  3S7P A;  4JXV A;  4HES A;  2VGK A;  4LV3 A;  3HLC A;  4UA6 A;  2XLN A;  4Q0J A;  4MCW A;  3G6O A;  3BYD A;  2VGJ A;  3BQA A;  3MKE A;  1BLH A;  2J3T C;  2Z2M B;  2JKR I;  3V3S A;  4D2O A;  3JYI A;  4S2J A;  4M3K A;  2ZOI A;  5DTK A;  4CQH A;  4JGO A;  1BYW A;  1ESI A;  3ITB A;  3SH7 A;  3QP4 A;  2XGN A;  1ZHH B;  3Q82 A;  4E3I A;  1CJF A;  4GDN A;  1HLU P;  3IBJ A;  1PW8 A;  1DRM A;  2PU4 A;  3EQU A;  1YQS A;  3SW1 A;  2E8J A;  2HGV A;  2OLV A;  1RGZ A;  1MWS A;  3VE4 A;  4R38 A;  3C4P A;  2VGL S;  3IX8 A;  3MQ0 A;  5GHX A;  1KGF A;  2IA2 A;  2NUP C;  5TBM A;  1L0G A;  2X71 A;  4Q0I A;  3IXG A;  4HP9 A;  5FL3 A;  3KSG A;  1ODV A;  4IUK A;  1F5M A;  2GJ3 A;  3EQV A;  5HPF A;  3GRJ A;  4DMZ A;  1LHY A;  2IWD A;  2QPN A;  3EWK A;  4NXG A;  5EVL A;  3C5A A;  2A3U A;  2ZC5 B;  1XA7 A;  1SCW A;  2WGI A;  4DRT A;  4N1X A;  5A90 A;  5J3W A;  4HEF A;  1S66 L;  3OBF A;  1NLY A;  1P97 A;  3HLG A;  5EM1 A;  4S2L A;  5HX9 A;  4ZDX A;  4GB7 A;  3E98 A;  3DWK A;  4LV1 A;  4ZBE A;  4OPQ A;  2WAF A;  5F1G A;  1IYP A;  1HTZ A;  2Y2N A;  5CEC A;  1FSW A;  3MSH A;  1LSW A;  2ZJ9 A;  2ZM8 A;  4LFU A;  2OV5 A;  3AGE A;  2Y2L A;  5E2F A;  2Y2M A;  5HPI A;  4EEP A;  1YLW A;  3ICY A;  2VV6 A;  2W3E A;  3UO9 A;  3T4T A;  3W4P A;  3ZG8 B;  4UEY A;  1LSV A;  2PT7 A;  3HLB A;  2VX8 A;  4PM5 A;  5FAP A;  2PBY A;  3CIT A;  3HLF A;  2Y2J A;  3QNB A;  2PAV P;  3M2J A;  3GTC A;  2E8I A;  4YWZ A;  3DTE A;  3E0Y A;  4NXF A;  2WKQ A;  5FQM A;  4EU0 A;  5E43 A;  2OLU A;  1CQA A;  4I5S A;  2WKE A;  4QU3 A;  3QNC A;  3T1R A;  3CUE C;  2QKP A;  2W3H A;  2W27 A;  4KZ6 A;  2WGW B;  1KVM A;  1S4R A;  1LL5 A;  2ZQA A;  3ZNY A;  4KZA A;  3BY9 A;  3AGF A;  5A91 A;  2V20 A;  1I2S A;  3M6B A;  2Y59 A;  4IVI A;  4A5R A;  1ZTU A;  1MKI A;  1K54 C;  1RP5 A;  4CJN A;  3KYZ A;  5AQ7 A;  1XP4 A;  3UPP A;  3GSG A;  4BL3 A;  1VHM A;  4KQQ A;  4ESP A;  2ZMF A;  1VEU B;  4OP5 A;  1LI9 A;  3LIE A;  3WS5 A;  4EUZ A;  1PWC