3KX0X

Crystal structure of the pas domain of rv1364c
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
135
structure length
127
Chain Sequence
EMDWDKTVGAAEDVRRIFEHIPAILVGLEGPDHRFVAVNAAYRGFSPLLDTVGQPAREVYPELEGQQIYEMLDRVYQTGEPQSGSEWRLQEERYFDFVVTPRRRADGSIEGVQLIVDDVTSRVRARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of a PAS sensor domain in the Mycobacterium tuberculosis transcription regulator Rv1364c
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Signaling protein
molecule keywords Uncharacterized protein Rv1364c/MT1410
total genus 30
structure length 127
sequence length 135
ec nomenclature
pdb deposition date 2009-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF08448 PAS_4 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3kx0X00
2B02A 2J80A 2I9VA 3HJKA 1UGUA 2PR5A 3E4PA 3LICA 4HP4A 5J7EA 4HH2A 4LLOB 4HQAA 5HDCA 1F9IA 3NOPC 1DRMA 2WKPA 3P7NA 1N9LA 3MR0A 1V9ZA 3H82A 2D02A 1TS8A 1S67L 1G28A 2M1CA 5F68A 2QHKA 4R38A 1LSXA 2OWHA 3FG8A 3F1OA 2VV8A 1OTBA 2HV1A 4GW9A 1JNUA 4R3AA 4R70A 4EEUA 1N9NA 3F1OB 3PYPA 4MN6A 3MXQA 4WL9A 4I3IA 2PDRA 4F3LA 2L1MA 3CAXA 4RQ9A 3OLOA 4HNBA 4KUKA 3RTYA 2VV7A 3NOUC 4I38A 3IS2A 2VV6A 3CLOA 3EEHA 4H6JB 4LRYC 5J3WA 4HOIA 3ZQ5A 5HSQA 3MJQA 4JGQA 4XT2B 5I5LA 4GS9B 3T50A 1DP6A 4H6JA 5KIZA 5HZHA 3FC7A 5AVFA 2VLGA 3B33A 4GS9A 1P0ZA 3D72A 3MFXA 3F1NA 3IBRA 4L9GA 5F69A 5DJUA 3GDIA 5A8BA 3SW1A 3F1PB 1UWNX 3UB9A 3UB8A 3UB6A 3ULFA 4LRXC 3ICYA 2INWA 4I5SA 4BBVA 3LIEA 2V9AA 1BYWA 1N9OA 4NXGA 2R78A 4NXBA 2CMNA 4HHDA 4R6LA 4EXOA 2JHEA 3C8CA 4K08A 3VOLA 3EWKA 3LIDA 1LL8A 4WN5A 2WKQA 4EERA 3E4QA 1UWPX 1OT9A 3H7WA 3LUQA 2ZOIA 1T19A 1OT6A 1LSWA 4YWZA 4DJ2A 1OTAA 1GSXA 2A24B 5HWTA 1NWZA 4DJ3A 4JGOA 3LIFA 5DKKA 2D01A 4I3AA 4KUOA 2QWSA 3MQOA 2JN7A 2PYPA 5HD3A 1P97A 3A0RA 5IU1A 1VB6A 4HJ6A 1DP9A 1LT0A 4MN5A 2L4RA 2PR6A 3BY8A 1WA9A 1KOUA 4I39A 5F5YA 1XJ2A 5TBMA 1S1YA 2KX6A 5HDSA 4LPZA 4WF0A 1XFNA 5HWVA 2V1BA 1XFQA 2W0NA 4GCZA 5G4ZA 2ZBBA 1TS6A 2L0WA 5F6AA 4E04A 4EW7A 4HI4A 2H28A 4PKYA 3LI8A 4HIAA 2BASA 2VEAA 3UMDA 3LIAA 1LSVA 3LYXA 1T1BA 4KQDA 3VE3A 4JGPA 4L9FA 4NXEA 3BWLA 4PKYG 2WKRA 2A24A 2OWJA 5G4YA 3UE6A 4BBTA 5DJTA 4EETB 1GSVA 2PD7A 3KX0X 3PHYA 3H82B 4GHIA 4HP9A 3HJIA 4B9OA 3F1PA 5HD5A 1D06A 2PYRA 3UB7A 2YKFA 1S4SA 3A0SA 3E4OA 2PHYA 3LIBA 4LRZE 2ZOHA 1GSWA 1F98A 1S66L 1T18A 2P7JA 1ODVA 3IS2B 3LI9A 5HWWA 1V9YA 3NHQA 4EESA 3VE4A 2OOLA 4NXFA 2Z6CA 1XJ4A 1XJ3A 5DKLA 4WLAA 5HDDA 3H9WA 3C2WA 2V0WA 4M4XA 4WUJA 3CWFA 1DP8A 1TS0A 1EW0A 5J4EA 3F1NB 3K3CA 3K3DA 1X0OA 4HH3A 1OJGA 4L9EA 2V1AA 1OTDA 4BBUA 2EA9A 3NOTC 2KDKA 1OJ5A 1S4RA 5AVEA 4I3JA 3UMEA 4GHIB 2Z6DA 1D7EA 2QJ7A 2PD8A 2V0UA 3G6OA 1OTEA 4EQ1A 1OTIA 1TS7A 3RH8B 2YKHA 1MZUA 1T1AA 1Y28A 2W27A 4HJ3A 1S1ZA 5TBMB 4F3LB 3NJAA 3GECA 5EFWA 1XJ6A 3BY9A 1T1CA 2QKPA 4JGRA 4HJ4A 4HY8A 3H7WB 4XT2A 5IS1A 3A0VA 3MQQA 2K7SA 4EEPA 2QJ5A 2GJ3A
chains in the Genus database with same CATH superfamily
1K56A 5E2FA 3ISGA 3QP5A 1WYCA 5HX9A 2VGJA 4RA7A 2PDRA 4F3LA 3GV9A 4I38A 5J3WA 3CI6A 1YLWA 2VJWA 2PU2A 5AVFA 4BQMA 2ZM8A 5F69A 4WELA 5DF7A 3Q81A 5I94A 1DJAA 3QNCA 3T1RA 3SZTA 2BG1A 3NECA 4XUXA 3FKWA 4E3JA 2A24B 5EPHA 1JTGA 1NWZA 3SH9A 2ZQAA 3LIFA 4OPQA 4Y17A 2W1TA 2I72A 1AXBA 4IVKA 1S0WA 3OBFA 4OPYA 2OAQ1 4LPZA 3MBZA 5CEBA 3LR3A 3QHYA 3T4SA 3HLFA 5DTSA 2O9BA 1VM1A 3E98A 4CJNA 2Y8HA 5L8MA 3ITBA 3KX0X 1K55A 3TSGA 3OPHA 1BLSA 3ZG5A 1KDSA 1G5UA 4IHQA 1FCMA 5DKLA 1TS0A 4OOLA 1NLYA 3NOTC 3C7UA 3UMEA 1D7EA 3WS1A 3IHBA 3W4OA 1YMXA 2ZC4B 3EGXC 5FI7A 2IWBA 4JLFA 4MBFA 4X1LA 3LR4A 3EOIA 1K0KA 3PBSA 4R70A 2XDMA 2M7UA 2O0YA 4GDBA 2ZJ9A 3F1OB 4JXSA 4RVAA 2H0YA 3CAXA 3HUOA 3T1QB 2HP9A 4FCFA 1DP6A 5FQJA 3MFXA 5GHYA 2XROA 3GDIA 3SW1A 2VKSA 2PU4A 3UO9A 3LR5A 3P98A 4I5SA 3LY4A 2W3EA 3M6HA 2EXBA 3LUQA 2XQZA 1EI5A 2JN7A 2XD5A 2L4RA 4LFUA 3G32A 3BQ8A 4OVDA 4CLCA 5KZHA 1JWZA 3IXGA 4D2OA 4X25A 4GB7A 4JKTA 3BWLA 4HESA 4BBTA 3UE6A 1PNEA 3T4KA 4P85A 1LI9A 4PM8A 4GN2A 3GSGA 2ZC6B 4MBKA 1ODVA 3LI9A 3IXDA 4Y13A 4HH3A 4KZ6A 4FD8A 5DFYA 4YFMA 2V8FA 2X02A 4H8RA 3S1YA 1GHMA 3N6IA 5EM1A 1KDWA 1XXMA 3MFDA 3BJNA 3SS5A 2G7UA 5HDCA 3HJKA 1YSPA 3IQAA 3BLSA 5DTTA 1TS8A 1K54C 1D1JA 1GCEA 5M1AA 5FDHA 4RQ9A 4WZ5C 3OZHA 2XH9A 1A0KA 2VV6A 3IS2A 4R4SA 1IFQA 1ZKJA 1VHMA 3MJQA 1F2KA 2WGWB 1E3UA 1N4OA 1ZC2A 2Q9MA 3F1PB 3M6BA 4QHCA 1KGEA 4UQIS 3KSGA 3AGDA 1PIOA 1GHIA 2AVXA 3VOLA 2G2WA 3T4TA 3DAVA 3D4FA 4DJ2A 1QMFA 3KO6A 1PW8A 1SKOB 4C3QA 1BULA 3C30A 5IU1A 4JXWA 5HL6A 1TDLA 1BTLA 4MBHA 1XFQA 2PAVP 4E04A 2EX6A 2H28A 5F1FA 1XA7A 1G68A 2EWVA 2XR0A 3WS4A 2PD7A 4RYEA 3WS0A 4Y0TA 1I2SA 2DRWA 2UWXA 1IEMA 2C6WB 2A3UA 4KQRA 2VX8A 4KZ4A 1F98A 3HBRA 2PBYA 3IHAA 2R9XA 1U60A 3IF6C 3UB5P 1X0OA 3MZDA 4L9EA 3JPUA 4BBUA 4Y2FA 3G6OA 1OTEA 1I5QA 4PAUA 4ETZA 5TBMB 4U3TA 1PI4A 2B02A 1MPLA 3U4LP 3IF5A 4HH2A 4Q0HA 1K6SA 2WKPA 5FAOA 4PM5A 2PRFA 2D02A 1OTBA 1NJ4A 4GW9A 5GLAA 5HFOA 3VP3A 2J3WA 3PYPA 3QP2A 4MCWA 1FIKA 2V8CA 4OH0A 2VA0A 2P9VA 1MWRA 4QPRA 1ESIA 5BOHA 3MF0A 1H8YA 2V1ZA 2V9AA 4LV1A 2HGVA 1CI8A 3Q82A 4K08A 5AJGA 2J3TC 3UE0A 3IH8A 3HREA 3HLCA 2O9AA 4NKPA 5HWTA 