3KX0X

Crystal structure of the pas domain of rv1364c
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
135
structure length
127
Chain Sequence
EMDWDKTVGAAEDVRRIFEHIPAILVGLEGPDHRFVAVNAAYRGFSPLLDTVGQPAREVYPELEGQQIYEMLDRVYQTGEPQSGSEWRLQEERYFDFVVTPRRRADGSIEGVQLIVDDVTSRVRARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Uncharacterized protein Rv1364c/MT1410
publication title Role of a PAS sensor domain in the Mycobacterium tuberculosis transcription regulator Rv1364c
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 30
structure length 127
sequence length 135
ec nomenclature
pdb deposition date 2009-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF08448 PAS_4 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3kx0X00
2EA9A 2W0NA 5HDCA 5TBMA 5DKLA 3EWKA 3F1OA 1XJ4A 4HP9A 2QJ5A 2R78A 3NOPC 1DP9A 5HWTA 1S67L 3MFXA 2WKRA 1T18A 4NXGA 3OLOA 3BWLA 3ULFA 5HD3A 1XFNA 1T19A 1V9YA 4L9FA 1TS6A 2PYRA 4EERA 3LUQA 5A8BA 2VV6A 1S1ZA 3A0VA 3UMDA 4I3JA 4LRZE 3KX0X 4BBTA 2WKQA 2V0UA 5HZHA 1T1CA 4LRXC 4HP4A 5I5LA 1S1YA 2WKPA 3UB8A 4GS9B 3MQQA 4XT2B 1MZUA 3ZQ5A 4JGRA 4WN5A 1TS8A 4EETB 5IS1A 3BY8A 3MXQA 4JGQA 3LICA 1GSVA 3ICYA 2PD8A 5AVFA 2L4RA 4MN5A 4HI4A 4I39A 5J3WA 3IS2B 2A24A 4NXBA 1D06A 4NXEA 3H7WA 3F1PA 3C2WA 4JGPA 4R38A 3NHQA 3D72A 2ZBBA 3UB6A 2CMNA 4KUOA 5HWWA 3BY9A 5F68A 3UE6A 4I3AA 3CAXA 2M1CA 1DP6A 4BBVA 2V1BA 2PHYA 5HWVA 3E4PA 3K3CA 4EQ1A 1VB6A 4DJ2A 2OWJA 1XJ2A 4L9GA 4I5SA 2VEAA 2K7SA 2PYPA 1OTIA 3LIEA 1T1AA 1UGUA 4EESA 1ODVA 1N9NA 4LRYC 1S66L 4GW9A 4WL9A 3MQOA 3LIDA 3VOLA 2ZOIA 1S4SA 1LSXA 1LL8A 3VE4A 3A0SA 1LSWA 2INWA 5DJUA 1BYWA 1TS0A 5AVEA 2PR6A 2D01A 2W27A 3F1NA 1OT6A 3LI8A 2BASA 1X0OA 4R70A 1OJ5A 4HH3A 3H82B 1TS7A 2H28A 3MR0A 5DJTA 3C8CA 3UB9A 1DRMA 3K3DA 2PR5A 3GECA 5HDDA 4E04A 1GSWA 4H6JB 4WLAA 3UMEA 4EW7A 1OTAA 1G28A 1OT9A 1UWPX 1P0ZA 2JHEA 4JGOA 4EEUA 2YKFA 4HY8A 3MJQA 1JNUA 2L0WA 2B02A 4GHIB 5F5YA 2ZOHA 3H9WA 5J7EA 5EFWA 4PKYG 2I9VA 1XJ3A 5KIZA 5HDSA 5G4YA 4HIAA 3LI9A 1OTBA 4HQAA 4GS9A 5TBMB 4XT2A 4WF0A 3F1OB 1KOUA 2QJ7A 3EEHA 2PD7A 3P7NA 4RQ9A 1F98A 2D02A 3LIBA 3IS2A 3NOTC 4PKYA 3NJAA 1DP8A 3E4OA 2VV8A 4WUJA 2JN7A 4R3AA 4MN6A 1EW0A 1OTEA 4HJ6A 4I38A 2L1MA 4M4XA 1P97A 4LPZA 2V0WA 1Y28A 2VLGA 2KDKA 4I3IA 2OWHA 4EEPA 3RTYA 1GSXA 4HNBA 5HSQA 5G4ZA 5F6AA 2YKHA 4DJ3A 2GJ3A 4HOIA 2QKPA 4EXOA 5J4EA 4HJ3A 1UWNX 4B9OA 1OTDA 2A24B 2QWSA 2VV7A 3H7WB 2J80A 2HV1A 1NWZA 3F1PB 3FC7A 2V1AA 3LIFA 3NOUC 1T1BA 4YWZA 5DKKA 2OOLA 1D7EA 3PHYA 1N9OA 3IBRA 3RH8B 3GDIA 3G6OA 5IU1A 3SW1A 1WA9A 3A0RA 3T50A 4R6LA 1LSVA 4HHDA 1V9ZA 1F9IA 1LT0A 4F3LB 2QHKA 3VE3A 4K08A 3PYPA 4HH2A 4GCZA 5HD5A 3E4QA 3HJKA 1N9LA 2V9AA 4KQDA 1OJGA 1XFQA 3H82A 3CWFA 3CLOA 2PDRA 4HJ4A 4H6JA 2KX6A 3B33A 4L9EA 1S4RA 4F3LA 3LIAA 5F69A 4BBUA 3HJIA 1XJ6A 3LYXA 4KUKA 4LLOB 4NXFA 4GHIA 3FG8A 3F1NB 2Z6CA 3UB7A 2Z6DA 2P7JA
chains in the Genus database with same CATH superfamily
2HJ9C 2EA9A 4ESPA 1LI0A 2ZJ9A 1L0FA 2BG1A 5HDCA 5TBMA 4NKPA 3A3DA 1YLPA 2I72A 4S2PA 4ZJ3A 2H0TA 2R78A 3W4OA 1PWDA 2BTFP 3LO7A 4OLDA 1S67L 2WKRA 2IA2A 3NIAA 2M7UA 3EEAA 4WELA 2WUQA 4X55A 3ULFA 2OLUA 4CLCE 3NY4A 1T19A 1F5MA 2ZC7A 1TS6A 2VJWA 4MLLA 4EERA 3LUQA 3UE0A 2P9VB 5A8BA 2FH5A 1S1ZA 1XGIA 3A0VA 3S7QA 1A0KA 3MKFA 3T4QA 2VA0A 3QNBA 4LRZE 2W3DA 5M18A 3KX0X 3IH9A 5HARA 3SS3A 3Q7VB 4QWOA 2V0UA 2ZQ7A 1T1CA 3SZTA 2HDSA 1S1YA 3V67A 4BMWA 4GS9B 3MQQA 2M7VA 4WZ4A 5CERA 3FKVA 1EROA 2ZQCA 3IF6A 1GSVA 3QP5A 1H8ZA 4JXWA 3IS2B 2A24A 4OPYA 1IEMA 1S0WA 2OV5A 4R38A 3CZDA 4Y3IA 3HLFA 2O99A 3IHBA 5DF9A 3UB6A 4Q0JA 4KUOA 5AQ7A 1IELA 5F68A 4I3AA 4DDSA 1W7FA 1PI4A 1GHIA 2JKRI 4OOYA 4BBVA 3O3VA 4G3KA 4BLMA 3E4PA 4X6TA 4G3VA 4DE2A 2FFYA 5EVIB 1L0EA 5A93A 2WKHA 3LIEA 4EESA 1P9WA 3QP8A 4N92A 4LRYC 4B4ZA 1NJ4A 3N7WA 3HL9A 3LIDA 4NEED 3HLEA 3G2ZA 4JPMA 2PRFA 2UWXA 1OPXA 1S4SA 3WS2A 1W79A 3T1QB 3MF0A 1GA9A 2Y2LA 1PFLA 5AVEA 2PR6A 1YQSA 3K2NA 1ZTUA 2Y4AA 4EBNA 4IJGA 2PAVP 3I7JA 1CI8A 2WGWA 3T4LA 4S2NC 4FH4A 2RCXA 3NECA 1IYPA 2A49A 4U3TA 5GLBA 3W8KA 2QPNA 4FH2A 1MKIA 1MKMA 1J3WA 3NI9A 3H82B 1TVFA 4GKUA 5DJTA 2J7VA 1CEGA 2XEPA 3UN7A 4MBFA 3K3DA 3GECA 4E04A 4JBFA 4WLAA 3HLGA 5DFXA 2ZL1B 3G35A 1OTAA 4UA9A 4LV3A 3W2ZA 5EVID 1GCEA 5M19A 4JLFA 4E3NA 3BFCA 1WE4A 1NZOA 3VFHA 3T4SA 4MBKA 3BFGA 4GHIB 3VP4A 4K91A 4EWFA 5EFWA 4PKYG 1XJ3A 1XKZA 2ZQ9A 5KIZA 1TF1A 4FOFA 2WAFA 2R9WA 1IFQA 4II7A 3BLSA 5G4YA 2OAP1 4XT2A 3KYZA 3IH8A 4WEJA 3IX3A 1K6RA 3P7NA 4LGWA 1MWUA 1M6KA 2XQZA 4DF6A 4UA6A 3IF6C 3NOTC 2ACGA 1PWGA 4PMAA 4R3JA 3UPPA 4WUJA 2Y2QA 5FAQA 3C4PA 2XROA 3L7HA 4R3AA 4DE3A 1XGJA 4EQIA 1Y4OA 2EFXA 4M4XA 1FQGA 2DRWA 3MSHA 2JCHA 1ONGA 4RX3A 2P04A 3CHWP 3LCEA 4B4XA 3NDGA 5A92A 3KYQA 4WYYA 5HL1A 4D60A 2YKHA 2KOIA 3G34A 2HGVA 2QKPA 4EXOA 3P98A 4LFUA 3ZVTA 1YPRA 3RXXA 5J4EA 1NLZA 3LEQA 2Y2GA 1FILA 3R7WB 1YKDA 3IHAA 3QHYA 2NUPC 5CTMA 5KZHA 1NWZA 3F1PB 2GZAA 1L3LA 2V1AA 4KZAA 2WGIA 1T1BA 5CGWA 4R4SA 4Y0TA 1N9OA 3RH8B 3UDXA 5A91A 1WA9A 4U0TA 2EX8A 3RFBA 4R6LA 2O9AA 4HHDA 3S4XA 3G2YA 2QHKA 4A5RA 5FAPA 1KDWA 4HH2A 5CHUA 1Q2PA 5EVLA 2Y2KA 5FQIA 1LI9A 2QMIA 4KQDA 4O0PA 