3KX0X

Crystal structure of the pas domain of rv1364c
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
135
structure length
127
Chain Sequence
EMDWDKTVGAAEDVRRIFEHIPAILVGLEGPDHRFVAVNAAYRGFSPLLDTVGQPAREVYPELEGQQIYEMLDRVYQTGEPQSGSEWRLQEERYFDFVVTPRRRADGSIEGVQLIVDDVTSRVRARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein Rv1364c/MT1410
publication title Role of a PAS sensor domain in the Mycobacterium tuberculosis transcription regulator Rv1364c
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Signaling protein
total genus 30
structure length 127
sequence length 135
ec nomenclature
pdb deposition date 2009-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF08448 PAS_4 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3kx0X00
1N9OA 1TS7A 2GJ3A 3F1PA 2QKPA 3B33A 3IS2B 5HDCA 2PR6A 1T1AA 3SW1A 2QWSA 1DP9A 2VV6A 3F1OA 3UMEA 3UE6A 3MJQA 1UWNX 3VE3A 4NXEA 3LI8A 4GW9A 4EEPA 1T19A 3EWKA 5EFWA 4R6LA 4EXOA 5G4ZA 3A0RA 2YKFA 1TS0A 3ULFA 2L4RA 1OT9A 1TS6A 3NJAA 4E04A 1S4SA 1WA9A 3A0SA 3RH8B 4HNBA 5DJUA 4F3LB 1GSWA 3LIEA 2WKQA 4H6JB 5I5LA 1D7EA 4WLAA 1OTDA 4LRZE 1OT6A 2KDKA 4WN5A 4EETB 4GHIB 4HHDA 4KUOA 5HWVA 3MR0A 4DJ3A 4HIAA 5A8BA 2OWHA 3IS2A 3MQOA 2L0WA 3H9WA 3NOTC 4JGPA 2YKHA 1XFQA 2OOLA 4BBTA 2L1MA 5J7EA 4LRYC 1UGUA 4I3AA 1LL8A 5F68A 4EERA 3E4PA 5HWTA 1BYWA 5HDDA 2PR5A 3H7WB 3RTYA 1F9IA 1S1ZA 2V1BA 4F3LA 4H6JA 5HDSA 4JGOA 3C2WA 4MN6A 3D72A 4HI4A 5HZHA 3E4OA 1S67L 2PD7A 2R78A 1OJGA 4GHIA 4I5SA 2VLGA 5F5YA 1XJ4A 3F1NB 1KOUA 3CWFA 4HJ3A 3LIBA 5J4EA 4EESA 3FG8A 3VE4A 4EEUA 1S4RA 3LIDA 2PD8A 2B02A 4LPZA 3BY8A 1TS8A 1V9ZA 3HJKA 1DP8A 2K7SA 4HH2A 3H7WA 1T1BA 1F98A 1JNUA 3BY9A 3OLOA 4EW7A 4XT2B 4RQ9A 4EQ1A 4L9GA 4B9OA 5F69A 4R3AA 2HV1A 5TBMB 1LSWA 1OTBA 4HP4A 3UB6A 3LUQA 3LIAA 4WF0A 5IU1A 4JGQA 1EW0A 3EEHA 4YWZA 4M4XA 2V0UA 1LT0A 1S66L 2CMNA 4HJ6A 5F6AA 3LYXA 4PKYA 2PYPA 3F1NA 4WL9A 4GCZA 4NXBA 5HD3A 3ZQ5A 1XFNA 1OJ5A 2M1CA 3NOPC 2PDRA 3GDIA 4R70A 2Z6DA 2OWJA 1OTAA 1NWZA 1GSVA 2QHKA 4PKYG 3A0VA 4L9EA 4K08A 2PYRA 3C8CA 4KUKA 1VB6A 4BBVA 4XT2A 3ICYA 4HY8A 3GECA 3F1OB 4WUJA 1Y28A 2WKPA 3UB7A 5TBMA 2J80A 1N9LA 3P7NA 5DKLA 2H28A 1XJ2A 4GS9B 3HJIA 2W0NA 1GSXA 1N9NA 5HD5A 5AVEA 2W27A 2KX6A 1D06A 2D02A 3FC7A 2JN7A 3LICA 4I38A 4HJ4A 4HOIA 3CLOA 4MN5A 2P7JA 2WKRA 2I9VA 5HSQA 3MFXA 4I39A 4LRXC 1G28A 2JHEA 4I3JA 2Z6CA 1OTEA 3G6OA 1OTIA 3UB9A 3K3DA 5IS1A 2V9AA 1V9YA 2BASA 1P0ZA 1XJ6A 2V0WA 1XJ3A 3K3CA 2PHYA 3NOUC 4GS9A 3NHQA 5HWWA 2ZBBA 2VEAA 5DKKA 2A24B 5G4YA 3H82B 2D01A 4HP9A 2EA9A 2V1AA 4I3IA 4LLOB 3MQQA 5AVFA 4R38A 4JGRA 3IBRA 2QJ7A 1UWPX 4NXFA 1LSXA 2ZOIA 3F1PB 3LI9A 1MZUA 3KX0X 1T18A 1P97A 2INWA 3CAXA 3VOLA 3PYPA 4KQDA 1T1CA 2VV8A 4L9FA 2VV7A 3T50A 2QJ5A 1DRMA 5KIZA 1X0OA 4NXGA 5J3WA 3UMDA 3MXQA 5DJTA 1DP6A 1S1YA 2ZOHA 4HH3A 4HQAA 3LIFA 4DJ2A 3E4QA 1ODVA 2A24A 3H82A 1LSVA 4BBUA 3BWLA 3PHYA 3UB8A
chains in the Genus database with same CATH superfamily
1N9OA 2HP9A 2PT7A 3IF6A 3MSHA 3WS5A 4ARZB 3DTIA 2Z2LB 1CF0A 3PAGA 3QNBA 4X1LA 3T4QA 1CEGA 1YLTA 3DAVA 3IT9A 3HBRA 3UE6A 1K25A 3BFEA 1LHYA 1BT5A 1T19A 2JE5A 1PWDA 2FFYA 4M3KA 4PM6A 3ULFA 3G30A 1YKDA 2WZZA 1WA9A 3LY3A 1SKFA 3WRZA 2WKQA 4OQHA 3ZG5A 2Y2HA 5IT5A 1TF1A 4WLAA 4LRZE 1OT6A 2KDKA 4GHIB 3NBLA 4FCFA 4Z1WA 3N8RA 4CLCD 4KUOA 5HWVA 3MR0A 3HLGA 5L8MA 2RL3A 3I7JA 4HIAA 5CGXA 2VZWA 2OWHA 3UY6A 4B4XA 4BENA 5M19A 2YKHA 1MKMA 1K54C 4WEKA 2ZJ9A 2NUTC 2L1MA 4R3BA 5J7EA 3MXRA 4LRYC 3A3IA 1VQQA 3BQ8A 4I3AA 1RCJA 1SHVA 2R9XA 5HWTA 3PBTA 5IHVA 2O9BA 4WELA 2BG1A 1VETB 2XFTA 5HDDA 5TFQA 4E3OA 3H7WB 2JKRM 2J3WA 1ZG4A 4IUKA 2HDQA 4DXBA 3D3OA 1ZKJA 4GDNA 1TEMA 2ZQDA 3NCKA 4QU3A 1K56D 3A3FA 4H6JA 2ZD8A 2WAEA 4MN6A 4E3LA 1E25A 5EVLA 3TJZC 3IH8A 4XUZA 5GL9A 1FIKA 3M6HA 3ITAA 4I5SA 1DJCA 5AQ7A 1XJ4A 5CHMA 1BLPA 4DE2A 3D9YA 4X56A 1O7EA 1K57C 3UN7A 1JWPA 2KLIA 4Q0IA 1ERMA 3ZG8B 1S4RA 3FPWA 3LIDA 2Y79A 3M6BA 4DE0A 3BY8A 1V9ZA 5L07A 3VFFA 1F98A 3OLOA 4XT2B 1PYYA 1NJ4A 2PAVP 4N1HA 3A3JA 4H8RA 4R3AA 2HV1A 5TBMB 3BEBA 1MBLA 5L2FA 1CEFA 1OTBA 2B18A 3LY4A 3LUQA 3HLWA 4U0TA 1FSYA 3KSFA 5IU1A 2X71A 2FFFB 3EQUA 2Y2PA 1LT0A 5L09A 1S66L 2CMNA 4HJ6A 5EVIC 3IF5A 3SZTA 4PKYA 3F1NA 3GVBA 3KYEA 4NXBA 1XFNA 2M1CA 5FI2A 1IYSA 1YSQA 1BTLA 1GHPA 2Z6DA 5KSCA 3SH8A 1NWZA 1GSVA 1MXOA 3N7WA 1F5MA 1H8MA 3MS6A 3E2KA 4PKYG 4KZ8A 4KQQA 3C8CA 2WGWA 4PAUA 4PM8A 5CTMA 3ZYTA 3G32A 3TRCA 2ZQCA 4IVKA 4JXVA 3PBSA 1LL9A 3GTCA 3WS1A 1I5QA 3GECA 3HLBA 2WGIA 3R7WB 1W8YA 1SCWA 3LCEA 3IHBA 2JKTI 5CGSA 1N9LA 4ZAMA 1XJ2A 3CPTB 1EROA 3ZHHA 1YM1A 4HBTA 1N9NA 1XP4A 3BYDA 2A2LA 2W27A 2KX6A 2HJ9C 5J8XA 4FD8A 4WMCA 4EUVA 4C75A 2XFSA 4UA7A 2W3DA 4I38A 4HJ4A 1IKGA 5EVID 2GX5A 2RCXA 5GLDA 2W1TB 3KSIA 5F1FA 3T4OA 4G3VA 3QP1A 4MN5A 1H5XA 4GB7A 4S2MA 1SKOB 3ISGA 4I39A 1FILA 3RJUA 1G28A 2JHEA 3T1QB 2WKHA 3BFFA 4BD1A 1WYCA 3N8SA 2V9AA 1V9YA 4KZ7A 5FSRA 3O86A 2JCHA 3TW8A 1XJ6A 3Q07A 3IXHA 4S2PA 3K3CA 2ZQ7A 4E3NA 3NHQA 3LGOA 4K0WA 2B95A 4RVAA 5DKKA 1H0MA 4KZ6A 2A24B 1W79A 3PBRA 4KQOA 1W8QA 4HP9A 4WBGA 4I3IA 4LLOB 2GZAA 5AVFA 3G34A 3IBRA 1UWPX 3RXWA 2HDSA 1MWSA 1E4DA 5HL6A 2EX6A 3L7HA 5FASA 