1L0DA

X-ray crystal structure of ampc s64d mutant beta-lactamase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
358
structure length
351
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGDVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-lactamase
publication title Structural bases of stability-function tradeoffs in enzymes.
pubmed doi rcsb
source organism Escherichia coli
total genus 115
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1l0dA00
2XGNA 4OP5A 3BRMA 4OLGA 2WKHA 4OKPA 4JKTA 3CMZA 4EBNA 3UE1A 1L0FA 1ES2A 3AGEA 3MZFA 1G6AA 4R4SA 3SOIA 1IEMA 4PM6A 4GD6A 4JF5A 1XPBA 1H8ZA 4FSFA 4IVKA 3N7WA 5DTKA 4MNRA 5CGXA 4K91A 5DF9A 1FSWA 1L0DA 1TVFA 2ZQCA 4KZBA 3RJUA 2Y2JA 2Y59A 5FQIA 2WYXA 4EBPA 4P0MA 1RCJA 3I7JA 1K55C 3QNBA 5GLAA 5A90A 3PBRA 2QPNA 1KGFA 3NDEA 4RX2A 3SS5A 2VGJA 5HAQA 4FD8A 4S2KA 3UNWA 4C6YA 4Y7PA 3OPLA 5DF7A 5FI2A 3A3JA 2E8IA 1Y54A 2OLUA 3V5MA 3NBLA 2FFYA 3WS2A 4K0XA 4L0LA 4QY6A 3VP2A 3O88A 3Q81A 3OPPA 5CHJA 4EV4A 4QB8A 3HLWA 4JBFA 2OSUA 3NC8A 4KZ9A 4C75A 2OV5A 5GLBA 1PZPA 2BLSA 2J9PA 3IXHA 2EX9A 2XR0A 1QMEA 1FCOA 3WRZA 1EI5A 3WS0A 1TDLA 3ZNTA 3UPNA 1N4OA 4HBUA 1YT4A 4OOMA 3W4PA 4P87A 2JE5A 4KENB 3FKVA 1VQQA 3RXXA 1XA1A 4LV2A 2QZ6A 3ZG9B 3G32A 4BLMA 3LCEA 5EOOA 1XX2A 3BFCA 3WS4A 3PAGA 4KG6A 3TOIA 2J8YA 3VP3A 3A3IA 1NJ4A 3G34A 1BT5A 2ZQ9A 3LEZA 2J7VA 2ZC6B 4LV0A 5IHVA 1KE0A 1ZKJA 4PM8A 1BLSA 5CTMA 1PI5A 4S2JA 1KE3A 4QU3A 4E6WA 1K4EA 5FQMA 5U47A 1ALQA 1MWRA 1SKFA 3EQVA 2XEPA 4R4RA 1BUEA 3OCNA 4S2OA 5E2HA 3BYDA 4DXCA 2H10A 4EUZA 1AXBA 2Y2LA 4JXWA 4X6TA 3CJMA 1IYOA 3MKFA 3HLBA 4LENA 3GVBA 3G4PA 3V3SA 4GB7A 3GSGA 1O7EA 4BD1A 1MWTA 5J8XA 5HW3A 4BL3A 2HDSA 3DW0A 3ITAA 3JYIA 5CGSA 4N92A 1IELA 1YLTA 2XD5A 1PYYA 2ZD8A 5EUAA 1ES5A 1FR6A 1KDSA 4E3OA 3WWXA 2V1ZA 3IWOA 5D3OA 5A93A 4ZTKA 4GZBA 4EBLA 4X55A 1J9MA 3IF6C 3BM6A 2EXBA 4CPKA 4JPMA 4E3KA 3UPOA 3HL9A 4LV1A 4OQHA 3S4XA 1FCMA 2C5WB 1KGEA 2ZM2A 5FQQA 1KVLA 3PAEA 4N9KA 1M6KA 2XFSA 1K54A 2RL3A 3SH9A 2HP6A 1IYQA 4HEFA 1ONHA 5EVIB 3ZG8B 1MXOA 4MBHA 2EX8A 4QHCA 1YQSA 3UPPA 1PZOA 4IBRA 1CI9A 4FCFA 4GNUA 2X02A 1JVJA 2ZM8A 4Y0UA 5HARA 3NI9A 1BTLA 3IF5A 4P85A 3UDFA 1PWGA 4S2NA 5A91A 5FQJA 3VSKA 3PBTA 3QNCA 3IXBA 1G68A 2DNSA 5E43A 1W8YA 1K4FA 3SS3A 5DTSA 5CEDA 4UA6A 1C3BA 3LY3A 1ES4A 4ZJ1A 5I94A 1BSGA 1LL5A 3ITBA 3C7UA 5FASA 4WMCA 5KSHA 4OVDA 4XXRA 2Y2OA 3MBZA 3D4FA 1MY8A 3W4QA 1K6RA 5G18A 2PBYA 3Q1FA 2Q9NA 4IVIA 1ZG4A 4OQ0A 5GHZA 1GA9A 3HREA 4R3JA 1ERQA 3UDIA 1Q2QA 4RX3A 3UE3A 1XGIA 2HP5A 2ZQDA 4UA7A 2R9WA 5FAOA 2EXAA 4D2OA 3HBRA 3HUNA 4FH4A 4KQOA 5JYOA 3Q07A 5JYPA 3DTMA 4H8RA 1HZOA 3HLCA 4U0TA 5EVIA 4UA9A 1I2SA 5TFQA 3S22A 1WYCA 3HLFA 1FOFA 5F83A 2Y55A 2Y2IA 4N9LA 5M1AA 2JCHA 1L0GA 4WM9A 1MPLA 4DDYA 3IT9A 2HDRA 2Q9MA 3GV9A 1SHVA 1YMSA 4OPYA 4QD4A 5EOEA 1PI4A 4KG5A 4DE1A 1EROA 4OQIA 3G35A 1IYPA 3N8RA 3C4OA 3ZVWA 3PTEA 3MFDA 1CEFA 1W7FA 3IH9A 5FQKA 1MKIA 1NYYA 3OCLA 4MLLA 4R23A 1PW1A 4YFMA 2WKIA 4RVAA 4WMCD 2QMIA 4BD0A 1NY0A 4KQQA 1BULA 2WGIA 4E3LA 3N8SA 1KVMA 4F94A 1O07A 2XFTA 3IWQA 4ID4A 1YLPA 1FCNA 3VFHA 3ZG5A 3BEBA 4R1GA 3FZCA 5KZHA 3PBOA 3BLSA 5AQAA 3AGDA 2G2WA 5AQBA 1BLHA 5HAIA 2X01A 4DDSA 5M19A 1LLBA 2A49A 2XD1A 3NY4A 4ZJ2A 2ZMAA 2VGKA 4PM7A 2WAFA 2G2UA 3SS4A 1LHYA 1U60A 3UN7A 3MXRA 4WELA 5EVID 4R3BA 2Y2NA 2ZM0A 3FKWA 1MWSA 5GHYA 2WZZA 3E2LA 3G31A 1PWCA 4QY5A 1NRFA 5TGFA 1W79A 3G2ZA 3ZG0A 2ZC7A 4DF6A 3M6BA 4OP8A 3EQUA 1N9BA 2Y2MA 4X69A 3N8LA 1DJCA 1K57A 1CEGA 1S0WA 2V20A 4NETA 3O86A 3IWIA 4C3QA 5EPHA 5EVLA 4EWFA 3S1YA 2PU2A 2WKEA 3G30A 1HVBA 3MXSA 4KZAA 2DRWA 3WS5A 4OOYA 2WK0A 2EX2A 3IHAA 3FV7A 5CTNA 1GHPA 2Y2KA 5A92A 1YMXA 1XKZA 4UAAA 2HP9A 3HLGA 3HVFA 3P09A 4UHUA 5CHMA 1LI9A 3VOYA 3ZG7B 1ONGA 2C6WB 2X71A 1JWPA 2XLNA 4WZ4A 1NYMA 1DJBA 3Q7VB 5CEBA 1MWUA 4JF4A 4KZ4A 4WZ5A 2WGWB 1QMFA 4FH2A 5CECA 1LI0A 1K54C 4KZ3A 3P98A 2ZJ9A 3VOZA 3ZCZA 3OZHA 5TR7A 3NIAA 2Z2LB 2CC1A 1JTGA 3IH8A 1M40A 1YM1A 2HDQA 1BLCA 4DXBA 3OPRA 4B4ZA 1MBLA 1FQGA 3PBQA 4U0XA 4S2NC 5HAPA 1JWZA 2ZC4B 2OLVA 5AQ9A 5CXWA 4Z9QA 3G2YA 5FAQA 1W8QA 4BQMA 1JWVA 4RYEA 2XDMA 1GHIA 2Y91A 3FWLA 4MBKA 4X56A 1NXYA 1ESUA 1OMEA 1L0EA 1H8YA 5FA7A 1KDWA 5CGWA 4DRTA 4E3NA 2ZLYA 2Y2HA 2J9OA 3PBSA 5M18A 1NZUA 4B4XA 5L2FA 3UO9A 4E3JA 3PBNA 5CERA 1WYBA 1K25A 1S6RA 3B3XA 2XQZA 3W8KA 1H5XA 2WADA 2Y2GA 2ZQ8A 5F1FA 4KZ5A 4N1XA 5DTTA 3BECA 1K6SA 5FSRA 4HESA 3C4PA 4OOLA 3GR2A 1E25A 3Q82A 3Q7VA 5FI6A 2ZC5B 2WGWA 2A3UA 1I2WA 3SH8A 4EQIA 1HD8A 3MZDA 2XH9A 1IKGA 4ZAMA 4Y0TA 3BFFA 3UDXA 2JBFA 3A3DA 2XK1A 4R0QA 5EVIC 4S2MA 1K55A 1K38A 4M3KA 5CRFA 1XP4A 1IYSA 1ZG6A 4GDBA 1PIOA 2V2FF 3BFGA 5E2EA 1XGJA 4MBFA 4A5RA 2IWCA 4KG2A 4KQRA 3SH7A 5F1GA 3V3RA 4BENA 4LCMA 5EE8A 5GHXA 3HLDA 4GKUA 1E3UD 4OPZA 3M2JA 3AGFA 4GOGA 5E2GA 5AQ7A 5GLDA 2EFXA 3IXDA 1K56D 3QHYA 4PMAA 5HFOA 1HTZA 4P6BA 4JXVA 2UWXA 3WS1A 4GD8A 3Q7ZA 4OH0A 4JLFA 1PW8A 3FYZA 4DE3A 2Y4AA 3LO7A 4NK3A 4Q8IA 4JXSA 2ZQ7A 1RP5A 3CZDA 3VP4A 3HLEA 3NDGA 5E2FA 2H0TA 2EFUA 3HUMA 1DY6A 4LV3A 3ZNYA 3A3EA 3CG5A 1FR1A 2I72A 4GDNA 4S2PA 5HL1A 3IF6B 4ZBEA 1ESIA 3O87A 4JF6A 4PPRA 1SDNA 2HDUA 2P9VB 3VMAA 3VFFA 4ZDXA 3MKEA 2EX6A 4B88A 3A3FA 3GRJA 4LCLA 1CI8A 3ZFZA 4X53A 5GL9A 4QJGA 4WBGA 2DCFA 1ERMA 3MZEA 3NCKA 3E2KA 3M6HA 1GCEA 2FFFB 2HPBA 3TG9A 3DWKA 5FATA 1RGYA 2P74A 4DE0A 4PM5A 4IBXA 1GA0A 5FAPA 1EWZA 3WRTA 3IHBA 2R9XA 1YLWA 3V50A 1E4DA 2Y2PA 3ZGAB 3N6IA 1XA7A 4GN2A 2Y2QA 2PU4A 4BJPA 4PM9A 1BLPA 1W5DA 3TSGA 2H5SA 4OONA 5FDHA 4CJNA 1K57C 3C5AA 1BZAA 1PWDA 4HBTA 3ZHHA 5FI7A 2ZQAA 4Y0OA 3UE0A 1KGGA 2Z2MB 4OPQA 5GLCA 2WAEA 3OC2A 4OQGA 1TEMA 3BFEA 4OPRA 4KZ7A 4XUZA 1NZOA 4X68A 2JC7A 4IEDA 3VP0A 1I5QA 1L2SA 1LL9A 2GDNA 4JXGA 2H0YA 2IWDA 3GTCA 3V39A 4DE2A 4KZ8A 5CHUA 1Q2PA 1RGZA 3IF6A 4S2IA 4S2LA 1IKIA 3HUOA 4DKIA 1FSYA 3M2KA 4KZ6A 3BFDA 1SCWA 1YLJA 2P9VA 4WEJA 5HX9A 3IXGA 1GHMA 1CK3A 4WZ5C 3DWZA 1VM1A 3IQAA 5BOHA 4K0WA 1YLZA 4WEKA 5DVAA 2WGVA 1E3UA 3GQZA 1KE4A 4N1HA 1YLYA 1K56A 1ZC2A 4OLDA 1DJAA 4E6XA 1SDEA 3W4OA 3ZVTA 5KMWA 4YINA 3ZDJA 1XXMA 1ES3A 3GMWA 1JTDA 4BL2A 4E3MA 5EECA 2B5RA 3C7VA 5F82A 3OPHA 1TDGA 4WYYA 2IWBA 4O7DA 1Z6FA 3UY6A 5DF8A 4XUXA 2ZC3B 1WE4A 2XF3A 3N4IA 4E3IA 3RXWA 2WZXA 4ZJ3A 3O3VA 4MEZA 3ISGA 5KSCA 5FQ9A 3VSLA 3LY4A 2BG1A 4U3TA 4RA7A 2WUQA 3BLMA 2RCXA 3VP1A
