3KX0X

Crystal structure of the pas domain of rv1364c
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
135
structure length
127
Chain Sequence
b'EMDWDKTVGAAEDVRRIFEHIPAILVGLEGPDHRFVAVNAAYRGFSPLLDTVGQPAREVYPELEGQQIYEMLDRVYQTGEPQSGSEWRLQEERYFDFVVTPRRRADGSIEGVQLIVDDVTSRVRARQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein Rv1364c/MT1410
publication title Role of a PAS sensor domain in the Mycobacterium tuberculosis transcription regulator Rv1364c
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Signaling protein
total genus 30
structure length 127
sequence length 135
ec nomenclature
pdb deposition date 2009-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF08448 PAS_4 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3kx0X00
3VE3A 1NWZA 3BWLA 2OOLA 4PKYA 3OLOA 5HD3A 2YKFA 1WA9A 5TBMA 2PR5A 3VOLA 2VV8A 4LPZA 5F69A 4BBUA 2ZBBA 1LSXA 3F1PA 2YKHA 4K08A 3H82B 4GHIA 3H7WB 2Z6DA 3MFXA 1OJ5A 4JGOA 2PR6A 4EXOA 5F68A 4EERA 3UMDA 4R3AA 4WN5A 1T1AA 1G28A 2QKPA 4JGQA 2QJ7A 5DJTA 3MJQA 1VB6A 3K3CA 5KIZA 3EWKA 4R70A 1UWPX 1GSVA 2PD8A 3NOPC 3HJIA 5IU1A 4EESA 2V1BA 1Y28A 4WLAA 3T50A 4XT2A 3CWFA 1OJGA 5EFWA 2PDRA 1KOUA 2W0NA 3NOUC 2PYRA 5HWVA 1DP6A 2L1MA 4JGPA 1LL8A 1N9NA 4M4XA 1BYWA 2J80A 4HP4A 2Z6CA 5HSQA 4I38A 3F1OB 3VE4A 3LI9A 2L0WA 5HDCA 4HP9A 2L4RA 1OTDA 4HQAA 4PKYG 4GS9B 4KUOA 1XJ4A 5DKLA 3E4QA 3A0VA 3GECA 4B9OA 1LSVA 1GSXA 4HJ6A 3UB8A 5TBMB 2BASA 4I3IA 3LYXA 2CMNA 4NXGA 1MZUA 2OWHA 4EEPA 3A0SA 4EEUA 2M1CA 3F1PB 4MN6A 1TS6A 2KX6A 1OTBA 4GHIB 1XFQA 3B33A 3CAXA 3LIEA 3SW1A 3CLOA 3C2WA 2ZOIA 2H28A 4WF0A 1V9ZA 3MQOA 4L9FA 3E4PA 4I3AA 5J3WA 3ZQ5A 4KUKA 3NHQA 5HD5A 4HOIA 5F6AA 5F5YA 4LLOB 2V0UA 1DP9A 2INWA 1OT9A 1S4RA 4H6JA 3C8CA 4XT2B 2ZOHA 3RTYA 3KX0X 5DKKA 2D01A 2WKPA 1LSWA 1GSWA 2QWSA 4DJ3A 4LRZE 1EW0A 2R78A 4RQ9A 3PHYA 4YWZA 4DJ2A 5G4ZA 4GCZA 1XFNA 3LIAA 1TS7A 3LUQA 1P0ZA 4L9GA 2KDKA 4EQ1A 3F1NA 2QHKA 3MXQA 3FC7A 3HJKA 5J4EA 2PYPA 3LI8A 5J7EA 4HJ3A 1N9OA 4WUJA 2JHEA 1D7EA 4I3JA 4F3LA 1S1YA 1XJ3A 1UWNX 1T1CA 3UB9A 3IS2A 1F9IA 3NOTC 1DP8A 2VV7A 4I39A 4LRXC 4L9EA 4HY8A 2I9VA 5I5LA 2A24A 3NJAA 4HI4A 2PD7A 2W27A 1XJ6A 3UMEA 5HDDA 1S67L 1TS8A 1ODVA 3P7NA 4WL9A 1S1ZA 4HH2A 5HDSA 1N9LA 2WKQA 4H6JB 1P97A 3UB6A 4BBTA 4BBVA 1OTAA 3E4OA 5HWTA 2P7JA 1OT6A 4R6LA 3GDIA 5A8BA 3K3DA 1F98A 5DJUA 4HH3A 2D02A 2K7SA 3EEHA 1X0OA 1LT0A 3IBRA 4GW9A 3MR0A 1S66L 5G4YA 1OTIA 2QJ5A 4KQDA 3BY8A 3F1NB 5AVEA 3A0RA 2WKRA 3H82A 3H7WA 2JN7A 1S4SA 4NXFA 3LIBA 3G6OA 1T1BA 3LIDA 2B02A 4R38A 3ULFA 3BY9A 4LRYC 4I5SA 3UB7A 3D72A 2HV1A 1T18A 1DRMA 1D06A 4E04A 4F3LB 2EA9A 1UGUA 1T19A 1V9YA 4HJ4A 4NXEA 2VV6A 1XJ2A 3IS2B 2GJ3A 2PHYA 5IS1A 2VEAA 3UE6A 1OTEA 3FG8A 1JNUA 2A24B 4HHDA 5HZHA 5AVFA 2V0WA 3ICYA 4NXBA 3MQQA 3LICA 3PYPA 3H9WA 5HWWA 3F1OA 4HIAA 2OWJA 4EETB 4JGRA 2V9AA 1TS0A 3RH8B 2VLGA 2V1AA 4GS9A 4MN5A 4HNBA 3LIFA 4EW7A
chains in the Genus database with same CATH superfamily
3VE3A 2X02A 3OOVA 2LB9A 1WA9A 3N8RA 4WMCD 4WMCA 4CPKA 1W63M 3ZG8B 3GTCA 5CHJA 5EE8A 2YKHA 4K08A 1OPXA 3MFXA 1OJ5A 2PR6A 5F68A 2VX8A 1H0MA 4R3AA 1T1AA 4O0PA 4CJNA 4BMWA 4ZJ3A 1CI9A 3VMAA 3MJQA 1Y54A 1VB6A 2EX6A 4MLLA 4OPYA 4E3IA 4Y7PA 3DWKA 3Q7ZA 5EOEA 1XKZA 3HLDA 3UB5P 2WUQA 2XA7M 1GSVA 4E3KA 1KDSA 2PD8A 3SH7A 3HJIA 3T50A 3MZFA 1YLJA 2ZM8A 2Y2GA 1K54C 1F2KA 1W8QA 1J3WA 4FUWA 1KOUA 4G3WA 5CGSA 2GZAA 2W0NA 3Q81A 4XUZA 5HAQA 2HDSA 1LL5A 2A49A 3NOUC 3VSLA 5HWVA 1DP6A 2L1MA 3T4OA 1LL8A 4OPRA 4U0TA 2HZ5A 5JYPA 1N9NA 2O0YA 3RFBA 3BLMA 3WWXA 4IVIA 4XXRA 4XUXA 2Q9MA 1ACFA 3G35A 4E3OA 4OONA 1MY8A 1K4EA 5DVAA 4P6ZS 2L4RA 5FSRA 1PI4A 4PKYG 1BTLA 1GHPA 1VEUA 3PBNA 5FQQA 3A0VA 1FQGA 5FQ9A 1G6OA 4LV0A 1EWZA 5A93A 4IEDA 1NLYA 3JPUA 5TBMB 4WEJA 4LCLA 3EGXC 4NXGA 1BLPA 4EEPA 3A0SA 4R0QA 4EEUA 3EOIA 2V1ZA 2V8FA 1TS6A 4MN6A 5DFXA 4E6WA 3CAXA 1D1JA 1KGFA 3MS6A 2HP5A 4CLCB 3U2AA 1C3BA 2PBYA 3E4PA 3G32A 4KUKA 4E3MA 1KE4A 4GJ4A 4DE0A 3GQZA 3G4PA 1STZA 3HREA 4HOIA 1H8MA 3SS5A 1KGGA 5F6AA 2QMIA 4N9KA 4GOGA 4D60A 5FDSA 3Q07A 1I2SA 5M1AA 1EI5A 2ZOHA 4Q0JA 3RTYA 1XX2A 1FR6A 5CERA 2W1RA 3WRZA 4II7A 1SHVA 5GLCA 1GSWA 2HDRA 2ZQ8A 5FI6A 4Z1WA 2CC1A 1CK3A 4QWOA 5FAPA 3NY4A 4BL2A 3TRCA 1PRQA 1CJFA 1GHMA 4E3JA 1AWIA 2W1TA 4OOLA 4N1HA 5DTSA 1SDNA 1W8YA 1ESUA 1FOFA 3T12B 4EQ1A 3IHAA 3F1NA 5GLAA 1ONHA 5DF7A 3LI8A 1WE4A 3IH9A 4HJ3A 2P08A 1N9OA 2JBFA 4UAAA 4WEKA 1D7EA 2EX9A 2JCHA 4JF5A 4YINA 5U47A 1A0KA 1XJ3A 1QMFA 3MXSA 2Y55A 3UB9A 3DW0A 4LCMA 4OPQA 1O07A 1LI0A 3W4PA 3ISGA 4UQIM 4LRXC 3JYIA 4L9EA 2VJWA 2QYBA 4LV2A 1MXOA 4N92A 4HY8A 5D3OA 2PD7A 3DTKA 2W27A 5HFOA 1YKDA 4KZ4A 3E0YA 1S67L 1TS8A 1ODVA 1YMXA 2P9VA 3NBLA 2B18A 2WKQA 4H6JB 3T4KA 4ETZA 4ETXA 3T4LA 3OPHA 3BEBA 1XXMA 3NCKA 1S0WA 1OTAA 2P7JA 3C4OA 3DBAA 4ME4A 3BRMA 4R6LA 5A8BA 2KOIA 2Y8HA 2VZWA 3P01A 2PAVP 1K25A 2XF3A 3MR0A 1IELA 3B3XA 3SH9A 2QJ5A 2ZMAA 1HD8A 1ES3A 4JF6A 3LY3A 2JKTM 3M6BA 4DXCA 3Q1FA 5AVEA 3A0RA 3MZEA 1ALQA 3H7WA 4UA7A 4B88A 3ZVTA 3G6OA 3IX4A 2J3WA 2J7VA 4Y17A 3BY9A 3HLEA 3IF6B 2ZC4B 1D06A 1UGUA 2IWCA 4R4RA 2ZL1A 1KVMA 2OSUA 4NXEA 4DE1A 3IF5A 4ZAMA 3WS4A 2FH5A 2VV6A 5DTTA 