2EFXA 4OOMA 4B4ZA 3PXPA 2Y2NA 4WYYA 1G6OA 1P97A 2O9CA 4MN7A 3ZVTA 5FDHA 1I2SA 2KOIA 3JYIA 3CAXA 4DMZA 1HTZA 3T50A 2HDRA 4JF6A 3TSGA 3UMDA 3LR5A 1M6KA 1GHMA 3GSGA 5FAQA 1DP6A 2E8JA 2ZM8A 3FZCA 3LIFA 1IFQA 2WKEA 3P98A 2VGLM 4KG6A 4DJ2A 1MPLA 4LFUA 4BBUA 1K4FA 4JXSA 4WZ5C 1K4EA 2ZMVA 3GR2A 3PHYA 3UB8A 3VSKA 1TS7A 4ZBEA 2GJ3A 4DF6A 1PZPA 3F1PA 2VX8A 5HW3A 3DTKA 4D2OA 3IS2B 3C30A 5HDCA 1W7FA 4GNUA 2ZC3B 4JKTA 2IWCA 2X01A 4ESPA 1PIOA 1KDWA 1LI9A 2VV6A 2PU2A 3K2NA 4ZRRA 5CTNA 5FQJA 1UWNX 3OPRA 3V39A 3VE3A 3UPNA 3VOZA 2QPNA 2WGWB 1KE4A 1I2WA 1CI8A 5M18A 4OONA 4EXOA 1TS0A 4QY5A 3Q7ZA 3NJAA 2Y91A 4E04A 1VEUA 3A0SA 3D4FA 4NKPA 4HNBA 4MMNA 4F3LB 4RX3A 1GSWA 3LIEA 1XA7A 5I5LA 3E0YA 1D7EA 4FH4A 4JXGA 1BLHA 1OTDA 3UDFA 4UAAA 2ZMAA 3A3DA 5L10A 4O7DA 4DRTA 3QNCA 3ZNYA 3ZGAB 5FI6A 1ACFA 5A8BA 3IWOA 4NG2A 4EUZA 3MQOA 2L0WA 3NULA 4JLFA 1PFLA 3NOTC 1LL5A 3IX8A 2XSSA 3IHAA 2DCFA 4IEDA 4PPRA 1FR6A 4AFIA 3T1XA 1LI0A 1K55A 2WUQA 3EGDC 3NI9A 1L0GA 4E3KA 3ITBA 5F82A 1AWIA 3G4PA 4OQIA 5GHYA 1PNEA 1CI9A 4C6YA 2JKRI 4JGOA 4KENB 4Y3IA 3D72A 4HI4A 5CHUA 3E4OA 1S67L 1G5UA 4KQRA 1TDLA 4E6WA 1OJGA 5F1GA 5HAQA 2ZMFA 5F5YA 1M40A 3IWQA 2FH5A 4JF4A 4EWFA 1KOUA 2OSUA 3JPUA 3S7NA 2O0YA 4OOLA 3VOYA 1RGYA 4P6BA 3W4PA 1AXBA 4OP8A 2WK0A 2Y8HA 3ZG9B 1PZOA 5EVIB 2EX8A 2PD8A 2ZC7A 1FCMA 1CJFA 1MY8A 4C3QA 4X1MA 4X6TA 2K7SA 2Y2GA 1JNUA 5DVAA 1BULA 4QJGA 5F69A 3LR4A 4JXWA 4P6ZM 2P9VA 3ZCZA 4O01A 4HP4A 4DDYA 3CUEA 4UQIM 3LIAA 1BUEA 1DJBA 3EEHA 3MZDA 4YWZA 4IBRA 4R4SA 2XROA 3HREA 3PTEA 3IBJA 4GCZA 1IYOA 4E3JA 2ZL1A 2DNSA 4ZDXA 3CHWP 3NOPC 2UWXA 1O07A 4LV2A 1XKZA 3GDIA 1TDGA 3IH9A 1FSWA 3C7UA 2QHKA 3C4PA 2I72A 2EX9A 5A91A 3DBAA 2XD1A 1KDSA 2A49A 4K08A 5A90A 2PYRA 2ZQAA 3OPPA 4KUKA 4IHQA 4WEJA 2FZ0A 5EM1A 3EEAA 4BBVA 4IBXA 1K6SA 4OPZA 2J7VA 2EXBA 3HUNA 4MDZA 3JVUA 1Y28A 4IVIA 3UB7A 3PBQA 3CMZA 2C5WB 2J9PA 4JF5A 1XXMA 3LEZA 1PI4A 4QB8A 4ME4A 3DW0A 1FOFA 1FCNA 2QMIA 1MC0A 3HJIA 2W0NA 3T4LA 1VEUB 3N8LA 4HBUA 3UO9A 2IWDA 4P0MA 5AVEA 5CEDA 5HPIA 5D3OA 1D06A 2C6WB 2DMWA 3RXXA 2EXAA 4QY6A 2JN7A 1IOUA 1LLBA 4LENA 1P9RA 4OLDA 1ES4A 3MFDA 3UE3A 4CLCA 4Z9QA 4Q0JA 4R0QA 3WRTA 3CITA 1OTEA 4LV0A 3UPOA 3BECA 3BFCA 1P0ZA 5DF8A 2V0WA 1Z6FA 4NETA 2ZM0A 4S2LA 2PHYA 3IXBA 3N4IA 3NOUC 4GS9A 2WADA 3PR6A 5EOEA 5HWWA 1L0FA 4QWOA 4WMCD 5E43A 5G4YA 3BFGA 1W5DA 3MMHA 5A92A 3OOVA 1ESIA 3VP1A 4BQMA 2V1AA 4KG2A 5AJGA 2V8FA 4R38A 2Y2KA 4JGRA 4Y5FA 2W3HA 1XPBA 2ZC5B 1GA0A 5CXWA 2Q9NA 3IF6B 3QP5A 4RX2A 3IWIA 3KX0X 5A93A 4BMWA 4X69A 1T18A 2XQZA 4DXCA 2HJEA 4U0XA 3VP3A 3VOLA 2M7UA 3EQVA 1HVBA 2WZXA 4GLQA 5EE8A 1IKIA 3PBOA 2QJ5A 5KIZA 1YAXA 5FDSA 3UE0A 3GQZA 1S1YA 4HQAA 3V50A 4E3MA 2HP5A 4A5RA 1K54A 1NXYA 1ESUA 3HLCA 3E4QA 1ODVA 5DF9A 2X02A 1ES5A 2WAFA 3QP4A 2ZQ9A 3H82A 1YPRA 5K5BA 1D1JA 3OPHA 4G3KA 1H8ZA 4OQ0A 4EBNA 3ZG7B 4N9KA 4S2NC 3IX3A 5JYPA 5HL1A 3GV9A 1TVFA 5E2FA 3QP2A 3QP8A 2QKPA 2PR6A 4UHUA 3M2KA 1T1AA 4WZ4A 2QWSA 3KYZA 1J3WA 1DP9A 1NZUA 4IJGA 5FQKA 1HZOA 3LI8A 4GW9A 2JBFA 1IELA 3EWKA 3VP4A 4PHTA 5EFWA 3BQAA 4R6LA 5DF7A 5G4ZA 3A0RA 1K57A 2YKFA 2L4RA 1OT9A 3RFBA 4QPRA 4P87A 3G31A 1S4SA 5DJUA 4H6JB 3Q7VA 1Y54A 2XDMA 2ZQ8A 1XX2A 2A3UA 4DE3A 4WM9A 4R3JA 1FQGA 5EPHA 1L2SA 4ZJ2A 4HHDA 4P85A 2OAP1 4PMAA 3PAEA 2W3EA 4DJ3A 1PW1A 5DTTA 3FYZA 2Y55A 3OZHA 4ARZA 1N9BA 3KO6A 4UEYA 3BFDA 3O3VA 4JGPA 4R1GA 4N9LA 4YINA 1XFQA 2OOLA 3FKWA 4BBTA 3V5MA 5KZHA 1UGUA 3NDGA 5FAPA 4EERA 3UDXA 4Y2FA 3Q1FA 1STZA 3E4PA 4D60A 1BYWA 1YT4A 3WS0A 2PR5A 4ID4A 2CC1A 3RTYA 1F9IA 1PI5A 1S1ZA 4GN2A 5F83A 3WS2A 2VK3A 2V20A 3IF6C 4BWIA 2Q0OA 2IWBA 1CQAA 3QP6A 5HDSA 1BLCA 5HZHA 1KGEA 3VP2A 2Q9MA 4GJ4A 1K38A 4GHIA 5FEFA 4ETXA 2VLGA 1NRFA 4S2JA 3KSGA 3HLEA 3MQ0A 5C5KA 3F1NB 4QD4A 3CWFA 2HDUA 4MNRA 3LIBA 4EESA 1YMSA 2VKSA 3G2YA 5EV0A 1K0KA 2BLSA 3G2ZA 3VE4A 3W4OA 2JKGA 4HESA 4OKPA 5FAOA 5BOHA 2Y2QA 5E2GA 3W4QA 4BL2A 2PBDP 1ZC2A 3HJKA 1DP8A 1VETA 3UB5P 1YLYA 2J9OA 3H7WA 4EV4A 4CQHA 4RQ9A 4EQ1A 4L9GA 1YLPA 4B9OA 3LFVA 4CLCE 4Y15A 3TOIA 5EM0A 2XEPA 1LSWA 1JTDA 1OPXA 3AGEA 3CI6A 4WF0A 4DE1A 4XXRA 1KGGA 1EW0A 4M4XA 5DFXA 1EWZA 3FV7A 4CJNA 1E3UA 5GLBA 3T4SA 5F6AA 3LYXA 4BLMA 3IQAA 5CHJA 3S22A 2PYPA 3OCLA 3ZQ5A 5HD3A 2G7UA 2Z2MB 1PRQA 3T4TA 4GDBA 4MBFA 1XGIA 3UDIA 1W63Q 5EUAA 3CZDA 4R70A 4P6ZS 2OWJA 4EBLA 1OTAA 1K6RA 4Y0TA 5HFOA 1JWVA 1KVLA 4UQIS 3VP0A 4B88A 4MBKA 3A0VA 5M1AA 4LGWA 2EWWA 3HUOA 4GD8A 2Y2JA 4R4RA 1ZTUA 4XT2A 2XA7M 3ICYA 3C38A 4IUHA 2H10A 1ZG6A 2JKFA 1ES2A 5TBMA 2M7VA 3S1YA 1XGJA 1H3QA 3R4KA 2ZM2A 4FUWA 2J80A 2P08A 1KE0A 1JTGA 3CG5A 3W8KA 3O5YA 3VSLA 1YLJA 1GSXA 3OCNA 4Y0UA 5HD5A 3S7OA 5KSHA 5I94A 2IA2A 1MWTA 2Y4AA 4RA7A 2D02A 4F94A 3IXGA 4OOYA 3JVVA 2VGJA 3MZEA 4HOIA 5FEGA 4FTXA 1KGFA 2HF6A 4N1XA 5CGWA 2XR0A 4Y7PA 2GDNA 2I9VA 2JC7A 3FPVA 2Y2LA 3MFXA 4WZ5A 4LRXC 1QMEA 2Z6CA 1L0EA 3NIAA 1OTIA 5TR7A 3K3DA 3R7WA 5IS1A 3AGDA 4KZ4A 4MBHA 2BASA 3W2ZA 1MKIA 4X53A 2XK1A 1XJ3A 3LO7A 4GD6A 1L0DA 3CPTA 3ZFZA 4PM7A 1YMXA 3C5AA 2ZBBA 4S2OA 5FQIA 3CJMA 2UV0E 1L3LA 2O99A 1VM1A 2J8YA 1W63M 3MQQA 3MF0A 3HLFA 2QJ7A 5FL3A 2WGVA 4XUXA 2W1TA 4NXFA 3F1PB 4OLGA 3LI9A 3SS4A 2J3TC 3T1SA 