2M7VA

Green light-absorbing state of tepixj, an active cyanobacteriochrome domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
165
structure length
165
Chain Sequence
b'MAAVQLSELRDRQAIFETLVAKGRELLACDRVIVYAFDDNYVGTVVAESVAEGWPQARDQVIEDPCFREHWVEAYRQGRIQATTDIFKAGLTECHLNQLRPLKVRANLVVPMVIDDQLFGLLIAHQASEPRQWQEIEIDQFSELASTGSLVLERLHFLEQTIASL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methyl-accepting chemotaxis protein
molecule tags Signaling protein
source organism Thermosynechococcus elongatus
publication title Structural and Flexibility Variations Between the Ground and Photoactivated States of a Blue/Green Light-Absorbing Cyanobacteriochrome
rcsb
total genus 28
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2m7vA00
4ETXA 4O0PA 4LRYC 4Z1WA 5TJJA 3CI6A 2K2NA 4YNRA 2IA2A 4ZRRA 3IBJA 3KSIA 3TRCA 4FOFA 4MMNA 4DN0A 2O9AA 3EEAA 4MDZA 2LB9A 3MMHA 5DFXA 4DMZA 3DBAA 4O01A 3OOVA 1YSQA 1MC0A 4Q0HA 5HPFA 3ZQ5A 4YOFA 5AJGA 3HCYA 2W3GA 3NOUC 3IBRA 5HL6A 4R6LA 4G3VA 2Y8HA 4QPRA 5C5KA 2QYBA 4EUVA 5L8MA 4Y2FA 3E98A 4Y5FA 4EU0A 3BJNA 2XROA 3KSGA 2O9BA 3VV4A 5I5LA 2W3FA 5HPIA 1F5MA 4Q0JA 2VZWA 3MQ0A 4IUHA 2VKSA 2OOLA 2Y79A 1ZTUA 4ME4A 5K5BA 3O5YA 3S7OA 2LB5A 2XSSA 2KLIA 4BWIA 2W3DA 3D3OA 5LBRA 2KOIA 3E0YA 3OBFA 4Y3IA 2O9CA 2W3EA 4PAUA 3G6OA 4GW9A 4O8GA 3CITA 2GX5A 3C2WA 2ZMFA 3R4KA 1MKMA 1YSPA 1VHMA 2W1TA 3NOTC 4CQHA 3KO6A 4Q0IA 2M7VA 3KSHA 2VJWA 3RFBA 1TD5A 2W3HA 3MF0A 3NOPC 4LRXC 5HSQA 5DFYA 2W1RA 2HGVA 4MCWA 4RQ9A 4MN7A 4ETZA 4IJGA 3S7NA 4E04A 3K2NA 1STZA 3KSFA 4G3KA 2XRNA 4R70A 2K31A 2G7UA 3LFVA 4G3WA 2B18A 1TF1A 3S7PA 1YKDA 3W2ZA 4GLQA 2M7UA 2VEAA 3S7QA 2O99A 2O0YA 3NHQA 2W1TB 4LRZE 4IUKA
chains in the Genus database with same CATH superfamily
2H5SA 2VGKA 5TR7A 4FSFA 3PXPA 3MSHA 5J8XA 3IH9A 3A0VA 1TDLA 3ZG5A 2Y2JA 3FKWA 4QU3A 3N8LA 4IVIA 3PBTA 5E2HA 2X02A 1D7EA 4KZ5A 4C3QA 2OLUA 3BWLA 5EVEA 4NXBA 3EEHA 3UNWA 3HBRA 2E8IA 2ACGA 2OLVA 3E98A 5GHXA 1LHYA 4EBPA 1OTAA 4HH3A 3F1NB 4HNBA 4HBUA 2VKSA 1JWZA 2ZQAA 3TOIA 2D01A 5K5BA 4DKIA 2HDQA 2KLIA 2HV1A 3FV7A 1FIKA 4BMWA 3ISGA 2ZD8A 4I3AA 1BLPA 4Q8IA 3EGDC 3CZDA 2V0WA 3C4PA 5A93A 5EOEA 4QJGA 4HIAA 4N1HA 2WGWB 5GLCA 3SH9A 5EUAA 3EWKA 1T19A 3H7WB 2VGJA 1OTBA 1PWGA 2QMIA 2XFSA 4L9EA 3LIEA 2EFUA 2VK3A 1S6RA 2H28A 4HJ4A 5F1FA 2ZMAA 4YFMA 4EERA 1NWZA 1DY6A 3B42A 4EQIA 1EI5A 5L2FA 1PFLA 4HEFA 1G6OA 5HD5A 3TRCA 3ZDJA 4PMAA 1K56A 1ESUA 3O87A 1HVBA 4GNUA 1YSQA 4XUZA 3UB7A 2WKQA 4BBTA 1FCNA 3T4SA 4GDNA 2EWVA 5HAQA 4E3MA 1W63Q 5F83A 2Y2IA 3SS3A 4EEPA 4PKYG 3FKVA 1MWTA 3KSGA 1CF0A 3SH8A 3Q7ZA 1JWPA 1IELA 5TGFA 1OT6A 2OOLA 3IXHA 4NXEA 1ERMA 5FATA 4ME4A 2ZL1A 4NETA 4FCFA 1BLHA 2XH9A 3D3OA 3P01A 4E3LA 3GQZA 1KE3A 5HDCA 2ZQ7A 4QY6A 4JF6A 2JKTM 5KZHA 5DKKA 3KSHA 2BTFP 1W7FA 4JGQA 3BYDA 1MY8A 2GDNA 3RTYA 3UY6A 2KX6A 3MZDA 3UPPA 2R9WA 2GNXA 1JNUA 4MN7A 5CXWA 3S7NA 4E04A 1KDSA 1TS6A 2XRNA 2DRWA 4G3WA 4R0QA 1FSWA 1TF1A 2Q0OA 4EW7A 3KYQA 2EA9A 3B33A 1EROA 4E3NA 3T1RA 1PZOA 3QHYA 2PU2A 4ZJ1A 2OSUA 4RX2A 3NC8A 4OP8A 4D2OA 3BECA 2HJ9C 1H8YA 2CC1A 1LL5A 2HDSA 4YNRA 3IX4A 1GSVA 4FTXA 4BLMA 3KSIA 3ZCZA 1K57A 3ZGAB 2Y2LA 4P6ZS 1DP9A 3EEAA 3HLWA 4JBFA 5D3OA 1K4EA 1H8MA 2PAVP 1S4RA 5HPFA 3LIDA 1PI5A 4DE2A 3VE4A 4X6TA 3FPVA 2XA7M 2Y8HA 3W4OA 2Z6CA 5L8MA 3BFDA 3MFXA 1W8QA 4NXFA 1MXOA 1Y4OA 2VZWA 4DE0A 5DF7A 4OOYA 3BQAA 3T1XA 1IYOA 3U2AA 3U4LP 1K56D 2XD1A 4X56A 5MC7A 2JKTI 1OTEA 5I94A 4R3JA 1LLBA 1GHPA 3TW8A 1NYYA 2HDRA 3QP1A 4BL2A 3G2YA 5CERA 4CQHA 3NIAA 3T4KA 4NXGA 1TVFA 4KZ9A 3QNBA 1H3QA 3BRMA 4MCWA 1IEMA 4WYYA 1YAXA 3OPLA 3SW1A 4E6WA 3A3EA 1W8YA 1BSGA 4GKUA 4S2JA 1PWCA 3UB8A 2B18A 2INWA 1ZG4A 5KMWA 1XA7A 1MWSA 4XUXA 3FC7A 1YKDA 1YLJA 5HARA 2O0YA 3NHQA 3HUNA 1YLYA 4O0PA 3CPTB 1GSWA 4N9LA 4WZ4A 5CGWA 5FASA 1ALQA 4RA7A 1JTDA 2B02A 4C6YA 2X01A 3N7WA 4MDZA 3FWLA 1PI4A 4H8RA 3BEBA 4DMZA 4O7DA 1OJGA 2OAP1 3IXGA 4YOFA 5FL3A 4M4XA 3WS1A 1YMXA 2R78A 2WKRA 1JVJA 3FPWA 1CJFA 3BJNA 1K54C 4EWFA 4WMCA 2PBDP 3ULFA 1L0DA 3F1OA 3Q1FA 1W79A 1A0KA 2XSSA 2Y2GA 1T1BA 2H0TA 4JF5A 4FUWA 4WEJA 2D02A 3W8KA 4JXGA 4EETB 3PBSA 3UPOA 4UA9A 5E2FA 3NOPC 1MWUA 4GHIB 1QMEA 3M2KA 2PYPA 1MZUA 3UPNA 1SKOA 3MXQA 2EX9A 2V1BA 5DF8A 4CLCB 5IS1A 1DJAA 5FQMA 5F69A 3T12B 1F98A 4KZAA 5DVAA 4BBVA 5HWVA 1NLZA 5FQ9A 3V3SA 4X68A 3JPUA 1K57C 3SS5A 2O99A 2ZC4B 1N9OA 1YLTA 1KGEA 4X55A 5HD3A 2JKRI 3IF6A 4N92A 4BQMA 2PT7A 4ARZA 3BFEA 4FOFA 1S4SA 5F5YA 1GHIA 1SKOB 5HDSA 1X0OA 3PYPA 2P7JA 1OT9A 5EVIB 4P85A 5EECA 4LFUA 5HL6A 5A92A 4I38A 1S1ZA 3GR2A 4I39A 3M6BA 1DRMA 5HPIA 1T1AA 3EQVA 3PBNA 2OAQ1 2P9VB 4KZ3A 1ZTUA 4KENB 1XP4A 2J9OA 3S7OA 3P09A 3NBLA 3UMEA 1K54A 1XFNA 4OQGA 3Q07A 3T4TA 1TEMA 4OQ0A 3V39A 3IS2A 1D1JA 2W3EA 1I5QA 2XEPA 2Z6DA 3SH7A 2VGLM 