3KX0X

Crystal structure of the pas domain of rv1364c
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
135
structure length
127
Chain Sequence
b'EMDWDKTVGAAEDVRRIFEHIPAILVGLEGPDHRFVAVNAAYRGFSPLLDTVGQPAREVYPELEGQQIYEMLDRVYQTGEPQSGSEWRLQEERYFDFVVTPRRRADGSIEGVQLIVDDVTSRVRARQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein Rv1364c/MT1410
molecule tags Signaling protein
source organism Mycobacterium tuberculosis
publication title Role of a PAS sensor domain in the Mycobacterium tuberculosis transcription regulator Rv1364c
pubmed doi rcsb
total genus 30
structure length 127
sequence length 135
ec nomenclature
pdb deposition date 2009-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF08448 PAS_4 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3kx0X00
1BYWA 1TS6A 2JHEA 1LSXA 2L1MA 2OOLA 1UGUA 2OWHA 4HP4A 1MZUA 3UB6A 3BY9A 3LYXA 2PYPA 4DJ3A 1S4SA 2A24A 3ICYA 3LIFA 3OLOA 1T19A 3H82A 5TBMA 1S66L 1S4RA 2H28A 4JGPA 1TS8A 5DKKA 1V9ZA 5DKLA 5F6AA 1D7EA 5F68A 3GDIA 3H9WA 1LT0A 4GCZA 3VOLA 3CAXA 3NOUC 1DRMA 4JGOA 4L9GA 4BBVA 5HDDA 4I5SA 4PKYA 2Z6DA 2VV7A 3A0SA 1UWNX 2VLGA 4L9EA 3F1PA 4LRXC 1LL8A 4WF0A 2V1AA 3CWFA 4EESA 4EQ1A 4KUOA 1F9IA 2V9AA 4HHDA 4HNBA 1EW0A 2PHYA 4L9FA 4R6LA 2ZBBA 5HD5A 5IU1A 4EERA 2YKFA 3K3CA 3LIEA 3UMDA 4HJ3A 5KIZA 3A0RA 4H6JA 2BASA 5HZHA 5EFWA 4EEPA 3F1OB 4R38A 5DJTA 2QJ5A 3BWLA 3D72A 3E4OA 3C8CA 3LIAA 4DJ2A 4F3LA 4R3AA 1V9YA 3LUQA 1ODVA 2WKPA 1T1CA 4EEUA 3F1NA 1OTEA 4HY8A 2HV1A 2EA9A 3E4QA 3K3DA 2KDKA 1WA9A 1P97A 3IBRA 3LIBA 4I38A 5AVFA 2INWA 5HWWA 2I9VA 3C2WA 1UWPX 3UB8A 1LSVA 4HQAA 1XJ6A 1VB6A 4JGQA 3F1PB 3MFXA 1N9NA 4GS9B 4K08A 3IS2B 2JN7A 2YKHA 4WN5A 4NXGA 4EXOA 4F3LB 2QWSA 1OT9A 1D06A 5J4EA 2VV6A 3RH8B 2L4RA 1N9LA 4BBUA 2D01A 2WKRA 5J3WA 4HJ4A 1TS0A 3P7NA 5TBMB 1F98A 1OTAA 4HI4A 4XT2B 1XFNA 3VE3A 2KX6A 4BBTA 2V1BA 1TS7A 4KUKA 3SW1A 3MJQA 1JNUA 1DP9A 4R70A 4NXFA 1LSWA 3IS2A 2W27A 4WLAA 4GS9A 2QJ7A 4HH3A 4HOIA 5HDCA 2VEAA 3E4PA 4E04A 4EETB 1T18A 2GJ3A 1OJ5A 2M1CA 4EW7A 4NXEA 3H82B 3PHYA 5G4ZA 3LICA 3LIDA 1OTBA 1XJ2A 2ZOIA 3H7WB 2PDRA 2PYRA 4KQDA 1DP6A 3RTYA 5HWVA 5J7EA 2J80A 4HJ6A 2R78A 1G28A 1T1BA 5DJUA 4M4XA 3ULFA 3HJKA 5HSQA 3NOPC 4GHIB 1X0OA 4MN5A 1KOUA 4WUJA 5A8BA 2Z6CA 4I3IA 3NHQA 1GSXA 4I39A 4LLOB 2PR6A 5G4YA 3EWKA 3FC7A 2V0UA 4YWZA 3MXQA 3UMEA 3G6OA 1OJGA 3NOTC 1OTDA 2WKQA 2P7JA 3FG8A 5F5YA 3UE6A 1OTIA 3T50A 4LRZE 1Y28A 5HD3A 2OWJA 2ZOHA 3MQOA 4I3AA 3KX0X 4GW9A 5I5LA 2VV8A 2W0NA 1OT6A 3LI8A 1DP8A 1GSWA 3A0VA 4XT2A 5F69A 3NJAA 4GHIA 3LI9A 3PYPA 3EEHA 2L0WA 2QHKA 1S67L 4LPZA 2A24B 4HIAA 3UB7A 4JGRA 3H7WA 3MR0A 4WL9A 3F1OA 1T1AA 4HP9A 2CMNA 3HJIA 2QKPA 3BY8A 1S1ZA 1P0ZA 4B9OA 1GSVA 1XFQA 4H6JB 4LRYC 3UB9A 4PKYG 1N9OA 2K7SA 4HH2A 4I3JA 2D02A 1XJ3A 5AVEA 4RQ9A 5IS1A 1XJ4A 2V0WA 3CLOA 4NXBA 3GECA 2PR5A 3F1NB 5HWTA 3ZQ5A 2B02A 4MN6A 1NWZA 2PD8A 1S1YA 3B33A 3MQQA 5HDSA 3VE4A 2PD7A
chains in the Genus database with same CATH superfamily
4KZBA 1BYWA 2OWHA 1UGUA 3BY9A 2R9WA 3OLOA 4WELA 3R7WB 2Y55A 2ZMVA 1ZC2A 2GNXA 2QYBA 3T1RA 5TR7A 5F6AA 1AWIA 5TJJA 5A93A 3CJMA 3F1PA 3IH8A 1PW8A 4MCWA 2X02A 2V9AA 3C30A 5HD5A 5IU1A 1YSPA 3T1QB 4Y7PA 3LO7A 3D72A 5L07A 4LV2A 3P01A 3UN7A 4JGQA 3C7VA 4WN5A 2JN7A 5J4EA 4PM7A 4U3TA 4KUKA 4R70A 1P9WA 1KE4A 1LSWA 3W4QA 2OSUA 1KVLA 4RA7A 3M6HA 2EX8A 4HOIA 4EETB 5AQ9A 2GDNA 2HPBA 5EOOA 5GLAA 5GLCA 2VJWA 1SKFA 1WE4A 4IVIA 3V3SA 4HJ6A 3NOPC 5A8BA 1KDSA 3EWKA 3NDGA 3NOTC 3VV4A 1LHYA 4LCLA 5HD3A 2BG1A 4JF5A 3BECA 3NECA 4N1HA 3JYIA 1I2SA 3H7WA 3HJIA 5EVIB 1S1ZA 4G3VA 2ZM8A 5A90A 2VA0A 3GECA 1NWZA 1JTDA 3GMWA 5FDHA 3TJZC 1L0EA 1YLPA 4B93A 4Y5FA 3K2NA 2J7VA 5FAOA 3UB6A 5M18A 2A24A 3ICYA 1FCMA 5EM1A 1BSGA 4R3JA 4E6XA 5F1GA 3VOLA 3EOIA 3N8RA 3G2ZA 2VV7A 3A0SA 3GSGA 3OPLA 3RH8B 5FQJA 1IFQA 1SDNA 2BASA 4UQIS 3EGDC 1HLUP 1Q2QA 4F3LA 2Y2GA 3PR6A 4I38A 4OPZA 2B5RA 3S7OA 2DMWA 2XDMA 1CEGA 1Q2PA 1QMEA 2D01A 2O99A 4C6YA 4S2MA 2J9OA 5GHYA 5HARA 5L2FA 4OOYA 1YQSA 2PYRA 1S6RA 2R78A 1G28A 3VSLA 3EQVA 2XROA 1AXBA 1W5DA 4KZ9A 3BLMA 4X55A 4LGWA 3FG8A 2WKIA 4LRZE 1TD5A 5F83A 5I5LA 1PYYA 1OT6A 3LI8A 3TRCA 1FOFA 3IBJA 1PZPA 4E3LA 4WL9A 2WK0A 4LRYC 1XKZA 2H5SA 4R4SA 3DWZA 2PR5A 2PD8A 3VE4A 3VP3A 3IXGA 5IT5A 1S4SA 3BQAA 4OOMA 1Z6FA 3NOUC 1DRMA 2HP6A 1ACFA 2J9PA 5I94A 3CWFA 1CF0A 4KUOA 2WGVA 1EW0A 3MMHA 2ZD8A 5CERA 3NC8A 4H6JA 4E3JA 3PBQA 5EFWA 3F1OB 3TW8A 1K38A 3BWLA 1VQQA 4MNRA 1ODVA 1RGYA 2WKEA 5HWWA 4EBLA 1PWDA 3F1PB 1W8YA 1CI9A 2PBYA 3PXPA 3SS3A 3SH8A 1OTAA 3ZG0A 1XFNA 3VE3A 3UPPA 4ZDXA 2JKFA 4GS9A 3E4PA 2V1ZA 4BWIA 2Y2NA 1FCNA 1K57C 3Q7ZA 2WAFA 4N1XA 5DJUA 1H8MA 4GHIB 1DJCA 2W3DA 4E3MA 1S0WA 2KOIA 1PIOA 3NIAA 2Z2LB 2MJ6A 2PU4A 1BULA 1H5XA 5L10A 3T50A 2VZWA 2ZOHA 3NY4A 3IF6C 4EQIA 5A91A 1STZA 3BFFA 4X25A 1IELA 2ZC3B 4WEJA 5DF8A 4N9LA 1P0ZA 1GSVA 1IOUA 3WRTA 3KSHA 1K54C 3MSHA 2DNSA 2D02A 1XJ3A 2JC7A 5CTMA 3EEAA 2XF3A 1CQAA 5CEDA 2Y79A 1FCOA 4FH4A 3BRMA 4QU3A 4X1LA 3CMZA 5BOHA 1T19A 2ZJ9A 4NKPA 2HJ9C 1ES2A 2JKTM 4L9GA 1HD8A 5HDDA 5CHMA 1KGFA 4BQMA 2CC1A 3B47A 1BZAA 4R6LA 3R4KA 1VEUB 4KQQA 2VK3A 2ZQAA 5KIZA 4OONA 4ZAMA 3HUNA 