2M7VA

Green light-absorbing state of tepixj, an active cyanobacteriochrome domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
165
structure length
165
Chain Sequence
MAAVQLSELRDRQAIFETLVAKGRELLACDRVIVYAFDDNYVGTVVAESVAEGWPQARDQVIEDPCFREHWVEAYRQGRIQATTDIFKAGLTECHLNQLRPLKVRANLVVPMVIDDQLFGLLIAHQASEPRQWQEIEIDQFSELASTGSLVLERLHFLEQTIASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Flexibility Variations Between the Ground and Photoactivated States of a Blue/Green Light-Absorbing Cyanobacteriochrome
rcsb
source organism Thermosynechococcus elongatus
molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis protein
total genus 28
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2m7vA00
2VKSA 4GLQA 5TJJA 5AJGA 2HGVA 3KSGA 4IUHA 2XRNA 4MCWA 5HL6A 4CQHA 4ZRRA 4YNRA 3S7PA 4FOFA 2O0YA 2ZMFA 3RFBA 3S7OA 3EEAA 3IBRA 5L8MA 5C5KA 4E04A 4R70A 2W1TA 2IA2A 3LFVA 4ETZA 2QYBA 3NHQA 4R6LA 3IBJA 4EU0A 4DMZA 4IJGA 4Y2FA 3BJNA 5LBRA 2W3HA 2O9AA 4GW9A 2XROA 2XSSA 2KLIA 4LRXC 4Q0IA 4O0PA 4Q0HA 2OOLA 3NOUC 3S7QA 2B18A 3E0YA 4RQ9A 5I5LA 3R4KA 3C2WA 3KO6A 2W3FA 4MMNA 4DN0A 4G3KA 1F5MA 5HSQA 3ZQ5A 4ETXA 1VHMA 1YSQA 3KSIA 2GX5A 4EUVA 4BWIA 5K5BA 2O9CA 2W3GA 1TF1A 2W3DA 3NOTC 3CI6A 3OOVA 2O9BA 2K2NA 1YKDA 2KOIA 3VV4A 2LB9A 4ME4A 4O8GA 1TD5A 4Y3IA 3KSHA 4LRZE 4O01A 4G3WA 2LB5A 4PAUA 1MC0A 3CITA 3MF0A 3NOPC 4MDZA 1YSPA 2M7VA 5HPFA 4G3VA 3W2ZA 3MMHA 2Y8HA 2O99A 3S7NA 2VZWA 3KSFA 2G7UA 3OBFA 2VEAA 3O5YA 2W1TB 4LRYC 3DBAA 3HCYA 2K31A 4QPRA 4Q0JA 4YOFA 2W1RA 5HPIA 3D3OA 4IUKA 3MQ0A 1ZTUA 4Z1WA 1MKMA 1STZA 2VJWA 3K2NA 3E98A 2W3EA 3G6OA 4MN7A 2Y79A 5DFYA 5DFXA 4Y5FA 3TRCA 2M7UA
chains in the Genus database with same CATH superfamily
1W63Q 4UQIS 1ONHA 1XA7A 1S1YA 3SW1A 5TJJA 4EBLA 3PHYA 2L1MA 2DMWA 5FASA 5AQ7A 4ZRRA 3N8LA 5F1GA 2ZBBA 3PR6A 3OLOA 3QNCA 4OH0A 2IWBA 2VV7A 5GL9A 2HDRA 3EWKA 5CXWA 1N9LA 4E6WA 1TEMA 4R6LA 5EVID 1BULA 4MN6A 3LI9A 3BY8A 1G28A 3NI9A 3ICYA 5CGSA 3MKFA 3AGFA 1V9ZA 2JN7A 1EI5A 1L0FA 1PWDA 3MXSA 3DWKA 1EROA 4JF6A 4QWOA 1OJGA 3DTEA 5G18A 4L9EA 3B3XA 1X0OA 4EUVA 2XQZA 1TVFA 3ZGAB 5L07A 2XFSA 4S2OA 4X1LA 2UV0E 1C3BA 2LB9A 5F68A 4GHIB 1D1JA 2ZL1B 4GS9B 2WAEA 2WGIA 3LCEA 2NUPC 3ZCZA 2JKFA 1ALQA 3BFDA 1ONGA 2HPBA 3MR0A 4HHDA 3AGEA 1PRQA 2MJ6A 4KENB 5F82A 1GA9A 3DBAA 3HCYA 1K25A 5EE8A 5DJTA 4DJ2A 2Y2LA 2P9VA 4NK3A 2ACGA 3ZG7B 3VP4A 4HP4A 5A8BA 3C7UA 3A3EA 3LEQA 2W3EA 1W8YA 4QY5A 4DE1A 5FI6A 1JTDA 3VP1A 5FQ9A 2J3WA 4MCWA 4QD4A 2VK3A 4FOFA 2GNXA 1XGJA 5J4EA 4MN5A 3H82A 2Y91A 5AQBA 3VP2A 3LIDA 3IH8A 5BOHA 1ES3A 1LL9A 1NZUA 5I94A 1XJ6A 4R3BA 4DMZA 2M1CA 5LBRA 3WRTA 1BZAA 3HLWA 3QNBA 3DTKA 3T1XA 1GHMA 2BG1A 4GDNA 3ZYTA 3O3VA 3P09A 4GHIA 2UWXA 2ZC4B 1XPBA 3FYZA 1VEUA 2PU2A 4ZAMA 3V3RA 2PAVP 4OVDA 2RL3A 4GB7A 5HWWA 4F3LB 3JYIA 3LR4A 2M7VA 1YLZA 3MMHA 1OTBA 1ES2A 4R38A 2A3UA 2ZQCA 3G31A 1K4EA 5HFOA 1NYMA 2H0TA 3EOIA 4NXFA 1FR1A 1BSGA 1STZA 2DNSA 4BD0A 4Y0TA 3LR5A 4UA9A 3V67A 3FG8A 2JKTM 3G6OA 4NXEA 3G34A 5DFXA 4BLMA 4Y5FA 3TRCA 2PT7A 5EM0A 2Y2IA 3TG9A 3UDIA 5CX7A 3ZDJA 5DF9A 4OPRA 2HDQA 1YLYA 2O0YA 2D02A 3LGOA 4KQOA 3O88A 4I38A 1PZPA 2JKRI 4HBUA 3RTYA 4DE3A 1KE3A 2V0WA 1FSYA 4HH2A 2WGWB 2Y2MA 5EVIC 2VX8A 4O0PA 4Y7PA 3V3SA 5CERA 5I5LA 1HD8A 1XP4A 4WN5A 3BQAA 4MMNA 4UHUA 2V0UA 2ZOHA 1YLPA 2WAFA 4R4RA 3HLCA 4H6JA 4OOMA 3OCNA 3NOTC 4JKTA 5M19A 5FDHA 2Y2HA 3GV9A 4P6BA 5GLDA 4FD8A 2HJEA 3K3DA 3UMDA 4ZTKA 4DXCA 3KYQA 2ZQAA 4HNBA 5EOEA 4EV4A 1G68A 3F1NA 4OPYA 3VOZA 1JWVA 3IXBA 4BJPA 3PBSA 1PYYA 5EVLA 1ES4A 5HWVA 2JE5A 1LSWA 2H5SA 1UWPX 2INWA 4X56A 5HPIA 5JYOA 5FI2A 3D4FA 5HDCA 1CQAA 3MKEA 3K2NA 2J3TD 4OOLA 3FZCA 2QZ6A 2X02A 3FPWA 4JGQA 1KVMA 1RGZA 2H0YA 2HGVA 4FCFA 1P9WA 3S7PA 4CPKA 2I72A 1GSWA 5FEFA 3N6IA 1PZOA 3O86A 3VE3A 1JTGA 4GD6A 2Y2GA 5FQMA 4I5SA 2Y2JA 4Y2FA 4EEUA 3MQOA 3ZVTA 2O9AA 3MFDA 5F69A 2Y55A 4PPRA 3Q82A 3IXGA 5FEGA 1EW0A 3M2JA 5CHUA 1A0KA 3KO6A 4PKYA 5CTMA 4ETXA 4C3QA 1VHMA 3KYEA 3L9KA 1P97A 4Y0OA 1WYCA 3B47A 2Z6DA 3VFFA 5HL1A 1GHIA 1YKDA 2WADA 4O8GA 2A49A 3E2LA 3LICA 4K08A 4PAUA 5TR7A 2IWCA 2JBFA 4EBNA 4HH3A 1XXMA 2WKRA 2Q0OA 1NYYA 1IEMA 3CZDA 3NECA 4DE2A 3S4XA 3H9WA 1YLTA 4I39A 2ZJ9A 3JPUA 3A0RA 1XA1A 5HD3A 4EETB 2C5WB 4JXGA 1VEUB 4YFMA 2C6WB 3HJKA 1LI9A 1S67L 1IYSA 1OTDA 4GOGA 3BFFA 1M40A 3A3JA 3MFXA 5J8XA 1W7FA 3SOIA 1H5XA 3IBJA 1I2WA 3IWQA 3H82B 2HZ5A 3PXPA 2JKRM 5CEDA 3KX0X 3GQZA 4Q0HA 2Y2NA 4GJ4A 4NEED 1XJ2A 1BLHA 2WUQA 3DAVA 1F98A 4R0QA 3QP5A 4XT2A 3IWIA 4EEPA 3IHBA 3VE4A 1TF1A 4HBTA 3NDEA 2XK1A 4OKPA 4EERA 2Q9MA 3VV4A 5HD5A 4EBPA 5TBMA 1HTZA 4QY6A 4OQHA 3BM6A 5FQKA 4HJ3A 1K6RA 4LFUA 2O99A 3QP1A 3BFEA 3W4OA 3OPLA 2ZD8A 2OSUA 4N1HA 4YOFA 3F1PB 2BTFP 3QHYA 2R9WA 4Z1WA 2YKFA 4X25A 4OLDA 3SS5A 1V9YA 2V8CA 3F1PA 