chains in the Genus database with same CATH superfamily
2XGNA 5J3WA 2FH5A 3HCYA 2PT7A 4JKTA 3CMZA 5HPIA 3UE1A 1L0FA 1ES2A 3AGEA 3MZFA 4JF5A 2XA7S 1F9IA 2JKFA 3N7WA 2L1MA 4MNRA 3FPWA 2A24B 3RJUA 3G6OA 4EBPA 4YOFA 1RCJA 3NJAA 1MKMA 3PBRA 2QPNA 4RX2A 3SS5A 2Y79A 3UNWA 3LIDA 4Y5FA 4Y7PA 1XJ3A 2E8IA 3A3JA 2OLUA 1V9ZA 4IHQA 4PHTA 1VETA 2JHEA 5FEGA 3C8CA 5GLBA 2JKTM 2EX9A 3BWLA 1FCOA 3WS0A 1TDLA 4HOIA 2ZMFA 2V8FA 4QWOA 1N4OA 4OOMA 2G7UA 2W1TB 3T4TA 3KSIA 3T12B 4KG6A 2I9VA 4F3LA 3A3IA 2ZC6B 4YWZA 5DJUA 1T1CA 1PI5A 4S2JA 1ALQA 1MWRA 3MQQA 4R4RA 5FL3A 1Y28A 2Y2LA 4X6TA 2EWVA 3HLBA 3T4KA 2INWA 3LIEA 3MR0A 3GSGA 4BD1A 1MWTA 4Y13A 5J8XA 5DKKA 3JYIA 3DW0A 3ITAA 5CGSA 4N92A 2XD5A 3DTEA 2LB5A 3WWXA 5A93A 4KQDA 1ZTUA 2ZM2A 4B93A 3S7OA 3CUEA 2X02A 2EWWA 2ZM8A 3MQOA 1PWGA 3LR5A 3IXBA 1G68A 5E43A 2HV1A 5CEDA 3LY3A 4G3KA 4ZJ1A 1LL5A 3ITBA 1TS0A 5FASA 1MY8A 2VV7A 1K6RA 5G18A 3Q1FA 4OQ0A 3CPTB 1GA9A 4R3JA 2VZWA 5IS1A 2XSSA 3HBRA 3HUNA 4KQOA 3BY8A 3EWKA 4GCZA 4FOFA 4U0TA 1I2SA 4N9LA 5M1AA 2JCHA 4DDYA 3GV9A 1SHVA 1P9WA 4QD4A 5EOEA 4KG5A 4DE1A 3CAXA 1EROA 3ZQ5A 5EM1A 3G35A 1SKOB 3C4OA 1GSVA 2AVXA 2O0YA 1PW1A 3OOVA 1ODVA 3LIBA 1O07A 2XFTA 3ZG5A 2W3HA 5AJGA 5DFXA 5AQBA 4DDSA 5M19A 1LLBA 2J3WA 2XD1A 3E0YA 2G2UA 1LHYA 1U60A 2OOLA 3UN7A 5KIZA 4WELA 2Y2NA 3FKWA 5GHYA 1VEUB 4QY5A 3G2ZA 1K57A 2D02A 3EEAA 4O8GA 3O86A 5EVLA 3S1YA 2ACGA 2B95A 2DRWA 3A0SA 4OOYA 4D60A 1GSXA 3IHAA 3UB9A 5CTNA 1GHPA 5CHMA 1XKZA 2C6WB 1IFQA 3CLOA 1DP6A 4LRXC 3KO6A 5CEBA 2O9AA 4WZ5A 5I5LA 5IT5A 4CLCB 1HLUP 1G6OA 1OT6A 3OZHA 2CC1A 2XRNA 2J3TD 1YM1A 2PHYA 1FQGA 4S2NC 1JWZA 5L10A 4WLAA 2VJWA 2XDMA 1ESUA 1L0EA 1G5UA 2NUPC 4E3JA 4X1LA 1K25A 2XQZA 4YNRA 5DJTA 4MN6A 2Y2GA 2ZQ8A 4KZ5A 5DTTA 1E25A 1P0ZA 3Q82A 5FI6A 2ZC5B 3MZDA 4JGRA 3A3DA 2XK1A 3S7QA 1YAXA 1K55A 1K38A 5CRFA 2V0WA 5E2EA 3A0RA 5F1GA 4LCMA 3HLDA 5AQ7A 3KSHA 4JXVA 3WS1A 3Q7ZA 4JLFA 4NK3A 1RP5A 3HLEA 3A3EA 3UMEA 3IF6B 2YKFA 1SDNA 4K08A 1OJGA 2P9VB 3MKEA 3LIAA 3O5YA 2W3EA 4B88A 1CI8A 1ERMA 3DWKA 3UB6A 1P9RA 1GA0A 3WRTA 3IHBA 2BTFP 3V50A 1E4DA 2LB9A 1D7EA 3TSGA 4CJNA 5K5BA 3C5AA 1KGGA 4OQGA 1NZOA 1L2SA 4KZ8A 2H28A 1D06A 4S2LA 1XFNA 1IKIA 4DKIA 2JKTI 3IS2A 4NKPA 4P6ZM 1CK3A 4EEUA 4K0WA 4WEKA 5DVAA 1KE4A 1CJFA 3JVUA 2K7SA 1SDEA 3K2NA 1XXMA 3GMWA 4E3MA 1YSQA 4O7DA 4I38A 2ZC3B 1TS7A 3KSFA 2XF3A 4E3IA 3T4LA 3O3VA 4MEZA 3RTYA 4Q0JA 1VETB 1YSPA 3T1SA 3VSLA 3LY4A 1EW0A 2BG1A 2WUQA 3VP1A 3U4LP 5G4ZA 3H7WB 4HP9A 3KSGA 4EBNA 2JKRM 1G6AA 2GJ3A 4PM6A 4ESPA 4FSFA 4IVKA 3H9WA 5CGXA 4K91A 4KZBA 2Y2JA 2Y59A 4CLCC 3EGXC 4P0MA 3EOIA 5C5KA 3QNBA 3NDEA 2VGJA 5HAQA 4FD8A 2NUTC 4C6YA 5DF7A 5FI2A 2O99A 5CHJA 1FILA 4KZ9A 3A0VA 2J9PA 3F1OB 1DP9A 1UWNX 2O9BA 4LRYC 1EI5A 4HBUA 1VQQA 1XA1A 2QZ6A 3ZG9B 3G32A 2J3TC 5F69A 3PAGA 3TOIA 3VP3A 1BT5A 4CLCE 3LEZA 2J7VA 3KYEA 4LV0A 1KE0A 4PKYG 4PM8A 1W63Q 1JNUA 4E6WA 5U47A 3LEQA 4EU0A 2K31A 1SKFA 2XEPA 1BUEA 4S2OA 2H10A 4JXWA 3GVBA 4GB7A 4NXBA 2HGVA 1IELA 1PYYA 5HDCA 1S1YA 4GW9A 4E3OA 2GNXA 4ZTKA 3T4OA 4EBLA 3IF6C 4CPKA 2EXBA 4E3KA 4OQHA 1KGEA 1KVLA 3PAEA 4EQ1A 4XT2A 1ONHA 3ZG8B 3V67A 1CI9A 2V0UA 1Y4OA 4P85A 3PBTA 3QNCA 3UB7A 2DNSA 1W8YA 1ES4A 1LSXA 1BSGA 2K2NA 3C7UA 4WMCA 5KSHA 3NOTC 4FTXA 4OVDA 3D4FA 3QP5A 3UDIA 1Q2QA 4RX3A 4IJGA 3UE3A 2HP5A 3MF0A 4H8RA 5EVIA 3S22A 4UQIM 4LPZA 3F1PA 3HLFA 5F83A 2Y55A 3IT9A 2HDRA 2A2LA 3D72A 1YMSA 1OT9A 3RFBA 3KYQA 4OQIA 2W27A 4LRZE 3ZVWA 2FZ0A 3PTEA 1W7FA 3IH9A 5FQKA 1MKIA 4R23A 3HJIA 3OCLA 4RVAA 1VHMA 1NY0A 4HH2A 2ZBBA 3TW8A 1XJ2A 3IWQA 5KZHA 5AQAA 3AGDA 3BJNA 4ZJ2A 4PM7A 1ACFA 3MXRA 4HI4A 2ZM0A 4GHIA 3G31A 1PWCA 2PR6A 1W79A 1H3QA 3M6BA 5HWWA 4X69A 1DJCA 1S0WA 3PR6A 5MC7A 5EPHA 2PU2A 2KDKA 2WKEA 3G30A 3MXSA 4KZAA 4EW7A 5CX7A 2KX6A 3VV4A 4FUWA 2Y2KA 5A92A 4KUKA 2ZL1A 4UHUA 1LSWA 2HP9A 3HLGA 3P09A 1DRMA 2XLNA 3VOLA 4WZ4A 3H82A 1NYMA 4JF4A 4KZ4A 4HQAA 1QMFA 4FH2A 5CECA 1TD5A 2PR5A 3VE4A 3VOZA 5TR7A 3CUEC 2Z2LB 4B4ZA 1MBLA 4CQHA 3PBQA 4U0XA 3QP1A 5HPFA 2OLVA 4BBUA 3G2YA 2W3FA 3MXQA 1J3WA 2XA7M 5HWVA 5FA7A 5CGWA 2Y2HA 2J9OA 5L2FA 1W63M 3PBNA 2VV8A 4JGOA 1H5XA 5J7EA 1TS6A 3BECA 1K6SA 1BYWA 3L7HA 3GR2A 4X1MA 3K3DA 2WGWA 2A3UA 1I2WA 3SH8A 1F98A 1IKGA 1OTIA 4ZAMA 3K3CA 3BFFA 4Y0TA 4R0QA 4Y2FA 4M3KA 5TBMA 1PIOA 2IWCA 3SH7A 3V3RA 3LIFA 4GKUA 4EETB 3AGFA 3FPVA 5E2GA 1CF0A 2PAVP 3T50A 3OBFA 5HFOA 1T18A 4DE3A 2Y4AA 4LLOB 3UE6A 1T19A 4NXFA 2O9CA 2H0TA 4LV3A 3ZNYA 3CG5A 4S2PA 4DJ2A 4JF6A 3IS2B 3VFFA 3NHQA 2VEAA 2JKRI 3A3FA 3GRJA 2E8JA 4X53A 3ZFZA 4WBGA 3KX0X 1S4RA 4CLCD 4IUHA 3TG9A 1RGYA 3NECA 1EWZA 3LGOA 1Z09A 2ZOHA 4GN2A 2Y2QA 5AVFA 5FDHA 2VGLM 1K57C 3U2AA 2ZQAA 4OPQA 5GLCA 2WAEA 4II7A 3DTKA 1TEMA 3BFEA 4XUZA 4R70A 4IEDA 4JXGA 2H0YA 3GTCA 3BY9A 4HJ3A 3V39A 5CHUA 1Q2PA 