3KX0X

Crystal structure of the pas domain of rv1364c
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
135
structure length
127
Chain Sequence
EMDWDKTVGAAEDVRRIFEHIPAILVGLEGPDHRFVAVNAAYRGFSPLLDTVGQPAREVYPELEGQQIYEMLDRVYQTGEPQSGSEWRLQEERYFDFVVTPRRRADGSIEGVQLIVDDVTSRVRARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of a PAS sensor domain in the Mycobacterium tuberculosis transcription regulator Rv1364c
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Signaling protein
molecule keywords Uncharacterized protein Rv1364c/MT1410
total genus 30
structure length 127
sequence length 135
ec nomenclature
pdb deposition date 2009-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF08448 PAS_4 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3kx0X00
1UGUA 4I39A 5A8BA 4JGRA 5KIZA 5J7EA 5AVEA 5F6AA 2L1MA 4HNBA 3F1PA 3H9WA 3UB6A 3A0RA 4BBTA 2H28A 1OTAA 2PHYA 1DRMA 1T1BA 1EW0A 1X0OA 2INWA 3H7WB 3LIBA 3NOPC 4KQDA 2QWSA 3H82B 4NXFA 4WLAA 2CMNA 1OJGA 2V1BA 4YWZA 1MZUA 4H6JB 1S4SA 2M1CA 1T1AA 3LUQA 1OT9A 3GECA 3A0SA 5I5LA 2K7SA 1XFNA 3B33A 5G4ZA 3VE4A 3LICA 1N9LA 3MXQA 2PD7A 4I38A 2QJ5A 3BWLA 5J4EA 5TBMB 3MQQA 3RTYA 3VOLA 4HP9A 5HD3A 4E04A 3IS2A 2ZOHA 3SW1A 1GSXA 5HWVA 2OOLA 3F1OA 5IU1A 3MQOA 4HH2A 4I5SA 5HDSA 3UMDA 4GW9A 5HWWA 3EWKA 4EEPA 1TS8A 4GS9B 1G28A 3G6OA 2PYRA 4HY8A 2BASA 3A0VA 4JGQA 5HDCA 1DP6A 4EERA 1LSWA 4R6LA 3FG8A 3NJAA 3E4QA 4JGOA 4B9OA 3BY8A 2YKFA 1T1CA 2VV8A 2D02A 5TBMA 5AVFA 1ODVA 2VV6A 3VE3A 5HDDA 2QJ7A 3NHQA 4XT2B 1GSVA 2QHKA 4BBUA 4R3AA 2JN7A 2KDKA 1F98A 3LIDA 4M4XA 4GS9A 2L4RA 3MFXA 4KUKA 1S67L 2ZOIA 4BBVA 1P0ZA 2I9VA 4HH3A 4K08A 5DJUA 5J3WA 4NXEA 3PYPA 1T18A 1UWPX 2Z6DA 3CWFA 3D72A 3NOTC 5IS1A 1XJ2A 1OTIA 3K3CA 4EXOA 3F1NB 2V1AA 3P7NA 5DKKA 3ZQ5A 1T19A 1D06A 4HQAA 4L9FA 2PR5A 2ZBBA 4HP4A 4XT2A 2PR6A 2V9AA 4L9EA 1N9OA 1D7EA 1V9ZA 3LIFA 4PKYA 4LPZA 1NWZA 4MN6A 4R70A 2PDRA 5F69A 4DJ3A 4EESA 5EFWA 2WKRA 1KOUA 2KX6A 2QKPA 2R78A 3FC7A 4KUOA 3UMEA 3H7WA 1TS6A 3IBRA 3RH8B 5F5YA 1OTEA 1XJ6A 1S4RA 4L9GA 1DP8A 3C2WA 3HJIA 4R38A 2VEAA 1OT6A 3E4OA 3F1OB 5DKLA 2W27A 4GCZA 2PD8A 3MR0A 4MN5A 3F1NA 5DJTA 5F68A 3LYXA 5HWTA 3UE6A 2A24B 2EA9A 3UB7A 1S66L 1XJ4A 1UWNX 1LSVA 2OWHA 4WF0A 3K3DA 3KX0X 1N9NA 1VB6A 4LRYC 2L0WA 3HJKA 1XJ3A 2VV7A 2Z6CA 3E4PA 3IS2B 2WKQA 4DJ2A 4GHIB 5HZHA 2YKHA 2A24A 4HJ6A 4HHDA 4HI4A 4HJ3A 4WUJA 5HSQA 5G4YA 1BYWA 1XFQA 2WKPA 1TS0A 2OWJA 3LI9A 4HOIA 1LL8A 4LRXC 2JHEA 4NXGA 3ULFA 2VLGA 3LIEA 4I3AA 1F9IA 1JNUA 2PYPA 2P7JA 2V0WA 2HV1A 3BY9A 1LSXA 3F1PB 1OTBA 4I3JA 5HD5A 1V9YA 4I3IA 4EEUA 3LI8A 3PHYA 2J80A 4NXBA 4WN5A 4EW7A 1DP9A 3UB9A 3CAXA 2GJ3A 3EEHA 4JGPA 2D01A 4H6JA 4F3LA 2V0UA 4EETB 4LRZE 4EQ1A 3H82A 3NOUC 4GHIA 3C8CA 1OJ5A 1S1ZA 3MJQA 4RQ9A 3OLOA 3CLOA 4WL9A 4LLOB 3UB8A 1LT0A 1Y28A 4HIAA 3T50A 1TS7A 2B02A 4F3LB 1OTDA 2W0NA 4HJ4A 3GDIA 3LIAA 1P97A 1S1YA 1WA9A 4PKYG 1GSWA 3ICYA
chains in the Genus database with same CATH superfamily
3C38A 1HTZA 1U60A 3F1PA 1FILA 5GLDA 2INWA 2DMWA 4Y13A 3BECA 2ZQCA 4XXRA 3B47A 1ES5A 4DRTA 2VZWA 4IBXA 4UA7A 5HDCA 1FR1A 3QP4A 4MBFA 3CZDA 1OMEA 2YKFA 1TEMA 5CGWA 5HDDA 2ZQAA 4XT2B 2QHKA 5CEBA 3HLGA 2EWWA 4HH3A 1J3WA 1D1JA 3A3JA 5EVEA 2Y2KA 3NOTC 3DTIA 4EXOA 2WKEA 1YLTA 3P7NA 3MXRA 1YLPA 2LB9A 4Y2FA 4Z9QA 4QY6A 3M2JA 2A3UA 3UDFA 4JXVA 2W3FA 2Y4AA 1GCEA 3FWLA 4N1XA 4KZ3A 1NZUA 2E8IA 4LCLA 4Q0HA 3OBFA 3UB7A 1CJFA 3Q7VB 1OPXA 3IS2B 3PBNA 1PW8A 4DJ2A 4N9KA 1XGJA 3OCLA 4KG5A 1G6OA 1XFQA 2DNSA 4O7DA 2P7JA 4OOYA 3LI8A 5EVIB 4E3NA 3GTCA 1DP9A 2FH5A 3BQ8A 4X53A 3N8RA 4F3LA 3UPOA 5A93A 4YFMA 1OTDA 4S2NA 1S1YA 5G18A 4DXBA 4K0WA 5E2EA 5J7EA 2JKGA 3H9WA 1ESIA 3A0RA 4KZ8A 1SCWA 3GV9A 4KQDA 4NXFA 5TGFA 1EROA 4Z1WA 3LICA 5CHUA 5TBMB 4E04A 1K6RA 4HP9A 5HD3A 1KE3A 5CECA 3F1OA 4I5SA 2VGLM 3EWKA 5TJJA 4GS9B 5HX9A 4OKPA 3W4PA 5KMWA 4KQQA 3WS0A 3KSFA 1BLPA 4S2KA 1XXMA 2HDQA 2EXBA 3BFDA 4K91A 1F98A 3WS1A 1VETB 2PT7A 2XSSA 3ITAA 5E2GA 4OPRA 1UWPX 1MKIA 2RL3A 2PR5A 4L9EA 4U0TA 3S7OA 2G2WA 1NY0A 3PTEA 3RH8B 3Q07A 5L07A 2VEAA 3E4OA 2P9VA 4UA9A 4EUZA 2Y8HA 2GNXA 4KG6A 3K3DA 1N9NA 2L0WA 3BW6A 2WKQA 3IH8A 5BOHA 2M7VA 3PR6A 4HI4A 5DTKA 3LY4A 1NLYA 4HOIA 4Y5FA 1JNUA 5A91A 2W3DA 1A0KA 2HZ5A 3NI9A 2ZC6B 4RVAA 3CPTB 5EV0A 1JVJA 2B02A 1ZC2A 3Q81A 1OTIA 1DJBA 1F2KA 3LFVA 2VKSA 4Y3IA 1BLCA 1MWUA 3MFDA 4OPZA 3GRJA 3IX8A 4OOLA 2IWDA 2K7SA 5G4ZA 5EVIC 2CC1A 2PU4A 3MXQA 3KYZA 4DE2A 1CK3A 1E3UA 1O7EA 5HWWA 1E3UD 3G6OA 3LR4A 2BASA 1I2WA 2XDMA 1DJAA 5HL1A 4Q0JA 4NK3A 4E3JA 4PPRA 5GHYA 3T4QA 1PI4A 3CWFA 5IS1A 2Y2NA 2PBYA 4O01A 3HVFA 3K3CA 1DJCA 3T1SA 3FC7A 4FH2A 5F82A 4DDYA 4L9GA 2ZC3B 5E2FA 1SKFA 1WYCA 3T4JA 2XGNA 1BUEA 2J8YA 4QPRA 3IHBA 4GHIB 4JPMA 4LFUA 1AXBA 5GHZA 1NRFA 4H8RA 1TS0A 2Y2QA 2VLGA 2V0WA 1BTLA 1SZVA 5L10A 4WN5A 5J8XA 4E6WA 3BM6A 3VMAA 1MY8A 5FATA 2V0UA 3RJUA 4DE0A 4LLOB 3WS4A 1VHMA 4DMZA 1GSWA 3UO9A 1YLWA 4UQIM 4R4RA 1FIKA 4OQHA 1PI5A 1M6KA 1T1AA 1E25A 3UNWA 2VGJA 3IWQA 3ZYTA 3U2AA 3IS2A 2W3EA 4R1GA 5EPHA 3SS3A 4EBLA 2DCFA 3Q7ZA 5EE8A 3M6BA 1J9MA 3C4OA 3FG8A 4BL3A 5GLAA 3VP1A 3MS6A 1MWTA 2X01A 2W1TA 2R9XA 2Z2MB 3D9YA 3LEZA 