3MBZA 4B4XA 2HDUA 5GHYA 3V5MA 4OPZA 3N8SA 5EFWA 2PHYA 5KZHA 4IEDA 4S2NA 1PWGA 1L0DA 3MZDA 3PBNA 1I2SA 5EV0A 4X6TA 3LFVA 5L2FA 5EPHA 1RGYA 5DTKA 3EEHA 1J9MA 4QJGA 1MPLA 3C8CA 2W3HA 2XR0A 3F1NB 2XSSA 1H3QA 3MXQA 3C4PA 3ITAA 5E2GA 1S6RA 3G32A 2DCFA 3C4OA 1Q2QA 4WYYA 1T1BA 1OJ5A 1SKOA 1JVJA 4I3JA 2EX8A 3BY9A 3H7WB 3BLMA 3GMWA 1DY6A 4LCLA 1N9BA 3PBQA 1XJ4A 1ZG6A 5L09A 3UE1A 2O9BA 2J8YA 4IBXA 2ZQ9A 1S0WA 2ZC6B 1OPXA 5HPFA 2B5RA 2QHKA 3CWFA 1BUEA 3S7NA 3KSFA 1H8MA 3PAGA 3ZHHA 3O5YA 3A0VA 3UPOA 2QJ7A 2ZM8A 3N7WA 4DF6A 1YLJA 1ZTUA 3UE3A 3CUEA 5TFQA 1MWUA 2ZQDA 3A0SA 2L0WA 1OT6A 2OV5A 2P74A 2V1ZA 2BASA 2Y79A 4E3MA 4C75A 4OQGA 4JGPA 3IT9A 4XXRA 5GHZA 1LSXA 1QMFA 1PI4A 4ZDXA 3EEAA 1T1AA 3T4OA 4R70A 4CJNA 3NDGA 3ZG5A 2VGLS 4S2JA 2Q9NA 1FIKA 3GRJA 4EU0A 5DJUA 4IJGA 3BJNA 1IYPA 4LCMA 3BYDA 3UPNA 3A3FA 3HLGA 4WM9A 1L0EA 2QJ5A 2Z2LB 4BWIA 1AXBA 3E4PA 3GSGA 2EXAA 1YT4A 5E43A 3F1OB 3QP4A 3UE0A 3W4QA 4FH2A 2PYPA 1JNUA 1K57C 2ZQ7A 5HARA 3OPPA 1FOFA 4HJ6A 3CLOA 1YSPA 4OQIA 3NC8A 1OMEA 3SH9A 1Y54A 1KE0A 4ARZA 3SS4A 5FSRA 1DJBA 2FFYA 3TJZC 2JKTI 1P0ZA 1IOUA 3Q7ZA 3D3OA 3MQ0A 4P6ZS 1MKMA 1MY8A 1J3WA 4RYEA 5MC7A 1N9OA 4P6ZM 3BFGA 1GSVA 1CEFA 3BRMA 3CPTA 4EQ1A 4RA7A 4WUJA 3M6BA 2PBYA 2HJ9C 2ZMVA 4FUWA 1E3UD 1S1ZA 3ISGA 3ULFA 3HLBA 2HP5A 4MBHA 4PM6A 1W8QA 1YAXA 4E3OA 2IA2A 3LI8A 2VGJA 3M6HA 3VP0A 3G30A 1ZG4A 1MKIA 3VMAA 1T1CA 3HVFA 2PR5A 1FCOA 3Q07A 4GN2A 2J3TC 3LYXA 3S22A 5IT5A 1K56D 2R9XA 1DP6A 4E3NA 3ZG9B 1K57A 1CEGA 3E4OA 3G2YA 2VV6A 4II7A 4WL9A 1PW1A 1NZOA 3C5AA 2O9CA 5DF8A 2W3DA 5CHJA 4ME4A 1MWRA 4H6JB 1LL5A 3CUEC 1XX2A 3CAXA 1F9IA 5FQIA 4KQQA 3W2ZA 3MXRA 1SKFA 1YPRA 3PTEA 4Q8IA 1O7EA 3LY3A 4QB8A 3VSLA 3IHAA 3JVVA 4K91A 5E2EA 4EWFA 1JWPA 3UNWA 4IUKA 2QWSA 1Q2PA 2P08A 3QP6A 1DJAA 3Q7VB 3RXXA 2OLUA 3CHWP 2JHEA 4B93A 3DTMA 3GDIA 2Z2MB 1FILA 3IX4A 3IQAA 4L9GA 3ZG0A 2PR6A 1SZVA 3UMEA 3Q7VA 4XUXA 2HP9A 2KDKA 5CGXA 2WKPA 4MBKA 3RFBA 5M18A 3NIAA 4Y15A 1LSVA 4JF5A 3Q81A 5CGWA 4BD1A 1YMXA 5KMWA 4U0XA 3WS1A 2Z6CA 4HP9A 1BT5A 2XA7M 2P04A 5EVIB 1W79A 1TS8A 4F3LA 3T1QB 1F2KA 1HVBA 2XH9A 1SCWA 3RXWA 3R7WB 3UB7A 1YMSA 3QP8A 2OAP1 2G2UA 4G3WA 3IS2A 2QPNA 2WKIA 2Y2OA 4JGRA 3MJQA 1NLYA 5HWTA 3ZNTA 3WS0A 1T19A 3WRZA 1PWCA 4HOIA 4JXWA 3T50A 1K6SA 4QPRA 4AFIA 3ZFZA 3P98A 3LIFA 4CLCA 1VB6A 4DE0A 5J3WA 5AQAA 4EESA 3I7JA 1IKGA 2VJWA 4BBTA 3CPTB 1FQGA 2GZAA 4Z9QA 1DRMA 1QMEA 1MXOA 2P9VB 4HJ4A 3NBLA 3LIAA 2ZOIA 3NY4A 5IHVA 3B42A 3G4PA 3LR3A 1CK3A 5KIZA 3KSGA 3SS3A 5KSCA 3KYZA 4CQHA 3W8KA 2PRFA 4YNRA 4OLGA 4RX3A 3S7OA 4F94A 5HDSA 4Y13A 1W5DA 4B4ZA 2Y4AA 1LL8A 1XGIA 4ETZA 5DKLA 4H8RA 5EOOA 4KZ3A 1K0KA 4R1GA 2L4RA 3EGDC 3PBRA 3T1RA 3S7QA 5F83A 1H0MA 4YWZA 3VOYA 3IF6B 3UPPA 1Y28A 3OPRA 1YLWA 3HBRA 1K54C 3T12B 1L2SA 4UQIM 3ZVWA 3BWLA 2W3GA 3FPVA 3CI6A 1CJFA 1GHPA 4FTXA 1TD5A 3U4LP 5AQ9A 3VFHA 4E3IA 3Q1FA 5EVIA 4IVIA 4IVKA 4PMAA 3HLEA 1FR6A 2G7UA 4B9OA 1PFLA 3EQVA 2VGKA 4JGOA 3N4IA 1TS7A 4PM8A 4MEZA 2XA7S 2WK0A 4S2IA 1TS6A 3GECA 3HLDA 3DW0A 4I3AA 4GCZA 3LIBA 5A93A 1XFNA 5DTTA 3VSKA 4N92A 5HAPA 4IHQA 3TE8A 4GD8A 1KDSA 5DTSA 1O07A 4IBRA 4KQDA 4MN7A 3D9YA 2EX9A 1NY0A 1S66L 4R3JA 2X71A 3P01A 4DXBA 4MBFA 3OC2A 4GLQA 4RX2A 5HAQA 2V1AA 4FSFA 5F6AA 1ES5A 3NULA 3VP3A 2ZMFA 1H8ZA 5J7EA 5HDDA 1L3LA 1N4OA 3U2AA 5C5KA 2A2LA 4WBGA 4OP5A 1U60A 3TOIA 4PHTA 3UB6A 2CC1A 3C30A 4EUZA 2ZC5B 4WZ5C 4U3TA 3G2ZA 2QKPA 2XEPA 3L7HA 3V39A 4GW9A 2G2WA 4JF4A 4KZ4A 4JXVA 3T1SA 4JBFA 3LO7A 2OOLA 4P0MA 2B18A 3T4KA 1Z6FA 3VOLA 3S1YA 5FA7A 2WZZA 3T4LA 3A3DA 4WZ5A 5E2FA 1E3UA 1SKOB 3OOVA 4PM7A 4OQ0A 4KZ7A 3W4PA 5HZHA 1T18A 3KSHA 4FH4A 4WLAA 4YINA 4E3LA 3NOPC 3M2KA 4GKUA 3T4QA 4CLCE 4EQIA 5KSHA 2VZWA 1ZHHB 4NETA 2W1TB 5EVEA 3DTIA 4NXBA 2W1RA 5G4ZA 3SH7A 5DKKA 3MS6A 4ID4A 1MWTA 3CG5A 5AVFA 1HZOA 1OTIA 1G6OA 2E8IA 1CF0A 4GS9A 3IXHA 4X53A 4B88A 3UDFA 4XUZA 1AWIA 3PAEA 2JCHA 4KZ5A 4M4XA 3LEZA 1I5QA 2EWWA 4WF0A 4ZJ2A 4S2PA 2KX6A 1SDNA 5L8MA 4KG5A 2OWHA 1K56A 2HP6A 4X68A 1KGEA 2FH5A 4QU3A 1BLSA 1NRFA 1BLPA 1G6AA 3WWXA 2H28A 4Q0IA 4KZ8A 5TBMB 3HUNA 3E0YA 4HY8A 1IYQA 4RQ9A 4HESA 2X01A 2W3FA 1UWNX 1F5MA 5DF7A 5CECA 4L0LA 4OOYA 1KE4A 1ESUA 3G35A 1PIOA 1YQSA 3GVBA 3N8RA 4S2NC 1E4DA 1W63M 1IKIA 4O01A 4JXSA 2LB5A 3CITA 1MBLA 1DP9A 3BLSA 2H10A 2B95A 1D06A 3C38A 1FCMA 4LV3A 2V2FF 1E25A 3UB9A 2ZC3B 3UB8A 2XD1A 3UE6A 4UAAA 2A24B 4PKYG 2HF6A 3HREA 2WGVA 2D01A 4Y0UA 5FAQA 2P7JA 2HV1A 4LGWA 4KZBA 1RP5A 2Y2PA 3IWOA 2WKHA 4R3AA 4WMCD 3ZG8B 3JVUA 3TSGA 1HLUP 4S2MA 4QHCA 4K0XA 3IF6A 5HL6A 1G5UA 4BENA 4M3KA 4ESPA 2WGWA 2RCXA 2W1TA 5GLAA 2EXBA 1LI0A 3NHQA 3BQ8A 4I3IA 2OAQ1 1PNEA 1D7EA 5JYPA 5FAPA 4PM5A 3IH9A 1H8YA 4HIAA 4LRXC 5A92A 3PBOA 1FSWA 1MWSA 1RCJA 2IWDA 3K3CA 5A91A 3UY6A 4O7DA 2PYRA 4G3KA 3MZFA 1XKZA 2EA9A 