2OAP1 1RGZA 4S2IA 4WUJA 3M2KA 4ETZA 5HX9A 1GHMA 3HJKA 4WZ5C 4E04A 1VM1A 2WGVA 1E3UA 2ZMVA 3F1NA 3GQZA 1P97A 4N1HA 1K56A 4OLDA 3ZYTA 4YINA 2QHKA 2VK3A 4BL2A 5F82A 1TDGA 1OPXA 4WYYA 1Z6FA 3DBAA 4WF0A 3PYPA 1S4SA 2WZXA 4Q0HA 4P6ZS 5KSCA 3RH8B 5FQ9A 4HHDA 2RCXA 4OP5A 3BRMA 2WKHA 1IEMA 3QP8A 1H8ZA 5DTKA 1FSWA 1L0DA 1NWZA 5FQIA 5IU1A 5HSQA 3I7JA 1SZVA 1K55C 5A90A 4AFIA 4KUOA 1KGFA 3JVVA 4S2KA 1UWPX 3LFVA 3OPLA 4I3JA 2BASA 4K0XA 4L0LA 3OPPA 4G3WA 4QB8A 3HLWA 4JBFA 4IUKA 2XR0A 1QMEA 4L9FA 3WRZA 3ZNTA 3W4PA 4P87A 3CPTA 4KENB 3QP6A 4JGQA 4LV2A 1XX2A 1OTBA 4XT2B 1A0KA 3MJQA 1ZKJA 1BLSA 3LR4A 1K0KA 1KE3A 4QU3A 5FQMA 3C30A 3LYXA 3OCNA 2OAQ1 5HWTA 3BYDA 4EUZA 2PDRA 4I3IA 5HDDA 3G4PA 1KOUA 1XFQA 2HDSA 2WKPA 3B33A 1ES5A 1FR6A 1KDSA 3R7WA 1IOUA 4HP4A 5D3OA 4GZBA 2W0NA 2OWJA 3BM6A 3UPOA 3HL9A 3S4XA 1FCMA 5FQQA 2V8CA 1M6KA 3IBRA 1K54A 2RL3A 5EVIB 1IYQA 4HEFA 1MXOA 3C2WA 2EX8A 1YQSA 3UPPA 4ARZA 4GJ4A 4FCFA 3QP2A 4GNUA 5FDSA 1JVJA 4Y0UA 3NI9A 3IF5A 3UDFA 5A91A 3VSKA 2VV6A 1K4FA 1C3BA 3GECA 2GZAA 4HJ4A 4WN5A 2B18A 4XXRA 3MBZA 3W4QA 1S1ZA 3DTIA 3L9KA 1ZG4A 2PBDP 2HZ5A 2WKQA 1XJ4A 1XGIA 1ZHHB 3T4JA 1DP8A 2ZQDA 4F3LB 5FAOA 2PRFA 3T4SA 1S66L 1MC0A 1HZOA 3HLCA 2W3DA 1FOFA 2Y2IA 3PXPA 4WM9A 1MPLA 4GHIB 3E4QA 3BW6A 4OPYA 1PI4A 3IBJA 3T4QA 1IYPA 3D3OA 2VX8A 4MN5A 4UQIS 3MS6A 1D1JA 3FC7A 2WKIA 2QMIA 1XJ6A 2WGIA 4E3LA 3N8SA 4ID4A 3VFHA 3BEBA 4R1GA 3MSHA 3FZCA 4ETXA 2W3GA 2G2WA 1BLHA 2X01A 2A49A 5HD5A 1N9LA 2VGKA 2WAFA 3SS4A 4DN0A 4R3BA 5TJJA 1MWSA 2HJEA 5TGFA 1NRFA 2XROA 5F6AA 1N9OA 3ZG0A 2ZC7A 4DF6A 3TJZC 4OP8A 2Y2MA 3N8LA 1CEGA 2V20A 2QWSA 4C3QA 4JGPA 4EWFA 4BBVA 5L8MA 1HVBA 2EX2A 1PNEA 3FV7A 4HNBA 3LI8A 1YMXA 3HVFA 3S7PA 1PRQA 3VOYA 1ONGA 4R38A 2X71A 1MWUA 4WL9A 2WGWB 2VA0A 4HY8A 1LI0A 2ZJ9A 2GX5A 3ZCZA 3NIAA 5F68A 3IH8A 1M40A 4DXBA 4H6JA 5FAQA 1W8QA 2Y91A 4X56A 1NXYA 3LUQA 1OMEA 4I3AA 4DRTA 1KDWA 4E3NA 3FG8A 4B4XA 4HIAA 5CERA 1WYBA 4MCWA 1S6RA 3B3XA 3KYZA 5F1FA 2L0WA 4N1XA 3C4PA 4OOLA 4DJ3A 1OTDA 3Q7VA 4NXEA 4EQIA 2XH9A 2JBFA 2ZOIA 5EVIC 1N9NA 4S2MA 4GS9A 1XP4A 3BFGA 1XGJA 4A5RA 4KQRA 4KG2A 4BENA 5GHXA 1E3UD 4OPZA 4GOGA 2PYPA 4M4XA 1K56D 4PMAA 2UWXA 1PW8A 1S67L 2J80A 3FYZA 3LR3A 4Y17A 2Z6CA 5E2FA 1VB6A 3HUMA 1DY6A 2P7JA 3SW1A 4GDNA 5HL1A 1ESIA 3O87A 3H7WA 2HDUA 3C38A 3VMAA 1FIKA 5FEFA 4O01A 2EA9A 2DCFA 3F1NB 3NCKA 3E2KA 1GCEA 2HPBA 5FATA 4DE0A 4IBXA 3TE8A 2R9XA 3ZGAB 3N6IA 2PU4A 1BLPA 4OONA 1BZAA 1PWDA 4HBTA 3IX3A 5FI7A 3OC2A 3SZTA 4OPRA 4X68A 1I5QA 1LL9A 2GDNA 2IWDA 4DE2A 3QP4A 3F1OA 3HUOA 4KZ6A 2VGLS 4WEJA 4L9GA 3IXGA 4PAUA 3IQAA 5BOHA 1YLZA 3CI6A 4NG2A 2M7UA 3LR0A 1ZC2A 5KMWA 3UMDA 3ZDJA 1NRJA 1ES3A 1JTDA 2KLIA 3C7VA 3OPHA 2IWBA 5DF8A 1WE4A 1V9YA 3RXWA 2QJ5A 4ZJ3A 1GSWA 1LSVA 4R6LA 1OTAA 3CHWP 4OLGA 4OKPA 1STZA 4R4SA 3SOIA 4GD6A 1XPBA 4NEED 3E4PA 5DF9A 2ZQCA 1TVFA 2WYXA 5GLAA 4EUVA 3D9YA 1Y54A 3V5MA 3NBLA 2FFYA 3WS2A 3NULA 3LI9A 3MQ0A 4QY6A 3VP2A 3O88A 3Q81A 4EV4A 2QJ7A 2OWHA 2OSUA 3NC8A 4C75A 2OV5A 1PZPA 2BLSA 3IXHA 1YPRA 4O0PA 3R7WB 4Q0IA 1TS8A 3UPNA 1YT4A 5EM0A 2JE5A 2UV0E 3FKVA 3RXXA 3ULFA 3B47A 4BLMA 3LCEA 2A24A 5EOOA 4DMZA 3BFCA 3WS4A 5L09A 2J8YA 1NJ4A 3G34A 2V1AA 5HL6A 2ZQ9A 5IHVA 1X0OA 1LL8A 1L3LA 5CTMA 4ARZB 1K4EA 4ZRRA 2PYRA 2B02A 3VE3A 3EQVA 5E2HA 1MZUA 4DXCA 1F5MA 1AXBA 3CJMA 1IYOA 2R78A 3MKFA 4LENA 3V3SA 1O7EA 4LGWA 5HW3A 3R4KA 4BL3A 1LT0A 4GLQA 3B42A 1YLTA 2ZD8A 5EUAA 2Y8HA 2V1ZA 3IWOA 4X55A 1J9MA 3E98A 4JPMA 4EESA 4LV1A 3E4OA 2C5WB 2W1TA 4N9KA 2XFSA 3T1XA 1H0MA 3SH9A 2HP6A 4MBHA 4QHCA 1PZOA 1WA9A 4IBRA 4HH3A 4G3VA 2PD8A 5HARA 1BTLA 4S2NA 5FQJA 1NLYA 5HDSA 3SS3A 5DTSA 4UA6A 3CWFA 5I94A 5LBRA 2CMNA 2Y2OA 2PBYA 2Q9NA 4IVIA 5GHZA 3HREA 1ERQA 3S7NA 4UA7A 2R9WA 4D2OA 2EXAA 4FH4A 5JYOA 3Q07A 5JYPA 3DTMA 4L9EA 5TFQA 4UA9A 1WYCA 1L0GA 3NOPC 2Q9MA 1AWIA 2WKRA 1F2KA 4Z1WA 2VLGA 3N8RA 2HF6A 3MFDA 1CEFA 5HD3A 5EV0A 4YFMA 1NYYA 4MLLA 4WMCD 4BD0A 4KQQA 1BULA 1KVMA 4F94A 4MMNA 1YLPA 1FCNA 3PBOA 1T1AA 3BLSA 4NXGA 5HAIA 4B9OA 3NY4A 3UB5P 2ZMAA 4PKYA 2DMWA 5EVID 4EERA 4R3AA 2WZZA 4H6JB 3E2LA 3PHYA 4ME4A 3EQUA 1N9BA 2P04A 1SKOA 4QPRA 4NETA 3IWIA 5EVEA 5EFWA 3WS5A 2WK0A 2QKPA 1UGUA 4UAAA 3ZG7B 2JKGA 3EEHA 1LI9A 2M7VA 5J4EA 1JWPA 1DJBA 3Q7VB 5AVEA 3F1PB 2MJ6A 2PD7A 5DKLA 1K54C 4KZ3A 3P98A 4GS9B 4BMWA 3ICYA 1JTGA 2HDQA 1BLCA 3OPRA 4RQ9A 1VEUA 4MDZA 5HAPA 2ZC4B 5AQ9A 3LICA 5CXWA 4Z9QA 4BQMA 2M1CA 1JWVA 4RYEA 1GHIA 3FWLA 4MBKA 3P7NA 1H8YA 2ZLYA 3PBSA 5M18A 1NZUA 3UO9A 3EGDC 3W8KA 2WADA 3UB8A 5FSRA 4HESA 1G28A 3BQAA 1CQAA 3IX8A 1HD8A 3IX4A 3UDXA 4CLCA 3T1QB 1IYSA 1ZG6A 2KOIA 2V2FF 4GDBA 2L4RA 4MBFA 4Y15A 3BQ8A 5EE8A 1H8MA 1T1BA 4I5SA 4X25A 3M2JA 5GLDA 2EFXA 3IXDA 3QHYA 1HTZA 4P6BA 4GD8A 3TRCA 4OH0A 4I39A 1YKDA 3LO7A 4Q8IA 4JXSA 2ZQ7A 2ZL1B 3CZDA 3VP4A 3NDGA 2EFUA 5F5YA 2HJ9C 3JPUA 3H82B 2P08A 5L07A 1FR1A 2I72A 1NLZA 2W1RA 4EXOA 4ZBEA 4HJ6A 4PPRA 4BBTA 5A8BA 4ZDXA 2Q0OA 2EX6A 4LCLA 2V1BA 4QJGA 5GL9A 5DFYA 3NOUC 1OTEA 2QYBA 3MZEA 3DAVA 5G4YA 3M6HA 2FFFB 2P74A 4PM5A 3MFXA 3P01A 5FAPA 1YLWA 2Y2PA 3MMHA 2IA2A 3W2ZA 1XA7A 4BJPA 3OLOA 4PM9A 1W5DA 2H5SA 2V9AA 2VKSA 3ZHHA 4Y0OA 3UE0A 2Z2MB 4KZ7A 2JC7A 3VP0A 5HZHA 4Y3IA 3T1RA 2D01A 3IF6A 1FSYA 3BFDA 1SCWA 1YLJA 4LFUA 2P9VA 5TBMB 3DWZA 1PFLA 1YLYA 1DJAA 4E6XA 3W4OA 3ZVTA 3GDIA 4BWIA 2YKHA 5EECA 2B5RA 3UY6A 2JN7A 4XUXA 1TF1A 4UEYA 3N4IA 2Z6DA 4EEPA 3CITA 3ISGA 4U3TA 4RA7A 1OJ5A 3BLMA 4MN7A
chains in the Genus database with same CATH topology