5GHZA 4B4ZA 1V9ZA 4Q0IA 3IHAA 1CEFA 1ERQA 4NKPA 1K6SA 3DTMA 3LEZA 4WELA 3M6HA 3E4OA 2FH5A 4QHCA 4HY8A 2GZAA 3MFDA 3MJQA 3RXXA 4HQAA 1H8ZA 3HJIA 3VFFA 5AQ7A 1KE0A 3KX0X 3B3XA 1STZA 5EVID 2WUQA 4G3KA 4Y13A 4NK3A 2KDKA 4PPRA 5EE8A 3JVUA 4JGPA 3EOIA 1H5XA 1Z6FA 3UB5P 4S2KA 3V67A 4EXOA 1XGJA 2EWWA 3VOLA 1FR6A 1M6KA 3WS0A 2IA2A 4ZRRA 3JYIA 5CGSA 2ZLYA 5KSHA 5DTSA 4GCZA 3R7WB 3GDIA 3ZQ5A 1UWPX 5AJGA 2VV6A 2QWSA 5DJTA 4OPYA 4KZ4A 5CGXA 4F3LB 3A3IA 2PD7A 2W27A 3T50A 3BQ8A 3HLDA 3VSLA 4HESA 3G32A 3HUMA 2W3DA 4GD8A 1IOUA 3OBFA 3LIAA 3G6OA 2Y2PA 1RP5A 4Y0UA 4F3LA 1NXYA 5AVEA 4K0XA 3NOTC 3MF0A 4OQIA 1G6AA 1SCWA 4CLCC 3MKFA 4JGRA 4OPRA 4U0XA 4GHIA 2OV5A 2ZJ9A 4HH2A 2J3WA 3GRJA 5FSRA 3EQUA 1BTLA 1ES3A 3UE3A 3T1QB 1ZG6A 1PNEA 1YPRA 2FFYA 2WZXA 1NZUA 4GS9A 1YLPA 3IS2B 5AQBA 3ZG9B 4KZ7A 3C5AA 1Y54A 3CUEC 1FSYA 2VEAA 4GJ4A 3NY4A 2IWBA 3UE0A 3CMZA 3F1OB 2VLGA 4S2PA 3D9YA 5CHUA 2Y2NA 1XKZA 1O07A 5A8BA 2WYXA 3VOYA 1Q2QA 3KYZA 1E3UA 2JKFA 2WGWA 3N6IA 3VFHA 3NOUC 4DXCA 1XXMA 3WS2A 3C7UA 5FQQA 2AVXA 3WWXA 5HAPA 4RVAA 2XA7S 4LV3A 4BBUA 5FEFA 4H6JA 3CPTA 2QHKA 5J7EA 1LI9A 1F5MA 4IUHA 1O7EA 2ZBBA 3LR0A 3M2JA 3IX8A 5DTKA 4IBXA 4DXBA 3K3DA 3VP0A 5IT5A 5CX7A 4Y0OA 1KE4A 3UN7A 3G4PA 1NRFA 3UO9A 4UEYA 4N9KA 1XFQA 3C4OA 1BZAA 4WZ5C 1K38A 4GB7A 2DNSA 3K3CA 1TDGA 3LGOA 1YM1A 3KSFA 5FQJA 4ARZB 4ZAMA 2K31A 2PBYA 4R3BA 4GZBA 3LYXA 4PKYA 3VP4A 5FI2A 3IWOA 2Y2MA 3LR5A 3MXRA 4KQQA 5TBMA 2EXBA 3W2ZA 4WN5A 4S2NA 2W1TB 4LRZE 1ONGA 2A24A 2HF6A 3IT9A 2EX2A 4EUZA 1UGUA 1W63M 4B93A 1JTGA 1F2KA 4E3JA 4P6ZM 1DP8A 2PHYA 4NG2A 2LB9A 3N8SA 4RX3A 4A5RA 1MC0A 3AGDA 3BW6A 3SS4A 4Z9QA 4MBHA 4MEZA 4OP5A 1PWDA 2FFFB 4PHTA 2JE5A 1FR1A 5G4YA 3ZFZA 2QYBA 5F6AA 1L2SA 4ZJ2A 4EU0A 1FQGA 5CHJA 4DE3A 4LV2A 4BD1A 5M1AA 2CMNA 4KUKA 5FI7A 4S2MA 2K7SA 4EEUA 2Y2QA 3T4QA 3BY8A 5F82A 3HL9A 5EOOA 1V9YA 3VP1A 4ESPA 2BG1A 3ZVWA 5CRFA 2Y91A 3H82A 1K6RA 3MS6A 4JPMA 3LR4A 1D06A 1MKMA 2PDRA 2M1CA 1I2WA 2RL3A 3OCLA 3W4QA 3HUOA 4QB8A 4UA6A 2JKRM 2Z2MB 5F1GA 4I5SA 3HLGA 1RGYA 3ZG8B 1J9MA 1GSXA 2P04A 2J8YA 4PM9A 1G28A 4HHDA 4CLCA 2Q9MA 2EX8A 3QP4A 3MBZA 1XJ6A 5HFOA 3MR0A 4HP9A 2G2WA 1SHVA 3G2ZA 4OPZA 4X53A 2P08A 3MZFA 5HZHA 3H82B 1IKIA 4Z1WA 4LV1A 5TJJA 2PU4A 3UDFA 4C75A 4OONA 2ZQDA 3PAGA 4MMNA 4QWOA 3A3FA 5KSCA 2H0YA 3VP3A 3ZVTA 1DP6A 1Y28A 2V0UA 4BJPA 4QD4A 3V3RA 4HJ6A 2W3GA 4X1MA 3IBRA 1ZKJA 4PM7A 1BT5A 3S4XA 3RXWA 3CWFA 4Y2FA 2WGIA 3W4PA 2P74A 3VV4A 5HX9A 2W3FA 2V20A 5HAIA 4JGOA 4MN5A 1WYBA 5GLBA 2JBFA 3GECA 1L0GA 1ES4A 3S22A 1FILA 4JXSA 2V8CA 4KQDA 3LIFA 2JN7A 4WZ5A 4DF6A 4LGWA 3T4OA 1VB6A 4N1XA 5FAOA 2EFXA 5E2GA 2W1TA 1IKGA 4DDSA 1P9WA 1TD5A 2WKEA 5TBMB 2J3TC 3BM6A 3Q82A 1PIOA 2W1RA 3IH8A 1IYQA 2X71A 4ETZA 3DTKA 2V8FA 4S2IA 1AWIA 4OOMA 1SKFA 1N9LA 2ZM2A 4IHQA 1XGIA 2PRFA 1HZOA 4XT2A 4F94A 4MBKA 5IHVA 4K91A 3CAXA 2J7VA 2ZL1B 3T1SA 4IUKA 1YLZA 1VETA 5CTMA 4LRYC 3BLMA 3IF6B 2P9VA 4MN6A 1NYMA 1OJ5A 2ZM8A 1KVLA 4E6XA 4HOIA 3DTIA 4O01A 4OKPA 2ZC3B 1M40A 3T4JA 3PTEA 4R23A 3VMAA 1DJBA 2HP9A 2EXAA 4LCLA 2XF3A 2QZ6A 4WF0A 3VSKA 3L7HA 3WS4A 2WAFA 3NECA 1DJCA 3TSGA 2ZOIA 4EQ1A 4Q0JA 5DF9A 3ICYA 1YMSA 1WA9A 4M3KA 4BWIA 1BUEA 3N4IA 3D4FA 2ZQCA 3QNCA 2Y2KA 2KOIA 4OQHA 2GJ3A 3WRTA 4Y7PA 4OOLA 3MQQA 4R38A 1S0WA 3UE6A 3DAVA 1G5UA 1FCMA 3BY9A 3O3VA 2VGLS 1ONHA 3H7WA 2BLSA 1J3WA 1F9IA 4EESA 1MPLA 3N8RA 4AFIA 2B95A 4KG5A 5FAPA 3HLEA 4X1LA 2J9PA 5A90A 3MKEA 1OTIA 5JYPA 1NY0A 3RH8B 2WKIA 5E43A 1BLCA 2I72A 1TS0A 2HDUA 3OLOA 4JXWA 2A3UA 4BD0A 1KGFA 2QPNA 4S2LA 3V5MA 5J3WA 1VEUA 4Y0TA 3HLFA 4R4RA 2QJ5A 4KZBA 4LCMA 2Z2LB 1E3UD 3HREA 5G18A 2K2NA 2I9VA 2C6WB 4FD8A 3C30A 3Q81A 2V9AA 4DN0A 3WRZA 3E4QA 1TS8A 3OOVA 5HDDA 4KG2A 4UA7A 2ZOHA 2BASA 3IXBA 3BFFA 3RJUA 4UQIM 4DDYA 1N9BA 1N4OA 4GN2A 3QP5A 1ODVA 5I5LA 3O88A 3LR3A 1NZOA 3MQ0A 2NUPC 3R7WA 2J3TD 1CI8A 4NEED 3UDIA 1NJ4A 3L9KA 3E2KA 5LBRA 1XX2A 1K55A 3IWIA 4S2NC 2XK1A 1Z09A 1SDEA 3NULA 5GLAA 2V1AA 3IQAA 2E8JA 3R4KA 5EV0A 1YSPA 1GA9A 3RFBA 2VJWA 4KQOA 1HD8A 4HP4A 5HWTA 4RQ9A 1PYYA 1XJ3A 5M19A 1VM1A 2G7UA 4X69A 3CUEA 4I3IA 2ZMVA 4UHUA 2L0WA 2M7UA 2JCHA 1RGZA 1E25A 1I2SA 1E4DA 3IF6C 4OPQA 5G4ZA 4II7A 4EBNA 2XROA 4FH2A 3DW0A 3ITAA 4PM6A 3Q7VB 1XJ2A 3E4PA 2C5WB 4YWZA 5CEBA 3TG9A 1S1YA 1P97A 3D72A 1KOUA 4Q0HA 1KVMA 3LUQA 4Y17A 4BL3A 2VV8A 2B5RA 3HVFA 4IVKA 5EVLA 1VQQA 4JF4A 4IEDA 2EX6A 4Y5FA 2QKPA 3UB9A 3LI8A 1ES5A 1EW0A 4YINA 5FI6A 1ES2A 3TJZC 1NLYA 1H0MA 3MQOA 3BLSA 4WM9A 3SOIA 1LT0A 4PAUA 3ZG7B 1XA1A 4EV4A 4O8GA 2GX5A 1ESIA 4L9FA 4GOGA 1W5DA 1QMFA 3FG8A 4B9OA 3G31A 5EM0A 5HSQA 3B47A 3KYEA 5CHMA 4GD6A 1LI0A 2HGVA 4KZ6A 2J80A 3LCEA 5GL9A 1IFQA 1PZPA 2DCFA 3LI9A 5L07A 4R70A 1GHMA 2IWDA 1KGGA 2XLNA 3NDEA 5AQAA 5EPHA 3LIBA 2Q9NA 4PM8A 5L10A 4KG6A 2QJ7A 2PD8A 4ETXA 1GCEA 5FAQA 