1K25A 3M2KA 1QMEA 3DTMA 3ZNTA 3Q07A 1DJCA 5DF8A 5E2EA 1XFNA 4KG6A 4R1GA 2ZC5B 1GA0A 4B88A 4HI4A 1K56D 4PKYG 4DRTA 2A24A 3F1PA 2XA7M 4P6ZS 3IXHA 2PHYA 3ZG8B 4MMNA 1C3BA 5FEFA 3EEAA 1H3QA 1PYYA 3K3CA 4BJPA 4KQQA 2PD8A 4DE3A 4GD6A 2EFUA 2W27A 1BT5A 3W8KA 1GA9A 2J9OA 3BY9A 1T1CA 5TFQA 4ZBEA 2HZ5A 3SH7A 4U0XA 5FAPA 2LB5A 4OP8A 3V5MA 1UGUA 5E2HA 1ERQA 3BEBA 4R3AA 1M6KA 1YT4A 3CPTB 3U2AA 4WL9A 5HPFA 4GNUA 4MEZA 5I5LA 4QJGA 3TW8A 1MKIA 2VLGA 3F1NA 3UB8A 5HW3A 4DMZA 4Y0OA 2OLUA 3GRJA 4BMWA 2KLIA 4Z1WA 3H7WA 4UA6A 4DJ3A 1LSWA 3KSIA 4FTXA 3EQVA 2EXAA 4OKPA 4UHUA 3MQ0A 2PR6A 1IKGA 5HDSA 4D60A 1VEUB 2J3TD 4N1XA 2XK1A 4DF6A 1MBLA 3CZDA 2Y4AA 3EGDC 3LIAA 3KYQA 4UA7A 5AQ7A 1FCOA 1K57A 4WBGA 4KZ7A 3T4JA 2XSSA 1RGZA 3L7HA 5F1GA 3A0SA 3E4OA 4S2JA 3MSHA 1GSWA 2JKRM 2X71A 4PM6A 2P7JA 3JVUA 4F94A 1W63M 4WZ4A 1BUEA 3LO7A 1ACFA 4LV0A 1IYSA 4OLGA 2LB9A 4PM9A 1IYPA 1S4RA 2RCXA 4II7A 3HUMA 1PWDA 2V0UA 1MC0A 1I2WA 3RFBA 3IX3A 1SHVA 4WMCD 4JF5A 3TE8A 4LCLA 1NY0A 1FR1A 1Q2QA 4E6XA 5J7EA 3LICA 2W3GA 3Q7VB 3ZGAB 3P7NA 4E3NA 3UPPA 2QHKA 4BL3A 2H0TA 3G2ZA 2VV8A 5EECA 2VZWA 5EUAA 3EEHA 3FPWA 5CTNA 3FC7A 5L09A 5FQQA 3WWXA 2IWCA 3ULFA 4E3KA 4JPMA 2INWA 1L0FA 4DDYA 3ZVTA 4KZ5A 4O7DA 1YM1A 2WUQA 1LL8A 4KZAA 2ACGA 3E4QA 3W4PA 4ZDXA 2QMIA 4YNRA 1H8ZA 3LGOA 2FZ0A 3Q1FA 4Q0IA 4FH2A 2JBFA 5J8XA 1CJFA 5F5YA 4BD0A 3BFCA 1ES4A 2JKGA 2WYXA 1FSWA 2BASA 3PXPA 3C5AA 3ZCZA 1IKIA 3ZG9B 1LHYA 2ZQ9A 3ZYTA 4GLQA 1ESUA 4IEDA 4EESA 2Y2OA 4E3IA 4NXFA 3UN7A 1JTDA 1BLCA 3NULA 2HP5A 4BENA 3T12B 4P6ZM 4AFIA 2ZQ7A 5FQKA 1G6OA 2XEPA 5HPIA 2OV5A 3UY6A 2WADA 2GJ3A 2P04A 3ZHHA 3ZFZA 2GX5A 4OP5A 4B4XA 4IBRA 4FH4A 1XA1A 2A2LA 1G6AA 4NETA 3IWOA 3IWQA 2NUPC 2ZQDA 1JNUA 1YLJA 3CPTA 3S22A 1ZG4A 2ZQ8A 1MKMA 3HUNA 5EOOA 2Y2NA 2DNSA 3MXSA 5CGXA 5EVID 3GVBA 5AQBA 1TDGA 2V2FF 4LRXC 1N9OA 3MS6A 5CGWA 3MKEA 4LV2A 4FUWA 1WE4A 5HAQA 3C8CA 3FPVA 3VSKA 1W7FA 2WKEA 5DKKA 4KUOA 2V20A 3MQOA 3ZG0A 1P97A 4HJ6A 4GOGA 1S1YA 4DKIA 1BLHA 3A3IA 3W2ZA 3BRMA 1E25A 3GTCA 3HLGA 2WKRA 3C4PA 5FEGA 3BFGA 3NDGA 3TJZC 1DJBA 4PHTA 4E6WA 2ZLYA 1YSQA 2Y91A 3IS2B 4Z9QA 3C2WA 1K4FA 3TRCA 1VETA 3HCYA 1E4DA 1PRQA 1YLPA 3F1NB 4QU3A 4EUVA 1VETB 3ZNYA 2HDQA 4EU0A 5A91A 4OQIA 4P6BA 5FQIA 1MZUA 2HDRA 2M7VA 2OAP1 1NZOA 2ZM0A 1E3UD 4KQOA 2J80A 3VFFA 5EVIC 2PR5A 4Y5FA 3C7VA 1N9LA 2B95A 2HV1A 4ID4A 2Y79A 3CG5A 3CLOA 4WM9A 3LR0A 4G3KA 4XT2B 3T50A 4R4RA 4LV3A 1BSGA 3R7WB 4Y15A 5CXWA 3IF6B 2PT7A 4X69A 2QZ6A 2WKQA 3S7PA 2NUTC 2W3DA 1XP4A 1DY6A 3O3VA 4X1MA 1RGYA 4N92A 1DP9A 3N8SA 4I39A 4WF0A 5G4ZA 2Y2LA 1TS6A 3CJMA 2WZZA 4OPZA 4DE2A 3IX4A 3UPNA 2OLVA 4S2PA 2Y2HA 2ZMVA 4MLLA 2Q0OA 1L0GA 3RXXA 2WKIA 2EFXA 1KVLA 4JXVA 3IX8A 4K91A 2Y2IA 2Y59A 3NHQA 5FI6A 2P74A 1OJGA 3AGEA 2O99A 3K2NA 4EV4A 1OJ5A 3S7OA 2IA2A 1W8QA 2Z2LB 1Z6FA 3GECA 1BZAA 4HJ4A 4DDSA 4XT2A 5DFXA 4S2LA 2QPNA 2HJ9C 3N7WA 4LLOB 1V9ZA 1RCJA 2ZQCA 1ES2A 1ZTUA 1XPBA 3IF6A 3FG8A 4I3IA 2ZL1B 5FSRA 2Q9NA 3T4LA 5TGFA 5L07A 3V39A 3PBTA 3UB9A 3UB6A 3LIEA 5FATA 3OPRA 3DW0A 4R6LA 3A3EA 1NZUA 3PBOA 3S7QA 4BLMA 4ME4A 3B47A 2VK3A 1OTAA 4JGOA 5HD3A 2RL3A 4LGWA 3BY8A 1NRJA 4BD1A 2GZAA 4X56A 2W0NA 2Z2MB 4GCZA 5A93A 2ZBBA 4Y0UA 4EUZA 3A3JA 3NI9A 4HIAA 4C6YA 1ONGA 4FOFA 5E2GA 2OWJA 3HLWA 3PAGA 4GHIA 3P09A 3UB7A 1ES3A 1S4SA 2J9PA 2VGKA 3IBJA 3FWLA 3HLBA 3P01A 1MY8A 4PMAA 5TR7A 3H9WA 4M4XA 4O8GA 2K2NA 2XFTA 4I3JA 1GHPA 1KE0A 1XJ6A 3UPOA 3A0VA 5EE8A 2HP6A 3DTKA 4HP4A 3FV7A 3GQZA 1NYYA 1LL5A 5F68A 4ZAMA 4S2NC 1K38A 5GL9A 1YPRA 3CUEC 1SZVA 3T4QA 1YLZA 1NRFA 4LRYC 3ZQ5A 3BFDA 1K4EA 3LEZA 1CEFA 4OOYA 2Y55A 3O88A 3G4PA 5A8BA 3B42A 5MC7A 4NK3A 5GLDA 1ERMA 3CHWP 4N1HA 3G34A 4EERA 1PI5A 5FDSA 1UWPX 4WEKA 3R4KA 2XD1A 2JKTM 1P9WA 3BQAA 4MN5A 2DMWA 5FI2A 3TOIA 3G2YA 2P08A 2KX6A 4OOMA 4OLDA 5EM0A 3MMHA 3KYZA 4EBPA 5AQAA 3V67A 3BFFA 2FH5A 5FAQA 2EX8A 1PZPA 5M18A 2J7VA 1XJ3A 4NEED 1XX2A 3Q7VA 1DP8A 2ZC3B 1EW0A 2HF6A 3V50A 3OCLA 2KDKA 2Y2MA 4GHIB 1K57C 1ES5A 3RH8B 4IVIA 3NJAA 3UDFA 5FA7A 4ESPA 1PW1A 3T4OA 3B33A 4BBVA 1HTZA 4HQAA 3VFHA 3VOYA 4GKUA 4S2NA 4R38A 1N9NA 3NC8A 4L0LA 4ARZB 4BL2A 2L1MA 1XKZA 4EWFA 4H6JB 4DN0A 3PAEA 3E2LA 3QP1A 3DTIA 5FL3A 2XGNA 2XFSA 1Q2PA 2EX2A 4KG5A 2A49A 3N8LA 3D3OA 2R78A 4HHDA 4EXOA 2Y2GA 2VGLM 1O7EA 4QY6A 4GJ4A 1CEGA 4PM7A 1IYQA 3VP2A 5CHMA 1CQAA 2QWSA 4OQGA 3NY4A 5IT5A 3QP8A 1TEMA 1CK3A 2KOIA 1Y54A 2BLSA 1W63Q 1PWGA 4S2KA 2WZXA 2WGIA 4KZ8A 1F5MA 4CLCD 3MXRA 4PKYA 1RP5A 3MZFA 4JGPA 1JWVA 4DE0A 4EETB 4R0QA 3MZEA 3HJIA 1LI0A 4Q8IA 3JYIA 1D06A 2YKFA 4LENA 1P9RA 3N8RA 4OQHA 3C38A 4IJGA 3W4QA 1W8YA 4KG2A 1H5XA 4WUJA 2QYBA 3K3DA 4XXRA 3HLDA 5A92A 5U47A 1MWTA 4K0WA 4F3LB 4K0XA 5EFWA 1J9MA 5HARA 5CECA 4IUKA 4ZJ1A 5EOEA 3E4PA 4MNRA 2ZC7A 3MR0A 2HDSA 4X55A 1S67L 1G28A 1MXOA 4UA9A 3VP1A 2B5RA 3OC2A 4EEUA 1N9BA 3O87A 3TG9A 3E2KA 4KUKA 5C5KA 3O86A 4JGQA 1YLYA 2VGLS 5HZHA 1L0DA 4CLCE 3IBRA 3R7WA 1LL9A 2JKFA 5EVLA 2ZMFA 1BYWA 4X53A 2JHEA 3G30A 4CLCB 1OT6A 4YWZA 4E3MA 1TF1A 2JKTI 5GHZA 2PYPA 4JF4A 4ZJ3A 3PBNA 3AGFA 1VB6A 1LT0A 1AWIA 1WA9A 5TBMA 3JVVA 2V1BA 4C75A 5HAPA 5L10A 2L0WA 1L0EA 4WEJA 3NCKA 4KZ9A 4X6TA 1LSVA 3LYXA 4KQDA 3IT9A 2EX9A 