1OJGA 1LHYA 3T1SA 3SS5A 2WGVA 3M2JA 1L0GA 3CJMA 3IX4A 4H6JA 3KSHA 3NC8A 1TD5A 3BEBA 3DW0A 1CQAA 2VKSA 1XA7A 4N9LA 1KVLA 2W1TB 5D3OA 4BBUA 3HREA 5A90A 3HJIA 1XJ6A 4LV0A 4KZ9A 4OLGA 4ARZA 2B95A 1HD8A 4KUKA 1SKOA 4HBTA 2LB5A 3O87A 4IUKA 1QMFA 3A3EA 3UB5P 5DTKA 3UB7A 2P7JA 2VGLM 4QD4A 2W0NA 1W5DA 1XJ4A 1JTDA 5U47A 4KG5A 1GHMA 2VX8A 1RGYA 3S7NA 4Y5FA 3BM6A 2W1RA 4QB8A 4JF5A 1NYMA 3BFDA 3MFXA 1ERMA 1SKFA 4NXGA 2C5WB 1PRQA 3BWLA 1VETB 1V9YA 4L9FA 3HBRA 4CLCB 1ERQA 2Y2JA 2EX9A 5BOHA 5F82A 4X53A 2O0YA 2OAQ1 3G30A 4OOMA 2ZM0A 2K31A 4MMNA 4X25A 3BQAA 1YMXA 4P6BA 3OC2A 4E6WA 5KSCA 4ZAMA 4R1GA 5JYOA 3UB8A 2R9XA 4JGRA 3CITA 2G2UA 4MNRA 3T4JA 3MXQA 2XLNA 3ICYA 3HUOA 3A3FA 4FCFA 2JKGA 4MN5A 1E3UA 4I39A 1KE4A 4S2JA 5J3WA 5DF8A 4BWIA 3PAGA 3Q1FA 1D06A 1HTZA 4NXEA 1MWRA 4QU3A 3C2WA 3TW8A 3DTIA 3CUEA 5L09A 4GB7A 1BT5A 2LB9A 2ZBBA 4KZ3A 2CMNA 5HWWA 1CEFA 4FUWA 4Y0UA 2G7UA 1NXYA 3EQVA 2Y2OA 1JVJA 3C4OA 2VGLS 4KQQA 1YSPA 2HDUA 3T1XA 2V1BA 2PHYA 2XK1A 2FZ0A 1E3UD 1WYCA 1JWZA 2Y2IA 3K3CA 4EQ1A 1BULA 2Y2MA 3MXSA 4L9GA 2VEAA 2PYPA 4KZ8A 5F1GA 4JXVA 4B93A 1OTIA 4GD6A 1T1AA 4DE1A 1PZPA 4NK3A 4OVDA 2Y2HA 4GW9A 4GOGA 4Z9QA 3ZG5A 2ZOIA 3CMZA 1LL8A 3EQUA 4KG6A 2B18A 3BW6A 1G68A 3PAEA 3WS1A 3VE4A 3IF5A 5TJJA 3B47A 4OP8A 4E3JA 4QJGA 3A0SA 2ZQAA 1MXOA 2INWA 4WZ5A 5FL3A 1BYWA 1YM1A 2E8JA 1FR1A 3LR5A 2W27A 3F1NA 5EM0A 4DXCA 4Y13A 3BRMA 2BASA 2CC1A 3DWKA 3E98A 5DFYA 1X0OA 2H0YA 3VFFA 2GX5A 2Y91A 5AQ9A 3CPTB 4X56A 3ZHHA 4YFMA 4EBLA 2C6WB 5CXWA 3UNWA 1EWZA 3PBTA 4GLQA 1GSWA 4XUXA 4L0LA 1W63M 1UWPX 2XRNA 2ZQDA 4GDBA 3ZG7B 3VSKA 2P9VA 4EEUA 1JNUA 5EE8A 1I2WA 4GD8A 4KQOA 2HP5A 2ZLYA 2MJ6A 3MQ0A 5K5BA 5F5YA 5FDHA 3O88A 2I9VA 4DRTA 5HDSA 3VP2A 1IKIA 3Q7VA 1H0MA 4UA7A 4P87A 2WYXA 3CPTA 1FIKA 4HIAA 4GS9A 3CG5A 4WF0A 3F1OB 3FV7A 4E3IA 2QJ7A 2O9CA 1F98A 2D02A 3IS2A 4WBGA 3ITBA 3NJAA 3ZG8B 3JVUA 4KZ4A 1FCNA 4OPQA 3N8LA 4MN6A 1EW0A 4ZRRA 1JWPA 1OTEA 3CUEC 2GDNA 1KGFA 4I38A 3LR4A 5GHXA 1G6OA 2L1MA 1E4DA 1NRFA 4WMCA 5FI7A 1K4EA 1NY0A 1GHPA 2J9PA 1NYYA 5DVAA 2IWCA 5GLAA 1GSXA 4N1HA 1PNEA 3O86A 2AVXA 1WYBA 4PM9A 5F6AA 2WAEA 5EVIA 3WS0A 1MWSA 4DMZA 1K57A 2XFTA 2QYBA 3AGFA 2HPBA 4OPRA 4B9OA 3TSGA 5CGSA 5FEFA 3H7WB 3MXRA 3ZCZA 2HV1A 4WMCD 4EUZA 3U4LP 3NOUC 3PR6A 5DKKA 4GZBA 3PHYA 4FSFA 4S2MA 3G6OA 3SW1A 3T50A 2QZ6A 1LSVA 1V9ZA 3KSIA 4ZJ2A 3MBZA 4QPRA 4OP5A 3OCNA 3FPWA 4GCZA 2ZMVA 3A3JA 2EX6A 2A3UA 4AFIA 3BQ8A 3HJKA 2ZM2A 4BL3A 1N9LA 3MZFA 1XFQA 3P09A 3H82A 1YLJA 4UEYA 3CLOA 3T1RA 1BLSA 1O07A 1ES5A 2PDRA 5EVEA 3RXWA 4HJ4A 4YOFA 3N8SA 2PT7A 4DN0A 1VHMA 4CPKA 2ZL1A 2KX6A 3FKWA 4ZTKA 1YLZA 2X02A 1DJAA 3UO9A 1BTLA 1MBLA 2K2NA 5F69A 2J9OA 4E6XA 3UY6A 4KZBA 4P85A 4KZ7A 3WRTA 2H10A 4OQIA 1H5XA 4LLOB 4GHIA 2WZZA 3MS6A 1STZA 1LLBA 5F1FA 1BLPA 4OOLA 4JF4A 2Z6DA 3G32A 1BLHA 1YLTA 3KSGA 3LEZA 3EWKA 4F94A 5FQQA 3UPNA 3IWIA 2Q9NA 3NOPC 1K25A 1DP9A 5HWTA 5GLDA 5AJGA 2V8CA 3LY3A 2XR0A 1ES3A 2WKEA 3QP4A 5FQJA 1T18A 3OLOA 2JKTI 5HD3A 1XFNA 4HBUA 1KE3A 1K54A 2V8FA 1N9BA 5FAOA 2J3TD 3M2KA 4KQRA 2ZC3B 4R3BA 4X1LA 2EXBA 3V5MA 1HZOA 3S7OA 2H5SA 1ES2A 4BBTA 2KLIA 2WKQA 2Z2LB 5IT5A 4DKIA 5HZHA 1FR6A 5I5LA 1O7EA 2WKPA 3ZDJA 3ZQ5A 3CI6A 4WN5A 2XDMA 1QMEA 2X01A 4EETB 3QP1A 3WS5A 1F2KA 5IS1A 5EVIC 4JGQA 1ZG6A 3LICA 4E3LA 2PD8A 1PWCA 2L4RA 3WS4A 3GR2A 3R7WA 1SHVA 1K57C 1S6RA 3M6BA 3OCLA 4NXBA 3S1YA 2HDRA 5EPHA 2XA7M 3DWZA 3NCKA 4XUZA 4WM9A 4Q8IA 1YLYA 4UHUA 3F1PA 4JGPA 5J8XA 3NHQA 1RP5A 4ETZA 4JF6A 2PBDP 3NULA 2VZWA 3E2LA 3BY9A 4C3QA 1Q2QA 3PBSA 4OPZA 4KZ5A 3ZYTA 4E3OA 3CAXA 3UDFA 4ZBEA 1DP6A 5FDSA 3Q7ZA 1K38A 1ACFA 3C7VA 3IXDA 4Y7PA 4B88A 1VB6A 3GTCA 4DJ2A 3C5AA 1KGGA 3MMHA 2EFUA 2Y2PA 2K7SA 2OSUA 3ITAA 1AXBA 3HVFA 5KSHA 1UGUA 1PYYA 1ODVA 4IEDA 1S66L 3IXHA 4WL9A 1L0DA 3MQOA 4RA7A 3PBOA 4Q0IA 1LSXA 5EUAA 3GMWA 5L8MA 1IYSA 2W1TA 1LSWA 3G31A 4IHQA 3OBFA 3HLWA 1TS0A 3WRZA 4RVAA 3HLCA 4OQHA 2PBYA 4D2OA 4S2KA 2D01A 4MEZA 3VP1A 4PM8A 3LI8A 4X68A 2VGKA 4U0XA 1ZHHB 4ETXA 3D4FA 1FOFA 1VEUB 3G4PA 1OJ5A 4EUVA 3S7PA 3FWLA 4OQGA 2XA7S 1LL5A 1TS7A 2H28A 1YAXA 5TFQA 3MR0A 2HZ5A 3C8CA 3UB9A 4K0WA 2V1ZA 2PR5A 3LFVA 1YT4A 3LGOA 1YMSA 3TE8A 4BJPA 1VETA 1G28A 1OT9A 1SDEA 5GLCA 4CLCA 1P0ZA 2JHEA 1P9RA 4JGOA 1NZUA 4ZJ1A 2ZMAA 3PBNA 4PM6A 2E8IA 2YKFA 4X69A 2OLVA 1GA0A 1YLWA 3C38A 2JKTM 2ZQ8A 4C75A 3GSGA 1TDGA 3IX8A 4N9KA 5J7EA 4IVIA 4GJ4A 3GVBA 3KYEA 5EOEA 4LV2A 4HQAA 3DBAA 5TBMB 3OPHA 1MY8A 4ME4A 4OONA 1KOUA 3T4KA 4Y15A 1E25A 3NDEA 1Z09A 2PD7A 3MFDA 3R4KA 4CLCD 3UE1A 4JXSA 1IYOA 3BECA 5FA7A 5TGFA 3ZFZA 3LIBA 2JBFA 2J3WA 2WK0A 3KO6A 2DCFA 5DF7A 5CGXA 3VP0A 1DP8A 3V3SA 2VV8A 1C3BA 5FEGA 1K4FA 3QP6A 3P01A 3VOZA 4NG2A 5CTNA 1U60A 4R23A 5L07A 2V0WA 5E2EA 2VLGA 4C6YA 4O8GA 4MCWA 3L9KA 3RTYA 3Q07A 1CJFA 1NLYA 3EGDC 1MWTA 3HCYA 2HP6A 4HNBA 3QNCA 5HSQA 5G4ZA 5F83A 1IKGA 5IHVA 4DJ3A 5E2GA 3V50A 2ZM8A 2J8YA 4HOIA 2ZC4B 2UV0E 3DTEA 1CF0A 4HJ3A 5AQBA 3IF6B 3A3IA 3SH9A 3JPUA 1PW8A 2A24B 2VV7A 1FCMA 3D9YA 3C7UA 3FC7A 3W4QA 3LIFA 4DDYA 4YWZA 3OOVA 2OOLA 5CEBA 3IBRA 1PIOA 3GDIA 2XSSA 5EECA 3TRCA 5EM1A 1PI5A 2ZMFA 4G3WA 1K55A 3ZG9B 1FCOA 3VE3A 4KG2A 4Y17A 4K08A 1H8MA 3N6IA 