3CI6A 3IX3A 4KZ8A 2Y2OA 1PW8A 1XPBA 4R1GA 4MBFA 4R4SA 3UE1A 2HP6A 3BFCA 3LO7A 1JWVA 4GS9B 3DBAA 2WKHA 3DWKA 3HCYA 3JVVA 4G3VA 3SZTA 1KDWA 1L0EA 4EUVA 1LSXA 3G30A 3AGFA 1XJ4A 3ZNTA 4K08A 4OLGA 2IWCA 2JHEA 3GTCA 2WAEA 3O5YA 3G34A 1S67L 2R9XA 4XT2B 2FZ0A 2JKGA 5GHYA 3TE8A 3F1PA 2O9CA 4GW9A 3C2WA 2XR0A 2HP5A 1K0KA 3C38A 3ZG0A 1IYSA 4IBRA 4OVDA 3CHWP 2M7VA 5FQIA 4LPZA 3GSGA 3ZYTA 4K0WA 5BOHA 3UMDA 4WBGA 2HPBA 3HLBA 3MZEA 4IJGA 2XQZA 3EGXC 3OC2A 3LFVA 2XFTA 4DJ3A 1BULA 2MJ6A 4OH0A 4CLCD 2VX8A 4ZTKA 1L3LA 1ACFA 3OPHA 3H9WA 3F1NA 3I7JA 5DTTA 5GLDA 5A91A 5L09A 1PW1A 4WLAA 5EM1A 3AGEA 3OCNA 1UWNX 5EFWA 1CK3A 1TS7A 5U47A 3QP2A 3PBRA 3IXDA 4U3TA 2A24B 3VOZA 3IF5A 4BENA 3PBQA 4UQIS 1AXBA 3OPPA 4DJ2A 2O9BA 4CPKA 4L0LA 1PRQA 2ZM0A 1FOFA 1T1CA 1C3BA 4ID4A 2ZQ8A 2VA0A 3NDGA 2Y55A 3V50A 2WK0A 4HJ3A 1ZC2A 4Y3IA 3MXSA 2Y59A 5AQ9A 4CLCE 1WYCA 2HJEA 2L4RA 5HL1A 2ZC6B 3OPRA 5DFYA 3A3JA 4LLOB 1HTZA 4DRTA 3OZHA 4R3AA 1YLWA 3LY4A 2ZC7A 2G2UA 2Y4AA 4L9GA 2V2FF 3HJKA 5EVIA 3S1YA 5IU1A 1S66L 2YKFA 2WADA 4H6JB 1CEGA 4GLQA 4P0MA 2Y2HA 3S7QA 1LSVA 1EWZA 1G68A 3IHBA 3IBJA 3CLOA 2O9AA 1T18A 3FYZA 3HLCA 5FEGA 3A0RA 1WE4A 1BLSA 3GV9A 3G35A 4LV0A 3QP8A 4XXRA 2V1ZA 1OTDA 2NUTC 1VETB 5E2EA 5C5KA 4B88A 1K55C 4U0TA 4ZJ3A 4FH4A 4E3OA 4WL9A 3NI9A 4P6BA 4GDBA 3DTEA 5AVFA 4OLDA 3IWQA 2WGVA 4ZBEA 2LB5A 3NCKA 1ZHHB 1MBLA 1U60A 3WS5A 4E3KA 1OPXA 4PM5A 4B4XA 1HLUP 3VP2A 2JC7A 1K25A 5EVIC 3Q7VA 1LL8A 5KIZA 1P9RA 4S2OA 3E2LA 4UAAA 2WKPA 2UV0E 5HW3A 3UDXA 5FDHA 2VV7A 4KQRA 5FQKA 4JLFA 1NRJA 4MNRA 3P98A 4JXVA 3CG5A 1CI9A 3PHYA 1OMEA 4D60A 3O86A 5CECA 2OWJA 3S7PA 4KUOA 3ZHHA 5CEDA 3P7NA 3C8CA 2XD5A 1SDNA 3CJMA 3NJAA 4RYEA 4QY5A 3VE3A 3PBOA 2ZQ9A 4E3IA 5CTNA 3MMHA 4I3JA 5DFXA 2PYRA 3FZCA 1GA0A 1N9NA 5J4EA 2OWHA 3UB6A 4CJNA 1BYWA 4WUJA 4R6LA 4WMCD 4QPRA 1IYPA 4WEKA 2RCXA 3GVBA 3T4LA 3LEQA 3PAEA 4EBLA 2DMWA 3DWZA 2A49A 5FDSA 2ZC5B 3LY3A 1L0FA 2Y79A 3F1PB 1CQAA 4MLLA 2PR5A 2YKHA 2XGNA 4X25A 5HWWA 1P0ZA 3E0YA 1SZVA 3GMWA 4LENA 4HI4A 1K4FA 5F68A 3CITA 1MWRA 5DJUA 2ZMFA 1YQSA 1VHMA 4Y15A 2WZZA 1Q2PA 3PR6A 2A2LA 3KO6A 2W3HA 4LRXC 3QP6A 3ITBA 5DKLA 4ZDXA 1RCJA 1LL9A 4DE1A 2H10A 5JYOA 1MKIA 3K2NA 1VEUB 4HBTA 3A0SA 2W0NA 2HZ5A 2XDMA 3BFGA 2L1MA 5FA7A 5M18A 3A3DA 5TFQA 4JKTA 3LICA 1LSWA 1FCOA 3ZNYA 3C7VA 2UWXA 2PR6A 4P87A 1YT4A
chains in the Genus database with same CATH topology
4ETXA 4FSFA 3PXPA 4Z1WA 5HD3A 2JKRI 5TJJA 3CI6A 2PT7A 3A0VA 4ARZA 4FOFA 4MMNA 1S4SA 5F5YA 3PBTA 1DP6A 1Y28A 5HDSA 4GS9B 1D7EA 2V0UA 3DBAA 1X0OA 4BJPA 3PYPA 2P7JA 1OT9A 3BWLA 4HJ6A 4NXBA 3HCYA 2W3GA 3EEHA 3JVVA 3IBRA 5HL6A 4G3VA 3CWFA 4I38A 4EUVA 4Y2FA 1S1ZA 1LSXA 3E98A 3VV4A 1OTAA 4HH3A 2W3FA 1XJ4A 4I39A 4JGOA 1DRMA 3F1NB 5HPIA 4MN5A 1T1AA 4HNBA 3EQVA 3PBNA 4K08A 2OAQ1 2VKSA 2JHEA 2D01A 1ZTUA 3GECA 5K5BA 3O5YA 3S7OA 3UMEA 2KLIA 1XFNA 2HV1A 1S67L 3T4TA 4XT2B 2FZ0A 3IS2A 3TE8A 3F1PA 2O9CA 2W3EA 4KQDA 3LIFA 4BMWA 4GW9A 2JN7A 4I3AA 2Z6DA 3C2WA 3T4OA 1VB6A 3EGDC 2VGLM 3C38A 1V9ZA 2V0WA 2W1TA 4Q0IA 2M7VA 1P9WA 4NKPA 4LPZA 4HIAA 1TD5A 5TBMB 2J3TC 3ZYTA 4WELA 2W1RA 3UMDA 3E4OA 2FH5A 4HY8A 2GZAA 3MJQA 4HQAA 3EWKA 1T19A 3HJIA 3H7WB 3KX0X 1OTBA 4ETZA 4IJGA 4OOMA 1STZA 4L9EA 1N9LA 3EGXC 4G3KA 4IHQA 3OC2A 2KDKA 3LFVA 3LIEA 4XT2A 3JVUA 4JGPA 3EOIA 4DJ3A 2MJ6A 2H28A 4HJ4A 3CAXA 4EERA 1NWZA 3V67A 4IUKA 4CLCD 2VX8A 4EXOA 3B42A 4LRYC 2EWWA 3VOLA 3H9WA 2IA2A 4MN6A 4ZRRA 1G6OA 5HD5A 3TRCA 5KSHA 3F1NA 1OJ5A 4GCZA 4WLAA 4HOIA 4O01A 1YSQA 3R7WB 3OCNA 1UWNX 5EFWA 3GDIA 3ZQ5A 1TS7A 1UWPX 3UB7A 2WKQA 4BBTA 3T4JA 5AJGA 3PBRA 3T4SA 2A24B 2EWVA 2VV6A 1W63Q 2QWSA 5DJTA 4WF0A 4EEPA 3PBQA 4UQIS 4PKYG 4F3LB 4DJ2A 3KSGA 2O9BA 2ZOIA 4L0LA 4EQ1A 4Q0JA 1OT6A 1T1CA 2OOLA 2PD7A 4NXEA 2W27A 3T50A 3BQ8A 5DF9A 3ICYA 4ME4A 1WA9A 2VA0A 4BWIA 2W3DA 4HJ3A 3D3OA 3P01A 2KOIA 1IOUA 2GJ3A 3OBFA 4Y3IA 3LIAA 4OOLA 3G6OA 5HDCA 3MQQA 4R38A 4CLCE 4F3LA 2JKTM 3UE6A 5AVEA 3BY9A 3NOTC 5DKKA 2HJEA 2VGLS 3H7WA 3KSHA 2L4RA 3MF0A 1F9IA 4JGQA 4EESA 5DFYA 4CLCC 4LLOB 4AFIA 3RTYA 4JGRA 2KX6A 1OTIA 4R3AA 2GNXA 1JNUA 4MN7A 3RH8B 4GHIA 3S7NA 4E04A 4HH2A 4L9GA 1TS0A 2J3WA 1TS6A 2XRNA 3EQUA 3OLOA 3HJKA 3UE3A 4G3WA 5IU1A 1TF1A 4EW7A 1S66L 3KYQA 4GS9A 3IS2B 2EA9A 2YKFA 3B33A 4H6JB 5J3WA 3CUEC 4GLQA 2VEAA 3S7QA 2QJ5A 4GJ4A 1LSVA 2HJ9C 3F1OB 2VLGA 2K2NA 4YNRA 2I9VA 1GSVA 3C30A 3IBJA 3KSIA 2V9AA 3CLOA 4P6ZS 2O9AA 1DP9A 3EEAA 4DN0A 5A8BA 1T18A 3E4QA 1TS8A 1H8MA 3A0RA 1S4RA 3OOVA 5HPFA 3LIDA 3KYZA 5HDDA 2ZOHA 3VE4A 2BASA 3NOUC 3FPVA 4UQIM 1OTDA 2NUTC 2XA7M 2Y8HA 5C5KA 2Z6CA 5L8MA 2XA7S 4BBUA 3MFXA 4H6JA 4NXFA 1ODVA 4WL9A 5I5LA 2QHKA 5J7EA 3LR3A 1F5MA 2VZWA 3MQ0A 5AVFA 4IUHA 2NUPC 3BQAA 3R7WA 2J3TD 2ZBBA 2LB5A 4NEED 3LR0A 1ZHHB 3U2AA 5LBRA 5MC7A 2JKTI 1OTEA 3K3DA 5IT5A 