2O9BA 2WKPA 1SZVA 1YLJA 3G35A 2QPNA 1XJ6A 4NXGA 4ME4A 1D06A 3NI9A 1YSQA 1MKIA 1ESIA 2WGWA 4Q8IA 5DTTA 1LI0A 5FATA 3VP1A 2V1BA 4ETXA 5FEFA 3SW1A 3CZDA 3RXXA 3BFCA 1NYMA 2V20A 3LR5A 5HDCA 4E04A 1JWVA 5LBRA 1GHIA 5G4ZA 3LICA 1YKDA 3H7WB 5EVID 3C4OA 3LEZA 4M4XA 1Y54A 4PAUA 2Y2KA 4CJNA 4EUVA 3Q82A 1VETB 1PRQA 3FKVA 1G68A 3ITAA 1PFLA 1ES3A 3ZVWA 3T4KA 3EEHA 1S67L 3W8KA 3Q1FA 3Q7VA 2DCFA 2V8FA 2ZM0A 4ID4A 2B95A 2EX2A 4OKPA 1K54A 2PD7A 2O9CA 3CUEA 3OPRA 1MBLA 4PHTA 3C4PA 4OQHA 3IWIA 2ZQ8A 4Z1WA 3NBLA 1F2KA 4FH2A 3O3VA 4UA7A 2W3HA 1NZOA 4GNUA 2HV1A 5AVFA 4LV0A 4BL2A 1UWPX 1YMXA 4JXWA 3QP6A 1MWUA 2QMIA 4G3WA 2I72A 4GLQA 3E2LA 4ETZA 2HGVA 3R7WA 4U0TA 3P98A 2IWDA 3G31A 2V2FF 5FA7A 3MJQA 2PAVP 3UY6A 5CEBA 2UWXA 2WUQA 2H10A 1NLZA 1I2WA 5EVIA 4OP5A 1MWTA 1MY8A 4ESPA 4ZRRA 1X0OA 1CI8A 2PR6A 2VX8A 4R3BA 5CTNA 1GA9A 1OTIA 1CK3A 3DTMA 3LY3A 2VV8A 3N7WA 4GHIA 2E8JA 2Z2MB 4KZ7A 5DF9A 4GN2A 2HJEA 3UB7A 4AFIA 3SS5A 3HLFA 4C75A 1N9OA 3PBOA 3DW0A 1EROA 1M6KA 4Q0JA 4IBXA 5GHZA 3OOVA 1VM1A 4IJGA 3B33A 4WZ5A 5HDSA 3IHBA 1HVBA 3E0YA 1BUEA 2JHEA 4IUHA 4YOFA 2ZL1B 5EPHA 3ZYTA 1PZOA 2H28A 2WADA 3IWQA 2Y4AA 2FZ0A 1OMEA 1LT0A 1K55C 4BBVA 2Y2PA 1FIKA 2J3TC 1K25A 2Z6DA 5FAQA 2W3EA 5CECA 2V1AA 4CLCE 3NDEA 3VP0A 4RVAA 4HBTA 5HZHA 5FI7A 5MC7A 4DJ2A 3LUQA 2KLIA 4GDBA 1PWCA 3BQ8A 2GZAA 1YAXA 2ACGA 2FFYA 2XH9A 3MFXA 3UDFA 4II7A 4F3LB 4OPQA 5CHUA 4PPRA 3UE1A 4XT2B 5EECA 3M2KA 3DBAA 4DKIA 2GJ3A 2HDQA 4EW7A 1MWRA 1O7EA 1NRJA 4BMWA 3V3RA 3IT9A 3O5YA 2Y2IA 4E3OA 3MQ0A 2A2LA 2M7UA 4I39A 4P87A 2RL3A 5KSHA 3LEQA 4HEFA 1LI9A 1OJGA 2W3GA 2P7JA 3IX4A 2WZZA 5F5YA 3A3DA 2IWBA 3A0VA 3ISGA 3QP5A 4ZJ1A 1ESUA 1E4DA 1QMFA 2G2UA 2XA7M 4JGRA 5M19A 4KZ3A 3GVBA 5AVEA 5TFQA 3C7UA 4MN6A 2XSSA 3MKFA 3ZNTA 2QZ6A 5CXWA 1S66L 3ZNYA 1K56D 2O0YA 5EVLA 5HL1A 3AGFA 4LRXC 3OCNA 2J3TD 5CRFA 2YKFA 3K3CA 4KZ5A 3PAGA 3FKWA 1ONGA 3IF6B 3N4IA 3F1NA 4HY8A 3E4QA 4NETA 3LIBA 1LSVA 2H0TA 4EXOA 2E8IA 1LLBA 5EVIC 4X68A 4KZAA 1XGIA 4IUKA 4Q0HA 1NLYA 2M1CA 2Y2QA 3VOZA 1TDGA 3S1YA 1KDWA 2Z6CA 5GHXA 3IXDA 3D3OA 4DE2A 4K0XA 4BD1A 1M40A 1E25A 2Y2HA 3FPVA 1JWPA 4MMNA 1GCEA 5FQKA 1H8YA 4NG2A 4GKUA 3UB9A 4DE1A 3IHAA 2K31A 2WGIA 2B02A 4JBFA 3WS1A 3G34A 4E3NA 2VGJA 2JKRM 1K56A 3LIFA 3H82A 1KGGA 5F68A 3ZG9B 3SH7A 1K4FA 4UAAA 4I5SA 4WF0A 4H8RA 3VP4A 4HNBA 3VMAA 4JF6A 5G18A 2WAEA 4HJ3A 4O01A 5DFYA 5DJTA 4KZ8A 1XA7A 3FV7A 3UPNA 4K08A 1N9LA 4Y15A 5J3WA 1IYQA 4X6TA 1JNUA 2A3UA 4Y17A 3ZG5A 4WLAA 4FTXA 3NCKA 1J9MA 4HESA 3UDXA 1FR1A 2ZOIA 4G3KA 1XXMA 3FZCA 1HZOA 3TG9A 3MXSA 4OLGA 4MN5A 1SKOA 3C5AA 3E2KA 3BEBA 5HL6A 3UPOA 2HZ5A 4XUXA 4KZ6A 2JKRI 3TE8A 1JTGA 2W0NA 1DP8A 4E3IA 5EOEA 3NJAA 3LI9A 4JPMA 4MDZA 5DTKA 3U4LP 3F1OA 2CMNA 5L09A 1WYCA 3MFDA 4H6JB 3QP1A 1O07A 1E3UA 4NXBA 3F1NB 1BLSA 1H8ZA 1BLPA 3BYDA 4D2OA 1A0KA 5TBMA 1YM1A 5DKKA 3HUOA 5HAPA 1D7EA 1OPXA 4MBFA 1VHMA 2ZC6B 4OOLA 4Z9QA 2XA7S 1LL8A 4X56A 4L9FA 5E2HA 2LB5A 1CJFA 5HPFA 3C8CA 4BENA 3PAEA 4EV4A 4QD4A 5CGSA 2EA9A 4GDNA 5AQ7A 2INWA 1ES5A 4HQAA 3C38A 3IS2B 2HDSA 4LV3A 4JXVA 5FAPA 2L4RA 4BBUA 1PI5A 4DN0A 4HJ4A 1K0KA 2OAP1 4PM8A 4Y0OA 3T1XA 3IS2A 2W27A 2QJ7A 4QB8A 3HREA 4WBGA 1YMSA 2EFXA 2B18A 3PHYA 1GHPA 5FI2A 3E98A 2NUTC 4EBNA 3G32A 1SCWA 3HLBA 1T1BA 5AJGA 4WUJA 4EU0A 1SHVA 5G4YA 3Q81A 4YWZA 4D60A 4DRTA 4OLDA 1RCJA 5HFOA 2EX9A 3HVFA 2P74A 4RX3A 4K0WA 4XT2A 5F69A 3BW6A 4MEZA 3ZGAB 5GLDA 1H3QA 2L0WA 5U47A 2HF6A 2JKTI 3HCYA 3IWOA 2VGLS 3KO6A 4WYYA 2UV0E 2ZL1A 4S2NA 1NYYA 3S7NA 1NXYA 2XR0A 2OOLA 3ZG8B 1MZUA 3LYXA 1DJAA 3HL9A 1S4RA 2Y2LA 3EQUA 1PWGA 4XUZA 1NY0A 3TSGA 3I7JA 4FUWA 5DTSA 2Y91A 3S4XA 4EEPA 1G6AA 1N9BA 1OTEA 1EI5A 1ZTUA 3UO9A 3CPTB 4CQHA 1CEFA 3MZFA 4S2LA 5HW3A 4KQRA 2P9VB 5K5BA 3S7QA 1T18A 1BLHA 3A3FA 2R9XA 4O0PA 1XJ2A 1J3WA 3LR0A 3KSIA 4LCMA 4KENB 2NUPC 4KQOA 5FQQA 2WKQA 3WS5A 3UE6A 2H0YA 2PRFA 3HLCA 1XA1A 3B3XA 5EV0A 3UE3A 3VOYA 3WS4A 4X1MA 1ES4A 1NJ4A 4HP9A 2PT7A 1SDEA 4HH2A 3T12B 1MWSA 2EFUA 2C6WB 3MZEA 3V50A 1FSWA 4YNRA 4WMCA 3BM6A 2Y2OA 4DE0A 1TS6A 2EWWA 1H0MA 3DTIA 3CHWP 3FWLA 2XLNA 4EUZA 4UEYA 5E2EA 1K55A 1TEMA 3LR4A 1XPBA 2G7UA 3LY4A 4N9KA 3UB5P 3LCEA 2IWCA 1L0GA 4S2OA 3BFDA 1FR6A 3IH9A 1RGZA 3G4PA 4E6WA 3T4TA 3A0RA 4ZTKA 4GD6A 5FSRA 4EEUA 3DTKA 4MLLA 5KMWA 3ZDJA 3RJUA 1EWZA 1W79A 1IKGA 4IVKA 4WZ4A 5KSCA 2VV6A 2WKRA 3O86A 5TBMB 2AVXA 2JKGA 3PTEA 4KZ4A 3A3IA 5HX9A 3KYZA 1YLTA 2VEAA 4PM5A 1ERQA 4QPRA 4Y3IA 4KQDA 2VGKA 5GLBA 5HWVA 1KVMA 1RP5A 3MF0A 5HSQA 4OQGA 4QHCA 1YLWA 1D1JA 3GR2A 1OTDA 2ZQ7A 2OLVA 3AGDA 4CLCD 1YLYA 2X71A 1Y4OA 3MS6A 2WGWB 4NK3A 4R23A 3Q7VB 3MR0A 2LB9A 1DJBA 4LFUA 1LL5A 4QWOA 2K7SA 2XQZA 3ZCZA 2RCXA 4R4RA 4ZBEA 3ZQ5A 2XD1A 3QNBA 3UNWA 3QNCA 3MQQA 1XP4A 1GHMA 3VFHA 4DJ3A 2PYPA 3UE0A 5FDSA 1VEUA 1ZKJA 1JWZA 5F82A 3H9WA 3RXWA 4FOFA 1ALQA 3HLEA 3CPTA 4YFMA 4U0XA 3P09A 3SH9A 3ZVTA 4EERA 1IKIA 4L0LA 2QJ5A 3E4OA 4OQIA 4R3AA 1T1CA 5FQIA 4YINA 2KDKA 3RFBA 1XX2A 4LV1A 1VB6A 3B42A 2HDRA 4GS9B 1W8QA 1K6SA 5EVEA 1XGJA 3IQAA 4WZ5C 3SS4A 3JVUA 5CX7A 2OLUA 2KX6A 3PBRA 3G2YA 4HH3A 1IYOA 3NULA 5F1FA 4QJGA 2P08A 1BLCA 2Y2JA 4FD8A 2ZLYA 4JKTA 1TF1A 2PDRA 2J80A 1IYSA 3ULFA 1KOUA 1JVJA 