3E0YA 1HVBA 1Z09A 4HEFA 4B93A 3KYEA 1FSYA 1JVJA 3IWIA 3BECA 2ZOHA 1T18A 4QB8A 5FQ9A 5HWWA 5IHVA 2HDUA 2Z6CA 1XGJA 4WLAA 3IXBA 4N9LA 2V1AA 5E43A 3VP0A 3VV4A 3QP4A 3DWKA 1OTIA 4HJ3A 1Y28A 1FQGA 3I7JA 2QJ5A 5F83A 1CI9A 1IELA 1F9IA 3NBLA 1DRMA 1OPXA 3ZDJA 1YMSA 4ETXA 1FR6A 5M19A 3T1SA 3MXQA 1L2SA 4S2MA 1HZOA 3FKVA 3OLOA 5DF9A 2OSUA 4HOIA 1NYMA 3IH9A 1P0ZA 4UQIM 1FILA 4DXCA 3EQUA 1UWNX 5EVIA 3OCNA 4BWIA 4OPRA 2UV0E 5KSCA 2ZL1A 2CMNA 5FASA 4Y7PA 1VEUA 2JKRI 3UE1A 2W3HA 1T19A 3NIAA 1HD8A 3HL9A 3O5YA 3A0RA 1Y4OA 3SOIA 3V3SA 4U0TA 2W1TB 1PZOA 3CITA 4HBUA 1ZG6A 3LI8A 2E8IA 1SKOA 2VEAA 2WAFA 4QD4A 4YINA 2PYRA 3FYZA 2DCFA 3LIBA 1S66L 3OOVA 1KVMA 1NXYA 5HDDA 4NG2A 2WGWA 5J4EA 1SKFA 2WK0A 3LEQA 1OTDA 2EA9A 1KE4A 1OMEA 5GHXA 1S1ZA 2QKPA 5CRFA 3B3XA 4E3OA 2G2UA 4RX2A 3ITAA 3BM6A 3GR2A 2XLNA 2X01A 2MJ6A 2O9CA 3VOZA 1CF0A 2M1CA 1LSXA 2OWHA 3F1OA 1S6RA 2R9WA 3S4XA 3DWZA 4Y3IA 2IWDA 3KSFA 2VV7A 2E8JA 5HSQA 2CC1A 4MDZA 3WS5A 3UDXA 3G35A 5DJUA 4MN7A 3SS3A 1IYOA 4NXBA 3A3FA 4P87A 3LIDA 4WN5A 4OQ0A 4GDNA 1PFLA 4JBFA 5G18A 2ZOIA 4HBTA 2XRNA 1KGGA 4O0PA 4QY5A 1KOUA 4PPRA 1XJ2A 2W1RA 2JCHA 5F6AA 4EW7A 2WAEA 1K6RA 4P0MA 4ZJ2A 3DTEA 4NXEA 3H82B 3VP4A 4G3VA 2WKHA 5F82A 4ZRRA 4CQHA 4R23A 3WRZA 4LRZE 3GMWA 1KGFA 2ZD8A 1JWPA 3SH8A 4RX3A 1KE3A 2FFYA 2Y2JA 5D3OA 4M3KA 2V0WA 3CWFA 4GD8A 2WGVA 5CHJA 4B4ZA 1VQQA 3HVFA 4QWOA 1T1AA 2HPBA 4HY8A 2JE5A 5IS1A 3KSHA 2ZM2A 3ZVWA 3LY3A 2PBDP 1BLPA 4IUHA 4UEYA 3T1XA 2JC7A 4JF6A 5GLCA 4MN6A 3DBAA 4EBLA 3RTYA 3NOUC 1H8MA 4H6JA 5JYOA 4OONA 1W79A 4JXGA 3ICYA 3VSLA 1YQSA 2FFFB 4NXGA 2J8YA 3Q7ZA 5CEDA 3MKFA 3BLMA 3RXWA 1HLUP 3CUEA 2Y2PA 4FSFA 1PWCA 2D01A 2GDNA 1YLTA 4KENB 1SDNA 3V3RA 5HWVA 1MWUA 3CMZA 3OPLA 1W5DA 1T1BA 1MWSA 5KIZA 4WYYA 2W3FA 3PBQA 4B9OA 5HD5A 1K54A 4DE1A 4S2IA 3LCEA 1FOFA 2EWWA 4CLCC 1V9YA 3VE4A 1XJ4A 4N9KA 2Y2KA 3LFVA 3ZG7B 5AQ9A 3HLEA 5DTKA 1NLZA 2XA7S 5AVEA 5FQMA 3VMAA 2Y2QA 1TVFA 5A90A 2C5WB 1TS7A 2YKHA 1WYBA 4KZ3A 4UAAA 3C4OA 4JGRA 5JYPA 3H7WB 3MQQA 2K7SA 3S7NA 2H5SA 1L3LA 1M40A 3N4IA 3BW6A 1SCWA 3PBRA 2I9VA 5GLBA 4A5RA 4E3LA 4LCMA 5KSHA 2H10A 3NOPC 4G3WA 5CX7A 3H82A 3L9KA 5CGSA 5HAIA 3SS4A 1K55C 4GZBA 1O07A 4KZBA 1J3WA 4HNBA 3WRTA 2XF3A 3PR6A 4GS9B 3UE3A 3G31A 1LLBA 4GS9A 3D72A 4L9GA 4IBXA 1ZHHB 4EQIA 5K5BA 1XGIA 3A3DA 3QNBA 3QP6A 5EVEA 1EROA 3UDIA 3EWKA 4WZ5A 1YKDA 1OT9A 1IOUA 5KMWA 1GSXA 5LBRA 1ALQA 4I3AA 3WS2A 4CPKA 1YAXA 3OPPA 2HJEA 5EVIB 2B18A 4XUZA 1STZA 2BTFP 5TJJA 4WMCA 3M2JA 3UNWA 4O01A 2ZMAA 3UMDA 3VE3A 4L9FA 1H0MA 4X68A 1SDEA 5G4YA 5DVAA 5DJTA 1GSVA 3PHYA 4HP9A 4YOFA 4EBNA 2K31A 4R3BA 5HL1A 4ZTKA 3D9YA 5CTMA 1TD5A 4DXBA 2OOLA 5CERA 5CHUA 3BFEA 2Z6DA 2QJ7A 1FCNA 3RJUA 3BYDA 4S2OA 4EQ1A 3PTEA 4Q0JA 1ONHA 3NDEA 3FZCA 1EWZA 2P9VB 4ARZA 4R3JA 4EEPA 5EV0A 2GNXA 5L2FA
chains in the Genus database with same CATH topology
1UGUA 2HJ9C 4LLOB 1F9IA 1DRMA 1OPXA 1V9ZA 1ZTUA 4ETXA 3FG8A 4R3AA 3U2AA 3MXQA 4WL9A 4I3IA 2PDRA 4F3LA 5HPFA 3OLOA 5DF9A 4I38A 5J3WA 4HOIA 3CI6A 5I5LA 3T4LA 2VJWA 3TW8A 5AVFA 2VLGA 1P0ZA 4UQIM 3F1NA 5F69A 4WELA 3PBTA 3EQUA 1UWNX 3UB9A 3OCNA 3UB8A 3UB6A 4BWIA 3LIEA 4DMZA 2CMNA 4R6LA 4BMWA 2KLIA 4Z1WA 2JKRI 3PBOA 2W3HA 3H7WA 3S7QA 4ME4A 1T19A 3B47A 1LSWA 4DJ3A 1OTAA 2A24B 1NWZA 4JGOA 3KSIA 3LIFA 3O5YA 3EQVA 5HD3A 3A0RA 2W1TA 3MQ0A 2W1TB 3CITA 3OBFA 2PR6A 3BY8A 1NRJA 2OAQ1 2GZAA 5HDSA 4LPZA 2J3TD 2W0NA 4GCZA 2ZBBA 3LR3A 3T4SA 3EGDC 2O9BA 3LI8A 4HIAA 3E98A 2VEAA 2Y8HA 3LIAA 4FOFA 3KYQA 5L8MA 2OWJA 3KX0X 4GHIA 3T4JA 2XSSA 2PYRA 3UB7A 1S4SA 3A0SA 3E4OA 3LIBA 3IBJA 1GSWA 2JKRM 1S66L 2P7JA 3JVUA 3OOVA 1W63M 3P01A 4IHQA 5HDDA 5DKLA 3H9WA 4M4XA 4O8GA 1TS0A 2K2NA 5J4EA 4OOLA 1NLYA 1OTDA 2EA9A 2LB9A 3NOTC 1S4RA 4II7A 4I3JA 3UMEA 1D7EA 2V0UA 1MC0A 3RFBA 1S1ZA 1XJ6A 2QKPA 3TE8A 3A0VA 3EGXC 5J7EA 3LICA 4HP4A 2W3GA 3P7NA 2MJ6A 2O9CA 3LR4A 2M1CA 3EOIA 2QHKA 5F68A 1LSXA 2OWHA 3F1OA 2VV8A 3PBSA 4R70A 2M7UA 2O0YA 3F1OB 2VZWA 3CUEC 4Y3IA 3CAXA 3T4QA 3KSFA 2VV7A 4LRYC 3ZQ5A 3EEHA 5HSQA 4MDZA 1DP6A 3FPWA 3FC7A 3MFXA 5DJUA 2XROA 3GDIA 5A8BA 3SW1A 2VKSA 3ULFA 3B42A 5MC7A 4MN7A 3LR5A 2INWA 4I5SA 4NXBA 3LIDA 2W3EA 2QJ5A 1LL8A 4WN5A 4EERA 3E4QA 1UWPX 3LUQA 4WEKA 2ZOIA 3R4KA 4YNRA 2FZ0A 2JKTM 1P9WA 4Q0IA 2JN7A 2XRNA 3BQAA 4O0PA 4MN5A 2L4RA 2DMWA 1KOUA 5F5YA 1XJ2A 2W1RA 2P08A 2KX6A 3BQ8A 4OOMA 4CLCA 5F6AA 4EW7A 3MMHA 3KYZA 2BASA 3PXPA 3V67A 4NXEA 3BWLA 4BBTA 3UE6A 2FH5A 3H82B 3T4KA 3ZYTA 4G3VA 4ZRRA 4CQHA 4GLQA 4LRZE 1ODVA 3LI9A 4EESA 4NXFA 1XJ3A 4NEED 2V0WA 3CWFA 1DP8A 1EW0A 4HH3A 2HF6A 3OCLA 4P6ZM 5DFYA 4AFIA 2KDKA 4GHIB 1G6OA 3RH8B 1T1AA 5HPIA 3NJAA 4HY8A 3BJNA 3T4OA 5IS1A 3B33A 3KSHA 2G7UA 5HDCA 2GJ3A 4BBVA 2P04A 2GX5A 3HJKA 4HQAA 1YSPA 4IUHA 2A2LA 1TS8A 4R38A 2NUPC 4UEYA 1JNUA 1N9NA 4L0LA 4MN6A 4ARZB 2L1MA 4RQ9A 3DBAA 3RTYA 1MKMA 3NOUC 3IS2A 2VV6A 4H6JB 1IFQA 4DN0A 1VHMA 3MJQA 1H8MA 4H6JA 5FL3A 3F1PB 4LRXC 3ICYA 1N9OA 3D3OA 2R78A 4NXGA 4UQIS 3KSGA 4HHDA 4EXOA 2VGLM 3C8CA 3VOLA 3T4TA 4GJ4A 3FPVA 3CUEA 4DJ2A 3KO6A 4FSFA 5DKKA 2D01A 4KUOA 2QWSA 3MQOA 3C30A 1P97A 5IU1A 4HJ6A 5IT5A 5HL6A 1S1YA 2KOIA 5HWVA 1W63Q 1XFQA 4E04A 4CLCD 1F5MA 3W2ZA 