1OPXA 3TW8A 5CX7A 2V1AA 3R4KA 1YSPA 4CQHA 4UEYA 3RFBA 2VJWA 1XFQA 3T4KA 4NXGA 4KQOA 1LL8A 5KIZA 1P9RA 1H3QA 4HP4A 2WKPA 4MCWA 5HWTA 4RQ9A 1YAXA 1XJ3A 3K3CA 3SW1A 2VV7A 3KSFA 4ARZB 1NRJA 2K31A 2G7UA 3UB8A 2B18A 2INWA 3LYXA 4PKYA 3PHYA 3CUEA 4I3IA 3LR5A 2OWJA 2ZMVA 3S7PA 2L0WA 3FC7A 5TBMA 1YKDA 3W2ZA 2M7UA 4KUOA 2O0YA 3NHQA 2W1TB 4LRZE 4WN5A 5G4ZA 4II7A 2A24A 2HF6A 2XROA 4O0PA 1UGUA 1GSWA 1W63M 3P7NA 4B93A 3C8CA 4P6ZM 1DP8A 1XJ2A 3NJAA 2B02A 3E4PA 4YWZA 2PHYA 4MDZA 3PBOA 3VE3A 1S1YA 2LB9A 1P97A 3MMHA 3D72A 4I3JA 5DFXA 4DMZA 1OJGA 1KOUA 1MC0A 3BW6A 4Q0HA 2PYRA 2OAP1 3LUQA 4YOFA 1N9NA 5FL3A 5J4EA 4M4XA 2OWHA 3UB6A 1BYWA 4WUJA 2VV8A 4R6LA 4PHTA 4QPRA 5G4YA 2R78A 2QYBA 2WKRA 4WEKA 5F6AA 3FPWA 4Y5FA 4EU0A 3BJNA 3T4LA 2QKPA 3UB9A 3LI8A 1EW0A 2DMWA 2CMNA 4KUKA 3TJZC 2K7SA 4EEUA 2Y79A 3ULFA 3F1PB 1NLYA 3F1OA 3T4QA 3BY8A 2XSSA 3MQOA 2PR5A 1V9YA 1T1BA 2YKHA 1LT0A 5HWWA 1P0ZA 3E0YA 4HI4A 4PAUA 4O8GA 5F68A 3CITA 3H82A 2GX5A 5DJUA 4L9FA 2ZMFA 3LR4A 1D06A 4WEJA 2D02A 1MKMA 2PDRA 4EETB 2M1CA 1VHMA 3FG8A 3PBSA 3PR6A 2A2LA 3KO6A 3OCLA 2W3HA 4B9OA 3NOPC 4GHIB 4LRXC 5HSQA 5DKLA 3B47A 2PYPA 1MZUA 2HGVA 2JKRM 4I5SA 2J80A 3MXQA 2V1BA 1IFQA 1GSXA 2P04A 1G28A 4CLCB 5IS1A 3K2NA 4HHDA 4CLCA 5F69A 3LI9A 1F98A 4R70A 3A0SA 2W0NA 4BBVA 1XJ6A 2L1MA 5HWVA 1NLZA 3MR0A 4HP9A 3LICA 1LSWA 3LIBA 2P08A 2O99A 2PR6A 1N9OA 2QJ7A 5HZHA 3H82B 2PD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ETX A;  4O0P A;  4LRY C;  4Z1W A;  5TJJ A;  3CI6 A;  2K2N A;  4YNR A;  2IA2 A;  4ZRR A;  3IBJ A;  3KSI A;  3TRC A;  4FOF A;  4MMN A;  4DN0 A;  2O9A A;  3EEA A;  4MDZ A;  2LB9 A;  3MMH A;  5DFX A;  4DMZ A;  3DBA A;  4O01 A;  3OOV A;  1YSQ A;  1MC0 A;  4Q0H A;  5HPF A;  3ZQ5 A;  4YOF A;  5AJG A;  3HCY A;  2W3G A;  3NOU C;  3IBR A;  5HL6 A;  4R6L A;  4G3V A;  2Y8H A;  4QPR A;  5C5K A;  2QYB A;  4EUV A;  5L8M A;  4Y2F A;  3E98 A;  4Y5F A;  4EU0 A;  3BJN A;  2XRO A;  3KSG A;  2O9B A;  3VV4 A;  5I5L A;  2W3F A;  5HPI A;  1F5M A;  4Q0J A;  2VZW A;  3MQ0 A;  4IUH A;  2VKS A;  2OOL A;  2Y79 A;  1ZTU A;  4ME4 A;  5K5B A;  3O5Y A;  3S7O A;  2LB5 A;  2XSS A;  2KLI A;  4BWI A;  2W3D A;  3D3O A;  5LBR A;  2KOI A;  3E0Y A;  3OBF A;  4Y3I A;  2O9C A;  2W3E A;  4PAU A;  3G6O A;  4GW9 A;  4O8G A;  3CIT A;  2GX5 A;  3C2W A;  2ZMF A;  3R4K A;  1MKM A;  1YSP A;  1VHM A;  2W1T A;  3NOT C;  4CQH A;  3KO6 A;  4Q0I A;  2M7V A;  3KSH A;  2VJW A;  3RFB A;  1TD5 A;  2W3H A;  3MF0 A;  3NOP C;  4LRX C;  5HSQ A;  5DFY A;  2W1R A;  2HGV A;  4MCW A;  4RQ9 A;  4MN7 A;  4ETZ A;  4IJG A;  3S7N A;  4E04 A;  3K2N A;  1STZ A;  3KSF A;  4G3K A;  2XRN A;  4R70 A;  2K31 A;  2G7U A;  3LFV A;  4G3W A;  2B18 A;  1TF1 A;  3S7P A;  1YKD A;  3W2Z A;  4GLQ A;  2M7U A;  2VEA A;  3S7Q A;  2O99 A;  2O0Y A;  3NHQ A;  2W1T B;  4LRZ E;  4IUK A; 
#chains in the Genus database with same CATH topology
 2H5S A;  2VGK A;  5TR7 A;  4FSF A;  3PXP A;  3MSH A;  5J8X A;  3IH9 A;  3A0V A;  1TDL A;  3ZG5 A;  2Y2J A;  3FKW A;  4QU3 A;  3N8L A;  4IVI A;  3PBT A;  5E2H A;  2X02 A;  1D7E A;  4KZ5 A;  4C3Q A;  2OLU A;  3BWL A;  5EVE A;  4NXB A;  3EEH A;  3UNW A;  3HBR A;  2E8I A;  2ACG A;  2OLV A;  3E98 A;  5GHX A;  1LHY A;  4EBP A;  1OTA A;  4HH3 A;  3F1N B;  4HNB A;  4HBU A;  2VKS A;  1JWZ A;  2ZQA A;  3TOI A;  2D01 A;  5K5B A;  4DKI A;  2HDQ A;  2KLI A;  2HV1 A;  3FV7 A;  1FIK A;  4BMW A;  3ISG A;  2ZD8 A;  4I3A A;  1BLP A;  4Q8I A;  3EGD C;  3CZD A;  2V0W A;  3C4P A;  5A93 A;  5EOE A;  4QJG A;  4HIA A;  4N1H A;  2WGW B;  5GLC A;  3SH9 A;  5EUA A;  3EWK A;  1T19 A;  3H7W B;  2VGJ A;  1OTB A;  1PWG A;  2QMI A;  2XFS A;  4L9E A;  3LIE A;  2EFU A;  2VK3 A;  1S6R A;  2H28 A;  4HJ4 A;  5F1F A;  2ZMA A;  4YFM A;  4EER A;  1NWZ A;  1DY6 A;  3B42 A;  4EQI A;  1EI5 A;  5L2F A;  1PFL A;  4HEF A;  1G6O A;  5HD5 A;  3TRC A;  3ZDJ A;  4PMA A;  1K56 A;  1ESU A;  3O87 A;  1HVB A;  4GNU A;  1YSQ A;  4XUZ A;  3UB7 A;  2WKQ A;  4BBT A;  1FCN A;  3T4S A;  4GDN A;  2EWV A;  5HAQ A;  4E3M A;  1W63 Q;  5F83 A;  2Y2I A;  3SS3 A;  4EEP A;  4PKY G;  3FKV A;  1MWT A;  3KSG A;  1CF0 A;  3SH8 A;  3Q7Z A;  1JWP A;  1IEL A;  5TGF A;  1OT6 A;  2OOL A;  3IXH A;  4NXE A;  1ERM A;  5FAT A;  4ME4 A;  2ZL1 A;  4NET A;  4FCF A;  1BLH A;  2XH9 A;  3D3O A;  3P01 A;  4E3L A;  3GQZ A;  1KE3 A;  5HDC A;  2ZQ7 A;  4QY6 A;  4JF6 A;  2JKT M;  5KZH A;  5DKK A;  3KSH A;  2BTF P;  1W7F A;  4JGQ A;  3BYD A;  1MY8 A;  2GDN A;  3RTY A;  3UY6 A;  2KX6 A;  3MZD A;  3UPP A;  2R9W A;  2GNX A;  1JNU A;  4MN7 A;  5CXW A;  3S7N A;  4E04 A;  1KDS A;  1TS6 A;  2XRN A;  2DRW A;  4G3W A;  4R0Q A;  1FSW A;  1TF1 A;  2Q0O A;  4EW7 A;  3KYQ A;  2EA9 A;  3B33 A;  1ERO A;  4E3N A;  3T1R A;  