2XGNA 4OP5A 3BRMA 4OLGA 2WKHA 4OKPA 4JKTA 3CMZA 4EBNA 3UE1A 1L0FA 1ES2A 3AGEA 3MZFA 1G6AA 4R4SA 3SOIA 1IEMA 4PM6A 4GD6A 4JF5A 1XPBA 1H8ZA 4FSFA 4IVKA 3N7WA 5DTKA 4MNRA 5CGXA 4K91A 5DF9A 1FSWA 1L0DA 1TVFA 2ZQCA 4KZBA 3RJUA 2Y2JA 2Y59A 5FQIA 2WYXA 4EBPA 4P0MA 1RCJA 3I7JA 1K55C 3QNBA 5GLAA 5A90A 3PBRA 2QPNA 1KGFA 3NDEA 4RX2A 3SS5A 2VGJA 5HAQA 4FD8A 4S2KA 3UNWA 4C6YA 4Y7PA 3OPLA 5DF7A 5FI2A 3A3JA 2E8IA 1Y54A 2OLUA 3V5MA 3NBLA 2FFYA 3WS2A 4K0XA 4L0LA 4QY6A 3VP2A 3O88A 3Q81A 3OPPA 5CHJA 4EV4A 4QB8A 3HLWA 4JBFA 2OSUA 3NC8A 4KZ9A 4C75A 2OV5A 5GLBA 1PZPA 2BLSA 2J9PA 3IXHA 2EX9A 2XR0A 1QMEA 1FCOA 3WRZA 1EI5A 3WS0A 1TDLA 3ZNTA 3UPNA 1N4OA 4HBUA 1YT4A 4OOMA 3W4PA 4P87A 2JE5A 4KENB 3FKVA 1VQQA 3RXXA 1XA1A 4LV2A 2QZ6A 3ZG9B 3G32A 4BLMA 3LCEA 5EOOA 1XX2A 3BFCA 3WS4A 3PAGA 4KG6A 3TOIA 2J8YA 3VP3A 3A3IA 1NJ4A 3G34A 1BT5A 2ZQ9A 3LEZA 2J7VA 2ZC6B 4LV0A 5IHVA 1KE0A 1ZKJA 4PM8A 1BLSA 5CTMA 1PI5A 4S2JA 1KE3A 4QU3A 4E6WA 1K4EA 5FQMA 5U47A 1ALQA 1MWRA 1SKFA 3EQVA 2XEPA 4R4RA 1BUEA 3OCNA 4S2OA 5E2HA 3BYDA 4DXCA 2H10A 4EUZA 1AXBA 2Y2LA 4JXWA 4X6TA 3CJMA 1IYOA 3MKFA 3HLBA 4LENA 3GVBA 3G4PA 3V3SA 4GB7A 3GSGA 1O7EA 4BD1A 1MWTA 5J8XA 5HW3A 4BL3A 2HDSA 3DW0A 3ITAA 3JYIA 5CGSA 4N92A 1IELA 1YLTA 2XD5A 1PYYA 2ZD8A 5EUAA 1ES5A 1FR6A 1KDSA 4E3OA 3WWXA 2V1ZA 3IWOA 5D3OA 5A93A 4ZTKA 4GZBA 4EBLA 4X55A 1J9MA 3IF6C 3BM6A 2EXBA 4CPKA 4JPMA 4E3KA 3UPOA 3HL9A 4LV1A 4OQHA 3S4XA 1FCMA 2C5WB 1KGEA 2ZM2A 5FQQA 1KVLA 3PAEA 4N9KA 1M6KA 2XFSA 1K54A 2RL3A 3SH9A 2HP6A 1IYQA 4HEFA 1ONHA 5EVIB 3ZG8B 1MXOA 4MBHA 2EX8A 4QHCA 1YQSA 3UPPA 1PZOA 4IBRA 1CI9A 4FCFA 4GNUA 2X02A 1JVJA 2ZM8A 4Y0UA 5HARA 3NI9A 1BTLA 3IF5A 4P85A 3UDFA 1PWGA 4S2NA 5A91A 5FQJA 3VSKA 3PBTA 3QNCA 3IXBA 1G68A 2DNSA 5E43A 1W8YA 1K4FA 3SS3A 5DTSA 5CEDA 4UA6A 1C3BA 3LY3A 1ES4A 4ZJ1A 5I94A 1BSGA 1LL5A 3ITBA 3C7UA 5FASA 4WMCA 5KSHA 4OVDA 4XXRA 2Y2OA 3MBZA 3D4FA 1MY8A 3W4QA 1K6RA 5G18A 2PBYA 3Q1FA 2Q9NA 4IVIA 1ZG4A 4OQ0A 5GHZA 1GA9A 3HREA 4R3JA 1ERQA 3UDIA 1Q2QA 4RX3A 3UE3A 1XGIA 2HP5A 2ZQDA 4UA7A 2R9WA 5FAOA 2EXAA 4D2OA 3HBRA 3HUNA 4FH4A 4KQOA 5JYOA 3Q07A 5JYPA 3DTMA 4H8RA 1HZOA 3HLCA 4U0TA 5EVIA 4UA9A 1I2SA 5TFQA 3S22A 1WYCA 3HLFA 1FOFA 5F83A 2Y55A 2Y2IA 4N9LA 5M1AA 2JCHA 1L0GA 4WM9A 1MPLA 4DDYA 3IT9A 2HDRA 2Q9MA 3GV9A 1SHVA 1YMSA 4OPYA 4QD4A 5EOEA 1PI4A 4KG5A 4DE1A 1EROA 4OQIA 3G35A 1IYPA 3N8RA 3C4OA 3ZVWA 3PTEA 3MFDA 1CEFA 1W7FA 3IH9A 5FQKA 1MKIA 1NYYA 3OCLA 4MLLA 4R23A 1PW1A 4YFMA 2WKIA 4RVAA 4WMCD 2QMIA 4BD0A 1NY0A 4KQQA 1BULA 2WGIA 4E3LA 3N8SA 1KVMA 4F94A 1O07A 2XFTA 3IWQA 4ID4A 1YLPA 1FCNA 3VFHA 3ZG5A 3BEBA 4R1GA 3FZCA 5KZHA 3PBOA 3BLSA 5AQAA 3AGDA 2G2WA 5AQBA 1BLHA 5HAIA 2X01A 4DDSA 5M19A 1LLBA 2A49A 2XD1A 3NY4A 4ZJ2A 2ZMAA 2VGKA 4PM7A 2WAFA 2G2UA 3SS4A 1LHYA 1U60A 3UN7A 3MXRA 4WELA 5EVID 4R3BA 2Y2NA 2ZM0A 3FKWA 1MWSA 5GHYA 2WZZA 3E2LA 3G31A 1PWCA 4QY5A 1NRFA 5TGFA 1W79A 3G2ZA 3ZG0A 2ZC7A 4DF6A 3M6BA 4OP8A 3EQUA 1N9BA 2Y2MA 4X69A 3N8LA 1DJCA 1K57A 1CEGA 1S0WA 2V20A 4NETA 3O86A 3IWIA 4C3QA 5EPHA 5EVLA 4EWFA 3S1YA 2PU2A 2WKEA 3G30A 1HVBA 3MXSA 4KZAA 2DRWA 3WS5A 4OOYA 2WK0A 2EX2A 3IHAA 3FV7A 5CTNA 1GHPA 2Y2KA 5A92A 1YMXA 1XKZA 4UAAA 2HP9A 3HLGA 3HVFA 3P09A 4UHUA 5CHMA 1LI9A 3VOYA 3ZG7B 1ONGA 2C6WB 2X71A 1JWPA 2XLNA 4WZ4A 1NYMA 1DJBA 3Q7VB 5CEBA 1MWUA 4JF4A 4KZ4A 4WZ5A 2WGWB 1QMFA 4FH2A 5CECA 1LI0A 1K54C 4KZ3A 3P98A 2ZJ9A 3VOZA 3ZCZA 3OZHA 5TR7A 3NIAA 2Z2LB 2CC1A 1JTGA 3IH8A 1M40A 1YM1A 2HDQA 1BLCA 4DXBA 3OPRA 4B4ZA 1MBLA 1FQGA 3PBQA 4U0XA 4S2NC 5HAPA 1JWZA 2ZC4B 2OLVA 5AQ9A 5CXWA 4Z9QA 3G2YA 5FAQA 1W8QA 4BQMA 1JWVA 4RYEA 2XDMA 1GHIA 2Y91A 3FWLA 4MBKA 4X56A 1NXYA 1ESUA 1OMEA 1L0EA 1H8YA 5FA7A 1KDWA 5CGWA 4DRTA 4E3NA 2ZLYA 2Y2HA 2J9OA 3PBSA 5M18A 1NZUA 4B4XA 5L2FA 3UO9A 4E3JA 3PBNA 5CERA 1WYBA 1K25A 1S6RA 3B3XA 2XQZA 3W8KA 1H5XA 2WADA 2Y2GA 2ZQ8A 5F1FA 4KZ5A 4N1XA 5DTTA 3BECA 1K6SA 5FSRA 4HESA 3C4PA 4OOLA 3GR2A 1E25A 3Q82A 3Q7VA 5FI6A 2ZC5B 2WGWA 2A3UA 1I2WA 3SH8A 4EQIA 1HD8A 3MZDA 2XH9A 1IKGA 4ZAMA 4Y0TA 3BFFA 3UDXA 2JBFA 3A3DA 2XK1A 4R0QA 5EVIC 4S2MA 1K55A 1K38A 4M3KA 5CRFA 1XP4A 1IYSA 1ZG6A 4GDBA 1PIOA 2V2FF 3BFGA 5E2EA 1XGJA 4MBFA 4A5RA 2IWCA 4KG2A 4KQRA 3SH7A 5F1GA 3V3RA 4BENA 4LCMA 5EE8A 5GHXA 3HLDA 4GKUA 1E3UD 4OPZA 3M2JA 3AGFA 4GOGA 5E2GA 5AQ7A 5GLDA 2EFXA 3IXDA 1K56D 3QHYA 4PMAA 5HFOA 1HTZA 4P6BA 4JXVA 2UWXA 3WS1A 4GD8A 3Q7ZA 4OH0A 4JLFA 1PW8A 3FYZA 4DE3A 2Y4AA 3LO7A 4NK3A 4Q8IA 4JXSA 2ZQ7A 1RP5A 3CZDA 3VP4A 3HLEA 3NDGA 5E2FA 2H0TA 2EFUA 3HUMA 1DY6A 4LV3A 3ZNYA 3A3EA 3CG5A 1FR1A 2I72A 4GDNA 4S2PA 5HL1A 3IF6B 4ZBEA 1ESIA 3O87A 4JF6A 4PPRA 1SDNA 2HDUA 2P9VB 3VMAA 3VFFA 4ZDXA 3MKEA 2EX6A 4B88A 3A3FA 3GRJA 4LCLA 1CI8A 3ZFZA 4X53A 5GL9A 4QJGA 4WBGA 2DCFA 1ERMA 3MZEA 3NCKA 3E2KA 3M6HA 1GCEA 2FFFB 2HPBA 3TG9A 3DWKA 5FATA 1RGYA 2P74A 4DE0A 4PM5A 4IBXA 1GA0A 5FAPA 1EWZA 3WRTA 3IHBA 2R9XA 1YLWA 3V50A 1E4DA 2Y2PA 3ZGAB 3N6IA 1XA7A 4GN2A 2Y2QA 2PU4A 4BJPA 4PM9A 1BLPA 1W5DA 3TSGA 2H5SA 4OONA 5FDHA 4CJNA 1K57C 3C5AA 1BZAA 1PWDA 4HBTA 3ZHHA 5FI7A 2ZQAA 4Y0OA 3UE0A 1KGGA 2Z2MB 4OPQA 5GLCA 2WAEA 3OC2A 4OQGA 1TEMA 3BFEA 4OPRA 4KZ7A 4XUZA 1NZOA 4X68A 2JC7A 4IEDA 3VP0A 1I5QA 1L2SA 1LL9A 2GDNA 4JXGA 2H0YA 2IWDA 3GTCA 3V39A 4DE2A 4KZ8A 5CHUA 1Q2PA 1RGZA 3IF6A 4S2IA 4S2LA 1IKIA 3HUOA 4DKIA 1FSYA 3M2KA 4KZ6A 3BFDA 1SCWA 1YLJA 2P9VA 4WEJA 5HX9A 3IXGA 1GHMA 1CK3A 4WZ5C 3DWZA 1VM1A 3IQAA 5BOHA 4K0WA 1YLZA 4WEKA 5DVAA 2WGVA 1E3UA 3GQZA 1KE4A 4N1HA 1YLYA 1K56A 1ZC2A 4OLDA 1DJAA 4E6XA 1SDEA 3W4OA 3ZVTA 5KMWA 4YINA 3ZDJA 1XXMA 1ES3A 3GMWA 1JTDA 4BL2A 4E3MA 5EECA 2B5RA 