5GHXA 4P87A 1VETB 2EWVA 1N9NA 1PI5A 4N1XA 2XFTA 4MLLA 4PM9A 4ARZB 4KUKA 3MF0A 2PBDP 3QP2A 3E4QA 2JKGA 2Y8HA 2HDSA 1TDLA 4ZJ1A 2XLNA 3FKVA 1BLCA 1BTLA 2V9AA 4DKIA 1WE4A 2K31A 2CMNA 4JPMA 4MNRA 4K0WA 4U0TA 2ZMAA 4LV2A 3IS2B 1GCEA 2OWJA 4S2LA 1KGFA 1ERMA 4A5RA 2EX2A 1KVLA 2YKHA 2Y2QA 2E8JA 1ACFA 1KGGA 1VQQA 4DDYA 2PDRA 2EFUA 3T4TA 5F1FA 3GR2A 4WMCA 1DP8A 4NXGA 1P9RA 4WZ4A 3DWZA 3UB5P 4N9LA 4DDSA 1SDEA 1NWZA 3UDXA 1WA9A 3WS2A 3MSHA 2QMIA 1ODVA 3LY4A 3BEBA 3T4JA 5A90A 4GZBA 1TDGA 5EECA 2XDMA 2NUTC 2R78A 5HX9A 5E2HA 2B02A 4DN0A 2V1BA 3FC7A 2WKEA 1YSQA 3KSIA 3CMZA 2GX5A 3OCLA 3FV7A 3HL9A 5K5BA 1JWZA 2VV8A 1S4SA 2J80A 1VETA 4D60A 1BYWA 2EX6A 3IF5A 5CRFA 2XGNA 2GJ3A 1MC0A 4G3VA 1M6KA 4OPQA 4BL2A 3T4SA 4X69A 4OP8A 4R23A 2DRWA 3IXDA 4E6XA 3ITBA 1FCNA 5U47A 4Q0JA 4X55A 4E3JA 3IX8A 4GDBA 5CTNA 4UEYA 1DJCA 4LV0A 3RH8B 2J9OA 3LUQA 1NRJA 1EWZA 1K54A 2M7UA 3NCKA 1ZKJA 3PYPA 3E2KA 4C6YA 4CLCD 5AJGA 4IUHA 5GLCA 2J7VA 2PU4A 1KDWA 1GSXA 1K4FA 2OLVA 4E04A 4HEFA 2WKQA 4L9FA 4LPZA 2QYBA 3OZHA 1SHVA 3D72A 3C7VA 4R4SA 1PW8A 5HAIA 3SH8A 4LLOB 2JC7A 5FQJA 5FL3A 4DJ3A 3SZTA 2XROA 5FI7A 3O87A 2W0NA 1CI8A 5L10A 3NOUC 5GLBA 4OONA 3CJMA 4ZJ3A 3C2WA 4N9KA 4LV1A 2I9VA 3ZQ5A 3MQQA 3LIEA 3HUOA 3WS4A 2XF3A 1KOUA 2WZXA 1NXYA 4KQRA 2J9PA 2K2NA 4BL3A 4WELA 1OT9A 4CLCC 1OTAA 5TGFA 1K38A 5AVEA 5G4YA 1IELA 4S2KA 2VA0A 3TW8A 5FQQA 4P85A 5IU1A 1OTEA 4LRYC 3AGDA 1IFQA 2AVXA 4KZAA 1XJ3A 2PD7A 4XT2B 3P7NA 2V20A 1MZUA 4WEJA 2BLSA 3GTCA 1ESIA 3F1OA 2XD5A 5FDSA 2VLGA 5F5YA 5FATA 4KG6A 3EQUA 3ZNYA 5HSQA 2VKSA 3UO9A 5M1AA 4BBVA 2Y2KA 1LLBA 2XRNA 3BW6A 4WEKA 4X1MA 4CLCB 1VM1A 3WS5A 1XFQA 3IBRA 4RVAA 1WYBA 1LT0A 4ZBEA 1K55A 2FZ0A 1NJ4A 4DRTA 3FKWA 5CEBA 4EXOA 4BQMA 3OPHA 5HW3A 4HQAA 2KLIA 4BMWA 2ZL1A 4KUOA 3BECA 4EW7A 5DVAA 5EM1A 3R4KA 2ZLYA 3PBTA 1S4RA 3R7WA 3IF6C 2ZM0A 2PD8A 2W27A 1Z09A 1NLZA 5D3OA 5EUAA 2FFFB 2GDNA 4JLFA 1ERQA 2KOIA 1Y4OA 3LR0A 4E3KA 4Y3IA 2Y59A 2EFXA 1ZC2A 3HLFA 1YM1A 4LRZE 3HUMA 3EGXC 4HI4A 4KZ9A 4UA6A 1LHYA 4KG2A 2WYXA 4MDZA 1UGUA 3FWLA 2VGLM 4GNUA 2K7SA 3A3IA 3MZEA 4BBUA 2V8FA 3BFCA 4NKPA 3OBFA 2A24A 5FAOA 2VEAA 4NG2A 4UA7A 4Y17A 5IS1A 4KZ6A 3B33A 1TS0A 3HJIA 4D2OA 4LENA 3IX3A 2ZQ8A 3RJUA 2ZC7A 3UN7A 1L0GA 1IYOA 3NJAA 1K55C 3E98A 3V50A 2ZM2A 5DFYA 3H7WA 1GA0A 1CI9A 5CHMA
chains in the Genus database with same CATH topology
1W63Q 4L9GA 4UQIS 3SW1A 1S1YA 2PR6A 5TJJA 3JVUA 3UMEA 3PHYA 2L1MA 2DMWA 2KDKA 5HL6A 3MFXA 4ZRRA 2WKPA 3RFBA 2ZBBA 3PR6A 3OLOA 1LSVA 2VV7A 2W1TA 3EWKA 1N9LA 3NHQA 3BQ8A 4I3IA 2OAQ1 3IBJA 4R6LA 4MN6A 1D7EA 3LI9A 3H82B 3BY8A 1G28A 3PXPA 2JKRM 3KX0X 4HIAA 3ICYA 4LRXC 3PBOA 2Z6CA 4HP9A 4Q0HA 1V9ZA 2JN7A 2XA7M 2P04A 4GJ4A 4NEED 1XJ2A 3K3CA 1TS8A 4F3LA 2PYRA 4G3KA 1OJGA 1F98A 4L9EA 4XT2A 2EA9A 1X0OA 4EUVA 4EEPA 3R7WB 3VE4A 1TF1A 3UB7A 2EWVA 1N9NA 4EERA 3VV4A 5HD5A 2LB9A 5F68A 2OAP1 5TBMA 4GHIB 4ARZB 4G3WA 4KUKA 3MF0A 4GS9B 3IS2A 4HJ3A 3E4QA 4JGRA 3MJQA 2NUPC 2Y8HA 2O99A 1NLYA 5HWTA 3MR0A 1T19A 4HHDA 4HOIA 2MJ6A 3T50A 2V9AA 3DBAA 3HCYA 2K31A 2CMNA 4QPRA 4AFIA 3IS2B 5DJTA 4DJ2A 4YOFA 3LIFA 3F1PB 4CLCA 2OWJA 1VB6A 4Z1WA 2YKFA 5J3WA 4EESA 4HP4A 2VJWA 5A8BA 2YKHA 4BBTA 1V9YA 2GZAA 2W3EA 1DRMA 2PDRA 3F1PA 3T4TA 4HJ4A 3LIAA 2ZOIA 1DP8A 3B42A 5EFWA 4NXGA 1P9RA 3LR3A 2PHYA 5KIZA 3KSGA 2J3WA 3KYZA 4MCWA 4CQHA 4YNRA 4FOFA 2GNXA 1NWZA 3S7OA 1WA9A 3PBNA 5HDSA 5J4EA 3LFVA 4MN5A 3H82A 1LL8A 1ODVA 4ETZA 3EEHA 3LIDA 5DKLA 1XJ6A 4DMZA 2M1CA 5LBRA 3C8CA 2W3HA 3T4JA 3F1NB 2XSSA 1H3QA 3MXQA 2L4RA 2NUTC 2R78A 3EGDC 3PBRA 3S7QA 4YWZA 2B02A 1Y28A 1T1BA 4DN0A 1OJ5A 2V1BA 3FC7A 3ZYTA 1YSQA 3KSIA 4GHIA 4I3JA 2GX5A 3OCLA 3BY9A 3H7WB 4UQIM 3PBQA 5K5BA 1XJ4A 3BWLA 2W3GA 2VV8A 1S4SA 2J80A 3CI6A 2O9BA 3FPVA 1BYWA 1TD5A 2GJ3A 1MC0A 5HWWA 1OPXA 4F3LB 2M7VA 3LR4A 4G3VA 5HPFA 3T4SA 2QHKA 3CWFA 3MMHA 1OTBA 3S7NA 4R38A 3KSFA 2G7UA 4B9OA 1H8MA 3O5YA 3EQVA 3A0VA 4JGOA 1TS7A 2XA7S 4Q0JA 1TS6A 2QJ7A 3EOIA 3GECA 1ZTUA 4I3AA 3UE3A 3CUEA 4NXFA 4GCZA 3LIBA 1STZA 1XFNA 4UEYA 3LR5A 4IHQA 3A0SA 3V67A 2L0WA 1OT6A 3RH8B 3FG8A 2JKTM 3TE8A 3LUQA 4KQDA 3G6OA 1NRJA 4MN7A 4NXEA 2BASA 2Y79A 5DFXA 1S66L 4Y5FA 3P01A 3TRCA 2M7UA 3OC2A 2PT7A 4JGPA 3PYPA 4GLQA 4CLCD 5AJGA 2V1AA 4FSFA 4IUHA 1LSXA 5CX7A 5DF9A 5F6AA 2O0YA 2D02A 2ZMFA 4KQOA 3EEAA 1GSXA 5J7EA 5HDDA 4I38A 1T1AA 3U2AA 5C5KA 4E04A 3T4OA 4R70A 2A2LA 2WKQA 4L9FA 2JKRI 4PHTA 3UB6A 4LPZA 2VGLS 2QYBA 3RTYA 3D72A 3C30A 4EU0A 5DJUA 4IJGA 3BJNA 2QKPA 4LLOB 5FL3A 2V0WA 4DJ3A 4GW9A 4HH2A 2XROA 2W0NA 2VX8A 4O0PA 2OOLA 3NOUC 2B18A 3T4KA 3VOLA 5I5LA 3C2WA 4WN5A 3BQAA 4MMNA 2I9VA 3ZQ5A 3MQQA 3LIEA 2V0UA 2ZOHA 3T4LA 2QJ5A 4BWIA 4H6JA 3E4PA 1KOUA 4OOMA 3OCNA 3F1OB 3NOTC 3OOVA 2K2NA 4WELA 1OT9A 5HZHA 2PYPA 1JNUA 4CLCC 2HJEA 1T18A 1OTAA 3K3DA 