3FYZA 3IS2B 4R1GA 5DF9A 2PHYA 2ZC6B 2ZC7A 3IXGA 3NDGA 3DTIA 3UE6A 3ZHHA 1JTGA 4HHDA 5HPFA 3OC2A 3CUEC 1HTZA 3CHWP 3ICYA 2LB5A 1FSWA 2PU4A 5TGFA 1K57A 3LICA 5A91A 3H9WA 3F1OA 4HIAA 3MMHA 3OPRA 1SKOA 4OH0A 5FEGA 2V9AA 2XDMA 3ZNTA 4Y15A 4KQOA 4NEED 4JXVA 4GD8A 4EW7A 3TE8A 1XGJA 3NC8A 1LI9A 2PU2A 4RX2A 1NWZA 5HD3A 4IUKA 3HLFA 3BFDA 4OLGA 3BFFA 2PR5A 4X25A 4CQHA 2VV8A 4LPZA 4NKPA 5F69A 1N9BA 4FD8A 1LSXA 4Q8IA 3F1PA 2HP9A 4QB8A 3BFGA 3W4QA 2VKSA 2VGKA 4PAUA 1KE3A 4EERA 2W3DA 4LV3A 1G28A 2X01A 3L9KA 4PM6A 5DJTA 1PWGA 3PXPA 5HARA 3MBZA 1L0FA 4PM5A 3IXDA 3IQAA 2Z2LB 2NUTC 5F83A 4A5RA 5KIZA 4ZJ2A 2OLUA 2BTFP 5HX9A 2Y2LA 3NOPC 3LGOA 1YSPA 4XT2A 3CWFA 1OJGA 5AQBA 5HPIA 1YM1A 1DJAA 1WYBA 5GLDA 3D9YA 3LR4A 4AFIA 2J80A 3QP8A 4R4SA 3LEQA 5E2EA 5CHMA 2C5WB 3WS0A 4S2LA 2EX2A 2H0TA 3QP5A 3HL9A 4GS9B 1ES4A 1PZOA 4EQIA 1XJ4A 1PYYA 2RL3A 3DAVA 1ZG6A 1E3UD 3BFCA 1G6AA 3GVBA 2OV5A 1E3UA 1GSXA 1ZHHB 1MC0A 4OQIA 3KYQA 3JVUA 2OWHA 2Z2MB 3LR3A 3T1XA 2M1CA 3T1SA 4UHUA 4PM7A 1OTBA 2XFSA 4EBNA 1L0DA 4N1XA 3SW1A 4KENB 4Y2FA 2ZOIA 4U3TA 3IXHA 2Y91A 1V9ZA 3IX3A 5A92A 1Q2QA 4L9FA 4UA6A 4OQGA 1VQQA 4KZAA 3ZQ5A 3QNBA 4KZ6A 4L0LA 1FSYA 1HLUP 3OCLA 1XA1A 3V3SA 1BLHA 1GA0A 3K2NA 4CLCC 5F5YA 2G2UA 3TSGA 1OMEA 4LENA 1YLTA 3C7UA 1MBLA 1S4RA 4NK3A 2EXBA 3CMZA 5FL3A 1M40A 3BQ8A 2XD5A 2D01A 5FQJA 2QZ6A 2VK3A 2UWXA 3PBTA 1LSWA 4IJGA 3LEZA 4DJ3A 3UE0A 1S6RA 1PIOA 5FI7A 1EW0A 3PHYA 5CEDA 3UPNA 1IOUA 3GSGA 5CTMA 4GDBA 2O9CA 2Y59A 4GCZA 2ZLYA 3VP2A 3LIAA 4ESPA 1TS7A 3LUQA 3FKVA 4EU0A 1GA9A 1P0ZA 3W8KA 5EVLA 3ZVWA 4L9GA 3FPWA 4MBKA 1VEUB 3ZG7B 5EVIB 3MXQA 4X53A 3FC7A 4WZ5C 3LO7A 2PYPA 5TR7A 2Y2PA 2K31A 3O87A 1ONGA 1K0KA 4O01A 4WUJA 2IWBA 1CQAA 1CI8A 5IHVA 2Y4AA 1VETA 2B5RA 2WAFA 4JPMA 4BLMA 3G31A 4NG2A 4FH4A 2EX8A 2WK0A 2ZD8A 2ZJ9A 1TD5A 3VP1A 1FR1A 1F9IA 4QJGA 2K2NA 3NOTC 4N9LA 2VV7A 4Y5FA 1AXBA 1NY0A 3MXRA 4BWIA 4MEZA 1NYMA 3M2KA 3B47A 3UDFA 5BOHA 5I5LA 2A24A 1PFLA 4LV1A 4HI4A 2O99A 3LFVA 5TFQA 1K38A 5AJGA 1XJ6A 3UMEA 4OKPA 2GX5A 1KGEA 4B93A 4R23A 1YLPA 1KVLA 1FCNA 5HDSA 5AQAA 4M3KA 3DTMA 4KZ5A 4DRTA 5TJJA 3HCYA 2OAQ1 1HVBA 2PBDP 3UB6A 4BBVA 5HWTA 1OT6A 1JWPA 4BJPA 1RCJA 4JXSA 4KG5A 1MWTA 4MDZA 3UNWA 4QD4A 3KYZA 3V67A 4S2NC 4LFUA 1CF0A 2WADA 5HL6A 2FFFB 3UO9A 3BM6A 1LT0A 3LY4A 4JLFA 4CLCD 2W1TB 1NYYA 2W3HA 4IUHA 1K56D 2UV0E 4GW9A 4FTXA 3RJUA 4S2PA 5G4YA 2EFUA 3DTEA 3BY8A 4X68A 3F1NB 2H0YA 2EXAA 3H82A 5FAQA 3UE3A 1S4SA 3NECA 1I5QA 3MQ0A 3LR0A 2ZQ9A 1DY6A 3HLGA 2Y2JA 5J8XA 2JC7A 5L2FA 4E04A 3Q7VA 4MN7A 3VV4A 4GLQA 1H5XA 1K54A 5L09A 3IF6C 2FFYA 2WGVA 1H8YA 5K5BA 5GLBA 5IS1A 2WZZA 3PAGA 4YNRA 1LLBA 2VEAA 2GDNA 4ARZA 2XEPA 3WRTA 3FG8A 5HZHA 5AVFA 1RGYA 3GMWA 4BENA 1P9WA 3L7HA 2Y79A 1YPRA 2P9VB 3PYPA 2Y2MA 4PMAA 3SOIA 3PTEA 2M7UA 3ZYTA 4JGRA 4S2IA 5L10A 3HBRA 4FH2A 2VLGA 3EGDC 3CPTA 1YQSA 1PWDA 2XLNA 4OOYA 1IFQA 2EWWA 3LIFA 3ZGAB 1EROA 3IBJA 2HJEA 3NULA 2XA7S 3BWLA 4PKYA 5KZHA 4FOFA 4X69A 1ES2A 3VOLA 2P04A 2Q9NA 2ZM2A 4BBUA 5L07A 2ZBBA 4HESA 3ITBA 3UY6A 4GHIA 1P9RA 3H7WB 1W63Q 2Z6DA 3FZCA 3O88A 3HUMA 4EXOA 2WKHA 3MZDA 3UMDA 4WN5A 4GKUA 3V3RA 4JGQA 1IEMA 1BLSA 2E8IA 3ZDJA 5CGWA 2JKRM 3T1QB 3QP6A 5FDHA 2ZL1B 1MWUA 5FATA 1PW8A 4R70A 3WS2A 3ITAA 4JXGA 2XFTA 2R9WA 5IU1A 1DJBA 2ZQDA 2V1BA 1Y28A 4WLAA 4E6XA 4D2OA 5EFWA 3OBFA 3GRJA 2Q0OA 4P85A 3ZG0A 1KDWA 3VOZA 5EOOA 4JGPA 1KE0A 2Y2OA 4M4XA 1BYWA 1FCOA 1IYPA 3W4OA 2JKFA 4ZRRA 1W7FA 4I38A 2W3FA 1ES5A 3F1OB 2HDUA 3R7WA 4QU3A 5JYOA 2C6WB 3ZFZA 2WAEA 3T4TA 4X55A 4KZ7A 1G68A 2BLSA 5EPHA 3UN7A 2DNSA 2L0WA 5HDCA 1K55C 3S7PA 3ZG5A 1OTDA 3N8SA 4PM9A 4KUOA 3BYDA 5AQ9A 5F1GA 5CGXA 5DKLA 2IWDA 1Z6FA 4P6BA 1LSVA 3UB8A 4RA7A 1TDGA 2V2FF 4I3IA 3T4JA 3LYXA 2CMNA 2XRNA 1I2WA 1M6KA 4KG6A 3T4SA 4S2OA 5L8MA 3W2ZA 3EQVA 1FILA 3F1PB 2X71A 2KX6A 4E3NA 1ERMA 3BJNA 3B33A 3G34A 1SKFA 5I94A 2HGVA 3TJZC 3C2WA 1TEMA 4EV4A 4WF0A 1LL9A 3MQOA 4EWFA 4MNRA 5HL1A 4I3AA 4X1LA 3V50A 3O3VA 3NHQA 2J9OA 1W5DA 3FV7A 1IYOA 3EEAA 3VP4A 4H8RA 4LLOB 3OCNA 4WBGA 2V0UA 1DP9A 1NJ4A 5FQMA 3C7VA 2INWA 1SCWA 1OT9A 4IHQA 2HPBA 1IYQA 3C8CA 2WGWA 3NI9A 4XT2B 3D4FA 2ZQCA 3KX0X 2A2LA 1XPBA 3HLWA 3B42A 3MFDA 3CJMA 4IBXA 2WKPA 4DN0A 1BSGA 5A90A 1JTDA 4E3LA 4BQMA 2R78A 4KZBA 4YWZA 1XP4A 3UPOA 4DJ2A 4Y0UA 4JKTA 4UQIS 1XFNA 3CITA 4X56A 3UDIA 2KDKA 3VOYA 3ZCZA 4OQHA 2P74A 3HJKA 1VM1A 5J4EA 3HLBA 3EQUA 1YLWA 5FASA 3TW8A 5FAOA 5J7EA 3BFEA 4FSFA 4KZ9A 3N8LA 2O9AA 4I3JA 4KG2A 4EUZA 5EVIC 3VFHA 3S4XA 4ZJ1A 4K0WA 3WS1A 4F3LA 2ACGA 4Q0IA 4OP8A 1T1CA 3CUEA 3PBOA 5CRFA 4I39A 3IH8A 1YMSA 2ZC3B 3QHYA 4F94A 2XR0A 1VHMA 4C6YA 2W3EA 2I9VA 4EBPA 1BUEA 5EUAA 4CLCE 1K6SA 1XA7A 4QY6A 5HDDA 4HBUA 2PT7A 3P7NA 4GB7A 4WL9A 2OLVA 1NZOA 4Y0TA 2J3TC 3M6HA 4EBLA 4PM8A 1IKIA 1JWVA 3G2YA 4BBTA 3HUOA 2ZC5B 1LHYA 4JXWA 5CECA 4MMNA 1TVFA 3VFFA 1YT4A 4RVAA 1F98A 1HZOA 1PW1A 1BZAA 4HH3A 2A3UA 4G3KA 5FA7A 1RP5A 1S66L 1OTIA 2Y2QA 3T4QA 2WKRA 2JN7A 4NXFA 1BT5A 3O5YA 4IBRA 1NRJA 3LIDA 2B02A 4R38A 2DMWA 2HDQA 3UB7A 3D72A 3PBQA 1ZKJA 4HBTA 5KSHA 1T18A 4R3JA 4DMZA 2Y2NA 1DRMA 4X1MA 1VETB 3FPVA 1E25A 2EA9A 1L2SA 5GHXA 3FWLA 2NUPC 4HJ4A 5E2HA 3S22A 1YSQA 2I72A 2GJ3A 