3EOIA 4OPQA 2Y2MA 4RYEA 3T12B 1U60A 1SKOA 2INWA 1KE3A 4KZ5A 1T1CA 3G35A 3LEQA 2Y2OA 2DRWA 2VV7A 3UNWA 3FKVA 3SOIA 5J3WA 4LV1A 3MXQA 1BSGA 5DJTA 2ZOHA 4HH3A 4Y0OA 5AQBA 5E2EA 2P04A 1NY0A 4LCMA 2XGNA 1OMEA 4KG5A 3HL9A 4BL3A 1MWUA 2A24A 5AQ9A 3A3EA 5HPFA 3GMWA 5TGFA 4BJPA 1DJAA 5EVEA 1YLZA 1GCEA 2XRNA 3Q82A 4O8GA 3ZVWA 2V8CA 1YSPA 3GRJA 1NZOA 3OC2A 5TJJA 1IEMA 3B33A 2W1RA 1NYYA 4OVDA 5E2HA 3SW1A 4UA9A 3ZNTA 2XD5A 3C7VA 4NK3A 1TD5A 3OBFA 4ZJ1A 1DY6A 4EBPA 3Q81A 2Y59A 2V1ZA 2J3TD 3F1OA 3UMEA 3BLMA 4X68A 1FR1A 5FA7A 1GHIA 3HLDA 3MJQA 4NXEA 4EEPA 1SDEA 2ZC6B 1BZAA 2WKIA 2MJ6A 4NEED 5CRFA 3T4JA 4FOFA 3EGXC 5GLAA 1TS6A 5FQQA 1ZHHB 2XH9A 4MCWA 3RH8B 2ACGA 2K2NA 2B5RA 4E6XA 4GOGA 1K56A 1RGZA 4WN5A 4EETB 2P74A 5DTKA 2Y2IA 3TE8A 4N92A 4E3IA 5LBRA 4MLLA 2VGKA 5EOOA 3DTEA 4O0PA 3TG9A 3MXSA 5GLCA 1P9WA 3VV4A 3IS2A 4KZBA 1PW8A 1SDNA 2GNXA 3LR0A 3H9WA 3B47A 5FI7A 2ZLYA 5CEBA 4ZJ3A 3O88A 4GZBA 3ZG0A 1LL8A 5F68A 4OQGA 1IYQA 2EFUA 4BD0A 1NRJA 4JPMA 4Y13A 4DDSA 1CK3A 5DFYA 2E8IA 2LB9A 1GA9A 5CECA 3U4LP 4YFMA 1G6AA 3DWKA 4FSFA 1WE4A 3V3RA 4ZTKA 2V1BA 2P9VB 4F3LA 5HX9A 2OLVA 1HLUP 2ZC4B 3C2WA 5GHXA 3BM6A 1KVMA 3KYQA 2PD7A 2OLUA 2VJWA 2R78A 4KZ3A 2V2FF 2VA0A 4S2IA 3SH9A 2PU4A 3B42A 3DWZA 2WYXA 2H0TA 5DTSA 1QMFA 1ALQA 2ZL1B 4GKUA 3N6IA 4G3WA 3MBZA 4HJ3A 5MC7A 2VGLS 5J4EA 2R9WA 3FG8A 5AQAA 1YQSA 2OV5A 2HP6A 1G68A 4EEUA 3NC8A 3FWLA 1FCOA 2B02A 4LPZA 1TS8A 3NECA 4B93A 1S6RA 3T4KA 4HH2A 2W3GA 4K91A 1JVJA 1T1BA 3BY9A 4EW7A 5FQ9A 3S7PA 3AGFA 5HARA 3SS3A 1ONHA 3E2LA 3WWXA 3QHYA 1JWZA 3BLSA 1NLYA 2QYBA 3UB6A 3MZFA 4JGQA 3NY4A 3S4XA 4OP5A 2V0UA 1MWRA 1Y4OA 1K55C 5U47A 4WL9A 4KZAA 4Y17A 1OJ5A 1PWGA 1Q2QA 2PDRA 1PWCA 1S0WA 1WYBA 3VMAA 4ETZA 4X55A 2EX2A 1ERQA 5EVIA 3SH7A 4Q8IA 4CLCB 4L9EA 3UPPA 1VB6A 1YLWA 3MKEA 3V3SA 2XF3A 2JKTM 4HY8A 3B3XA 3F1OB 4WUJA 4JBFA 2WKPA 4EU0A 3LR3A 3P7NA 1E3UD 5DKLA 2H28A 4II7A 4GS9B 3OPLA 4U3TA 2AVXA 3P09A 4FH2A 4QHCA 4DKIA 5GHZA 2XA7S 4S2KA 4YNRA 3FC7A 3BW6A 1ONGA 3LICA 2H5SA 1F2KA 5JYOA 3CLOA 4PM5A 1C3BA 2HPBA 4OH0A 4K0XA 3WS4A 4LCLA 4OPYA 3ZDJA 3KSHA 2P7JA 3CUEC 1NYMA 1NLZA 2WKRA 3T1RA 5HSQA 3E98A 4HEFA 1H8YA 2OAQ1 4S2NA 2W3FA 3IXDA 4I3JA 5FATA 3G6OA 3O87A 5EECA 3UB9A 3C4OA 4L0LA 3HCYA 1A0KA 4EQIA 4MEZA 1XA1A 2BTFP 1VHMA 1EI5A 3S7QA 3IX4A 2VEAA 1Q2PA 3H82B 2D01A 5CX7A 2EA9A 4YOFA 3NDEA 2K31A 4OPRA 1LSXA 1BLSA 2ZOIA 2HGVA 3BJNA 1RP5A 3U2AA 1ES3A 3L9KA 5HAPA 1MZUA 5CERA 3DTMA 4X25A 3UE1A 1N4OA 2O9AA 2PBYA 3MKFA 4DN0A 3HUMA 5HAIA 4LV3A 3BRMA 1J9MA 4UA6A 4KZ9A 5FQMA 3PYPA 4KQDA 2PRFA 2VV8A 4L9FA 4PM9A 5G18A 1IYPA 1DRMA 5KMWA 1X0OA 1Z09A 4NXGA 2LB5A 2HZ5A 4CPKA 3M2JA 3SS5A 2XLNA 3HVFA 4Q0HA 3PBNA 4R23A 3Q7VB 4CLCC 1HD8A 2QZ6A 1LSVA 3P01A 2H0YA 2G2UA 2EWVA 2G2WA 3BWLA 3V67A 3VFHA 1SZVA 2NUPC
chains in the Genus database with same CATH topology
1N9OA 1TS7A 2GJ3A 3OC2A 2PT7A 3F1PA 2VX8A 5TJJA 2QKPA 3B33A 3IS2B 3C30A 5HDCA 4ARZB 2W1RA 2PR6A 1T1AA 3SW1A 2QWSA 3KYZA 3T4QA 1TD5A 1DP9A 3OBFA 2VV6A 3F1OA 3UMEA 2J3TD 3K2NA 4IJGA 4ZRRA 3UE6A 3MJQA 1UWNX 3VE3A 4NXEA 3LI8A 4GW9A 4EEPA 1T19A 3EWKA 4PHTA 2MJ6A 5EFWA 3BQAA 4NEED 4R6LA 4EXOA 5G4ZA 3T4JA 3A0RA 2YKFA 1TS0A 4FOFA 3EGXC 3ULFA 2L4RA 1OT9A 1TS6A 3RFBA 3NJAA 4QPRA 1YKDA 4E04A 1ZHHB 1S4SA 1WA9A 3A0SA 4MCWA 3RH8B 4NKPA 4HNBA 4MMNA 5DJUA 4F3LB 1GSWA 3LIEA 2WKQA 4H6JB 5I5LA 3E0YA 5IT5A 1D7EA 1TF1A 2K2NA 4WLAA 1OTDA 4LRZE 1OT6A 2KDKA 4WN5A 4EETB 4GHIB 3TE8A 4HHDA 5LBRA 2OAP1 4Z1WA 4CLCD 4KUOA 5HWVA 3MR0A 5L8MA 2W3EA 4DJ3A 4HIAA 5A8BA 4O0PA 2VZWA 2OWHA 1P9WA 3VV4A 3IS2A 3MQOA 2L0WA 4ARZA 3KO6A 2GNXA 4UEYA 3LR0A 3H9WA 3NOTC 4JGPA 2YKHA 3B47A 1XFQA 2OOLA 2XSSA 1MKMA 4WEKA 4BBTA 2NUTC 2L1MA 5J7EA 4LRYC 1UGUA 3BQ8A 4AFIA 4I3AA 1LL8A 5F68A 4EERA 4Y2FA 1STZA 3E4PA 1NRJA 5HWTA 3PBTA 1BYWA 2O9BA 4WELA 3EGDC 5HDDA 2PR5A 3H7WB 5DFYA 2LB9A 3RTYA 1F9IA 1S1ZA 2JKRM 2J3WA 4FSFA 4IUKA 4BWIA 3D3OA 2V1BA 4F3LA 4H6JA 5HDSA 2JKRI 4JGOA 3C2WA 4MN6A 4Y3IA 3D72A 4HI4A 3TJZC 5HZHA 3E4OA 3KYQA 1S67L 2PD7A 2VJWA 2R78A 4GJ4A 2VA0A 1OJGA 4GHIA 4I5SA 4ETXA 2VLGA 2ZMFA 5F5YA 3KSGA 3B42A 2FH5A 3MQ0A 5C5KA 1XJ4A 3F1NB 1KOUA 3CWFA 4G3WA 4HJ3A 3S7NA 5MC7A 3LIBA 2O0YA 2VGLS 5J4EA 4OOLA 4EESA 2VKSA 3FG8A 2KLIA 3VE4A 2Y8HA 4EEUA 4Q0IA 2NUPC 1S4RA 3FPWA 3LIDA 2Y79A 2PD8A 2B02A 4LPZA 3BY8A 1TS8A 1V9ZA 4B93A 3HJKA 1DP8A 3T4KA 2K7SA 4HH2A 2W3GA 3H7WA 1T1BA 1F98A 1JNUA 3BY9A 3OLOA 4CQHA 4EW7A 4XT2B 4RQ9A 4EQ1A 3S7PA 4L9GA 4B9OA 5F69A 3LR4A 3LFVA 4CLCE 4P6ZM 4R3AA 2HV1A 5TBMB 4O01A 1LSWA 1OTBA 2B18A 4HP4A 1NLYA 1OPXA 2QYBA 3UB6A 3LUQA 3CUEA 4UQIM 3CI6A 3LIAA 4WF0A 3KSFA 5IU1A 4JGQA 1EW0A 3EQUA 3EEHA 4YWZA 4M4XA 5DFXA 2V0UA 1LT0A 1S66L 2CMNA 3T4SA 4HJ6A 5F6AA 3LYXA 2XROA 4PKYA 2PYPA 3F1NA 3IBJA 3OCLA 4WL9A 4GCZA 4NXBA 5HD3A 3ZQ5A 2G7UA 1XFNA 3T4TA 1OJ5A 2M1CA 1YSQA 3NOPC 1W63Q 2PDRA 3GDIA 4R70A 2Z6DA 4P6ZS 2OWJA 1OTAA 4ETZA 1NWZA 1GSVA 2QHKA 1F5MA 1H8MA 4PKYG 4UQIS 3A0VA 3DBAA 4CLCB 4L9EA 4K08A 2PYRA 2EWWA 3C8CA 4KUKA 4PAUA 4IHQA 4WEJA 3ZYTA 2FZ0A 3TRCA 1VB6A 3EEAA 4BBVA 1ZTUA 4XT2A 2JKTM 2XA7M 3ICYA 3PBSA 3C38A 4HY8A 4IUHA 3GECA 3F1OB 4MDZA 4WUJA 3R7WB 3JVUA 