1PZO A;  3QHY A;  2PU2 A;  4ZJ1 A;  2OSU A;  4RX2 A;  3NC8 A;  4OP8 A;  4D2O A;  3BEC A;  2HJ9 C;  1H8Y A;  2CC1 A;  1LL5 A;  2HDS A;  4YNR A;  3IX4 A;  1GSV A;  4FTX A;  4BLM A;  3KSI A;  3ZCZ A;  1K57 A;  3ZGA B;  2Y2L A;  4P6Z S;  1DP9 A;  3EEA A;  3HLW A;  4JBF A;  5D3O A;  1K4E A;  1H8M A;  2PAV P;  1S4R A;  5HPF A;  3LID A;  1PI5 A;  4DE2 A;  3VE4 A;  4X6T A;  3FPV A;  2XA7 M;  2Y8H A;  3W4O A;  2Z6C A;  5L8M A;  3BFD A;  3MFX A;  1W8Q A;  4NXF A;  1MXO A;  1Y4O A;  2VZW A;  4DE0 A;  5DF7 A;  4OOY A;  3BQA A;  3T1X A;  1IYO A;  3U2A A;  3U4L P;  1K56 D;  2XD1 A;  4X56 A;  5MC7 A;  2JKT I;  1OTE A;  5I94 A;  4R3J A;  1LLB A;  1GHP A;  3TW8 A;  1NYY A;  2HDR A;  3QP1 A;  4BL2 A;  3G2Y A;  5CER A;  4CQH A;  3NIA A;  3T4K A;  4NXG A;  1TVF A;  4KZ9 A;  3QNB A;  1H3Q A;  3BRM A;  4MCW A;  1IEM A;  4WYY A;  1YAX A;  3OPL A;  3SW1 A;  4E6W A;  3A3E A;  1W8Y A;  1BSG A;  4GKU A;  4S2J A;  1PWC A;  3UB8 A;  2B18 A;  2INW A;  1ZG4 A;  5KMW A;  1XA7 A;  1MWS A;  4XUX A;  3FC7 A;  1YKD A;  1YLJ A;  5HAR A;  2O0Y A;  3NHQ A;  3HUN A;  1YLY A;  4O0P A;  3CPT B;  1GSW A;  4N9L A;  4WZ4 A;  5CGW A;  5FAS A;  1ALQ A;  4RA7 A;  1JTD A;  2B02 A;  4C6Y A;  2X01 A;  3N7W A;  4MDZ A;  3FWL A;  1PI4 A;  4H8R A;  3BEB A;  4DMZ A;  4O7D A;  1OJG A;  2OAP 1;  3IXG A;  4YOF A;  5FL3 A;  4M4X A;  3WS1 A;  1YMX A;  2R78 A;  2WKR A;  1JVJ A;  3FPW A;  1CJF A;  3BJN A;  1K54 C;  4EWF A;  4WMC A;  2PBD P;  3ULF A;  1L0D A;  3F1O A;  3Q1F A;  1W79 A;  1A0K A;  2XSS A;  2Y2G A;  1T1B A;  2H0T A;  4JF5 A;  4FUW A;  4WEJ A;  2D02 A;  3W8K A;  4JXG A;  4EET B;  3PBS A;  3UPO A;  4UA9 A;  5E2F A;  3NOP C;  1MWU A;  4GHI B;  1QME A;  3M2K A;  2PYP A;  1MZU A;  3UPN A;  1SKO A;  3MXQ A;  2EX9 A;  2V1B A;  5DF8 A;  4CLC B;  5IS1 A;  1DJA A;  5FQM A;  5F69 A;  3T12 B;  1F98 A;  4KZA A;  5DVA A;  4BBV A;  5HWV A;  1NLZ A;  5FQ9 A;  3V3S A;  4X68 A;  3JPU A;  1K57 C;  3SS5 A;  2O99 A;  2ZC4 B;  1N9O A;  1YLT A;  1KGE A;  4X55 A;  5HD3 A;  2JKR I;  3IF6 A;  4N92 A;  4BQM A;  2PT7 A;  4ARZ A;  3BFE A;  4FOF A;  1S4S A;  5F5Y A;  1GHI A;  1SKO B;  5HDS A;  1X0O A;  3PYP A;  2P7J A;  1OT9 A;  5EVI B;  4P85 A;  5EEC A;  4LFU A;  5HL6 A;  5A92 A;  4I38 A;  1S1Z A;  3GR2 A;  4I39 A;  3M6B A;  1DRM A;  5HPI A;  1T1A A;  3EQV A;  3PBN A;  2OAQ 1;  2P9V B;  4KZ3 A;  1ZTU A;  4KEN B;  1XP4 A;  2J9O A;  3S7O A;  3P09 A;  3NBL A;  3UME A;  1K54 A;  1XFN A;  4OQG A;  3Q07 A;  3T4T A;  1TEM A;  4OQ0 A;  3V39 A;  3IS2 A;  1D1J A;  2W3E A;  1I5Q A;  2XEP A;  2Z6D A;  3SH7 A;  2VGL M;  5GHZ A;  4B4Z A;  1V9Z A;  4Q0I A;  3IHA A;  1CEF A;  1ERQ A;  4NKP A;  1K6S A;  3DTM A;  3LEZ A;  4WEL A;  3M6H A;  3E4O A;  2FH5 A;  4QHC A;  4HY8 A;  2GZA A;  3MFD A;  3MJQ A;  3RXX A;  4HQA A;  1H8Z A;  3HJI A;  3VFF A;  5AQ7 A;  1KE0 A;  3KX0 X;  3B3X A;  1STZ A;  5EVI D;  2WUQ A;  4G3K A;  4Y13 A;  4NK3 A;  2KDK A;  4PPR A;  5EE8 A;  3JVU A;  4JGP A;  3EOI A;  1H5X A;  1Z6F A;  3UB5 P;  4S2K A;  3V67 A;  4EXO A;  1XGJ A;  2EWW A;  3VOL A;  1FR6 A;  1M6K A;  3WS0 A;  2IA2 A;  4ZRR A;  3JYI A;  5CGS A;  2ZLY A;  5KSH A;  5DTS A;  4GCZ A;  3R7W B;  3GDI A;  3ZQ5 A;  1UWP X;  5AJG A;  2VV6 A;  2QWS A;  5DJT A;  4OPY A;  4KZ4 A;  5CGX A;  4F3L B;  3A3I A;  2PD7 A;  2W27 A;  3T50 A;  3BQ8 A;  3HLD A;  3VSL A;  4HES A;  3G32 A;  3HUM A;  2W3D A;  4GD8 A;  1IOU A;  3OBF A;  3LIA A;  3G6O A;  2Y2P A;  1RP5 A;  4Y0U A;  4F3L A;  1NXY A;  5AVE A;  4K0X A;  3NOT C;  3MF0 A;  4OQI A;  1G6A A;  1SCW A;  4CLC C;  3MKF A;  4JGR A;  4OPR A;  4U0X A;  4GHI A;  2OV5 A;  2ZJ9 A;  4HH2 A;  2J3W A;  3GRJ A;  5FSR A;  3EQU A;  1BTL A;  1ES3 A;  3UE3 A;  3T1Q B;  1ZG6 A;  1PNE A;  1YPR A;  2FFY A;  2WZX A;  1NZU A;  4GS9 A;  1YLP A;  3IS2 B;  5AQB A;  3ZG9 B;  4KZ7 A;  3C5A A;  1Y54 A;  3CUE C;  1FSY A;  2VEA A;  4GJ4 A;  3NY4 A;  2IWB A;  3UE0 A;  3CMZ A;  3F1O B;  2VLG A;  4S2P A;  3D9Y A;  5CHU A;  2Y2N A;  1XKZ A;  1O07 A;  5A8B A;  2WYX A;  3VOY A;  1Q2Q A;  3KYZ A;  1E3U A;  2JKF A;  2WGW A;  3N6I A;  3VFH A;  3NOU C;  4DXC A;  1XXM A;  3WS2 A;  3C7U A;  5FQQ A;  2AVX A;  3WWX A;  5HAP A;  4RVA A;  2XA7 S;  4LV3 A;  4BBU A;  5FEF A;  4H6J A;  3CPT A;  2QHK A;  5J7E A;  1LI9 A;  1F5M A;  4IUH A;  1O7E A;  2ZBB A;  3LR0 A;  3M2J A;  3IX8 A;  5DTK A;  4IBX A;  4DXB A;  3K3D A;  3VP0 A;  5IT5 A;  5CX7 A;  4Y0O A;  1KE4 A;  3UN7 A;  3G4P A;  1NRF A;  3UO9 A;  4UEY A;  4N9K A;  1XFQ A;  3C4O A;  1BZA A;  4WZ5 C;  1K38 A;  4GB7 A;  2DNS A;  3K3C A;  1TDG A;  3LGO A;  1YM1 A;  3KSF A;  5FQJ A;  4ARZ B;  4ZAM A;  2K31 A;  2PBY A;  4R3B A;  4GZB A;  3LYX A;  4PKY A;  3VP4 A;  5FI2 A;  3IWO A;  2Y2M A;  