3C30A 5CTNA 1TDLA 3IXBA 1OTEA 1JNUA 2A24B 4DDSA 3UPPA 4QY5A 2GNXA 2V0WA 1N4OA 4PPRA 3HUNA 1YAXA 4DE3A 4K0XA 4NXBA 5EVID 3MQQA 5EVIA 1MWSA 4Y0OA 4RYEA 3MKEA 3QNCA 1Y4OA 3RXXA 3A3EA 4JF4A 4EETB 1TS0A 4UA9A 3G30A 3RH8B 5DF8A 1YLYA 5CXWA 4BL3A 2VGLM 3ZG9B 3KO6A 3S1YA 2DCFA 2OOLA 1DJCA 2G7UA 1MKMA 3OLOA 1H8ZA 2YKFA 2XGNA 3BQAA 1L0GA 5TBMA 5EVEA 4MBFA 4LGWA 3E98A 5HAPA 3N7WA 4IVKA 1SZVA 1G5UA 3QP4A 3MKFA 3QP1A 3A3FA 2DRWA 2J3TD 3PAEA 3H82B 3TOIA 4JGOA 2VA0A 4CLCA 4C3QA 2QKPA 1K56A 1PNEA 2QJ7A 2WGIA 3DWZA 4Q0HA 4KQQA 3BLSA 1NZUA 1BULA 3IWQA 3Q7VB 3K3CA 1J9MA 3EWKA 3PBRA 3UE1A 1UWPX 3V39A 2Y2KA 4EESA 4OOMA 3IHBA 3IX8A 4ARZB 4ZBEA 5MC7A 3E2KA 2PDRA 2ZQAA 1E4DA 3UDXA 4OP5A 2PYRA 4U0XA 1F5MA 4S2MA 4S2KA 2QPNA 3SH8A 3JVVA 3KSGA 4HP4A 2OAP1 2Z6CA 5HSQA 1RGZA 2FZ0A 1GCEA 3OPLA 4WZ5A 3VE4A 5CEBA 1MKIA 3LI9A 5CHUA 1YLZA 5KMWA 4HP9A 1TF1A 2WKIA 3GR2A 4HQAA 3N6IA 1K57C 4ZTKA 3CPTB 3BW6A 1FCMA 1BLCA 4DKIA 2WKEA 3AGEA 1NLZA 4R3BA 4UEYA 5F82A 3KSFA 5G18A 3E4QA 5IT5A 4KZ8A 3GECA 4B9OA 5LBRA 1PZPA 4HJ6A 3NIAA 4C75A 2BASA 5EM1A 1CEGA 1MZUA 5M19A 3A3DA 5FI2A 4GHIB 2HF6A 1XFQA 3A3JA 4K91A 5HAIA 2XD1A 1CEFA 3LIEA 3CLOA 2H28A 1U60A 2MJ6A 3MF0A 4PHTA 3WS5A 2PRFA 2VGJA 4P87A 5J3WA 1IKGA 5HD5A 3HLCA 1Z09A 4BD1A 2XSSA 3CI6A 4FCFA 2XH9A 1Q2PA 2ZQ7A 4DE2A 4WM9A 3KSIA 4GN2A 3KSHA 3D3OA 3U4LP 3R4KA 2V8CA 4H6JA 4YOFA 4HEFA 4S2NA 3PBSA 5DKKA 2EFXA 4BD0A 2QWSA 4P0MA 4QHCA 5EV0A 2RCXA 4LRZE 1XGIA 5GL9A 4RQ9A 4KQRA 2IA2A 3HVFA 5DTKA 5AQ7A 3R7WB 4MCWA 5G4ZA 2ZM0A 2HP6A 1O7EA 1ZC2A 4S2JA 4ID4A 2KLIA 4JBFA 3OZHA 2R9XA 3KYEA 3IWIA 3PR6A 4DF6A 2QHKA 4DXBA 3LCEA 1SKOB 2V20A 2VGLS 1ERQA 2JHEA 3IF6A 5FEFA 2B95A 2AVXA 3M2JA 5FQIA 3Q82A 1FIKA 2W3GA 1S1YA 1UWNX 3N4IA 3BECA 5E43A 5EECA 2XQZA 1W79A 5HW3A 3IS2A 3SZTA 1ZTUA 3FKWA 1K4FA 3SS4A 1DP8A 3O86A 2E8JA 3VP0A 4GZBA 3VP3A 3ZNYA 3GV9A 4OQ0A 2J9PA 1IYSA 4Y3IA 3NJAA 2JKTI 3A3IA 3MSHA 1GHIA 2JKRI 3S7QA 1NXYA 5C5KA 3RXWA 3VSKA 1S1ZA 5EM0A 1MWRA 3E2LA 4HH2A 1N9LA 1MPLA 4Y13A 3I7JA 3AGDA 2WGWB 4P6ZM 1P97A 3AGFA 4EUVA 3E4OA 4RX3A 4O8GA 2Y2IA 3IT9A 5DFYA 2WZXA 3GDIA 3P98A 5KSCA 2Y2HA 1H3QA 3K3DA 5FQKA 2ZMVA 1PWCA 5DJUA 3P09A 2D02A 3S7OA 2K7SA 1JVJA 3EEHA 1JWZA 3C4PA 1X0OA 3IBRA 3QP2A 1ESIA 2M7VA 4OVDA 1K6RA 3IWOA 1L3LA 2EWVA 4Z9QA 4WELA 4YFMA 4KQDA 5GHYA 2HJ9C 2WYXA 4OLDA 2JKGA 3G2ZA 4ZDXA 4B4ZA 3LR5A 2XROA 2JE5A 3TG9A 3LIBA 3T1RA 1T1BA 3ULFA 4GNUA 1PI5A 4LRYC 4I5SA 2HV1A 5F1FA 5M18A 4X6TA 4F3LB 1T19A 3C5AA 4OPZA 3SS3A 1V9YA 4MBHA 2BG1A 1XJ2A 1QMEA 3CG5A 2H10A 5E2GA 3NDEA 4WYYA 1L0EA 1NRFA 4NETA 4O7DA 4GD6A 2ZMFA 2O9BA 2XK1A 5CX7A 1K55A 3S7NA 2G2WA 4GDNA 4KZ3A 1WYCA 3V5MA 2H5SA 5HWWA 4WZ4A 2OWJA 4QPRA 3OPPA 5E2FA 4B4XA 3CZDA 1SDEA 2J8YA 4G3VA 4DDYA 2V1AA 4GS9A 4MN5A 1ZG4A 4HNBA 3C38A 5GHZA
chains in the Genus database with same CATH topology
3TE8A 3VE3A 3IBJA 2VGLM 2HJEA 3KO6A 2XA7S 1NWZA 3BWLA 2OOLA 4PKYA 2G7UA 1MKMA 3OLOA 5HD3A 3OOVA 2YKFA 4IUKA 4FOFA 2LB9A 3BQAA 1WA9A 5TBMA 2PR5A 3VOLA 2P04A 4CQHA 2VV8A 4LPZA 3E98A 4NKPA 5F69A 4BBUA 1W63M 2ZBBA 1LSXA 3F1PA 2J3TD 2YKHA 4K08A 1OPXA 3H82B 4GHIA 1P9RA 3H7WB 1W63Q 2VKSA 2Z6DA 3MFXA 1OJ5A 4JGOA 4PAUA 2PR6A 4EXOA 5F68A 2VX8A 4EERA 2VA0A 2W3DA 3UMDA 4CLCA 4R3AA 4WN5A 1T1AA 1G28A 2QKPA 4O0PA 4BMWA 4JGQA 2QJ7A 4Q0HA 5DJTA 3MJQA 3PXPA 1VB6A 2JKRM 3K3CA 2NUTC 5KIZA 3EWKA 3PBRA 4R70A 1UWPX 2XA7M 1GSVA 2PD8A 3NOPC 3HJIA 5IU1A 4EESA 2V1BA 4OOMA 1Y28A 4WLAA 3T50A 1YSPA 4XT2A 4ARZB 3CWFA 1OJGA 3OBFA 5EFWA 5MC7A 2PDRA 1KOUA 4G3WA 2GZAA 2W0NA 3NOUC 2PYRA 5HWVA 5HPIA 1DP6A 2L1MA 3T4OA 1F5MA 4JGPA 1LL8A 1N9NA 4M4XA 1BYWA 3LR4A 2O0YA 2J80A 3JVVA 4AFIA 3KSGA 4HP4A 3RFBA 2OAP1 4ZRRA 2Z6CA 5HSQA 4I38A 2W3FA 3F1OB 2FZ0A 3R7WA 3T4TA 3VE4A 3LI9A 2L0WA 5HDCA 3S7PA 4HP9A 2L4RA 1TF1A 4P6ZS 1OTDA 4HQAA 4PKYG 3BW6A 4GS9B 4KUOA 1XJ4A 1NLZA 3PBNA 4UEYA 5DKLA 3KSFA 3E4QA 3A0VA 5IT5A 1G6OA 3GECA 4B9OA 5LBRA 1LSVA 1GSXA 1ZHHB 4HJ6A 3UB8A 1MC0A 1NLYA 5TBMB 2BASA 4WEJA 4I3IA 3KYQA 3JVUA 3EGXC 3T4JA 3LYXA 2CMNA 4NXGA 1MZUA 2OWHA 2XRNA 3LR3A 3T4SA 4EEPA 3A0SA 4EEUA 3EOIA 5L8MA 3W2ZA 3EQVA 2M1CA 3F1PB 4MN6A 1TS6A 2KX6A 1OTBA 3BJNA 5DFXA 4GHIB 2HF6A 1XFQA 3B33A 3CAXA 3LIEA 2HGVA 3SW1A 3CLOA 3TJZC 3C2WA 4Y2FA 2ZOIA 2H28A 4WF0A 4CLCB 1V9ZA 3MQOA 3U2AA 4L9FA 2MJ6A 3MF0A 4PHTA 3E4PA 4I3AA 5J3WA 3ZQ5A 4KUKA 4L0LA 4GJ4A 3NHQA 3OCLA 5HD5A 1STZA 4HOIA 1H8MA 3K2NA 5F6AA 2XSSA 3CI6A 5F5YA 3EEAA 4CLCC 4LLOB 3OCNA 2V0UA 1DP9A 3KSIA 3KSHA 3D3OA 3R4KA 2INWA 1OT9A 1S4RA 4IHQA 4H6JA 3C8CA 4YOFA 4XT2B 2ZOHA 4Q0JA 3KX0X 3RTYA 2A2LA 5FL3A 3BQ8A 3PBSA 5DKKA 2W1RA 2D01A 3B42A 2WKPA 3PBTA 4DN0A 1LSWA 4IJGA 4II7A 1GSWA 2QWSA 4Z1WA 4DJ3A 4LRZE 1EW0A 2R78A 4RQ9A 3PHYA 3TRCA 4YWZA 1IOUA 2IA2A 3R7WB 4DJ2A 2O9CA 4MCWA 5G4ZA 4GCZA 4UQIS 1XFNA 2W1TA 4OOLA 3CITA 3LIAA 1TS7A 3LUQA 2KLIA 4EU0A 1P0ZA 4L9GA 3FPWA 2KDKA 3PR6A 4EQ1A 3F1NA 2QHKA 3MXQA 3FC7A 3HJKA 5J4EA 2PYPA 3EQUA 2EWWA 3LI8A 3TW8A 5J7EA 2K31A 4FSFA 2VGLS 2O9AA 4HJ3A 2P08A 1N9OA 4O01A 4WEKA 4WUJA 2JHEA 1D7EA 4I3JA 4F3LA 4Q0IA 2W3GA 1S1YA 1XJ3A 1TD5A 1UWNX 1T1CA 3UB9A 3IS2A 1F9IA 3CUEA 1ZTUA 2K2NA 3NOTC 3PBOA 1DP8A 