2H28A 4PKYA 1T1BA 4JGPA 4EETB 2WKRA 5KIZA 2EWVA 2PD7A 3HJIA 2W3FA 3PBQA 4B9OA 5HD5A 1D06A 2YKFA 3TJZC 4PHTA 1P9RA 2VX8A 1F98A 2EWWA 4CLCC 1YSQA 3C38A 3IS2B 4IJGA 1V9YA 3VE4A 1XJ4A 3C2WA 4WUJA 2QYBA 3LFVA 3TRCA 3HCYA 3F1NB 3K3DA 1X0OA 4EUVA 4L9EA 4BBUA 1NLZA 2XA7S 4Y2FA 4EU0A 5AVEA 3G6OA 1OTEA 1TS7A 4PAUA 2YKHA 1MZUA 5TBMB 2M7VA 4ETZA 4F3LB 4EEPA 5EFWA 2OAP1 4JGRA 3H7WB 3MQQA 2GNXA 2K7SA 3S7NA 4KQOA 2B02A 3BW6A 2J80A 3PBRA 2I9VA 4IUKA 2PR5A 3E4PA 4HH2A 4Q0HA 5KSHA 4G3WA 3NOPC 4Y5FA 2WKPA 5CX7A 1N9LA 3MR0A 3H82A 2D02A 1S67L 1G28A 1OTBA 2HV1A 4GW9A 3OC2A 4EEUA 2J3WA 3PYPA 4MCWA 2Y79A 4HNBA 4KUKA 5C5KA 3CLOA 2VA0A 3LR0A 4G3KA 4JGQA 4XT2B 3PR6A 3T50A 4GS9B 4QPRA 3UE3A 2VGLS 5HZHA 4GS9A 4L9GA 3D72A 4CLCE 3IBRA 3MF0A 3R7WA 1ZHHB 5K5BA 3R7WB 2V9AA 2ZMFA 1BYWA 2PT7A 2HGVA 2JHEA 4K08A 5AJGA 2J3TC 3EWKA 2WKQA 3S7PA 2NUTC 1YKDA 1OT9A 2W3DA 1IOUA 4CLCB 2O9AA 1OT6A 4NKPA 4YWZA 1GSXA 5LBRA 5HWTA 1TF1A 2JKTI 4I3AA 2PYPA 3PBNA 1VB6A 1YAXA 1DP9A 1LT0A 2HJEA 1WA9A 4I39A 2B18A 5TBMA 4WF0A 1STZA 1XFNA 3JVVA 2V1BA 5TJJA 5G4ZA 1TS6A 2L0WA 4WEJA 4HI4A 4O01A 3UMDA 1LSVA 3LYXA 4KQDA 3VE3A 4L9FA 4PKYG 2A24A 5G4YA 5DJTA 1GSVA 3PHYA 3E0YA 4B93A 4HP9A 4YOFA 3F1PA 2K31A 2XA7M 4P6ZS 2ZMVA 2PHYA 4MMNA 2ZOHA 1T18A 1TD5A 5HWWA 3NHQA 3EEAA 2OOLA 2Z6CA 1H3QA 4WLAA 3K3CA 4BJPA 1OJGA 2V1AA 2O99A 3K2NA 1OJ5A 3S7OA 3VV4A 2Z6DA 2QJ7A 2IA2A 2PD8A 4EQ1A 1OTIA 1Y28A 2W27A 4HJ3A 4Q0JA 3GECA 3BY9A 1T1CA 4HJ4A 4XT2A 4ARZA 5DFXA 2LB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B02 A;  2J80 A;  2I9V A;  3HJK A;  1UGU A;  2PR5 A;  3E4P A;  3LIC A;  4HP4 A;  5J7E A;  4HH2 A;  4LLO B;  4HQA A;  5HDC A;  1F9I A;  3NOP C;  1DRM A;  2WKP A;  3P7N A;  1N9L A;  3MR0 A;  1V9Z A;  3H82 A;  2D02 A;  1TS8 A;  1S67 L;  1G28 A;  2M1C A;  5F68 A;  2QHK A;  4R38 A;  1LSX A;  2OWH A;  3FG8 A;  3F1O A;  2VV8 A;  1OTB A;  2HV1 A;  4GW9 A;  1JNU A;  4R3A A;  4R70 A;  4EEU A;  1N9N A;  3F1O B;  3PYP A;  4MN6 A;  3MXQ A;  4WL9 A;  4I3I A;  2PDR A;  4F3L A;  2L1M A;  3CAX A;  4RQ9 A;  3OLO A;  4HNB A;  4KUK A;  3RTY A;  2VV7 A;  3NOU C;  4I38 A;  3IS2 A;  2VV6 A;  3CLO A;  3EEH A;  4H6J B;  4LRY C;  5J3W A;  4HOI A;  3ZQ5 A;  5HSQ A;  3MJQ A;  4JGQ A;  4XT2 B;  5I5L A;  4GS9 B;  3T50 A;  1DP6 A;  4H6J A;  5KIZ A;  5HZH A;  3FC7 A;  5AVF A;  2VLG A;  3B33 A;  4GS9 A;  1P0Z A;  3D72 A;  3MFX A;  3F1N A;  3IBR A;  4L9G A;  5F69 A;  5DJU A;  3GDI A;  5A8B A;  3SW1 A;  3F1P B;  1UWN X;  3UB9 A;  3UB8 A;  3UB6 A;  3ULF A;  4LRX C;  3ICY A;  2INW A;  4I5S A;  4BBV A;  3LIE A;  2V9A A;  1BYW A;  1N9O A;  4NXG A;  2R78 A;  4NXB A;  2CMN A;  4HHD A;  4R6L A;  4EXO A;  2JHE A;  3C8C A;  4K08 A;  3VOL A;  3EWK A;  3LID A;  1LL8 A;  4WN5 A;  2WKQ A;  4EER A;  3E4Q A;  1UWP X;  1OT9 A;  3H7W A;  3LUQ A;  2ZOI A;  1T19 A;  1OT6 A;  1LSW A;  4YWZ A;  4DJ2 A;  1OTA A;  1GSX A;  2A24 B;  5HWT A;  1NWZ A;  4DJ3 A;  4JGO A;  3LIF A;  5DKK A;  2D01 A;  4I3A A;  4KUO A;  2QWS A;  3MQO A;  2JN7 A;  2PYP A;  5HD3 A;  1P97 A;  3A0R A;  5IU1 A;  1VB6 A;  4HJ6 A;  1DP9 A;  1LT0 A;  4MN5 A;  2L4R A;  2PR6 A;  3BY8 A;  1WA9 A;  1KOU A;  4I39 A;  5F5Y A;  1XJ2 A;  5TBM A;  1S1Y A;  2KX6 A;  5HDS A;  4LPZ A;  4WF0 A;  1XFN A;  5HWV A;  2V1B A;  1XFQ A;  2W0N A;  4GCZ A;  5G4Z A;  2ZBB A;  1TS6 A;  2L0W A;  5F6A A;  4E04 A;  4EW7 A;  4HI4 A;  2H28 A;  4PKY A;  3LI8 A;  4HIA A;  2BAS A;  2VEA A;  3UMD A;  3LIA A;  1LSV A;  3LYX A;  1T1B A;  4KQD A;  3VE3 A;  4JGP A;  4L9F A;  4NXE A;  3BWL A;  4PKY G;  2WKR A;  2A24 A;  2OWJ A;  5G4Y A;  3UE6 A;  4BBT A;  5DJT A;  4EET B;  1GSV A;  2PD7 A;  3KX0 X;  3PHY A;  3H82 B;  4GHI A;  4HP9 A;  3HJI A;  4B9O A;  3F1P A;  5HD5 A;  1D06 A;  2PYR A;  3UB7 A;  2YKF A;  1S4S A;  3A0S A;  3E4O A;  2PHY A;  3LIB A;  4LRZ E;  2ZOH A;  1GSW A;  1F98 A;  1S66 L;  1T18 A;  2P7J A;  1ODV A;  3IS2 B;  3LI9 A;  5HWW A;  1V9Y A;  3NHQ A;  4EES A;  3VE4 A;  2OOL A;  4NXF A;  2Z6C A;  1XJ4 A;  1XJ3 A;  5DKL A;  4WLA A;  5HDD A;  3H9W A;  3C2W A;  2V0W A;  4M4X A;  4WUJ A;  3CWF A;  1DP8 A;  1TS0 A;  1EW0 A;  5J4E A;  3F1N B;  3K3C A;  3K3D A;  1X0O A;  4HH3 A;  1OJG A;  4L9E A;  2V1A A;  1OTD A;  4BBU A;  2EA9 A;  3NOT C;  2KDK A;  1OJ5 A;  1S4R A;  5AVE A;  4I3J A;  3UME A;  4GHI B;  2Z6D A;  1D7E A;  2QJ7 A;  2PD8 A;  2V0U A;  3G6O A;  1OTE A;  4EQ1 A;  1OTI A;  1TS7 A;  3RH8 B;  2YKH A;  1MZU A;  1T1A A;  1Y28 A;  2W27 A;  4HJ3 A;  1S1Z A;  5TBM B;  4F3L B;  3NJA A;  3GEC A;  5EFW A;  1XJ6 A;  3BY9 A;  1T1C A;  2QKP A;  4JGR A;  4HJ4 A;  4HY8 A;  3H7W B;  4XT2 A;  5IS1 A;  3A0V A;  3MQQ A;  2K7S A;  4EEP A;  2QJ5 A;  2GJ3 A; 
#chains in the Genus database with same CATH topology