3LR5 A;  3MXR A;  4KQQ A;  5TBM A;  2EXB A;  3W2Z A;  4WN5 A;  4S2N A;  2W1T B;  4LRZ E;  1ONG A;  2A24 A;  2HF6 A;  3IT9 A;  2EX2 A;  4EUZ A;  1UGU A;  1W63 M;  4B93 A;  1JTG A;  1F2K A;  4E3J A;  4P6Z M;  1DP8 A;  2PHY A;  4NG2 A;  2LB9 A;  3N8S A;  4RX3 A;  4A5R A;  1MC0 A;  3AGD A;  3BW6 A;  3SS4 A;  4Z9Q A;  4MBH A;  4MEZ A;  4OP5 A;  1PWD A;  2FFF B;  4PHT A;  2JE5 A;  1FR1 A;  5G4Y A;  3ZFZ A;  2QYB A;  5F6A A;  1L2S A;  4ZJ2 A;  4EU0 A;  1FQG A;  5CHJ A;  4DE3 A;  4LV2 A;  4BD1 A;  5M1A A;  2CMN A;  4KUK A;  5FI7 A;  4S2M A;  2K7S A;  4EEU A;  2Y2Q A;  3T4Q A;  3BY8 A;  5F82 A;  3HL9 A;  5EOO A;  1V9Y A;  3VP1 A;  4ESP A;  2BG1 A;  3ZVW A;  5CRF A;  2Y91 A;  3H82 A;  1K6R A;  3MS6 A;  4JPM A;  3LR4 A;  1D06 A;  1MKM A;  2PDR A;  2M1C A;  1I2W A;  2RL3 A;  3OCL A;  3W4Q A;  3HUO A;  4QB8 A;  4UA6 A;  2JKR M;  2Z2M B;  5F1G A;  4I5S A;  3HLG A;  1RGY A;  3ZG8 B;  1J9M A;  1GSX A;  2P04 A;  2J8Y A;  4PM9 A;  1G28 A;  4HHD A;  4CLC A;  2Q9M A;  2EX8 A;  3QP4 A;  3MBZ A;  1XJ6 A;  5HFO A;  3MR0 A;  4HP9 A;  2G2W A;  1SHV A;  3G2Z A;  4OPZ A;  4X53 A;  2P08 A;  3MZF A;  5HZH A;  3H82 B;  1IKI A;  4Z1W A;  4LV1 A;  5TJJ A;  2PU4 A;  3UDF A;  4C75 A;  4OON A;  2ZQD A;  3PAG A;  4MMN A;  4QWO A;  3A3F A;  5KSC A;  2H0Y A;  3VP3 A;  3ZVT A;  1DP6 A;  1Y28 A;  2V0U A;  4BJP A;  4QD4 A;  3V3R A;  4HJ6 A;  2W3G A;  4X1M A;  3IBR A;  1ZKJ A;  4PM7 A;  1BT5 A;  3S4X A;  3RXW A;  3CWF A;  4Y2F A;  2WGI A;  3W4P A;  2P74 A;  3VV4 A;  5HX9 A;  2W3F A;  2V20 A;  5HAI A;  4JGO A;  4MN5 A;  1WYB A;  5GLB A;  2JBF A;  3GEC A;  1L0G A;  1ES4 A;  3S22 A;  1FIL A;  4JXS A;  2V8C A;  4KQD A;  3LIF A;  2JN7 A;  4WZ5 A;  4DF6 A;  4LGW A;  3T4O A;  1VB6 A;  4N1X A;  5FAO A;  2EFX A;  5E2G A;  2W1T A;  1IKG A;  4DDS A;  1P9W A;  1TD5 A;  2WKE A;  5TBM B;  2J3T C;  3BM6 A;  3Q82 A;  1PIO A;  2W1R A;  3IH8 A;  1IYQ A;  2X71 A;  4ETZ A;  3DTK A;  2V8F A;  4S2I A;  1AWI A;  4OOM A;  1SKF A;  1N9L A;  2ZM2 A;  4IHQ A;  1XGI A;  2PRF A;  1HZO A;  4XT2 A;  4F94 A;  4MBK A;  5IHV A;  4K91 A;  3CAX A;  2J7V A;  2ZL1 B;  3T1S A;  4IUK A;  1YLZ A;  1VET A;  5CTM A;  4LRY C;  3BLM A;  3IF6 B;  2P9V A;  4MN6 A;  1NYM A;  1OJ5 A;  2ZM8 A;  1KVL A;  4E6X A;  4HOI A;  3DTI A;  4O01 A;  4OKP A;  2ZC3 B;  1M40 A;  3T4J A;  3PTE A;  4R23 A;  3VMA A;  1DJB A;  2HP9 A;  2EXA A;  4LCL A;  2XF3 A;  2QZ6 A;  4WF0 A;  3VSK A;  3L7H A;  3WS4 A;  2WAF A;  3NEC A;  1DJC A;  3TSG A;  2ZOI A;  4EQ1 A;  4Q0J A;  5DF9 A;  3ICY A;  1YMS A;  1WA9 A;  4M3K A;  4BWI A;  1BUE A;  3N4I A;  3D4F A;  2ZQC A;  3QNC A;  2Y2K A;  2KOI A;  4OQH A;  2GJ3 A;  3WRT A;  4Y7P A;  4OOL A;  3MQQ A;  4R38 A;  1S0W A;  3UE6 A;  3DAV A;  1G5U A;  1FCM A;  3BY9 A;  3O3V A;  2VGL S;  1ONH A;  3H7W A;  2BLS A;  1J3W A;  1F9I A;  4EES A;  1MPL A;  3N8R A;  4AFI A;  2B95 A;  4KG5 A;  5FAP A;  3HLE A;  4X1L A;  2J9P A;  5A90 A;  3MKE A;  1OTI A;  5JYP A;  1NY0 A;  3RH8 B;  2WKI A;  5E43 A;  1BLC A;  2I72 A;  1TS0 A;  2HDU A;  3OLO A;  4JXW A;  2A3U A;  4BD0 A;  1KGF A;  2QPN A;  4S2L A;  3V5M A;  5J3W A;  1VEU A;  4Y0T A;  3HLF A;  4R4R A;  2QJ5 A;  4KZB A;  4LCM A;  2Z2L B;  1E3U D;  3HRE A;  5G18 A;  2K2N A;  2I9V A;  2C6W B;  4FD8 A;  3C30 A;  3Q81 A;  2V9A A;  4DN0 A;  3WRZ A;  3E4Q A;  1TS8 A;  3OOV A;  5HDD A;  4KG2 A;  4UA7 A;  2ZOH A;  2BAS A;  3IXB A;  3BFF A;  3RJU A;  4UQI M;  4DDY A;  1N9B A;  1N4O A;  4GN2 A;  3QP5 A;  1ODV A;  5I5L A;  3O88 A;  3LR3 A;  1NZO A;  3MQ0 A;  2NUP C;  3R7W A;  2J3T D;  1CI8 A;  4NEE D;  3UDI A;  1NJ4 A;  3L9K A;  3E2K A;  5LBR A;  1XX2 A;  1K55 A;  3IWI A;  4S2N C;  2XK1 A;  1Z09 A;  1SDE A;  3NUL A;  5GLA A;  2V1A A;  3IQA A;  2E8J A;  3R4K A;  5EV0 A;  1YSP A;  1GA9 A;  3RFB A;  2VJW A;  4KQO A;  1HD8 A;  4HP4 A;  5HWT A;  4RQ9 A;  1PYY A;  1XJ3 A;  5M19 A;  1VM1 A;  2G7U A;  4X69 A;  3CUE A;  4I3I A;  2ZMV A;  4UHU A;  2L0W A;  2M7U A;  2JCH A;  1RGZ A;  1E25 A;  1I2S A;  1E4D A;  3IF6 C;  4OPQ A;  5G4Z A;  4II7 A;  4EBN A;  2XRO A;  4FH2 A;  3DW0 A;  3ITA A;  4PM6 A;  3Q7V B;  1XJ2 A;  3E4P A;  2C5W B;  4YWZ A;  5CEB A;  3TG9 A;  1S1Y A;  1P97 A;  3D72 A;  1KOU A;  4Q0H A;  1KVM A;  3LUQ A;  4Y17 A;  4BL3 A;  2VV8 A;  2B5R A;  3HVF A;  4IVK A;  5EVL A;  1VQQ A;  4JF4 A;  4IED A;  2EX6 A;  4Y5F A;  2QKP A;  3UB9 A;  3LI8 A;  1ES5 A;  1EW0 A;  4YIN A;  5FI6 A;  1ES2 A;  3TJZ C;  1NLY A;  1H0M A;  3MQO A;  3BLS A;  4WM9 A;  3SOI A;  1LT0 A;  4PAU A;  3ZG7 B;  1XA1 A;  4EV4 A;  4O8G A;  2GX5 A;  1ESI A;  4L9F A;  4GOG A;  1W5D A;  1QMF A;  3FG8 A;  4B9O A;  3G31 A;  5EM0 A;  5HSQ A;  3B47 A;  3KYE A;  5CHM A;  4GD6 A;  1LI0 A;  2HGV A;  4KZ6 A;  