3PYPA 4GNUA 2HF6A 1K56A 2ZC6B 3T4OA 3BJNA 5M1AA 4LCMA 4OQ0A 3FZCA 4KENB 4N1XA 2V9AA 2HDQA 3BFEA 1IYQA 5TR7A 3CWFA 2GNXA 5CEDA 5HPFA 1BSGA 3JVVA 3OPPA 2DNSA 4PAUA 1S4RA 3ZNTA 4CLCC 3LIAA 1RCJA 3GQZA 1DJBA 5HFOA 1K56D 2BLSA 1BUEA 3JYIA 4NXFA 1I2SA 3PXPA 5AQAA 4BD1A 2Z6CA 1LL9A 1LT0A 2WGWB 2V20A 4UQIM 1XX2A 1CK3A 2EX2A 5DKLA 2W3HA 3UPOA 3DAVA 3IQAA 5HAQA 3F1OA 2XGNA 4HP9A 4ID4A 2QJ5A 2Q9MA 2Q0OA 4Z1WA 3ZG0A 3GRJA 2IWDA 4R4RA 3UE3A 2XF3A 1MPLA 3GV9A 2P08A 4E3KA 3SOIA 2WKIA 4WEKA 3IWOA 1PW1A 2EWVA 4JKTA 3FPVA 3AGDA 1Y54A 2PYRA 2VV6A 3UMDA 3MKEA 4S2IA 4I3JA 3EGXC 4O01A 3MZDA 5FQ9A 4E3MA 2X71A 2Z2MB 2FFFB 2HP9A 4LCLA 3VP3A 3DTKA 4WZ5C 4LRXC 4HP4A 1K6SA 3BYDA 4XT2B 1MZUA 1TS8A 2Y8HA 4NETA 2EWWA 4CQHA 3VV4A 3BY8A 4RYEA 5AVFA 4HI4A 5DTSA 3OPLA 2Y2NA 3PTEA 3BFFA 3OPRA 3DTMA 1DY6A 5E2HA 3H7WA 2XH9A 3MZEA 3PBRA 1PZOA 4OKPA 2P74A 3D72A 2V2FF 4DXBA 4ZDXA 1I5QA 5G18A 4PM5A 3TJZC 3UE6A 4UQIS 1MC0A 2M1CA 2VK3A 1H3QA 1YSQA 1K55C 4M3KA 2DMWA 5E43A 5HWVA 3T12B 4IBRA 1ZKJA 4EBPA 2OWJA 5CX7A 1XJ2A 3SS4A 5FI2A 5CHJA 4I5SA 5CECA 3OZHA 1DJCA 3E0YA 3ZGAB 4O7DA 1N9NA 3Q81A 1SDNA 4YINA 5HAIA 1H8YA 2VGJA 1ES4A 3VOLA 3B42A 4S2OA 1IOUA 1N4OA 5FQKA 4BENA 3TOIA 4YNRA 1G6AA 5DJUA 4IBXA 4K0XA 2WADA 3TG9A 3VMAA 2ZC5B 1VM1A 1OT6A 3D3OA 1K0KA 4Y2FA 3EOIA 3NBLA 4H8RA 2JKRM 2XD1A 5HAPA 4R70A 4HESA 3ZVWA 4HH3A 1EI5A 3S22A 5GHZA 2O9BA 3HLBA 3C30A 1XPBA 1NRJA 3HUNA 4JXGA 1W8YA 1DRMA 3SH7A 5HDDA 2ZD8A 2W3EA 4P6ZM 4Y0OA 4H6JB 3QP2A 1ONHA 3UMEA 5HW3A 4EW7A 2PU2A 3M6HA 2WZXA 2XFSA 4HY8A 3MJQA 4UAAA 3N8RA 2Y55A 3FYZA 4ARZB 1ESIA 2L0WA 4PM7A 1SKOB 2B02A 4PPRA 4MBHA 1KE0A 2ZOHA 1VQQA 3H9WA 3V39A 5CHMA 5I94A 5HX9A 1FSWA 4R0QA 3IWQA 3W4PA 4GDNA 3HUMA 3LI9A 1OTBA 3KSFA 4MDZA 1G5UA 1KVMA 1XA1A 3EEHA 5C5KA 3LR3A 3BLMA 4RQ9A 3N4IA 1Z6FA 2XD5A 2JC7A 5FQMA 3VOYA 4BD0A 4PKYA 1W63Q 1AWIA 3V3RA 5HL6A 3E4OA 2JN7A 4DE0A 2EXAA 4RX2A 1XXMA 2W3FA 4KZ6A 1JTGA 5KMWA 1TEMA 4HJ6A 4GN2A 1HLUP 4BQMA 5EOOA 1P97A 4LPZA 1CI9A 1Y28A 2KDKA 4I3IA 2OWHA 1ALQA 4QHCA 1BLCA 4HEFA 4EEPA 4IVKA 2Y59A 4EV4A 1ESUA 3LY4A 2GJ3A 3IBJA 4LV1A 3IXGA 4P0MA 2G2WA 4P6ZS 1KDSA 3PBQA 1W8QA 2J3TC 1UWNX 5JYPA 1FSYA 3IT9A 5GL9A 1OTDA 3HLDA 2QWSA 4X1MA 1HVBA 2J80A 4FTXA 1SZVA 1L2SA 1J9MA 5FI6A 3AGEA 5FASA 4OH0A 1D7EA 3T4TA 3ISGA 5EV0A 3UDIA 5IU1A 4XXRA 3SH8A 2JKFA 3A0RA 4BL2A 5LBRA 1ZG4A 2A2LA 5CRFA 5L2FA 1F9IA 1BZAA 4F3LB 3Q82A 1K54C 2RL3A 3IXBA 1M40A 4LENA 1D1JA 5FSRA 5MC7A 1RGZA 4FD8A 1VEUA 4QY5A 5HD5A 4MN7A 4IUHA 1SCWA 3E4QA 4S2LA 3E2KA 5L10A 1OMEA 1ZC2A 1KGEA 2PU4A 4CJNA 2JE5A 3VSLA 3ZNYA 5HPIA 5GHYA 4PHTA 2B5RA 2NUTC 2W3GA 1JWVA 1XP4A 4QY6A 2HJEA 3B33A 2Y79A 3LR0A 4L9EA 4F3LA 3RJUA 5FATA 4EU0A 3O5YA 1TDLA 4Q0HA 5DTTA 3LYXA 2IWBA 3B3XA 5E2FA 3FG8A 3U2AA 3F1NB 3WWXA 4S2NA
chains in the Genus database with same CATH topology
2HJ9C 2EA9A 4UQIM 2VGLM 3KSGA 2W0NA 5HDCA 5TBMA 4NKPA 5DKLA 3EWKA 2W3HA 3F1OA 1XJ4A 4HP9A 2QJ5A 2R78A 3NOPC 4Z1WA 2VX8A 1DP9A 5HWTA 3S7NA 4Y5FA 3UE3A 5AJGA 2W1RA 2P08A 1S67L 3MFXA 2WKRA 1T18A 4NXGA 3OLOA 2JKTI 2IA2A 4WEKA 2EWVA 2M7UA 3EEAA 4WELA 3FPVA 3BWLA 3ULFA 5HD3A 1XFNA 1T19A 1V9YA 4L9FA 4CLCE 4CLCB 1F5MA 1TS6A 2PYRA 2VJWA 4EERA 3LUQA 5A8BA 2VV6A 2FH5A 1S1ZA 3A0VA 2J3TD 3S7QA 3UMDA 3T4QA 4I3JA 3EGXC 2VA0A 4LRZE 2W3DA 4O01A 2O0YA 3KX0X 2OAQ1 4OOMA 2K31A 4MMNA 3S7OA 3BQAA 3OC2A 4BBTA 2KLIA 2WKQA 5IT5A 2V0UA 5HZHA 1T1CA 4LRXC 4HP4A 5I5LA 1S1YA 3V67A 2WKPA 3UB8A 4GS9B 4BMWA 3MQQA 4XT2B 1MZUA 3ZQ5A 4JGRA 3CITA 3CI6A 4WN5A 1TS8A 2M7VA 4EETB 2Y8HA 5IS1A 2EWWA 3T4JA 4CQHA 3VV4A 3BY8A 3MXQA 4JGQA 3LICA 1GSVA 3ICYA 2PD8A 5AVFA 2L4RA 4MN5A 4HI4A 4I39A 3R7WA 5J3WA 3IS2B 4BWIA 2A24A 3OCLA 4NXBA 1D06A 2XA7M 4NXEA 3H7WA 3F1PA 3C2WA 4JGPA 3TW8A 4R38A 3PBRA 4Y3IA 3CUEA 3NHQA 2O99A 3D72A 2LB9A 4ETZA 2ZBBA 5DF9A 3UB6A 2CMNA 4Q0JA 4KUOA 5HWWA 2VZWA 2G7UA 3BY9A 3PBSA 3TJZC 5F68A 3ZYTA 3UE6A 3EQVA 4I3AA 4UQIS 3CAXA 1MC0A 2VGLS 2M1CA 1YSPA 1DP6A 2JKRI 1H3QA 1YSQA 4BBVA 4G3KA 2DMWA 2V1BA 2PHYA 2FZ0A 5HWVA 3E4PA 4G3VA 3K3CA 4EQ1A 1VB6A 4DJ2A 2OWJA 5CX7A 1XJ2A 4L9GA 3MMHA 4I5SA 2VEAA 2K7SA 2PYPA 4B93A 1OTIA 5KSHA 3LIEA 1T1AA 3E0YA 1UGUA 4EESA 1P9WA 1ODVA 1N9NA 4LRYC 1S66L 4GW9A 4WL9A 3MQOA 3LIDA 4NEED 3PBOA 3VOLA 2ZOIA 1OPXA 3B42A 1S4SA 1LSXA 4Q0IA 1LL8A 3EQUA 2B18A 3BW6A 1IOUA 3MF0A 3VE4A 5L8MA 5TJJA 3B47A 2W1TA 3A0SA 1LSWA 4YNRA 2INWA 4IHQA 5FL3A 5DJUA 3OBFA 1BYWA 1TS0A 5AVEA 2PR6A 3K2NA 1ZTUA 3LR5A 2D01A 2W27A 3F1NA 4IJGA 1OT6A 3D3OA 3LI8A 2BASA 4Y2FA 3EOIA 2JKRM 3T4LA 3E98A 1ZHHB 4ETXA 5DFYA 1X0OA 4R70A 1OJ5A 4EUVA 3S7PA 2GX5A 4HH3A 2O9BA 1MKMA 2XA7S 3H82B 1TS7A 2H28A 1YAXA 3C30A 1NRJA 3MR0A 5DJTA 3C8CA 3UB9A 1DRMA 3PBTA 3K3DA 2PR5A 3LFVA 3GECA 5HDDA 4E04A 4GLQA 2W3EA 4P6ZM 1GSWA 4H6JB 4WLAA 5DFXA 3TE8A 3UMEA 4L0LA 4BJPA 1W63M 4EW7A 1OTAA 1G28A 1OT9A 1UWPX 3W2ZA 4CLCA 1P0ZA 2XRNA 2JHEA 1P9RA 4JGOA 4EEUA 3PBNA 2YKFA 4HY8A 3MJQA 1JNUA 3T4SA 4ARZB 2L0WA 4KQOA 3C38A 2B02A 2MJ6A 4GHIB 2JKTM 3MQ0A 5K5BA 5F5YA 2ZOHA 3H9WA 5J7EA 5EFWA 4PKYG 2I9VA 1XJ3A 4GJ4A 5KIZA 5HDSA 1TF1A 4FOFA 1IFQA 4II7A 5G4YA 4HIAA 3LI9A 1OTBA 3DBAA 2OAP1 4GS9A 4HQAA 5TBMB 