1Y28A 2WKPA 3UB7A 3PBQA 5TBMA 2M7VA 1H3QA 3R4KA 4EU0A 2JKTI 2J80A 2P08A 3LR3A 1N9LA 3P7NA 5DKLA 2H28A 4II7A 4ME4A 1XJ2A 1MC0A 3O5YA 4GS9B 3HJIA 2W0NA 3T4LA 1GSXA 1N9NA 3OCNA 5HD5A 3S7OA 5KSHA 2A2LA 5AVEA 2W27A 5HPIA 2KX6A 1D06A 2IA2A 2HJ9C 2XA7S 2D02A 2DMWA 4YNRA 4EUVA 3FC7A 3BW6A 2JN7A 2W3DA 3JVVA 1IOUA 3LICA 4I38A 4HJ4A 4HOIA 3CLOA 2GX5A 2W1TB 2HF6A 3KSIA 3T4OA 4G3VA 4MN5A 1P9RA 3UE3A 3KSHA 4CLCA 2P7JA 3CUEC 1NLZA 2WKRA 4Q0JA 2I9VA 5HSQA 3FPVA 3E98A 3MFXA 4I39A 4LRXC 1G28A 2JHEA 2OAQ1 2W3FA 4I3JA 2Z6CA 3CITA 1OTEA 3G6OA 1OTIA 3UB9A 3K3DA 3R7WA 5IS1A 2V9AA 1V9YA 3TW8A 2BASA 3W2ZA 4L0LA 1P0ZA 1XJ6A 3HCYA 2V0WA 1XJ3A 3K3CA 2PHYA 3NOUC 4GS9A 1VHMA 3NHQA 3PR6A 5HWWA 2ZBBA 3S7QA 2VEAA 5DKKA 2A24B 5G4YA 3H82B 3PBRA 3MMHA 2D01A 3OOVA 4KQOA 4HP9A 2O99A 5CX7A 2EA9A 2V1AA 4I3IA 4LLOB 1W63M 5AJGA 3MQQA 2GZAA 3MF0A 5AVFA 4R38A 4JGRA 4YOFA 3IBRA 4Y5FA 2QJ7A 5FL3A 2K31A 2W3HA 1UWPX 2W1TA 4NXFA 1LSXA 2ZOIA 2HGVA 3BJNA 3F1PB 3U2AA 3LI9A 5HL6A 1MZUA 3KX0X 2J3TC 4OOMA 4BMWA 3PXPA 1T18A 3EOIA 1G6OA 1P97A 2O9CA 2O9AA 4MN7A 4DN0A 2INWA 2HJEA 2KOIA 3CAXA 3VOLA 2M7UA 4DMZA 3EQVA 3PYPA 4GLQA 1T1CA 4KQDA 2VV8A 4L9FA 2VV7A 3T50A 3PBOA 2QJ5A 1DRMA 5KIZA 1X0OA 4NXGA 5J3WA 1YAXA 3UMDA 3LR5A 3MXQA 2LB5A 5DJTA 1DP6A 1S1YA 2ZOHA 4HH3A 4HQAA 3LIFA 1IFQA 2P04A 2VGLM 4Q0HA 4DJ2A 3PBNA 3E4QA 1ODVA 5DF9A 2A24A 4CLCC 3H82A 5HPFA 5K5BA 1LSVA 4BBUA 3P01A 4G3KA 4BJPA 2EWVA 2ZMVA 3BWLA 3PHYA 3V67A 2XRNA 4O8GA 3UB8A 1YSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9O A;  1TS7 A;  2GJ3 A;  3F1P A;  2QKP A;  3B33 A;  3IS2 B;  5HDC A;  2PR6 A;  1T1A A;  3SW1 A;  2QWS A;  1DP9 A;  2VV6 A;  3F1O A;  3UME A;  3UE6 A;  3MJQ A;  1UWN X;  3VE3 A;  4NXE A;  3LI8 A;  4GW9 A;  4EEP A;  1T19 A;  3EWK A;  5EFW A;  4R6L A;  4EXO A;  5G4Z A;  3A0R A;  2YKF A;  1TS0 A;  3ULF A;  2L4R A;  1OT9 A;  1TS6 A;  3NJA A;  4E04 A;  1S4S A;  1WA9 A;  3A0S A;  3RH8 B;  4HNB A;  5DJU A;  4F3L B;  1GSW A;  3LIE A;  2WKQ A;  4H6J B;  5I5L A;  1D7E A;  4WLA A;  1OTD A;  4LRZ E;  1OT6 A;  2KDK A;  4WN5 A;  4EET B;  4GHI B;  4HHD A;  4KUO A;  5HWV A;  3MR0 A;  4DJ3 A;  4HIA A;  5A8B A;  2OWH A;  3IS2 A;  3MQO A;  2L0W A;  3H9W A;  3NOT C;  4JGP A;  2YKH A;  1XFQ A;  2OOL A;  4BBT A;  2L1M A;  5J7E A;  4LRY C;  1UGU A;  4I3A A;  1LL8 A;  5F68 A;  4EER A;  3E4P A;  5HWT A;  1BYW A;  5HDD A;  2PR5 A;  3H7W B;  3RTY A;  1F9I A;  1S1Z A;  2V1B A;  4F3L A;  4H6J A;  5HDS A;  4JGO A;  3C2W A;  4MN6 A;  3D72 A;  4HI4 A;  5HZH A;  3E4O A;  1S67 L;  2PD7 A;  2R78 A;  1OJG A;  4GHI A;  4I5S A;  2VLG A;  5F5Y A;  1XJ4 A;  3F1N B;  1KOU A;  3CWF A;  4HJ3 A;  3LIB A;  5J4E A;  4EES A;  3FG8 A;  3VE4 A;  4EEU A;  1S4R A;  3LID A;  2PD8 A;  2B02 A;  4LPZ A;  3BY8 A;  1TS8 A;  1V9Z A;  3HJK A;  1DP8 A;  2K7S A;  4HH2 A;  3H7W A;  1T1B A;  1F98 A;  1JNU A;  3BY9 A;  3OLO A;  4EW7 A;  4XT2 B;  4RQ9 A;  4EQ1 A;  4L9G A;  4B9O A;  5F69 A;  4R3A A;  2HV1 A;  5TBM B;  1LSW A;  1OTB A;  4HP4 A;  3UB6 A;  3LUQ A;  3LIA A;  4WF0 A;  5IU1 A;  4JGQ A;  1EW0 A;  3EEH A;  4YWZ A;  4M4X A;  2V0U A;  1LT0 A;  1S66 L;  2CMN A;  4HJ6 A;  5F6A A;  3LYX A;  4PKY A;  2PYP A;  3F1N A;  4WL9 A;  4GCZ A;  4NXB A;  5HD3 A;  3ZQ5 A;  1XFN A;  1OJ5 A;  2M1C A;  3NOP C;  2PDR A;  3GDI A;  4R70 A;  2Z6D A;  2OWJ A;  1OTA A;  1NWZ A;  1GSV A;  2QHK A;  4PKY G;  3A0V A;  4L9E A;  4K08 A;  2PYR A;  3C8C A;  4KUK A;  1VB6 A;  4BBV A;  4XT2 A;  3ICY A;  4HY8 A;  3GEC A;  3F1O B;  4WUJ A;  1Y28 A;  2WKP A;  3UB7 A;  5TBM A;  2J80 A;  1N9L A;  3P7N A;  5DKL A;  2H28 A;  1XJ2 A;  4GS9 B;  3HJI A;  2W0N A;  1GSX A;  1N9N A;  5HD5 A;  5AVE A;  2W27 A;  2KX6 A;  1D06 A;  2D02 A;  3FC7 A;  2JN7 A;  3LIC A;  4I38 A;  4HJ4 A;  4HOI A;  3CLO A;  4MN5 A;  2P7J A;  2WKR A;  2I9V A;  5HSQ A;  3MFX A;  4I39 A;  4LRX C;  1G28 A;  2JHE A;  4I3J A;  2Z6C A;  1OTE A;  3G6O A;  1OTI A;  3UB9 A;  3K3D A;  5IS1 A;  2V9A A;  1V9Y A;  2BAS A;  1P0Z A;  1XJ6 A;  2V0W A;  1XJ3 A;  3K3C A;  2PHY A;  3NOU C;  4GS9 A;  3NHQ A;  5HWW A;  2ZBB A;  2VEA A;  5DKK A;  2A24 B;  5G4Y A;  3H82 B;  2D01 A;  4HP9 A;  2EA9 A;  2V1A A;  4I3I A;  4LLO B;  3MQQ A;  5AVF A;  4R38 A;  4JGR A;  3IBR A;  2QJ7 A;  1UWP X;  4NXF A;  1LSX A;  2ZOI A;  3F1P B;  3LI9 A;  1MZU A;  3KX0 X;  1T18 A;  1P97 A;  2INW A;  3CAX A;  3VOL A;  3PYP A;  4KQD A;  1T1C A;  2VV8 A;  4L9F A;  2VV7 A;  3T50 A;  2QJ5 A;  1DRM A;  5KIZ A;  1X0O A;  4NXG A;  5J3W A;  3UMD A;  3MXQ A;  5DJT A;  1DP6 A;  1S1Y A;  2ZOH A;  4HH3 A;  4HQA A;  3LIF A;  4DJ2 A;  3E4Q A;  1ODV A;  2A24 A;  3H82 A;  1LSV A;  4BBU A;  3BWL A;  3PHY A;  3UB8 A; 
#chains in the Genus database with same CATH topology