3V3SA 1T18A 4LV0A 2EXAA 4XT2A 2C5WB 4PKYA 4DJ3A 2Y2JA 1GA9A 2WKRA 1KDWA 1FQGA 1YAXA 3F1OB 4MN5A 1YKDA 4FH4A 1PIOA 2JKRI 2J3TC 4PHTA 4MCWA 3NCKA 1LHYA 4FD8A 3IX4A 1PWDA 3IXHA 2WGVA 3BJNA 2H10A 1V9YA 2V1ZA 3ZVTA 3N8LA 3P98A 1N4OA 2Y2GA 1Z6FA 3T4LA 3G30A 3EGDC 4PKYG 5KIZA 4QJGA 4BBTA 5AJGA 1X0OA 2XA7M 3VP2A 2XA7S 1GHIA 3LUQA 3E0YA 3MMHA 5KSCA 4JF4A 1K56D 1K4FA 1W8YA 4IHQA 5FQJA 4GW9A 2OAP1 1IYQA 1IYSA 3NJAA 1IELA 3LR3A 3UDXA 5HPIA 1EI5A 5AVFA 1KGFA 4EV4A 4CQHA 3U4LP 3OPLA 1BT5A 2ZC5B 5EUAA 2HDRA 3TRCA 3S4XA 4P0MA 4ARZB 3N4IA 1D7EA 3QP8A 4LPZA 1RGYA 3UE1A 3PBSA 4QD4A 1ERQA 3LO7A 4R38A 3GSGA 1Q2PA 2EFUA 3MZDA 3SZTA 3W8KA 4Q0IA 1YSQA 1ES3A 4DKIA 4JXWA 3CHWP 3IXBA 2IWBA 3F1PB 3BY9A 1IKGA 3O87A 4OPYA 3CG5A 5GLCA 3HUOA 2OSUA 4ZAMA 2O9CA 1SKOA 3SH9A 4N1HA 3H82A 2EX6A 3WS2A 1OJ5A 1LL5A 1IYPA 1XA1A 3CLOA 4OQGA 4BWIA 2XD5A 1P97A 2L1MA 3UB6A 2PHYA 1PWCA 3A3EA 4WLAA 1W63Q 5AQ7A 5CHJA 1L0DA 4ZJ2A 2RCXA 2HP9A 4UEYA 4U0XA 2DRWA 2WKIA 4RYEA 1KVLA 1H8MA 3T1RA 1LI0A 2Y2PA 2OLVA 1ZG4A 3ZDJA 2WGWB 3NHQA 4RX3A 3EQVA 1XA7A 3JVUA 4GLQA 3G34A 3D72A 3FKWA 2JBFA 2Q0OA 3F1NB 3ZFZA 2J3TD 3DWZA 3PAEA 3M2KA 1N9OA 1NWZA 2QKPA 2R78A 4JXGA 3UMEA 1S4RA 2ZM8A 3HJIA 3SS5A 2PD8A 2EA9A 4WF0A 2OWHA 3KX0X 3CPTA 1K55A 3N8SA 4LV3A 2ZD8A 3FZCA 3NBLA 3GR2A 5JYOA 2OWJA 2ZMFA 1XKZA 1P9RA 2HV1A 3CITA 4HESA 2NUTC 4EETB 1S1ZA 3Q1FA 4XUXA 4HJ4A 4RX2A 3S1YA 5I94A 2GX5A 3FV7A 4DDSA 2PAVP 2EFXA 5FDSA 1DRMA 2PU2A 1EW0A 1OJGA 3VV4A 3NIAA 2QJ5A 5J4EA 1K57C 3IWIA 4QB8A 2OOLA 4HH2A 1VETA 2Y2MA 1XGIA 2PYRA 2OLUA 4KQRA 3E2KA 3A3DA 1H8ZA 3MQ0A 2X02A 1IKIA 3VP0A 3HUMA 2XFSA 5KZHA 2JN7A 4U3TA 4AFIA 5LBRA 1L2SA 5FSRA 2ZQ8A 4O0PA 1IFQA 5EOEA 2V1AA 1ERMA 4CPKA 4EBPA 4HQAA 1D06A 5CERA 4LCMA 2V9AA 1V9ZA 1C3BA 2WK0A 2QYBA 4KUOA 3W4QA 1JWZA 2ZQDA 3V50A 4OVDA 3F1NA 1MPLA 3BFEA 1S66L 1XJ4A 4X1MA 1BSGA 3ZGAB 2A24A 1H3QA 5HSQA 1XX2A 1ONHA 5FQQA 3LIEA 5FQMA 4EW7A 4LV2A 1FCOA 3KYQA 4MBKA 4X1LA 3NOUC 3T12B 4UQIS 2MJ6A 4S2NC 1WE4A 2XH9A 1FCMA 1VM1A 5EECA 3OCNA 4OQIA 4FOFA 5KSHA 3ICYA 1ES4A 1NYMA 4UA6A 3PBRA 1LLBA 3R7WA 3NOPC 4ZTKA 4YWZA 3FPVA 5HW3A 2WUQA 5CTMA 3MQQA 5CRFA 3RTYA 3ZG7B 2WZXA 1EWZA 4KZ9A 2JCHA 2P04A 3MQOA 4OP5A 2P08A 4YOFA 3A0VA 3S22A 4D2OA 4GDBA 3BY8A 4IJGA 1T1CA 1ODVA 1FCNA 1NZOA 1NYYA 5FL3A 4FCFA 1S67L 4KZ4A 4X69A 3HLCA 3KO6A 4MNRA 1HZOA 5HFOA 4NKPA 4P6BA 1K54C 4L9FA 3IX3A 3BRMA 4R70A 2PDRA 4GOGA 5CTNA 4Y0UA 1PFLA 2XD1A 3LY3A 1FOFA 1K55C 1LSVA 3ZG9B 1TDLA 2Q9MA 3GVBA 1JWVA 3D4FA 4WUJA 5G4YA 3LI9A 2J7VA 3ULFA 1M40A 1GA0A 4JGPA 2HDUA 4L0LA 4D60A 2EX2A 3BFGA 3HLDA 4ZJ3A 4ZBEA 5M19A 5K5BA 2WAEA 1PW1A 2Y2HA 1E4DA 5AQAA 5F6AA 3OPPA 2H28A 4S2LA 3ZCZA 1K6SA 4JF6A 4H6JB 5E43A 1XFNA 4GNUA 2PD7A 1BULA 1IOUA 5FASA 1IYOA 3TG9A 2ZL1A 4QY5A 5L09A 3KYEA 4EEPA 1G28A 3CUEC 3QP1A 5TR7A 1VEUB 3C30A 5GHXA 5M1AA 5AQ9A 4JKTA 2VGLS 2VV6A 4PM5A 3PBQA 1L3LA 3B42A 1CI8A 4A5RA 3RFBA 2L4RA 3IT9A 4KZBA 3FPWA 2I9VA 3IXGA 1K57A 3O5YA 4BLMA 3C7UA 3T4KA 5FEGA 4MN7A 3SOIA 5CXWA 2HGVA 4EUVA 3ZG5A 1KOUA 4OQ0A 1YQSA 4Y7PA 1YM1A 3N6IA 1OTEA 1W8QA 3A3IA 4OONA 4QU3A 3PAGA 3VOYA 5L8MA 1KGEA 2JKTM 3NECA 4EWFA 3EQUA 4HEFA 4WZ5A 2JHEA 2HJ9C 5DVAA 4ID4A 1RGZA 3P01A 3CAXA 3TJZC 5AQBA 4P85A 1LT0A 2H0TA 3G35A 1GHPA 4WM9A 4LENA 3LR5A 3JVVA 1XP4A 2JKRM 5DTTA 2QWSA 2H0YA 3HLWA 5C5KA 1KVMA 5EVID 4ZDXA 1OT9A 2Y2LA 5HAIA 1HVBA 4ME4A 3UMDA 4MLLA 4II7A 2OV5A 3OPHA 3N7WA 4GD8A 2BTFP 4RA7A 3QP5A 3FKVA 3LIDA 4UHUA 3BFFA 2ZJ9A 1MWRA 3PYPA 2VX8A 2Z6DA 1CQAA 3WWXA 1XJ2A 2WADA 2PBDP 3MKFA 5FI2A 1RCJA 1LI9A 2IA2A 2ZM2A 3IF6C 1W79A 2B95A 4HP4A 3QP6A 4CLCE 4ESPA 3K2NA 1ESUA 2QMIA 2V20A 4WMCD 3CMZA 1XJ6A 4QHCA 2W27A 3ISGA 2HP6A 4DN0A 2E8JA 4R3JA 3ZNTA 2JE5A 2ZQ7A 3GQZA 4HBTA 4CLCD 4K0XA 3T4OA 5DFYA 2YKHA 1HD8A 4IUHA 5FEFA 1PWGA 3W2ZA 1ZHHB 3E98A 1LSXA 3EGXC 4ZJ1A 3SH8A 1HLUP 2J80A 4JLFA 4PM7A 3S7NA 3UDIA 3VP4A 3GMWA 4BJPA 2W0NA 1K25A 4CJNA 3G4PA 2JKTI 4F94A 1T1BA 1BZAA 3LIBA 3IBJA 1SKOB 5I5LA 4PM9A 4C75A 3VSLA 4GB7A 3VOLA 1DY6A 4CLCA 4B4ZA 1TS8A 2J3WA 3OC2A 4OLDA 4Y0TA 5EOOA 1LSWA 3MBZA 1L0FA 4B9OA 4B4XA 3DTKA 1GSVA 4BBUA 4GS9A 2HJEA 3MFXA 1BLHA 1W63M 4KUKA 3BFCA 4GZBA 3S7QA 4NXEA 1SDEA 3PXPA 2Z2LB 1SHVA 1ZKJA 2P9VB 3UPNA 5HPFA 2Y79A 4QWOA 2XF3A 4EESA 3L7HA 1Y4OA 1TF1A 3QP2A 1DP8A 1STZA 3VSKA 1H5XA 3BLSA 4KZ6A 2WGIA 4R0QA 2A24B 4KZ7A 4X25A 3HJKA 4S2MA 5EVLA 2XRNA 4DE1A 5IT5A 3VFFA 1YLJA 4FUWA 1YPRA 4JXSA 4LV1A 1JWPA 3UB9A 3BYDA 3RXWA 4H6JA 4P6ZS 1TVFA 3Q7VA 3DWKA 4GD6A 1ES2A 3T4SA 1Y28A 3T1XA 2ZM0A 1TS7A 3GDIA 4Y15A 4JGOA 3CI6A 3L9KA 4JGRA 2V2FF 3LR0A 3E2LA 2X71A 3SS4A 3MZFA 2HP5A 3HLEA 3GECA 4UAAA 2O9AA 1O07A 1CEFA 5FI6A 1Q2QA 3TOIA 2EX8A 2A2LA 4WEKA 4HY8A 4BQMA 4R6LA 3B3XA 3E4QA 5EVIA 4HBUA 1W7FA 2VV8A 3OZHA 3O86A 3IF6B 2FZ0A 3MKEA 3HL9A 1ACFA 4Y0OA 4DXCA 4CLCC 3HREA 3R4KA 4E6XA 1T19A 1FSYA 2K31A 2WZZA 4WELA 4B93A 5F1FA 3ZVWA 3KSGA 2UV0E 2VGKA 2ZMVA 3KSHA 1QMFA 4BL2A 5FAQA 4MDZA 3G31A 4X6TA 3TW8A 5DFXA 5DJTA 5HL6A 5F68A 1NLZA 3LYXA 4E3KA 1NJ4A 2ZMAA 3IH9A 5HZHA 4ETZA 2WKPA 3TE8A 3NC8A 2VJWA 1RP5A 4NXBA 4X55A 2XEPA 5FAPA 5E2HA 1F5MA 1AWIA 2W1RA 4GHIA 3AGDA 3DTMA 3UB8A 1Z09A 2VA0A 