3KSHA 3UMDA 4WLAA 3KYQA 4HJ6A 5AVEA 5G4YA 3NOPC 3CLOA 4HNBA 2VA0A 1YSPA 3F1NA 3TW8A 3T4QA 4CLCE 4ARZA 5KSHA 4BJPA 3PBSA 2VZWA 5IU1A 1ZHHB 3TJZC 1OTEA 5HWVA 2W1TB 4LRYC 2JKTI 1IFQA 1P0ZA 1LSWA 1IOUA 1XJ3A 1UWPX 2INWA 2PD7A 4NXBA 2W1RA 5G4ZA 5HPIA 3D3OA 5DKKA 3MQ0A 4XT2B 3P7NA 4P6ZS 5AVFA 1MZUA 4WEJA 1MKMA 1OTIA 5HDCA 1G6OA 3F1OA 4GS9A 2VLGA 3K2NA 5MC7A 2J3TD 5F5YA 1N9OA 4OOLA 4P6ZM 1GSVA 3EQUA 5HSQA 4M4XA 3FPWA 4EQ1A 4WUJA 4JGQA 2VKSA 4BBVA 2HJ9C 2HGVA 2ZMVA 2EWWA 4WF0A 2XRNA 1S1ZA 1P9WA 3BW6A 4WEKA 3ULFA 4CLCB 3S7PA 2KX6A 1XFQA 3IBRA 5L8MA 1GSWA 2OWHA 1LT0A 1YAXA 2IA2A 3LI8A 3VE3A 2FZ0A 4I5SA 2FH5A 4Y2FA 4EEUA 3MQOA 4EXOA 1T1CA 2O9AA 2H28A 4HQAA 2KLIA 4BMWA 2PR5A 4Q0IA 4KUOA 4EW7A 5F69A 2J3TC 3LYXA 5TBMB 5IT5A 3E0YA 4HY8A 4RQ9A 1EW0A 3R4KA 3KO6A 1DP6A 2W3FA 1UWNX 3PBTA 4PKYA 1F5MA 1S4RA 4L0LA 3E4OA 3R7WA 2VV6A 4II7A 1VHMA 4ETXA 4WL9A 2PD8A 2W27A 1P97A 3B47A 2Z6DA 1NLZA 2O9CA 2W3DA 1YKDA 2KOIA 3LR0A 4ME4A 1W63M 4H6JB 4O8GA 4Y3IA 3LICA 3CUEC 4K08A 4LRZE 4O01A 2LB5A 3EGXC 4PAUA 3CITA 4HI4A 4HH3A 1DP9A 2WKRA 3CAXA 1D06A 4MDZA 3C38A 1UGUA 2VGLM 1F9IA 3W2ZA 2K7SA 4BBUA 3UB9A 4NKPA 3OBFA 3UB8A 3JVVA 2A24A 3H9WA 2VEAA 3UE6A 5IS1A 4I39A 3B33A 2A24B 1TS0A 3HJIA 4IUKA 4PKYG 3A0RA 2QWSA 2HF6A 2P08A 2D01A 5HD3A 4EETB 2P7JA 2HV1A 3NJAA 3E98A 3HJKA 1S67L 2JHEA 4B93A 5DFYA 3H7WA 1OTDA 3GDIA 4R3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKS A;  4GLQ A;  5TJJ A;  5AJG A;  2HGV A;  3KSG A;  4IUH A;  2XRN A;  4MCW A;  5HL6 A;  4CQH A;  4ZRR A;  4YNR A;  3S7P A;  4FOF A;  2O0Y A;  2ZMF A;  3RFB A;  3S7O A;  3EEA A;  3IBR A;  5L8M A;  5C5K A;  4E04 A;  4R70 A;  2W1T A;  2IA2 A;  3LFV A;  4ETZ A;  2QYB A;  3NHQ A;  4R6L A;  3IBJ A;  4EU0 A;  4DMZ A;  4IJG A;  4Y2F A;  3BJN A;  5LBR A;  2W3H A;  2O9A A;  4GW9 A;  2XRO A;  2XSS A;  2KLI A;  4LRX C;  4Q0I A;  4O0P A;  4Q0H A;  2OOL A;  3NOU C;  3S7Q A;  2B18 A;  3E0Y A;  4RQ9 A;  5I5L A;  3R4K A;  3C2W A;  3KO6 A;  2W3F A;  4MMN A;  4DN0 A;  4G3K A;  1F5M A;  5HSQ A;  3ZQ5 A;  4ETX A;  1VHM A;  1YSQ A;  3KSI A;  2GX5 A;  4EUV A;  4BWI A;  5K5B A;  2O9C A;  2W3G A;  1TF1 A;  2W3D A;  3NOT C;  3CI6 A;  3OOV A;  2O9B A;  2K2N A;  1YKD A;  2KOI A;  3VV4 A;  2LB9 A;  4ME4 A;  4O8G A;  1TD5 A;  4Y3I A;  3KSH A;  4LRZ E;  4O01 A;  4G3W A;  2LB5 A;  4PAU A;  1MC0 A;  3CIT A;  3MF0 A;  3NOP C;  4MDZ A;  1YSP A;  2M7V A;  5HPF A;  4G3V A;  3W2Z A;  3MMH A;  2Y8H A;  2O99 A;  3S7N A;  2VZW A;  3KSF A;  2G7U A;  3OBF A;  2VEA A;  3O5Y A;  2W1T B;  4LRY C;  3DBA A;  3HCY A;  2K31 A;  4QPR A;  4Q0J A;  4YOF A;  2W1R A;  5HPI A;  3D3O A;  4IUK A;  3MQ0 A;  1ZTU A;  4Z1W A;  1MKM A;  1STZ A;  2VJW A;  3K2N A;  3E98 A;  2W3E A;  3G6O A;  4MN7 A;  2Y79 A;  5DFY A;  5DFX A;  4Y5F A;  3TRC A;  2M7U A; 
#chains in the Genus database with same CATH topology
 1W63 Q;  4UQI S;  1ONH A;  1XA7 A;  1S1Y A;  3SW1 A;  5TJJ A;  4EBL A;  3PHY A;  2L1M A;  2DMW A;  5FAS A;  5AQ7 A;  4ZRR A;  3N8L A;  5F1G A;  2ZBB A;  3PR6 A;  3OLO A;  3QNC A;  4OH0 A;  2IWB A;  2VV7 A;  5GL9 A;  2HDR A;  3EWK A;  5CXW A;  1N9L A;  4E6W A;  1TEM A;  4R6L A;  5EVI D;  1BUL A;  4MN6 A;  3LI9 A;  3BY8 A;  1G28 A;  3NI9 A;  3ICY A;  5CGS A;  3MKF A;  3AGF A;  1V9Z A;  2JN7 A;  1EI5 A;  1L0F A;  1PWD A;  3MXS A;  3DWK A;  1ERO A;  4JF6 A;  4QWO A;  1OJG A;  3DTE A;  5G18 A;  4L9E A;  3B3X A;  1X0O A;  4EUV A;  2XQZ A;  1TVF A;  3ZGA B;  5L07 A;  2XFS A;  4S2O A;  4X1L A;  2UV0 E;  1C3B A;  2LB9 A;  5F68 A;  4GHI B;  1D1J A;  2ZL1 B;  4GS9 B;  2WAE A;  2WGI A;  3LCE A;  2NUP C;  3ZCZ A;  2JKF A;  1ALQ A;  3BFD A;  1ONG A;  2HPB A;  3MR0 A;  4HHD A;  3AGE A;  1PRQ A;  2MJ6 A;  4KEN B;  5F82 A;  1GA9 A;  3DBA A;  3HCY A;  1K25 A;  5EE8 A;  5DJT A;  4DJ2 A;  2Y2L A;  2P9V A;  4NK3 A;  2ACG A;  3ZG7 B;  3VP4 A;  4HP4 A;  5A8B A;  3C7U A;  3A3E A;  3LEQ A;  2W3E A;  1W8Y A;  4QY5 A;  4DE1 A;  5FI6 A;  1JTD A;  3VP1 A;  5FQ9 A;  2J3W A;  4MCW A;  4QD4 A;  2VK3 A;  4FOF A;  2GNX A;  1XGJ A;  5J4E A;  4MN5 A;  3H82 A;  2Y91 A;  5AQB A;  3VP2 A;  3LID A;  3IH8 A;  5BOH A;  1ES3 A;  1LL9 A;  1NZU A;  5I94 A;  1XJ6 A;  4R3B A;  4DMZ A;  2M1C A;  5LBR A;  3WRT A;  1BZA A;  3HLW A;  3QNB A;  3DTK A;  3T1X A;  1GHM A;  2BG1 A;  4GDN A;  3ZYT A;  3O3V A;  3P09 A;  4GHI A;  2UWX A;  2ZC4 B;  1XPB A;  3FYZ A;  1VEU A;  2PU2 A;  4ZAM A;  3V3R A;  2PAV P;  4OVD A;  2RL3 A;  4GB7 A;  5HWW A;  4F3L B;  3JYI A;  3LR4 A;  2M7V A;  1YLZ A;  3MMH A;  1OTB A;  1ES2 A;  4R38 A;  2A3U A;  2ZQC A;  3G31 A;  1K4E A;  5HFO A;  1NYM A;  2H0T A;  3EOI A;  4NXF A;  1FR1 A;  1BSG A;  1STZ A;  2DNS A;  4BD0 A;  4Y0T A;  3LR5 A;  4UA9 A;  3V67 A;  3FG8 A;  