3C7VA 5F82A 3OPHA 1TDGA 4WYYA 2IWBA 4O7DA 1Z6FA 3UY6A 5DF8A 4XUXA 2ZC3B 1WE4A 2XF3A 3N4IA 4E3IA 3RXWA 2WZXA 4ZJ3A 3O3VA 4MEZA 3ISGA 5KSCA 5FQ9A 3VSLA 3LY4A 2BG1A 4U3TA 4RA7A 2WUQA 3BLMA 2RCXA 3VP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGN A;  4OP5 A;  3BRM A;  4OLG A;  2WKH A;  4OKP A;  4JKT A;  3CMZ A;  4EBN A;  3UE1 A;  1L0F A;  1ES2 A;  3AGE A;  3MZF A;  1G6A A;  4R4S A;  3SOI A;  1IEM A;  4PM6 A;  4GD6 A;  4JF5 A;  1XPB A;  1H8Z A;  4FSF A;  4IVK A;  3N7W A;  5DTK A;  4MNR A;  5CGX A;  4K91 A;  5DF9 A;  1FSW A;  1L0D A;  1TVF A;  2ZQC A;  4KZB A;  3RJU A;  2Y2J A;  2Y59 A;  5FQI A;  2WYX A;  4EBP A;  4P0M A;  1RCJ A;  3I7J A;  1K55 C;  3QNB A;  5GLA A;  5A90 A;  3PBR A;  2QPN A;  1KGF A;  3NDE A;  4RX2 A;  3SS5 A;  2VGJ A;  5HAQ A;  4FD8 A;  4S2K A;  3UNW A;  4C6Y A;  4Y7P A;  3OPL A;  5DF7 A;  5FI2 A;  3A3J A;  2E8I A;  1Y54 A;  2OLU A;  3V5M A;  3NBL A;  2FFY A;  3WS2 A;  4K0X A;  4L0L A;  4QY6 A;  3VP2 A;  3O88 A;  3Q81 A;  3OPP A;  5CHJ A;  4EV4 A;  4QB8 A;  3HLW A;  4JBF A;  2OSU A;  3NC8 A;  4KZ9 A;  4C75 A;  2OV5 A;  5GLB A;  1PZP A;  2BLS A;  2J9P A;  3IXH A;  2EX9 A;  2XR0 A;  1QME A;  1FCO A;  3WRZ A;  1EI5 A;  3WS0 A;  1TDL A;  3ZNT A;  3UPN A;  1N4O A;  4HBU A;  1YT4 A;  4OOM A;  3W4P A;  4P87 A;  2JE5 A;  4KEN B;  3FKV A;  1VQQ A;  3RXX A;  1XA1 A;  4LV2 A;  2QZ6 A;  3ZG9 B;  3G32 A;  4BLM A;  3LCE A;  5EOO A;  1XX2 A;  3BFC A;  3WS4 A;  3PAG A;  4KG6 A;  3TOI A;  2J8Y A;  3VP3 A;  3A3I A;  1NJ4 A;  3G34 A;  1BT5 A;  2ZQ9 A;  3LEZ A;  2J7V A;  2ZC6 B;  4LV0 A;  5IHV A;  1KE0 A;  1ZKJ A;  4PM8 A;  1BLS A;  5CTM A;  1PI5 A;  4S2J A;  1KE3 A;  4QU3 A;  4E6W A;  1K4E A;  5FQM A;  5U47 A;  1ALQ A;  1MWR A;  1SKF A;  3EQV A;  2XEP A;  4R4R A;  1BUE A;  3OCN A;  4S2O A;  5E2H A;  3BYD A;  4DXC A;  2H10 A;  4EUZ A;  1AXB A;  2Y2L A;  4JXW A;  4X6T A;  3CJM A;  1IYO A;  3MKF A;  3HLB A;  4LEN A;  3GVB A;  3G4P A;  3V3S A;  4GB7 A;  3GSG A;  1O7E A;  4BD1 A;  1MWT A;  5J8X A;  5HW3 A;  4BL3 A;  2HDS A;  3DW0 A;  3ITA A;  3JYI A;  5CGS A;  4N92 A;  1IEL A;  1YLT A;  2XD5 A;  1PYY A;  2ZD8 A;  5EUA A;  1ES5 A;  1FR6 A;  1KDS A;  4E3O A;  3WWX A;  2V1Z A;  3IWO A;  5D3O A;  5A93 A;  4ZTK A;  4GZB A;  4EBL A;  4X55 A;  1J9M A;  3IF6 C;  3BM6 A;  2EXB A;  4CPK A;  4JPM A;  4E3K A;  3UPO A;  3HL9 A;  4LV1 A;  4OQH A;  3S4X A;  1FCM A;  2C5W B;  1KGE A;  2ZM2 A;  5FQQ A;  1KVL A;  3PAE A;  4N9K A;  1M6K A;  2XFS A;  1K54 A;  2RL3 A;  3SH9 A;  2HP6 A;  1IYQ A;  4HEF A;  1ONH A;  5EVI B;  3ZG8 B;  1MXO A;  4MBH A;  2EX8 A;  4QHC A;  1YQS A;  3UPP A;  1PZO A;  4IBR A;  1CI9 A;  4FCF A;  4GNU A;  2X02 A;  1JVJ A;  2ZM8 A;  4Y0U A;  5HAR A;  3NI9 A;  1BTL A;  3IF5 A;  4P85 A;  3UDF A;  1PWG A;  4S2N A;  5A91 A;  5FQJ A;  3VSK A;  3PBT A;  3QNC A;  3IXB A;  1G68 A;  2DNS A;  5E43 A;  1W8Y A;  1K4F A;  3SS3 A;  5DTS A;  5CED A;  4UA6 A;  1C3B A;  3LY3 A;  1ES4 A;  4ZJ1 A;  5I94 A;  1BSG A;  1LL5 A;  3ITB A;  3C7U A;  5FAS A;  4WMC A;  5KSH A;  4OVD A;  4XXR A;  2Y2O A;  3MBZ A;  3D4F A;  1MY8 A;  3W4Q A;  1K6R A;  5G18 A;  2PBY A;  3Q1F A;  2Q9N A;  4IVI A;  1ZG4 A;  4OQ0 A;  5GHZ A;  1GA9 A;  3HRE A;  4R3J A;  1ERQ A;  3UDI A;  1Q2Q A;  4RX3 A;  3UE3 A;  1XGI A;  2HP5 A;  2ZQD A;  4UA7 A;  2R9W A;  5FAO A;  2EXA A;  4D2O A;  3HBR A;  3HUN A;  4FH4 A;  4KQO A;  5JYO A;  3Q07 A;  5JYP A;  3DTM A;  4H8R A;  1HZO A;  3HLC A;  4U0T A;  5EVI A;  4UA9 A;  1I2S A;  5TFQ A;  3S22 A;  1WYC A;  3HLF A;  1FOF A;  5F83 A;  2Y55 A;  2Y2I A;  4N9L A;  5M1A A;  2JCH A;  1L0G A;  4WM9 A;  1MPL A;  4DDY A;  3IT9 A;  2HDR A;  2Q9M A;  3GV9 A;  1SHV A;  1YMS A;  4OPY A;  4QD4 A;  5EOE A;  1PI4 A;  4KG5 A;  4DE1 A;  1ERO A;  4OQI A;  3G35 A;  1IYP A;  3N8R A;  3C4O A;  3ZVW A;  3PTE A;  3MFD A;  1CEF A;  1W7F A;  3IH9 A;  5FQK A;  1MKI A;  1NYY A;  3OCL A;  4MLL A;  4R23 A;  1PW1 A;  4YFM A;  2WKI A;  4RVA A;  4WMC D;  2QMI A;  4BD0 A;  1NY0 A;  4KQQ A;  1BUL A;  2WGI A;  4E3L A;  3N8S A;  1KVM A;  4F94 A;  1O07 A;  2XFT A;  3IWQ A;  4ID4 A;  1YLP A;  1FCN A;  3VFH A;  3ZG5 A;  3BEB A;  4R1G A;  3FZC A;  5KZH A;  3PBO A;  3BLS A;  5AQA A;  3AGD A;  2G2W A;  5AQB A;  1BLH A;  5HAI A;  2X01 A;  4DDS A;  5M19 A;  1LLB A;  2A49 A;  2XD1 A;  3NY4 A;  4ZJ2 A;  2ZMA A;  2VGK A;  4PM7 A;  2WAF A;  2G2U A;  3SS4 A;  1LHY A;  1U60 A;  3UN7 A;  3MXR A;  4WEL A;  5EVI D;  4R3B A;  2Y2N A;  2ZM0 A;  3FKW A;  1MWS A;  5GHY A;  2WZZ A;  3E2L A;  3G31 A;  1PWC A;  4QY5 A;  1NRF A;  5TGF A;  1W79 A;  3G2Z A;  3ZG0 A;  2ZC7 A;  4DF6 A;  3M6B A;  4OP8 A;  3EQU A;  1N9B A;  2Y2M A;  4X69 A;  3N8L A;  1DJC A;  1K57 A;  1CEG A;  1S0W A;  2V20 A;  4NET A;  3O86 A;  3IWI A;  4C3Q A;  5EPH A;  5EVL A;  4EWF A;  3S1Y A;  2PU2 A;  2WKE A;  3G30 A;  1HVB A;  3MXS A;  4KZA A;  2DRW A;  3WS5 A;  4OOY A;  2WK0 A;  2EX2 A;  3IHA A;  3FV7 A;  5CTN A;  1GHP A;  2Y2K A;  5A92 A;  1YMX A;  1XKZ A;  4UAA A;  2HP9 A;  3HLG A;  3HVF A;  3P09 A;  4UHU A;  5CHM A;  1LI9 A;  3VOY A;  3ZG7 B;  1ONG A;  2C6W B;  2X71 A;  1JWP A;  2XLN A;  4WZ4 A;  1NYM A;  1DJB A;  3Q7V B;  5CEB A;  1MWU A;  4JF4 A;  4KZ4 A;  4WZ5 A;  2WGW B;  1QMF A;  4FH2 A;  5CEC A;  1LI0 A;  1K54 C;  4KZ3 A;  3P98 A;  2ZJ9 A;  3VOZ A;  3ZCZ A;  3OZH A;  5TR7 A;  3NIA A;  2Z2L B;  2CC1 A;  1JTG A;  3IH8 A;  1M40 A;  1YM1 A;  2HDQ A;  1BLC A;  4DXB A;  3OPR A;  4B4Z A;  1MBL A;  1FQG A;  