3LIAA 2PYPA 2XK1A 4JBFA 3S7PA 5AVEA 5FQ9A 2ZQ9A 4IBRA 2UWXA 2O99A 1KDSA 3V67A 2V1BA 1S4SA 1PZOA 2M1CA 3B33A 1GHMA 3UE3A 1BLSA 3BWLA 1G5UA 3NY4A 4KG2A 3IF5A 3OPRA 3VOZA 1GSXA 4FTXA 3IF6A 3O3VA 3G32A 1MBLA 4IEDA 2FFYA 3VE3A 5A92A 4MBHA 4R3AA 3QNCA 4R23A 2KDKA 3AGEA 4M4XA 2IWCA 3QNBA 5J3WA 4K08A 2GDNA 2HDSA 4DE3A 1FR6A 4PMAA 3ZG0A 4EU0A 3EEAA 3C4PA 3IWOA 4GN2A 1ZG6A 3G2YA 4N92A 3LIFA 2BLSA 4LGWA 4P87A 1ALQA 3VP3A 2EX9A 5EFWA 3HCYA 3H7WA 3JYIA 5F5YA 4C3QA 1LL9A 3DBAA 2M7UA 2Y59A 4IVIA 3MR0A 5FA7A 2B5RA 5TFQA 3AGFA 1YMSA 2Y55A 4LRYC 1XJ3A 4CLCB 1IEMA 5CGSA 5HARA 1VQQA 1ZTUA 4NXGA 4I3AA 1F9IA 3UN7A 4XUZA 4I3JA 3V5MA 3PHYA 2KLIA 1I2SA 3G2ZA 4EQ1A 3NULA 3C8CA 4WL9A 3T50A 1TD5A 4WZ5C 4I39A 4GJ4A 1H8YA 3UPPA 2WGWA 4M3KA 4G3KA 1OTAA 3V39A 1MZUA 5U47A 3A0SA 2V8CA 3VE4A 1N9LA 3VFHA 4NEED 2ZOHA 3SW1A 4OOMA 4WZ4A 3O88A 5HWVA 3QHYA 4GKUA 5FQIA 1K4EA 3WS5A 4P6ZM 4R3BA 2BG1A 4ZRRA 3ZHHA 3BEBA 3DW0A 3M6HA 2ZC7A 4MMNA 2D02A 4G3VA 4FSFA 4KENB 3JPUA 3UB5P 2VK3A 3LCEA 5EM1A 1PNEA 1FSWA 2O9BA 2ACGA 4BBVA 3C5AA 3CUEA 5FAOA 1WYBA 3DAVA 4OH0A 2NUPC 5CGXA 5IHVA 2A49A 4R4SA 2PR6A 4BENA 1CF0A 5F69A 4WYYA 2KX6A 3PBTA 1ONGA 5CEDA 1H0MA 1S0WA 1UWNX 5HAQA 2XROA 3BQAA 3E4PA 2Z6CA 4NETA 4HHDA 3CJMA 4OPQA 1LL8A 3SH7A 2P74A 4IVKA 4PM6A 4I3IA 2GZAA 2C6WB 4WBGA 3T1QB 1TDGA 1YLYA 5DF8A 4OLGA 3MJQA 3OLOA 4S2PA 3Q82A 3A3FA 4HIAA 3EOIA 3LEQA 1WA9A 3T4TA 4KZ5A 3I7JA 4X56A 1UGUA 4HNBA 3KSIA 4EBNA 2G7UA 4Y17A 2B18A 5DF9A 3H7WB 4EEUA 3H82B 1VEUA 2PRFA 4B88A 5JYPA 4I38A 3WRZA 3W4OA 1KGGA 2OAQ1 3WRTA 5M18A 2LB5A 1K54A 5FQKA 3V3RA 3TSGA 4JGQA 1QMEA 3ZNYA 3RXXA 3C7VA 1I5QA 5A90A 1KE4A 4NG2A 4YINA 1YLZA 2ZC4B 2Y91A 4S2OA 1PYYA 3D3OA 3OOVA 1P9WA 5DJUA 2J9OA 3NDGA 2HPBA 3HUNA 4IUKA 1L0EA 4ARZA 2WKHA 3MF0A 2ZL1B 4PAUA 5DKKA 3DTEA 2ZBBA 2Y2IA 1KE0A 2KOIA 1K38A 4BD0A 4WMCA 1TS6A 4ETXA 4N9LA 1SDNA 1YMXA 2JC7A 2G2UA 3C2WA 3UE6A 5HWTA 4S2JA 1S6RA 4EQIA 5DTSA 5HD5A 1VB6A 2XLNA 4HJ6A 4C6YA 5D3OA 1YSPA 1OTBA 3NDEA 3EEHA 2GJ3A 2D01A 3UE0A 4LRZE 4BMWA 4O8GA 4X68A 2Y2OA 5HAPA 4RQ9A 3ZG8B 4S2IA 3ITBA 3P09A 5A8BA 1K0KA 3BLMA 3MSHA 5GL9A 4JF5A 4KQOA 5F83A 4PM8A 2CMNA 3LGOA 5FDHA 5FI7A 1XPBA 4E3OA 2FFFB 2V8FA 2XFTA 2R9WA 4E3LA 1G68A 4E3MA 2JKFA 3MZEA 3IXDA 4G3WA 5IU1A 5HDSA 1JTGA 2EWVA 1CEGA 1CI9A 5MC7A 1DP6A 4OP8A 4EERA 2AVXA 5TBMA 2QJ7A 3UY6A 5CX7A 1W5DA 2H5SA 2J9PA 2W3HA 3HBRA 1Y54A 2O0YA 2ZOIA 5F1GA 1P0ZA 4E3IA 1G6AA 3HLBA 3MXSA 1PZPA 4Q8IA 3ZQ5A 2WAFA 1MKMA 2HF6A 1NRJA 2W1TB 4MN6A 3IHAA 1MC0A 4YNRA 3R7WB 3IBRA 2XR0A 5DKLA 1OT6A 4GCZA 1N9BA 2VV7A 5GLBA 1K56A 2Q9NA 4HJ3A 1YT4A 5EM0A 1BYWA 4KZAA 4LRXC 4WEJA 2W3GA 3PBOA 4GDNA 2WYXA 5DF7A 1MXOA 2I72A 2ZLYA 4MEZA 1JTDA 4DF6A 4BD1A 5L2FA 1PRQA 2K2NA 5CHMA 1NXYA 3FYZA 3HLFA 1MWSA 2XQZA 1L0GA 2QZ6A 4F3LB 3IQAA 2QPNA
chains in the Genus database with same CATH topology
3C38A 3S7PA 5KIZA 5AVEA 5F6AA 3F1PA 4BBTA 2H28A 5AJGA 1X0OA 2XA7M 2INWA 2DMWA 2O99A 2XA7S 2V1BA 3V67A 4H6JB 1S4SA 2M1CA 3LUQA 3E0YA 1XFNA 3B33A 3UE3A 2PD7A 1IOUA 3BWLA 3MMHA 3B47A 1GSXA 4IHQA 4GW9A 2OAP1 4EEPA 1G28A 2VZWA 3CUEC 5HDCA 3C30A 3NJAA 3LR3A 5HPIA 2YKFA 3VE3A 5AVFA 2VGLS 2VV6A 5HDDA 3PBQA 4XT2B 2QHKA 4CQHA 3B42A 4R3AA 3RFBA 2KDKA 4M4XA 2L4RA 2EWWA 3FPWA 2I9VA 4HH3A 4K08A 5J3WA 3O5YA 3NOTC 3T4KA 4EU0A 3EEAA 4MN7A 3TRCA 4EXOA 3P7NA 2HGVA 4EUVA 4ARZB 2LB9A 4Y2FA 1D7EA 3LIFA 4LPZA 5EFWA 1KOUA 3HCYA 3H7WA 3PBSA 2W3FA 5F5YA 1OTEA 3DBAA 2M7UA 4R38A 3MR0A 4Q0HA 3OBFA 5L8MA 3UB7A 2JKTM 4LRYC 3PBNA 1OPXA 3IS2B 1XJ3A 4DJ2A 4CLCB 4Q0IA 3EQUA 3OCLA 1YSQA 1G6OA 1XFQA 4NXGA 1ZTUA 2JHEA 2HJ9C 4I3AA 1F9IA 2P7JA 3F1PB 3BY9A 4I3JA 3LI8A 3PHYA 1DP9A 2KLIA 2FH5A 3P01A 3BQ8A 2O9CA 3CAXA 4F3LA 4EQ1A 3H82A 3TJZC 3C8CA 1OJ5A 4WL9A 3CLOA 1LT0A 3T50A 4BWIA 1OTDA 1TD5A 1P97A 1S1YA 4I39A 5J7EA 3LR5A 2L1MA 3JVVA 2JKRM 3H9WA 4GJ4A 3UB6A 3A0RA 4G3KA 1OTAA 2PHYA 4KQDA 4NXFA 4WLAA 2QWSA 5C5KA 1MZUA 1W63Q 1OT9A 3A0SA 4Z1WA 3VE4A 3LICA 1N9LA 4NEED 5TBMB 4E04A 4HP9A 5HD3A 2ZOHA 3SW1A 4OOMA 5HWVA 4ME4A 3F1OA 3UMDA 4I5SA 2VGLM 3EWKA 4II7A 4GS9B 5TJJA 4UEYA 4P6ZM 4ZRRA 1H8MA 3KSFA 4MMNA 2D02A 4G3VA 4FSFA 3NHQA 1F98A 3LIDA 3EQVA 3JVUA 2O9BA 4GLQA 4BBVA 2PT7A 2XSSA 3CUEA 3PYPA 2VX8A 1UWPX 2Z6DA 3D72A 2NUPC 1XJ2A 3F1NB 2IA2A 2J3TD 2PR5A 4HP4A 4CLCE 2PR6A 4L9EA 1N9OA 3S7OA 1NWZA 5F69A 3K2NA 2QKPA 2KX6A 2R78A 3PBTA 3UMEA 3RH8B 1XJ6A 1S4RA 3HJIA 2VEAA 3E4OA 2W27A 2PD8A 2Y8HA 4DN0A 2GNXA 2EA9A 1UWNX 2OWHA 4WF0A 3K3DA 2XROA 3KX0X 1N9NA 3BQAA 2L0WA 3BW6A 3E4PA 2Z6CA 4CLCD 2WKQA 3T4OA 5DFYA 2YKHA 2M7VA 3PR6A 4HHDA 4HI4A 4IUHA 1NLYA 4HOIA 2OWJA 1LL8A 2ZMFA 4Y5FA 1P9RA 3W2ZA 1ZHHB 1JNUA 3E98A 2HV1A 3CITA 1LSXA 3EGXC 2W3DA 4I3IA 2GZAA 2J80A 3S7NA 2NUTC 4EETB 4BJPA 1S1ZA 3MJQA 3OLOA 4HIAA 3EOIA 2B02A 2W0NA 4HJ4A 1OTIA 1WA9A 3T4TA 1UGUA 3LFVA 2VKSA 2GX5A 4HNBA 4Y3IA 2JKTI 3KSIA 2G7UA 2B18A 5DF9A 1DRMA 1T1BA 1EW0A 3H7WB 3LIBA 4EEUA 3H82B 3IBJA 1OJGA 3VV4A 5I5LA 4OOLA 2K7SA 5G4ZA 3MXQA 4I38A 3KYZA 2QJ5A 5J4EA 3VOLA 2OAQ1 4CLCA 2OOLA 4HH2A 2LB5A 5HWWA 1TS8A 2J3WA 3G6OA 3OC2A 3LR4A 2PYRA 2BASA 4JGQA 1LSWA 3MQ0A 4B9OA 4Q0JA 1GSVA 4BBUA 2JN7A 3D3OA 4GS9A 3MFXA 