 1K56 A;  5E2F A;  3ISG A;  3QP5 A;  1WYC A;  5HX9 A;  2VGJ A;  4RA7 A;  2PDR A;  4F3L A;  3GV9 A;  4I38 A;  5J3W A;  3CI6 A;  1YLW A;  2VJW A;  2PU2 A;  5AVF A;  4BQM A;  2ZM8 A;  5F69 A;  4WEL A;  5DF7 A;  3Q81 A;  5I94 A;  1DJA A;  3QNC A;  3T1R A;  3SZT A;  2BG1 A;  3NEC A;  4XUX A;  3FKW A;  4E3J A;  2A24 B;  5EPH A;  1JTG A;  1NWZ A;  3SH9 A;  2ZQA A;  3LIF A;  4OPQ A;  4Y17 A;  2W1T A;  2I72 A;  1AXB A;  4IVK A;  1S0W A;  3OBF A;  4OPY A;  2OAQ 1;  4LPZ A;  3MBZ A;  5CEB A;  3LR3 A;  3QHY A;  3T4S A;  3HLF A;  5DTS A;  2O9B A;  1VM1 A;  3E98 A;  4CJN A;  2Y8H A;  5L8M A;  3ITB A;  3KX0 X;  1K55 A;  3TSG A;  3OPH A;  1BLS A;  3ZG5 A;  1KDS A;  1G5U A;  4IHQ A;  1FCM A;  5DKL A;  1TS0 A;  4OOL A;  1NLY A;  3NOT C;  3C7U A;  3UME A;  1D7E A;  3WS1 A;  3IHB A;  3W4O A;  1YMX A;  2ZC4 B;  3EGX C;  5FI7 A;  2IWB A;  4JLF A;  4MBF A;  4X1L A;  3LR4 A;  3EOI A;  1K0K A;  3PBS A;  4R70 A;  2XDM A;  2M7U A;  2O0Y A;  4GDB A;  2ZJ9 A;  3F1O B;  4JXS A;  4RVA A;  2H0Y A;  3CAX A;  3HUO A;  3T1Q B;  2HP9 A;  4FCF A;  1DP6 A;  5FQJ A;  3MFX A;  5GHY A;  2XRO A;  3GDI A;  3SW1 A;  2VKS A;  2PU4 A;  3UO9 A;  3LR5 A;  3P98 A;  4I5S A;  3LY4 A;  2W3E A;  3M6H A;  2EXB A;  3LUQ A;  2XQZ A;  1EI5 A;  2JN7 A;  2XD5 A;  2L4R A;  4LFU A;  3G32 A;  3BQ8 A;  4OVD A;  4CLC A;  5KZH A;  1JWZ A;  3IXG A;  4D2O A;  4X25 A;  4GB7 A;  4JKT A;  3BWL A;  4HES A;  4BBT A;  3UE6 A;  1PNE A;  3T4K A;  4P85 A;  1LI9 A;  4PM8 A;  4GN2 A;  3GSG A;  2ZC6 B;  4MBK A;  1ODV A;  3LI9 A;  3IXD A;  4Y13 A;  4HH3 A;  4KZ6 A;  4FD8 A;  5DFY A;  4YFM A;  2V8F A;  2X02 A;  4H8R A;  3S1Y A;  1GHM A;  3N6I A;  5EM1 A;  1KDW A;  1XXM A;  3MFD A;  3BJN A;  3SS5 A;  2G7U A;  5HDC A;  3HJK A;  1YSP A;  3IQA A;  3BLS A;  5DTT A;  1TS8 A;  1K54 C;  1D1J A;  1GCE A;  5M1A A;  5FDH A;  4RQ9 A;  4WZ5 C;  3OZH A;  2XH9 A;  1A0K A;  2VV6 A;  3IS2 A;  4R4S A;  1IFQ A;  1ZKJ A;  1VHM A;  3MJQ A;  1F2K A;  2WGW B;  1E3U A;  1N4O A;  1ZC2 A;  2Q9M A;  3F1P B;  3M6B A;  4QHC A;  1KGE A;  4UQI S;  3KSG A;  3AGD A;  1PIO A;  1GHI A;  2AVX A;  3VOL A;  2G2W A;  3T4T A;  3DAV A;  3D4F A;  4DJ2 A;  1QMF A;  3KO6 A;  1PW8 A;  1SKO B;  4C3Q A;  1BUL A;  3C30 A;  5IU1 A;  4JXW A;  5HL6 A;  1TDL A;  1BTL A;  4MBH A;  1XFQ A;  2PAV P;  4E04 A;  2EX6 A;  2H28 A;  5F1F A;  1XA7 A;  1G68 A;  2EWV A;  2XR0 A;  3WS4 A;  2PD7 A;  4RYE A;  3WS0 A;  4Y0T A;  1I2S A;  2DRW A;  2UWX A;  1IEM A;  2C6W B;  2A3U A;  4KQR A;  2VX8 A;  4KZ4 A;  1F98 A;  3HBR A;  2PBY A;  3IHA A;  2R9X A;  1U60 A;  3IF6 C;  3UB5 P;  1X0O A;  3MZD A;  4L9E A;  3JPU A;  4BBU A;  4Y2F A;  3G6O A;  1OTE A;  1I5Q A;  4PAU A;  4ETZ A;  5TBM B;  4U3T A;  1PI4 A;  2B02 A;  1MPL A;  3U4L P;  3IF5 A;  4HH2 A;  4Q0H A;  1K6S A;  2WKP A;  5FAO A;  4PM5 A;  2PRF A;  2D02 A;  1OTB A;  1NJ4 A;  4GW9 A;  5GLA A;  5HFO A;  3VP3 A;  2J3W A;  3PYP A;  3QP2 A;  4MCW A;  1FIK A;  2V8C A;  4OH0 A;  2VA0 A;  2P9V A;  1MWR A;  4QPR A;  1ESI A;  5BOH A;  3MF0 A;  1H8Y A;  2V1Z A;  2V9A A;  4LV1 A;  2HGV A;  1CI8 A;  3Q82 A;  4K08 A;  5AJG A;  2J3T C;  3UE0 A;  3IH8 A;  3HRE A;  3HLC A;  2O9A A;  4NKP A;  5HWT A;  1K25 A;  3M2K A;  1QME A;  3DTM A;  3ZNT A;  3Q07 A;  1DJC A;  5DF8 A;  5E2E A;  1XFN A;  4KG6 A;  4R1G A;  2ZC5 B;  1GA0 A;  4B88 A;  4HI4 A;  1K56 D;  4PKY G;  4DRT A;  2A24 A;  3F1P A;  2XA7 M;  4P6Z S;  3IXH A;  2PHY A;  3ZG8 B;  4MMN A;  1C3B A;  5FEF A;  3EEA A;  1H3Q A;  1PYY A;  3K3C A;  4BJP A;  4KQQ A;  2PD8 A;  4DE3 A;  4GD6 A;  2EFU A;  2W27 A;  1BT5 A;  3W8K A;  1GA9 A;  2J9O A;  3BY9 A;  1T1C A;  5TFQ A;  4ZBE A;  2HZ5 A;  3SH7 A;  4U0X A;  5FAP A;  2LB5 A;  4OP8 A;  3V5M A;  1UGU A;  5E2H A;  1ERQ A;  3BEB A;  4R3A A;  1M6K A;  1YT4 A;  3CPT B;  3U2A A;  4WL9 A;  5HPF A;  4GNU A;  4MEZ A;  5I5L A;  4QJG A;  3TW8 A;  1MKI A;  2VLG A;  3F1N A;  3UB8 A;  5HW3 A;  4DMZ A;  4Y0O A;  2OLU A;  3GRJ A;  4BMW A;  2KLI A;  4Z1W A;  3H7W A;  4UA6 A;  4DJ3 A;  1LSW A;  3KSI A;  4FTX A;  3EQV A;  2EXA A;  4OKP A;  4UHU A;  3MQ0 A;  2PR6 A;  1IKG A;  5HDS A;  4D60 A;  1VEU B;  2J3T D;  4N1X A;  2XK1 A;  4DF6 A;  1MBL A;  3CZD A;  2Y4A A;  3EGD C;  3LIA A;  3KYQ A;  4UA7 A;  5AQ7 A;  1FCO A;  1K57 A;  4WBG A;  4KZ7 A;  3T4J A;  2XSS A;  1RGZ A;  3L7H A;  5F1G A;  3A0S A;  3E4O A;  4S2J A;  3MSH A;  1GSW A;  2JKR M;  2X71 A;  4PM6 A;  2P7J A;  3JVU A;  4F94 A;  1W63 M;  4WZ4 A;  1BUE A;  3LO7 A;  1ACF A;  4LV0 A;  1IYS A;  4OLG A;  2LB9 A;  4PM9 A;  1IYP A;  1S4R A;  2RCX A;  4II7 A;  3HUM A;  1PWD A;  2V0U A;  1MC0 A;  1I2W A;  3RFB A;  3IX3 A;  1SHV A;  4WMC D;  4JF5 A;  3TE8 A;  4LCL A;  1NY0 A;  1FR1 A;  1Q2Q A;  4E6X A;  5J7E A;  3LIC A;  2W3G A;  3Q7V B;  3ZGA B;  3P7N A;  4E3N A;  3UPP A;  2QHK A;  4BL3 A;  2H0T A;  3G2Z A;  2VV8 A;  5EEC A;  2VZW A;  5EUA A;  3EEH A;  3FPW A;  5CTN A;  3FC7 A;  5L09 A;  5FQQ A;  3WWX A;  2IWC A;  3ULF A;  4E3K A;  4JPM A;  2INW A;  1L0F A;  4DDY A;  3ZVT A;  4KZ5 A;  4O7D A;  1YM1 A;  2WUQ A;  1LL8 A;  4KZA A;  2ACG A;  3E4Q A;  3W4P A;  4ZDX A;  2QMI A;  4YNR A;  1H8Z A;  3LGO A;  2FZ0 A;  3Q1F A;  4Q0I A;  4FH2 A;  2JBF A;  5J8X A;  1CJF A;  5F5Y A;  4BD0 A;  3BFC A;  1ES4 A;  2JKG A;  2WYX A;  1FSW A;  2BAS A;  3PXP A;  3C5A A;  3ZCZ A;  1IKI A;  3ZG9 B;  1LHY A;  2ZQ9 A;  3ZYT A;  4GLQ A;  1ESU A;  4IED A;  4EES A;  2Y2O A;  4E3I A;  4NXF A;  3UN7 A;  1JTD A;  1BLC