A;  3QP2 A;  2P9V B;  4FH4 A;  2FFY A;  3RTY A;  1ACF A;  2ZL1 B;  4N1H A;  4U0X A;  1H0M A;  4GLQ A;  4QY6 A;  1ALQ A;  5CGW A;  3LUQ A;  3MFD A;  2PBD P;  3NY4 A;  1Z09 A;  2JN7 A;  4ETZ A;  2PD8 A;  2BLS A;  2EX8 A;  3A0R A;  5DF8 A;  2ZM0 A;  3K2N A;  2KLI A;  4FD8 A;  1YSQ A;  3LID A;  4WUJ A;  4OPR A;  4FUW A;  3L7H A;  3BLS A;  3NIA A;  4GS9 B;  2UWX A;  3F1O B;  4S2K A;  4NG2 A;  3H7W B;  2EX2 A;  4IUH A;  4OQ0 A;  3IH9 A;  2VV8 A;  5TJJ A;  2XK1 A;  5HWV A;  4DE0 A;  3IBR A;  3W8K A;  1VQQ A;  2VLG A;  4GDB A;  3B42 A;  4LEN A;  3PAE A;  2RL3 A;  5GLA A;  1N9O A;  1Q2P A;  3Q7Z A;  4HH3 A;  2ZMV A;  4BWI A;  1IYS A;  4R3J A;  3NBL A;  4OQH A;  3IS2 A;  4HI4 A;  3KYE A;  4CLC A;  3KSF A;  5EV0 A;  3PXP A;  4K0X A;  2D02 A;  3TG9 A;  3LY3 A;  2VGL M;  3O5Y A;  2ZQ7 A;  4F3L A;  1YPR A;  3OCN A;  4I3J A;  5I5L A;  3OOV A;  1GSX A;  2Y91 A;  3LEZ A;  4NET A;  3LR5 A;  4S2M A;  1KOU A;  4HHD A;  4EWF A;  3RFB A;  1S1Z A;  1PZP A;  4CLC D;  3IXH A;  4WYY A;  2M1C A;  3VP4 A;  2HPB A;  2ZQC A;  5F82 A;  5KZH A;  2J9P A;  1FR1 A;  3R7W B;  5HAP A;  3UDX A;  4QY5 A;  4IBX A;  3I7J A;  3CJM A;  3QP1 A;  1Y28 A;  1DJA A;  3ZVT A;  4Y17 A;  4E3L A;  1XJ2 A;  4ZJ1 A;  4BBV A;  2HJE A;  3GDI A;  4XXR A;  2GDN A;  4R4S A;  1NWZ A;  4NK3 A;  3LR0 A;  2LB5 A;  3DBA A;  2EWW A;  4FTX A;  4JGQ A;  3OLO A;  3F1P A;  3FYZ A;  4X55 A;  4BD1 A;  2JBF A;  5IU1 A;  4OLG A;  3O88 A;  3WS1 A;  5HDD A;  3C4O A;  2OWH A;  3B47 A;  2H28 A;  5J7E A;  4HJ3 A;  5C5K A;  5HW3 A;  4GOG A;  2RCX A;  2ZC3 B;  5HAI A;  3W2Z A;  4I3I A;  3PHY A;  4KZ5 A;  4PKY A;  3E4Q A;  3T1X A;  1TS7 A;  1AWI A;  5EFW A;  3LIA A;  1SKO A;  3BFG A;  3FWL A;  1BLS A;  5E2H A;  2R9X A;  3UE3 A;  4MMN A;  2V9A A;  5FDH A;  5FAS A;  4DDS A;  1H5X A;  4P6Z M;  1VB6 A;  4GNU A;  5M1A A;  3DTK A;  5J4E A;  2HP6 A;  2O0Y A;  4ME4 A;  4M4X A;  4LCL A;  2ZQD A;  4RX2 A;  1FSY A;  1K38 A;  3NCK A;  5F83 A;  2G7U A;  2EFU