3PBQ A;  4U0X A;  4S2N C;  5HAP A;  1JWZ A;  2ZC4 B;  2OLV A;  5AQ9 A;  5CXW A;  4Z9Q A;  3G2Y A;  5FAQ A;  1W8Q A;  4BQM A;  1JWV A;  4RYE A;  2XDM A;  1GHI A;  2Y91 A;  3FWL A;  4MBK A;  4X56 A;  1NXY A;  1ESU A;  1OME A;  1L0E A;  1H8Y A;  5FA7 A;  1KDW A;  5CGW A;  4DRT A;  4E3N A;  2ZLY A;  2Y2H A;  2J9O A;  3PBS A;  5M18 A;  1NZU A;  4B4X A;  5L2F A;  3UO9 A;  4E3J A;  3PBN A;  5CER A;  1WYB A;  1K25 A;  1S6R A;  3B3X A;  2XQZ A;  3W8K A;  1H5X A;  2WAD A;  2Y2G A;  2ZQ8 A;  5F1F A;  4KZ5 A;  4N1X A;  5DTT A;  3BEC A;  1K6S A;  5FSR A;  4HES A;  3C4P A;  4OOL A;  3GR2 A;  1E25 A;  3Q82 A;  3Q7V A;  5FI6 A;  2ZC5 B;  2WGW A;  2A3U A;  1I2W A;  3SH8 A;  4EQI A;  1HD8 A;  3MZD A;  2XH9 A;  1IKG A;  4ZAM A;  4Y0T A;  3BFF A;  3UDX A;  2JBF A;  3A3D A;  2XK1 A;  4R0Q A;  5EVI C;  4S2M A;  1K55 A;  1K38 A;  4M3K A;  5CRF A;  1XP4 A;  1IYS A;  1ZG6 A;  4GDB A;  1PIO A;  2V2F F;  3BFG A;  5E2E A;  1XGJ A;  4MBF A;  4A5R A;  2IWC A;  4KG2 A;  4KQR A;  3SH7 A;  5F1G A;  3V3R A;  4BEN A;  4LCM A;  5EE8 A;  5GHX A;  3HLD A;  4GKU A;  1E3U D;  4OPZ A;  3M2J A;  3AGF A;  4GOG A;  5E2G A;  5AQ7 A;  5GLD A;  2EFX A;  3IXD A;  1K56 D;  3QHY A;  4PMA A;  5HFO A;  1HTZ A;  4P6B A;  4JXV A;  2UWX A;  3WS1 A;  4GD8 A;  3Q7Z A;  4OH0 A;  4JLF A;  1PW8 A;  3FYZ A;  4DE3 A;  2Y4A A;  3LO7 A;  4NK3 A;  4Q8I A;  4JXS A;  2ZQ7 A;  1RP5 A;  3CZD A;  3VP4 A;  3HLE A;  3NDG A;  5E2F A;  2H0T A;  2EFU A;  3HUM A;  1DY6 A;  4LV3 A;  3ZNY A;  3A3E A;  3CG5 A;  1FR1 A;  2I72 A;  4GDN A;  4S2P A;  5HL1 A;  3IF6 B;  4ZBE A;  1ESI A;  3O87 A;  4JF6 A;  4PPR A;  1SDN A;  2HDU A;  2P9V B;  3VMA A;  3VFF A;  4ZDX A;  3MKE A;  2EX6 A;  4B88 A;  3A3F A;  3GRJ A;  4LCL A;  1CI8 A;  3ZFZ A;  4X53 A;  5GL9 A;  4QJG A;  4WBG A;  2DCF A;  1ERM A;  3MZE A;  3NCK A;  3E2K A;  3M6H A;  1GCE A;  2FFF B;  2HPB A;  3TG9 A;  3DWK A;  5FAT A;  1RGY A;  2P74 A;  4DE0 A;  4PM5 A;  4IBX A;  1GA0 A;  5FAP A;  1EWZ A;  3WRT A;  3IHB A;  2R9X A;  1YLW A;  3V50 A;  1E4D A;  2Y2P A;  3ZGA B;  3N6I A;  1XA7 A;  4GN2 A;  2Y2Q A;  2PU4 A;  4BJP A;  4PM9 A;  1BLP A;  1W5D A;  3TSG A;  2H5S A;  4OON A;  5FDH A;  4CJN A;  1K57 C;  3C5A A;  1BZA A;  1PWD A;  4HBT A;  3ZHH A;  5FI7 A;  2ZQA A;  4Y0O A;  3UE0 A;  1KGG A;  2Z2M B;  4OPQ A;  5GLC A;  2WAE A;  3OC2 A;  4OQG A;  1TEM A;  3BFE A;  4OPR A;  4KZ7 A;  4XUZ A;  1NZO A;  4X68 A;  2JC7 A;  4IED A;  3VP0 A;  1I5Q A;  1L2S A;  1LL9 A;  2GDN A;  4JXG A;  2H0Y A;  2IWD A;  3GTC A;  3V39 A;  4DE2 A;  4KZ8 A;  5CHU A;  1Q2P A;  1RGZ A;  3IF6 A;  4S2I A;  4S2L A;  1IKI A;  3HUO A;  4DKI A;  1FSY A;  3M2K A;  4KZ6 A;  3BFD A;  1SCW A;  1YLJ A;  2P9V A;  4WEJ A;  5HX9 A;  3IXG A;  1GHM A;  1CK3 A;  4WZ5 C;  3DWZ A;  1VM1 A;  3IQA A;  5BOH A;  4K0W A;  1YLZ A;  4WEK A;  5DVA A;  2WGV A;  1E3U A;  3GQZ A;  1KE4 A;  4N1H A;  1YLY A;  1K56 A;  1ZC2 A;  4OLD A;  1DJA A;  4E6X A;  1SDE A;  3W4O A;  3ZVT A;  5KMW A;  4YIN A;  3ZDJ A;  1XXM A;  1ES3 A;  3GMW A;  1JTD A;  4BL2 A;  4E3M A;  5EEC A;  2B5R A;  3C7V A;  5F82 A;  3OPH A;  1TDG A;  4WYY A;  2IWB A;  4O7D A;  1Z6F A;  3UY6 A;  5DF8 A;  4XUX A;  2ZC3 B;  1WE4 A;  2XF3 A;  3N4I A;  4E3I A;  3RXW A;  2WZX A;  4ZJ3 A;  3O3V A;  4MEZ A;  3ISG A;  5KSC A;  5FQ9 A;  3VSL A;  3LY4 A;  2BG1 A;  4U3T A;  4RA7 A;  2WUQ A;  3BLM A;  2RCX A;  3VP1 A; 
#chains in the Genus database with same CATH topology
 2XGN A;  5J3W A;  2FH5 A;  3HCY A;  2PT7 A;  4JKT A;  3CMZ A;  5HPI A;  3UE1 A;  1L0F A;  1ES2 A;  3AGE A;  3MZF A;  4JF5 A;  2XA7 S;  1F9I A;  2JKF A;  3N7W A;  2L1M A;  4MNR A;  3FPW A;  2A24 B;  3RJU A;  3G6O A;  4EBP A;  4YOF A;  1RCJ A;  3NJA A;  1MKM A;  3PBR A;  2QPN A;  4RX2 A;  3SS5 A;  2Y79 A;  3UNW A;  3LID A;  4Y5F A;  4Y7P A;  1XJ3 A;  2E8I A;  3A3J A;  2OLU A;  1V9Z A;  4IHQ A;  4PHT A;  1VET A;  2JHE A;  5FEG A;  3C8C A;  5GLB A;  2JKT M;  2EX9 A;  3BWL A;  1FCO A;  3WS0 A;  1TDL A;  4HOI A;  2ZMF A;  2V8F A;  4QWO A;  1N4O A;  4OOM A;  2G7U A;  2W1T B;  3T4T A;  3KSI A;  3T12 B;  4KG6 A;  2I9V A;  4F3L A;  3A3I A;  2ZC6 B;  4YWZ A;  5DJU A;  1T1C A;  1PI5 A;  4S2J A;  1ALQ A;  1MWR A;  3MQQ A;  4R4R A;  5FL3 A;  1Y28 A;  2Y2L A;  4X6T A;  2EWV A;  3HLB A;  3T4K A;  2INW A;  3LIE A;  3MR0 A;  3GSG A;  4BD1 A;  1MWT A;  4Y13 A;  5J8X A;  5DKK A;  3JYI A;  3DW0 A;  3ITA A;  5CGS A;  4N92 A;  2XD5 A;  3DTE A;  2LB5 A;  3WWX A;  5A93 A;  4KQD A;  1ZTU A;  2ZM2 A;  4B93 A;  3S7O A;  3CUE A;  2X02 A;  2EWW A;  2ZM8 A;  3MQO A;  1PWG A;  3LR5 A;  3IXB A;  1G68 A;  5E43 A;  2HV1 A;  5CED A;  3LY3 A;  4G3K A;  4ZJ1 A;  1LL5 A;  3ITB A;  1TS0 A;  5FAS A;  1MY8 A;  2VV7 A;  1K6R A;  5G18 A;  3Q1F A;  4OQ0 A;  3CPT B;  1GA9 A;  4R3J A;  2VZW A;  5IS1 A;  2XSS A;  3HBR A;  3HUN A;  4KQO A;  3BY8 A;  3EWK A;  4GCZ A;  4FOF A;  4U0T A;  1I2S A;  4N9L A;  5M1A A;  2JCH A;  4DDY A;  3GV9 A;  1SHV A;  1P9W A;  4QD4 A;  5EOE A;  4KG5 A;  4DE1 A;  3CAX A;  1ERO A;  3ZQ5 A;  5EM1 A;  3G35 A;  1SKO B;  3C4O A;  1GSV A;  2AVX A;  2O0Y A;  1PW1 A;  3OOV A;  1ODV A;  3LIB A;  1O07 A;  2XFT A;  3ZG5 A;  2W3H A;  5AJG A;  5DFX A;  5AQB A;  4DDS A;  5M19 A;  1LLB A;  2J3W A;  2XD1 A;  3E0Y A;  2G2U A;  1LHY A;  1U60 A;  2OOL A;  3UN7 A;  5KIZ A;  4WEL A;  2Y2N A;  3FKW A;  5GHY A;  1VEU B;  4QY5 A;  3G2Z A;  1K57 A;  2D02 A;  3EEA A;  4O8G A;  3O86 A;  5EVL A;  3S1Y A;  2ACG A;  2B95 A;  2DRW