3HLWA 4DMZA 2V0UA 2K2NA 3T4LA 4N92A 4OH0A 2HP9A 3N6IA 3KX0X 1GSWA 4PMAA 4WM9A 4LPZA 4HIAA 3MXRA 3BY8A 4B9OA 2GX5A 5JYPA 2VGLM 4RQ9A 2V0WA 3TOIA 4KG5A 3ITBA 4OPRA 2ZC4B 3PYPA 3M2JA 2ZQCA 4O7DA 3W4PA 2ZQDA 1L2SA 2EWVA 5CGWA 5L8MA 2EX6A 3G30A 1P9RA 3T4SA 4PKYA 4L9EA 2VLGA 3LGOA 4HHDA 2PHYA 2P04A 3UMDA 2JE5A 1F5MA 3L9KA 5DVAA 5EM0A 4M3KA 1FSYA 5E2GA 3K3DA 4C3QA 3ZFZA 1P97A 4ZJ3A 4P6ZM 4HBUA 1OT9A 2BLSA 5D3OA 1NRFA 4IHQA 1TS7A 4FCFA 4DF6A 3WWXA 1DP9A 1TVFA 4BLMA 4NXFA 3QP2A 3W4OA 5CGXA 5HAIA 4DDSA 4UHUA 3D9YA 3KYEA 5FI6A 4JXSA 3IF6A 3IXHA 3RTYA 2ZMFA 1DP6A 1HTZA 3GV9A 4X53A 3QHYA 4X69A 2W1TA 4FSFA 1GSXA 4BL3A 4S2KA 4DE3A 3N8SA 4MBKA 4DDYA 4UQIM 2OWJA 4GW9A 4MN7A 1YT4A 2WZXA 4Q0IA 4OVDA 2A24B 2XRNA 4Y0UA 1G5UA 4PKYG 3EGXC 5J8XA 2DRWA 4ARZB 3W2ZA 5E43A 5JYOA 1W63Q 3DWKA 4XXRA 2BTFP 3T4JA 1YLZA 4BD0A 4B88A 1V9ZA 5DKLA 3HBRA 2OV5A 5E2FA 4O8GA 5AQAA 3IXBA 1E3UD 3QP4A 4DXBA 1K4EA 1MC0A 1G6OA 2Y59A 1C3BA 2EXAA 2ZM2A 2XFTA 1ERMA 3CI6A 3C2WA 3LFVA 4GD8A 4K91A 4GB7A 4MBHA 3T1SA 2YKHA 2QWSA 2Q0OA 1KE3A 2Y8HA 1L3LA 2W1TB 3P7NA 3PBNA 4HI4A 4BBTA 3OC2A 2W1RA 2O9AA 3WS0A 4R1GA 3QP8A 2EXBA 1BTLA 1OJ5A 1KE0A 3U2AA 5TGFA 3IX8A 3LIDA 1OTBA 4PM6A 3OCLA 2P9VA 1NZUA 3T4OA 3KYQA 4F94A 4Y13A 5AQBA 1W63M 1YPRA 3T4QA 3DAVA 3G6OA 2XK1A 3A3JA 3PBSA 4I3AA 1SKOB 3D4FA 1L0FA 1T1AA 2WKHA 2QKPA 4BJPA 4EBPA 5KZHA 5HWTA 1K6RA 2Q9MA 2HP5A 2J3WA 4R0QA 2L1MA 2Y2MA 4HP4A 4EWFA 3DTEA 1MXOA 4S2IA 1U60A 4UA9A 4JGPA 5CHJA 1IYPA 4P0MA 4B4XA 3GDIA 4DXCA 3SZTA 3CAXA 4JGOA 3CG5A 1UWNX 4EESA 4EQ1A 1F9IA 5FL3A 2G2WA 2WYXA 3BLSA 3BFGA 4GZBA 4R38A 3JVVA 4OPYA 4ARZA 1V9YA 4JXGA 3BJNA 2OAQ1 1WA9A 4LENA 2I9VA 3UB8A 5A92A 3HLGA 1N9NA 3UDIA 4KG2A 1FQGA 1WYBA 3CITA 3IF5A 1K57A 2A49A 3LR3A 1ZHHB 4RYEA 3WRZA 4ZJ2A 3GRJA 4P6BA 1DY6A 3GTCA 3V39A 3VSKA 2C5WB 5HPIA 2XEPA 1I5QA 1IEMA 4NXEA 4S2NC 3V5MA 2W3FA 3M6BA 5J7EA 1KGEA 1ZG6A 3HJKA 3O87A 3A3EA 2JCHA 3MZDA 3NHQA 3OZHA 3FC7A 2FFFB 4KG6A 1Y28A 3MQOA 5FQ9A 2QHKA 2XFSA 3L7HA 4P6ZS 2M7VA 1ONHA 2X01A 3HLDA 2IA2A 3S22A 4I3JA 4P85A 4WEKA 3SOIA 3OPPA 2Q9NA 4Y2FA 3IX3A 4CLCA 3CLOA 1TDLA 2ZQ9A 3N8LA 5GL9A 3FPWA 1L0DA 1MPLA 4GOGA 1LSXA 4S2JA 3OBFA 1PNEA 1ZG4A 1TS8A 4UA6A 3CUEC 4GJ4A 3V67A 4GCZA 4IBRA 3VFFA 2FH5A 3BFEA 1VETA 2XGNA 5FQMA 3FYZA 3VP2A 5IHVA 3S7PA 2ZBBA 3LIEA 3KSGA 1LL9A 3JPUA 4JF4A 2ZC5B 1N4OA 1W7FA 1GA0A 3MBZA 3LIAA 4CLCC 4A5RA 4E3KA 5FASA 2HDUA 4JLFA 2XD5A 3IBRA 2JBFA 3PBTA 5FEGA 5EE8A 2ZMAA 5HAQA 1PW1A 3HUMA 1BT5A 1TS0A 1Z09A 3OPHA 5DFXA 1F98A 3ZG7B 3WS2A 2PBDP 4B4ZA 1FILA 5EUAA 4Y0TA 4QY5A 3H82B 4OQ0A 4PM9A 3ZHHA 4QY6A 4NEED 4I3IA 4CPKA 3Q07A 4LLOB 5DF7A 3GQZA 2V8CA 3KSFA 3MXQA 3UMEA 1MKMA 2PU2A 4OP8A 4CLCB 4WMCD 2J8YA 4IEDA 5C5KA 4S2PA 1PI4A 3MKEA 1XFQA 3AGEA 4RX2A 5IS1A 2ZC7A 1XJ4A 5M1AA 3O88A 1S1YA 2VKSA
chains in the Genus database with same CATH topology
1BYWA 2OWHA 2O9CA 1UGUA 3CUEA 3BY9A 3OLOA 4WELA 3R7WB 2ZMVA 5TBMA 5DKKA 2EWVA 2GNXA 2QYBA 5L8MA 5F6AA 1D7EA 4PHTA 1OPXA 1P9RA 5TJJA 3T4SA 1VHMA 4PKYA 4L9EA 4OOLA 2VLGA 2XA7S 3F1PA 1LL8A 4MCWA 2V9AA 4HHDA 4L9FA 2PHYA 3C30A 5HD5A 5IU1A 4Z1WA 1YSPA 2LB5A 2P04A 3UMDA 1F5MA 5HPFA 3D72A 3C8CA 2W3HA 2HV1A 3P01A 2EA9A 3K3DA 1P97A 5AVFA 2INWA 1UWPX 4HQAA 4JGQA 4P6ZM 3C38A 2JN7A 3IS2B 4WN5A 4G3WA 1OT9A 5J4EA 2L4RA 4BBUA 4GLQA 4ETZA 2HGVA 4DN0A 4HJ4A 3R7WA 2OAP1 4IHQA 1TS7A 4KUKA 3MJQA 1DP9A 4R70A 1P9WA 4NXFA 1LSWA 3IS2A 2W27A 2QJ7A 4HOIA 4EETB 2B18A 3PHYA 1NLZA 2VJWA 3E98A 2NUTC 3RTYA 2ZMFA 1DP6A 4HJ6A 1T1BA 5AJGA 3NOPC 4WUJA 1X0OA 4ZRRA 5A8BA 2W1TA 4FSFA 4EU0A 1GSXA 2PR6A 5G4YA 2VX8A 3EWKA 4YWZA 3NOTC 3VV4A 1OTIA 4UQIM 5HD3A 2OWJA 4GW9A 2VV8A 4MN7A 4XT2A 5F69A 3BW6A 4GHIA 4Q0IA 1H3QA 2L0WA 5DF9A 2A24B 2HJEA 2HF6A 2JKTI 2XRNA 3H7WA 2VGLS 3HCYA 3KO6A 3UB7A 4AFIA 3HJIA 1S1ZA 4G3VA 1N9OA 4PKYG 3PBOA 3EGXC 3S7NA 2VA0A 4Q0JA 3GECA 1NWZA 3OOVA 4IJGA 3B33A 4ARZB 5HDSA 3TJZC 3E0YA 3W2ZA 4YOFA 2JHEA 4IUHA 4Y5FA 3K2NA 2OOLA 4B93A 1MZUA 1W63Q 3LYXA 3UB6A 3ZYTA 2A24A 3ICYA 3T4JA 1S4RA 2H28A 1V9ZA 5DKLA 2FZ0A 1LT0A 3VOLA 3EQUA 4BBVA 3EOIA 2J3TC 4O8GA 2Z6DA 2VV7A 3A0SA 2W3EA 2V1AA 3RH8B 4CLCE 1MC0A 1IFQA 2BASA 5HZHA 4EEPA 4UQIS 3EGDC 1G6OA 5MC7A 4F3LA 4DJ2A 3LUQA 2KLIA 1OTEA 3PR6A 1ZTUA 3CI6A 4I38A 3BQ8A 2GZAA 3C2WA 1YAXA 3LFVA 3MFXA 3S7OA 4CQHA 2YKHA 4II7A 4F3LB 2DMWA 2QWSA 2Y8HA 2D01A 2W1TB 3P7NA 3PBNA 2O99A 4HI4A 4XT2B 4BBTA 3OC2A 2W1RA 2O9AA 5K5BA 3DBAA 3S7QA 1T18A 2GJ3A 1OJ5A 4EW7A 3U2AA 1NRJA 3LIDA 4O0PA 4BMWA 1OTBA 1XJ2A 2PYRA 3O5YA 3OCLA 3LR0A 3MQ0A 2R78A 1G28A 3KSIA 3KYQA 3EQVA 3T4OA 2XROA 2NUPC 1W63M 2A2LA 2M7UA 4I39A 4KQOA 3T4QA 5KSHA 3G6OA 1OJGA 2W3GA 2WKQA 2P7JA 3FG8A 5F5YA 3UE6A 4LRZE 1TD5A 3PBSA 4I3AA 5I5LA 1OT6A 3LI8A 3A0VA 3TRCA 3UE3A 3IBJA 2XA7M 4JGRA 4WL9A 1T1AA 4HP9A 2QKPA 2PT7A 4LRYC 4HH2A 4BJPA 5AVEA 4YNRA 5HWTA 2PR5A 4MN6A 2PD8A 2XSSA 3VE4A 2J3WA 1TS6A 2EWWA 2L1MA 4HP4A 5IT5A 1S4SA 4UEYA 1S66L 3LR4A 4JGPA 3BQAA 4OOMA 2G7UA 3GDIA 3CAXA 3NOUC 1DRMA 4JGOA 2O0YA 1UWNX 4EESA 4EQ1A 4LRXC 3CWFA 3OCNA 4KUOA 1F9IA 2J3TD 1EW0A 3MMHA 5FL3A 2YKFA 3K3CA 3T4TA 3A0RA 4H6JA 3PBQA 5EFWA 3F1OB 4R38A 3TW8A 3JVVA 3BWLA 4ARZA 