2HJEA 4KUKA 1W63M 3OOVA 1P9WA 5DJUA 3S7QA 4AFIA 4NXEA 3PXPA 3T4QA 3CWFA 5LBRA 4IUKA 4ARZA 5IS1A 4O01A 4O0PA 3MF0A 1IFQA 3K3CA 2V1AA 4PAUA 5DKKA 4HQAA 1D06A 2ZBBA 5HPFA 2Y79A 2V9AA 1V9ZA 4EESA 2KOIA 2QYBA 3FC7A 4KUOA 1TS6A 4ETXA 1TF1A 4L9GA 1DP8A 3C2WA 1STZA 3UE6A 5HWTA 3F1NA 2A24B 3T4JA 1S66L 1XJ4A 5HD5A 1VB6A 4QPRA 3HJKA 4GHIB 2XRNA 4HJ6A 2A24A 1H3QA 5HSQA 5IT5A 1TS0A 2VLGA 3LIEA 1YSPA 2V0WA 1OTBA 4EW7A 4WN5A 3KYQA 3UB9A 3EEHA 2GJ3A 2D01A 4H6JA 4P6ZS 2V0UA 4LRZE 3NOUC 4BMWA 4O8GA 4UQIS 2MJ6A 4RQ9A 3T4SA 4LLOB 1Y28A 1TS7A 3GDIA 3OCNA 1VHMA 4DMZA 4FOFA 1GSWA 3ICYA 3CI6A 4JGOA 5KSHA 5A8BA 4JGRA 3LR0A 3PBRA 4UQIM 3R7WA 4KQOA 3NOPC 2CMNA 4YWZA 3FPVA 1T1AA 3GECA 2O9AA 3ZYTA 3MQQA 3RTYA 3U2AA 3IS2A 2W3EA 4G3WA 5IU1A 2P04A 3MQOA 5HDSA 2A2LA 4WEKA 2EWVA 2P08A 4HY8A 4YOFA 3A0VA 5MC7A 1DP6A 4EERA 4R6LA 3FG8A 3E4QA 3BY8A 4IJGA 1T1CA 2VV8A 5TBMA 1ODVA 2QJ7A 5CX7A 2W1TA 2W3HA 2O0YA 5FL3A 2FZ0A 1S67L 2ZOIA 1P0ZA 3KO6A 1T18A 4CLCC 3R4KA 4NKPA 3ZQ5A 1T19A 4L9FA 1MKMA 2HF6A 1NRJA 4XT2A 2K31A 2W1TB 4PKYA 4MN6A 4R70A 4DJ3A 2PDRA 4WELA 4B93A 2WKRA 3KSGA 2ZMVA 1MC0A 3KSHA 4YNRA 3IBRA 3R7WB 4MDZA 1YAXA 1OT6A 3F1OB 5DKLA 3TW8A 4GCZA 4MN5A 5DFXA 5DJTA 1YKDA 1NLZA 5F68A 3LYXA 5HL6A 2JKRI 2J3TC 1LSVA 4PHTA 2VV7A 4MCWA 5HZHA 4HJ3A 4WUJA 4ETZA 5G4YA 1BYWA 2WKPA 3LI9A 3TE8A 4LRXC 2VJWA 3ULFA 4WEJA 2W3GA 3PBOA 3BJNA 1V9YA 4NXBA 4JGPA 2K2NA 4L0LA 1F5MA 2W1RA 4GHIA 3T4LA 3UB8A 4F3LB 5K5BA 2VA0A 3EGDC 3LIAA 2PYPA 4PKYG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGU A;  4I39 A;  5A8B A;  4JGR A;  5KIZ A;  5J7E A;  5AVE A;  5F6A A;  2L1M A;  4HNB A;  3F1P A;  3H9W A;  3UB6 A;  3A0R A;  4BBT A;  2H28 A;  1OTA A;  2PHY A;  1DRM A;  1T1B A;  1EW0 A;  1X0O A;  2INW A;  3H7W B;  3LIB A;  3NOP C;  4KQD A;  2QWS A;  3H82 B;  4NXF A;  4WLA A;  2CMN A;  1OJG A;  2V1B A;  4YWZ A;  1MZU A;  4H6J B;  1S4S A;  2M1C A;  1T1A A;  3LUQ A;  1OT9 A;  3GEC A;  3A0S A;  5I5L A;  2K7S A;  1XFN A;  3B33 A;  5G4Z A;  3VE4 A;  3LIC A;  1N9L A;  3MXQ A;  2PD7 A;  4I38 A;  2QJ5 A;  3BWL A;  5J4E A;  5TBM B;  3MQQ A;  3RTY A;  3VOL A;  4HP9 A;  5HD3 A;  4E04 A;  3IS2 A;  2ZOH A;  3SW1 A;  1GSX A;  5HWV A;  2OOL A;  3F1O A;  5IU1 A;  3MQO A;  4HH2 A;  4I5S A;  5HDS A;  3UMD A;  4GW9 A;  5HWW A;  3EWK A;  4EEP A;  1TS8 A;  4GS9 B;  1G28 A;  3G6O A;  2PYR A;  4HY8 A;  2BAS A;  3A0V A;  4JGQ A;  5HDC A;  1DP6 A;  4EER A;  1LSW A;  4R6L A;  3FG8 A;  3NJA A;  3E4Q A;  4JGO A;  4B9O A;  3BY8 A;  2YKF A;  1T1C A;  2VV8 A;  2D02 A;  5TBM A;  5AVF A;  1ODV A;  2VV6 A;  3VE3 A;  5HDD A;  2QJ7 A;  3NHQ A;  4XT2 B;  1GSV A;  2QHK A;  4BBU A;  4R3A A;  2JN7 A;  2KDK A;  1F98 A;  3LID A;  4M4X A;  4GS9 A;  2L4R A;  3MFX A;  4KUK A;  1S67 L;  2ZOI A;  4BBV A;  1P0Z A;  2I9V A;  4HH3 A;  4K08 A;  5DJU A;  5J3W A;  4NXE A;  3PYP A;  1T18 A;  1UWP X;  2Z6D A;  3CWF A;  3D72 A;  3NOT C;  5IS1 A;  1XJ2 A;  1OTI A;  3K3C A;  4EXO A;  3F1N B;  2V1A A;  3P7N A;  5DKK A;  3ZQ5 A;  1T19 A;  1D06 A;  4HQA A;  4L9F A;  2PR5 A;  2ZBB A;  4HP4 A;  4XT2 A;  2PR6 A;  2V9A A;  4L9E A;  1N9O A;  1D7E A;  1V9Z A;  3LIF A;  4PKY A;  4LPZ A;  1NWZ A;  4MN6 A;  4R70 A;  2PDR A;  5F69 A;  4DJ3 A;  4EES A;  5EFW A;  2WKR A;  1KOU A;  2KX6 A;  2QKP A;  2R78 A;  3FC7 A;  4KUO A;  3UME A;  3H7W A;  1TS6 A;  3IBR A;  3RH8 B;  5F5Y A;  1OTE A;  1XJ6 A;  1S4R A;  4L9G A;  1DP8 A;  3C2W A;  3HJI A;  4R38 A;  2VEA A;  1OT6 A;  3E4O A;  3F1O B;  5DKL A;  2W27 A;  4GCZ A;  2PD8 A;  3MR0 A;  4MN5 A;  3F1N A;  5DJT A;  5F68 A;  3LYX A;  5HWT A;  3UE6 A;  2A24 B;  2EA9 A;  3UB7 A;  1S66 L;  1XJ4 A;  1UWN X;  1LSV A;  2OWH A;  4WF0 A;  3K3D A;  3KX0 X;  1N9N A;  1VB6 A;  4LRY C;  2L0W A;  3HJK A;  1XJ3 A;  2VV7 A;  2Z6C A;  3E4P A;  3IS2 B;  2WKQ A;  4DJ2 A;  4GHI B;  5HZH A;  2YKH A;  2A24 A;  4HJ6 A;  4HHD A;  4HI4 A;  4HJ3 A;  4WUJ A;  5HSQ A;  5G4Y A;  1BYW A;  1XFQ A;  2WKP A;  1TS0 A;  2OWJ A;  3LI9 A;  4HOI A;  1LL8 A;  4LRX C;  2JHE A;  4NXG A;  3ULF A;  2VLG A;  3LIE A;  4I3A A;  1F9I A;  1JNU A;  2PYP A;  2P7J A;  2V0W A;  2HV1 A;  3BY9 A;  1LSX A;  3F1P B;  1OTB A;  4I3J A;  5HD5 A;  1V9Y A;  4I3I A;  4EEU A;  3LI8 A;  3PHY A;  2J80 A;  4NXB A;  4WN5 A;  4EW7 A;  1DP9 A;  3UB9 A;  3CAX A;  2GJ3 A;  3EEH A;  4JGP A;  2D01 A;  4H6J A;  4F3L A;  2V0U A;  4EET B;  4LRZ E;  4EQ1 A;  3H82 A;  3NOU C;  4GHI A;  3C8C A;  1OJ5 A;  1S1Z A;  3MJQ A;  4RQ9 A;  3OLO A;  3CLO A;  4WL9 A;  4LLO B;  3UB8 A;  1LT0 A;  1Y28 A;  4HIA A;  3T50 A;  1TS7 A;  2B02 A;  4F3L B;  1OTD A;  2W0N A;  4HJ4 A;  3GDI A;  3LIA A;  1P97 A;  1S1Y A;  1WA9 A;  4PKY G;  1GSW A;  3ICY A; 
#chains in the Genus database with same CATH topology