2JKT M;  3G6O A;  4NXE A;  3G34 A;  5DFX A;  4BLM A;  4Y5F A;  3TRC A;  2PT7 A;  5EM0 A;  2Y2I A;  3TG9 A;  3UDI A;  5CX7 A;  3ZDJ A;  5DF9 A;  4OPR A;  2HDQ A;  1YLY A;  2O0Y A;  2D02 A;  3LGO A;  4KQO A;  3O88 A;  4I38 A;  1PZP A;  2JKR I;  4HBU A;  3RTY A;  4DE3 A;  1KE3 A;  2V0W A;  1FSY A;  4HH2 A;  2WGW B;  2Y2M A;  5EVI C;  2VX8 A;  4O0P A;  4Y7P A;  3V3S A;  5CER A;  5I5L A;  1HD8 A;  1XP4 A;  4WN5 A;  3BQA A;  4MMN A;  4UHU A;  2V0U A;  2ZOH A;  1YLP A;  2WAF A;  4R4R A;  3HLC A;  4H6J A;  4OOM A;  3OCN A;  3NOT C;  4JKT A;  5M19 A;  5FDH A;  2Y2H A;  3GV9 A;  4P6B A;  5GLD A;  4FD8 A;  2HJE A;  3K3D A;  3UMD A;  4ZTK A;  4DXC A;  3KYQ A;  2ZQA A;  4HNB A;  5EOE A;  4EV4 A;  1G68 A;  3F1N A;  4OPY A;  3VOZ A;  1JWV A;  3IXB A;  4BJP A;  3PBS A;  1PYY A;  5EVL A;  1ES4 A;  5HWV A;  2JE5 A;  1LSW A;  2H5S A;  1UWP X;  2INW A;  4X56 A;  5HPI A;  5JYO A;  5FI2 A;  3D4F A;  5HDC A;  1CQA A;  3MKE A;  3K2N A;  2J3T D;  4OOL A;  3FZC A;  2QZ6 A;  2X02 A;  3FPW A;  4JGQ A;  1KVM A;  1RGZ A;  2H0Y A;  2HGV A;  4FCF A;  1P9W A;  3S7P A;  4CPK A;  2I72 A;  1GSW A;  5FEF A;  3N6I A;  1PZO A;  3O86 A;  3VE3 A;  1JTG A;  4GD6 A;  2Y2G A;  5FQM A;  4I5S A;  2Y2J A;  4Y2F A;  4EEU A;  3MQO A;  3ZVT A;  2O9A A;  3MFD A;  5F69 A;  2Y55 A;  4PPR A;  3Q82 A;  3IXG A;  5FEG A;  1EW0 A;  3M2J A;  5CHU A;  1A0K A;  3KO6 A;  4PKY A;  5CTM A;  4ETX A;  4C3Q A;  1VHM A;  3KYE A;  3L9K A;  1P97 A;  4Y0O A;  1WYC A;  3B47 A;  2Z6D A;  3VFF A;  5HL1 A;  1GHI A;  1YKD A;  2WAD A;  4O8G A;  2A49 A;  3E2L A;  3LIC A;  4K08 A;  4PAU A;  5TR7 A;  2IWC A;  2JBF A;  4EBN A;  4HH3 A;  1XXM A;  2WKR A;  2Q0O A;  1NYY A;  1IEM A;  3CZD A;  3NEC A;  4DE2 A;  3S4X A;  3H9W A;  1YLT A;  4I39 A;  2ZJ9 A;  3JPU A;  3A0R A;  1XA1 A;  5HD3 A;  4EET B;  2C5W B;  4JXG A;  1VEU B;  4YFM A;  2C6W B;  3HJK A;  1LI9 A;  1S67 L;  1IYS A;  1OTD A;  4GOG A;  3BFF A;  1M40 A;  3A3J A;  3MFX A;  5J8X A;  1W7F A;  3SOI A;  1H5X A;  3IBJ A;  1I2W A;  3IWQ A;  3H82 B;  2HZ5 A;  3PXP A;  2JKR M;  5CED A;  3KX0 X;  3GQZ A;  4Q0H A;  2Y2N A;  4GJ4 A;  4NEE D;  1XJ2 A;  1BLH A;  2WUQ A;  3DAV A;  1F98 A;  4R0Q A;  3QP5 A;  4XT2 A;  3IWI A;  4EEP A;  3IHB A;  3VE4 A;  1TF1 A;  4HBT A;  3NDE A;  2XK1 A;  4OKP A;  4EER A;  2Q9M A;  3VV4 A;  5HD5 A;  4EBP A;  5TBM A;  1HTZ A;  4QY6 A;  4OQH A;  3BM6 A;  5FQK A;  4HJ3 A;  1K6R A;  4LFU A;  2O99 A;  3QP1 A;  3BFE A;  3W4O A;  3OPL A;  2ZD8 A;  2OSU A;  4N1H A;  4YOF A;  3F1P B;  2BTF P;  3QHY A;  2R9W A;  4Z1W A;  2YKF A;  4X25 A;  4OLD A;  3SS5 A;  1V9Y A;  2V8C A;  3F1P A;  3MBZ A;  4B4X A;  2HDU A;  5GHY A;  3V5M A;  4OPZ A;  3N8S A;  5EFW A;  2PHY A;  5KZH A;  4IED A;  4S2N A;  1PWG A;  1L0D A;  3MZD A;  3PBN A;  1I2S A;  5EV0 A;  4X6T A;  3LFV A;  5L2F A;  5EPH A;  1RGY A;  5DTK A;  3EEH A;  1J9M A;  4QJG A;  1MPL A;  3C8C A;  2W3H A;  2XR0 A;  3F1N B;  2XSS A;  1H3Q A;  3MXQ A;  3C4P A;  3ITA A;  5E2G A;  1S6R A;  3G32 A;  2DCF A;  3C4O A;  1Q2Q A;  4WYY A;  1T1B A;  1OJ5 A;  1SKO A;  1JVJ A;  4I3J A;  2EX8 A;  3BY9 A;  3H7W B;  3BLM A;  3GMW A;  1DY6 A;  4LCL A;  1N9B A;  3PBQ A;  1XJ4 A;  1ZG6 A;  5L09 A;  3UE1 A;  2O9B A;  2J8Y A;  4IBX A;  2ZQ9 A;  1S0W A;  2ZC6 B;  1OPX A;  5HPF A;  2B5R A;  2QHK A;  3CWF A;  1BUE A;  3S7N A;  3KSF A;  1H8M A;  3PAG A;  3ZHH A;  3O5Y A;  3A0V A;  3UPO A;  2QJ7 A;  2ZM8 A;  3N7W A;  4DF6 A;  1YLJ A;  1ZTU A;  3UE3 A;  3CUE A;  5TFQ A;  1MWU A;  2ZQD A;  3A0S A;  2L0W A;  1OT6 A;  2OV5 A;  2P74 A;  2V1Z A;  2BAS A;  2Y79 A;  4E3M A;  4C75 A;  4OQG A;  4JGP A;  3IT9 A;  4XXR A;  5GHZ A;  1LSX A;  1QMF A;  1PI4 A;  4ZDX A;  3EEA A;  1T1A A;  3T4O A;  4R70 A;  4CJN A;  3NDG A;  3ZG5 A;  2VGL S;  4S2J A;  2Q9N A;  1FIK A;  3GRJ A;  4EU0 A;  5DJU A;  4IJG A;  3BJN A;  1IYP A;  4LCM A;  3BYD A;  3UPN A;  3A3F A;  3HLG A;  4WM9 A;  1L0E A;  2QJ5 A;  2Z2L B;  4BWI A;  1AXB A;  3E4P A;  3GSG A;  2EXA A;  1YT4 A;  5E43 A;  3F1O B;  3QP4 A;  3UE0 A;  3W4Q A;  4FH2 A;  2PYP A;  1JNU A;  1K57 C;  2ZQ7 A;  5HAR A;  3OPP A;  1FOF A;  4HJ6 A;  3CLO A;  1YSP A;  4OQI A;  3NC8 A;  1OME A;  3SH9 A;  1Y54 A;  1KE0 A;  4ARZ A;  3SS4 A;  5FSR A;  1DJB A;  2FFY A;  3TJZ C;  2JKT I;  1P0Z A;  1IOU A;  3Q7Z A;  3D3O A;  3MQ0 A;  4P6Z S;  1MKM A;  1MY8 A;  1J3W A;  4RYE A;  5MC7 A;  1N9O A;  4P6Z M;  3BFG A;  1GSV A;  1CEF A;  3BRM A;  3CPT A;  4EQ1 A;  4RA7 A;  4WUJ A;  3M6B A;  2PBY A;  2HJ9 C;  2ZMV A;  4FUW A;  1E3U D;  1S1Z A;  3ISG A;  3ULF A;  3HLB A;  2HP5 A;  4MBH A;  4PM6 A;  1W8Q A;  1YAX A;  4E3O A;  2IA2 A;  3LI8 A;  2VGJ A;  3M6H A;  3VP0 A;  3G30 A;  1ZG4 A;  1MKI A;  3VMA A;  1T1C