1V9YA 1ODVA 4EEUA 3F1NA 4HY8A 3BJNA 2OAQ1 3E4QA 1WA9A 3LIBA 5HWWA 2I9VA 3UB8A 1LSVA 3F1PB 1N9NA 3CITA 4EXOA 2VV6A 3PXPA 2WKRA 3LR3A 5TBMB 1OTAA 1ZHHB 1XFNA 3VE3A 4IUKA 4Q0HA 3KYZA 1NLYA 5HPIA 4GS9A 2VEAA 3E4PA 4BWIA 2M1CA 4NXEA 4QPRA 2W3FA 4Y3IA 4KQDA 5HWVA 5J7EA 3MF0A 5DJUA 5HSQA 1H8MA 3HJKA 4GHIB 2W3DA 2Z6CA 3NHQA 2KOIA 3D3OA 3FC7A 1OTDA 2MJ6A 3T50A 1Y28A 2VZWA 2ZOHA 3MQOA 4CLCD 1STZA 3FPVA 4MMNA 3PYPA 2QHKA 4WEJA 3MR0A 2LB9A 4P6ZS 2M7VA 1P0ZA 1GSVA 3UB9A 1IOUA 2K7SA 2IA2A 3KSHA 4I3JA 4WEKA 2D02A 1XJ3A 3EEAA 4Y2FA 4CLCA 3CLOA 2K31A 3ZQ5A 2Y79A 2B02A 3MQQA 3FPWA 2JKRM 1LSXA 4DJ3A 3OBFA 2PYPA 3LIFA 1T19A 3H82A 4NKPA 1TS8A 2HJ9C 3CUEC 4GJ4A 5F68A 3V67A 3H9WA 4GCZA 2JKTM 4FOFA 4L9GA 5HDDA 2FH5A 4I5SA 4WF0A 3B47A 4R6LA 4HNBA 3S7PA 4EERA 2ZBBA 3R4KA 3LIEA 3KSGA 4HJ3A 5KIZA 4O01A 5DFYA 4L0LA 5DJTA 2QJ5A 3E4OA 4CLCC 3LIAA 4R3AA 2O9BA 2WKPA 1T1CA 2KDKA 3RFBA 3IBRA 1XJ6A 1VB6A 3PBTA 3B42A 4GS9B 4K08A 4NXGA 4ME4A 1D06A 1YSQA 1N9LA 5J3WA 1TS0A 3JVUA 5CX7A 5DFXA 1F98A 2KX6A 2V1BA 3PBRA 4ETXA 3SW1A 1JNUA 4WLAA 3LR5A 4HH3A 5HDCA 4E04A 5LBRA 2P08A 3H82B 5G4ZA 3LICA 1YKDA 2ZOIA 3H7WB 1TF1A 2PDRA 4G3KA 2J80A 3ULFA 4M4XA 4MN5A 1KOUA 4NEED 4I3IA 4PAUA 4DMZA 4LLOB 4EUVA 3KSFA 2V0UA 3MXQA 3UMEA 2K2NA 3T4LA 5HL6A 1MKMA 2JKRI 3TE8A 3KX0X 4CLCB 2W0NA 1DP8A 1GSWA 3NJAA 3T4KA 5C5KA 3LI9A 3EEHA 1S67L 4LPZA 4MDZA 4HIAA 3F1OA 2CMNA 3BY8A 4B9OA 1XFQA 2GX5A 4H6JB 2VGLM 4RQ9A 5IS1A 1XJ4A 2V0WA 4NXBA 3F1NB 1S1YA 2VKSA 2PD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BYW A;  1TS6 A;  2JHE A;  1LSX A;  2L1M A;  2OOL A;  1UGU A;  2OWH A;  4HP4 A;  1MZU A;  3UB6 A;  3BY9 A;  3LYX A;  2PYP A;  4DJ3 A;  1S4S A;  2A24 A;  3ICY A;  3LIF A;  3OLO A;  1T19 A;  3H82 A;  5TBM A;  1S66 L;  1S4R A;  2H28 A;  4JGP A;  1TS8 A;  5DKK A;  1V9Z A;  5DKL A;  5F6A A;  1D7E A;  5F68 A;  3GDI A;  3H9W A;  1LT0 A;  4GCZ A;  3VOL A;  3CAX A;  3NOU C;  1DRM A;  4JGO A;  4L9G A;  4BBV A;  5HDD A;  4I5S A;  4PKY A;  2Z6D A;  2VV7 A;  3A0S A;  1UWN X;  2VLG A;  4L9E A;  3F1P A;  4LRX C;  1LL8 A;  4WF0 A;  2V1A A;  3CWF A;  4EES A;  4EQ1 A;  4KUO A;  1F9I A;  2V9A A;  4HHD A;  4HNB A;  1EW0 A;  2PHY A;  4L9F A;  4R6L A;  2ZBB A;  5HD5 A;  5IU1 A;  4EER A;  2YKF A;  3K3C A;  3LIE A;  3UMD A;  4HJ3 A;  5KIZ A;  3A0R A;  4H6J A;  2BAS A;  5HZH A;  5EFW A;  4EEP A;  3F1O B;  4R38 A;  5DJT A;  2QJ5 A;  3BWL A;  3D72 A;  3E4O A;  3C8C A;  3LIA A;  4DJ2 A;  4F3L A;  4R3A A;  1V9Y A;  3LUQ A;  1ODV A;  2WKP A;  1T1C A;  4EEU A;  3F1N A;  1OTE A;  4HY8 A;  2HV1 A;  2EA9 A;  3E4Q A;  3K3D A;  2KDK A;  1WA9 A;  1P97 A;  3IBR A;  3LIB A;  4I38 A;  5AVF A;  2INW A;  5HWW A;  2I9V A;  3C2W A;  1UWP X;  3UB8 A;  1LSV A;  4HQA A;  1XJ6 A;  1VB6 A;  4JGQ A;  3F1P B;  3MFX A;  1N9N A;  4GS9 B;  4K08 A;  3IS2 B;  2JN7 A;  2YKH A;  4WN5 A;  4NXG A;  4EXO A;  4F3L B;  2QWS A;  1OT9 A;  1D06 A;  5J4E A;  2VV6 A;  3RH8 B;  2L4R A;  1N9L A;  4BBU A;  2D01 A;  2WKR A;  5J3W A;  4HJ4 A;  1TS0 A;  3P7N A;  5TBM B;  1F98 A;  1OTA A;  4HI4 A;  4XT2 B;  1XFN A;  3VE3 A;  2KX6 A;  4BBT A;  2V1B A;  1TS7 A;  4KUK A;  3SW1 A;  3MJQ A;  1JNU A;  1DP9 A;  4R70 A;  4NXF A;  1LSW A;  3IS2 A;  2W27 A;  4WLA A;  4GS9 A;  2QJ7 A;  4HH3 A;  4HOI A;  5HDC A;  2VEA A;  3E4P A;  4E04 A;  4EET B;  1T18 A;  2GJ3 A;  1OJ5 A;  2M1C A;  4EW7 A;  4NXE A;  3H82 B;  3PHY A;  5G4Z A;  3LIC A;  3LID A;  1OTB A;  1XJ2 A;  2ZOI A;  3H7W B;  2PDR A;  2PYR A;  4KQD A;  1DP6 A;  3RTY A;  5HWV A;  5J7E A;  2J80 A;  4HJ6 A;  2R78 A;  1G28 A;  1T1B A;  5DJU A;  4M4X A;  3ULF A;  3HJK A;  5HSQ A;  3NOP C;  4GHI B;  1X0O A;  4MN5 A;  1KOU A;  4WUJ A;  5A8B A;  2Z6C A;  4I3I A;  3NHQ A;  1GSX A;  4I39 A;  4LLO B;  2PR6 A;  5G4Y A;  3EWK A;  3FC7 A;  2V0U A;  4YWZ A;  3MXQ A;  3UME A;  3G6O A;  1OJG A;  3NOT C;  1OTD A;  2WKQ A;  2P7J A;  3FG8 A;  5F5Y A;  3UE6 A;  1OTI A;  3T50 A;  4LRZ E;  1Y28 A;  5HD3 A;  2OWJ A;  2ZOH A;  3MQO A;  4I3A A;  3KX0 X;  4GW9 A;  5I5L A;  2VV8 A;  2W0N A;  1OT6 A;  3LI8 A;  1DP8 A;  1GSW A;  3A0V A;  4XT2 A;  5F69 A;  3NJA A;  4GHI A;  3LI9 A;  3PYP A;  3EEH A;  2L0W A;  2QHK A;  1S67 L;  4LPZ A;  2A24 B;  4HIA A;  3UB7 A;  4JGR A;  3H7W A;  3MR0 A;  4WL9 A;  3F1O A;  1T1A A;  4HP9 A;  2CMN A;  3HJI A;  2QKP A;  3BY8 A;  1S1Z A;  1P0Z A;  4B9O A;  1GSV A;  1XFQ A;  4H6J B;  4LRY C;  3UB9 A;  4PKY G;  1N9O A;  2K7S A;  4HH2 A;  4I3J A;  2D02 A;  1XJ3 A;  5AVE A;  4RQ9 A;  5IS1 A;  1XJ4 A;  2V0W A;  3CLO A;  4NXB A;  3GEC A;  2PR5 A;  3F1N B;  5HWT A;  3ZQ5 A;  2B02 A;  4MN6 A;  1NWZ A;  2PD8 A;  1S1Y A;  3B33 A;  3MQQ A;  5HDS A;  3VE4 A;  2PD7 A; 
#chains in the Genus database with same CATH topology