2VV7A 4I39A 4Y5FA 4UQIM 4LRXC 4L9EA 2VJWA 2QYBA 4BWIA 1VHMA 3B47A 4HY8A 2W3EA 2I9VA 5I5LA 2A24A 4Y3IA 3NJAA 4CLCE 4HI4A 2JKTI 2O99A 2PD7A 2W27A 3LFVA 5AJGA 1XJ6A 3UMEA 1YKDA 2JKRI 3S7QA 5HDDA 3E0YA 1S67L 2GX5A 1TS8A 2PT7A 5C5KA 4B93A 1ODVA 3P7NA 4WL9A 1S1ZA 4HH2A 5HDSA 1N9LA 2B18A 2WKQA 4H6JB 3T4KA 2J3TC 4P6ZM 4ETZA 4ETXA 5TJJA 3HCYA 3T4LA 2OAQ1 1P97A 3UB6A 4BBTA 4BBVA 4EUVA 1OTAA 3E4OA 5HWTA 4O8GA 2P7JA 1OT6A 3DBAA 4ME4A 4R6LA 4BJPA 5DFYA 4MMNA 3GDIA 4MDZA 1H3QA 5A8BA 2KOIA 3K3DA 3KYZA 3V67A 2Y8HA 2VZWA 1F98A 2ZMVA 5DJUA 4HH3A 3P01A 5HL6A 2D02A 3S7OA 2K7SA 3EEHA 4G3KA 1X0OA 1LT0A 4CLCD 3IBRA 2W1TB 2M7VA 2W3HA 4IUHA 4GW9A 3MR0A 1S66L 2EWVA 5G4YA 1OTIA 2QJ5A 4WELA 4KQDA 2JKTM 3BY8A 3F1NB 5AVEA 3T4QA 2HJ9C 3A0RA 2WKRA 3H82A 3UE3A 3H7WA 2JN7A 1S4SA 4NXFA 3LR5A 3O5YA 2XROA 1NRJA 3LIBA 3G6OA 1T1BA 3MQ0A 3LIDA 2J3WA 3LR0A 2B02A 4R38A 3ULFA 3BY9A 2DMWA 4LRYC 4I5SA 3UB7A 3D72A 3PBQA 2HV1A 5KSHA 1T18A 4DMZA 1DRMA 1D06A 3FPVA 4E04A 4F3LB 2EA9A 1UGUA 1T19A 4MN7A 3VV4A 4GLQA 2NUPC 1V9YA 4HJ4A 4NXEA 2FH5A 2VV6A 1XJ2A 1YSQA 3IS2B 2GJ3A 5DF9A 3C30A 2PHYA 5K5BA 5IS1A 4YNRA 2VEAA 3UE6A 4ARZA 1OTEA 3FG8A 1JNUA 2A24B 4HHDA 5HPFA 5HZHA 3OC2A 3CUEC 2GNXA 2V0WA 2ZMFA 5AVFA 2O9BA 3ICYA 5CX7A 2LB5A 1YAXA 1P9WA 3S7NA 4NXBA 2Y79A 3MQQA 3LICA 3PYPA 3H9WA 5HWWA 3F1OA 4HIAA 3MMHA 2OWJA 4QPRA 2M7UA 3ZYTA 4JGRA 4EETB 2V9AA 1TS0A 3RH8B 2VLGA 4G3VA 3EGDC 4KQOA 2V1AA 4NEED 4GS9A 4MN5A 4HNBA 1IFQA 3C38A 3LIFA 4EW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VE3 A;  1NWZ A;  3BWL A;  2OOL A;  4PKY A;  3OLO A;  5HD3 A;  2YKF A;  1WA9 A;  5TBM A;  2PR5 A;  3VOL A;  2VV8 A;  4LPZ A;  5F69 A;  4BBU A;  2ZBB A;  1LSX A;  3F1P A;  2YKH A;  4K08 A;  3H82 B;  4GHI A;  3H7W B;  2Z6D A;  3MFX A;  1OJ5 A;  4JGO A;  2PR6 A;  4EXO A;  5F68 A;  4EER A;  3UMD A;  4R3A A;  4WN5 A;  1T1A A;  1G28 A;  2QKP A;  4JGQ A;  2QJ7 A;  5DJT A;  3MJQ A;  1VB6 A;  3K3C A;  5KIZ A;  3EWK A;  4R70 A;  1UWP X;  1GSV A;  2PD8 A;  3NOP C;  3HJI A;  5IU1 A;  4EES A;  2V1B A;  1Y28 A;  4WLA A;  3T50 A;  4XT2 A;  3CWF A;  1OJG A;  5EFW A;  2PDR A;  1KOU A;  2W0N A;  3NOU C;  2PYR A;  5HWV A;  1DP6 A;  2L1M A;  4JGP A;  1LL8 A;  1N9N A;  4M4X A;  1BYW A;  2J80 A;  4HP4 A;  2Z6C A;  5HSQ A;  4I38 A;  3F1O B;  3VE4 A;  3LI9 A;  2L0W A;  5HDC A;  4HP9 A;  2L4R A;  1OTD A;  4HQA A;  4PKY G;  4GS9 B;  4KUO A;  1XJ4 A;  5DKL A;  3E4Q A;  3A0V A;  3GEC A;  4B9O A;  1LSV A;  1GSX A;  4HJ6 A;  3UB8 A;  5TBM B;  2BAS A;  4I3I A;  3LYX A;  2CMN A;  4NXG A;  1MZU A;  2OWH A;  4EEP A;  3A0S A;  4EEU A;  2M1C A;  3F1P B;  4MN6 A;  1TS6 A;  2KX6 A;  1OTB A;  4GHI B;  1XFQ A;  3B33 A;  3CAX A;  3LIE A;  3SW1 A;  3CLO A;  3C2W A;  2ZOI A;  2H28 A;  4WF0 A;  1V9Z A;  3MQO A;  4L9F A;  3E4P A;  4I3A A;  5J3W A;  3ZQ5 A;  4KUK A;  3NHQ A;  5HD5 A;  4HOI A;  5F6A A;  5F5Y A;  4LLO B;  2V0U A;  1DP9 A;  2INW A;  1OT9 A;  1S4R A;  4H6J A;  3C8C A;  4XT2 B;  2ZOH A;  3RTY A;  3KX0 X;  5DKK A;  2D01 A;  2WKP A;  1LSW A;  1GSW A;  2QWS A;  4DJ3 A;  4LRZ E;  1EW0 A;  2R78 A;  4RQ9 A;  3PHY A;  4YWZ A;  4DJ2 A;  5G4Z A;  4GCZ A;  1XFN A;  3LIA A;  1TS7 A;  3LUQ A;  1P0Z A;  4L9G A;  2KDK A;  4EQ1 A;  3F1N A;  2QHK A;  3MXQ A;  3FC7 A;  3HJK A;  5J4E A;  2PYP A;  3LI8 A;  5J7E A;  4HJ3 A;  1N9O A;  4WUJ A;  2JHE A;  1D7E A;  4I3J A;  4F3L A;  1S1Y A;  1XJ3 A;  1UWN X;  1T1C A;  3UB9 A;  3IS2 A;  1F9I A;  3NOT C;  1DP8 A;  2VV7 A;  4I39 A;  4LRX C;  4L9E A;  4HY8 A;  2I9V A;  5I5L A;  2A24 A;  3NJA A;  4HI4 A;  2PD7 A;  2W27 A;  1XJ6 A;  3UME A;  5HDD A;  1S67 L;  1TS8 A;  1ODV A;  3P7N A;  4WL9 A;  1S1Z A;  4HH2 A;  5HDS A;  1N9L A;  2WKQ A;  4H6J B;  1P97 A;  3UB6 A;  4BBT A;  4BBV A;  1OTA A;  3E4O A;  5HWT A;  2P7J A;  1OT6 A;  4R6L A;  3GDI A;  5A8B A;  3K3D A;  1F98 A;  5DJU A;  4HH3 A;  2D02 A;  2K7S A;  3EEH A;  1X0O A;  1LT0 A;  3IBR A;  4GW9 A;  3MR0 A;  1S66 L;  5G4Y A;  1OTI A;  2QJ5 A;  4KQD A;  3BY8 A;  3F1N B;  5AVE A;  3A0R A;  2WKR A;  3H82 A;  3H7W A;  2JN7 A;  1S4S A;  4NXF A;  3LIB A;  3G6O A;  1T1B A;  3LID A;  2B02 A;  4R38 A;  3ULF A;  3BY9 A;  4LRY C;  4I5S A;  3UB7 A;  3D72 A;  2HV1 A;  1T18 A;  1DRM A;  1D06 A;  4E04 A;  4F3L B;  2EA9 A;  1UGU A;  1T19 A;  1V9Y A;  4HJ4 A;  4NXE A;  2VV6 A;  1XJ2 A;  3IS2 B;  2GJ3 A;  2PHY A;  5IS1 A;  2VEA A;  3UE6 A;  1OTE A;  3FG8 A;  1JNU A;  2A24 B;  4HHD A;  5HZH A;  5AVF A;  2V0W A;  3ICY A;  4NXB A;  3MQQ A;  3LIC A;  3PYP A;  3H9W A;  5HWW A;  3F1O A;  4HIA A;  2OWJ A;  4EET B;  4JGR A;  2V9A A;  1TS0 A;  3RH8 B;  2VLG A;  2V1A A;  4GS9 A;  4MN5 A;  4HNB A;  3LIF A;  4EW7 A; 
#chains in the Genus database with same CATH topology