A;  3HVF A;  2PR5 A;  1FCO A;  3Q07 A;  4GN2 A;  2J3T C;  3LYX A;  3S22 A;  5IT5 A;  1K56 D;  2R9X A;  1DP6 A;  4E3N A;  3ZG9 B;  1K57 A;  1CEG A;  3E4O A;  3G2Y A;  2VV6 A;  4II7 A;  4WL9 A;  1PW1 A;  1NZO A;  3C5A A;  2O9C A;  5DF8 A;  2W3D A;  5CHJ A;  4ME4 A;  1MWR A;  4H6J B;  1LL5 A;  3CUE C;  1XX2 A;  3CAX A;  1F9I A;  5FQI A;  4KQQ A;  3W2Z A;  3MXR A;  1SKF A;  1YPR A;  3PTE A;  4Q8I A;  1O7E A;  3LY3 A;  4QB8 A;  3VSL A;  3IHA A;  3JVV A;  4K91 A;  5E2E A;  4EWF A;  1JWP A;  3UNW A;  4IUK A;  2QWS A;  1Q2P A;  2P08 A;  3QP6 A;  1DJA A;  3Q7V B;  3RXX A;  2OLU A;  3CHW P;  2JHE A;  4B93 A;  3DTM A;  3GDI A;  2Z2M B;  1FIL A;  3IX4 A;  3IQA A;  4L9G A;  3ZG0 A;  2PR6 A;  1SZV A;  3UME A;  3Q7V A;  4XUX A;  2HP9 A;  2KDK A;  5CGX A;  2WKP A;  4MBK A;  3RFB A;  5M18 A;  3NIA A;  4Y15 A;  1LSV A;  4JF5 A;  3Q81 A;  5CGW A;  4BD1 A;  1YMX A;  5KMW A;  4U0X A;  3WS1 A;  2Z6C A;  4HP9 A;  1BT5 A;  2XA7 M;  2P04 A;  5EVI B;  1W79 A;  1TS8 A;  4F3L A;  3T1Q B;  1F2K A;  1HVB A;  2XH9 A;  1SCW A;  3RXW A;  3R7W B;  3UB7 A;  1YMS A;  3QP8 A;  2OAP 1;  2G2U A;  4G3W A;  3IS2 A;  2QPN A;  2WKI A;  2Y2O A;  4JGR A;  3MJQ A;  1NLY A;  5HWT A;  3ZNT A;  3WS0 A;  1T19 A;  3WRZ A;  1PWC A;  4HOI A;  4JXW A;  3T50 A;  1K6S A;  4QPR A;  4AFI A;  3ZFZ A;  3P98 A;  3LIF A;  4CLC A;  1VB6 A;  4DE0 A;  5J3W A;  5AQA A;  4EES A;  3I7J A;  1IKG A;  2VJW A;  4BBT A;  3CPT B;  1FQG A;  2GZA A;  4Z9Q A;  1DRM A;  1QME A;  1MXO A;  2P9V B;  4HJ4 A;  3NBL A;  3LIA A;  2ZOI A;  3NY4 A;  5IHV A;  3B42 A;  3G4P A;  3LR3 A;  1CK3 A;  5KIZ A;  3KSG A;  3SS3 A;  5KSC A;  3KYZ A;  4CQH A;  3W8K A;  2PRF A;  4YNR A;  4OLG A;  4RX3 A;  3S7O A;  4F94 A;  5HDS A;  4Y13 A;  1W5D A;  4B4Z A;  2Y4A A;  1LL8 A;  1XGI A;  4ETZ A;  5DKL A;  4H8R A;  5EOO A;  4KZ3 A;  1K0K A;  4R1G A;  2L4R A;  3EGD C;  3PBR A;  3T1R A;  3S7Q A;  5F83 A;  1H0M A;  4YWZ A;  3VOY A;  3IF6 B;  3UPP A;  1Y28 A;  3OPR A;  1YLW A;  3HBR A;  1K54 C;  3T12 B;  1L2S A;  4UQI M;  3ZVW A;  3BWL A;  2W3G A;  3FPV A;  3CI6 A;  1CJF A;  1GHP A;  4FTX A;  1TD5 A;  3U4L P;  5AQ9 A;  3VFH A;  4E3I A;  3Q1F A;  5EVI A;  4IVI A;  4IVK A;  4PMA A;  3HLE A;  1FR6 A;  2G7U A;  4B9O A;  1PFL A;  3EQV A;  2VGK A;  4JGO A;  3N4I A;  1TS7 A;  4PM8 A;  4MEZ A;  2XA7 S;  2WK0 A;  4S2I A;  1TS6 A;  3GEC A;  3HLD A;  3DW0 A;  4I3A A;  4GCZ A;  3LIB A;  5A93 A;  1XFN A;  5DTT A;  3VSK A;  4N92 A;  5HAP A;  4IHQ A;  3TE8 A;  4GD8 A;  1KDS A;  5DTS A;  1O07 A;  4IBR A;  4KQD A;  4MN7 A;  3D9Y A;  2EX9 A;  1NY0 A;  1S66 L;  4R3J A;  2X71 A;  3P01 A;  4DXB A;  4MBF A;  3OC2 A;  4GLQ A;  4RX2 A;  5HAQ A;  2V1A A;  4FSF A;  5F6A A;  1ES5 A;  3NUL A;  3VP3 A;  2ZMF A;  1H8Z A;  5J7E A;  5HDD A;  1L3L A;  1N4O A;  3U2A A;  5C5K A;  2A2L A;  4WBG A;  4OP5 A;  1U60 A;  3TOI A;  4PHT A;  3UB6 A;  2CC1 A;  3C30 A;  4EUZ A;  2ZC5 B;  4WZ5 C;  4U3T A;  3G2Z A;  2QKP A;  2XEP A;  3L7H A;  3V39 A;  4GW9 A;  2G2W A;  4JF4 A;  4KZ4 A;  4JXV A;  3T1S A;  4JBF A;  3LO7 A;  2OOL A;  4P0M A;  2B18 A;  3T4K A;  1Z6F A;  3VOL A;  3S1Y A;  5FA7 A;  2WZZ A;  3T4L A;  3A3D A;  4WZ5 A;  5E2F A;  1E3U A;  1SKO B;  3OOV A;  4PM7 A;  4OQ0 A;  4KZ7 A;  3W4P A;  5HZH A;  1T18 A;  3KSH A;  4FH4 A;  4WLA A;  4YIN A;  4E3L A;  3NOP C;  3M2K A;  4GKU A;  3T4Q A;  4CLC E;  4EQI A;  5KSH A;  2VZW A;  1ZHH B;  4NET A;  2W1T B;  5EVE A;  3DTI A;  4NXB A;  2W1R A;  5G4Z A;  3SH7 A;  5DKK A;  3MS6 A;  4ID4 A;  1MWT A;  3CG5 A;  5AVF A;  1HZO A;  1OTI A;  1G6O A;  2E8I A;  1CF0 A;  4GS9 A;  3IXH A;  4X53 A;  4B88 A;  3UDF A;  4XUZ A;  1AWI A;  3PAE A;  2JCH A;  4KZ5 A;  4M4X A;  3LEZ A;  1I5Q A;  2EWW A;  4WF0 A;  4ZJ2 A;  4S2P A;  2KX6 A;  1SDN A;  5L8M A;  4KG5 A;  2OWH A;  1K56 A;  2HP6 A;  4X68 A;  1KGE A;  2FH5 A;  4QU3 A;  1BLS A;  1NRF A;  1BLP A;  1G6A A;  3WWX A;  2H28 A;  4Q0I A;  4KZ8 A;  5TBM B;  3HUN A;  3E0Y A;  4HY8 A;  1IYQ A;  4RQ9 A;  4HES A;  2X01 A;  2W3F A;  1UWN X;  1F5M A;  5DF7 A;  5CEC A;  4L0L A;  4OOY A;  1KE4 A;  1ESU A;  3G35 A;  1PIO A;  1YQS A;  3GVB A;  3N8R A;  4S2N C;  1E4D A;  1W63 M;  1IKI A;  4O01 A;  4JXS A;  2LB5 A;  3CIT A;  1MBL A;  1DP9 A;  3BLS A;  2H10 A;  2B95 A;  1D06 A;  3C38 A;  1FCM A;  4LV3 A;  2V2F F;  1E25 A;  3UB9 A;  2ZC3 B;  3UB8 A;  2XD1 A;  3UE6 A;  4UAA A;  2A24 B;  4PKY G;  2HF6 A;  3HRE A;  2WGV A;  2D01 A;  4Y0U A;  5FAQ A;  2P7J A;  2HV1 A;  4LGW A;  4KZB A;  1RP5 A;  2Y2P A;  3IWO A;  2WKH A;  4R3A A;  4WMC D;  3ZG8 B;  3JVU A;  3TSG A;  1HLU P;  4S2M A;  4QHC A;  4K0X A;  3IF6 A;  5HL6 A;  1G5U A;  4BEN A;  4M3K A;  4ESP A;  2WGW A;  2RCX A;  2W1T A;  5GLA A;  2EXB A;  