 4KZB A;  1BYW A;  2OWH A;  1UGU A;  3BY9 A;  2R9W A;  3OLO A;  4WEL A;  3R7W B;  2Y55 A;  2ZMV A;  1ZC2 A;  2GNX A;  2QYB A;  3T1R A;  5TR7 A;  5F6A A;  1AWI A;  5TJJ A;  5A93 A;  3CJM A;  3F1P A;  3IH8 A;  1PW8 A;  4MCW A;  2X02 A;  2V9A A;  3C30 A;  5HD5 A;  5IU1 A;  1YSP A;  3T1Q B;  4Y7P A;  3LO7 A;  3D72 A;  5L07 A;  4LV2 A;  3P01 A;  3UN7 A;  4JGQ A;  3C7V A;  4WN5 A;  2JN7 A;  5J4E A;  4PM7 A;  4U3T A;  4KUK A;  4R70 A;  1P9W A;  1KE4 A;  1LSW A;  3W4Q A;  2OSU A;  1KVL A;  4RA7 A;  3M6H A;  2EX8 A;  4HOI A;  4EET B;  5AQ9 A;  2GDN A;  2HPB A;  5EOO A;  5GLA A;  5GLC A;  2VJW A;  1SKF A;  1WE4 A;  4IVI A;  3V3S A;  4HJ6 A;  3NOP C;  5A8B A;  1KDS A;  3EWK A;  3NDG A;  3NOT C;  3VV4 A;  1LHY A;  4LCL A;  5HD3 A;  2BG1 A;  4JF5 A;  3BEC A;  3NEC A;  4N1H A;  3JYI A;  1I2S A;  3H7W A;  3HJI A;  5EVI B;  1S1Z A;  4G3V A;  2ZM8 A;  5A90 A;  2VA0 A;  3GEC A;  1NWZ A;  1JTD A;  3GMW A;  5FDH A;  3TJZ C;  1L0E A;  1YLP A;  4B93 A;  4Y5F A;  3K2N A;  2J7V A;  5FAO A;  3UB6 A;  5M18 A;  2A24 A;  3ICY A;  1FCM A;  5EM1 A;  1BSG A;  4R3J A;  4E6X A;  5F1G A;  3VOL A;  3EOI A;  3N8R A;  3G2Z A;  2VV7 A;  3A0S A;  3GSG A;  3OPL A;  3RH8 B;  5FQJ A;  1IFQ A;  1SDN A;  2BAS A;  4UQI S;  3EGD C;  1HLU P;  1Q2Q A;  4F3L A;  2Y2G A;  3PR6 A;  4I38 A;  4OPZ A;  2B5R A;  3S7O A;  2DMW A;  2XDM A;  1CEG A;  1Q2P A;  1QME A;  2D01 A;  2O99 A;  4C6Y A;  4S2M A;  2J9O A;  5GHY A;  5HAR A;  5L2F A;  4OOY A;  1YQS A;  2PYR A;  1S6R A;  2R78 A;  1G28 A;  3VSL A;  3EQV A;  2XRO A;  1AXB A;  1W5D A;  4KZ9 A;  3BLM A;  4X55 A;  4LGW A;  3FG8 A;  2WKI A;  4LRZ E;  1TD5 A;  5F83 A;  5I5L A;  1PYY A;  1OT6 A;  3LI8 A;  3TRC A;  1FOF A;  3IBJ A;  1PZP A;  4E3L A;  4WL9 A;  2WK0 A;  4LRY C;  1XKZ A;  2H5S A;  4R4S A;  3DWZ A;  2PR5 A;  2PD8 A;  3VE4 A;  3VP3 A;  3IXG A;  5IT5 A;  1S4S A;  3BQA A;  4OOM A;  1Z6F A;  3NOU C;  1DRM A;  2HP6 A;  1ACF A;  2J9P A;  5I94 A;  3CWF A;  1CF0 A;  4KUO A;  2WGV A;  1EW0 A;  3MMH A;  2ZD8 A;  5CER A;  3NC8 A;  4H6J A;  4E3J A;  3PBQ A;  5EFW A;  3F1O B;  3TW8 A;  1K38 A;  3BWL A;  1VQQ A;  4MNR A;  1ODV A;  1RGY A;  2WKE A;  5HWW A;  4EBL A;  1PWD A;  3F1P B;  1W8Y A;  1CI9 A;  2PBY A;  3PXP A;  3SS3 A;  3SH8 A;  1OTA A;  3ZG0 A;  1XFN A;  3VE3 A;  3UPP A;  4ZDX A;  2JKF A;  4GS9 A;  3E4P A;  2V1Z A;  4BWI A;  2Y2N A;  1FCN A;  1K57 C;  3Q7Z A;  2WAF A;  4N1X A;  5DJU A;  1H8M A;  4GHI B;  1DJC A;  2W3D A;  4E3M A;  1S0W A;  2KOI A;  1PIO A;  3NIA A;  2Z2L B;  2MJ6 A;  2PU4 A;  1BUL A;  1H5X A;  5L10 A;  3T50 A;  2VZW A;  2ZOH A;  3NY4 A;  3IF6 C;  4EQI A;  5A91 A;  1STZ A;  3BFF A;  4X25 A;  1IEL A;  2ZC3 B;  4WEJ A;  5DF8 A;  4N9L A;  1P0Z A;  1GSV A;  1IOU A;  3WRT A;  3KSH A;  1K54 C;  3MSH A;  2DNS A;  2D02 A;  1XJ3 A;  2JC7 A;  5CTM A;  3EEA A;  2XF3 A;  1CQA A;  5CED A;  2Y79 A;  1FCO A;  4FH4 A;  3BRM A;  4QU3 A;  4X1L A;  3CMZ A;  5BOH A;  1T19 A;  2ZJ9 A;  4NKP A;  2HJ9 C;  1ES2 A;  2JKT M;  4L9G A;  1HD8 A;  5HDD A;  5CHM A;  1KGF A;  4BQM A;  2CC1 A;  3B47 A;  1BZA A;  4R6L A;  3R4K A;  1VEU B;  4KQQ A;  2VK3 A;  2ZQA A;  5KIZ A;  4OON A;  4ZAM A;  3HUN A;  2O9B A;  2WKP A;  1SZV A;  1YLJ A;  3G35 A;  2QPN A;  1XJ6 A;  4NXG A;  4ME4 A;  1D06 A;  3NI9 A;  1YSQ A;  1MKI A;  1ESI A;  2WGW A;  4Q8I A;  5DTT A;  1LI0 A;  5FAT A;  3VP1 A;  2V1B A;  4ETX A;  5FEF A;  3SW1 A;  3CZD A;  3RXX A;  3BFC A;  1NYM A;  2V20 A;  3LR5 A;  5HDC A;  4E04 A;  1JWV A;  5LBR A;  1GHI A;  5G4Z A;  3LIC A;  1YKD A;  3H7W B;  5EVI D;  3C4O A;  3LEZ A;  4M4X A;  1Y54 A;  4PAU A;  2Y2K A;  4CJN A;  4EUV A;  3Q82 A;  1VET B;  1PRQ A;  3FKV A;  1G68 A;  3ITA A;  1PFL A;  1ES3 A;  3ZVW A;  3T4K A;  3EEH A;  1S67 L;  3W8K A;  3Q1F A;  3Q7V A;  2DCF A;  2V8F A;  2ZM0 A;  4ID4 A;  2B95 A;  2EX2 A;  4OKP A;  1K54 A;  2PD7 A;  2O9C A;  3CUE A;  3OPR A;  1MBL A;  4PHT A;  3C4P A;  4OQH A;  3IWI A;  2ZQ8 A;  4Z1W A;  3NBL A;  1F2K A;  4FH2 A;  3O3V A;  4UA7 A;  2W3H A;  1NZO A;  4GNU A;  2HV1 A;  5AVF A;  4LV0 A;  4BL2 A;  1UWP X;  1YMX A;  4JXW A;  3QP6 A;  1MWU A;  2QMI A;  4G3W A;  2I72 A;  4GLQ A;  3E2L A;  4ETZ A;  2HGV A;  3R7W A;  4U0T A;  3P98 A;  2IWD A;  3G31 A;  2V2F F;  5FA7 A;  3MJQ A;  2PAV P;  3UY6 A;  5CEB A;  2UWX A;  2WUQ A;  2H10 A;  1NLZ A;  1I2W A;  5EVI A;  4OP5 A;  1MWT A;  1MY8 A;  4ESP A;  4ZRR A;  1X0O A;  1CI8 A;  2PR6 A;  2VX8 A;  4R3B A;  5CTN A;  1GA9 A;  1OTI A;  1CK3 A;  3DTM A;  3LY3 A;  2VV8 A;  3N7W A;  4GHI A;  2E8J A;  2Z2M B;  4KZ7 A;  5DF9 A;  4GN2 A;  2HJE A;  3UB7 A;  4AFI A;  3SS5 A;  3HLF A;  4C75 A;  1N9O A;  3PBO A;  3DW0 A;  1ERO A;  1M6K A;  4Q0J A;  4IBX A;  5GHZ A;  3OOV A;  1VM1 A;  4IJG A;  3B33 A;  4WZ5 A;  5HDS A;  3IHB A;  1HVB A;  3E0Y A;  1BUE A;  2JHE A;  4IUH A;  4YOF A;  2ZL1 B;  5EPH A;  3ZYT A;  1PZO A;  2H28 A;  2WAD A;  3IWQ A;  2Y4A A;  2FZ0 A;  1OME A;  1LT0 A;  1K55 C;  4BBV A;  2Y2P A;  1FIK A;  2J3T C;  1K25 A;  2Z6D A;  5FAQ A;  2W3E A;  5CEC A;  2V1A A;  4CLC E;  3NDE A;  3VP0 A;  4RVA A;  4HBT A;  5HZH A;  5FI7 A;  5MC7 A;  4DJ2 A;  3LUQ A;  2KLI A;  4GDB A;  1PWC A;  3BQ8 A;  2GZA A;  1YAX A;  2ACG A;  2FFY A;  2XH9 A;  3MFX A;  3UDF A;  4II7 A;  4F3L B;  4OPQ A;  5CHU A;  4PPR A;  3UE1 A;  4XT2 B;  5EEC A;  3M2K A;  3DBA A;  4DKI A;  2GJ3 A;  2HDQ A;  4EW7 A;  1MWR A;  1O7E A;  1NRJ A;  4BMW A;  3V3R A;  3IT9 A;  3O5Y A;  2Y2I A;  