A;  3A0S A;  4OOY A;  4D60 A;  1GSX A;  3IHA A;  3UB9 A;  5CTN A;  1GHP A;  5CHM A;  1XKZ A;  2C6W B;  1IFQ A;  3CLO A;  1DP6 A;  4LRX C;  3KO6 A;  5CEB A;  2O9A A;  4WZ5 A;  5I5L A;  5IT5 A;  4CLC B;  1HLU P;  1G6O A;  1OT6 A;  3OZH A;  2CC1 A;  2XRN A;  2J3T D;  1YM1 A;  2PHY A;  1FQG A;  4S2N C;  1JWZ A;  5L10 A;  4WLA A;  2VJW A;  2XDM A;  1ESU A;  1L0E A;  1G5U A;  2NUP C;  4E3J A;  4X1L A;  1K25 A;  2XQZ A;  4YNR A;  5DJT A;  4MN6 A;  2Y2G A;  2ZQ8 A;  4KZ5 A;  5DTT A;  1E25 A;  1P0Z A;  3Q82 A;  5FI6 A;  2ZC5 B;  3MZD A;  4JGR A;  3A3D A;  2XK1 A;  3S7Q A;  1YAX A;  1K55 A;  1K38 A;  5CRF A;  2V0W A;  5E2E A;  3A0R A;  5F1G A;  4LCM A;  3HLD A;  5AQ7 A;  3KSH A;  4JXV A;  3WS1 A;  3Q7Z A;  4JLF A;  4NK3 A;  1RP5 A;  3HLE A;  3A3E A;  3UME A;  3IF6 B;  2YKF A;  1SDN A;  4K08 A;  1OJG A;  2P9V B;  3MKE A;  3LIA A;  3O5Y A;  2W3E A;  4B88 A;  1CI8 A;  1ERM A;  3DWK A;  3UB6 A;  1P9R A;  1GA0 A;  3WRT A;  3IHB A;  2BTF P;  3V50 A;  1E4D A;  2LB9 A;  1D7E A;  3TSG A;  4CJN A;  5K5B A;  3C5A A;  1KGG A;  4OQG A;  1NZO A;  1L2S A;  4KZ8 A;  2H28 A;  1D06 A;  4S2L A;  1XFN A;  1IKI A;  4DKI A;  2JKT I;  3IS2 A;  4NKP A;  4P6Z M;  1CK3 A;  4EEU A;  4K0W A;  4WEK A;  5DVA A;  1KE4 A;  1CJF A;  3JVU A;  2K7S A;  1SDE A;  3K2N A;  1XXM A;  3GMW A;  4E3M A;  1YSQ A;  4O7D A;  4I38 A;  2ZC3 B;  1TS7 A;  3KSF A;  2XF3 A;  4E3I A;  3T4L A;  3O3V A;  4MEZ A;  3RTY A;  4Q0J A;  1VET B;  1YSP A;  3T1S A;  3VSL A;  3LY4 A;  1EW0 A;  2BG1 A;  2WUQ A;  3VP1 A;  3U4L P;  5G4Z A;  3H7W B;  4HP9 A;  3KSG A;  4EBN A;  2JKR M;  1G6A A;  2GJ3 A;  4PM6 A;  4ESP A;  4FSF A;  4IVK A;  3H9W A;  5CGX A;  4K91 A;  4KZB A;  2Y2J A;  2Y59 A;  4CLC C;  3EGX C;  4P0M A;  3EOI A;  5C5K A;  3QNB A;  3NDE A;  2VGJ A;  5HAQ A;  4FD8 A;  2NUT C;  4C6Y A;  5DF7 A;  5FI2 A;  2O99 A;  5CHJ A;  1FIL A;  4KZ9 A;  3A0V A;  2J9P A;  3F1O B;  1DP9 A;  1UWN X;  2O9B A;  4LRY C;  1EI5 A;  4HBU A;  1VQQ A;  1XA1 A;  2QZ6 A;  3ZG9 B;  3G32 A;  2J3T C;  5F69 A;  3PAG A;  3TOI A;  3VP3 A;  1BT5 A;  4CLC E;  3LEZ A;  2J7V A;  3KYE A;  4LV0 A;  1KE0 A;  4PKY G;  4PM8 A;  1W63 Q;  1JNU A;  4E6W A;  5U47 A;  3LEQ A;  4EU0 A;  2K31 A;  1SKF A;  2XEP A;  1BUE A;  4S2O A;  2H10 A;  4JXW A;  3GVB A;  4GB7 A;  4NXB A;  2HGV A;  1IEL A;  1PYY A;  5HDC A;  1S1Y A;  4GW9 A;  4E3O A;  2GNX A;  4ZTK A;  3T4O A;  4EBL A;  3IF6 C;  4CPK A;  2EXB A;  4E3K A;  4OQH A;  1KGE A;  1KVL A;  3PAE A;  4EQ1 A;  4XT2 A;  1ONH A;  3ZG8 B;  3V67 A;  1CI9 A;  2V0U A;  1Y4O A;  4P85 A;  3PBT A;  3QNC A;  3UB7 A;  2DNS A;  1W8Y A;  1ES4 A;  1LSX A;  1BSG A;  2K2N A;  3C7U A;  4WMC A;  5KSH A;  3NOT C;  4FTX A;  4OVD A;  3D4F A;  3QP5 A;  3UDI A;  1Q2Q A;  4RX3 A;  4IJG A;  3UE3 A;  2HP5 A;  3MF0 A;  4H8R A;  5EVI A;  3S22 A;  4UQI M;  4LPZ A;  3F1P A;  3HLF A;  5F83 A;  2Y55 A;  3IT9 A;  2HDR A;  2A2L A;  3D72 A;  1YMS A;  1OT9 A;  3RFB A;  3KYQ A;  4OQI A;  2W27 A;  4LRZ E;  3ZVW A;  2FZ0 A;  3PTE A;  1W7F A;  3IH9 A;  5FQK A;  1MKI A;  4R23 A;  3HJI A;  3OCL A;  4RVA A;  1VHM A;  1NY0 A;  4HH2 A;  2ZBB A;  3TW8 A;  1XJ2 A;  3IWQ A;  5KZH A;  5AQA A;  3AGD A;  3BJN A;  4ZJ2 A;  4PM7 A;  1ACF A;  3MXR A;  4HI4 A;  2ZM0 A;  4GHI A;  3G31 A;  1PWC A;  2PR6 A;  1W79 A;  1H3Q A;  3M6B A;  5HWW A;  4X69 A;  1DJC A;  1S0W A;  3PR6 A;  5MC7 A;  5EPH A;  2PU2 A;  2KDK A;  2WKE A;  3G30 A;  3MXS A;  4KZA A;  4EW7 A;  5CX7 A;  2KX6 A;  3VV4 A;  4FUW A;  2Y2K A;  5A92 A;  4KUK A;  2ZL1 A;  4UHU A;  1LSW A;  2HP9 A;  3HLG A;  3P09 A;  1DRM A;  2XLN A;  3VOL A;  4WZ4 A;  3H82 A;  1NYM A;  4JF4 A;  4KZ4 A;  4HQA A;  1QMF A;  4FH2 A;  5CEC A;  1TD5 A;  2PR5 A;  3VE4 A;  3VOZ A;  5TR7 A;  3CUE C;  2Z2L B;  4B4Z A;  1MBL A;  4CQH A;  3PBQ A;  4U0X A;  3QP1 A;  5HPF A;  2OLV A;  4BBU A;  3G2Y A;  2W3F A;  3MXQ A;  1J3W A;  2XA7 M;  5HWV A;  5FA7 A;  5CGW A;  2Y2H A;  2J9O A;  5L2F A;  1W63 M;  3PBN A;  2VV8 A;  4JGO A;  1H5X A;  5J7E A;  1TS6 A;  3BEC A;  1K6S A;  1BYW A;  3L7H A;  3GR2 A;  4X1M A;  3K3D A;  2WGW A;  2A3U A;  1I2W A;  3SH8 A;  1F98 A;  1IKG A;  1OTI A;  4ZAM A;  3K3C A;  3BFF A;  4Y0T A;  4R0Q A;  4Y2F A;  4M3K A;  5TBM A;  1PIO A;  2IWC A;  3SH7 A;  3V3R A;  3LIF A;  4GKU A;  4EET B;  3AGF A;  3FPV A;  5E2G A;  1CF0 A;  2PAV P;  3T50 A;  3OBF A;  5HFO A;  1T18 A;  4DE3 A;  2Y4A A;  4LLO B;  3UE6 A;  1T19 A;  4NXF A;  2O9C A;  2H0T A;  4LV3 A;  3ZNY A;  3CG5 A;  4S2P A;  4DJ2 A;  4JF6 A;  3IS2 B;  3VFF A;  3NHQ A;  2VEA A;  2JKR I;  3A3F A;  3GRJ A;  2E8J A;  4X53 A;  3ZFZ A;  4WBG A;  3KX0 X;  1S4R A;  4CLC D;  4IUH A;  3TG9 A;  1RGY A;  3NEC A;  1EWZ A;  3LGO A;  1Z09 A;  2ZOH A;  4GN2 A;  2Y2Q A;  5AVF A;  5FDH A;  2VGL M;  1K57 C;  3U2A A;  2ZQA A;  4OPQ A;  5GLC A;  2WAE A;  4II7 A;  3DTK A;  1TEM A;  3BFE A;  4XUZ A;  4R70 A;  4IED A;  4JXG A;  2H0Y A;  3GTC A;  3BY9 A;  4HJ3 A;  3V39 A;  5CHU A;  1Q2P A;  2OAP 1;  1RGZ A;  4S2I A;  4WUJ A;  3M2K A;  4ETZ A;  5HX9 A;  1GHM A;  3HJK A;  4WZ5 C;  4E04 A;  1VM1 A;  2WGV A;  1E3U A;  2ZMV A;  3F1N A;  3GQZ A;  1P97 A;  4N1H A;  1K56 A;  4OLD A;  3ZYT A;  4YIN A;  2QHK A;  2VK3 A;  4BL2 A;  5F82 A;  1TDG A;  1OPX A;  4WYY A;  1Z6F A;  3DBA A;  4WF0 A;  3PYP A;  1S4S A;  2WZX A;  4Q0H A;  4P6Z S;  5KSC A;  3RH8 B;  5FQ9 A;  4HHD A;  2RCX A;  4OP5 A;  3BRM A;  2WKH A;  1IEM A;  3QP8 A;  1H8Z A;  5DTK A;  1FSW A;  1L0D A;  1NWZ A;  5FQI