3KSFA 4WF0A 4XT2A 3KYZA 4MDZA 3F1OB 4ME4A 1KOUA 3T4KA 2QJ7A 4WEJA 3EEHA 2O9CA 5C5KA 3LR3A 2PD7A 3P7NA 3R4KA 4CLCD 4RQ9A 1F98A 2D02A 3LIBA 2J3WA 3IS2A 3NOTC 3KO6A 4PKYA 1W63Q 3NJAA 3JVUA 1DP8A 5HL6A 3E4OA 2VV8A 4WUJA 2JN7A 2XROA 4R3AA 4MN6A 2W3FA 3P01A 1EW0A 4ZRRA 3CUEC 1OTEA 4HJ6A 4I38A 3LR4A 1G6OA 2L1MA 4M4XA 1P97A 4LPZA 2V0WA 1Y28A 2VLGA 4O8GA 2KDKA 4MCWA 2P04A 4I3IA 2OWHA 4EEPA 3RTYA 1GSXA 1NLYA 3EGDC 3HCYA 4HNBA 5HSQA 5G4ZA 3KYQA 5F6AA 2YKHA 4DJ3A 2GJ3A 2KOIA 3IBJA 4HOIA 2HGVA 2QKPA 4EXOA 4P6ZS 4DMZA 5J4EA 4HJ3A 3PBQA 1NLZA 2QYBA 2J3TC 1UWNX 3R7WB 4B9OA 1OTDA 1YKDA 2A24B 2QWSA 2VV7A 2NUPC 3H7WB 2J80A 2HV1A 1NWZA 3F1PB 2GZAA 3FC7A 2V1AA 3LIFA 3NOUC 1T1BA 3PR6A 4YWZA 3OOVA 5DKKA 2OOLA 1D7EA 3PHYA 4FSFA 1N9OA 3IBRA 3T4TA 3RH8B 3GDIA 2XSSA 3TRCA 3G6OA 5IU1A 3SW1A 1WA9A 3A0RA 2ZMFA 3RFBA 3T50A 4R6LA 2O9AA 4G3WA 1LSVA 5LBRA 2A2LA 4HHDA 1V9ZA 1F9IA 1LT0A 3KSIA 4F3LB 2QHKA 3VE3A 4QPRA 4K08A 1H8MA 3PYPA 3OCNA 2HF6A 4HH2A 3FPWA 3T4OA 5MC7A 3BJNA 2ZMVA 4GCZA 5HD5A 4MN7A 4AFIA 4IUHA 3BQ8A 3E4QA 3HJKA 1N9LA 2V9AA 4KQDA 4O0PA 1OJGA 1XFQA 3H82A 3CWFA 4UEYA 5HPIA 3CLOA 2GNXA 4PHTA 2PDRA 2NUTC 4HJ4A 5HPFA 2W3GA 3JVVA 4YOFA 2HJEA 2PT7A 4H6JA 3KSHA 1VHMA 4DN0A 1TD5A 2KX6A 3B33A 2VKSA 2Y79A 4PAUA 3LR0A 4L9EA 2W1TB 2K2NA 1S4RA 4CLCC 4F3LA 3LIAA 5F69A 4BBUA 4EU0A 3O5YA 3HJIA 4Q0HA 1XJ6A 3LYXA 4ARZA 4KUKA 4LLOB 4NXFA 3PXPA 4GHIA 2LB5A 3FG8A 4IUKA 3U2AA 1STZA 3F1NB 2Z6CA 4OOLA 3UB7A 2Z6DA 2P7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EA9 A;  2W0N A;  5HDC A;  5TBM A;  5DKL A;  3EWK A;  3F1O A;  1XJ4 A;  4HP9 A;  2QJ5 A;  2R78 A;  3NOP C;  1DP9 A;  5HWT A;  1S67 L;  3MFX A;  2WKR A;  1T18 A;  4NXG A;  3OLO A;  3BWL A;  3ULF A;  5HD3 A;  1XFN A;  1T19 A;  1V9Y A;  4L9F A;  1TS6 A;  2PYR A;  4EER A;  3LUQ A;  5A8B A;  2VV6 A;  1S1Z A;  3A0V A;  3UMD A;  4I3J A;  4LRZ E;  3KX0 X;  4BBT A;  2WKQ A;  2V0U A;  5HZH A;  1T1C A;  4LRX C;  4HP4 A;  5I5L A;  1S1Y A;  2WKP A;  3UB8 A;  4GS9 B;  3MQQ A;  4XT2 B;  1MZU A;  3ZQ5 A;  4JGR A;  4WN5 A;  1TS8 A;  4EET B;  5IS1 A;  3BY8 A;  3MXQ A;  4JGQ A;  3LIC A;  1GSV A;  3ICY A;  2PD8 A;  5AVF A;  2L4R A;  4MN5 A;  4HI4 A;  4I39 A;  5J3W A;  3IS2 B;  2A24 A;  4NXB A;  1D06 A;  4NXE A;  3H7W A;  3F1P A;  3C2W A;  4JGP A;  4R38 A;  3NHQ A;  3D72 A;  2ZBB A;  3UB6 A;  2CMN A;  4KUO A;  5HWW A;  3BY9 A;  5F68 A;  3UE6 A;  4I3A A;  3CAX A;  2M1C A;  1DP6 A;  4BBV A;  2V1B A;  2PHY A;  5HWV A;  3E4P A;  3K3C A;  4EQ1 A;  1VB6 A;  4DJ2 A;  2OWJ A;  1XJ2 A;  4L9G A;  4I5S A;  2VEA A;  2K7S A;  2PYP A;  1OTI A;  3LIE A;  1T1A A;  1UGU A;  4EES A;  1ODV A;  1N9N A;  4LRY C;  1S66 L;  4GW9 A;  4WL9 A;  3MQO A;  3LID A;  3VOL A;  2ZOI A;  1S4S A;  1LSX A;  1LL8 A;  3VE4 A;  3A0S A;  1LSW A;  2INW A;  5DJU A;  1BYW A;  1TS0 A;  5AVE A;  2PR6 A;  2D01 A;  2W27 A;  3F1N A;  1OT6 A;  3LI8 A;  2BAS A;  1X0O A;  4R70 A;  1OJ5 A;  4HH3 A;  3H82 B;  1TS7 A;  2H28 A;  3MR0 A;  5DJT A;  3C8C A;  3UB9 A;  1DRM A;  3K3D A;  2PR5 A;  3GEC A;  5HDD A;  4E04 A;  1GSW A;  4H6J B;  4WLA A;  3UME A;  4EW7 A;  1OTA A;  1G28 A;  1OT9 A;  1UWP X;  1P0Z A;  2JHE A;  4JGO A;  4EEU A;  2YKF A;  4HY8 A;  3MJQ A;  1JNU A;  2L0W A;  2B02 A;  4GHI B;  5F5Y A;  2ZOH A;  3H9W A;  5J7E A;  5EFW A;  4PKY G;  2I9V A;  1XJ3 A;  5KIZ A;  5HDS A;  5G4Y A;  4HIA A;  3LI9 A;  1OTB A;  4HQA A;  4GS9 A;  5TBM B;  4XT2 A;  4WF0 A;  3F1O B;  1KOU A;  2QJ7 A;  3EEH A;  2PD7 A;  3P7N A;  4RQ9 A;  1F98 A;  2D02 A;  3LIB A;  3IS2 A;  3NOT C;  4PKY A;  3NJA A;  1DP8 A;  3E4O A;  2VV8 A;  4WUJ A;  2JN7 A;  4R3A A;  4MN6 A;  1EW0 A;  1OTE A;  4HJ6 A;  4I38 A;  2L1M A;  4M4X A;  1P97 A;  4LPZ A;  2V0W A;  1Y28 A;  2VLG A;  2KDK A;  4I3I A;  2OWH A;  4EEP A;  3RTY A;  1GSX A;  4HNB A;  5HSQ A;  5G4Z A;  5F6A A;  2YKH A;  4DJ3 A;  2GJ3 A;  4HOI A;  2QKP A;  4EXO A;  5J4E A;  4HJ3 A;  1UWN X;  4B9O A;  1OTD A;  2A24 B;  2QWS A;  2VV7 A;  3H7W B;  2J80 A;  2HV1 A;  1NWZ A;  3F1P B;  3FC7 A;  2V1A A;  3LIF A;  3NOU C;  1T1B A;  4YWZ A;  5DKK A;  2OOL A;  1D7E A;  3PHY A;  1N9O A;  3IBR A;  3RH8 B;  3GDI A;  3G6O A;  5IU1 A;  3SW1 A;  1WA9 A;  3A0R A;  3T50 A;  4R6L A;  1LSV A;  4HHD A;  1V9Z A;  1F9I A;  1LT0 A;  4F3L B;  2QHK A;  3VE3 A;  4K08 A;  3PYP A;  4HH2 A;  4GCZ A;  5HD5 A;  3E4Q A;  3HJK A;  1N9L A;  2V9A A;  4KQD A;  1OJG A;  1XFQ A;  3H82 A;  3CWF A;  3CLO A;  2PDR A;  4HJ4 A;  4H6J A;  2KX6 A;  3B33 A;  4L9E A;  1S4R A;  4F3L A;  3LIA A;  5F69 A;  4BBU A;  3HJI A;  1XJ6 A;  3LYX A;  4KUK A;  4LLO B;  4NXF A;  4GHI A;  3FG8 A;  3F1N B;  2Z6C A;  3UB7 A;  2Z6D A;  2P7J A; 
#chains in the Genus database with same CATH topology