 3VE3 A;  2X02 A;  3OOV A;  2LB9 A;  1WA9 A;  3N8R A;  4WMC D;  4WMC A;  4CPK A;  1W63 M;  3ZG8 B;  3GTC A;  5CHJ A;  5EE8 A;  2YKH A;  4K08 A;  1OPX A;  3MFX A;  1OJ5 A;  2PR6 A;  5F68 A;  2VX8 A;  1H0M A;  4R3A A;  1T1A A;  4O0P A;  4CJN A;  4BMW A;  4ZJ3 A;  1CI9 A;  3VMA A;  3MJQ A;  1Y54 A;  1VB6 A;  2EX6 A;  4MLL A;  4OPY A;  4E3I A;  4Y7P A;  3DWK A;  3Q7Z A;  5EOE A;  1XKZ A;  3HLD A;  3UB5 P;  2WUQ A;  2XA7 M;  1GSV A;  4E3K A;  1KDS A;  2PD8 A;  3SH7 A;  3HJI A;  3T50 A;  3MZF A;  1YLJ A;  2ZM8 A;  2Y2G A;  1K54 C;  1F2K A;  1W8Q A;  1J3W A;  4FUW A;  1KOU A;  4G3W A;  5CGS A;  2GZA A;  2W0N A;  3Q81 A;  4XUZ A;  5HAQ A;  2HDS A;  1LL5 A;  2A49 A;  3NOU C;  3VSL A;  5HWV A;  1DP6 A;  2L1M A;  3T4O A;  1LL8 A;  4OPR A;  4U0T A;  2HZ5 A;  5JYP A;  1N9N A;  2O0Y A;  3RFB A;  3BLM A;  3WWX A;  4IVI A;  4XXR A;  4XUX A;  2Q9M A;  1ACF A;  3G35 A;  4E3O A;  4OON A;  1MY8 A;  1K4E A;  5DVA A;  4P6Z S;  2L4R A;  5FSR A;  1PI4 A;  4PKY G;  1BTL A;  1GHP A;  1VEU A;  3PBN A;  5FQQ A;  3A0V A;  1FQG A;  5FQ9 A;  1G6O A;  4LV0 A;  1EWZ A;  5A93 A;  4IED A;  1NLY A;  3JPU A;  5TBM B;  4WEJ A;  4LCL A;  3EGX C;  4NXG A;  1BLP A;  4EEP A;  3A0S A;  4R0Q A;  4EEU A;  3EOI A;  2V1Z A;  2V8F A;  1TS6 A;  4MN6 A;  5DFX A;  4E6W A;  3CAX A;  1D1J A;  1KGF A;  3MS6 A;  2HP5 A;  4CLC B;  3U2A A;  1C3B A;  2PBY A;  3E4P A;  3G32 A;  4KUK A;  4E3M A;  1KE4 A;  4GJ4 A;  4DE0 A;  3GQZ A;  3G4P A;  1STZ A;  3HRE A;  4HOI A;  1H8M A;  3SS5 A;  1KGG A;  5F6A A;  2QMI A;  4N9K A;  4GOG A;  4D60 A;  5FDS A;  3Q07 A;  1I2S A;  5M1A A;  1EI5 A;  2ZOH A;  4Q0J A;  3RTY A;  1XX2 A;  1FR6 A;  5CER A;  2W1R A;  3WRZ A;  4II7 A;  1SHV A;  5GLC A;  1GSW A;  2HDR A;  2ZQ8 A;  5FI6 A;  4Z1W A;  2CC1 A;  1CK3 A;  4QWO A;  5FAP A;  3NY4 A;  4BL2 A;  3TRC A;  1PRQ A;  1CJF A;  1GHM A;  4E3J A;  1AWI A;  2W1T A;  4OOL A;  4N1H A;  5DTS A;  1SDN A;  1W8Y A;  1ESU A;  1FOF A;  3T12 B;  4EQ1 A;  3IHA A;  3F1N A;  5GLA A;  1ONH A;  5DF7 A;  3LI8 A;  1WE4 A;  3IH9 A;  4HJ3 A;  2P08 A;  1N9O A;  2JBF A;  4UAA A;  4WEK A;  1D7E A;  2EX9 A;  2JCH A;  4JF5 A;  4YIN A;  5U47 A;  1A0K A;  1XJ3 A;  1QMF A;  3MXS A;  2Y55 A;  3UB9 A;  3DW0 A;  4LCM A;  4OPQ A;  1O07 A;  1LI0 A;  3W4P A;  3ISG A;  4UQI M;  4LRX C;  3JYI A;  4L9E A;  2VJW A;  2QYB A;  4LV2 A;  1MXO A;  4N92 A;  4HY8 A;  5D3O A;  2PD7 A;  3DTK A;  2W27 A;  5HFO A;  1YKD A;  4KZ4 A;  3E0Y A;  1S67 L;  1TS8 A;  1ODV A;  1YMX A;  2P9V A;  3NBL A;  2B18 A;  2WKQ A;  4H6J B;  3T4K A;  4ETZ A;  4ETX A;  3T4L A;  3OPH A;  3BEB A;  1XXM A;  3NCK A;  1S0W A;  1OTA A;  2P7J A;  3C4O A;  3DBA A;  4ME4 A;  3BRM A;  4R6L A;  5A8B A;  2KOI A;  2Y8H A;  2VZW A;  3P01 A;  2PAV P;  1K25 A;  2XF3 A;  3MR0 A;  1IEL A;  3B3X A;  3SH9 A;  2QJ5 A;  2ZMA A;  1HD8 A;  1ES3 A;  4JF6 A;  3LY3 A;  2JKT M;  3M6B A;  4DXC A;  3Q1F A;  5AVE A;  3A0R A;  3MZE A;  1ALQ A;  3H7W A;  4UA7 A;  4B88 A;  3ZVT A;  3G6O A;  3IX4 A;  2J3W A;  2J7V A;  4Y17 A;  3BY9 A;  3HLE A;  3IF6 B;  2ZC4 B;  1D06 A;  1UGU A;  2IWC A;  4R4R A;  2ZL1 A;  1KVM A;  2OSU A;  4NXE A;  4DE1 A;  3IF5 A;  4ZAM A;  3WS4 A;  2FH5 A;  2VV6 A;  5DTT A;  3FYZ A;  3IS2 B;  4R1G A;  5DF9 A;  2PHY A;  2ZC6 B;  2ZC7 A;  3IXG A;  3NDG A;  3DTI A;  3UE6 A;  3ZHH A;  1JTG A;  4HHD A;  5HPF A;  3OC2 A;  3CUE C;  1HTZ A;  3CHW P;  3ICY A;  2LB5 A;  1FSW A;  2PU4 A;  5TGF A;  1K57 A;  3LIC A;  5A91 A;  3H9W A;  3F1O A;  4HIA A;  3MMH A;  3OPR A;  1SKO A;  4OH0 A;  5FEG A;  2V9A A;  2XDM A;  3ZNT A;  4Y15 A;  4KQO A;  4NEE D;  4JXV A;  4GD8 A;  4EW7 A;  3TE8 A;  1XGJ A;  3NC8 A;  1LI9 A;  2PU2 A;  4RX2 A;  1NWZ A;  5HD3 A;  4IUK A;  3HLF A;  3BFD A;  4OLG A;  3BFF A;  2PR5 A;  4X25 A;  4CQH A;  2VV8 A;  4LPZ A;  4NKP A;  5F69 A;  1N9B A;  4FD8 A;  1LSX A;  4Q8I A;  3F1P A;  2HP9 A;  4QB8 A;  3BFG A;  3W4Q A;  2VKS A;  2VGK A;  4PAU A;  1KE3 A;  4EER A;  2W3D A;  4LV3 A;  1G28 A;  2X01 A;  3L9K A;  4PM6 A;  5DJT A;  1PWG A;  3PXP A;  5HAR A;  3MBZ A;  1L0F A;  4PM5 A;  3IXD A;  3IQA A;  2Z2L B;  2NUT C;  5F83 A;  4A5R A;  5KIZ A;  4ZJ2 A;  2OLU A;  2BTF P;  5HX9 A;  2Y2L A;  3NOP C;  3LGO A;  1YSP A;  4XT2 A;  3CWF A;  1OJG A;  5AQB A;  5HPI A;  1YM1 A;  1DJA A;  1WYB A;  5GLD A;  3D9Y A;  3LR4 A;  4AFI A;  2J80 A;  3QP8 A;  4R4S A;  3LEQ A;  5E2E A;  5CHM A;  2C5W B;  3WS0 A;  4S2L A;  2EX2 A;  2H0T A;  3QP5 A;  3HL9 A;  4GS9 B;  1ES4 A;  1PZO A;  4EQI A;  1XJ4 A;  1PYY A;  2RL3 A;  3DAV A;  1ZG6 A;  1E3U D;  3BFC A;  1G6A A;  3GVB A;  2OV5 A;  1E3U A;  1GSX A;  1ZHH B;  1MC0 A;  4OQI A;  3KYQ A;  3JVU A;  2OWH A;  2Z2M B;  3LR3 A;  3T1X A;  2M1C A;  3T1S A;  4UHU A;  4PM7 A;  1OTB A;  2XFS A;  4EBN A;  1L0D A;  4N1X A;  3SW1 A;  4KEN B;  4Y2F A;  2ZOI A;  4U3T A;  3IXH A;  2Y91 A;  1V9Z A;  3IX3 A;  5A92 A;  1Q2Q A;  4L9F A;  4UA6 A;  4OQG A;  1VQQ A;  4KZA A;  3ZQ5 A;  3QNB A;  4KZ6 A;  4L0L A;  1FSY A;  1HLU P;  3OCL A;  1XA1 A;  3V3S A;  1BLH A;  1GA0 A;  3K2N A;  4CLC C;  5F5Y A;  2G2U A;  3TSG A;  1OME A;  4LEN A;  1YLT A;  3C7U A;  1MBL A;  1S4R A;  4NK3 A;  2EXB A;  3CMZ A;  5FL3 A;  1M40 A;  3BQ8 A;  2XD5 A;  2D01 A;  5FQJ A;  2QZ6 A;  2VK3 A;  2UWX A;  3PBT A;  1LSW A;  4IJG A;  3LEZ A;  4DJ3 A;  3UE0 A;  1S6R A;  1PIO A;  5FI7 A;  1EW0 A;  3PHY A;  5CED A;  3UPN A;  1IOU A;  3GSG A;  5CTM A;  4GDB A;  2O9C A;  2Y59 A;  4GCZ A;  2ZLY A;  3VP2 A;  