4E3O A;  3MQ0 A;  2A2L A;  2M7U A;  4I39 A;  4P87 A;  2RL3 A;  5KSH A;  3LEQ A;  4HEF A;  1LI9 A;  1OJG A;  2W3G A;  2P7J A;  3IX4 A;  2WZZ A;  5F5Y A;  3A3D A;  2IWB A;  3A0V A;  3ISG A;  3QP5 A;  4ZJ1 A;  1ESU A;  1E4D A;  1QMF A;  2G2U A;  2XA7 M;  4JGR A;  5M19 A;  4KZ3 A;  3GVB A;  5AVE A;  5TFQ A;  3C7U A;  4MN6 A;  2XSS A;  3MKF A;  3ZNT A;  2QZ6 A;  5CXW A;  1S66 L;  3ZNY A;  1K56 D;  2O0Y A;  5EVL A;  5HL1 A;  3AGF A;  4LRX C;  3OCN A;  2J3T D;  5CRF A;  2YKF A;  3K3C A;  4KZ5 A;  3PAG A;  3FKW A;  1ONG A;  3IF6 B;  3N4I A;  3F1N A;  4HY8 A;  3E4Q A;  4NET A;  3LIB A;  1LSV A;  2H0T A;  4EXO A;  2E8I A;  1LLB A;  5EVI C;  4X68 A;  4KZA A;  1XGI A;  4IUK A;  4Q0H A;  1NLY A;  2M1C A;  2Y2Q A;  3VOZ A;  1TDG A;  3S1Y A;  1KDW A;  2Z6C A;  5GHX A;  3IXD A;  3D3O A;  4DE2 A;  4K0X A;  4BD1 A;  1M40 A;  1E25 A;  2Y2H A;  3FPV A;  1JWP A;  4MMN A;  1GCE A;  5FQK A;  1H8Y A;  4NG2 A;  4GKU A;  3UB9 A;  4DE1 A;  3IHA A;  2K31 A;  2WGI A;  2B02 A;  4JBF A;  3WS1 A;  3G34 A;  4E3N A;  2VGJ A;  2JKR M;  1K56 A;  3LIF A;  3H82 A;  1KGG A;  5F68 A;  3ZG9 B;  3SH7 A;  1K4F A;  4UAA A;  4I5S A;  4WF0 A;  4H8R A;  3VP4 A;  4HNB A;  3VMA A;  4JF6 A;  5G18 A;  2WAE A;  4HJ3 A;  4O01 A;  5DFY A;  5DJT A;  4KZ8 A;  1XA7 A;  3FV7 A;  3UPN A;  4K08 A;  1N9L A;  4Y15 A;  5J3W A;  1IYQ A;  4X6T A;  1JNU A;  2A3U A;  4Y17 A;  3ZG5 A;  4WLA A;  4FTX A;  3NCK A;  1J9M A;  4HES A;  3UDX A;  1FR1 A;  2ZOI A;  4G3K A;  1XXM A;  3FZC A;  1HZO A;  3TG9 A;  3MXS A;  4OLG A;  4MN5 A;  1SKO A;  3C5A A;  3E2K A;  3BEB A;  5HL6 A;  3UPO A;  2HZ5 A;  4XUX A;  4KZ6 A;  2JKR I;  3TE8 A;  1JTG A;  2W0N A;  1DP8 A;  4E3I A;  5EOE A;  3NJA A;  3LI9 A;  4JPM A;  4MDZ A;  5DTK A;  3U4L P;  3F1O A;  2CMN A;  5L09 A;  1WYC A;  3MFD A;  4H6J B;  3QP1 A;  1O07 A;  1E3U A;  4NXB A;  3F1N B;  1BLS A;  1H8Z A;  1BLP A;  3BYD A;  4D2O A;  1A0K A;  5TBM A;  1YM1 A;  5DKK A;  3HUO A;  5HAP A;  1D7E A;  1OPX A;  4MBF A;  1VHM A;  2ZC6 B;  4OOL A;  4Z9Q A;  2XA7 S;  1LL8 A;  4X56 A;  4L9F A;  5E2H A;  2LB5 A;  1CJF A;  5HPF A;  3C8C A;  4BEN A;  3PAE A;  4EV4 A;  4QD4 A;  5CGS A;  2EA9 A;  4GDN A;  5AQ7 A;  2INW A;  1ES5 A;  4HQA A;  3C38 A;  3IS2 B;  2HDS A;  4LV3 A;  4JXV A;  5FAP A;  2L4R A;  4BBU A;  1PI5 A;  4DN0 A;  4HJ4 A;  1K0K A;  2OAP 1;  4PM8 A;  4Y0O A;  3T1X A;  3IS2 A;  2W27 A;  2QJ7 A;  4QB8 A;  3HRE A;  4WBG A;  1YMS A;  2EFX A;  2B18 A;  3PHY A;  1GHP A;  5FI2 A;  3E98 A;  2NUT C;  4EBN A;  3G32 A;  1SCW A;  3HLB A;  1T1B A;  5AJG A;  4WUJ A;  4EU0 A;  1SHV A;  5G4Y A;  3Q81 A;  4YWZ A;  4D60 A;  4DRT A;  4OLD A;  1RCJ A;  5HFO A;  2EX9 A;  3HVF A;  2P74 A;  4RX3 A;  4K0W A;  4XT2 A;  5F69 A;  3BW6 A;  4MEZ A;  3ZGA B;  5GLD A;  1H3Q A;  2L0W A;  5U47 A;  2HF6 A;  2JKT I;  3HCY A;  3IWO A;  2VGL S;  3KO6 A;  4WYY A;  2UV0 E;  2ZL1 A;  4S2N A;  1NYY A;  3S7N A;  1NXY A;  2XR0 A;  2OOL A;  3ZG8 B;  1MZU A;  3LYX A;  1DJA A;  3HL9 A;  1S4R A;  2Y2L A;  3EQU A;  1PWG A;  4XUZ A;  1NY0 A;  3TSG A;  3I7J A;  4FUW A;  5DTS A;  2Y91 A;  3S4X A;  4EEP A;  1G6A A;  1N9B A;  1OTE A;  1EI5 A;  1ZTU A;  3UO9 A;  3CPT B;  4CQH A;  1CEF A;  3MZF A;  4S2L A;  5HW3 A;  4KQR A;  2P9V B;  5K5B A;  3S7Q A;  1T18 A;  1BLH A;  3A3F A;  2R9X A;  4O0P A;  1XJ2 A;  1J3W A;  3LR0 A;  3KSI A;  4LCM A;  4KEN B;  2NUP C;  4KQO A;  5FQQ A;  2WKQ A;  3WS5 A;  3UE6 A;  2H0Y A;  2PRF A;  3HLC A;  1XA1 A;  3B3X A;  5EV0 A;  3UE3 A;  3VOY A;  3WS4 A;  4X1M A;  1ES4 A;  1NJ4 A;  4HP9 A;  2PT7 A;  1SDE A;  4HH2 A;  3T12 B;  1MWS A;  2EFU A;  2C6W B;  3MZE A;  3V50 A;  1FSW A;  4YNR A;  4WMC A;  3BM6 A;  2Y2O A;  4DE0 A;  1TS6 A;  2EWW A;  1H0M A;  3DTI A;  3CHW P;  3FWL A;  2XLN A;  4EUZ A;  4UEY A;  5E2E A;  1K55 A;  1TEM A;  3LR4 A;  1XPB A;  2G7U A;  3LY4 A;  4N9K A;  3UB5 P;  3LCE A;  2IWC A;  1L0G A;  4S2O A;  3BFD A;  1FR6 A;  3IH9 A;  1RGZ A;  3G4P A;  4E6W A;  3T4T A;  3A0R A;  4ZTK A;  4GD6 A;  5FSR A;  4EEU A;  3DTK A;  4MLL A;  5KMW A;  3ZDJ A;  3RJU A;  1EWZ A;  1W79 A;  1IKG A;  4IVK A;  4WZ4 A;  5KSC A;  2VV6 A;  2WKR A;  3O86 A;  5TBM B;  2AVX A;  2JKG A;  3PTE A;  4KZ4 A;  3A3I A;  5HX9 A;  3KYZ A;  1YLT A;  2VEA A;  4PM5 A;  1ERQ A;  4QPR A;  4Y3I A;  4KQD A;  2VGK A;  5GLB A;  5HWV A;  1KVM A;  1RP5 A;  3MF0 A;  5HSQ A;  4OQG A;  4QHC A;  1YLW A;  1D1J A;  3GR2 A;  1OTD A;  2ZQ7 A;  2OLV A;  3AGD A;  4CLC D;  1YLY A;  2X71 A;  1Y4O A;  3MS6 A;  2WGW B;  4NK3 A;  4R23 A;  3Q7V B;  3MR0 A;  2LB9 A;  1DJB A;  4LFU A;  1LL5 A;  4QWO A;  2K7S A;  2XQZ A;  3ZCZ A;  2RCX A;  4R4R A;  4ZBE A;  3ZQ5 A;  2XD1 A;  3QNB A;  3UNW A;  3QNC A;  3MQQ A;  1XP4 A;  1GHM A;  3VFH A;  4DJ3 A;  2PYP A;  3UE0 A;  5FDS A;  1VEU A;  1ZKJ A;  1JWZ A;  5F82 A;  3H9W A;  3RXW A;  4FOF A;  1ALQ A;  3HLE A;  3CPT A;  4YFM A;  4U0X A;  3P09 A;  3SH9 A;  3ZVT A;  4EER A;  1IKI A;  4L0L A;  2QJ5 A;  3E4O A;  4OQI A;  4R3A A;  1T1C A;  5FQI A;  4YIN A;  2KDK A;  3RFB A;  1XX2 A;  4LV1 A;  1VB6 A;  3B42 A;  2HDR A;  4GS9 B;  1W8Q A;  