 2HJ9 C;  2EA9 A;  4ESP A;  1LI0 A;  2ZJ9 A;  1L0F A;  2BG1 A;  5HDC A;  5TBM A;  4NKP A;  3A3D A;  1YLP A;  2I72 A;  4S2P A;  4ZJ3 A;  2H0T A;  2R78 A;  3W4O A;  1PWD A;  2BTF P;  3LO7 A;  4OLD A;  1S67 L;  2WKR A;  2IA2 A;  3NIA A;  2M7U A;  3EEA A;  4WEL A;  2WUQ A;  4X55 A;  3ULF A;  2OLU A;  4CLC E;  3NY4 A;  1T19 A;  1F5M A;  2ZC7 A;  1TS6 A;  2VJW A;  4MLL A;  4EER A;  3LUQ A;  3UE0 A;  2P9V B;  5A8B A;  2FH5 A;  1S1Z A;  1XGI A;  3A0V A;  3S7Q A;  1A0K A;  3MKF A;  3T4Q A;  2VA0 A;  3QNB A;  4LRZ E;  2W3D A;  5M18 A;  3KX0 X;  3IH9 A;  5HAR A;  3SS3 A;  3Q7V B;  4QWO A;  2V0U A;  2ZQ7 A;  1T1C A;  3SZT A;  2HDS A;  1S1Y A;  3V67 A;  4BMW A;  4GS9 B;  3MQQ A;  2M7V A;  4WZ4 A;  5CER A;  3FKV A;  1ERO A;  2ZQC A;  3IF6 A;  1GSV A;  3QP5 A;  1H8Z A;  4JXW A;  3IS2 B;  2A24 A;  4OPY A;  1IEM A;  1S0W A;  2OV5 A;  4R38 A;  3CZD A;  4Y3I A;  3HLF A;  2O99 A;  3IHB A;  5DF9 A;  3UB6 A;  4Q0J A;  4KUO A;  5AQ7 A;  1IEL A;  5F68 A;  4I3A A;  4DDS A;  1W7F A;  1PI4 A;  1GHI A;  2JKR I;  4OOY A;  4BBV A;  3O3V A;  4G3K A;  4BLM A;  3E4P A;  4X6T A;  4G3V A;  4DE2 A;  2FFY A;  5EVI B;  1L0E A;  5A93 A;  2WKH A;  3LIE A;  4EES A;  1P9W A;  3QP8 A;  4N92 A;  4LRY C;  4B4Z A;  1NJ4 A;  3N7W A;  3HL9 A;  3LID A;  4NEE D;  3HLE A;  3G2Z A;  4JPM A;  2PRF A;  2UWX A;  1OPX A;  1S4S A;  3WS2 A;  1W79 A;  3T1Q B;  3MF0 A;  1GA9 A;  2Y2L A;  1PFL A;  5AVE A;  2PR6 A;  1YQS A;  3K2N A;  1ZTU A;  2Y4A A;  4EBN A;  4IJG A;  2PAV P;  3I7J A;  1CI8 A;  2WGW A;  3T4L A;  4S2N C;  4FH4 A;  2RCX A;  3NEC A;  1IYP A;  2A49 A;  4U3T A;  5GLB A;  3W8K A;  2QPN A;  4FH2 A;  1MKI A;  1MKM A;  1J3W A;  3NI9 A;  3H82 B;  1TVF A;  4GKU A;  5DJT A;  2J7V A;  1CEG A;  2XEP A;  3UN7 A;  4MBF A;  3K3D A;  3GEC A;  4E04 A;  4JBF A;  4WLA A;  3HLG A;  5DFX A;  2ZL1 B;  3G35 A;  1OTA A;  4UA9 A;  4LV3 A;  3W2Z A;  5EVI D;  1GCE A;  5M19 A;  4JLF A;  4E3N A;  3BFC A;  1WE4 A;  1NZO A;  3VFH A;  3T4S A;  4MBK A;  3BFG A;  4GHI B;  3VP4 A;  4K91 A;  4EWF A;  5EFW A;  4PKY G;  1XJ3 A;  1XKZ A;  2ZQ9 A;  5KIZ A;  1TF1 A;  4FOF A;  2WAF A;  2R9W A;  1IFQ A;  4II7 A;  3BLS A;  5G4Y A;  2OAP 1;  4XT2 A;  3KYZ A;  3IH8 A;  4WEJ A;  3IX3 A;  1K6R A;  3P7N A;  4LGW A;  1MWU A;  1M6K A;  2XQZ A;  4DF6 A;  4UA6 A;  3IF6 C;  3NOT C;  2ACG A;  1PWG A;  4PMA A;  4R3J A;  3UPP A;  4WUJ A;  2Y2Q A;  5FAQ A;  3C4P A;  2XRO A;  3L7H A;  4R3A A;  4DE3 A;  1XGJ A;  4EQI A;  1Y4O A;  2EFX A;  4M4X A;  1FQG A;  2DRW A;  3MSH A;  2JCH A;  1ONG A;  4RX3 A;  2P04 A;  3CHW P;  3LCE A;  4B4X A;  3NDG A;  5A92 A;  3KYQ A;  4WYY A;  5HL1 A;  4D60 A;  2YKH A;  2KOI A;  3G34 A;  2HGV A;  2QKP A;  4EXO A;  3P98 A;  4LFU A;  3ZVT A;  1YPR A;  3RXX A;  5J4E A;  1NLZ A;  3LEQ A;  2Y2G A;  1FIL A;  3R7W B;  1YKD A;  3IHA A;  3QHY A;  2NUP C;  5CTM A;  5KZH A;  1NWZ A;  3F1P B;  2GZA A;  1L3L A;  2V1A A;  4KZA A;  2WGI A;  1T1B A;  5CGW A;  4R4S A;  4Y0T A;  1N9O A;  3RH8 B;  3UDX A;  5A91 A;  1WA9 A;  4U0T A;  2EX8 A;  3RFB A;  4R6L A;  2O9A A;  4HHD A;  3S4X A;  3G2Y A;  2QHK A;  4A5R A;  5FAP A;  1KDW A;  4HH2 A;  5CHU A;  1Q2P A;  5EVL A;  2Y2K A;  5FQI A;  1LI9 A;  2QMI A;  4KQD A;  4O0P A;  1OJG A;  1LHY A;  3T1S A;  3SS5 A;  2WGV A;  3M2J A;  1L0G A;  3CJM A;  3IX4 A;  4H6J A;  3KSH A;  3NC8 A;  1TD5 A;  3BEB A;  3DW0 A;  1CQA A;  2VKS A;  1XA7 A;  4N9L A;  1KVL A;  2W1T B;  5D3O A;  4BBU A;  3HRE A;  5A90 A;  3HJI A;  1XJ6 A;  4LV0 A;  4KZ9 A;  4OLG A;  4ARZ A;  2B95 A;  1HD8 A;  4KUK A;  1SKO A;  4HBT A;  2LB5 A;  3O87 A;  4IUK A;  1QMF A;  3A3E A;  3UB5 P;  5DTK A;  3UB7 A;  2P7J A;  2VGL M;  4QD4 A;  2W0N A;  1W5D A;  1XJ4 A;  1JTD A;  5U47 A;  4KG5 A;  1GHM A;  2VX8 A;  1RGY A;  3S7N A;  4Y5F A;  3BM6 A;  2W1R A;  4QB8 A;  4JF5 A;  1NYM A;  3BFD A;  3MFX A;  1ERM A;  1SKF A;  4NXG A;  2C5W B;  1PRQ A;  3BWL A;  1VET B;  1V9Y A;  4L9F A;  3HBR A;  4CLC B;  1ERQ A;  2Y2J A;  2EX9 A;  5BOH A;  5F82 A;  4X53 A;  2O0Y A;  2OAQ 1;  3G30 A;  4OOM A;  2ZM0 A;  2K31 A;  4MMN A;  4X25 A;  3BQA A;  1YMX A;  4P6B A;  3OC2 A;  4E6W A;  5KSC A;  4ZAM A;  4R1G A;  5JYO A;  3UB8 A;  2R9X A;  4JGR A;  3CIT A;  2G2U A;  4MNR A;  3T4J A;  3MXQ A;  2XLN A;  3ICY A;  3HUO A;  3A3F A;  4FCF A;  2JKG A;  4MN5 A;  1E3U A;  4I39 A;  1KE4 A;  4S2J A;  5J3W A;  5DF8 A;  4BWI A;  3PAG A;  3Q1F A;  1D06 A;  1HTZ A;  4NXE A;  1MWR A;  4QU3 A;  3C2W A;  3TW8 A;  3DTI A;  3CUE A;  5L09 A;  4GB7 A;  1BT5 A;  2LB9 A;  2ZBB A;  4KZ3 A;  2CMN A;  5HWW A;  1CEF A;  4FUW A;  4Y0U A;  2G7U A;  1NXY A;  3EQV A;  2Y2O A;  1JVJ A;  3C4O A;  2VGL S;  4KQQ A;  1YSP A;  2HDU A;  3T1X A;  2V1B A;  2PHY A;  2XK1 A;  2FZ0 A;  1E3U D;  1WYC A;  1JWZ A;  2Y2I A;  3K3C A;  4EQ1 A;  1BUL A;  2Y2M A;  3MXS A;  4L9G A;  2VEA A;  2PYP A;  4KZ8 A;  5F1G A;  4JXV A;  4B93 A;  1OTI A;  4GD6 A;  1T1A A;  4DE1 A;  1PZP A;  4NK3 A;  4OVD A;  2Y2H A;  4GW9 A;  4GOG A;  4Z9Q A;  3ZG5 A;  2ZOI A;  3CMZ A;  1LL8 A;  3EQU A;  4KG6 A;  2B18 A;  3BW6 A;  1G68 A;  3PAE A;  3WS1 A;  3VE4 A;  3IF5 A;  5TJJ A;  3B47 A;  4OP8 A;  4E3J A;  4QJG A;  3A0S A;  2ZQA A;  1MXO A;  2INW A;  4WZ5 A;  5FL3 A;  1BYW A;  1YM1 A;  2E8J A;  1FR1 A;  3LR5 A;  2W27 A;  3F1N A;  5EM0 A;  4DXC A;  4Y13 A;  3BRM A;  2BAS A;  2CC1 A;  3DWK A;  3E98 A;  5DFY A;  1X0O A;  2H0Y A;  3VFF A;  2GX5 A;  2Y91 A;  5AQ9 A;  3CPT B;  4X56 A;  3ZHH A;  4YFM A;  4EBL