A;  4R3A A;  1EWZ A;  4KZ9 A;  4C6Y A;  1SDN A;  4K08 A;  1MY8 A;  1Z6F A;  5CGS A;  3H82 B;  1OJG A;  3VP1 A;  2PRF A;  2WUQ A;  4L9G A;  3FKW A;  1NRJ A;  2WGV A;  5FQ9 A;  2XRO A;  5F6A A;  3ULF A;  5M19 A;  5LBR A;  4E6W A;  1BUE A;  1C3B A;  1K54 A;  3RXW A;  1AXB A;  1KE0 A;  3UB9 A;  3MS6 A;  2DRW A;  2FFF B;  3C2W A;  1H8Z A;  1EW0 A;  3S4X A;  5CX7 A;  2WK0 A;  3PBT A;  2QJ5 A;  1W79 A;  2JKT I;  2PYP A;  3W4O A;  4GCZ A;  4P6B A;  2GX5 A;  4O01 A;  4HIA A;  3ZG5 A;  3Q1F A;  3EGX C;  3IXD A;  3BWL A;  5K5B A;  3M2K A;  5HD5 A;  4DDY A;  3RXX A;  1BZA A;  4NKP A;  5CHM A;  4K0W A;  5HFO A;  5A93 A;  3CPT A;  3UE6 A;  1BUL A;  3FV7 A;  1G5U A;  4OH0 A;  2V8C A;  2Z2L B;  5DKL A;  5G4Z A;  3A0S A;  5CTN A;  5FI6 A;  3VP0 A;  4DJ3 A;  5FQQ A;  1U60 A;  5GL9 A;  1E25 A;  4OP8 A;  2P04 A;  5HAR A;  1XXM A;  4X56 A;  4KZ8 A;  4KQD A;  4P85 A;  3N8R A;  1NZO A;  1HVB A;  1WA9 A;  2QYB A;  2AVX A;  3G2Z A;  4KQR A;  1P9R A;  2WAE A;  3IF5 A;  2W3G A;  1F98 A;  2J9O A;  4OKP A;  1H3Q A;  1LLB A;  3FPV A;  2HF6 A;  2W1R A;  4QPR A;  2D01 A;  1K25 A;  3MQO A;  2VV7 A;  3VFF A;  1GCE A;  4MNR A;  4WF0 A;  1ZC2 A;  1PRQ A;  4EQ1 A;  1XX2 A;  3NDE A;  3UMD A;  3A3I A;  1DP8 A;  3DTI A;  4Y3I A;  4CLC C;  5AQB A;  5D3O A;  1NLZ A;  1YKD A;  3UN7 A;  3GR2 A;  1PWD A;  4X1M A;  1LI0 A;  3BQ8 A;  2PD7 A;  3HL9 A;  5GLD A;  4KEN B;  1YM1 A;  4KG2 A;  3T12 B;  5L07 A;  2P74 A;  1YAX A;  5E2E A;  1IFQ A;  3DW0 A;  1MC0 A;  4ID4 A;  1FCO A;  1T1C A;  4ZJ2 A;  3PTE A;  3TW8 A;  3MZD A;  4MLL A;  4O7D A;  4N9K A;  3G2Y A;  4QWO A;  3MKF A;  1JWZ A;  4E3M A;  5TBM B;  2WYX A;  4ZJ3 A;  1L0D A;  4KG5 A;  5JYO A;  2IWB A;  3MQQ A;  1KVL A;  2VA0 A;  3EOI A;  2EFX A;  3KX0 X;  2C6W B;  1K6S A;  2WKH A;  3NC8 A;  3L9K A;  4FSF A;  1ONG A;  1XFQ A;  2H5S A;  3P09 A;  3UME A;  4R1G A;  3BLM A;  1ES4 A;  3LI8 A;  1MBL A;  1PIO A;  3IF6 B;  1L0F A;  1ES5 A;  2OSU A;  4GHI A;  1XGI A;  