 1N9O A;  2HP9 A;  2PT7 A;  3IF6 A;  3MSH A;  3WS5 A;  4ARZ B;  3DTI A;  2Z2L B;  1CF0 A;  3PAG A;  3QNB A;  4X1L A;  3T4Q A;  1CEG A;  1YLT A;  3DAV A;  3IT9 A;  3HBR A;  3UE6 A;  1K25 A;  3BFE A;  1LHY A;  1BT5 A;  1T19 A;  2JE5 A;  1PWD A;  2FFY A;  4M3K A;  4PM6 A;  3ULF A;  3G30 A;  1YKD A;  2WZZ A;  1WA9 A;  3LY3 A;  1SKF A;  3WRZ A;  2WKQ A;  4OQH A;  3ZG5 A;  2Y2H A;  5IT5 A;  1TF1 A;  4WLA A;  4LRZ E;  1OT6 A;  2KDK A;  4GHI B;  3NBL A;  4FCF A;  4Z1W A;  3N8R A;  4CLC D;  4KUO A;  5HWV A;  3MR0 A;  3HLG A;  5L8M A;  2RL3 A;  3I7J A;  4HIA A;  5CGX A;  2VZW A;  2OWH A;  3UY6 A;  4B4X A;  4BEN A;  5M19 A;  2YKH A;  1MKM A;  1K54 C;  4WEK A;  2ZJ9 A;  2NUT C;  2L1M A;  4R3B A;  5J7E A;  3MXR A;  4LRY C;  3A3I A;  1VQQ A;  3BQ8 A;  4I3A A;  1RCJ A;  1SHV A;  2R9X A;  5HWT A;  3PBT A;  5IHV A;  2O9B A;  4WEL A;  2BG1 A;  1VET B;  2XFT A;  5HDD A;  5TFQ A;  4E3O A;  3H7W B;  2JKR M;  2J3W A;  1ZG4 A;  4IUK A;  2HDQ A;  4DXB A;  3D3O A;  1ZKJ A;  4GDN A;  1TEM A;  2ZQD A;  3NCK A;  4QU3 A;  1K56 D;  3A3F A;  4H6J A;  2ZD8 A;  2WAE A;  4MN6 A;  4E3L A;  1E25 A;  5EVL A;  3TJZ C;  3IH8 A;  4XUZ A;  5GL9 A;  1FIK A;  3M6H A;  3ITA A;  4I5S A;  1DJC A;  5AQ7 A;  1XJ4 A;  5CHM A;  1BLP A;  4DE2 A;  3D9Y A;  4X56 A;  1O7E A;  1K57 C;  3UN7 A;  1JWP A;  2KLI A;  4Q0I A;  1ERM A;  3ZG8 B;  1S4R A;  3FPW A;  3LID A;  2Y79 A;  3M6B A;  4DE0 A;  3BY8 A;  1V9Z A;  5L07 A;  3VFF A;  1F98 A;  3OLO A;  4XT2 B;  1PYY A;  1NJ4 A;  2PAV P;  4N1H A;  3A3J A;  4H8R A;  4R3A A;  2HV1 A;  5TBM B;  3BEB A;  1MBL A;  5L2F A;  1CEF A;  1OTB A;  2B18 A;  3LY4 A;  3LUQ A;  3HLW A;  4U0T A;  1FSY A;  3KSF A;  5IU1 A;  2X71 A;  2FFF B;  3EQU A;  2Y2P A;  1LT0 A;  5L09 A;  1S66 L;  2CMN A;  4HJ6 A;  5EVI C;  3IF5 A;  3SZT A;  4PKY A;  3F1N A;  3GVB A;  3KYE A;  4NXB A;  1XFN A;  2M1C A;  5FI2 A;  1IYS A;  1YSQ A;  1BTL A;  1GHP A;  2Z6D A;  5KSC A;  3SH8 A;  1NWZ A;  1GSV A;  1MXO A;  3N7W A;  1F5M A;  1H8M A;  3MS6 A;  3E2K A;  4PKY G;  4KZ8 A;  4KQQ A;  3C8C A;  2WGW A;  4PAU A;  4PM8 A;  5CTM A;  3ZYT A;  3G32 A;  3TRC A;  2ZQC A;  4IVK A;  4JXV A;  3PBS A;  1LL9 A;  3GTC A;  3WS1 A;  1I5Q A;  3GEC A;  3HLB A;  2WGI A;  3R7W B;  1W8Y A;  1SCW A;  3LCE A;  3IHB A;  2JKT I;  5CGS A;  1N9L A;  4ZAM A;  1XJ2 A;  3CPT B;  1ERO A;  3ZHH A;  1YM1 A;  4HBT A;  1N9N A;  1XP4 A;  3BYD A;  2A2L A;  2W27 A;  2KX6 A;  2HJ9 C;  5J8X A;  4FD8 A;  4WMC A;  4EUV A;  4C75 A;  2XFS A;  4UA7 A;  2W3D A;  4I38 A;  4HJ4 A;  1IKG A;  5EVI D;  2GX5 A;  2RCX A;  5GLD A;  2W1T B;  3KSI A;  5F1F A;  3T4O A;  4G3V A;  3QP1 A;  4MN5 A;  1H5X A;  4GB7 A;  4S2M A;  1SKO B;  3ISG A;  4I39 A;  1FIL A;  3RJU A;  1G28 A;  2JHE A;  3T1Q B;  2WKH A;  3BFF A;  4BD1 A;  1WYC A;  3N8S A;  2V9A A;  1V9Y A;  4KZ7 A;  5FSR A;  3O86 A;  2JCH A;  3TW8 A;  1XJ6 A;  3Q07 A;  3IXH A;  4S2P A;  3K3C A;  2ZQ7 A;  4E3N A;  3NHQ A;  3LGO A;  4K0W A;  2B95 A;  4RVA A;  5DKK A;  1H0M A;  4KZ6 A;  2A24 B;  1W79 A;  3PBR A;  4KQO A;  1W8Q A;  4HP9 A;  4WBG A;  4I3I A;  4LLO B;  2GZA A;  5AVF A;  3G34 A;  3IBR A;  1UWP X;  3RXW A;  2HDS A;  1MWS A;  1E4D A;  5HL6 A;  2EX6 A;  3L7H A;  5FAS A;  2EFX A;  4OOM A;  4B4Z A;  3PXP A;  2Y2N A;  4WYY A;  1G6O A;  1P97 A;  2O9C A;  4MN7 A;  3ZVT A;  5FDH A;  1I2S A;  2KOI A;  3JYI A;  3CAX A;  4DMZ A;  1HTZ A;  3T50 A;  2HDR A;  4JF6 A;  3TSG A;  3UMD A;  3LR5 A;  1M6K A;  1GHM A;  3GSG A;  5FAQ A;  1DP6 A;  2E8J A;  2ZM8 A;  3FZC A;  3LIF A;  1IFQ A;  2WKE A;  3P98 A;  2VGL M;  4KG6 A;  4DJ2 A;  1MPL A;  4LFU A;  4BBU A;  1K4F A;  4JXS A;  4WZ5 C;  1K4E A;  2ZMV A;  3GR2 A;  3PHY A;  3UB8 A;  3VSK A;  1TS7 A;  4ZBE A;  2GJ3 A;  4DF6 A;  1PZP A;  3F1P A;  2VX8 A;  5HW3 A;  3DTK A;  4D2O A;  3IS2 B;  3C30 A;  5HDC A;  1W7F A;  4GNU A;  2ZC3 B;  4JKT A;  2IWC A;  2X01 A;  4ESP A;  1PIO A;  1KDW A;  1LI9 A;  2VV6 A;  2PU2 A;  3K2N A;  4ZRR A;  5CTN A;  5FQJ A;  1UWN X;  3OPR A;  3V39 A;  3VE3 A;  3UPN A;  3VOZ A;  2QPN A;  2WGW B;  1KE4 A;  1I2W A;  1CI8 A;  5M18 A;  4OON A;  4EXO A;  1TS0 A;  4QY5 A;  3Q7Z A;  3NJA A;  2Y91 A;  4E04 A;  1VEU A;  3A0S A;  3D4F A;  4NKP A;  4HNB A;  4MMN A;  4F3L B;  4RX3 A;  1GSW A;  3LIE A;  1XA7 A;  5I5L A;  3E0Y A;  1D7E A;  4FH4 A;  4JXG A;  1BLH A;  1OTD A;  3UDF A;  4UAA A;  2ZMA A;  3A3D A;  5L10 A;  4O7D A;  4DRT A;  3QNC A;  3ZNY A;  3ZGA B;  5FI6 A;  1ACF A;  5A8B A;  3IWO A;  4NG2 A;  4EUZ A;  3MQO A;  2L0W A;  3NUL A;  4JLF A;  1PFL A;  3NOT C;  1LL5 A;  3IX8 A;  2XSS A;  3IHA A;  2DCF A;  4IED A;  4PPR A;  1FR6 A;  4AFI A;  3T1X A;  1LI0 A;  1K55 A;  2WUQ A;  3EGD C;  3NI9 A;  1L0G A;  4E3K A;  3ITB A;  5F82 A;  1AWI A;  3G4P A;  4OQI A;  5GHY A;  1PNE A;  1CI9 A;  4C6Y A;  2JKR I;  4JGO A;  4KEN B;  4Y3I A;  3D72 A;  4HI4 A;  5CHU A;  3E4O A;  1S67 L;  1G5U A;  4KQR A;  1TDL A;  4E6W A;  1OJG A;  5F1G A;  5HAQ A;  2ZMF A;  5F5Y A;  1M40 A;  3IWQ A;  2FH5 A;  4JF4 A;  4EWF A;  1KOU A;  2OSU A;  3JPU A;  3S7N A;  2O0Y A;  4OOL A;  3VOY A;  1RGY A;  4P6B A;  3W4P A;  1AXB A;  4OP8 A;  2WK0 A;  2Y8H A;  3ZG9 B;  1PZO A;  5EVI B;  2EX8 A;  2PD8 A;  2ZC7 A;  1FCM A;  1CJF A;  1MY8 A;  4C3Q A;  4X1M A;  4X6T A;  2K7S A;  2Y2G A;  1JNU A;  5DVA A;  1BUL A;  4QJG A;  5F69 A;  3LR4 A;  4JXW A;  4P6Z M;  2P9V A;  3ZCZ A;  4O01 A;  4HP4 A;  4DDY A;  3CUE A;  4UQI M;  3LIA A;  1BUE A;  1DJB A;  3EEH A;  