A;  2C6W B;  5CXW A;  3UNW A;  1EWZ A;  3PBT A;  4GLQ A;  1GSW A;  4XUX A;  4L0L A;  1W63 M;  1UWP X;  2XRN A;  2ZQD A;  4GDB A;  3ZG7 B;  3VSK A;  2P9V A;  4EEU A;  1JNU A;  5EE8 A;  1I2W A;  4GD8 A;  4KQO A;  2HP5 A;  2ZLY A;  2MJ6 A;  3MQ0 A;  5K5B A;  5F5Y A;  5FDH A;  3O88 A;  2I9V A;  4DRT A;  5HDS A;  3VP2 A;  1IKI A;  3Q7V A;  1H0M A;  4UA7 A;  4P87 A;  2WYX A;  3CPT A;  1FIK A;  4HIA A;  4GS9 A;  3CG5 A;  4WF0 A;  3F1O B;  3FV7 A;  4E3I A;  2QJ7 A;  2O9C A;  1F98 A;  2D02 A;  3IS2 A;  4WBG A;  3ITB A;  3NJA A;  3ZG8 B;  3JVU A;  4KZ4 A;  1FCN A;  4OPQ A;  3N8L A;  4MN6 A;  1EW0 A;  4ZRR A;  1JWP A;  1OTE A;  3CUE C;  2GDN A;  1KGF A;  4I38 A;  3LR4 A;  5GHX A;  1G6O A;  2L1M A;  1E4D A;  1NRF A;  4WMC A;  5FI7 A;  1K4E A;  1NY0 A;  1GHP A;  2J9P A;  1NYY A;  5DVA A;  2IWC A;  5GLA A;  1GSX A;  4N1H A;  1PNE A;  3O86 A;  2AVX A;  1WYB A;  4PM9 A;  5F6A A;  2WAE A;  5EVI A;  3WS0 A;  1MWS A;  4DMZ A;  1K57 A;  2XFT A;  2QYB A;  3AGF A;  2HPB A;  4OPR A;  4B9O A;  3TSG A;  5CGS A;  5FEF A;  3H7W B;  3MXR A;  3ZCZ A;  2HV1 A;  4WMC D;  4EUZ A;  3U4L P;  3NOU C;  3PR6 A;  5DKK A;  4GZB A;  3PHY A;  4FSF A;  4S2M A;  3G6O A;  3SW1 A;  3T50 A;  2QZ6 A;  1LSV A;  1V9Z A;  3KSI A;  4ZJ2 A;  3MBZ A;  4QPR A;  4OP5 A;  3OCN A;  3FPW A;  4GCZ A;  2ZMV A;  3A3J A;  2EX6 A;  2A3U A;  4AFI A;  3BQ8 A;  3HJK A;  2ZM2 A;  4BL3 A;  1N9L A;  3MZF A;  1XFQ A;  3P09 A;  3H82 A;  1YLJ A;  4UEY A;  3CLO A;  3T1R A;  1BLS A;  1O07 A;  1ES5 A;  2PDR A;  5EVE A;  3RXW A;  4HJ4 A;  4YOF A;  3N8S A;  2PT7 A;  4DN0 A;  1VHM A;  4CPK A;  2ZL1 A;  2KX6 A;  3FKW A;  4ZTK A;  1YLZ A;  2X02 A;  1DJA A;  3UO9 A;  1BTL A;  1MBL A;  2K2N A;  5F69 A;  2J9O A;  4E6X A;  3UY6 A;  4KZB A;  4P85 A;  4KZ7 A;  3WRT A;  2H10 A;  4OQI A;  1H5X A;  4LLO B;  4GHI A;  2WZZ A;  3MS6 A;  1STZ A;  1LLB A;  5F1F A;  1BLP A;  4OOL A;  4JF4 A;  2Z6D A;  3G32 A;  1BLH A;  1YLT A;  3KSG A;  3LEZ A;  3EWK A;  4F94 A;  5FQQ A;  3UPN A;  3IWI A;  2Q9N A;  3NOP C;  1K25 A;  1DP9 A;  5HWT A;  5GLD A;  5AJG A;  2V8C A;  3LY3 A;  2XR0 A;  1ES3 A;  2WKE A;  3QP4 A;  5FQJ A;  1T18 A;  3OLO A;  2JKT I;  5HD3 A;  1XFN A;  4HBU A;  1KE3 A;  1K54 A;  2V8F A;  1N9B A;  5FAO A;  2J3T D;  3M2K A;  4KQR A;  2ZC3 B;  4R3B A;  4X1L A;  2EXB A;  3V5M A;  1HZO A;  3S7O A;  2H5S A;  1ES2 A;  4BBT A;  2KLI A;  2WKQ A;  2Z2L B;  5IT5 A;  4DKI A;  5HZH A;  1FR6 A;  5I5L A;  1O7E A;  2WKP A;  3ZDJ A;  3ZQ5 A;  3CI6 A;  4WN5 A;  2XDM A;  1QME A;  2X01 A;  4EET B;  3QP1 A;  3WS5 A;  1F2K A;  5IS1 A;  5EVI C;  4JGQ A;  1ZG6 A;  3LIC A;  4E3L A;  2PD8 A;  1PWC A;  2L4R A;  3WS4 A;  3GR2 A;  3R7W A;  1SHV A;  1K57 C;  1S6R A;  3M6B A;  3OCL A;  4NXB A;  3S1Y A;  2HDR A;  5EPH A;  2XA7 M;  3DWZ A;  3NCK A;  4XUZ A;  4WM9 A;  4Q8I A;  1YLY A;  4UHU A;  3F1P A;  4JGP A;  5J8X A;  3NHQ A;  1RP5 A;  4ETZ A;  4JF6 A;  2PBD P;  3NUL A;  2VZW A;  3E2L A;  3BY9 A;  4C3Q A;  1Q2Q A;  3PBS A;  4OPZ A;  4KZ5 A;  3ZYT A;  4E3O A;  3CAX A;  3UDF A;  4ZBE A;  1DP6 A;  5FDS A;  3Q7Z A;  1K38 A;  1ACF A;  3C7V A;  3IXD A;  4Y7P A;  4B88 A;  1VB6 A;  3GTC A;  4DJ2 A;  3C5A A;  1KGG A;  3MMH A;  2EFU A;  2Y2P A;  2K7S A;  2OSU A;  3ITA A;  1AXB A;  3HVF A;  5KSH A;  1UGU A;  1PYY A;  1ODV A;  4IED A;  1S66 L;  3IXH A;  4WL9 A;  1L0D A;  3MQO A;  4RA7 A;  3PBO A;  4Q0I A;  1LSX A;  5EUA A;  3GMW A;  5L8M A;  1IYS A;  2W1T A;  1LSW A;  3G31 A;  4IHQ A;  3OBF A;  3HLW A;  1TS0 A;  3WRZ A;  4RVA A;  3HLC A;  4OQH A;  2PBY A;  4D2O A;  4S2K A;  2D01 A;  4MEZ A;  3VP1 A;  4PM8 A;  3LI8 A;  4X68 A;  2VGK A;  4U0X A;  1ZHH B;  4ETX A;  3D4F A;  1FOF A;  1VEU B;  3G4P A;  1OJ5 A;  4EUV A;  3S7P A;  3FWL A;  4OQG A;  2XA7 S;  1LL5 A;  1TS7 A;  2H28 A;  1YAX A;  5TFQ A;  3MR0 A;  2HZ5 A;  3C8C A;  3UB9 A;  4K0W A;  2V1Z A;  2PR5 A;  3LFV A;  1YT4 A;  3LGO A;  1YMS A;  3TE8 A;  4BJP A;  1VET A;  1G28 A;  1OT9 A;  1SDE A;  5GLC A;  4CLC A;  1P0Z A;  2JHE A;  1P9R A;  4JGO A;  1NZU A;  4ZJ1 A;  2ZMA A;  3PBN A;  4PM6 A;  2E8I A;  2YKF A;  4X69 A;  2OLV A;  1GA0 A;  1YLW A;  3C38 A;  2JKT M;  2ZQ8 A;  4C75 A;  3GSG A;  1TDG A;  3IX8 A;  4N9K A;  5J7E A;  4IVI A;  4GJ4 A;  3GVB A;  3KYE A;  5EOE A;  4LV2 A;  4HQA A;  3DBA A;  5TBM B;  3OPH A;  1MY8 A;  4ME4 A;  4OON A;  1KOU A;  3T4K A;  4Y15 A;  1E25 A;  3NDE A;  1Z09 A;  2PD7 A;  3MFD A;  3R4K A;  4CLC D;  3UE1 A;  4JXS A;  1IYO A;  3BEC A;  5FA7 A;  5TGF A;  3ZFZ A;  3LIB A;  2JBF A;  2J3W A;  2WK0 A;  3KO6 A;  2DCF A;  5DF7 A;  5CGX A;  3VP0 A;  1DP8 A;  3V3S A;  2VV8 A;  1C3B A;  5FEG A;  1K4F A;  3QP6 A;  3P01 A;  3VOZ A;  4NG2 A;  5CTN A;  1U60 A;  4R23 A;  5L07 A;  2V0W A;  5E2E A;  2VLG A;  4C6Y A;  4O8G A;  4MCW A;  3L9K A;  3RTY A;  3Q07 A;  1CJF A;  1NLY A;  3EGD C;  1MWT A;  3HCY A;  2HP6 A;  4HNB A;  3QNC A;  5HSQ A;  5G4Z A;  5F83 A;  1IKG A;  5IHV A;  4DJ3 A;  5E2G A;  3V50 A;  2ZM8 A;  2J8Y A;  4HOI A;  2ZC4 B;  2UV0 E;  3DTE A;  1CF0 A;  4HJ3 A;  5AQB A;  3IF6 B;  3A3I A;  3SH9 A;  3JPU