1LI0 A;  3NHQ A;  3BQ8 A;  4I3I A;  2OAQ 1;  1PNE A;  1D7E A;  5JYP A;  5FAP A;  4PM5 A;  3IH9 A;  1H8Y A;  4HIA A;  4LRX C;  5A92 A;  3PBO A;  1FSW A;  1MWS A;  1RCJ A;  2IWD A;  3K3C A;  5A91 A;  3UY6 A;  4O7D A;  2PYR A;  4G3K A;  3MZF A;  1XKZ A;  2EA9 A;  5GHX A;  4P87 A;  1VET B;  2EWV A;  1N9N A;  1PI5 A;  4N1X A;  2XFT A;  4MLL A;  4PM9 A;  4ARZ B;  4KUK A;  3MF0 A;  2PBD P;  3QP2 A;  3E4Q A;  2JKG A;  2Y8H A;  2HDS A;  1TDL A;  4ZJ1 A;  2XLN A;  3FKV A;  1BLC A;  1BTL A;  2V9A A;  4DKI A;  1WE4 A;  2K31 A;  2CMN A;  4JPM A;  4MNR A;  4K0W A;  4U0T A;  2ZMA A;  4LV2 A;  3IS2 B;  1GCE A;  2OWJ A;  4S2L A;  1KGF A;  1ERM A;  4A5R A;  2EX2 A;  1KVL A;  2YKH A;  2Y2Q A;  2E8J A;  1ACF A;  1KGG A;  1VQQ A;  4DDY A;  2PDR A;  2EFU A;  3T4T A;  5F1F A;  3GR2 A;  4WMC A;  1DP8 A;  4NXG A;  1P9R A;  4WZ4 A;  3DWZ A;  3UB5 P;  4N9L A;  4DDS A;  1SDE A;  1NWZ A;  3UDX A;  1WA9 A;  3WS2 A;  3MSH A;  2QMI A;  1ODV A;  3LY4 A;  3BEB A;  3T4J A;  5A90 A;  4GZB A;  1TDG A;  5EEC A;  2XDM A;  2NUT C;  2R78 A;  5HX9 A;  5E2H A;  2B02 A;  4DN0 A;  2V1B A;  3FC7 A;  2WKE A;  1YSQ A;  3KSI A;  3CMZ A;  2GX5 A;  3OCL A;  3FV7 A;  3HL9 A;  5K5B A;  1JWZ A;  2VV8 A;  1S4S A;  2J80 A;  1VET A;  4D60 A;  1BYW A;  2EX6 A;  3IF5 A;  5CRF A;  2XGN A;  2GJ3 A;  1MC0 A;  4G3V A;  1M6K A;  4OPQ A;  4BL2 A;  3T4S A;  4X69 A;  4OP8 A;  4R23 A;  2DRW A;  3IXD A;  4E6X A;  3ITB A;  1FCN A;  5U47 A;  4Q0J A;  4X55 A;  4E3J A;  3IX8 A;  4GDB A;  5CTN A;  4UEY A;  1DJC A;  4LV0 A;  3RH8 B;  2J9O A;  3LUQ A;  1NRJ A;  1EWZ A;  1K54 A;  2M7U A;  3NCK A;  1ZKJ A;  3PYP A;  3E2K A;  4C6Y A;  4CLC D;  5AJG A;  4IUH A;  5GLC A;  2J7V A;  2PU4 A;  1KDW A;  1GSX A;  1K4F A;  2OLV A;  4E04 A;  4HEF A;  2WKQ A;  4L9F A;  4LPZ A;  2QYB A;  3OZH A;  1SHV A;  3D72 A;  3C7V A;  4R4S A;  1PW8 A;  5HAI A;  3SH8 A;  4LLO B;  2JC7 A;  5FQJ A;  5FL3 A;  4DJ3 A;  3SZT A;  2XRO A;  5FI7 A;  3O87 A;  2W0N A;  1CI8 A;  5L10 A;  3NOU C;  5GLB A;  4OON A;  3CJM A;  4ZJ3 A;  3C2W A;  4N9K A;  4LV1 A;  2I9V A;  3ZQ5 A;  3MQQ A;  3LIE A;  3HUO A;  3WS4 A;  2XF3 A;  1KOU A;  2WZX A;  1NXY A;  4KQR A;  2J9P A;  2K2N A;  4BL3 A;  4WEL A;  1OT9 A;  4CLC C;  1OTA A;  5TGF A;  1K38 A;  5AVE A;  5G4Y A;  1IEL A;  4S2K A;  2VA0 A;  3TW8 A;  5FQQ A;  4P85 A;  5IU1 A;  1OTE A;  4LRY C;  3AGD A;  1IFQ A;  2AVX A;  4KZA A;  1XJ3 A;  2PD7 A;  4XT2 B;  3P7N A;  2V20 A;  1MZU A;  4WEJ A;  2BLS A;  3GTC A;  1ESI A;  3F1O A;  2XD5 A;  5FDS A;  2VLG A;  5F5Y A;  5FAT A;  4KG6 A;  3EQU A;  3ZNY A;  5HSQ A;  2VKS A;  3UO9 A;  5M1A A;  4BBV A;  2Y2K A;  1LLB A;  2XRN A;  3BW6 A;  4WEK A;  4X1M A;  4CLC B;  1VM1 A;  3WS5 A;  1XFQ A;  3IBR A;  4RVA A;  1WYB A;  1LT0 A;  4ZBE A;  1K55 A;  2FZ0 A;  1NJ4 A;  4DRT A;  3FKW A;  5CEB A;  4EXO A;  4BQM A;  3OPH A;  5HW3 A;  4HQA A;  2KLI A;  4BMW A;  2ZL1 A;  4KUO A;  3BEC A;  4EW7 A;  5DVA A;  5EM1 A;  3R4K A;  2ZLY A;  3PBT A;  1S4R A;  3R7W A;  3IF6 C;  2ZM0 A;  2PD8 A;  2W27 A;  1Z09 A;  1NLZ A;  5D3O A;  5EUA A;  2FFF B;  2GDN A;  4JLF A;  1ERQ A;  2KOI A;  1Y4O A;  3LR0 A;  4E3K A;  4Y3I A;  2Y59 A;  2EFX A;  1ZC2 A;  3HLF A;  1YM1 A;  4LRZ E;  3HUM A;  3EGX C;  4HI4 A;  4KZ9 A;  4UA6 A;  1LHY A;  4KG2 A;  2WYX A;  4MDZ A;  1UGU A;  3FWL A;  2VGL M;  4GNU A;  2K7S A;  3A3I A;  3MZE A;  4BBU A;  2V8F A;  3BFC A;  4NKP A;  3OBF A;  2A24 A;  5FAO A;  2VEA A;  4NG2 A;  4UA7 A;  4Y17 A;  5IS1 A;  4KZ6 A;  3B33 A;  1TS0 A;  3HJI A;  4D2O A;  4LEN A;  3IX3 A;  2ZQ8 A;  3RJU A;  2ZC7 A;  3UN7 A;  1L0G A;  1IYO A;  3NJA A;  1K55 C;  3E98 A;  3V50 A;  2ZM2 A;  5DFY A;  3H7W A;  1GA0 A;  1CI9 A;  5CHM A; 
#chains in the Genus database with same CATH homology
 1W63 Q;  4L9G A;  4UQI S;  3SW1 A;  1S1Y A;  2PR6 A;  5TJJ A;  3JVU A;  3UME A;  3PHY A;  2L1M A;  2DMW A;  2KDK A;  5HL6 A;  3MFX A;  4ZRR A;  2WKP A;  3RFB A;  2ZBB A;  3PR6 A;  3OLO A;  1LSV A;  2VV7 A;  2W1T A;  3EWK A;  1N9L A;  3NHQ A;  3BQ8 A;  4I3I A;  2OAQ 1;  3IBJ A;  4R6L A;  4MN6 A;  1D7E A;  3LI9 A;  3H82 B;  3BY8 A;  1G28 A;  3PXP A;  2JKR M;  3KX0 X;  4HIA A;  3ICY A;  4LRX C;  3PBO A;  2Z6C A;  4HP9 A;  4Q0H A;  1V9Z A;  2JN7 A;  2XA7 M;  2P04 A;  4GJ4 A;  4NEE D;  1XJ2 A;  3K3C A;  1TS8 A;  4F3L A;  2PYR A;  4G3K A;  1OJG A;  1F98 A;  4L9E A;  4XT2 A;  2EA9 A;  1X0O A;  4EUV A;  4EEP A;  3R7W B;  3VE4 A;  1TF1 A;  3UB7 A;  2EWV A;  1N9N A;  4EER A;  3VV4 A;  5HD5 A;  2LB9 A;  5F68 A;  2OAP 1;  5TBM A;  4GHI B;  4ARZ B;  4G3W A;  4KUK A;  3MF0 A;  4GS9 B;  3IS2 A;  4HJ3 A;  3E4Q A;  4JGR A;  3MJQ A;  2NUP C;  2Y8H A;  2O99 A;  1NLY A;  5HWT A;  3MR0 A;  1T19 A;  4HHD A;  