3MZD A;  4YWZ A;  4IBR A;  4R4S A;  2XRO A;  3HRE A;  3PTE A;  3IBJ A;  4GCZ A;  1IYO A;  4E3J A;  2ZL1 A;  2DNS A;  4ZDX A;  3CHW P;  3NOP C;  2UWX A;  1O07 A;  4LV2 A;  1XKZ A;  3GDI A;  1TDG A;  3IH9 A;  1FSW A;  3C7U A;  2QHK A;  3C4P A;  2I72 A;  2EX9 A;  5A91 A;  3DBA A;  2XD1 A;  1KDS A;  2A49 A;  4K08 A;  5A90 A;  2PYR A;  2ZQA A;  3OPP A;  4KUK A;  4IHQ A;  4WEJ A;  2FZ0 A;  5EM1 A;  3EEA A;  4BBV A;  4IBX A;  1K6S A;  4OPZ A;  2J7V A;  2EXB A;  3HUN A;  4MDZ A;  3JVU A;  1Y28 A;  4IVI A;  3UB7 A;  3PBQ A;  3CMZ A;  2C5W B;  2J9P A;  4JF5 A;  1XXM A;  3LEZ A;  1PI4 A;  4QB8 A;  4ME4 A;  3DW0 A;  1FOF A;  1FCN A;  2QMI A;  1MC0 A;  3HJI A;  2W0N A;  3T4L A;  1VEU B;  3N8L A;  4HBU A;  3UO9 A;  2IWD A;  4P0M A;  5AVE A;  5CED A;  5HPI A;  5D3O A;  1D06 A;  2C6W B;  2DMW A;  3RXX A;  2EXA A;  4QY6 A;  2JN7 A;  1IOU A;  1LLB A;  4LEN A;  1P9R A;  4OLD A;  1ES4 A;  3MFD A;  3UE3 A;  4CLC A;  4Z9Q A;  4Q0J A;  4R0Q A;  3WRT A;  3CIT A;  1OTE A;  4LV0 A;  3UPO A;  3BEC A;  3BFC A;  1P0Z A;  5DF8 A;  2V0W A;  1Z6F A;  4NET A;  2ZM0 A;  4S2L A;  2PHY A;  3IXB A;  3N4I A;  3NOU C;  4GS9 A;  2WAD A;  3PR6 A;  5EOE A;  5HWW A;  1L0F A;  4QWO A;  4WMC D;  5E43 A;  5G4Y A;  3BFG A;  1W5D A;  3MMH A;  5A92 A;  3OOV A;  1ESI A;  3VP1 A;  4BQM A;  2V1A A;  4KG2 A;  5AJG A;  2V8F A;  4R38 A;  2Y2K A;  4JGR A;  4Y5F A;  2W3H A;  1XPB A;  2ZC5 B;  1GA0 A;  5CXW A;  2Q9N A;  3IF6 B;  3QP5 A;  4RX2 A;  3IWI A;  3KX0 X;  5A93 A;  4BMW A;  4X69 A;  1T18 A;  2XQZ A;  4DXC A;  2HJE A;  4U0X A;  3VP3 A;  3VOL A;  2M7U A;  3EQV A;  1HVB A;  2WZX A;  4GLQ A;  5EE8 A;  1IKI A;  3PBO A;  2QJ5 A;  5KIZ A;  1YAX A;  5FDS A;  3UE0 A;  3GQZ A;  1S1Y A;  4HQA A;  3V50 A;  4E3M A;  2HP5 A;  4A5R A;  1K54 A;  1NXY A;  1ESU A;  3HLC A;  3E4Q A;  1ODV A;  5DF9 A;  2X02 A;  1ES5 A;  2WAF A;  3QP4 A;  2ZQ9 A;  3H82 A;  1YPR A;  5K5B A;  1D1J A;  3OPH A;  4G3K A;  1H8Z A;  4OQ0 A;  4EBN A;  3ZG7 B;  4N9K A;  4S2N C;  3IX3 A;  5JYP A;  5HL1 A;  3GV9 A;  1TVF A;  5E2F A;  3QP2 A;  3QP8 A;  2QKP A;  2PR6 A;  4UHU A;  3M2K A;  1T1A A;  4WZ4 A;  2QWS A;  3KYZ A;  1J3W A;  1DP9 A;  1NZU A;  4IJG A;  5FQK A;  1HZO A;  3LI8 A;  4GW9 A;  2JBF A;  1IEL A;  3EWK A;  3VP4 A;  4PHT A;  5EFW A;  3BQA A;  4R6L A;  5DF7 A;  5G4Z A;  3A0R A;  1K57 A;  2YKF A;  2L4R A;  1OT9 A;  3RFB A;  4QPR A;  4P87 A;  3G31 A;  1S4S A;  5DJU A;  4H6J B;  3Q7V A;  1Y54 A;  2XDM A;  2ZQ8 A;  1XX2 A;  2A3U A;  4DE3 A;  4WM9 A;  4R3J A;  1FQG A;  5EPH A;  1L2S A;  4ZJ2 A;  4HHD A;  4P85 A;  2OAP 1;  4PMA A;  3PAE A;  2W3E A;  4DJ3 A;  1PW1 A;  5DTT A;  3FYZ A;  2Y55 A;  3OZH A;  4ARZ A;  1N9B A;  3KO6 A;  4UEY A;  3BFD A;  3O3V A;  4JGP A;  4R1G A;  4N9L A;  4YIN A;  1XFQ A;  2OOL A;  3FKW A;  4BBT A;  3V5M A;  5KZH A;  1UGU A;  3NDG A;  5FAP A;  4EER A;  3UDX A;  4Y2F A;  3Q1F A;  1STZ A;  3E4P A;  4D60 A;  1BYW A;  1YT4 A;  3WS0 A;  2PR5 A;  4ID4 A;  2CC1 A;  3RTY A;  1F9I A;  1PI5 A;  1S1Z A;  4GN2 A;  5F83 A;  3WS2 A;  2VK3 A;  2V20 A;  3IF6 C;  4BWI A;  2Q0O A;  2IWB A;  1CQA A;  3QP6 A;  5HDS A;  1BLC A;  5HZH A;  1KGE A;  3VP2 A;  2Q9M A;  4GJ4 A;  1K38 A;  4GHI A;  5FEF A;  4ETX A;  2VLG A;  1NRF A;  4S2J A;  3KSG A;  3HLE A;  3MQ0 A;  5C5K A;  3F1N B;  4QD4 A;  3CWF A;  2HDU A;  4MNR A;  3LIB A;  4EES A;  1YMS A;  2VKS A;  3G2Y A;  5EV0 A;  1K0K A;  2BLS A;  3G2Z A;  3VE4 A;  3W4O A;  2JKG A;  4HES A;  4OKP A;  5FAO A;  5BOH A;  2Y2Q A;  5E2G A;  3W4Q A;  4BL2 A;  2PBD P;  1ZC2 A;  3HJK A;  1DP8 A;  1VET A;  3UB5 P;  1YLY A;  2J9O A;  3H7W A;  4EV4 A;  4CQH A;  4RQ9 A;  4EQ1 A;  4L9G A;  1YLP A;  4B9O A;  3LFV A;  4CLC E;  4Y15 A;  3TOI A;  5EM0 A;  2XEP A;  1LSW A;  1JTD A;  1OPX A;  3AGE A;  3CI6 A;  4WF0 A;  4DE1 A;  4XXR A;  1KGG A;  1EW0 A;  4M4X A;  5DFX A;  1EWZ A;  3FV7 A;  4CJN A;  1E3U A;  5GLB A;  3T4S A;  5F6A A;  3LYX A;  4BLM A;  3IQA A;  5CHJ A;  3S22 A;  2PYP A;  3OCL A;  3ZQ5 A;  5HD3 A;  2G7U A;  2Z2M B;  1PRQ A;  3T4T A;  4GDB A;  4MBF A;  1XGI A;  3UDI A;  1W63 Q;  5EUA A;  3CZD A;  4R70 A;  4P6Z S;  2OWJ A;  4EBL A;  1OTA A;  1K6R A;  4Y0T A;  5HFO A;  1JWV A;  1KVL A;  4UQI S;  3VP0 A;  4B88 A;  4MBK A;  3A0V A;  5M1A A;  4LGW A;  2EWW A;  3HUO A;  4GD8 A;  2Y2J A;  4R4R A;  1ZTU A;  4XT2 A;  2XA7 M;  3ICY A;  3C38 A;  4IUH A;  2H10 A;  1ZG6 A;  2JKF A;  1ES2 A;  5TBM A;  2M7V A;  3S1Y A;  1XGJ A;  1H3Q A;  3R4K A;  2ZM2 A;  4FUW A;  2J80 A;  2P08 A;  1KE0 A;  1JTG A;  3CG5 A;  3W8K A;  3O5Y A;  3VSL A;  1YLJ A;  1GSX A;  3OCN A;  4Y0U A;  5HD5 A;  3S7O A;  5KSH A;  5I94 A;  2IA2 A;  1MWT A;  2Y4A A;  4RA7 A;  2D02 A;  4F94 A;  3IXG A;  4OOY A;  3JVV A;  2VGJ A;  3MZE A;  4HOI A;  5FEG A;  4FTX A;  1KGF A;  2HF6 A;  4N1X A;  5CGW A;  2XR0 A;  4Y7P A;  2GDN A;  2I9V A;  2JC7 A;  3FPV A;  2Y2L A;  3MFX A;  4WZ5 A;  4LRX C;  1QME A;  2Z6C A;  1L0E A;  3NIA A;  1OTI A;  5TR7 A;  3K3D A;  3R7W A;  5IS1 A;  3AGD A;  4KZ4 A;  4MBH A;  2BAS A;  3W2Z A;  1MKI A;  4X53 A;  2XK1 A;  1XJ3 A;  3LO7 