1K6S A;  5EVE A;  1XGJ A;  3IQA A;  4WZ5 C;  3SS4 A;  3JVU A;  5CX7 A;  2OLU A;  2KX6 A;  3PBR A;  3G2Y A;  4HH3 A;  1IYO A;  3NUL A;  5F1F A;  4QJG A;  2P08 A;  1BLC A;  2Y2J A;  4FD8 A;  2ZLY A;  4JKT A;  1TF1 A;  2PDR A;  2J80 A;  1IYS A;  3ULF A;  1KOU A;  1JVJ A;  3HLW A;  4DMZ A;  2V0U A;  2K2N A;  3T4L A;  4N92 A;  4OH0 A;  2HP9 A;  3N6I A;  3KX0 X;  1GSW A;  4PMA A;  4WM9 A;  4LPZ A;  4HIA A;  3MXR A;  3BY8 A;  4B9O A;  2GX5 A;  5JYP A;  2VGL M;  4RQ9 A;  2V0W A;  3TOI A;  4KG5 A;  3ITB A;  4OPR A;  2ZC4 B;  3PYP A;  3M2J A;  2ZQC A;  4O7D A;  3W4P A;  2ZQD A;  1L2S A;  2EWV A;  5CGW A;  5L8M A;  2EX6 A;  3G30 A;  1P9R A;  3T4S A;  4PKY A;  4L9E A;  2VLG A;  3LGO A;  4HHD A;  2PHY A;  2P04 A;  3UMD A;  2JE5 A;  1F5M A;  3L9K A;  5DVA A;  5EM0 A;  4M3K A;  1FSY A;  5E2G A;  3K3D A;  4C3Q A;  3ZFZ A;  1P97 A;  4ZJ3 A;  4P6Z M;  4HBU A;  1OT9 A;  2BLS A;  5D3O A;  1NRF A;  4IHQ A;  1TS7 A;  4FCF A;  4DF6 A;  3WWX A;  1DP9 A;  1TVF A;  4BLM A;  4NXF A;  3QP2 A;  3W4O A;  5CGX A;  5HAI A;  4DDS A;  4UHU A;  3D9Y A;  3KYE A;  5FI6 A;  4JXS A;  3IF6 A;  3IXH A;  3RTY A;  2ZMF A;  1DP6 A;  1HTZ A;  3GV9 A;  4X53 A;  3QHY A;  4X69 A;  2W1T A;  4FSF A;  1GSX A;  4BL3 A;  4S2K A;  4DE3 A;  3N8S A;  4MBK A;  4DDY A;  4UQI M;  2OWJ A;  4GW9 A;  4MN7 A;  1YT4 A;  2WZX A;  4Q0I A;  4OVD A;  2A24 B;  2XRN A;  4Y0U A;  1G5U A;  4PKY G;  3EGX C;  5J8X A;  2DRW A;  4ARZ B;  3W2Z A;  5E43 A;  5JYO A;  1W63 Q;  3DWK A;  4XXR A;  2BTF P;  3T4J A;  1YLZ A;  4BD0 A;  4B88 A;  1V9Z A;  5DKL A;  3HBR A;  2OV5 A;  5E2F A;  4O8G A;  5AQA A;  3IXB A;  1E3U D;  3QP4 A;  4DXB A;  1K4E A;  1MC0 A;  1G6O A;  2Y59 A;  1C3B A;  2EXA A;  2ZM2 A;  2XFT A;  1ERM A;  3CI6 A;  3C2W A;  3LFV A;  4GD8 A;  4K91 A;  4GB7 A;  4MBH A;  3T1S A;  2YKH A;  2QWS A;  2Q0O A;  1KE3 A;  2Y8H A;  1L3L A;  2W1T B;  3P7N A;  3PBN A;  4HI4 A;  4BBT A;  3OC2 A;  2W1R A;  2O9A A;  3WS0 A;  4R1G A;  3QP8 A;  2EXB A;  1BTL A;  1OJ5 A;  1KE0 A;  3U2A A;  5TGF A;  3IX8 A;  3LID A;  1OTB A;  4PM6 A;  3OCL A;  2P9V A;  1NZU A;  3T4O A;  3KYQ A;  4F94 A;  4Y13 A;  5AQB A;  1W63 M;  1YPR A;  3T4Q A;  3DAV A;  3G6O A;  2XK1 A;  3A3J A;  3PBS A;  4I3A A;  1SKO B;  3D4F A;  1L0F A;  1T1A A;  2WKH A;  2QKP A;  4BJP A;  4EBP A;  5KZH A;  5HWT A;  1K6R A;  2Q9M A;  2HP5 A;  2J3W A;  4R0Q A;  2L1M A;  2Y2M A;  4HP4 A;  4EWF A;  3DTE A;  1MXO A;  4S2I A;  1U60 A;  4UA9 A;  4JGP A;  5CHJ A;  1IYP A;  4P0M A;  4B4X A;  3GDI A;  4DXC A;  3SZT A;  3CAX A;  4JGO A;  3CG5 A;  1UWN X;  4EES A;  4EQ1 A;  1F9I A;  5FL3 A;  2G2W A;  2WYX A;  3BLS A;  3BFG A;  4GZB A;  4R38 A;  3JVV A;  4OPY A;  4ARZ A;  1V9Y A;  4JXG A;  3BJN A;  2OAQ 1;  1WA9 A;  4LEN A;  2I9V A;  3UB8 A;  5A92 A;  3HLG A;  1N9N A;  3UDI A;  4KG2 A;  1FQG A;  1WYB A;  3CIT A;  3IF5 A;  1K57 A;  2A49 A;  3LR3 A;  1ZHH B;  4RYE A;  3WRZ A;  4ZJ2 A;  3GRJ A;  4P6B A;  1DY6 A;  3GTC A;  3V39 A;  3VSK A;  2C5W B;  5HPI A;  2XEP A;  1I5Q A;  1IEM A;  4NXE A;  4S2N C;  3V5M A;  2W3F A;  3M6B A;  5J7E A;  1KGE A;  1ZG6 A;  3HJK A;  3O87 A;  3A3E A;  2JCH A;  3MZD A;  3NHQ A;  3OZH A;  3FC7 A;  2FFF B;  4KG6 A;  1Y28 A;  3MQO A;  5FQ9 A;  2QHK A;  2XFS A;  3L7H A;  4P6Z S;  2M7V A;  1ONH A;  2X01 A;  3HLD A;  2IA2 A;  3S22 A;  4I3J A;  4P85 A;  4WEK A;  3SOI A;  3OPP A;  2Q9N A;  4Y2F A;  3IX3 A;  4CLC A;  3CLO A;  1TDL A;  2ZQ9 A;  3N8L A;  5GL9 A;  3FPW A;  1L0D A;  1MPL A;  4GOG A;  1LSX A;  4S2J A;  3OBF A;  1PNE A;  1ZG4 A;  1TS8 A;  4UA6 A;  3CUE C;  4GJ4 A;  3V67 A;  4GCZ A;  4IBR A;  3VFF A;  2FH5 A;  3BFE A;  1VET A;  2XGN A;  5FQM A;  3FYZ A;  3VP2 A;  5IHV A;  3S7P A;  2ZBB A;  3LIE A;  3KSG A;  1LL9 A;  3JPU A;  4JF4 A;  2ZC5 B;  1N4O A;  1W7F A;  1GA0 A;  3MBZ A;  3LIA A;  4CLC C;  4A5R A;  4E3K A;  5FAS A;  2HDU A;  4JLF A;  2XD5 A;  3IBR A;  2JBF A;  3PBT A;  5FEG A;  5EE8 A;  2ZMA A;  5HAQ A;  1PW1 A;  3HUM A;  1BT5 A;  1TS0 A;  1Z09 A;  3OPH A;  5DFX A;  1F98 A;  3ZG7 B;  3WS2 A;  2PBD P;  4B4Z A;  1FIL A;  5EUA A;  4Y0T A;  4QY5 A;  3H82 B;  4OQ0 A;  4PM9 A;  3ZHH A;  4QY6 A;  4NEE D;  4I3I A;  4CPK A;  3Q07 A;  4LLO B;  5DF7 A;  3GQZ A;  2V8C A;  3KSF A;  3MXQ A;  3UME A;  1MKM A;  2PU2 A;  4OP8 A;  4CLC B;  4WMC D;  2J8Y A;  4IED A;  5C5K A;  4S2P A;  1PI4 A;  3MKE A;  1XFQ A;  3AGE A;  4RX2 A;  5IS1 A;  2ZC7 A;  1XJ4 A;  5M1A A;  3O88 A;  1S1Y A;  2VKS A; 
#chains in the Genus database with same CATH homology