3LIA A;  4ESP A;  1TS7 A;  3LUQ A;  3FKV A;  4EU0 A;  1GA9 A;  1P0Z A;  3W8K A;  5EVL A;  3ZVW A;  4L9G A;  3FPW A;  4MBK A;  1VEU B;  3ZG7 B;  5EVI B;  3MXQ A;  4X53 A;  3FC7 A;  4WZ5 C;  3LO7 A;  2PYP A;  5TR7 A;  2Y2P A;  2K31 A;  3O87 A;  1ONG A;  1K0K A;  4O01 A;  4WUJ A;  2IWB A;  1CQA A;  1CI8 A;  5IHV A;  2Y4A A;  1VET A;  2B5R A;  2WAF A;  4JPM A;  4BLM A;  3G31 A;  4NG2 A;  4FH4 A;  2EX8 A;  2WK0 A;  2ZD8 A;  2ZJ9 A;  1TD5 A;  3VP1 A;  1FR1 A;  1F9I A;  4QJG A;  2K2N A;  3NOT C;  4N9L A;  2VV7 A;  4Y5F A;  1AXB A;  1NY0 A;  3MXR A;  4BWI A;  4MEZ A;  1NYM A;  3M2K A;  3B47 A;  3UDF A;  5BOH A;  5I5L A;  2A24 A;  1PFL A;  4LV1 A;  4HI4 A;  2O99 A;  3LFV A;  5TFQ A;  1K38 A;  5AJG A;  1XJ6 A;  3UME A;  4OKP A;  2GX5 A;  1KGE A;  4B93 A;  4R23 A;  1YLP A;  1KVL A;  1FCN A;  5HDS A;  5AQA A;  4M3K A;  3DTM A;  4KZ5 A;  4DRT A;  5TJJ A;  3HCY A;  2OAQ 1;  1HVB A;  2PBD P;  3UB6 A;  4BBV A;  5HWT A;  1OT6 A;  1JWP A;  4BJP A;  1RCJ A;  4JXS A;  4KG5 A;  1MWT A;  4MDZ A;  3UNW A;  4QD4 A;  3KYZ A;  3V67 A;  4S2N C;  4LFU A;  1CF0 A;  2WAD A;  5HL6 A;  2FFF B;  3UO9 A;  3BM6 A;  1LT0 A;  3LY4 A;  4JLF A;  4CLC D;  2W1T B;  1NYY A;  2W3H A;  4IUH A;  1K56 D;  2UV0 E;  4GW9 A;  4FTX A;  3RJU A;  4S2P A;  5G4Y A;  2EFU A;  3DTE A;  3BY8 A;  4X68 A;  3F1N B;  2H0Y A;  2EXA A;  3H82 A;  5FAQ A;  3UE3 A;  1S4S A;  3NEC A;  1I5Q A;  3MQ0 A;  3LR0 A;  2ZQ9 A;  1DY6 A;  3HLG A;  2Y2J A;  5J8X A;  2JC7 A;  5L2F A;  4E04 A;  3Q7V A;  4MN7 A;  3VV4 A;  4GLQ A;  1H5X A;  1K54 A;  5L09 A;  3IF6 C;  2FFY A;  2WGV A;  1H8Y A;  5K5B A;  5GLB A;  5IS1 A;  2WZZ A;  3PAG A;  4YNR A;  1LLB A;  2VEA A;  2GDN A;  4ARZ A;  2XEP A;  3WRT A;  3FG8 A;  5HZH A;  5AVF A;  1RGY A;  3GMW A;  4BEN A;  1P9W A;  3L7H A;  2Y79 A;  1YPR A;  2P9V B;  3PYP A;  2Y2M A;  4PMA A;  3SOI A;  3PTE A;  2M7U A;  3ZYT A;  4JGR A;  4S2I A;  5L10 A;  3HBR A;  4FH2 A;  2VLG A;  3EGD C;  3CPT A;  1YQS A;  1PWD A;  2XLN A;  4OOY A;  1IFQ A;  2EWW A;  3LIF A;  3ZGA B;  1ERO A;  3IBJ A;  2HJE A;  3NUL A;  2XA7 S;  3BWL A;  4PKY A;  5KZH A;  4FOF A;  4X69 A;  1ES2 A;  3VOL A;  2P04 A;  2Q9N A;  2ZM2 A;  4BBU A;  5L07 A;  2ZBB A;  4HES A;  3ITB A;  3UY6 A;  4GHI A;  1P9R A;  3H7W B;  1W63 Q;  2Z6D A;  3FZC A;  3O88 A;  3HUM A;  4EXO A;  2WKH A;  3MZD A;  3UMD A;  4WN5 A;  4GKU A;  3V3R A;  4JGQ A;  1IEM A;  1BLS A;  2E8I A;  3ZDJ A;  5CGW A;  2JKR M;  3T1Q B;  3QP6 A;  5FDH A;  2ZL1 B;  1MWU A;  5FAT A;  1PW8 A;  4R70 A;  3WS2 A;  3ITA A;  4JXG A;  2XFT A;  2R9W A;  5IU1 A;  1DJB A;  2ZQD A;  2V1B A;  1Y28 A;  4WLA A;  4E6X A;  4D2O A;  5EFW A;  3OBF A;  3GRJ A;  2Q0O A;  4P85 A;  3ZG0 A;  1KDW A;  3VOZ A;  5EOO A;  4JGP A;  1KE0 A;  2Y2O A;  4M4X A;  1BYW A;  1FCO A;  1IYP A;  3W4O A;  2JKF A;  4ZRR A;  1W7F A;  4I38 A;  2W3F A;  1ES5 A;  3F1O B;  2HDU A;  3R7W A;  4QU3 A;  5JYO A;  2C6W B;  3ZFZ A;  2WAE A;  3T4T A;  4X55 A;  4KZ7 A;  1G68 A;  2BLS A;  5EPH A;  3UN7 A;  2DNS A;  2L0W A;  5HDC A;  1K55 C;  3S7P A;  3ZG5 A;  1OTD A;  3N8S A;  4PM9 A;  4KUO A;  3BYD A;  5AQ9 A;  5F1G A;  5CGX A;  5DKL A;  2IWD A;  1Z6F A;  4P6B A;  1LSV A;  3UB8 A;  4RA7 A;  1TDG A;  2V2F F;  4I3I A;  3T4J A;  3LYX A;  2CMN A;  2XRN A;  1I2W A;  1M6K A;  4KG6 A;  3T4S A;  4S2O A;  5L8M A;  3W2Z A;  3EQV A;  1FIL A;  3F1P B;  2X71 A;  2KX6 A;  4E3N A;  1ERM A;  3BJN A;  3B33 A;  3G34 A;  1SKF A;  5I94 A;  2HGV A;  3TJZ C;  3C2W A;  1TEM A;  4EV4 A;  4WF0 A;  1LL9 A;  3MQO A;  4EWF A;  4MNR A;  5HL1 A;  4I3A A;  4X1L A;  3V50 A;  3O3V A;  3NHQ A;  2J9O A;  1W5D A;  3FV7 A;  1IYO A;  3EEA A;  3VP4 A;  4H8R A;  4LLO B;  3OCN A;  4WBG A;  2V0U A;  1DP9 A;  1NJ4 A;  5FQM A;  3C7V A;  2INW A;  1SCW A;  1OT9 A;  4IHQ A;  2HPB A;  1IYQ A;  3C8C A;  2WGW A;  3NI9 A;  4XT2 B;  3D4F A;  2ZQC A;  3KX0 X;  2A2L A;  1XPB A;  3HLW A;  3B42 A;  3MFD A;  3CJM A;  4IBX A;  2WKP A;  4DN0 A;  1BSG A;  5A90 A;  1JTD A;  4E3L A;  4BQM A;  2R78 A;  4KZB A;  4YWZ A;  1XP4 A;  3UPO A;  4DJ2 A;  4Y0U A;  4JKT A;  4UQI S;  1XFN A;  3CIT A;  4X56 A;  3UDI A;  2KDK A;  3VOY A;  3ZCZ A;  4OQH A;  2P74 A;  3HJK A;  1VM1 A;  5J4E A;  3HLB A;  3EQU A;  1YLW A;  5FAS A;  3TW8 A;  5FAO A;  5J7E A;  3BFE A;  4FSF A;  4KZ9 A;  3N8L A;  2O9A A;  4I3J A;  4KG2 A;  4EUZ A;  5EVI C;  3VFH A;  3S4X A;  4ZJ1 A;  4K0W A;  3WS1 A;  4F3L A;  2ACG A;  4Q0I A;  4OP8 A;  1T1C A;  3CUE A;  3PBO A;  5CRF A;  4I39 A;  3IH8 A;  1YMS A;  2ZC3 B;  3QHY A;  4F94 A;  2XR0 A;  1VHM A;  4C6Y A;  2W3E A;  2I9V A;  4EBP A;  1BUE A;  5EUA A;  4CLC E;  1K6S A;  1XA7 A;  4QY6 A;  5HDD A;  4HBU A;  2PT7 A;  3P7N A;  4GB7 A;  4WL9 A;  2OLV A;  1NZO A;  4Y0T A;  2J3T C;  3M6H A;  4EBL A;  4PM8 A;  1IKI A;  1JWV A;  3G2Y A;  4BBT A;  3HUO A;  2ZC5 B;  1LHY A;  4JXW A;  5CEC A;  4MMN A;  1TVF A;  3VFF A;  1YT4 A;  4RVA A;  1F98 A;  1HZO A;  1PW1 A;  1BZA A;  4HH3 A;  2A3U A;  4G3K A;  5FA7 A;  1RP5 A;  1S66 L;  1OTI A;  2Y2Q A;  3T4Q A;  2WKR A;  2JN7 A;  4NXF A;  1BT5 A;  3O5Y A;  4IBR