2J80 A;  3LCE A;  5GL9 A;  1IFQ A;  1PZP A;  2DCF A;  3LI9 A;  5L07 A;  4R70 A;  1GHM A;  2IWD A;  1KGG A;  2XLN A;  3NDE A;  5AQA A;  5EPH A;  3LIB A;  2Q9N A;  4PM8 A;  5L10 A;  4KG6 A;  2QJ7 A;  2PD8 A;  4ETX A;  1GCE A;  5FAQ A;  3CI6 A;  3IX3 A;  4KZ8 A;  2Y2O A;  1PW8 A;  1XPB A;  4R1G A;  4MBF A;  4R4S A;  3UE1 A;  2HP6 A;  3BFC A;  3LO7 A;  1JWV A;  4GS9 B;  3DBA A;  2WKH A;  3DWK A;  3HCY A;  3JVV A;  4G3V A;  3SZT A;  1KDW A;  1L0E A;  4EUV A;  1LSX A;  3G30 A;  3AGF A;  1XJ4 A;  3ZNT A;  4K08 A;  4OLG A;  2IWC A;  2JHE A;  3GTC A;  2WAE A;  3O5Y A;  3G34 A;  1S67 L;  2R9X A;  4XT2 B;  2FZ0 A;  2JKG A;  5GHY A;  3TE8 A;  3F1P A;  2O9C A;  4GW9 A;  3C2W A;  2XR0 A;  2HP5 A;  1K0K A;  3C38 A;  3ZG0 A;  1IYS A;  4IBR A;  4OVD A;  3CHW P;  2M7V A;  5FQI A;  4LPZ A;  3GSG A;  3ZYT A;  4K0W A;  5BOH A;  3UMD A;  4WBG A;  2HPB A;  3HLB A;  3MZE A;  4IJG A;  2XQZ A;  3EGX C;  3OC2 A;  3LFV A;  2XFT A;  4DJ3 A;  1BUL A;  2MJ6 A;  4OH0 A;  4CLC D;  2VX8 A;  4ZTK A;  1L3L A;  1ACF A;  3OPH A;  3H9W A;  3F1N A;  3I7J A;  5DTT A;  5GLD A;  5A91 A;  5L09 A;  1PW1 A;  4WLA A;  5EM1 A;  3AGE A;  3OCN A;  1UWN X;  5EFW A;  1CK3 A;  1TS7 A;  5U47 A;  3QP2 A;  3PBR A;  3IXD A;  4U3T A;  2A24 B;  3VOZ A;  3IF5 A;  4BEN A;  3PBQ A;  4UQI S;  1AXB A;  3OPP A;  4DJ2 A;  2O9B A;  4CPK A;  4L0L A;  1PRQ A;  2ZM0 A;  1FOF A;  1T1C A;  1C3B A;  4ID4 A;  2ZQ8 A;  2VA0 A;  3NDG A;  2Y55 A;  3V50 A;  2WK0 A;  4HJ3 A;  1ZC2 A;  4Y3I A;  3MXS A;  2Y59 A;  5AQ9 A;  4CLC E;  1WYC A;  2HJE A;  2L4R A;  5HL1 A;  2ZC6 B;  3OPR A;  5DFY A;  3A3J A;  4LLO B;  1HTZ A;  4DRT A;  3OZH A;  4R3A A;  1YLW A;  3LY4 A;  2ZC7 A;  2G2U A;  2Y4A A;  4L9G A;  2V2F F;  3HJK A;  5EVI A;  3S1Y A;  5IU1 A;  1S66 L;  2YKF A;  2WAD A;  4H6J B;  1CEG A;  4GLQ A;  4P0M A;  2Y2H A;  3S7Q A;  1LSV A;  1EWZ A;  1G68 A;  3IHB A;  3IBJ A;  3CLO A;  2O9A A;  1T18 A;  3FYZ A;  3HLC A;  5FEG A;  3A0R A;  1WE4 A;  1BLS A;  3GV9 A;  3G35 A;  4LV0 A;  3QP8 A;  4XXR A;  2V1Z A;  1OTD A;  2NUT C;  1VET B;  5E2E A;  5C5K A;  4B88 A;  1K55 C;  4U0T A;  4ZJ3 A;  4FH4 A;  4E3O A;  4WL9 A;  3NI9 A;  4P6B A;  4GDB A;  3DTE A;  5AVF A;  4OLD A;  3IWQ A;  2WGV A;  4ZBE A;  2LB5 A;  3NCK A;  1ZHH B;  1MBL A;  1U60 A;  3WS5 A;  4E3K A;  1OPX A;  4PM5 A;  4B4X A;  1HLU P;  3VP2 A;  2JC7 A;  1K25 A;  5EVI C;  3Q7V A;  1LL8 A;  5KIZ A;  1P9R A;  4S2O A;  3E2L A;  4UAA A;  2WKP A;  2UV0 E;  5HW3 A;  3UDX A;  5FDH A;  2VV7 A;  4KQR A;  5FQK A;  4JLF A;  1NRJ A;  4MNR A;  3P98 A;  4JXV A;  3CG5 A;  1CI9 A;  3PHY A;  1OME A;  4D60 A;  3O86 A;  5CEC A;  2OWJ A;  3S7P A;  4KUO A;  3ZHH A;  5CED A;  3P7N A;  3C8C A;  2XD5 A;  1SDN A;  3CJM A;  3NJA A;  4RYE A;  4QY5 A;  3VE3 A;  3PBO A;  2ZQ9 A;  4E3I A;  5CTN A;  3MMH A;  4I3J A;  5DFX A;  2PYR A;  3FZC A;  1GA0 A;  1N9N A;  5J4E A;  2OWH A;  3UB6 A;  4CJN A;  1BYW A;  4WUJ A;  4R6L A;  4WMC D;  4QPR A;  1IYP A;  4WEK A;  2RCX A;  3GVB A;  3T4L A;  3LEQ A;  3PAE A;  4EBL A;  2DMW A;  3DWZ A;  2A49 A;  5FDS A;  2ZC5 B;  3LY3 A;  1L0F A;  2Y79 A;  3F1P B;  1CQA A;  4MLL A;  2PR5 A;  2YKH A;  2XGN A;  4X25 A;  5HWW A;  1P0Z A;  3E0Y A;  1SZV A;  3GMW A;  4LEN A;  4HI4 A;  1K4F A;  5F68 A;  3CIT A;  1MWR A;  5DJU A;  2ZMF A;  1YQS A;  1VHM A;  4Y15 A;  2WZZ A;  1Q2P A;  3PR6 A;  2A2L A;  3KO6 A;  2W3H A;  4LRX C;  3QP6 A;  3ITB A;  5DKL A;  4ZDX A;  1RCJ A;  1LL9 A;  4DE1 A;  2H10 A;  5JYO A;  1MKI A;  3K2N A;  1VEU B;  4HBT A;  3A0S A;  2W0N A;  2HZ5 A;  2XDM A;  3BFG A;  2L1M A;  5FA7 A;  5M18 A;  3A3D A;  5TFQ A;  4JKT A;  3LIC A;  1LSW A;  1FCO A;  3ZNY A;  3C7V A;  2UWX A;  2PR6 A;  4P87 A;  1YT4 A; 
#chains in the Genus database with same CATH homology
 4ETX A;  4FSF A;  3PXP A;  4Z1W A;  5HD3 A;  2JKR I;  5TJJ A;  3CI6 A;  2PT7 A;  3A0V A;  4ARZ A;  4FOF A;  4MMN A;  1S4S A;  5F5Y A;  3PBT A;  1DP6 A;  1Y28 A;  5HDS A;  4GS9 B;  1D7E A;  2V0U A;  3DBA A;  1X0O A;  4BJP A;  3PYP A;  2P7J A;  1OT9 A;  3BWL A;  4HJ6 A;  4NXB A;  3HCY A;  2W3G A;  3EEH A;  3JVV A;  3IBR A;  5HL6 A;  4G3V A;  3CWF A;  4I38 A;  4EUV A;  4Y2F A;  1S1Z A;  1LSX A;  3E98 A;  3VV4 A;  1OTA A;  4HH3 A;  2W3F A;  1XJ4 A;  4I39 A;  4JGO A;  1DRM A;  3F1N B;  5HPI A;  4MN5 A;  1T1A A;  4HNB A;  3EQV A;  3PBN A;  4K08 A;  2OAQ 1;  2VKS A;  2JHE A;  2D01 A;  1ZTU A;  3GEC A;  5K5B A;  3O5Y A;  3S7O A;  3UME A;  2KLI A;  1XFN A;  2HV1 A;  1S67 L;  3T4T A;  4XT2 B;  2FZ0 A;  3IS2 A;  3TE8 A;  3F1P A;  2O9C A;  2W3E A;  4KQD A;  3LIF A;  4BMW A;  4GW9 A;  2JN7 A;  4I3A A;  2Z6D A;  3C2W A;  3T4O A;  1VB6 A;  3EGD C;  2VGL M;  3C38 A;  1V9Z A;  2V0W A;  2W1T A;  4Q0I