 3C38 A;  1HTZ A;  1U60 A;  3F1P A;  1FIL A;  5GLD A;  2INW A;  2DMW A;  4Y13 A;  3BEC A;  2ZQC A;  4XXR A;  3B47 A;  1ES5 A;  4DRT A;  2VZW A;  4IBX A;  4UA7 A;  5HDC A;  1FR1 A;  3QP4 A;  4MBF A;  3CZD A;  1OME A;  2YKF A;  1TEM A;  5CGW A;  5HDD A;  2ZQA A;  4XT2 B;  2QHK A;  5CEB A;  3HLG A;  2EWW A;  4HH3 A;  1J3W A;  1D1J A;  3A3J A;  5EVE A;  2Y2K A;  3NOT C;  3DTI A;  4EXO A;  2WKE A;  1YLT A;  3P7N A;  3MXR A;  1YLP A;  2LB9 A;  4Y2F A;  4Z9Q A;  4QY6 A;  3M2J A;  2A3U A;  3UDF A;  4JXV A;  2W3F A;  2Y4A A;  1GCE A;  3FWL A;  4N1X A;  4KZ3 A;  1NZU A;  2E8I A;  4LCL A;  4Q0H A;  3OBF A;  3UB7 A;  1CJF A;  3Q7V B;  1OPX A;  3IS2 B;  3PBN A;  1PW8 A;  4DJ2 A;  4N9K A;  1XGJ A;  3OCL A;  4KG5 A;  1G6O A;  1XFQ A;  2DNS A;  4O7D A;  2P7J A;  4OOY A;  3LI8 A;  5EVI B;  4E3N A;  3GTC A;  1DP9 A;  2FH5 A;  3BQ8 A;  4X53 A;  3N8R A;  4F3L A;  3UPO A;  5A93 A;  4YFM A;  1OTD A;  4S2N A;  1S1Y A;  5G18 A;  4DXB A;  4K0W A;  5E2E A;  5J7E A;  2JKG A;  3H9W A;  1ESI A;  3A0R A;  4KZ8 A;  1SCW A;  3GV9 A;  4KQD A;  4NXF A;  5TGF A;  1ERO A;  4Z1W A;  3LIC A;  5CHU A;  5TBM B;  4E04 A;  1K6R A;  4HP9 A;  5HD3 A;  1KE3 A;  5CEC A;  3F1O A;  4I5S A;  2VGL M;  3EWK A;  5TJJ A;  4GS9 B;  5HX9 A;  4OKP A;  3W4P A;  5KMW A;  4KQQ A;  3WS0 A;  3KSF A;  1BLP A;  4S2K A;  1XXM A;  2HDQ A;  2EXB A;  3BFD A;  4K91 A;  1F98 A;  3WS1 A;  1VET B;  2PT7 A;  2XSS A;  3ITA A;  5E2G A;  4OPR A;  1UWP X;  1MKI A;  2RL3 A;  2PR5 A;  4L9E A;  4U0T A;  3S7O A;  2G2W A;  1NY0 A;  3PTE A;  3RH8 B;  3Q07 A;  5L07 A;  2VEA A;  3E4O A;  2P9V A;  4UA9 A;  4EUZ A;  2Y8H A;  2GNX A;  4KG6 A;  3K3D A;  1N9N A;  2L0W A;  3BW6 A;  2WKQ A;  3IH8 A;  5BOH A;  2M7V A;  3PR6 A;  4HI4 A;  5DTK A;  3LY4 A;  1NLY A;  4HOI A;  4Y5F A;  1JNU A;  5A91 A;  2W3D A;  1A0K A;  2HZ5 A;  3NI9 A;  2ZC6 B;  4RVA A;  3CPT B;  5EV0 A;  1JVJ A;  2B02 A;  1ZC2 A;  3Q81 A;  1OTI A;  1DJB A;  1F2K A;  3LFV A;  2VKS A;  4Y3I A;  1BLC A;  1MWU A;  3MFD A;  4OPZ A;  3GRJ A;  3IX8 A;  4OOL A;  2IWD A;  2K7S A;  5G4Z A;  5EVI C;  2CC1 A;  2PU4 A;  3MXQ A;  3KYZ A;  4DE2 A;  1CK3 A;  1E3U A;  1O7E A;  5HWW A;  1E3U D;  3G6O A;  3LR4 A;  2BAS A;  1I2W A;  2XDM A;  1DJA A;  5HL1 A;  4Q0J A;  4NK3 A;  4E3J A;  4PPR A;  5GHY A;  3T4Q A;  1PI4 A;  3CWF A;  5IS1 A;  2Y2N A;  2PBY A;  4O01 A;  3HVF A;  3K3C A;  1DJC A;  3T1S A;  3FC7 A;  4FH2 A;  5F82 A;  4DDY A;  4L9G A;  2ZC3 B;  5E2F A;  1SKF A;  1WYC A;  3T4J A;  2XGN A;  1BUE A;  2J8Y A;  4QPR A;  3IHB A;  4GHI B;  4JPM A;  4LFU A;  1AXB A;  5GHZ A;  1NRF A;  4H8R A;  1TS0 A;  2Y2Q A;  2VLG A;  2V0W A;  1BTL A;  1SZV A;  5L10 A;  4WN5 A;  5J8X A;  4E6W A;  3BM6 A;  3VMA A;  1MY8 A;  5FAT A;  2V0U A;  3RJU A;  4DE0 A;  4LLO B;  3WS4 A;  1VHM A;  4DMZ A;  1GSW A;  3UO9 A;  1YLW A;  4UQI M;  4R4R A;  1FIK A;  4OQH A;  1PI5 A;  1M6K A;  1T1A A;  1E25 A;  3UNW A;  2VGJ A;  3IWQ A;  3ZYT A;  3U2A A;  3IS2 A;  2W3E A;  4R1G A;  5EPH A;  3SS3 A;  4EBL A;  2DCF A;  3Q7Z A;  5EE8 A;  3M6B A;  1J9M A;  3C4O A;  3FG8 A;  4BL3 A;  5GLA A;  3VP1 A;  3MS6 A;  1MWT A;  2X01 A;  2W1T A;  2R9X A;  2Z2M B;  3D9Y A;  3LEZ A;  3V3S A;  1T18 A;  4LV0 A;  2EXA A;  4XT2 A;  2C5W B;  4PKY A;  4DJ3 A;  2Y2J A;  1GA9 A;  2WKR A;  1KDW A;  1FQG A;  1YAX A;  3F1O B;  4MN5 A;  1YKD A;  4FH4 A;  1PIO A;  2JKR I;  2J3T C;  4PHT A;  4MCW A;  3NCK A;  1LHY A;  4FD8 A;  3IX4 A;  1PWD A;  3IXH A;  2WGV A;  3BJN A;  2H10 A;  1V9Y A;  2V1Z A;  3ZVT A;  3N8L A;  3P98 A;  1N4O A;  2Y2G A;  1Z6F A;  3T4L A;  3G30 A;  3EGD C;  4PKY G;  5KIZ A;  4QJG A;  4BBT A;  5AJG A;  1X0O A;  2XA7 M;  3VP2 A;  2XA7 S;  1GHI A;  3LUQ A;  3E0Y A;  3MMH A;  5KSC A;  4JF4 A;  1K56 D;  1K4F A;  1W8Y A;  4IHQ A;  5FQJ A;  4GW9 A;  2OAP 1;  1IYQ A;  1IYS A;  3NJA A;  1IEL A;  3LR3 A;  3UDX A;  5HPI A;  1EI5 A;  5AVF A;  1KGF A;  4EV4 A;  4CQH A;  3U4L P;  3OPL A;  1BT5 A;  2ZC5 B;  5EUA A;  2HDR A;  3TRC A;  3S4X A;  4P0M A;  4ARZ B;  3N4I A;  1D7E A;  3QP8 A;  4LPZ A;  1RGY A;  3UE1 A;  3PBS A;  4QD4 A;  1ERQ A;  3LO7 A;  4R38 A;  3GSG A;  1Q2P A;  2EFU A;  3MZD A;  3SZT A;  3W8K A;  4Q0I A;  1YSQ A;  1ES3 A;  4DKI A;  4JXW A;  3CHW P;  3IXB A;  2IWB A;  3F1P B;  3BY9 A;  1IKG A;  3O87 A;  4OPY A;  3CG5 A;  5GLC A;  3HUO A;  2OSU A;  4ZAM A;  2O9C A;  1SKO A;  3SH9 A;  4N1H A;  3H82 A;  2EX6 A;  3WS2 A;  1OJ5 A;  1LL5 A;  1IYP A;  1XA1 A;  3CLO A;  4OQG A;  4BWI A;  2XD5 A;  1P97 A;  2L1M A;  3UB6 A;  2PHY A;  1PWC A;  3A3E A;  4WLA A;  1W63 Q;  5AQ7 A;  5CHJ A;  1L0D A;  4ZJ2 A;  2RCX A;  2HP9 A;  4UEY A;  4U0X A;  2DRW A;  2WKI A;  4RYE A;  1KVL A;  1H8M A;  3T1R A;  1LI0 A;  2Y2P A;  2OLV A;  1ZG4 A;  3ZDJ A;  2WGW B;  3NHQ A;  4RX3 A;  3EQV A;  1XA7 A;  3JVU A;  4GLQ A;  3G34 A;  3D72 A;  3FKW A;  2JBF A;  2Q0O A;  3F1N B;  3ZFZ A;  2J3T D;  3DWZ A;  3PAE A;  3M2K A;  1N9O A;  1NWZ A;  2QKP A;  2R78 A;  4JXG A;  3UME A;  1S4R A;  2ZM8 A;  3HJI A;  3SS5 A;  2PD8 A;  2EA9 A;  4WF0 A;  2OWH A;  3KX0 X;  3CPT A;  1K55 A;  3N8S A;  4LV3 A;  2ZD8 A;  3FZC A;  3NBL A;  3GR2 A;  5JYO A;  2OWJ A;  2ZMF A;  1XKZ A;  1P9R A;  2HV1 A;  3CIT A;  4HES A;  2NUT C;  4EET B;  1S1Z A;  3Q1F A;  4XUX A;  4HJ4 A;  4RX2 A;  3S1Y A;  5I94 A;  2GX5 A;  3FV7 A;  4DDS A;  2PAV P;  2EFX A;  5FDS A;  1DRM A;  2PU2 A;  1EW0 A;  1OJG A;  3VV4 A;  3NIA A;  2QJ5 A;  5J4E A;  1K57 C;  3IWI A;  4QB8 