3FG8 A;  2PR5 A;  3WS2 A;  5J8X A;  3BFC A;  4ZAM A;  4WEL A;  1KGE A;  5IHV A;  1LSX A;  2O9B A;  2INW A;  1PFL A;  4XUZ A;  2W0N A;  2ZQ8 A;  3MR0 A;  1OTA A;  3NUL A;  1CI9 A;  3HVF A;  1JVJ A;  1WYC A;  3D72 A;  3S7N A;  1PNE A;  3S7Q A;  1MPL A;  4EW7 A;  1JNU A;  3NEC A;  4IHQ A;  2ZC7 A;  4JKT A;  3MXR A;  3B3X A;  2Y2P A;  3LY4 A;  1UWP X;  1D06 A;  4P6Z S;  1NY0 A;  2HDU A;  4OON A;  4E04 A;  3NI9 A;  2V8F A;  5F69 A;  4LRZ E;  3ISG A;  5EVI A;  1BTL A;  3N7W A;  2WZZ A;  1JWP A;  3OPR A;  5KMW A;  4YOF A;  1CEG A;  4KUO A;  5FI2 A;  4R0Q A;  1L0E A;  2V0W A;  3C7U A;  1FCM A;  3BEC A;  1K0K A;  3WS4 A;  1N9N A;  4Y0U A;  5EVI D;  2EX6 A;  1V9Y A;  3ZYT A;  1J9M A;  3LIC A;  5GLC A;  3S1Y A;  3NOT C;  1KDS A;  4R4R A;  4HQA A;  5CHJ A;  1DP9 A;  2X02 A;  3PBO A;  3R4K A;  1MWU A;  1BLC A;  2ZC6 B;  4GW9 A;  1IYO A;  1JTD A;  5KSC A;  3JVU A;  4NXE A;  3W4Q A;  2JKT M;  1IOU A;  5HAQ A;  2WZX A;  4BJP A;  2A49 A;  4H6J A;  3Q7V A;  1W8Y A;  3WS0 A;  5FAQ A;  4YFM A;  2WKI A;  3NOU C;  2BTF P;  4NEE D;  4B4Z A;  3HCY A;  4DE3 A;  1OT6 A;  3PAG A;  5HD3 A;  4PM6 A;  3MXQ A;  2K31 A;  4JLF A;  1OTE A;  1GA0 A;  3BFE A;  1YLT A;  2V1Z A;  3NOP C;  4I38 A;  1LL8 A;  4F94 A;  1KE4 A;  4X69 A;  5DJU A;  5GHZ A;  5FDS A;  4DE1 A;  1PW1 A;  4D60 A;  2A24 A;  3VMA A;  5IT5 A;  1N9B A;  3WRZ A;  3CZD A;  3NHQ A;  1T1A A;  2ZLY A;  2OAQ 1;  1YLJ A;  2HV1 A;  2Y2Q A;  1PI5 A;  5HDS A;  4B4X A;  4BQM A;  3LR4 A;  1KGG A;  3A3E A;  2V1A A;  4HNB A;  2EA9 A;  2YKH A;  1LT0 A;  1ERQ A;  4HJ4 A;  4Y2F A;  4Y13 A;  2HJ9 C;  3LFV A;  5FAT A;  2JKR M;  3IWQ A;  3D9Y A;  5CRF A;  3LGO A;  4JGR A;  2V0U A;  1G6O A;  3P01 A;  3A3F A;  4C75 A;  2WAD A;  2H0Y A;  4WLA A;  2CC1 A;  3O86 A;  4P0M A;  4PM8 A;  4L9E A;  1IKG A;  4YIN A;  5U47 A;  3BY8 A;  5IS1 A;  2K7S A;  4B93 A;  2XDM A;  4GJ4 A;  1FCN A;  1ERM A;  1G28 A;  1A0K A;  1CI8 A;  2O99 A;  1QME A;  1RGY A;  2HP5 A;  3ZDJ A;  