A;  1NRJ A;  3LID A;  2B02 A;  4R38 A;  2DMW A;  2HDQ A;  3UB7 A;  3D72 A;  3PBQ A;  1ZKJ A;  4HBT A;  5KSH A;  1T18 A;  4R3J A;  4DMZ A;  2Y2N A;  1DRM A;  4X1M A;  1VET B;  3FPV A;  1E25 A;  2EA9 A;  1L2S A;  5GHX A;  3FWL A;  2NUP C;  4HJ4 A;  5E2H A;  3S22 A;  1YSQ A;  2I72 A;  2GJ3 A;  3C30 A;  5CTN A;  1TDL A;  3IXB A;  1OTE A;  1JNU A;  2A24 B;  4DDS A;  3UPP A;  4QY5 A;  2GNX A;  2V0W A;  1N4O A;  4PPR A;  3HUN A;  1YAX A;  4DE3 A;  4K0X A;  4NXB A;  5EVI D;  3MQQ A;  5EVI A;  1MWS A;  4Y0O A;  4RYE A;  3MKE A;  3QNC A;  1Y4O A;  3RXX A;  3A3E A;  4JF4 A;  4EET B;  1TS0 A;  4UA9 A;  3G30 A;  3RH8 B;  5DF8 A;  1YLY A;  5CXW A;  4BL3 A;  2VGL M;  3ZG9 B;  3KO6 A;  3S1Y A;  2DCF A;  2OOL A;  1DJC A;  2G7U A;  1MKM A;  3OLO A;  1H8Z A;  2YKF A;  2XGN A;  3BQA A;  1L0G A;  5TBM A;  5EVE A;  4MBF A;  4LGW A;  3E98 A;  5HAP A;  3N7W A;  4IVK A;  1SZV A;  1G5U A;  3QP4 A;  3MKF A;  3QP1 A;  3A3F A;  2DRW A;  2J3T D;  3PAE A;  3H82 B;  3TOI A;  4JGO A;  2VA0 A;  4CLC A;  4C3Q A;  2QKP A;  1K56 A;  1PNE A;  2QJ7 A;  2WGI A;  3DWZ A;  4Q0H A;  4KQQ A;  3BLS A;  1NZU A;  1BUL A;  3IWQ A;  3Q7V B;  3K3C A;  1J9M A;  3EWK A;  3PBR A;  3UE1 A;  1UWP X;  3V39 A;  2Y2K A;  4EES A;  4OOM A;  3IHB A;  3IX8 A;  4ARZ B;  4ZBE A;  5MC7 A;  3E2K A;  2PDR A;  2ZQA A;  1E4D A;  3UDX A;  4OP5 A;  2PYR A;  4U0X A;  1F5M A;  4S2M A;  4S2K A;  2QPN A;  3SH8 A;  3JVV A;  3KSG A;  4HP4 A;  2OAP 1;  2Z6C A;  5HSQ A;  1RGZ A;  2FZ0 A;  1GCE A;  3OPL A;  4WZ5 A;  3VE4 A;  5CEB A;  1MKI A;  3LI9 A;  5CHU A;  1YLZ A;  5KMW A;  4HP9 A;  1TF1 A;  2WKI A;  3GR2 A;  4HQA A;  3N6I A;  1K57 C;  4ZTK A;  3CPT B;  3BW6 A;  1FCM A;  1BLC A;  4DKI A;  2WKE A;  3AGE A;  1NLZ A;  4R3B A;  4UEY A;  5F82 A;  3KSF A;  5G18 A;  3E4Q A;  5IT5 A;  4KZ8 A;  3GEC A;  4B9O A;  5LBR A;  1PZP A;  4HJ6 A;  3NIA A;  4C75 A;  2BAS A;  5EM1 A;  1CEG A;  1MZU A;  5M19 A;  3A3D A;  5FI2 A;  4GHI B;  2HF6 A;  1XFQ A;  3A3J A;  4K91 A;  5HAI A;  2XD1 A;  1CEF A;  3LIE A;  3CLO A;  2H28 A;  1U60 A;  2MJ6 A;  3MF0 A;  4PHT A;  3WS5 A;  2PRF A;  2VGJ A;  4P87 A;  5J3W A;  1IKG A;  5HD5 A;  3HLC A;  1Z09 A;  4BD1 A;  2XSS A;  3CI6 A;  4FCF A;  2XH9 A;  1Q2P A;  2ZQ7 A;  4DE2 A;  4WM9 A;  3KSI A;  4GN2 A;  3KSH A;  3D3O A;  3U4L P;  3R4K A;  2V8C A;  4H6J A;  4YOF A;  4HEF A;  4S2N A;  3PBS A;  5DKK A;  2EFX A;  4BD0 A;  2QWS A;  4P0M A;  4QHC A;  5EV0 A;  2RCX A;  4LRZ E;  1XGI A;  5GL9 A;  4RQ9 A;  4KQR A;  2IA2 A;  3HVF A;  5DTK A;  5AQ7 A;  3R7W B;  4MCW A;  5G4Z A;  2ZM0 A;  2HP6 A;  1O7E A;  1ZC2 A;  4S2J A;  4ID4 A;  2KLI A;  4JBF A;  3OZH A;  2R9X A;  3KYE A;  3IWI A;  3PR6 A;  4DF6 A;  2QHK A;  4DXB A;  3LCE A;  1SKO B;  2V20 A;  2VGL S;  1ERQ A;  2JHE A;  3IF6 A;  5FEF A;  2B95 A;  2AVX A;  3M2J A;  5FQI A;  3Q82 A;  1FIK A;  2W3G A;  1S1Y A;  1UWN X;  3N4I A;  3BEC A;  5E43 A;  5EEC A;  2XQZ A;  1W79 A;  5HW3 A;  3IS2 A;  3SZT A;  1ZTU A;  3FKW A;  1K4F A;  3SS4 A;  1DP8 A;  3O86 A;  2E8J A;  3VP0 A;  4GZB A;  3VP3 A;  3ZNY A;  3GV9 A;  4OQ0 A;  2J9P A;  1IYS A;  4Y3I A;  3NJA A;  2JKT I;  3A3I A;  3MSH A;  1GHI A;  2JKR I;  3S7Q A;  1NXY A;  5C5K A;  3RXW A;  3VSK A;  1S1Z A;  5EM0 A;  1MWR A;  3E2L A;  4HH2 A;  1N9L A;  1MPL A;  4Y13 A;  3I7J A;  3AGD A;  2WGW B;  4P6Z M;  1P97 A;  3AGF A;  4EUV A;  3E4O A;  4RX3 A;  4O8G A;  2Y2I A;  3IT9 A;  5DFY A;  2WZX A;  3GDI A;  3P98 A;  5KSC A;  2Y2H A;  1H3Q A;  3K3D A;  5FQK A;  2ZMV A;  1PWC A;  5DJU A;  3P09 A;  2D02 A;  3S7O A;  2K7S A;  1JVJ A;  3EEH A;  1JWZ A;  3C4P A;  1X0O A;  3IBR A;  3QP2 A;  1ESI A;  2M7V A;  4OVD A;  1K6R A;  3IWO A;  1L3L A;  2EWV A;  4Z9Q A;  4WEL A;  4YFM A;  4KQD A;  5GHY A;  2HJ9 C;  2WYX A;  4OLD A;  2JKG A;  3G2Z A;  4ZDX A;  4B4Z A;  3LR5 A;  2XRO A;  2JE5 A;  3TG9 A;  3LIB A;  3T1R A;  1T1B A;  3ULF A;  4GNU A;  1PI5 A;  4LRY C;  4I5S A;  2HV1 A;  5F1F A;  5M18 A;  4X6T A;  4F3L B;  1T19 A;  3C5A A;  4OPZ A;  3SS3 A;  1V9Y A;  4MBH A;  2BG1 A;  1XJ2 A;  1QME A;  3CG5 A;  2H10 A;  5E2G A;  3NDE A;  4WYY A;  1L0E A;  1NRF A;  4NET A;  4O7D A;  4GD6 A;  2ZMF A;  2O9B A;  2XK1 A;  5CX7 A;  1K55 A;  3S7N A;  2G2W A;  4GDN A;  4KZ3 A;  1WYC A;  3V5M A;  2H5S A;  5HWW A;  4WZ4 A;  2OWJ A;  4QPR A;  3OPP A;  5E2F A;  4B4X A;  3CZD A;  1SDE A;  2J8Y A;  4G3V A;  4DDY A;  2V1A A;  4GS9 A;  4MN5 A;  1ZG4 A;  4HNB A;  3C38 A;  5GHZ A; 
#chains in the Genus database with same CATH homology