A;  2OOL A;  4HH2 A;  1VET A;  2Y2M A;  1XGI A;  2PYR A;  2OLU A;  4KQR A;  3E2K A;  3A3D A;  1H8Z A;  3MQ0 A;  2X02 A;  1IKI A;  3VP0 A;  3HUM A;  2XFS A;  5KZH A;  2JN7 A;  4U3T A;  4AFI A;  5LBR A;  1L2S A;  5FSR A;  2ZQ8 A;  4O0P A;  1IFQ A;  5EOE A;  2V1A A;  1ERM A;  4CPK A;  4EBP A;  4HQA A;  1D06 A;  5CER A;  4LCM A;  2V9A A;  1V9Z A;  1C3B A;  2WK0 A;  2QYB A;  4KUO A;  3W4Q A;  1JWZ A;  2ZQD A;  3V50 A;  4OVD A;  3F1N A;  1MPL A;  3BFE A;  1S66 L;  1XJ4 A;  4X1M A;  1BSG A;  3ZGA B;  2A24 A;  1H3Q A;  5HSQ A;  1XX2 A;  1ONH A;  5FQQ A;  3LIE A;  5FQM A;  4EW7 A;  4LV2 A;  1FCO A;  3KYQ A;  4MBK A;  4X1L A;  3NOU C;  3T12 B;  4UQI S;  2MJ6 A;  4S2N C;  1WE4 A;  2XH9 A;  1FCM A;  1VM1 A;  5EEC A;  3OCN A;  4OQI A;  4FOF A;  5KSH A;  3ICY A;  1ES4 A;  1NYM A;  4UA6 A;  3PBR A;  1LLB A;  3R7W A;  3NOP C;  4ZTK A;  4YWZ A;  3FPV A;  5HW3 A;  2WUQ A;  5CTM A;  3MQQ A;  5CRF A;  3RTY A;  3ZG7 B;  2WZX A;  1EWZ A;  4KZ9 A;  2JCH A;  2P04 A;  3MQO A;  4OP5 A;  2P08 A;  4YOF A;  3A0V A;  3S22 A;  4D2O A;  4GDB A;  3BY8 A;  4IJG A;  1T1C A;  1ODV A;  1FCN A;  1NZO A;  1NYY A;  5FL3 A;  4FCF A;  1S67 L;  4KZ4 A;  4X69 A;  3HLC A;  3KO6 A;  4MNR A;  1HZO A;  5HFO A;  4NKP A;  4P6B A;  1K54 C;  4L9F A;  3IX3 A;  3BRM A;  4R70 A;  2PDR A;  4GOG A;  5CTN A;  4Y0U A;  1PFL A;  2XD1 A;  3LY3 A;  1FOF A;  1K55 C;  1LSV A;  3ZG9 B;  1TDL A;  2Q9M A;  3GVB A;  1JWV A;  3D4F A;  4WUJ A;  5G4Y A;  3LI9 A;  2J7V A;  3ULF A;  1M40 A;  1GA0 A;  4JGP A;  2HDU A;  4L0L A;  4D60 A;  2EX2 A;  3BFG A;  3HLD A;  4ZJ3 A;  4ZBE A;  5M19 A;  5K5B A;  2WAE A;  1PW1 A;  2Y2H A;  1E4D A;  5AQA A;  5F6A A;  3OPP A;  2H28 A;  4S2L A;  3ZCZ A;  1K6S A;  4JF6 A;  4H6J B;  5E43 A;  1XFN A;  4GNU A;  2PD7 A;  1BUL A;  1IOU A;  5FAS A;  1IYO A;  3TG9 A;  2ZL1 A;  4QY5 A;  5L09 A;  3KYE A;  4EEP A;  1G28 A;  3CUE C;  3QP1 A;  5TR7 A;  1VEU B;  3C30 A;  5GHX A;  5M1A A;  5AQ9 A;  4JKT A;  2VGL S;  2VV6 A;  4PM5 A;  3PBQ A;  1L3L A;  3B42 A;  1CI8 A;  4A5R A;  3RFB A;  2L4R A;  3IT9 A;  4KZB A;  3FPW A;  2I9V A;  3IXG A;  1K57 A;  3O5Y A;  4BLM A;  3C7U A;  3T4K A;  5FEG A;  4MN7 A;  3SOI A;  5CXW A;  2HGV A;  4EUV A;  3ZG5 A;  1KOU A;  4OQ0 A;  1YQS A;  4Y7P A;  1YM1 A;  3N6I A;  1OTE A;  1W8Q A;  3A3I A;  4OON A;  4QU3 A;  3PAG A;  3VOY A;  5L8M A;  1KGE A;  2JKT M;  3NEC A;  4EWF A;  3EQU A;  4HEF A;  4WZ5 A;  2JHE A;  2HJ9 C;  5DVA A;  4ID4 A;  1RGZ A;  3P01 A;  3CAX A;  3TJZ C;  5AQB A;  4P85 A;  1LT0 A;  2H0T A;  3G35 A;  1GHP A;  4WM9 A;  4LEN A;  3LR5 A;  3JVV A;  1XP4 A;  2JKR M;  5DTT A;  2QWS A;  2H0Y A;  3HLW A;  5C5K A;  1KVM A;  5EVI D;  4ZDX A;  1OT9 A;  2Y2L A;  5HAI A;  1HVB A;  4ME4 A;  3UMD A;  4MLL A;  4II7 A;  2OV5 A;  3OPH A;  3N7W A;  4GD8 A;  2BTF P;  4RA7 A;  3QP5 A;  3FKV A;  3LID A;  4UHU A;  3BFF A;  2ZJ9 A;  1MWR A;  3PYP A;  2VX8 A;  2Z6D A;  1CQA A;  3WWX A;  1XJ2 A;  2WAD A;  2PBD P;  3MKF A;  5FI2 A;  1RCJ A;  1LI9 A;  2IA2 A;  2ZM2 A;  3IF6 C;  1W79 A;  2B95 A;  4HP4 A;  3QP6 A;  4CLC E;  4ESP A;  3K2N A;  1ESU A;  2QMI A;  2V20 A;  4WMC D;  3CMZ A;  1XJ6 A;  4QHC A;  2W27 A;  3ISG A;  2HP6 A;  4DN0 A;  2E8J A;  4R3J A;  3ZNT A;  2JE5 A;  2ZQ7 A;  3GQZ A;  4HBT A;  4CLC D;  4K0X A;  3T4O A;  5DFY A;  2YKH A;  1HD8 A;  4IUH A;  5FEF A;  1PWG A;  3W2Z A;  1ZHH B;  3E98 A;  1LSX A;  3EGX C;  4ZJ1 A;  3SH8 A;  1HLU P;  2J80 A;  4JLF A;  4PM7 A;  3S7N A;  3UDI A;  3VP4 A;  3GMW A;  4BJP A;  2W0N A;  1K25 A;  4CJN A;  3G4P A;  2JKT I;  4F94 A;  1T1B A;  1BZA A;  3LIB A;  3IBJ A;  1SKO B;  5I5L A;  4PM9 A;  4C75 A;  3VSL A;  4GB7 A;  3VOL A;  1DY6 A;  4CLC A;  4B4Z A;  1TS8 A;  2J3W A;  3OC2 A;  4OLD A;  4Y0T A;  5EOO A;  1LSW A;  3MBZ A;  1L0F A;  4B9O A;  4B4X A;  3DTK A;  1GSV A;  4BBU A;  4GS9 A;  2HJE A;  3MFX A;  1BLH A;  1W63 M;  4KUK A;  3BFC A;  4GZB A;  3S7Q A;  4NXE A;  1SDE A;  3PXP A;  2Z2L B;  1SHV A;  1ZKJ A;  2P9V B;  3UPN A;  5HPF A;  2Y79 A;  4QWO A;  2XF3 A;  4EES A;  3L7H A;  1Y4O A;  1TF1 A;  3QP2 A;  1DP8 A;  1STZ A;  3VSK A;  1H5X A;  3BLS A;  4KZ6 A;  2WGI A;  4R0Q A;  2A24 B;  4KZ7 A;  4X25 A;  3HJK A;  4S2M A;  5EVL A;  2XRN A;  4DE1 A;  5IT5 A;  3VFF A;  1YLJ A;  4FUW A;  1YPR A;  4JXS A;  4LV1 A;  1JWP A;  3UB9 A;  3BYD A;  3RXW A;  4H6J A;  4P6Z S;  1TVF A;  3Q7V A;  3DWK A;  4GD6 A;  1ES2 A;  3T4S A;  1Y28 A;  3T1X A;  2ZM0 A;  1TS7 A;  3GDI A;  4Y15 A;  4JGO A;  3CI6 A;  3L9K A;  4JGR A;  2V2F F;  3LR0 A;  3E2L A;  2X71 A;  3SS4 A;  3MZF A;  2HP5 A;  3HLE A;  3GEC A;  4UAA A;  2O9A A;  1O07 A;  1CEF A;  5FI6 A;  1Q2Q A;  3TOI A;  2EX8 A;  2A2L A;  4WEK A;  4HY8 A;  4BQM A;  4R6L A;  3B3X A;  3E4Q A;  5EVI A;  4HBU A;  1W7F A;  2VV8 A;  3OZH A;  3O86 A;  3IF6 B;  2FZ0 A;  3MKE A;  3HL9 A;  1ACF A;  4Y0O A;  4DXC A;  4CLC C;  3HRE A;  3R4K A;  4E6X A;  1T19 A;  1FSY A;  2K31 A;  2WZZ A;  4WEL A;  4B93 A;  5F1F A;  3ZVW A;  3KSG A;  2UV0 E;  2VGK A;  2ZMV A;  3KSH A;  1QMF A;  4BL2 A;  5FAQ A;  4MDZ A;  3G31 A;  4X6T A;  3TW8 A;  5DFX