A;  3NUL A;  2HP5 A;  4BEN A;  3T12 B;  4P6Z M;  4AFI A;  2ZQ7 A;  5FQK A;  1G6O A;  2XEP A;  5HPI A;  2OV5 A;  3UY6 A;  2WAD A;  2GJ3 A;  2P04 A;  3ZHH A;  3ZFZ A;  2GX5 A;  4OP5 A;  4B4X A;  4IBR A;  4FH4 A;  1XA1 A;  2A2L A;  1G6A A;  4NET A;  3IWO A;  3IWQ A;  2NUP C;  2ZQD A;  1JNU A;  1YLJ A;  3CPT A;  3S22 A;  1ZG4 A;  2ZQ8 A;  1MKM A;  3HUN A;  5EOO A;  2Y2N A;  2DNS A;  3MXS A;  5CGX A;  5EVI D;  3GVB A;  5AQB A;  1TDG A;  2V2F F;  4LRX C;  1N9O A;  3MS6 A;  5CGW A;  3MKE A;  4LV2 A;  4FUW A;  1WE4 A;  5HAQ A;  3C8C A;  3FPV A;  3VSK A;  1W7F A;  2WKE A;  5DKK A;  4KUO A;  2V20 A;  3MQO A;  3ZG0 A;  1P97 A;  4HJ6 A;  4GOG A;  1S1Y A;  4DKI A;  1BLH A;  3A3I A;  3W2Z A;  3BRM A;  1E25 A;  3GTC A;  3HLG A;  2WKR A;  3C4P A;  5FEG A;  3BFG A;  3NDG A;  3TJZ C;  1DJB A;  4PHT A;  4E6W A;  2ZLY A;  1YSQ A;  2Y91 A;  3IS2 B;  4Z9Q A;  3C2W A;  1K4F A;  3TRC A;  1VET A;  3HCY A;  1E4D A;  1PRQ A;  1YLP A;  3F1N B;  4QU3 A;  4EUV A;  1VET B;  3ZNY A;  2HDQ A;  4EU0 A;  5A91 A;  4OQI A;  4P6B A;  5FQI A;  1MZU A;  2HDR A;  2M7V A;  2OAP 1;  1NZO A;  2ZM0 A;  1E3U D;  4KQO A;  2J80 A;  3VFF A;  5EVI C;  2PR5 A;  4Y5F A;  3C7V A;  1N9L A;  2B95 A;  2HV1 A;  4ID4 A;  2Y79 A;  3CG5 A;  3CLO A;  4WM9 A;  3LR0 A;  4G3K A;  4XT2 B;  3T50 A;  4R4R A;  4LV3 A;  1BSG A;  3R7W B;  4Y15 A;  5CXW A;  3IF6 B;  2PT7 A;  4X69 A;  2QZ6 A;  2WKQ A;  3S7P A;  2NUT C;  2W3D A;  1XP4 A;  1DY6 A;  3O3V A;  4X1M A;  1RGY A;  4N92 A;  1DP9 A;  3N8S A;  4I39 A;  4WF0 A;  5G4Z A;  2Y2L A;  1TS6 A;  3CJM A;  2WZZ A;  4OPZ A;  4DE2 A;  3IX4 A;  3UPN A;  2OLV A;  4S2P A;  2Y2H A;  2ZMV A;  4MLL A;  2Q0O A;  1L0G A;  3RXX A;  2WKI A;  2EFX A;  1KVL A;  4JXV A;  3IX8 A;  4K91 A;  2Y2I A;  2Y59 A;  3NHQ A;  5FI6 A;  2P74 A;  1OJG A;  3AGE A;  2O99 A;  3K2N A;  4EV4 A;  1OJ5 A;  3S7O A;  2IA2 A;  1W8Q A;  2Z2L B;  1Z6F A;  3GEC A;  1BZA A;  4HJ4 A;  4DDS A;  4XT2 A;  5DFX A;  4S2L A;  2QPN A;  2HJ9 C;  3N7W A;  4LLO B;  1V9Z A;  1RCJ A;  2ZQC A;  1ES2 A;  1ZTU A;  1XPB A;  3IF6 A;  3FG8 A;  4I3I A;  2ZL1 B;  5FSR A;  2Q9N A;  3T4L A;  5TGF A;  5L07 A;  3V39 A;  3PBT A;  3UB9 A;  3UB6 A;  3LIE A;  5FAT A;  3OPR A;  3DW0 A;  4R6L A;  3A3E A;  1NZU A;  3PBO A;  3S7Q A;  4BLM A;  4ME4 A;  3B47 A;  2VK3 A;  1OTA A;  4JGO A;  5HD3 A;  2RL3 A;  4LGW A;  3BY8 A;  1NRJ A;  4BD1 A;  2GZA A;  4X56 A;  2W0N A;  2Z2M B;  4GCZ A;  5A93 A;  2ZBB A;  4Y0U A;  4EUZ A;  3A3J A;  3NI9 A;  4HIA A;  4C6Y A;  1ONG A;  4FOF A;  5E2G A;  2OWJ A;  3HLW A;  3PAG A;  4GHI A;  3P09 A;  3UB7 A;  1ES3 A;  1S4S A;  2J9P A;  2VGK A;  3IBJ A;  3FWL A;  3HLB A;  3P01 A;  1MY8 A;  4PMA A;  5TR7 A;  3H9W A;  4M4X A;  4O8G A;  2K2N A;  2XFT A;  4I3J A;  1GHP A;  1KE0 A;  1XJ6 A;  3UPO A;  3A0V A;  5EE8 A;  2HP6 A;  3DTK A;  4HP4 A;  3FV7 A;  3GQZ A;  1NYY A;  1LL5 A;  5F68 A;  4ZAM A;  4S2N C;  1K38 A;  5GL9 A;  1YPR A;  3CUE C;  1SZV A;  3T4Q A;  1YLZ A;  1NRF A;  4LRY C;  3ZQ5 A;  3BFD A;  1K4E A;  3LEZ A;  1CEF A;  4OOY A;  2Y55 A;  3O88 A;  3G4P A;  5A8B A;  3B42 A;  5MC7 A;  4NK3 A;  5GLD A;  1ERM A;  3CHW P;  4N1H A;  3G34 A;  4EER A;  1PI5 A;  5FDS A;  1UWP X;  4WEK A;  3R4K A;  2XD1 A;  2JKT M;  1P9W A;  3BQA A;  4MN5 A;  2DMW A;  5FI2 A;  3TOI A;  3G2Y A;  2P08 A;  2KX6 A;  4OOM A;  4OLD A;  5EM0 A;  3MMH A;  3KYZ A;  4EBP A;  5AQA A;  3V67 A;  3BFF A;  2FH5 A;  5FAQ A;  2EX8 A;  1PZP A;  5M18 A;  2J7V A;  1XJ3 A;  4NEE D;  1XX2 A;  3Q7V A;  1DP8 A;  2ZC3 B;  1EW0 A;  2HF6 A;  3V50 A;  3OCL A;  2KDK A;  2Y2M A;  4GHI B;  1K57 C;  1ES5 A;  3RH8 B;  4IVI A;  3NJA A;  3UDF A;  5FA7 A;  4ESP A;  1PW1 A;  3T4O A;  3B33 A;  4BBV A;  1HTZ A;  4HQA A;  3VFH A;  3VOY A;  4GKU A;  4S2N A;  4R38 A;  1N9N A;  3NC8 A;  4L0L A;  4ARZ B;  4BL2 A;  2L1M A;  1XKZ A;  4EWF A;  4H6J B;  4DN0 A;  3PAE A;  3E2L A;  3QP1 A;  3DTI A;  5FL3 A;  2XGN A;  2XFS A;  1Q2P A;  2EX2 A;  4KG5 A;  2A49 A;  3N8L A;  3D3O A;  2R78 A;  4HHD A;  4EXO A;  2Y2G A;  2VGL M;  1O7E A;  4QY6 A;  4GJ4 A;  1CEG A;  4PM7 A;  1IYQ A;  3VP2 A;  5CHM A;  1CQA A;  2QWS A;  4OQG A;  3NY4 A;  5IT5 A;  3QP8 A;  1TEM A;  1CK3 A;  2KOI A;  1Y54 A;  2BLS A;  1W63 Q;  1PWG A;  4S2K A;  2WZX A;  2WGI A;  4KZ8 A;  1F5M A;  4CLC D;  3MXR A;  4PKY A;  1RP5 A;  3MZF A;  4JGP A;  1JWV A;  4DE0 A;  4EET B;  4R0Q A;  3MZE A;  3HJI A;  1LI0 A;  4Q8I A;  3JYI A;  1D06 A;  2YKF A;  4LEN A;  1P9R A;  3N8R A;  4OQH A;  3C38 A;  4IJG A;  3W4Q A;  1W8Y A;  4KG2 A;  1H5X A;  4WUJ A;  2QYB A;  3K3D A;  4XXR A;  3HLD A;  5A92 A;  5U47 A;  1MWT A;  4K0W A;  4F3L B;  4K0X A;  5EFW A;  1J9M A;  5HAR A;  5CEC A;  4IUK A;  4ZJ1 A;  5EOE A;  3E4P A;  4MNR A;  2ZC7 A;  3MR0 A;  2HDS A;  4X55 A;  1S67 L;  1G28 A;  1MXO A;  4UA9 A;  3VP1 A;  2B5R A;  3OC2 A;  4EEU A;  1N9B A;  3O87 A;  3TG9 A;  3E2K A;  4KUK A;  5C5K A;  3O86 A;  4JGQ A;  1YLY A;  2VGL S;  5HZH A;  1L0D A;  4CLC E;  3IBR A;  3R7W A;  1LL9 A;  2JKF A;  5EVL A;  2ZMF A;  1BYW A;  4X53 A;  2JHE A;  3G30 A;  4CLC B;  1OT6 A;  