4HOI A;  2MJ6 A;  3T50 A;  2V9A A;  3DBA A;  3HCY A;  2K31 A;  2CMN A;  4QPR A;  4AFI A;  3IS2 B;  5DJT A;  4DJ2 A;  4YOF A;  3LIF A;  3F1P B;  4CLC A;  2OWJ A;  1VB6 A;  4Z1W A;  2YKF A;  5J3W A;  4EES A;  4HP4 A;  2VJW A;  5A8B A;  2YKH A;  4BBT A;  1V9Y A;  2GZA A;  2W3E A;  1DRM A;  2PDR A;  3F1P A;  3T4T A;  4HJ4 A;  3LIA A;  2ZOI A;  1DP8 A;  3B42 A;  5EFW A;  4NXG A;  1P9R A;  3LR3 A;  2PHY A;  5KIZ A;  3KSG A;  2J3W A;  3KYZ A;  4MCW A;  4CQH A;  4YNR A;  4FOF A;  2GNX A;  1NWZ A;  3S7O A;  1WA9 A;  3PBN A;  5HDS A;  5J4E A;  3LFV A;  4MN5 A;  3H82 A;  1LL8 A;  1ODV A;  4ETZ A;  3EEH A;  3LID A;  5DKL A;  1XJ6 A;  4DMZ A;  2M1C A;  5LBR A;  3C8C A;  2W3H A;  3T4J A;  3F1N B;  2XSS A;  1H3Q A;  3MXQ A;  2L4R A;  2NUT C;  2R78 A;  3EGD C;  3PBR A;  3S7Q A;  4YWZ A;  2B02 A;  1Y28 A;  1T1B A;  4DN0 A;  1OJ5 A;  2V1B A;  3FC7 A;  3ZYT A;  1YSQ A;  3KSI A;  4GHI A;  4I3J A;  2GX5 A;  3OCL A;  3BY9 A;  3H7W B;  4UQI M;  3PBQ A;  5K5B A;  1XJ4 A;  3BWL A;  2W3G A;  2VV8 A;  1S4S A;  2J80 A;  3CI6 A;  2O9B A;  3FPV A;  1BYW A;  1TD5 A;  2GJ3 A;  1MC0 A;  5HWW A;  1OPX A;  4F3L B;  2M7V A;  3LR4 A;  4G3V A;  5HPF A;  3T4S A;  2QHK A;  3CWF A;  3MMH A;  1OTB A;  3S7N A;  4R38 A;  3KSF A;  2G7U A;  4B9O A;  1H8M A;  3O5Y A;  3EQV A;  3A0V A;  4JGO A;  1TS7 A;  2XA7 S;  4Q0J A;  1TS6 A;  2QJ7 A;  3EOI A;  3GEC A;  1ZTU A;  4I3A A;  3UE3 A;  3CUE A;  4NXF A;  4GCZ A;  3LIB A;  1STZ A;  1XFN A;  4UEY A;  3LR5 A;  4IHQ A;  3A0S A;  3V67 A;  2L0W A;  1OT6 A;  3RH8 B;  3FG8 A;  2JKT M;  3TE8 A;  3LUQ A;  4KQD A;  3G6O A;  1NRJ A;  4MN7 A;  4NXE A;  2BAS A;  2Y79 A;  5DFX A;  1S66 L;  4Y5F A;  3P01 A;  3TRC A;  2M7U A;  3OC2 A;  2PT7 A;  4JGP A;  3PYP A;  4GLQ A;  4CLC D;  5AJG A;  2V1A A;  4FSF A;  4IUH A;  1LSX A;  5CX7 A;  5DF9 A;  5F6A A;  2O0Y A;  2D02 A;  2ZMF A;  4KQO A;  3EEA A;  1GSX A;  5J7E A;  5HDD A;  4I38 A;  1T1A A;  3U2A A;  5C5K A;  4E04 A;  3T4O A;  4R70 A;  2A2L A;  2WKQ A;  4L9F A;  2JKR I;  4PHT A;  3UB6 A;  4LPZ A;  2VGL S;  2QYB A;  3RTY A;  3D72 A;  3C30 A;  4EU0 A;  5DJU A;  4IJG A;  3BJN A;  2QKP A;  4LLO B;  5FL3 A;  2V0W A;  4DJ3 A;  4GW9 A;  4HH2 A;  2XRO A;  2W0N A;  2VX8 A;  4O0P A;  2OOL A;  3NOU C;  2B18 A;  3T4K A;  3VOL A;  5I5L A;  3C2W A;  4WN5 A;  3BQA A;  4MMN A;  2I9V A;  3ZQ5 A;  3MQQ A;  3LIE A;  2V0U A;  2ZOH A;  3T4L A;  2QJ5 A;  4BWI A;  4H6J A;  3E4P A;  1KOU A;  4OOM A;  3OCN A;  3F1O B;  3NOT C;  3OOV A;  2K2N A;  4WEL A;  1OT9 A;  5HZH A;  2PYP A;  1JNU A;  4CLC C;  2HJE A;  1T18 A;  1OTA A;  3K3D A;  3KSH A;  3UMD A;  4WLA A;  3KYQ A;  4HJ6 A;  5AVE A;  5G4Y A;  3NOP C;  3CLO A;  4HNB A;  2VA0 A;  1YSP A;  3F1N A;  3TW8 A;  3T4Q A;  4CLC E;  4ARZ A;  5KSH A;  4BJP A;  3PBS A;  2VZW A;  5IU1 A;  1ZHH B;  3TJZ C;  1OTE A;  5HWV A;  2W1T B;  4LRY C;  2JKT I;  1IFQ A;  1P0Z A;  1LSW A;  1IOU A;  1XJ3 A;  1UWP X;  2INW A;  2PD7 A;  4NXB A;  2W1R A;  5G4Z A;  5HPI A;  3D3O A;  5DKK A;  3MQ0 A;  4XT2 B;  3P7N A;  4P6Z S;  5AVF A;  1MZU A;  4WEJ A;  1MKM A;  1OTI A;  5HDC A;  1G6O A;  3F1O A;  4GS9 A;  2VLG A;  3K2N A;  5MC7 A;  2J3T D;  5F5Y A;  1N9O A;  4OOL A;  4P6Z M;  1GSV A;  3EQU A;  5HSQ A;  4M4X A;  3FPW A;  4EQ1 A;  4WUJ A;  4JGQ A;  2VKS A;  4BBV A;  2HJ9 C;  2HGV A;  2ZMV A;  2EWW A;  4WF0 A;  2XRN A;  1S1Z A;  1P9W A;  3BW6 A;  4WEK A;  3ULF A;  4CLC B;  3S7P A;  2KX6 A;  1XFQ A;  3IBR A;  5L8M A;  1GSW A;  2OWH A;  1LT0 A;  1YAX A;  2IA2 A;  3LI8 A;  3VE3 A;  2FZ0 A;  4I5S A;  2FH5 A;  4Y2F A;  4EEU A;  3MQO A;  4EXO A;  1T1C A;  2O9A A;  2H28 A;  4HQA A;  2KLI A;  4BMW A;  2PR5 A;  4Q0I A;  4KUO A;  4EW7 A;  5F69 A;  2J3T C;  3LYX A;  5TBM B;  5IT5 A;  3E0Y A;  4HY8 A;  4RQ9 A;  1EW0 A;  3R4K A;  3KO6 A;  1DP6 A;  2W3F A;  1UWN X;  3PBT A;  4PKY A;  1F5M A;  1S4R A;  4L0L A;  3E4O A;  3R7W A;  2VV6 A;  4II7 A;  1VHM A;  4ETX A;  4WL9 A;  2PD8 A;  2W27 A;  1P97 A;  3B47 A;  2Z6D A;  1NLZ A;  2O9C A;  2W3D A;  1YKD A;  2KOI A;  3LR0 A;  4ME4 A;  1W63 M;  4H6J B;  4O8G A;  4Y3I A;  3LIC A;  3CUE C;  4K08 A;  4LRZ E;  4O01 A;  2LB5 A;  3EGX C;  4PAU A;  3CIT A;  4HI4 A;  4HH3 A;  1DP9 A;  2WKR A;  3CAX A;  1D06 A;  4MDZ A;  3C38 A;  1UGU A;  2VGL M;  1F9I A;  3W2Z A;  2K7S A;  4BBU A;  3UB9 A;  4NKP A;  3OBF A;  3UB8 A;  3JVV A;  2A24 A;  3H9W A;  2VEA A;  3UE6 A;  5IS1 A;  4I39 A;  3B33 A;  2A24 B;  1TS0 A;  3HJI A;  4IUK A;  4PKY G;  3A0R A;  2QWS A;  2HF6 A;  2P08 A;  2D01 A;  5HD3 A;  4EET B;  2P7J A;  2HV1 A;  3NJA A;  3E98 A;  3HJK A;  1S67 L;  2JHE A;  4B93 A;  5DFY A;  3H7W A;  1OTD A;  3GDI A;  4R3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...