3T1S A;  1E4D A;  1I5Q A;  3VOL A;  4IVK A;  3IX3 A;  4MBF A;  2HZ5 A;  3IS2 B;  1VM1 A;  3GMW A;  4KZ4 A;  1PYY A;  3E4P A;  2Y55 A;  1CF0 A;  4CLC B;  1MZU A;  5DF9 A;  3UDI A;  4ETX A;  1MXO A;  3JVV A;  1K57 A;  3BEB A;  3MFX A;  1NRF A;  4JF4 A;  5JYP A;  2GNX A;  5FAO A;  1UGU A;  3IX4 A;  4ARZ A;  2QJ7 A;  4MN6 A;  4F3L B;  5FQI A;  3F1N A;  1SDE A;  3MF0 A;  1NYM A;  4WEJ A;  3PBN A;  4Z1W A;  3MXS A;  1ESU A;  3A3J A;  4BBT A;  3K3D A;  2C5W B;  4PAU A;  2G2W A;  2PU2 A;  3AGD A;  4DE2 A;  4R70 A;  5AVE A;  4JXG A;  4JGP A;  3VP3 A;  4K91 A;  4WMC A;  4XT2 A;  1M40 A;  4UAA A;  2A2L A;  1YMX A;  4N9L A;  2QHK A;  5GLB A;  3VFH A;  4C3Q A;  4Q0H A;  1XKZ A;  3MZE A;  3LIB A;  2VK3 A;  1K56 A;  2CMN A;  2XFT A;  3A3D A;  2GZA A;  3C38 A;  3LEQ A;  3BRM A;  4WMC D;  2EXB A;  2VJW A;  4EES A;  1KE3 A;  3F1P B;  1OTI A;  1GHM A;  3LCE A;  1CEF A;  2V2F F;  3UPN A;  2Y2G A;  4Y15 A;  4G3K A;  3UNW A;  4IJG A;  3MJQ A;  1K56 D;  1OT9 A;  5FSR A;  2BG1 A;  4DXB A;  1JWV A;  5EVI C;  1I2W A;  5F5Y A;  2Y2H A;  1S67 L;  5HL1 A;  3P98 A;  3T4S A;  5G18 A;  3M6H A;  5L8M A;  3E2K A;  2B95 A;  1P0Z A;  1SKO B;  1YT4 A;  1ZG4 A;  2ZOH A;  3UDF A;  4Y0O A;  1BSG A;  1T19 A;  2ZM2 A;  4S2O A;  4WEK A;  4MBH A;  1OTB A;  2XF3 A;  2Z6D A;  3HUM A;  4HJ6 A;  4FH2 A;  3VOZ A;  1PI4 A;  4LCM A;  4LGW A;  3PBQ A;  1OPX A;  2XQZ A;  5DTS A;  3SH8 A;  1T18 A;  5FA7 A;  3VOY A;  3OZH A;  1WYB A;  4N92 A;  2XD5 A;  3U2A A;  3ZQ5 A;  2HDS A;  2JE5 A;  2YKF A;  3HJI A;  1VET A;  4E3O A;  3V50 A;  3VSL A;  3IT9 A;  1TDG A;  1FIK A;  1K55 A;  5A8B A;  4OOL A;  2J80 A;  2W1T A;  3HUN A;  1TF1 A;  3HBR A;  5KIZ A;  4DN0 A;  2PR6 A;  4EXO A;  2Y79 A;  5DJT A;  2Y2O A;  3ZG7 B;  3BFF A;  3N8S A;  2NUT C;  4BMW A;  5DFY A;  1GSW A;  3E4O A;  2I9V A;  4I39 A;  4MN7 A;  3IWO A;  4Y5F A;  1DP6 A;  2Q9N A;  2JKG A;  4QD4 A;  4RX3 A;  3UY6 A;  1XA1 A;  4GD8 A;  2XR0 A;  1WE4 A;  3H9W A;  1RCJ A;  3SH9 A;  5I94 A;  1K4E A;  3KSI A;  4MEZ A;  4U3T A;  3CPT B;  2OOL A;  1XPB A;  4IED A;  3G31 A;  3DTM A;  5AVF A;  4FCF A;  3TRC A;  3KYQ A;  3UB6 A;  3N4I A;  2LB9 A;  5TGF A;  3PR6 A;  3CWF A;  4MN5 A;  4KZB A;  3HRE A;  3VP2 A;  4FOF A; 