A;  5DJT A;  5HL6 A;  5F68 A;  1NLZ A;  3LYX A;  4E3K A;  1NJ4 A;  2ZMA A;  3IH9 A;  5HZH A;  4ETZ A;  2WKP A;  3TE8 A;  3NC8 A;  2VJW A;  1RP5 A;  4NXB A;  4X55 A;  2XEP A;  5FAP A;  5E2H A;  1F5M A;  1AWI A;  2W1R A;  4GHI A;  3AGD A;  3DTM A;  3UB8 A;  1Z09 A;  2VA0 A;  3LIA A;  2PYP A;  2XK1 A;  4JBF A;  3S7P A;  5AVE A;  5FQ9 A;  2ZQ9 A;  4IBR A;  2UWX A;  2O99 A;  1KDS A;  3V67 A;  2V1B A;  1S4S A;  1PZO A;  2M1C A;  3B33 A;  1GHM A;  3UE3 A;  1BLS A;  3BWL A;  1G5U A;  3NY4 A;  4KG2 A;  3IF5 A;  3OPR A;  3VOZ A;  1GSX A;  4FTX A;  3IF6 A;  3O3V A;  3G32 A;  1MBL A;  4IED A;  2FFY A;  3VE3 A;  5A92 A;  4MBH A;  4R3A A;  3QNC A;  4R23 A;  2KDK A;  3AGE A;  4M4X A;  2IWC A;  3QNB A;  5J3W A;  4K08 A;  2GDN A;  2HDS A;  4DE3 A;  1FR6 A;  4PMA A;  3ZG0 A;  4EU0 A;  3EEA A;  3C4P A;  3IWO A;  4GN2 A;  1ZG6 A;  3G2Y A;  4N92 A;  3LIF A;  2BLS A;  4LGW A;  4P87 A;  1ALQ A;  3VP3 A;  2EX9 A;  5EFW A;  3HCY A;  3H7W A;  3JYI A;  5F5Y A;  4C3Q A;  1LL9 A;  3DBA A;  2M7U A;  2Y59 A;  4IVI A;  3MR0 A;  5FA7 A;  2B5R A;  5TFQ A;  3AGF A;  1YMS A;  2Y55 A;  4LRY C;  1XJ3 A;  4CLC B;  1IEM A;  5CGS A;  5HAR A;  1VQQ A;  1ZTU A;  4NXG A;  4I3A A;  1F9I A;  3UN7 A;  4XUZ A;  4I3J A;  3V5M A;  3PHY A;  2KLI A;  1I2S A;  3G2Z A;  4EQ1 A;  3NUL A;  3C8C A;  4WL9 A;  3T50 A;  1TD5 A;  4WZ5 C;  4I39 A;  4GJ4 A;  1H8Y A;  3UPP A;  2WGW A;  4M3K A;  4G3K A;  1OTA A;  3V39 A;  1MZU A;  5U47 A;  3A0S A;  2V8C A;  3VE4 A;  1N9L A;  3VFH A;  4NEE D;  2ZOH A;  3SW1 A;  4OOM A;  4WZ4 A;  3O88 A;  5HWV A;  3QHY A;  4GKU A;  5FQI A;  1K4E A;  3WS5 A;  4P6Z M;  4R3B A;  2BG1 A;  4ZRR A;  3ZHH A;  3BEB A;  3DW0 A;  3M6H A;  2ZC7 A;  4MMN A;  2D02 A;  4G3V A;  4FSF A;  4KEN B;  3JPU A;  3UB5 P;  2VK3 A;  3LCE A;  5EM1 A;  1PNE A;  1FSW A;  2O9B A;  2ACG A;  4BBV A;  3C5A A;  3CUE A;  5FAO A;  1WYB A;  3DAV A;  4OH0 A;  2NUP C;  5CGX A;  5IHV A;  2A49 A;  4R4S A;  2PR6 A;  4BEN A;  1CF0 A;  5F69 A;  4WYY A;  2KX6 A;  3PBT A;  1ONG A;  5CED A;  1H0M A;  1S0W A;  1UWN X;  5HAQ A;  2XRO A;  3BQA A;  3E4P A;  2Z6C A;  4NET A;  4HHD A;  3CJM A;  4OPQ A;  1LL8 A;  3SH7 A;  2P74 A;  4IVK A;  4PM6 A;  4I3I A;  2GZA A;  2C6W B;  4WBG A;  3T1Q B;  1TDG A;  1YLY A;  5DF8 A;  4OLG A;  3MJQ A;  3OLO A;  4S2P A;  3Q82 A;  3A3F A;  4HIA A;  3EOI A;  3LEQ A;  1WA9 A;  3T4T A;  4KZ5 A;  3I7J A;  4X56 A;  1UGU A;  4HNB A;  3KSI A;  4EBN A;  2G7U A;  4Y17 A;  2B18 A;  5DF9 A;  3H7W B;  4EEU A;  3H82 B;  1VEU A;  2PRF A;  4B88 A;  5JYP A;  4I38 A;  3WRZ A;  3W4O A;  1KGG A;  2OAQ 1;  3WRT A;  5M18 A;  2LB5 A;  1K54 A;  5FQK A;  3V3R A;  3TSG A;  4JGQ A;  1QME A;  3ZNY A;  3RXX A;  3C7V A;  1I5Q A;  5A90 A;  1KE4 A;  4NG2 A;  4YIN A;  1YLZ A;  2ZC4 B;  2Y91 A;  4S2O A;  1PYY A;  3D3O A;  3OOV A;  1P9W A;  5DJU A;  2J9O A;  3NDG A;  2HPB A;  3HUN A;  4IUK A;  1L0E A;  4ARZ A;  2WKH A;  3MF0 A;  2ZL1 B;  4PAU A;  5DKK A;  3DTE A;  2ZBB A;  2Y2I A;  1KE0 A;  2KOI A;  1K38 A;  4BD0 A;  4WMC A;  1TS6 A;  4ETX A;  4N9L A;  1SDN A;  1YMX A;  2JC7 A;  2G2U A;  3C2W A;  3UE6 A;  5HWT A;  4S2J A;  1S6R A;  4EQI A;  5DTS A;  5HD5 A;  1VB6 A;  2XLN A;  4HJ6 A;  4C6Y A;  5D3O A;  1YSP A;  1OTB A;  3NDE A;  3EEH A;  2GJ3 A;  2D01 A;  3UE0 A;  4LRZ E;  4BMW A;  4O8G A;  4X68 A;  2Y2O A;  5HAP A;  4RQ9 A;  3ZG8 B;  4S2I A;  3ITB A;  3P09 A;  5A8B A;  1K0K A;  3BLM A;  3MSH A;  5GL9 A;  4JF5 A;  4KQO A;  5F83 A;  4PM8 A;  2CMN A;  3LGO A;  5FDH A;  5FI7 A;  1XPB A;  4E3O A;  2FFF B;  2V8F A;  2XFT A;  2R9W A;  4E3L A;  1G68 A;  4E3M A;  2JKF A;  3MZE A;  3IXD A;  4G3W A;  5IU1 A;  5HDS A;  1JTG A;  2EWV A;  1CEG A;  1CI9 A;  5MC7 A;  1DP6 A;  4OP8 A;  4EER A;  2AVX A;  5TBM A;  2QJ7 A;  3UY6 A;  5CX7 A;  1W5D A;  2H5S A;  2J9P A;  2W3H A;  3HBR A;  1Y54 A;  2O0Y A;  2ZOI A;  5F1G A;  1P0Z A;  4E3I A;  1G6A A;  3HLB A;  3MXS A;  1PZP A;  4Q8I A;  3ZQ5 A;  2WAF A;  1MKM A;  2HF6 A;  1NRJ A;  2W1T B;  4MN6 A;  3IHA A;  1MC0 A;  4YNR A;  3R7W B;  3IBR A;  2XR0 A;  5DKL A;  1OT6 A;  4GCZ A;  1N9B A;  2VV7 A;  5GLB A;  1K56 A;  2Q9N A;  4HJ3 A;  1YT4 A;  5EM0 A;  1BYW A;  4KZA A;  4LRX C;  4WEJ A;  2W3G A;  3PBO A;  4GDN A;  2WYX A;  5DF7 A;  1MXO A;  2I72 A;  2ZLY A;  4MEZ A;  1JTD A;  4DF6 A;  4BD1 A;  5L2F A;  1PRQ A;  2K2N A;  5CHM A;  1NXY A;  3FYZ A;  3HLF A;  1MWS A;  2XQZ A;  1L0G A;  2QZ6 A;  4F3L B;  3IQA A;  2QPN A; 
#chains in the Genus database with same CATH homology