A;  1PW8 A;  2A24 B;  2VV7 A;  1FCM A;  3D9Y A;  3C7U A;  3FC7 A;  3W4Q A;  3LIF A;  4DDY A;  4YWZ A;  3OOV A;  2OOL A;  5CEB A;  3IBR A;  1PIO A;  3GDI A;  2XSS A;  5EEC A;  3TRC A;  5EM1 A;  1PI5 A;  2ZMF A;  4G3W A;  1K55 A;  3ZG9 B;  1FCO A;  3VE3 A;  4KG2 A;  4Y17 A;  4K08 A;  1H8M A;  3N6I A;  3PYP A;  4GNU A;  2HF6 A;  1K56 A;  2ZC6 B;  3T4O A;  3BJN A;  5M1A A;  4LCM A;  4OQ0 A;  3FZC A;  4KEN B;  4N1X A;  2V9A A;  2HDQ A;  3BFE A;  1IYQ A;  5TR7 A;  3CWF A;  2GNX A;  5CED A;  5HPF A;  1BSG A;  3JVV A;  3OPP A;  2DNS A;  4PAU A;  1S4R A;  3ZNT A;  4CLC C;  3LIA A;  1RCJ A;  3GQZ A;  1DJB A;  5HFO A;  1K56 D;  2BLS A;  1BUE A;  3JYI A;  4NXF A;  1I2S A;  3PXP A;  5AQA A;  4BD1 A;  2Z6C A;  1LL9 A;  1LT0 A;  2WGW B;  2V20 A;  4UQI M;  1XX2 A;  1CK3 A;  2EX2 A;  5DKL A;  2W3H A;  3UPO A;  3DAV A;  3IQA A;  5HAQ A;  3F1O A;  2XGN A;  4HP9 A;  4ID4 A;  2QJ5 A;  2Q9M A;  2Q0O A;  4Z1W A;  3ZG0 A;  3GRJ A;  2IWD A;  4R4R A;  3UE3 A;  2XF3 A;  1MPL A;  3GV9 A;  2P08 A;  4E3K A;  3SOI A;  2WKI A;  4WEK A;  3IWO A;  1PW1 A;  2EWV A;  4JKT A;  3FPV A;  3AGD A;  1Y54 A;  2PYR A;  2VV6 A;  3UMD A;  3MKE A;  4S2I A;  4I3J A;  3EGX C;  4O01 A;  3MZD A;  5FQ9 A;  4E3M A;  2X71 A;  2Z2M B;  2FFF B;  2HP9 A;  4LCL A;  3VP3 A;  3DTK A;  4WZ5 C;  4LRX C;  4HP4 A;  1K6S A;  3BYD A;  4XT2 B;  1MZU A;  1TS8 A;  2Y8H A;  4NET A;  2EWW A;  4CQH A;  3VV4 A;  3BY8 A;  4RYE A;  5AVF A;  4HI4 A;  5DTS A;  3OPL A;  2Y2N A;  3PTE A;  3BFF A;  3OPR A;  3DTM A;  1DY6 A;  5E2H A;  3H7W A;  2XH9 A;  3MZE A;  3PBR A;  1PZO A;  4OKP A;  2P74 A;  3D72 A;  2V2F F;  4DXB A;  4ZDX A;  1I5Q A;  5G18 A;  4PM5 A;  3TJZ C;  3UE6 A;  4UQI S;  1MC0 A;  2M1C A;  2VK3 A;  1H3Q A;  1YSQ A;  1K55 C;  4M3K A;  2DMW A;  5E43 A;  5HWV A;  3T12 B;  4IBR A;  1ZKJ A;  4EBP A;  2OWJ A;  5CX7 A;  1XJ2 A;  3SS4 A;  5FI2 A;  5CHJ A;  4I5S A;  5CEC A;  3OZH A;  1DJC A;  3E0Y A;  3ZGA B;  4O7D A;  1N9N A;  3Q81 A;  1SDN A;  4YIN A;  5HAI A;  1H8Y A;  2VGJ A;  1ES4 A;  3VOL A;  3B42 A;  4S2O A;  1IOU A;  1N4O A;  5FQK A;  4BEN A;  3TOI A;  4YNR A;  1G6A A;  5DJU A;  4IBX A;  4K0X A;  2WAD A;  3TG9 A;  3VMA A;  2ZC5 B;  1VM1 A;  1OT6 A;  3D3O A;  1K0K A;  4Y2F A;  3EOI A;  3NBL A;  4H8R A;  2JKR M;  2XD1 A;  5HAP A;  4R70 A;  4HES A;  3ZVW A;  4HH3 A;  1EI5 A;  3S22 A;  5GHZ A;  2O9B A;  3HLB A;  3C30 A;  1XPB A;  1NRJ A;  3HUN A;  4JXG A;  1W8Y A;  1DRM A;  3SH7 A;  5HDD A;  2ZD8 A;  2W3E A;  4P6Z M;  4Y0O A;  4H6J B;  3QP2 A;  1ONH A;  3UME A;  5HW3 A;  4EW7 A;  2PU2 A;  3M6H A;  2WZX A;  2XFS A;  4HY8 A;  3MJQ A;  4UAA A;  3N8R A;  2Y55 A;  3FYZ A;  4ARZ B;  1ESI A;  2L0W A;  4PM7 A;  1SKO B;  2B02 A;  4PPR A;  4MBH A;  1KE0 A;  2ZOH A;  1VQQ A;  3H9W A;  3V39 A;  5CHM A;  5I94 A;  5HX9 A;  1FSW A;  4R0Q A;  3IWQ A;  3W4P A;  4GDN A;  3HUM A;  3LI9 A;  1OTB A;  3KSF A;  4MDZ A;  1G5U A;  1KVM A;  1XA1 A;  3EEH A;  5C5K A;  3LR3 A;  3BLM A;  4RQ9 A;  3N4I A;  1Z6F A;  2XD5 A;  2JC7 A;  5FQM A;  3VOY A;  4BD0 A;  4PKY A;  1W63 Q;  1AWI A;  3V3R A;  5HL6 A;  3E4O A;  2JN7 A;  4DE0 A;  2EXA A;  4RX2 A;  1XXM A;  2W3F A;  4KZ6 A;  1JTG A;  5KMW A;  1TEM A;  4HJ6 A;  4GN2 A;  1HLU P;  4BQM A;  5EOO A;  1P97 A;  4LPZ A;  1CI9 A;  1Y28 A;  2KDK A;  4I3I A;  2OWH A;  1ALQ A;  4QHC A;  1BLC A;  4HEF A;  4EEP A;  4IVK A;  2Y59 A;  4EV4 A;  1ESU A;  3LY4 A;  2GJ3 A;  3IBJ A;  4LV1 A;  3IXG A;  4P0M A;  2G2W A;  4P6Z S;  1KDS A;  3PBQ A;  1W8Q A;  2J3T C;  1UWN X;  5JYP A;  1FSY A;  3IT9 A;  5GL9 A;  1OTD A;  3HLD A;  2QWS A;  4X1M A;  1HVB A;  2J80 A;  4FTX A;  1SZV A;  1L2S A;  1J9M A;  5FI6 A;  3AGE A;  5FAS A;  4OH0 A;  1D7E A;  3T4T A;  3ISG A;  5EV0 A;  3UDI A;  5IU1 A;  4XXR A;  3SH8 A;  2JKF A;  3A0R A;  4BL2 A;  5LBR A;  1ZG4 A;  2A2L A;  5CRF A;  5L2F A;  1F9I A;  1BZA A;  4F3L B;  3Q82 A;  1K54 C;  2RL3 A;  3IXB A;  1M40 A;  4LEN A;  1D1J A;  5FSR A;  5MC7 A;  1RGZ A;  4FD8 A;  1VEU A;  4QY5 A;  5HD5 A;  4MN7 A;  4IUH A;  1SCW A;  3E4Q A;  4S2L A;  3E2K A;  5L10 A;  1OME A;  1ZC2 A;  1KGE A;  2PU4 A;  4CJN A;  2JE5 A;  3VSL A;  3ZNY A;  5HPI A;  5GHY A;  4PHT A;  2B5R A;  2NUT C;  2W3G A;  1JWV A;  1XP4 A;  4QY6 A;  2HJE A;  3B33 A;  2Y79 A;  3LR0 A;  4L9E A;  4F3L A;  3RJU A;  5FAT A;  4EU0 A;  3O5Y A;  1TDL A;  4Q0H A;  5DTT A;  3LYX A;  2IWB A;  3B3X A;  5E2F A;  3FG8 A;  3U2A A;  3F1N B;  3WWX A;  4S2N A; 
#chains in the Genus database with same CATH homology