#chains in the Genus database with same CATH homology
 3B42 A;  4E04 A;  5F69 A;  3H82 A;  1N9O A;  4LRZ E;  4WN5 A;  4II7 A;  4HH3 A;  2ZMV A;  3LIF A;  4BWI A;  1S1Y A;  2L0W A;  2PDR A;  4L9F A;  4YOF A;  3IS2 A;  4KUO A;  4HI4 A;  4CLC A;  2V0W A;  3KSF A;  3PXP A;  5HL6 A;  4YNR A;  2D02 A;  3CUE A;  1N9N A;  3KSH A;  2FZ0 A;  4O8G A;  2QWS A;  3GEC A;  2VGL M;  1V9Y A;  3ZYT A;  3EEH A;  3O5Y A;  2XA7 S;  2Y8H A;  3LIC A;  4EEU A;  2EWV A;  4F3L A;  3VV4 A;  3V67 A;  3NOT C;  3OCN A;  4HQA A;  4OOM A;  4UQI S;  5MC7 A;  1DP9 A;  4I3J A;  5I5L A;  3OOV A;  1GSX A;  4R6L A;  3LR5 A;  1KOU A;  3PBO A;  4HHD A;  4HY8 A;  3RFB A;  1S1Z A;  4CLC D;  2M1C A;  2ZBB A;  3R4K A;  3EGD C;  2Z6C A;  4LRX C;  1OJ5 A;  4GW9 A;  2XSS A;  3MMH A;  4ZRR A;  3R7W B;  3JVU A;  4NXE A;  3P7N A;  1IOU A;  2FH5 A;  2JKT M;  1W63 Q;  1Y28 A;  4BJP A;  3OCL A;  2PHY A;  4H6J A;  2KOI A;  3T4K A;  2XRN A;  1XJ6 A;  4PKY G;  1XJ2 A;  4BBV A;  2HJE A;  1H8M A;  3GDI A;  3NOU C;  4NEE D;  4RQ9 A;  4EUV A;  3HCY A;  5KSH A;  1NWZ A;  1OT6 A;  4MDZ A;  5HSQ A;  2KDK A;  3LR0 A;  5AJG A;  2LB5 A;  3DBA A;  5HD3 A;  2DMW A;  3MXQ A;  2K31 A;  2EWW A;  4JGQ A;  3OLO A;  1OTE A;  3F1P A;  2W1T B;  4I38 A;  3NOP C;  5DKK A;  1LL8 A;  2WKP A;  5IU1 A;  3D3O A;  1TS6 A;  5HDD A;  4B9O A;  2OWH A;  3TE8 A;  5DJU A;  5HWW A;  3B47 A;  2M7V A;  2A24 A;  2H28 A;  5G4Y A;  5IT5 A;  5J7E A;  3NHQ A;  4HJ3 A;  1OTD A;  2VZW A;  5C5K A;  4I3A A;  3PBR A;  1T1A A;  5DFX A;  4DJ2 A;  3BJN A;  1YSP A;  4PHT A;  2OAQ 1;  2HV1 A;  5F68 A;  5HDS A;  3W2Z A;  4I3I A;  4AFI A;  3PHY A;  3LR4 A;  3CI6 A;  4PKY A;  3E4Q A;  2B18 A;  1TS7 A;  4HOI A;  2V1A A;  4HNB A;  