4YWZ A;  4E3M A;  1TF1 A;  2JKT I;  5GHZ A;  2PYP A;  4JF4 A;  4ZJ3 A;  3PBN A;  3AGF A;  1VB6 A;  1LT0 A;  1AWI A;  1WA9 A;  5TBM A;  3JVV A;  2V1B A;  4C75 A;  5HAP A;  5L10 A;  2L0W A;  1L0E A;  4WEJ A;  3NCK A;  4KZ9 A;  4X6T A;  1LSV A;  3LYX A;  4KQD A;  3IT9 A;  2EX9 A;  3E0Y A;  1HVB A;  1Z09 A;  4HEF A;  4B93 A;  3KYE A;  1FSY A;  1JVJ A;  3IWI A;  3BEC A;  2ZOH A;  1T18 A;  4QB8 A;  5FQ9 A;  5HWW A;  5IHV A;  2HDU A;  2Z6C A;  1XGJ A;  4WLA A;  3IXB A;  4N9L A;  2V1A A;  5E43 A;  3VP0 A;  3VV4 A;  3QP4 A;  3DWK A;  1OTI A;  4HJ3 A;  1Y28 A;  1FQG A;  3I7J A;  2QJ5 A;  5F83 A;  1CI9 A;  1IEL A;  1F9I A;  3NBL A;  1DRM A;  1OPX A;  3ZDJ A;  1YMS A;  4ETX A;  1FR6 A;  5M19 A;  3T1S A;  3MXQ A;  1L2S A;  4S2M A;  1HZO A;  3FKV A;  3OLO A;  5DF9 A;  2OSU A;  4HOI A;  1NYM A;  3IH9 A;  1P0Z A;  4UQI M;  1FIL A;  4DXC A;  3EQU A;  1UWN X;  5EVI A;  3OCN A;  4BWI A;  4OPR A;  2UV0 E;  5KSC A;  2ZL1 A;  2CMN A;  5FAS A;  4Y7P A;  1VEU A;  2JKR I;  3UE1 A;  2W3H A;  1T19 A;  3NIA A;  1HD8 A;  3HL9 A;  3O5Y A;  3A0R A;  1Y4O A;  3SOI A;  3V3S A;  4U0T A;  2W1T B;  1PZO A;  3CIT A;  4HBU A;  1ZG6 A;  3LI8 A;  2E8I A;  1SKO A;  2VEA A;  2WAF A;  4QD4 A;  4YIN A;  2PYR A;  3FYZ A;  2DCF A;  3LIB A;  1S66 L;  3OOV A;  1KVM A;  1NXY A;  5HDD A;  4NG2 A;  2WGW A;  5J4E A;  1SKF A;  2WK0 A;  3LEQ A;  1OTD A;  2EA9 A;  1KE4 A;  1OME A;  5GHX A;  1S1Z A;  2QKP A;  5CRF A;  3B3X A;  4E3O A;  2G2U A;  4RX2 A;  3ITA A;  3BM6 A;  3GR2 A;  2XLN A;  2X01 A;  2MJ6 A;  2O9C A;  3VOZ A;  1CF0 A;  2M1C A;  1LSX A;  2OWH A;  3F1O A;  1S6R A;  2R9W A;  3S4X A;  3DWZ A;  4Y3I A;  2IWD A;  3KSF A;  2VV7 A;  2E8J A;  5HSQ A;  2CC1 A;  4MDZ A;  3WS5 A;  3UDX A;  3G35 A;  5DJU A;  4MN7 A;  3SS3 A;  1IYO A;  4NXB A;  3A3F A;  4P87 A;  3LID A;  4WN5 A;  4OQ0 A;  4GDN A;  1PFL A;  4JBF A;  5G18 A;  2ZOI A;  4HBT A;  2XRN A;  1KGG A;  4O0P A;  4QY5 A;  1KOU A;  4PPR A;  1XJ2 A;  2W1R A;  2JCH A;  5F6A A;  4EW7 A;  2WAE A;  1K6R A;  4P0M A;  4ZJ2 A;  3DTE A;  4NXE A;  3H82 B;  3VP4 A;  4G3V A;  2WKH A;  5F82 A;  4ZRR A;  4CQH A;  4R23 A;  3WRZ A;  4LRZ E;  3GMW A;  1KGF A;  2ZD8 A;  1JWP A;  3SH8 A;  4RX3 A;  1KE3 A;  2FFY A;  2Y2J A;  5D3O A;  4M3K A;  2V0W A;  3CWF A;  4GD8 A;  2WGV A;  5CHJ A;  4B4Z A;  1VQQ A;  3HVF A;  4QWO A;  1T1A A;  2HPB A;  4HY8 A;  2JE5 A;  5IS1 A;  3KSH A;  2ZM2 A;  3ZVW A;  3LY3 A;  2PBD P;  1BLP A;  4IUH A;  4UEY A;  3T1X A;  2JC7 A;  4JF6 A;  5GLC A;  4MN6 A;  3DBA A;  4EBL A;  3RTY A;  3NOU C;  1H8M A;  4H6J A;  5JYO A;  4OON A;  1W79 A;  4JXG A;  3ICY A;  3VSL A;  1YQS A;  2FFF B;  4NXG A;  2J8Y A;  3Q7Z A;  5CED A;  3MKF A;  3BLM A;  3RXW A;  1HLU P;  3CUE A;  2Y2P A;  4FSF A;  1PWC A;  2D01 A;  2GDN A;  1YLT A;  4KEN B;  1SDN A;  3V3R A;  5HWV A;  1MWU A;  3CMZ A;  3OPL A;  1W5D A;  1T1B A;  1MWS A;  5KIZ A;  4WYY A;  2W3F A;  3PBQ A;  4B9O A;  5HD5 A;  1K54 A;  4DE1 A;  4S2I A;  3LCE A;  1FOF A;  2EWW A;  4CLC C;  1V9Y A;  3VE4 A;  1XJ4 A;  4N9K A;  2Y2K A;  3LFV A;  3ZG7 B;  5AQ9 A;  3HLE A;  5DTK A;  1NLZ A;  2XA7 S;  5AVE A;  5FQM A;  3VMA A;  2Y2Q A;  1TVF A;  5A90 A;  2C5W B;  1TS7 A;  2YKH A;  1WYB A;  4KZ3 A;  4UAA A;  3C4O A;  4JGR A;  5JYP A;  3H7W B;  3MQQ A;  2K7S A;  3S7N A;  2H5S A;  1L3L A;  1M40 A;  3N4I A;  3BW6 A;  1SCW A;  3PBR A;  2I9V A;  5GLB A;  4A5R A;  4E3L A;  4LCM A;  5KSH A;  2H10 A;  3NOP C;  4G3W A;  5CX7 A;  3H82 A;  3L9K A;  5CGS A;  5HAI A;  3SS4 A;  1K55 C;  4GZB A;  1O07 A;  4KZB A;  1J3W A;  4HNB A;  3WRT A;  2XF3 A;  3PR6 A;  4GS9 B;  3UE3 A;  3G31 A;  1LLB A;  4GS9 A;  3D72 A;  4L9G A;  4IBX A;  1ZHH B;  4EQI A;  5K5B A;  1XGI A;  3A3D A;  3QNB A;  3QP6 A;  5EVE A;  1ERO A;  3UDI A;  3EWK A;  4WZ5 A;  1YKD A;  1OT9 A;  1IOU A;  5KMW A;  1GSX A;  5LBR A;  1ALQ A;  4I3A A;  3WS2 A;  4CPK A;  1YAX A;  3OPP A;  2HJE A;  5EVI B;  2B18 A;  4XUZ A;  1STZ A;  2BTF P;  5TJJ A;  4WMC A;  3M2J A;  3UNW A;  4O01 A;  2ZMA A;  3UMD A;  3VE3 A;  4L9F A;  1H0M A;  4X68 A;  1SDE A;  5G4Y A;  5DVA A;  5DJT A;  1GSV A;  3PHY A;  4HP9 A;  4YOF A;  4EBN A;  2K31 A;  4R3B A;  5HL1 A;  4ZTK A;  3D9Y A;  5CTM A;  1TD5 A;  4DXB A;  2OOL A;  5CER A;  5CHU A;  3BFE A;  2Z6D A;  2QJ7 A;  1FCN A;  3RJU A;  3BYD A;  4S2O A;  4EQ1 A;  3PTE A;  4Q0J A;  1ONH A;  3NDE A;  3FZC A;  1EWZ A;  2P9V B;  4ARZ A;  4R3J A;  4EEP A;  5EV0 A;  2GNX A;  5L2F A; 
#chains in the Genus database with same CATH homology