A;  2M7V A;  1P9W A;  4NKP A;  4LPZ A;  4HIA A;  1TD5 A;  5TBM B;  2J3T C;  3ZYT A;  4WEL A;  2W1R A;  3UMD A;  3E4O A;  2FH5 A;  4HY8 A;  2GZA A;  3MJQ A;  4HQA A;  3EWK A;  1T19 A;  3HJI A;  3H7W B;  3KX0 X;  1OTB A;  4ETZ A;  4IJG A;  4OOM A;  1STZ A;  4L9E A;  1N9L A;  3EGX C;  4G3K A;  4IHQ A;  3OC2 A;  2KDK A;  3LFV A;  3LIE A;  4XT2 A;  3JVU A;  4JGP A;  3EOI A;  4DJ3 A;  2MJ6 A;  2H28 A;  4HJ4 A;  3CAX A;  4EER A;  1NWZ A;  3V67 A;  4IUK A;  4CLC D;  2VX8 A;  4EXO A;  3B42 A;  4LRY C;  2EWW A;  3VOL A;  3H9W A;  2IA2 A;  4MN6 A;  4ZRR A;  1G6O A;  5HD5 A;  3TRC A;  5KSH A;  3F1N A;  1OJ5 A;  4GCZ A;  4WLA A;  4HOI A;  4O01 A;  1YSQ A;  3R7W B;  3OCN A;  1UWN X;  5EFW A;  3GDI A;  3ZQ5 A;  1TS7 A;  1UWP X;  3UB7 A;  2WKQ A;  4BBT A;  3T4J A;  5AJG A;  3PBR A;  3T4S A;  2A24 B;  2EWV A;  2VV6 A;  1W63 Q;  2QWS A;  5DJT A;  4WF0 A;  4EEP A;  3PBQ A;  4UQI S;  4PKY G;  4F3L B;  4DJ2 A;  3KSG A;  2O9B A;  2ZOI A;  4L0L A;  4EQ1 A;  4Q0J A;  1OT6 A;  1T1C A;  2OOL A;  2PD7 A;  4NXE A;  2W27 A;  3T50 A;  3BQ8 A;  5DF9 A;  3ICY A;  4ME4 A;  1WA9 A;  2VA0 A;  4BWI A;  2W3D A;  4HJ3 A;  3D3O A;  3P01 A;  2KOI A;  1IOU A;  2GJ3 A;  3OBF A;  4Y3I A;  3LIA A;  4OOL A;  3G6O A;  5HDC A;  3MQQ A;  4R38 A;  4CLC E;  4F3L A;  2JKT M;  3UE6 A;  5AVE A;  3BY9 A;  3NOT C;  5DKK A;  2HJE A;  2VGL S;  3H7W A;  3KSH A;  2L4R A;  3MF0 A;  1F9I A;  4JGQ A;  4EES A;  5DFY A;  4CLC C;  4LLO B;  4AFI A;  3RTY A;  4JGR A;  2KX6 A;  1OTI A;  4R3A A;  2GNX A;  1JNU A;  4MN7 A;  3RH8 B;  4GHI A;  3S7N A;  4E04 A;  4HH2 A;  4L9G A;  1TS0 A;  2J3W A;  1TS6 A;  2XRN A;  3EQU A;  3OLO A;  3HJK A;  3UE3 A;  4G3W A;  5IU1 A;  1TF1 A;  4EW7 A;  1S66 L;  3KYQ A;  4GS9 A;  3IS2 B;  2EA9 A;  2YKF A;  3B33 A;  4H6J B;  5J3W A;  3CUE C;  4GLQ A;  2VEA A;  3S7Q A;  2QJ5 A;  4GJ4 A;  1LSV A;  2HJ9 C;  3F1O B;  2VLG A;  2K2N A;  4YNR A;  2I9V A;  1GSV A;  3C30 A;  3IBJ A;  3KSI A;  2V9A A;  3CLO A;  4P6Z S;  2O9A A;  1DP9 A;  3EEA A;  4DN0 A;  5A8B A;  1T18 A;  3E4Q A;  1TS8 A;  1H8M A;  3A0R A;  1S4R A;  3OOV A;  5HPF A;  3LID A;  3KYZ A;  5HDD A;  2ZOH A;  3VE4 A;  2BAS A;  3NOU C;  3FPV A;  4UQI M;  1OTD A;  2NUT C;  2XA7 M;  2Y8H A;  5C5K A;  2Z6C A;  5L8M A;  2XA7 S;  4BBU A;  3MFX A;  4H6J A;  4NXF A;  1ODV A;  4WL9 A;  5I5L A;  2QHK A;  5J7E A;  3LR3 A;  1F5M A;  2VZW A;  3MQ0 A;  5AVF A;  4IUH A;  2NUP C;  3BQA A;  3R7W A;  2J3T D;  2ZBB A;  2LB5 A;  4NEE D;  3LR0 A;  1ZHH B;  3U2A A;  5LBR A;  5MC7 A;  2JKT I;  1OTE A;  3K3D A;  5IT5 A;  1OPX A;  3TW8 A;  5CX7 A;  2V1A A;  3R4K A;  1YSP A;  4CQH A;  4UEY A;  3RFB A;  2VJW A;  1XFQ A;  3T4K A;  4NXG A;  4KQO A;  1LL8 A;  5KIZ A;  1P9R A;  1H3Q A;  4HP4 A;  2WKP A;  4MCW A;  5HWT A;  4RQ9 A;  1YAX A;  1XJ3 A;  3K3C A;  3SW1 A;  2VV7 A;  3KSF A;  4ARZ B;  1NRJ A;  2K31 A;  2G7U A;  3UB8 A;  2B18 A;  2INW A;  3LYX A;  4PKY A;  3PHY A;  3CUE A;  4I3I A;  3LR5 A;  2OWJ A;  2ZMV A;  3S7P A;  2L0W A;  3FC7 A;  5TBM A;  1YKD A;  3W2Z A;  2M7U A;  4KUO A;  2O0Y A;  3NHQ A;  2W1T B;  4LRZ E;  4WN5 A;  5G4Z A;  4II7 A;  2A24 A;  2HF6 A;  2XRO A;  4O0P A;  1UGU A;  1GSW A;  1W63 M;  3P7N A;  4B93 A;  3C8C A;  4P6Z M;  1DP8 A;  1XJ2 A;  3NJA A;  2B02 A;  3E4P A;  4YWZ A;  2PHY A;  4MDZ A;  3PBO A;  3VE3 A;  1S1Y A;  2LB9 A;  1P97 A;  3MMH A;  3D72 A;  4I3J A;  5DFX A;  4DMZ A;  1OJG A;  1KOU A;  1MC0 A;  3BW6 A;  4Q0H A;  2PYR A;  2OAP 1;  3LUQ A;  4YOF A;  1N9N A;  5FL3 A;  5J4E A;  4M4X A;  2OWH A;  3UB6 A;  1BYW A;  4WUJ A;  2VV8 A;  4R6L A;  4PHT A;  4QPR A;  5G4Y A;  2R78 A;  2QYB A;  2WKR A;  4WEK A;  5F6A A;  3FPW A;  4Y5F A;  4EU0 A;  3BJN A;  3T4L A;  2QKP A;  3UB9 A;  3LI8 A;  1EW0 A;  2DMW A;  2CMN A;  4KUK A;  3TJZ C;  2K7S A;  4EEU A;  2Y79 A;  3ULF A;  3F1P B;  1NLY A;  3F1O A;  3T4Q A;  3BY8 A;  2XSS A;  3MQO A;  2PR5 A;  1V9Y A;  1T1B A;  2YKH A;  1LT0 A;  5HWW A;  1P0Z A;  3E0Y A;  4HI4 A;  4PAU A;  4O8G A;  5F68 A;  3CIT A;  3H82 A;  2GX5 A;  5DJU A;  4L9F A;  2ZMF A;  3LR4 A;  1D06 A;  4WEJ A;  2D02 A;  1MKM A;  2PDR A;  4EET B;  2M1C A;  1VHM A;  3FG8 A;  3PBS A;  3PR6 A;  2A2L A;  3KO6 A;  3OCL A;  2W3H A;  4B9O A;  3NOP C;  4GHI B;  4LRX C;  5HSQ A;  5DKL A;  3B47 A;  2PYP A;  1MZU A;  2HGV A;  2JKR M;  4I5S A;  2J80 A;  3MXQ A;  2V1B A;  1IFQ A;  1GSX A;  2P04 A;  1G28 A;  4CLC B;  5IS1 A;  3K2N A;  4HHD A;  4CLC A;  5F69 A;  3LI9 A;  1F98 A;  4R70 A;  3A0S A;  2W0N A;  4BBV A;  1XJ6 A;  2L1M A;  5HWV A;  1NLZ A;  3MR0 A;  4HP9 A;  3LIC A;  1LSW A;  3LIB A;  2P08 A;  2O99 A;  2PR6 A;  1N9O A;  2QJ7 A;  5HZH A;  3H82 B;  2PD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...