2EA9 A;  2YKH A;  3LI9 A;  5EFW A;  1LT0 A;  1V9Z A;  3LIA A;  2L4R A;  3T4O A;  4HJ4 A;  3S7P A;  4Y2F A;  2HJ9 C;  3LFV A;  2JKR M;  3UE3 A;  4Q0J A;  4MMN A;  4MCW A;  3G6O A;  3BQA A;  2V9A A;  2J3T C;  1UWN X;  4GHI B;  3PBS A;  4JGR A;  4P6Z M;  2JKR I;  1STZ A;  1VB6 A;  2V0U A;  1G6O A;  3P01 A;  5J4E A;  2P08 A;  5HWT A;  2ZOI A;  4WLA A;  4CQH A;  4JGO A;  1BYW A;  2O0Y A;  4ME4 A;  4L9E A;  4M4X A;  1ZHH B;  3BY8 A;  5IS1 A;  3IBJ A;  2K7S A;  2G7U A;  4R3A A;  3EEA A;  1XFN A;  1DRM A;  4B93 A;  3EQU A;  4GJ4 A;  3SW1 A;  3T4Q A;  2HGV A;  4K08 A;  1G28 A;  5HZH A;  1MKM A;  2O99 A;  3H82 B;  1OJG A;  2XA7 M;  4KUK A;  2O9A A;  3VE4 A;  4L9G A;  1NRJ A;  4R38 A;  2VGL S;  3MQ0 A;  2XRO A;  3LYX A;  2IA2 A;  1TS8 A;  1TS0 A;  3VOL A;  1XJ4 A;  5F6A A;  4UQI M;  2NUP C;  3ULF A;  5TBM A;  4O0P A;  3IS2 B;  5LBR A;  3B33 A;  3E4P A;  4Q0I A;  4HP9 A;  3UB9 A;  2WKR A;  3KSG A;  1ODV A;  4IUK A;  5FL3 A;  1F5M A;  1MZU A;  2GJ3 A;  3C2W A;  3EQV A;  4P6Z S;  5DF9 A;  1EW0 A;  4CLC B;  5HPF A;  4ETX A;  3JVV A;  3UB7 A;  4DMZ A;  3MFX A;  5CX7 A;  3PBT A;  2QJ5 A;  2GNX A;  3EWK A;  1UGU A;  4NXG A;  2V1B A;  4ARZ A;  2JKT I;  2QJ7 A;  4MN6 A;  4F3L B;  2PYP A;  2K2N A;  2OAP 1;  4GCZ A;  2GX5 A;  4O01 A;  3F1N A;  3CAX A;  3MF0 A;  4HIA A;  2J3W A;  4WEJ A;  3PBN A;  3EGX C;  4KQO A;  4Z1W A;  2L1M A;  3BWL A;  5K5B A;  5HD5 A;  4BBT A;  3K3D A;  4PAU A;  5J3W A;  3K3C A;  1S66 L;  4GS9 A;  3OBF A;  3F1O A;  4NKP A;  1NLY A;  1P97 A;  3H7W A;  3E98 A;  2O9C A;  3UE6 A;  4R70 A;  5AVE A;  4JGP A;  3A0V A;  3KO6 A;  3S7O A;  3OC2 A;  5DKL A;  2W3D A;  4XT2 A;  5G4Z A;  4H6J B;  3A0S A;  1LSW A;  2A2L A;  1S4S A;  2QHK A;  3PYP A;  4DJ3 A;  4Q0H A;  2P04 A;  2R78 A;  5HPI A;  4EEP A;  3LIB A;  2CMN A;  2VV6 A;  3ICY A;  4KQD A;  1D7E A;  3FPW A;  2GZA A;  3C38 A;  2BAS A;  2W3E A;  4LRY C;  2VJW A;  4EES A;  1WA9 A;  2OWJ A;  3F1P B;  3T4T A;  1OTI A;  2QYB A;  