 1UGU A;  2HJ9 C;  4LLO B;  1F9I A;  1DRM A;  1OPX A;  1V9Z A;  1ZTU A;  4ETX A;  3FG8 A;  4R3A A;  3U2A A;  3MXQ A;  4WL9 A;  4I3I A;  2PDR A;  4F3L A;  5HPF A;  3OLO A;  5DF9 A;  4I38 A;  5J3W A;  4HOI A;  3CI6 A;  5I5L A;  3T4L A;  2VJW A;  3TW8 A;  5AVF A;  2VLG A;  1P0Z A;  4UQI M;  3F1N A;  5F69 A;  4WEL A;  3PBT A;  3EQU A;  1UWN X;  3UB9 A;  3OCN A;  3UB8 A;  3UB6 A;  4BWI A;  3LIE A;  4DMZ A;  2CMN A;  4R6L A;  4BMW A;  2KLI A;  4Z1W A;  2JKR I;  3PBO A;  2W3H A;  3H7W A;  3S7Q A;  4ME4 A;  1T19 A;  3B47 A;  1LSW A;  4DJ3 A;  1OTA A;  2A24 B;  1NWZ A;  4JGO A;  3KSI A;  3LIF A;  3O5Y A;  3EQV A;  5HD3 A;  3A0R A;  2W1T A;  3MQ0 A;  2W1T B;  3CIT A;  3OBF A;  2PR6 A;  3BY8 A;  1NRJ A;  2OAQ 1;  2GZA A;  5HDS A;  4LPZ A;  2J3T D;  2W0N A;  4GCZ A;  2ZBB A;  3LR3 A;  3T4S A;  3EGD C;  2O9B A;  3LI8 A;  4HIA A;  3E98 A;  2VEA A;  2Y8H A;  3LIA A;  4FOF A;  3KYQ A;  5L8M A;  2OWJ A;  3KX0 X;  4GHI A;  3T4J A;  2XSS A;  2PYR A;  3UB7 A;  1S4S A;  3A0S A;  3E4O A;  3LIB A;  3IBJ A;  1GSW A;  2JKR M;  1S66 L;  2P7J A;  3JVU A;  3OOV A;  1W63 M;  3P01 A;  4IHQ A;  5HDD A;  5DKL A;  3H9W A;  4M4X A;  4O8G A;  1TS0 A;  2K2N A;  5J4E A;  4OOL A;  1NLY A;  1OTD A;  2EA9 A;  2LB9 A;  3NOT C;  1S4R A;  4II7 A;  4I3J A;  3UME A;  1D7E A;  2V0U A;  1MC0 A;  3RFB A;  1S1Z A;  1XJ6 A;  2QKP A;  3TE8 A;  3A0V A;  3EGX C;  5J7E A;  3LIC A;  4HP4 A;  2W3G A;  3P7N A;  2MJ6 A;  2O9C A;  3LR4 A;  2M1C A;  3EOI A;  2QHK A;  5F68 A;  1LSX A;  2OWH A;  3F1O A;  2VV8 A;  3PBS A;  4R70 A;  2M7U A;  2O0Y A;  3F1O B;  2VZW A;  3CUE C;  4Y3I A;  3CAX A;  3T4Q A;  3KSF A;  2VV7 A;  4LRY C;  3ZQ5 A;  3EEH A;  5HSQ A;  4MDZ A;  1DP6 A;  3FPW A;  3FC7 A;  3MFX A;  5DJU A;  2XRO A;  3GDI A;  5A8B A;  3SW1 A;  2VKS A;  3ULF A;  3B42 A;  5MC7 A;  4MN7 A;  3LR5 A;  2INW A;  4I5S A;  4NXB A;  3LID A;  2W3E A;  2QJ5 A;  1LL8 A;  4WN5 A;  4EER A;  3E4Q A;  1UWP X;  3LUQ A;  4WEK A;  2ZOI A;  3R4K A;  4YNR A;  2FZ0 A;  2JKT M;  1P9W A;  4Q0I A;  2JN7 A;  2XRN A;  3BQA A;  4O0P A;  4MN5 A;  2L4R A;  2DMW A;  1KOU A;  5F5Y A;  1XJ2 A;  2W1R A;  2P08 A;  2KX6 A;  3BQ8 A;  4OOM A;  4CLC A;  5F6A A;  4EW7 A;  3MMH A;  3KYZ A;  2BAS A;  3PXP A;  3V67 A;  4NXE A;  3BWL A;  4BBT A;  3UE6 A;  2FH5 A;  3H82 B;  3T4K A;  3ZYT A;  4G3V A;  4ZRR A;  4CQH A;  4GLQ A;  4LRZ E;  1ODV A;  3LI9 A;  4EES A;  4NXF A;  1XJ3 A;  4NEE D;  2V0W A;  3CWF A;  1DP8 A;  1EW0 A;  4HH3 A;  2HF6 A;  3OCL A;  4P6Z M;  5DFY A;  4AFI A;  2KDK A;  4GHI B;  1G6O A;  3RH8 B;  1T1A A;  5HPI A;  3NJA A;  4HY8 A;  3BJN A;  3T4O A;  5IS1 A;  3B33 A;  3KSH A;  2G7U A;  5HDC A;  2GJ3 A;  4BBV A;  2P04 A;  2GX5 A;  3HJK A;  4HQA A;  1YSP A;  4IUH A;  2A2L A;  1TS8 A;  4R38 A;  2NUP C;  4UEY A;  1JNU A;  1N9N A;  4L0L A;  4MN6 A;  4ARZ B;  2L1M A;  4RQ9 A;  3DBA A;  3RTY A;  1MKM A;  3NOU C;  3IS2 A;  2VV6 A;  4H6J B;  1IFQ A;  4DN0 A;  1VHM A;  3MJQ A;  1H8M A;  4H6J A;  5FL3 A;  3F1P B;  4LRX C;  3ICY A;  1N9O A;  3D3O A;  2R78 A;  4NXG A;  4UQI S;  3KSG A;  4HHD A;  4EXO A;  2VGL M;  3C8C A;  3VOL A;  3T4T A;  4GJ4 A;  3FPV A;  3CUE A;  4DJ2 A;  3KO6 A;  4FSF A;  5DKK A;  2D01 A;  4KUO A;  2QWS A;  3MQO A;  3C30 A;  1P97 A;  5IU1 A;  4HJ6 A;  5IT5 A;  5HL6 A;  1S1Y A;  2KOI A;  5HWV A;  1W63 Q;  1XFQ A;  4E04 A;  4CLC D;  1F5M A;  3W2Z A;  2H28 A;  4PKY A;  1T1B A;  4JGP A;  4EET B;  2WKR A;  5KIZ A;  2EWV A;  2PD7 A;  3HJI A;  2W3F A;  3PBQ A;  4B9O A;  5HD5 A;  1D06 A;  2YKF A;  3TJZ C;  4PHT A;  1P9R A;  2VX8 A;  1F98 A;  2EWW A;  4CLC C;  1YSQ A;  3C38 A;  3IS2 B;  4IJG A;  1V9Y A;  3VE4 A;  1XJ4 A;  3C2W A;  4WUJ A;  2QYB A;  3LFV A;  3TRC A;  3HCY A;  3F1N B;  3K3D A;  1X0O A;  4EUV A;  4L9E A;  4BBU A;  1NLZ A;  2XA7 S;  4Y2F A;  4EU0 A;  5AVE A;  3G6O A;  1OTE A;  1TS7 A;  4PAU A;  2YKH A;  1MZU A;  5TBM B;  2M7V A;  4ETZ A;  4F3L B;  4EEP A;  5EFW A;  2OAP 1;  4JGR A;  3H7W B;  3MQQ A;  2GNX A;  2K7S A;  3S7N A;  4KQO A;  2B02 A;  3BW6 A;  2J80 A;  3PBR A;  2I9V A;  4IUK A;  2PR5 A;  3E4P A;  4HH2 A;  4Q0H A;  5KSH A;  4G3W A;  3NOP C;  4Y5F A;  2WKP A;  5CX7 A;  1N9L A;  3MR0 A;  3H82 A;  2D02 A;  1S67 L;  1G28 A;  1OTB A;  2HV1 A;  4GW9 A;  3OC2 A;  4EEU A;  2J3W A;  3PYP A;  4MCW A;  2Y79 A;  4HNB A;  4KUK A;  5C5K A;  3CLO A;  2VA0 A;  3LR0 A;  4G3K A;  4JGQ A;  4XT2 B;  3PR6 A;  3T50 A;  4GS9 B;  4QPR A;  3UE3 A;  2VGL S;  5HZH A;  4GS9 A;  4L9G A;  3D72 A;  4CLC E;  3IBR A;  3MF0 A;  3R7W A;  1ZHH B;  5K5B A;  3R7W B;  2V9A A;  2ZMF A;  1BYW A;  2PT7 A;  2HGV A;  2JHE A;  4K08 A;  5AJG A;  2J3T C;  3EWK A;  2WKQ A;  3S7P A;  2NUT C;  1YKD A;  1OT9 A;  2W3D A;  1IOU A;  4CLC B;  2O9A A;  1OT6 A;  4NKP A;  4YWZ A;  1GSX A;  5LBR A;  5HWT A;  1TF1 A;  2JKT I;  4I3A A;  2PYP A;  3PBN A;  1VB6 A;  1YAX A;  1DP9 A;  1LT0 A;  2HJE A;  1WA9 A;  4I39 A;  2B18 A;  5TBM A;  4WF0 A;  1STZ A;  1XFN A;  3JVV A;  2V1B A;  5TJJ A;  5G4Z A;  1TS6 A;  2L0W A;  4WEJ A;  4HI4 A;  4O01 A;  3UMD A;  1LSV A;  3LYX A;  4KQD A;  3VE3 A;  4L9F A;  4PKY G;  2A24 A;  5G4Y A;  5DJT A;  1GSV A;  3PHY A;  3E0Y A;  4B93 A;  4HP9 A;  4YOF A;  3F1P A;  2K31 A;  2XA7 M;  4P6Z S;  2ZMV A;  2PHY A;  4MMN A;  2ZOH A;  1T18 A;  1TD5 A;  5HWW A;  3NHQ A;  3EEA A;  2OOL A;  2Z6C A;  1H3Q A;  4WLA A;  3K3C A;  4BJP A;  1OJG A;  2V1A A;  2O99 A;  3K2N A;  1OJ5 A;  3S7O A;  3VV4 A;  2Z6D A;  2QJ7 A;  2IA2 A;  2PD8 A;  4EQ1 A;  1OTI A;  1Y28 A;  2W27 A;  4HJ3 A;  4Q0J A;  3GEC A;  3BY9 A;  1T1C A;  4HJ4 A;  4XT2 A;  4ARZ A;  5DFX A;  2LB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...