A;  4GD6 A;  1L0D A;  3CPT A;  3ZFZ A;  4PM7 A;  1YMX A;  3C5A A;  2ZBB A;  4S2O A;  5FQI A;  3CJM A;  2UV0 E;  1L3L A;  2O99 A;  1VM1 A;  2J8Y A;  1W63 M;  3MQQ A;  3MF0 A;  3HLF A;  2QJ7 A;  5FL3 A;  2WGV A;  4XUX A;  2W1T A;  4NXF A;  3F1P B;  4OLG A;  3LI9 A;  3SS4 A;  2J3T C;  3T1S A;  3EOI A;  4OPQ A;  2Y2M A;  4RYE A;  3T12 B;  1U60 A;  1SKO A;  2INW A;  1KE3 A;  4KZ5 A;  1T1C A;  3G35 A;  3LEQ A;  2Y2O A;  2DRW A;  2VV7 A;  3UNW A;  3FKV A;  3SOI A;  5J3W A;  4LV1 A;  3MXQ A;  1BSG A;  5DJT A;  2ZOH A;  4HH3 A;  4Y0O A;  5AQB A;  5E2E A;  2P04 A;  1NY0 A;  4LCM A;  2XGN A;  1OME A;  4KG5 A;  3HL9 A;  4BL3 A;  1MWU A;  2A24 A;  5AQ9 A;  3A3E A;  5HPF A;  3GMW A;  5TGF A;  4BJP A;  1DJA A;  5EVE A;  1YLZ A;  1GCE A;  2XRN A;  3Q82 A;  4O8G A;  3ZVW A;  2V8C A;  1YSP A;  3GRJ A;  1NZO A;  3OC2 A;  5TJJ A;  1IEM A;  3B33 A;  2W1R A;  1NYY A;  4OVD A;  5E2H A;  3SW1 A;  4UA9 A;  3ZNT A;  2XD5 A;  3C7V A;  4NK3 A;  1TD5 A;  3OBF A;  4ZJ1 A;  1DY6 A;  4EBP A;  3Q81 A;  2Y59 A;  2V1Z A;  2J3T D;  3F1O A;  3UME A;  3BLM A;  4X68 A;  1FR1 A;  5FA7 A;  1GHI A;  3HLD A;  3MJQ A;  4NXE A;  4EEP A;  1SDE A;  2ZC6 B;  1BZA A;  2WKI A;  2MJ6 A;  4NEE D;  5CRF A;  3T4J A;  4FOF A;  3EGX C;  5GLA A;  1TS6 A;  5FQQ A;  1ZHH B;  2XH9 A;  4MCW A;  3RH8 B;  2ACG A;  2K2N A;  2B5R A;  4E6X A;  4GOG A;  1K56 A;  1RGZ A;  4WN5 A;  4EET B;  2P74 A;  5DTK A;  2Y2I A;  3TE8 A;  4N92 A;  4E3I A;  5LBR A;  4MLL A;  2VGK A;  5EOO A;  3DTE A;  4O0P A;  3TG9 A;  3MXS A;  5GLC A;  1P9W A;  3VV4 A;  3IS2 A;  4KZB A;  1PW8 A;  1SDN A;  2GNX A;  3LR0 A;  3H9W A;  3B47 A;  5FI7 A;  2ZLY A;  5CEB A;  4ZJ3 A;  3O88 A;  4GZB A;  3ZG0 A;  1LL8 A;  5F68 A;  4OQG A;  1IYQ A;  2EFU A;  4BD0 A;  1NRJ A;  4JPM A;  4Y13 A;  4DDS A;  1CK3 A;  5DFY A;  2E8I A;  2LB9 A;  1GA9 A;  5CEC A;  3U4L P;  4YFM A;  1G6A A;  3DWK A;  4FSF A;  1WE4 A;  3V3R A;  4ZTK A;  2V1B A;  2P9V B;  4F3L A;  5HX9 A;  2OLV A;  1HLU P;  2ZC4 B;  3C2W A;  5GHX A;  3BM6 A;  1KVM A;  3KYQ A;  2PD7 A;  2OLU A;  2VJW A;  2R78 A;  4KZ3 A;  2V2F F;  2VA0 A;  4S2I A;  3SH9 A;  2PU4 A;  3B42 A;  3DWZ A;  2WYX A;  2H0T A;  5DTS A;  1QMF A;  1ALQ A;  2ZL1 B;  4GKU A;  3N6I A;  4G3W A;  3MBZ A;  4HJ3 A;  5MC7 A;  2VGL S;  5J4E A;  2R9W A;  3FG8 A;  5AQA A;  1YQS A;  2OV5 A;  2HP6 A;  1G68 A;  4EEU A;  3NC8 A;  3FWL A;  1FCO A;  2B02 A;  4LPZ A;  1TS8 A;  3NEC A;  4B93 A;  1S6R A;  3T4K A;  4HH2 A;  2W3G A;  4K91 A;  1JVJ A;  1T1B A;  3BY9 A;  4EW7 A;  5FQ9 A;  3S7P A;  3AGF A;  5HAR A;  3SS3 A;  1ONH A;  3E2L A;  3WWX A;  3QHY A;  1JWZ A;  3BLS A;  1NLY A;  2QYB A;  3UB6 A;  3MZF A;  4JGQ A;  3NY4 A;  3S4X A;  4OP5 A;  2V0U A;  1MWR A;  1Y4O A;  1K55 C;  5U47 A;  4WL9 A;  4KZA A;  4Y17 A;  1OJ5 A;  1PWG A;  1Q2Q A;  2PDR A;  1PWC A;  1S0W A;  1WYB A;  3VMA A;  4ETZ A;  4X55 A;  2EX2 A;  1ERQ A;  5EVI A;  3SH7 A;  4Q8I A;  4CLC B;  4L9E A;  3UPP A;  1VB6 A;  1YLW A;  3MKE A;  3V3S A;  2XF3 A;  2JKT M;  4HY8 A;  3B3X A;  3F1O B;  4WUJ A;  4JBF A;  2WKP A;  4EU0 A;  3LR3 A;  3P7N A;  1E3U D;  5DKL A;  2H28 A;  4II7 A;  4GS9 B;  3OPL A;  4U3T A;  2AVX A;  3P09 A;  4FH2 A;  4QHC A;  4DKI A;  5GHZ A;  2XA7 S;  4S2K A;  4YNR A;  3FC7 A;  3BW6 A;  1ONG A;  3LIC A;  2H5S A;  1F2K A;  5JYO A;  3CLO A;  4PM5 A;  1C3B A;  2HPB A;  4OH0 A;  4K0X A;  3WS4 A;  4LCL A;  4OPY A;  3ZDJ A;  3KSH A;  2P7J A;  3CUE C;  1NYM A;  1NLZ A;  2WKR A;  3T1R A;  5HSQ A;  3E98 A;  4HEF A;  1H8Y A;  2OAQ 1;  4S2N A;  2W3F A;  3IXD A;  4I3J A;  5FAT A;  3G6O A;  3O87 A;  5EEC A;  3UB9 A;  3C4O A;  4L0L A;  3HCY A;  1A0K A;  4EQI A;  4MEZ A;  1XA1 A;  2BTF P;  1VHM A;  1EI5 A;  3S7Q A;  3IX4 A;  2VEA A;  1Q2P A;  3H82 B;  2D01 A;  5CX7 A;  2EA9 A;  4YOF A;  3NDE A;  2K31 A;  4OPR A;  1LSX A;  1BLS A;  2ZOI A;  2HGV A;  3BJN A;  1RP5 A;  3U2A A;  1ES3 A;  3L9K A;  5HAP A;  1MZU A;  5CER A;  3DTM A;  4X25 A;  3UE1 A;  1N4O A;  2O9A A;  2PBY A;  3MKF A;  4DN0 A;  3HUM A;  5HAI A;  4LV3 A;  3BRM A;  1J9M A;  4UA6 A;  4KZ9 A;  5FQM A;  3PYP A;  4KQD A;  2PRF A;  2VV8 A;  4L9F A;  4PM9 A;  5G18 A;  1IYP A;  1DRM A;  5KMW A;  1X0O A;  1Z09 A;  4NXG A;  2LB5 A;  2HZ5 A;  4CPK A;  3M2J A;  3SS5 A;  2XLN A;  3HVF A;  4Q0H A;  3PBN A;  4R23 A;  3Q7V B;  4CLC C;  1HD8 A;  2QZ6 A;  1LSV A;  3P01 A;  2H0Y A;  2G2U A;  2EWV A;  2G2W A;  3BWL A;  3V67 A;  3VFH A;  1SZV A;  2NUP C; 
#chains in the Genus database with same CATH homology