 2HJ9 C;  2EA9 A;  4UQI M;  2VGL M;  3KSG A;  2W0N A;  5HDC A;  5TBM A;  4NKP A;  5DKL A;  3EWK A;  2W3H A;  3F1O A;  1XJ4 A;  4HP9 A;  2QJ5 A;  2R78 A;  3NOP C;  4Z1W A;  2VX8 A;  1DP9 A;  5HWT A;  3S7N A;  4Y5F A;  3UE3 A;  5AJG A;  2W1R A;  2P08 A;  1S67 L;  3MFX A;  2WKR A;  1T18 A;  4NXG A;  3OLO A;  2JKT I;  2IA2 A;  4WEK A;  2EWV A;  2M7U A;  3EEA A;  4WEL A;  3FPV A;  3BWL A;  3ULF A;  5HD3 A;  1XFN A;  1T19 A;  1V9Y A;  4L9F A;  4CLC E;  4CLC B;  1F5M A;  1TS6 A;  2PYR A;  2VJW A;  4EER A;  3LUQ A;  5A8B A;  2VV6 A;  2FH5 A;  1S1Z A;  3A0V A;  2J3T D;  3S7Q A;  3UMD A;  3T4Q A;  4I3J A;  3EGX C;  2VA0 A;  4LRZ E;  2W3D A;  4O01 A;  2O0Y A;  3KX0 X;  2OAQ 1;  4OOM A;  2K31 A;  4MMN A;  3S7O A;  3BQA A;  3OC2 A;  4BBT A;  2KLI A;  2WKQ A;  5IT5 A;  2V0U A;  5HZH A;  1T1C A;  4LRX C;  4HP4 A;  5I5L A;  1S1Y A;  3V67 A;  2WKP A;  3UB8 A;  4GS9 B;  4BMW A;  3MQQ A;  4XT2 B;  1MZU A;  3ZQ5 A;  4JGR A;  3CIT A;  3CI6 A;  4WN5 A;  1TS8 A;  2M7V A;  4EET B;  2Y8H A;  5IS1 A;  2EWW A;  3T4J A;  4CQH A;  3VV4 A;  3BY8 A;  3MXQ A;  4JGQ A;  3LIC A;  1GSV A;  3ICY A;  2PD8 A;  5AVF A;  2L4R A;  4MN5 A;  4HI4 A;  4I39 A;  3R7W A;  5J3W A;  3IS2 B;  4BWI A;  2A24 A;  3OCL A;  4NXB A;  1D06 A;  2XA7 M;  4NXE A;  3H7W A;  3F1P A;  3C2W A;  4JGP A;  3TW8 A;  4R38 A;  3PBR A;  4Y3I A;  3CUE A;  3NHQ A;  2O99 A;  3D72 A;  2LB9 A;  4ETZ A;  2ZBB A;  5DF9 A;  3UB6 A;  2CMN A;  4Q0J A;  4KUO A;  5HWW A;  2VZW A;  2G7U A;  3BY9 A;  3PBS A;  3TJZ C;  5F68 A;  3ZYT A;  3UE6 A;  3EQV A;  4I3A A;  4UQI S;  3CAX A;  1MC0 A;  2VGL S;  2M1C A;  1YSP A;  1DP6 A;  2JKR I;  1H3Q A;  1YSQ A;  4BBV A;  4G3K A;  2DMW A;  2V1B A;  2PHY A;  2FZ0 A;  5HWV A;  3E4P A;  4G3V A;  3K3C A;  4EQ1 A;  1VB6 A;  4DJ2 A;  2OWJ A;  5CX7 A;  1XJ2 A;  4L9G A;  3MMH A;  4I5S A;  2VEA A;  2K7S A;  2PYP A;  4B93 A;  1OTI A;  5KSH A;  3LIE A;  1T1A A;  3E0Y A;  1UGU A;  4EES A;  1P9W A;  1ODV A;  1N9N A;  4LRY C;  1S66 L;  4GW9 A;  4WL9 A;  3MQO A;  3LID A;  4NEE D;  3PBO A;  3VOL A;  2ZOI A;  1OPX A;  3B42 A;  1S4S A;  1LSX A;  4Q0I A;  1LL8 A;  3EQU A;  2B18 A;  3BW6 A;  1IOU A;  3MF0 A;  3VE4 A;  5L8M A;  5TJJ A;  3B47 A;  2W1T A;  3A0S A;  1LSW A;  4YNR A;  2INW A;  4IHQ A;  5FL3 A;  5DJU A;  3OBF A;  1BYW A;  1TS0 A;  5AVE A;  2PR6 A;  3K2N A;  1ZTU A;  3LR5 A;  2D01 A;  2W27 A;  3F1N A;  4IJG A;  1OT6 A;  3D3O A;  3LI8 A;  2BAS A;  4Y2F A;  3EOI A;  2JKR M;  3T4L A;  3E98 A;  1ZHH B;  4ETX A;  5DFY A;  1X0O A;  4R70 A;  1OJ5 A;  4EUV A;  3S7P A;  2GX5 A;  4HH3 A;  2O9B A;  1MKM A;  2XA7 S;  3H82 B;  1TS7 A;  2H28 A;  1YAX A;  3C30 A;  1NRJ A;  3MR0 A;  5DJT A;  3C8C A;  3UB9 A;  1DRM A;  3PBT A;  3K3D A;  2PR5 A;  3LFV A;  3GEC A;  5HDD A;  4E04 A;  4GLQ A;  2W3E A;  4P6Z M;  1GSW A;  4H6J B;  4WLA A;  5DFX A;  3TE8 A;  3UME A;  4L0L A;  4BJP A;  1W63 M;  4EW7 A;  1OTA A;  1G28 A;  1OT9 A;  1UWP X;  3W2Z A;  4CLC A;  1P0Z A;  2XRN A;  2JHE A;  1P9R A;  4JGO A;  4EEU A;  3PBN A;  2YKF A;  4HY8 A;  3MJQ A;  1JNU A;  3T4S A;  4ARZ B;  2L0W A;  4KQO A;  3C38 A;  2B02 A;  2MJ6 A;  4GHI B;  2JKT M;  3MQ0 A;  5K5B A;  5F5Y A;  2ZOH A;  3H9W A;  5J7E A;  5EFW A;  4PKY G;  2I9V A;  1XJ3 A;  4GJ4 A;  5KIZ A;  5HDS A;  1TF1 A;  4FOF A;  1IFQ A;  4II7 A;  5G4Y A;  4HIA A;  3LI9 A;  1OTB A;  3DBA A;  2OAP 1;  4GS9 A;  4HQA A;  5TBM B;  3KSF A;  4WF0 A;  4XT2 A;  3KYZ A;  4MDZ A;  3F1O B;  4ME4 A;  1KOU A;  3T4K A;  2QJ7 A;  4WEJ A;  3EEH A;  2O9C A;  5C5K A;  3LR3 A;  2PD7 A;  3P7N A;  3R4K A;  4CLC D;  4RQ9 A;  1F98 A;  2D02 A;  3LIB A;  2J3W A;  3IS2 A;  3NOT C;  3KO6 A;  4PKY A;  1W63 Q;  3NJA A;  3JVU A;  1DP8 A;  5HL6 A;  3E4O A;  2VV8 A;  4WUJ A;  2JN7 A;  2XRO A;  4R3A A;  4MN6 A;  2W3F A;  3P01 A;  1EW0 A;  4ZRR A;  3CUE C;  1OTE A;  4HJ6 A;  4I38 A;  3LR4 A;  1G6O A;  2L1M A;  4M4X A;  1P97 A;  4LPZ A;  2V0W A;  1Y28 A;  2VLG A;  4O8G A;  2KDK A;  4MCW A;  2P04 A;  4I3I A;  2OWH A;  4EEP A;  3RTY A;  1GSX A;  1NLY A;  3EGD C;  3HCY A;  4HNB A;  5HSQ A;  5G4Z A;  3KYQ A;  5F6A A;  2YKH A;  4DJ3 A;  2GJ3 A;  2KOI A;  3IBJ A;  4HOI A;  2HGV A;  2QKP A;  4EXO A;  4P6Z S;  4DMZ A;  5J4E A;  4HJ3 A;  3PBQ A;  1NLZ A;  2QYB A;  2J3T C;  1UWN X;  3R7W B;  4B9O A;  1OTD A;  1YKD A;  2A24 B;  2QWS A;  2VV7 A;  2NUP C;  3H7W B;  2J80 A;  2HV1 A;  1NWZ A;  3F1P B;  2GZA A;  3FC7 A;  2V1A A;  3LIF A;  3NOU C;  1T1B A;  3PR6 A;  4YWZ A;  3OOV A;  5DKK A;  2OOL A;  1D7E A;  3PHY A;  4FSF A;  1N9O A;  3IBR A;  3T4T A;  3RH8 B;  3GDI A;  2XSS A;  3TRC A;  3G6O A;  5IU1 A;  3SW1 A;  1WA9 A;  3A0R A;  2ZMF A;  3RFB A;  3T50 A;  4R6L A;  2O9A A;  4G3W A;  1LSV A;  5LBR A;  2A2L A;  4HHD A;  1V9Z A;  1F9I A;  1LT0 A;  3KSI A;  4F3L B;  2QHK A;  3VE3 A;  4QPR A;  4K08 A;  1H8M A;  3PYP A;  3OCN A;  2HF6 A;  4HH2 A;  3FPW A;  3T4O A;  5MC7 A;  3BJN A;  2ZMV A;  4GCZ A;  5HD5 A;  4MN7 A;  4AFI A;  4IUH A;  3BQ8 A;  3E4Q A;  3HJK A;  1N9L A;  2V9A A;  4KQD A;  4O0P A;  1OJG A;  1XFQ A;  3H82 A;  3CWF A;  4UEY A;  5HPI A;  3CLO A;  2GNX A;  4PHT A;  2PDR A;  2NUT C;  4HJ4 A;  5HPF A;  2W3G A;  3JVV A;  4YOF A;  2HJE A;  2PT7 A;  4H6J A;  3KSH A;  1VHM A;  4DN0 A;  1TD5 A;  2KX6 A;  3B33 A;  2VKS A;  2Y79 A;  4PAU A;  3LR0 A;  4L9E A;  2W1T B;  2K2N A;  1S4R A;  4CLC C;  4F3L A;  3LIA A;  5F69 A;  4BBU A;  4EU0 A;  3O5Y A;  3HJI A;  4Q0H A;  1XJ6 A;  3LYX A;  4ARZ A;  4KUK A;  4LLO B;  4NXF A;  3PXP A;  4GHI A;  2LB5 A;  3FG8 A;  4IUK A;  3U2A A;  1STZ A;  3F1N B;  2Z6C A;  4OOL A;  3UB7 A;  2Z6D A;  2P7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...