 1BYW A;  2OWH A;  2O9C A;  1UGU A;  3CUE A;  3BY9 A;  3OLO A;  4WEL A;  3R7W B;  2ZMV A;  5TBM A;  5DKK A;  2EWV A;  2GNX A;  2QYB A;  5L8M A;  5F6A A;  1D7E A;  4PHT A;  1OPX A;  1P9R A;  5TJJ A;  3T4S A;  1VHM A;  4PKY A;  4L9E A;  4OOL A;  2VLG A;  2XA7 S;  3F1P A;  1LL8 A;  4MCW A;  2V9A A;  4HHD A;  4L9F A;  2PHY A;  3C30 A;  5HD5 A;  5IU1 A;  4Z1W A;  1YSP A;  2LB5 A;  2P04 A;  3UMD A;  1F5M A;  5HPF A;  3D72 A;  3C8C A;  2W3H A;  2HV1 A;  3P01 A;  2EA9 A;  3K3D A;  1P97 A;  5AVF A;  2INW A;  1UWP X;  4HQA A;  4JGQ A;  4P6Z M;  3C38 A;  2JN7 A;  3IS2 B;  4WN5 A;  4G3W A;  1OT9 A;  5J4E A;  2L4R A;  4BBU A;  4GLQ A;  4ETZ A;  2HGV A;  4DN0 A;  4HJ4 A;  3R7W A;  2OAP 1;  4IHQ A;  1TS7 A;  4KUK A;  3MJQ A;  1DP9 A;  4R70 A;  1P9W A;  4NXF A;  1LSW A;  3IS2 A;  2W27 A;  2QJ7 A;  4HOI A;  4EET B;  2B18 A;  3PHY A;  1NLZ A;  2VJW A;  3E98 A;  2NUT C;  3RTY A;  2ZMF A;  1DP6 A;  4HJ6 A;  1T1B A;  5AJG A;  3NOP C;  4WUJ A;  1X0O A;  4ZRR A;  5A8B A;  2W1T A;  4FSF A;  4EU0 A;  1GSX A;  2PR6 A;  5G4Y A;  2VX8 A;  3EWK A;  4YWZ A;  3NOT C;  3VV4 A;  1OTI A;  4UQI M;  5HD3 A;  2OWJ A;  4GW9 A;  2VV8 A;  4MN7 A;  4XT2 A;  5F69 A;  3BW6 A;  4GHI A;  4Q0I A;  1H3Q A;  2L0W A;  5DF9 A;  2A24 B;  2HJE A;  2HF6 A;  2JKT I;  2XRN A;  3H7W A;  2VGL S;  3HCY A;  3KO6 A;  3UB7 A;  4AFI A;  3HJI A;  1S1Z A;  4G3V A;  1N9O A;  4PKY G;  3PBO A;  3EGX C;  3S7N A;  2VA0 A;  4Q0J A;  3GEC A;  1NWZ A;  3OOV A;  4IJG A;  3B33 A;  4ARZ B;  5HDS A;  3TJZ C;  3E0Y A;  3W2Z A;  4YOF A;  2JHE A;  4IUH A;  4Y5F A;  3K2N A;  2OOL A;  4B93 A;  1MZU A;  1W63 Q;  3LYX A;  3UB6 A;  3ZYT A;  2A24 A;  3ICY A;  3T4J A;  1S4R A;  2H28 A;  1V9Z A;  5DKL A;  2FZ0 A;  1LT0 A;  3VOL A;  3EQU A;  4BBV A;  3EOI A;  2J3T C;  4O8G A;  2Z6D A;  2VV7 A;  3A0S A;  2W3E A;  2V1A A;  3RH8 B;  4CLC E;  1MC0 A;  1IFQ A;  2BAS A;  5HZH A;  4EEP A;  4UQI S;  3EGD C;  1G6O A;  5MC7 A;  4F3L A;  4DJ2 A;  3LUQ A;  2KLI A;  1OTE A;  3PR6 A;  1ZTU A;  3CI6 A;  4I38 A;  3BQ8 A;  2GZA A;  3C2W A;  1YAX A;  3LFV A;  3MFX A;  3S7O A;  4CQH A;  2YKH A;  4II7 A;  4F3L B;  2DMW A;  2QWS A;  2Y8H A;  2D01 A;  2W1T B;  3P7N A;  3PBN A;  2O99 A;  4HI4 A;  4XT2 B;  4BBT A;  3OC2 A;  2W1R A;  2O9A A;  5K5B A;  3DBA A;  3S7Q A;  1T18 A;  2GJ3 A;  1OJ5 A;  4EW7 A;  3U2A A;  1NRJ A;  3LID A;  4O0P A;  4BMW A;  1OTB A;  1XJ2 A;  2PYR A;  3O5Y A;  3OCL A;  3LR0 A;  3MQ0 A;  2R78 A;  1G28 A;  3KSI A;  3KYQ A;  3EQV A;  3T4O A;  2XRO A;  2NUP C;  1W63 M;  2A2L A;  2M7U A;  4I39 A;  4KQO A;  3T4Q A;  5KSH A;  3G6O A;  1OJG A;  2W3G A;  2WKQ A;  2P7J A;  3FG8 A;  5F5Y A;  3UE6 A;  4LRZ E;  1TD5 A;  3PBS A;  4I3A A;  5I5L A;  1OT6 A;  3LI8 A;  3A0V A;  3TRC A;  3UE3 A;  3IBJ A;  2XA7 M;  4JGR A;  4WL9 A;  1T1A A;  4HP9 A;  2QKP A;  2PT7 A;  4LRY C;  4HH2 A;  4BJP A;  5AVE A;  4YNR A;  5HWT A;  2PR5 A;  4MN6 A;  2PD8 A;  2XSS A;  3VE4 A;  2J3W A;  1TS6 A;  2EWW A;  2L1M A;  4HP4 A;  5IT5 A;  1S4S A;  4UEY A;  1S66 L;  3LR4 A;  4JGP A;  3BQA A;  4OOM A;  2G7U A;  3GDI A;  3CAX A;  3NOU C;  1DRM A;  4JGO A;  2O0Y A;  1UWN X;  4EES A;  4EQ1 A;  4LRX C;  3CWF A;  3OCN A;  4KUO A;  1F9I A;  2J3T D;  1EW0 A;  3MMH A;  5FL3 A;  2YKF A;  3K3C A;  3T4T A;  3A0R A;  4H6J A;  3PBQ A;  5EFW A;  3F1O B;  4R38 A;  3TW8 A;  3JVV A;  3BWL A;  4ARZ A;  1V9Y A;  1ODV A;  4EEU A;  3F1N A;  4HY8 A;  3BJN A;  2OAQ 1;  3E4Q A;  1WA9 A;  3LIB A;  5HWW A;  2I9V A;  3UB8 A;  1LSV A;  3F1P B;  1N9N A;  3CIT A;  4EXO A;  2VV6 A;  3PXP A;  2WKR A;  3LR3 A;  5TBM B;  1OTA A;  1ZHH B;  1XFN A;  3VE3 A;  4IUK A;  4Q0H A;  3KYZ A;  1NLY A;  5HPI A;  4GS9 A;  2VEA A;  3E4P A;  4BWI A;  2M1C A;  4NXE A;  4QPR A;  2W3F A;  4Y3I A;  4KQD A;  5HWV A;  5J7E A;  3MF0 A;  5DJU A;  5HSQ A;  1H8M A;  3HJK A;  4GHI B;  2W3D A;  2Z6C A;  3NHQ A;  2KOI A;  3D3O A;  3FC7 A;  1OTD A;  2MJ6 A;  3T50 A;  1Y28 A;  2VZW A;  2ZOH A;  3MQO A;  4CLC D;  1STZ A;  3FPV A;  4MMN A;  3PYP A;  2QHK A;  4WEJ A;  3MR0 A;  2LB9 A;  4P6Z S;  2M7V A;  1P0Z A;  1GSV A;  3UB9 A;  1IOU A;  2K7S A;  2IA2 A;  3KSH A;  4I3J A;  4WEK A;  2D02 A;  1XJ3 A;  3EEA A;  4Y2F A;  4CLC A;  3CLO A;  2K31 A;  3ZQ5 A;  2Y79 A;  2B02 A;  3MQQ A;  3FPW A;  2JKR M;  1LSX A;  4DJ3 A;  3OBF A;  2PYP A;  3LIF A;  1T19 A;  3H82 A;  4NKP A;  1TS8 A;  2HJ9 C;  3CUE C;  4GJ4 A;  5F68 A;  3V67 A;  3H9W A;  4GCZ A;  2JKT M;  4FOF A;  4L9G A;  5HDD A;  2FH5 A;  4I5S A;  4WF0 A;  3B47 A;  4R6L A;  4HNB A;  3S7P A;  4EER A;  2ZBB A;  3R4K A;  3LIE A;  3KSG A;  4HJ3 A;  5KIZ A;  4O01 A;  5DFY A;  4L0L A;  5DJT A;  2QJ5 A;  3E4O A;  4CLC C;  3LIA A;  4R3A A;  2O9B A;  2WKP A;  1T1C A;  2KDK A;  3RFB A;  3IBR A;  1XJ6 A;  1VB6 A;  3PBT A;  3B42 A;  4GS9 B;  4K08 A;  4NXG A;  4ME4 A;  1D06 A;  1YSQ A;  1N9L A;  5J3W A;  1TS0 A;  3JVU A;  5CX7 A;  5DFX A;  1F98 A;  2KX6 A;  2V1B A;  3PBR A;  4ETX A;  3SW1 A;  1JNU A;  4WLA A;  3LR5 A;  4HH3 A;  5HDC A;  4E04 A;  5LBR A;  2P08 A;  3H82 B;  5G4Z A;  3LIC A;  1YKD A;  2ZOI A;  3H7W B;  1TF1 A;  2PDR A;  4G3K A;  2J80 A;  3ULF A;  4M4X A;  4MN5 A;  1KOU A;  4NEE D;  4I3I A;  4PAU A;  4DMZ A;  4LLO B;  4EUV A;  3KSF A;  2V0U A;  3MXQ A;  3UME A;  2K2N A;  3T4L A;  5HL6 A;  1MKM A;  2JKR I;  3TE8 A;  3KX0 X;  4CLC B;  2W0N A;  1DP8 A;  1GSW A;  3NJA A;  3T4K A;  5C5K A;  3LI9 A;  3EEH A;  1S67 L;  4LPZ A;  4MDZ A;  4HIA A;  3F1O A;  2CMN A;  3BY8 A;  4B9O A;  1XFQ A;  2GX5 A;  4H6J B;  2VGL M;  4RQ9 A;  5IS1 A;  1XJ4 A;  2V0W A;  4NXB A;  3F1N B;  1S1Y A;  2VKS A;  2PD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...