 1N9O A;  1TS7 A;  2GJ3 A;  3OC2 A;  2PT7 A;  3F1P A;  2VX8 A;  5TJJ A;  2QKP A;  3B33 A;  3IS2 B;  3C30 A;  5HDC A;  4ARZ B;  2W1R A;  2PR6 A;  1T1A A;  3SW1 A;  2QWS A;  3KYZ A;  3T4Q A;  1TD5 A;  1DP9 A;  3OBF A;  2VV6 A;  3F1O A;  3UME A;  2J3T D;  3K2N A;  4IJG A;  4ZRR A;  3UE6 A;  3MJQ A;  1UWN X;  3VE3 A;  4NXE A;  3LI8 A;  4GW9 A;  4EEP A;  1T19 A;  3EWK A;  4PHT A;  2MJ6 A;  5EFW A;  3BQA A;  4NEE D;  4R6L A;  4EXO A;  5G4Z A;  3T4J A;  3A0R A;  2YKF A;  1TS0 A;  4FOF A;  3EGX C;  3ULF A;  2L4R A;  1OT9 A;  1TS6 A;  3RFB A;  3NJA A;  4QPR A;  1YKD A;  4E04 A;  1ZHH B;  1S4S A;  1WA9 A;  3A0S A;  4MCW A;  3RH8 B;  4NKP A;  4HNB A;  4MMN A;  5DJU A;  4F3L B;  1GSW A;  3LIE A;  2WKQ A;  4H6J B;  5I5L A;  3E0Y A;  5IT5 A;  1D7E A;  1TF1 A;  2K2N A;  4WLA A;  1OTD A;  4LRZ E;  1OT6 A;  2KDK A;  4WN5 A;  4EET B;  4GHI B;  3TE8 A;  4HHD A;  5LBR A;  2OAP 1;  4Z1W A;  4CLC D;  4KUO A;  5HWV A;  3MR0 A;  5L8M A;  2W3E A;  4DJ3 A;  4HIA A;  5A8B A;  4O0P A;  2VZW A;  2OWH A;  1P9W A;  3VV4 A;  3IS2 A;  3MQO A;  2L0W A;  4ARZ A;  3KO6 A;  2GNX A;  4UEY A;  3LR0 A;  3H9W A;  3NOT C;  4JGP A;  2YKH A;  3B47 A;  1XFQ A;  2OOL A;  2XSS A;  1MKM A;  4WEK A;  4BBT A;  2NUT C;  2L1M A;  5J7E A;  4LRY C;  1UGU A;  3BQ8 A;  4AFI A;  4I3A A;  1LL8 A;  5F68 A;  4EER A;  4Y2F A;  1STZ A;  3E4P A;  1NRJ A;  5HWT A;  3PBT A;  1BYW A;  2O9B A;  4WEL A;  3EGD C;  5HDD A;  2PR5 A;  3H7W B;  5DFY A;  2LB9 A;  3RTY A;  1F9I A;  1S1Z A;  2JKR M;  2J3W A;  4FSF A;  4IUK A;  4BWI A;  3D3O A;  2V1B A;  4F3L A;  4H6J A;  5HDS A;  2JKR I;  4JGO A;  3C2W A;  4MN6 A;  4Y3I A;  3D72 A;  4HI4 A;  3TJZ C;  5HZH A;  3E4O A;  3KYQ A;  1S67 L;  2PD7 A;  2VJW A;  2R78 A;  4GJ4 A;  2VA0 A;  1OJG A;  4GHI A;  4I5S A;  4ETX A;  2VLG A;  2ZMF A;  5F5Y A;  3KSG A;  3B42 A;  2FH5 A;  3MQ0 A;  5C5K A;  1XJ4 A;  3F1N B;  1KOU A;  3CWF A;  4G3W A;  4HJ3 A;  3S7N A;  5MC7 A;  3LIB A;  2O0Y A;  2VGL S;  5J4E A;  4OOL A;  4EES A;  2VKS A;  3FG8 A;  2KLI A;  3VE4 A;  2Y8H A;  4EEU A;  4Q0I A;  2NUP C;  1S4R A;  3FPW A;  3LID A;  2Y79 A;  2PD8 A;  2B02 A;  4LPZ A;  3BY8 A;  1TS8 A;  1V9Z A;  4B93 A;  3HJK A;  1DP8 A;  3T4K A;  2K7S A;  4HH2 A;  2W3G A;  3H7W A;  1T1B A;  1F98 A;  1JNU A;  3BY9 A;  3OLO A;  4CQH A;  4EW7 A;  4XT2 B;  4RQ9 A;  4EQ1 A;  3S7P A;  4L9G A;  4B9O A;  5F69 A;  3LR4 A;  3LFV A;  4CLC E;  4P6Z M;  4R3A A;  2HV1 A;  5TBM B;  4O01 A;  1LSW A;  1OTB A;  2B18 A;  4HP4 A;  1NLY A;  1OPX A;  2QYB A;  3UB6 A;  3LUQ A;  3CUE A;  4UQI M;  3CI6 A;  3LIA A;  4WF0 A;  3KSF A;  5IU1 A;  4JGQ A;  1EW0 A;  3EQU A;  3EEH A;  4YWZ A;  4M4X A;  5DFX A;  2V0U A;  1LT0 A;  1S66 L;  2CMN A;  3T4S A;  4HJ6 A;  5F6A A;  3LYX A;  2XRO A;  4PKY A;  2PYP A;  3F1N A;  3IBJ A;  3OCL A;  4WL9 A;  4GCZ A;  4NXB A;  5HD3 A;  3ZQ5 A;  2G7U A;  1XFN A;  3T4T A;  1OJ5 A;  2M1C A;  1YSQ A;  3NOP C;  1W63 Q;  2PDR A;  3GDI A;  4R70 A;  2Z6D A;  4P6Z S;  2OWJ A;  1OTA A;  4ETZ A;  1NWZ A;  1GSV A;  2QHK A;  1F5M A;  1H8M A;  4PKY G;  4UQI S;  3A0V A;  3DBA A;  4CLC B;  4L9E A;  4K08 A;  2PYR A;  2EWW A;  3C8C A;  4KUK A;  4PAU A;  4IHQ A;  4WEJ A;  3ZYT A;  2FZ0 A;  3TRC A;  1VB6 A;  3EEA A;  4BBV A;  1ZTU A;  4XT2 A;  2JKT M;  2XA7 M;  3ICY A;  3PBS A;  3C38 A;  4HY8 A;  4IUH A;  3GEC A;  3F1O B;  4MDZ A;  4WUJ A;  3R7W B;  3JVU A;  1Y28 A;  2WKP A;  3UB7 A;  3PBQ A;  5TBM A;  2M7V A;  1H3Q A;  3R4K A;  4EU0 A;  2JKT I;  2J80 A;  2P08 A;  3LR3 A;  1N9L A;  3P7N A;  5DKL A;  2H28 A;  4II7 A;  4ME4 A;  1XJ2 A;  1MC0 A;  3O5Y A;  4GS9 B;  3HJI A;  2W0N A;  3T4L A;  1GSX A;  1N9N A;  3OCN A;  5HD5 A;  3S7O A;  5KSH A;  2A2L A;  5AVE A;  2W27 A;  5HPI A;  2KX6 A;  1D06 A;  2IA2 A;  2HJ9 C;  2XA7 S;  2D02 A;  2DMW A;  4YNR A;  4EUV A;  3FC7 A;  3BW6 A;  2JN7 A;  2W3D A;  3JVV A;  1IOU A;  3LIC A;  4I38 A;  4HJ4 A;  4HOI A;  3CLO A;  2GX5 A;  2W1T B;  2HF6 A;  3KSI A;  3T4O A;  4G3V A;  4MN5 A;  1P9R A;  3UE3 A;  3KSH A;  4CLC A;  2P7J A;  3CUE C;  1NLZ A;  2WKR A;  4Q0J A;  2I9V A;  5HSQ A;  3FPV A;  3E98 A;  3MFX A;  4I39 A;  4LRX C;  1G28 A;  2JHE A;  2OAQ 1;  2W3F A;  4I3J A;  2Z6C A;  3CIT A;  1OTE A;  3G6O A;  1OTI A;  3UB9 A;  3K3D A;  3R7W A;  5IS1 A;  2V9A A;  1V9Y A;  3TW8 A;  2BAS A;  3W2Z A;  4L0L A;  1P0Z A;  1XJ6 A;  3HCY A;  2V0W A;  1XJ3 A;  3K3C A;  2PHY A;  3NOU C;  4GS9 A;  1VHM A;  3NHQ A;  3PR6 A;  5HWW A;  2ZBB A;  3S7Q A;  2VEA A;  5DKK A;  2A24 B;  5G4Y A;  3H82 B;  3PBR A;  3MMH A;  2D01 A;  3OOV A;  4KQO A;  4HP9 A;  2O99 A;  5CX7 A;  2EA9 A;  2V1A A;  4I3I A;  4LLO B;  1W63 M;  5AJG A;  3MQQ A;  2GZA A;  3MF0 A;  5AVF A;  4R38 A;  4JGR A;  4YOF A;  3IBR A;  4Y5F A;  2QJ7 A;  5FL3 A;  2K31 A;  2W3H A;  1UWP X;  2W1T A;  4NXF A;  1LSX A;  2ZOI A;  2HGV A;  3BJN A;  3F1P B;  3U2A A;  3LI9 A;  5HL6 A;  1MZU A;  3KX0 X;  2J3T C;  4OOM A;  4BMW A;  3PXP A;  1T18 A;  3EOI A;  1G6O A;  1P97 A;  2O9C A;  2O9A A;  4MN7 A;  4DN0 A;  2INW A;  2HJE A;  2KOI A;  3CAX A;  3VOL A;  2M7U A;  4DMZ A;  3EQV A;  3PYP A;  4GLQ A;  1T1C A;  4KQD A;  2VV8 A;  4L9F A;  2VV7 A;  3T50 A;  3PBO A;  2QJ5 A;  1DRM A;  5KIZ A;  1X0O A;  4NXG A;  5J3W A;  1YAX A;  3UMD A;  3LR5 A;  3MXQ A;  2LB5 A;  5DJT A;  1DP6 A;  1S1Y A;  2ZOH A;  4HH3 A;  4HQA A;  3LIF A;  1IFQ A;  2P04 A;  2VGL M;  4Q0H A;  4DJ2 A;  3PBN A;  3E4Q A;  1ODV A;  5DF9 A;  2A24 A;  4CLC C;  3H82 A;  5HPF A;  5K5B A;  1LSV A;  4BBU A;  3P01 A;  4G3K A;  4BJP A;  2EWV A;  2ZMV A;  3BWL A;  3PHY A;  3V67 A;  2XRN A;  4O8G A;  3UB8 A;  1YSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...