 3C38 A;  3S7P A;  5KIZ A;  5AVE A;  5F6A A;  3F1P A;  4BBT A;  2H28 A;  5AJG A;  1X0O A;  2XA7 M;  2INW A;  2DMW A;  2O99 A;  2XA7 S;  2V1B A;  3V67 A;  4H6J B;  1S4S A;  2M1C A;  3LUQ A;  3E0Y A;  1XFN A;  3B33 A;  3UE3 A;  2PD7 A;  1IOU A;  3BWL A;  3MMH A;  3B47 A;  1GSX A;  4IHQ A;  4GW9 A;  2OAP 1;  4EEP A;  1G28 A;  2VZW A;  3CUE C;  5HDC A;  3C30 A;  3NJA A;  3LR3 A;  5HPI A;  2YKF A;  3VE3 A;  5AVF A;  2VGL S;  2VV6 A;  5HDD A;  3PBQ A;  4XT2 B;  2QHK A;  4CQH A;  3B42 A;  4R3A A;  3RFB A;  2KDK A;  4M4X A;  2L4R A;  2EWW A;  3FPW A;  2I9V A;  4HH3 A;  4K08 A;  5J3W A;  3O5Y A;  3NOT C;  3T4K A;  4EU0 A;  3EEA A;  4MN7 A;  3TRC A;  4EXO A;  3P7N A;  2HGV A;  4EUV A;  4ARZ B;  2LB9 A;  4Y2F A;  1D7E A;  3LIF A;  4LPZ A;  5EFW A;  1KOU A;  3HCY A;  3H7W A;  3PBS A;  2W3F A;  5F5Y A;  1OTE A;  3DBA A;  2M7U A;  4R38 A;  3MR0 A;  4Q0H A;  3OBF A;  5L8M A;  3UB7 A;  2JKT M;  4LRY C;  3PBN A;  1OPX A;  3IS2 B;  1XJ3 A;  4DJ2 A;  4CLC B;  4Q0I A;  3EQU A;  3OCL A;  1YSQ A;  1G6O A;  1XFQ A;  4NXG A;  1ZTU A;  2JHE A;  2HJ9 C;  4I3A A;  1F9I A;  2P7J A;  3F1P B;  3BY9 A;  4I3J A;  3LI8 A;  3PHY A;  1DP9 A;  2KLI A;  2FH5 A;  3P01 A;  3BQ8 A;  2O9C A;  3CAX A;  4F3L A;  4EQ1 A;  3H82 A;  3TJZ C;  3C8C A;  1OJ5 A;  4WL9 A;  3CLO A;  1LT0 A;  3T50 A;  4BWI A;  1OTD A;  1TD5 A;  1P97 A;  1S1Y A;  4I39 A;  5J7E A;  3LR5 A;  2L1M A;  3JVV A;  2JKR M;  3H9W A;  4GJ4 A;  3UB6 A;  3A0R A;  4G3K A;  1OTA A;  2PHY A;  4KQD A;  4NXF A;  4WLA A;  2QWS A;  5C5K A;  1MZU A;  1W63 Q;  1OT9 A;  3A0S A;  4Z1W A;  3VE4 A;  3LIC A;  1N9L A;  4NEE D;  5TBM B;  4E04 A;  4HP9 A;  5HD3 A;  2ZOH A;  3SW1 A;  4OOM A;  5HWV A;  4ME4 A;  3F1O A;  3UMD A;  4I5S A;  2VGL M;  3EWK A;  4II7 A;  4GS9 B;  5TJJ A;  4UEY A;  4P6Z M;  4ZRR A;  1H8M A;  3KSF A;  4MMN A;  2D02 A;  4G3V A;  4FSF A;  3NHQ A;  1F98 A;  3LID A;  3EQV A;  3JVU A;  2O9B A;  4GLQ A;  4BBV A;  2PT7 A;  2XSS A;  3CUE A;  3PYP A;  2VX8 A;  1UWP X;  2Z6D A;  3D72 A;  2NUP C;  1XJ2 A;  3F1N B;  2IA2 A;  2J3T D;  2PR5 A;  4HP4 A;  4CLC E;  2PR6 A;  4L9E A;  1N9O A;  3S7O A;  1NWZ A;  5F69 A;  3K2N A;  2QKP A;  2KX6 A;  2R78 A;  3PBT A;  3UME A;  3RH8 B;  1XJ6 A;  1S4R A;  3HJI A;  2VEA A;  3E4O A;  2W27 A;  2PD8 A;  2Y8H A;  4DN0 A;  2GNX A;  2EA9 A;  1UWN X;  2OWH A;  4WF0 A;  3K3D A;  2XRO A;  3KX0 X;  1N9N A;  3BQA A;  2L0W A;  3BW6 A;  3E4P A;  2Z6C A;  4CLC D;  2WKQ A;  3T4O A;  5DFY A;  2YKH A;  2M7V A;  3PR6 A;  4HHD A;  4HI4 A;  4IUH A;  1NLY A;  4HOI A;  2OWJ A;  1LL8 A;  2ZMF A;  4Y5F A;  1P9R A;  3W2Z A;  1ZHH B;  1JNU A;  3E98 A;  2HV1 A;  3CIT A;  1LSX A;  3EGX C;  2W3D A;  4I3I A;  2GZA A;  2J80 A;  3S7N A;  2NUT C;  4EET B;  4BJP A;  1S1Z A;  3MJQ A;  3OLO A;  4HIA A;  3EOI A;  2B02 A;  2W0N A;  4HJ4 A;  1OTI A;  1WA9 A;  3T4T A;  1UGU A;  3LFV A;  2VKS A;  2GX5 A;  4HNB A;  4Y3I A;  2JKT I;  3KSI A;  2G7U A;  2B18 A;  5DF9 A;  1DRM A;  1T1B A;  1EW0 A;  3H7W B;  3LIB A;  4EEU A;  3H82 B;  3IBJ A;  1OJG A;  3VV4 A;  5I5L A;  4OOL A;  2K7S A;  5G4Z A;  3MXQ A;  4I38 A;  3KYZ A;  2QJ5 A;  5J4E A;  3VOL A;  2OAQ 1;  4CLC A;  2OOL A;  4HH2 A;  2LB5 A;  5HWW A;  1TS8 A;  2J3W A;  3G6O A;  3OC2 A;  3LR4 A;  2PYR A;  2BAS A;  4JGQ A;  1LSW A;  3MQ0 A;  4B9O A;  4Q0J A;  1GSV A;  4BBU A;  2JN7 A;  3D3O A;  4GS9 A;  3MFX A;  2HJE A;  4KUK A;  1W63 M;  3OOV A;  1P9W A;  5DJU A;  3S7Q A;  4AFI A;  4NXE A;  3PXP A;  3T4Q A;  3CWF A;  5LBR A;  4IUK A;  4ARZ A;  5IS1 A;  4O01 A;  4O0P A;  3MF0 A;  1IFQ A;  3K3C A;  2V1A A;  4PAU A;  5DKK A;  4HQA A;  1D06 A;  2ZBB A;  5HPF A;  2Y79 A;  2V9A A;  1V9Z A;  4EES A;  2KOI A;  2QYB A;  3FC7 A;  4KUO A;  1TS6 A;  4ETX A;  1TF1 A;  4L9G A;  1DP8 A;  3C2W A;  1STZ A;  3UE6 A;  5HWT A;  3F1N A;  2A24 B;  3T4J A;  1S66 L;  1XJ4 A;  5HD5 A;  1VB6 A;  4QPR A;  3HJK A;  4GHI B;  2XRN A;  4HJ6 A;  2A24 A;  1H3Q A;  5HSQ A;  5IT5 A;  1TS0 A;  2VLG A;  3LIE A;  1YSP A;  2V0W A;  1OTB A;  4EW7 A;  4WN5 A;  3KYQ A;  3UB9 A;  3EEH A;  2GJ3 A;  2D01 A;  4H6J A;  4P6Z S;  2V0U A;  4LRZ E;  3NOU C;  4BMW A;  4O8G A;  4UQI S;  2MJ6 A;  4RQ9 A;  3T4S A;  4LLO B;  1Y28 A;  1TS7 A;  3GDI A;  3OCN A;  1VHM A;  4DMZ A;  4FOF A;  1GSW A;  3ICY A;  3CI6 A;  4JGO A;  5KSH A;  5A8B A;  4JGR A;  3LR0 A;  3PBR A;  4UQI M;  3R7W A;  4KQO A;  3NOP C;  2CMN A;  4YWZ A;  3FPV A;  1T1A A;  3GEC A;  2O9A A;  3ZYT A;  3MQQ A;  3RTY A;  3U2A A;  3IS2 A;  2W3E A;  4G3W A;  5IU1 A;  2P04 A;  3MQO A;  5HDS A;  2A2L A;  4WEK A;  2EWV A;  2P08 A;  4HY8 A;  4YOF A;  3A0V A;  5MC7 A;  1DP6 A;  4EER A;  4R6L A;  3FG8 A;  3E4Q A;  3BY8 A;  4IJG A;  1T1C A;  2VV8 A;  5TBM A;  1ODV A;  2QJ7 A;  5CX7 A;  2W1T A;  2W3H A;  2O0Y A;  5FL3 A;  2FZ0 A;  1S67 L;  2ZOI A;  1P0Z A;  3KO6 A;  1T18 A;  4CLC C;  3R4K A;  4NKP A;  3ZQ5 A;  1T19 A;  4L9F A;  1MKM A;  2HF6 A;  1NRJ A;  4XT2 A;  2K31 A;  2W1T B;  4PKY A;  4MN6 A;  4R70 A;  4DJ3 A;  2PDR A;  4WEL A;  4B93 A;  2WKR A;  3KSG A;  2ZMV A;  1MC0 A;  3KSH A;  4YNR A;  3IBR A;  3R7W B;  4MDZ A;  1YAX A;  1OT6 A;  3F1O B;  5DKL A;  3TW8 A;  4GCZ A;  4MN5 A;  5DFX A;  5DJT A;  1YKD A;  1NLZ A;  5F68 A;  3LYX A;  5HL6 A;  2JKR I;  2J3T C;  1LSV A;  4PHT A;  2VV7 A;  4MCW A;  5HZH A;  4HJ3 A;  4WUJ A;  4ETZ A;  5G4Y A;  1BYW A;  2WKP A;  3LI9 A;  3TE8 A;  4LRX C;  2VJW A;  3ULF A;  4WEJ A;  2W3G A;  3PBO A;  3BJN A;  1V9Y A;  4NXB A;  4JGP A;  2K2N A;  4L0L A;  1F5M A;  2W1R A;  4GHI A;  3T4L A;  3UB8 A;  4F3L B;  5K5B A;  2VA0 A;  3EGD C;  3LIA A;  2PYP A;  4PKY G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...