 3TE8 A;  3VE3 A;  3IBJ A;  2VGL M;  2HJE A;  3KO6 A;  2XA7 S;  1NWZ A;  3BWL A;  2OOL A;  4PKY A;  2G7U A;  1MKM A;  3OLO A;  5HD3 A;  3OOV A;  2YKF A;  4IUK A;  4FOF A;  2LB9 A;  3BQA A;  1WA9 A;  5TBM A;  2PR5 A;  3VOL A;  2P04 A;  4CQH A;  2VV8 A;  4LPZ A;  3E98 A;  4NKP A;  5F69 A;  4BBU A;  1W63 M;  2ZBB A;  1LSX A;  3F1P A;  2J3T D;  2YKH A;  4K08 A;  1OPX A;  3H82 B;  4GHI A;  1P9R A;  3H7W B;  1W63 Q;  2VKS A;  2Z6D A;  3MFX A;  1OJ5 A;  4JGO A;  4PAU A;  2PR6 A;  4EXO A;  5F68 A;  2VX8 A;  4EER A;  2VA0 A;  2W3D A;  3UMD A;  4CLC A;  4R3A A;  4WN5 A;  1T1A A;  1G28 A;  2QKP A;  4O0P A;  4BMW A;  4JGQ A;  2QJ7 A;  4Q0H A;  5DJT A;  3MJQ A;  3PXP A;  1VB6 A;  2JKR M;  3K3C A;  2NUT C;  5KIZ A;  3EWK A;  3PBR A;  4R70 A;  1UWP X;  2XA7 M;  1GSV A;  2PD8 A;  3NOP C;  3HJI A;  5IU1 A;  4EES A;  2V1B A;  4OOM A;  1Y28 A;  4WLA A;  3T50 A;  1YSP A;  4XT2 A;  4ARZ B;  3CWF A;  1OJG A;  3OBF A;  5EFW A;  5MC7 A;  2PDR A;  1KOU A;  4G3W A;  2GZA A;  2W0N A;  3NOU C;  2PYR A;  5HWV A;  5HPI A;  1DP6 A;  2L1M A;  3T4O A;  1F5M A;  4JGP A;  1LL8 A;  1N9N A;  4M4X A;  1BYW A;  3LR4 A;  2O0Y A;  2J80 A;  3JVV A;  4AFI A;  3KSG A;  4HP4 A;  3RFB A;  2OAP 1;  4ZRR A;  2Z6C A;  5HSQ A;  4I38 A;  2W3F A;  3F1O B;  2FZ0 A;  3R7W A;  3T4T A;  3VE4 A;  3LI9 A;  2L0W A;  5HDC A;  3S7P A;  4HP9 A;  2L4R A;  1TF1 A;  4P6Z S;  1OTD A;  4HQA A;  4PKY G;  3BW6 A;  4GS9 B;  4KUO A;  1XJ4 A;  1NLZ A;  3PBN A;  4UEY A;  5DKL A;  3KSF A;  3E4Q A;  3A0V A;  5IT5 A;  1G6O A;  3GEC A;  4B9O A;  5LBR A;  1LSV A;  1GSX A;  1ZHH B;  4HJ6 A;  3UB8 A;  1MC0 A;  1NLY A;  5TBM B;  2BAS A;  4WEJ A;  4I3I A;  3KYQ A;  3JVU A;  3EGX C;  3T4J A;  3LYX A;  2CMN A;  4NXG A;  1MZU A;  2OWH A;  2XRN A;  3LR3 A;  3T4S A;  4EEP A;  3A0S A;  4EEU A;  3EOI A;  5L8M A;  3W2Z A;  3EQV A;  2M1C A;  3F1P B;  4MN6 A;  1TS6 A;  2KX6 A;  1OTB A;  3BJN A;  5DFX A;  4GHI B;  2HF6 A;  1XFQ A;  3B33 A;  3CAX A;  3LIE A;  2HGV A;  3SW1 A;  3CLO A;  3TJZ C;  3C2W A;  4Y2F A;  2ZOI A;  2H28 A;  4WF0 A;  4CLC B;  1V9Z A;  3MQO A;  3U2A A;  4L9F A;  2MJ6 A;  3MF0 A;  4PHT A;  3E4P A;  4I3A A;  5J3W A;  3ZQ5 A;  4KUK A;  4L0L A;  4GJ4 A;  3NHQ A;  3OCL A;  5HD5 A;  1STZ A;  4HOI A;  1H8M A;  3K2N A;  5F6A A;  2XSS A;  3CI6 A;  5F5Y A;  3EEA A;  4CLC C;  4LLO B;  3OCN A;  2V0U A;  1DP9 A;  3KSI A;  3KSH A;  3D3O A;  3R4K A;  2INW A;  1OT9 A;  1S4R A;  4IHQ A;  4H6J A;  3C8C A;  4YOF A;  4XT2 B;  2ZOH A;  4Q0J A;  3KX0 X;  3RTY A;  2A2L A;  5FL3 A;  3BQ8 A;  3PBS A;  5DKK A;  2W1R A;  2D01 A;  3B42 A;  2WKP A;  3PBT A;  4DN0 A;  1LSW A;  4IJG A;  4II7 A;  1GSW A;  2QWS A;  4Z1W A;  4DJ3 A;  4LRZ E;  1EW0 A;  2R78 A;  4RQ9 A;  3PHY A;  3TRC A;  4YWZ A;  1IOU A;  2IA2 A;  3R7W B;  4DJ2 A;  2O9C A;  4MCW A;  5G4Z A;  4GCZ A;  4UQI S;  1XFN A;  2W1T A;  4OOL A;  3CIT A;  3LIA A;  1TS7 A;  3LUQ A;  2KLI A;  4EU0 A;  1P0Z A;  4L9G A;  3FPW A;  2KDK A;  3PR6 A;  4EQ1 A;  3F1N A;  2QHK A;  3MXQ A;  3FC7 A;  3HJK A;  5J4E A;  2PYP A;  3EQU A;  2EWW A;  3LI8 A;  3TW8 A;  5J7E A;  2K31 A;  4FSF A;  2VGL S;  2O9A A;  4HJ3 A;  2P08 A;  1N9O A;  4O01 A;  4WEK A;  4WUJ A;  2JHE A;  1D7E A;  4I3J A;  4F3L A;  4Q0I A;  2W3G A;  1S1Y A;  1XJ3 A;  1TD5 A;  1UWN X;  1T1C A;  3UB9 A;  3IS2 A;  1F9I A;  3CUE A;  1ZTU A;  2K2N A;  3NOT C;  3PBO A;  1DP8 A;  2VV7 A;  4I39 A;  4Y5F A;  4UQI M;  4LRX C;  4L9E A;  2VJW A;  2QYB A;  4BWI A;  1VHM A;  3B47 A;  4HY8 A;  2W3E A;  2I9V A;  5I5L A;  2A24 A;  4Y3I A;  3NJA A;  4CLC E;  4HI4 A;  2JKT I;  2O99 A;  2PD7 A;  2W27 A;  3LFV A;  5AJG A;  1XJ6 A;  3UME A;  1YKD A;  2JKR I;  3S7Q A;  5HDD A;  3E0Y A;  1S67 L;  2GX5 A;  1TS8 A;  2PT7 A;  5C5K A;  4B93 A;  1ODV A;  3P7N A;  4WL9 A;  1S1Z A;  4HH2 A;  5HDS A;  1N9L A;  2B18 A;  2WKQ A;  4H6J B;  3T4K A;  2J3T C;  4P6Z M;  4ETZ A;  4ETX A;  5TJJ A;  3HCY A;  3T4L A;  2OAQ 1;  1P97 A;  3UB6 A;  4BBT A;  4BBV A;  4EUV A;  1OTA A;  3E4O A;  5HWT A;  4O8G A;  2P7J A;  1OT6 A;  3DBA A;  4ME4 A;  4R6L A;  4BJP A;  5DFY A;  4MMN A;  3GDI A;  4MDZ A;  1H3Q A;  5A8B A;  2KOI A;  3K3D A;  3KYZ A;  3V67 A;  2Y8H A;  2VZW A;  1F98 A;  2ZMV A;  5DJU A;  4HH3 A;  3P01 A;  5HL6 A;  2D02 A;  3S7O A;  2K7S A;  3EEH A;  4G3K A;  1X0O A;  1LT0 A;  4CLC D;  3IBR A;  2W1T B;  2M7V A;  2W3H A;  4IUH A;  4GW9 A;  3MR0 A;  1S66 L;  2EWV A;  5G4Y A;  1OTI A;  2QJ5 A;  4WEL A;  4KQD A;  2JKT M;  3BY8 A;  3F1N B;  5AVE A;  3T4Q A;  2HJ9 C;  3A0R A;  2WKR A;  3H82 A;  3UE3 A;  3H7W A;  2JN7 A;  1S4S A;  4NXF A;  3LR5 A;  3O5Y A;  2XRO A;  1NRJ A;  3LIB A;  3G6O A;  1T1B A;  3MQ0 A;  3LID A;  2J3W A;  3LR0 A;  2B02 A;  4R38 A;  3ULF A;  3BY9 A;  2DMW A;  4LRY C;  4I5S A;  3UB7 A;  3D72 A;  3PBQ A;  2HV1 A;  5KSH A;  1T18 A;  4DMZ A;  1DRM A;  1D06 A;  3FPV A;  4E04 A;  4F3L B;  2EA9 A;  1UGU A;  1T19 A;  4MN7 A;  3VV4 A;  4GLQ A;  2NUP C;  1V9Y A;  4HJ4 A;  4NXE A;  2FH5 A;  2VV6 A;  1XJ2 A;  1YSQ A;  3IS2 B;  2GJ3 A;  5DF9 A;  3C30 A;  2PHY A;  5K5B A;  5IS1 A;  4YNR A;  2VEA A;  3UE6 A;  4ARZ A;  1OTE A;  3FG8 A;  1JNU A;  2A24 B;  4HHD A;  5HPF A;  5HZH A;  3OC2 A;  3CUE C;  2GNX A;  2V0W A;  2ZMF A;  5AVF A;  2O9B A;  3ICY A;  5CX7 A;  2LB5 A;  1YAX A;  1P9W A;  3S7N A;  4NXB A;  2Y79 A;  3MQQ A;  3LIC A;  3PYP A;  3H9W A;  5HWW A;  3F1O A;  4HIA A;  3MMH A;  2OWJ A;  4QPR A;  2M7U A;  3ZYT A;  4JGR A;  4EET B;  2V9A A;  1TS0 A;  3RH8 B;  2VLG A;  4G3V A;  3EGD C;  4KQO A;  2V1A A;  4NEE D;  4GS9 A;  4MN5 A;  4HNB A;  1IFQ A;  3C38 A;  3LIF A;  4EW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...