2W3F A;  4UEY A;  1F9I A;  1P9R A;  3RH8 B;  1LSV A;  2PT7 A;  4HH2 A;  2VX8 A;  2W3G A;  1F98 A;  4G3K A;  4IJG A;  2A24 B;  4HP4 A;  3C8C A;  3MJQ A;  1H3Q A;  3CIT A;  1OT9 A;  2VEA A;  3FPV A;  2HF6 A;  2W1R A;  4QPR A;  2D01 A;  3MQO A;  2VV7 A;  5F5Y A;  2KX6 A;  1S67 L;  4WF0 A;  3VE3 A;  4YWZ A;  4EQ1 A;  1X0O A;  3E0Y A;  3T4S A;  4NXF A;  2WKQ A;  3UMD A;  5L8M A;  4EU0 A;  1P0Z A;  1XJ3 A;  1DP8 A;  2ZOH A;  4I5S A;  3CLO A;  4Y3I A;  1T19 A;  4G3W A;  4CLC C;  4CLC E;  1NLZ A;  4WEK A;  1YKD A;  1OTB A;  2J3T D;  2Z6D A;  3CUE C;  2QKP A;  2W3H A;  2W27 A;  4HJ6 A;  3BQ8 A;  2PD7 A;  1S4R A;  3R7W A;  2VKS A;  3PBQ A;  1OPX A;  3BY9 A;  2B02 A;  2MJ6 A;  1YAX A;  1T18 A;  1IFQ A;  1N9L A;  3LR3 A;  1MC0 A;  3T4L A;  1T1C A;  3U2A A;  3ZQ5 A;  2YKF A;  1ZTU A;  3T4J A;  3TW8 A;  3HJI A;  3KYZ A;  4LLO B;  5HDC A;  1VHM A;  1T1B A;  5A8B A;  2ZMF A;  4OOL A;  2J80 A;  2W1T A;  3LIE A;  1P9W A;  1GSV A;  4L0L A;  1TF1 A;  5KIZ A;  4DN0 A;  5TBM B;  2PR6 A;  3TJZ C;  3RTY A;  4EXO A;  2Y79 A;  5DJT A;  4EER A;  3NJA A;  4GLQ A;  2NUT C;  4LPZ A;  3MQQ A;  2VA0 A;  4BMW A;  3EOI A;  5DFY A;  3T50 A;  1GSW A;  3KX0 X;  3LUQ A;  3E4O A;  2I9V A;  2JN7 A;  4ETZ A;  4I39 A;  4ARZ B;  2PD8 A;  4FSF A;  4MN7 A;  1XFQ A;  4Y5F A;  1DP6 A;  3A0R A;  3F1N B;  3UME A;  3K2N A;  2KLI A;  2JHE A;  2M7U A;  1YSQ A;  3LID A;  4WUJ A;  3LI8 A;  3H9W A;  4GS9 B;  3F1O B;  4GHI A;  3H7W B;  3UB8 A;  4IUH A;  2PYR A;  3FG8 A;  3KSI A;  2PR5 A;  2OOL A;  4NXB A;  4WEL A;  1TD5 A;  1LSX A;  2O9B A;  2INW A;  2VV8 A;  5AVF A;  3TRC A;  3KYQ A;  2W0N A;  3UB6 A;  4BBU A;  4EET B;  3MR0 A;  2LB9 A;  5TJJ A;  3PR6 A;  4XT2 B;  3CWF A;  1OTA A;  3FC7 A;  5HWV A;  4MN5 A;  3C30 A;  3D72 A;  3S7N A;  3HJK A;  3BW6 A;  3IBR A;  3S7Q A;  2P7J A;  4EW7 A;  1JNU A;  4IHQ A;  4WL9 A;  4G3V A;  4FOF A;  1UWP X;  2VLG A;  1D06 A;  1W63 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...