A;  5IU1 A;  5HSQ A;  3I7J A;  1SZV A;  1K55 C;  5A90 A;  4AFI A;  4KUO A;  1KGF A;  3JVV A;  4S2K A;  1UWP X;  3LFV A;  3OPL A;  4I3J A;  2BAS A;  4K0X A;  4L0L A;  3OPP A;  4G3W A;  4QB8 A;  3HLW A;  4JBF A;  4IUK A;  2XR0 A;  1QME A;  4L9F A;  3WRZ A;  3ZNT A;  3W4P A;  4P87 A;  3CPT A;  4KEN B;  3QP6 A;  4JGQ A;  4LV2 A;  1XX2 A;  1OTB A;  4XT2 B;  1A0K A;  3MJQ A;  1ZKJ A;  1BLS A;  3LR4 A;  1K0K A;  1KE3 A;  4QU3 A;  5FQM A;  3C30 A;  3LYX A;  3OCN A;  2OAQ 1;  5HWT A;  3BYD A;  4EUZ A;  2PDR A;  4I3I A;  5HDD A;  3G4P A;  1KOU A;  1XFQ A;  2HDS A;  2WKP A;  3B33 A;  1ES5 A;  1FR6 A;  1KDS A;  3R7W A;  1IOU A;  4HP4 A;  5D3O A;  4GZB A;  2W0N A;  2OWJ A;  3BM6 A;  3UPO A;  3HL9 A;  3S4X A;  1FCM A;  5FQQ A;  2V8C A;  1M6K A;  3IBR A;  1K54 A;  2RL3 A;  5EVI B;  1IYQ A;  4HEF A;  1MXO A;  3C2W A;  2EX8 A;  1YQS A;  3UPP A;  4ARZ A;  4GJ4 A;  4FCF A;  3QP2 A;  4GNU A;  5FDS A;  1JVJ A;  4Y0U A;  3NI9 A;  3IF5 A;  3UDF A;  5A91 A;  3VSK A;  2VV6 A;  1K4F A;  1C3B A;  3GEC A;  2GZA A;  4HJ4 A;  4WN5 A;  2B18 A;  4XXR A;  3MBZ A;  3W4Q A;  1S1Z A;  3DTI A;  3L9K A;  1ZG4 A;  2PBD P;  2HZ5 A;  2WKQ A;  1XJ4 A;  1XGI A;  1ZHH B;  3T4J A;  1DP8 A;  2ZQD A;  4F3L B;  5FAO A;  2PRF A;  3T4S A;  1S66 L;  1MC0 A;  1HZO A;  3HLC A;  2W3D A;  1FOF A;  2Y2I A;  3PXP A;  4WM9 A;  1MPL A;  4GHI B;  3E4Q A;  3BW6 A;  4OPY A;  1PI4 A;  3IBJ A;  3T4Q A;  1IYP A;  3D3O A;  2VX8 A;  4MN5 A;  4UQI S;  3MS6 A;  1D1J A;  3FC7 A;  2WKI A;  2QMI A;  1XJ6 A;  2WGI A;  4E3L A;  3N8S A;  4ID4 A;  3VFH A;  3BEB A;  4R1G A;  3MSH A;  3FZC A;  4ETX A;  2W3G A;  2G2W A;  1BLH A;  2X01 A;  2A49 A;  5HD5 A;  1N9L A;  2VGK A;  2WAF A;  3SS4 A;  4DN0 A;  4R3B A;  5TJJ A;  1MWS A;  2HJE A;  5TGF A;  1NRF A;  2XRO A;  5F6A A;  1N9O A;  3ZG0 A;  2ZC7 A;  4DF6 A;  3TJZ C;  4OP8 A;  2Y2M A;  3N8L A;  1CEG A;  2V20 A;  2QWS A;  4C3Q A;  4JGP A;  4EWF A;  4BBV A;  5L8M A;  1HVB A;  2EX2 A;  1PNE A;  3FV7 A;  4HNB A;  3LI8 A;  1YMX A;  3HVF A;  3S7P A;  1PRQ A;  3VOY A;  1ONG A;  4R38 A;  2X71 A;  1MWU A;  4WL9 A;  2WGW B;  2VA0 A;  4HY8 A;  1LI0 A;  2ZJ9 A;  2GX5 A;  3ZCZ A;  3NIA A;  5F68 A;  3IH8 A;  1M40 A;  4DXB A;  4H6J A;  5FAQ A;  1W8Q A;  2Y91 A;  4X56 A;  1NXY A;  3LUQ A;  1OME A;  4I3A A;  4DRT A;  1KDW A;  4E3N A;  3FG8 A;  4B4X A;  4HIA A;  5CER A;  1WYB A;  4MCW A;  1S6R A;  3B3X A;  3KYZ A;  5F1F A;  2L0W A;  4N1X A;  3C4P A;  4OOL A;  4DJ3 A;  1OTD A;  3Q7V A;  4NXE A;  4EQI A;  2XH9 A;  2JBF A;  2ZOI A;  5EVI C;  1N9N A;  4S2M A;  4GS9 A;  1XP4 A;  3BFG A;  1XGJ A;  4A5R A;  4KQR A;  4KG2 A;  4BEN A;  5GHX A;  1E3U D;  4OPZ A;  4GOG A;  2PYP A;  4M4X A;  1K56 D;  4PMA A;  2UWX A;  1PW8 A;  1S67 L;  2J80 A;  3FYZ A;  3LR3 A;  4Y17 A;  2Z6C A;  5E2F A;  1VB6 A;  3HUM A;  1DY6 A;  2P7J A;  3SW1 A;  4GDN A;  5HL1 A;  1ESI A;  3O87 A;  3H7W A;  2HDU A;  3C38 A;  3VMA A;  1FIK A;  5FEF A;  4O01 A;  2EA9 A;  2DCF A;  3F1N B;  3NCK A;  3E2K A;  1GCE A;  2HPB A;  5FAT A;  4DE0 A;  4IBX A;  3TE8 A;  2R9X A;  3ZGA B;  3N6I A;  2PU4 A;  1BLP A;  4OON A;  1BZA A;  1PWD A;  4HBT A;  3IX3 A;  5FI7 A;  3OC2 A;  3SZT A;  4OPR A;  4X68 A;  1I5Q A;  1LL9 A;  2GDN A;  2IWD A;  4DE2 A;  3QP4 A;  3F1O A;  3HUO A;  4KZ6 A;  2VGL S;  4WEJ A;  4L9G A;  3IXG A;  4PAU A;  3IQA A;  5BOH A;  1YLZ A;  3CI6 A;  4NG2 A;  2M7U A;  3LR0 A;  1ZC2 A;  5KMW A;  3UMD A;  3ZDJ A;  1NRJ A;  1ES3 A;  1JTD A;  2KLI A;  3C7V A;  3OPH A;  2IWB A;  5DF8 A;  1WE4 A;  1V9Y A;  3RXW A;  2QJ5 A;  4ZJ3 A;  1GSW A;  1LSV A;  4R6L A;  1OTA A;  3CHW P;  4OLG A;  4OKP A;  1STZ A;  4R4S A;  3SOI A;  4GD6 A;  1XPB A;  4NEE D;  3E4P A;  5DF9 A;  2ZQC A;  1TVF A;  2WYX A;  5GLA A;  4EUV A;  3D9Y A;  1Y54 A;  3V5M A;  3NBL A;  2FFY A;  3WS2 A;  3NUL A;  3LI9 A;  3MQ0 A;  4QY6 A;  3VP2 A;  3O88 A;  3Q81 A;  4EV4 A;  2QJ7 A;  2OWH A;  2OSU A;  3NC8 A;  4C75 A;  2OV5 A;  1PZP A;  2BLS A;  3IXH A;  1YPR A;  4O0P A;  3R7W B;  4Q0I A;  1TS8 A;  3UPN A;  1YT4 A;  5EM0 A;  2JE5 A;  2UV0 E;  3FKV A;  3RXX A;  3ULF A;  3B47 A;  4BLM A;  3LCE A;  2A24 A;  5EOO A;  4DMZ A;  3BFC A;  3WS4 A;  5L09 A;  2J8Y A;  1NJ4 A;  3G34 A;  2V1A A;  5HL6 A;  2ZQ9 A;  5IHV A;  1X0O A;  1LL8 A;  1L3L A;  5CTM A;  4ARZ B;  1K4E A;  4ZRR A;  2PYR A;  2B02 A;  3VE3 A;  3EQV A;  5E2H A;  1MZU A;  4DXC A;  1F5M A;  1AXB A;  3CJM A;  1IYO A;  2R78 A;  3MKF A;  4LEN A;  3V3S A;  1O7E A;  4LGW A;  5HW3 A;  3R4K A;  4BL3 A;  1LT0 A;  4GLQ A;  3B42 A;  1YLT A;  2ZD8 A;  5EUA A;  2Y8H A;  2V1Z A;  3IWO A;  4X55 A;  1J9M A;  3E98 A;  4JPM A;  4EES A;  4LV1 A;  3E4O A;  2C5W B;  2W1T A;  4N9K A;  2XFS A;  3T1X A;  1H0M A;  3SH9 A;  2HP6 A;  4MBH A;  4QHC A;  1PZO A;  1WA9 A;  4IBR A;  4HH3 A;  4G3V A;  2PD8 A;  5HAR A;  1BTL A;  4S2N A;  5FQJ A;  1NLY A;  5HDS A;  3SS3 A;  5DTS A;  4UA6 A;  3CWF A;  5I94 A;  5LBR A;  2CMN A;  2Y2O A;  2PBY A;  2Q9N A;  4IVI A;  5GHZ A;  3HRE A;  1ERQ A;  3S7N A;  4UA7 A;  2R9W A;  4D2O A;  2EXA A;  4FH4 A;  5JYO A;  3Q07 A;  5JYP A;  3DTM A;  4L9E A;  5TFQ A;  4UA9 A;  1WYC A;  1L0G A;  3NOP C;  2Q9M A;  1AWI A;  2WKR A;  1F2K A;  4Z1W A;  2VLG A;  3N8R A;  2HF6 A;  3MFD A;  1CEF A;  5HD3 A;  5EV0 A;  4YFM A;  1NYY A;  4MLL A;  4WMC D;  4BD0 A;  4KQQ A;  1BUL A;  1KVM A;  4F94 A;  4MMN A;  1YLP A;  1FCN A;  3PBO A;  1T1A A;  3BLS A;  4NXG A;  5HAI A;  4B9O A;  3NY4 A;  3UB5 P;  2ZMA A;  4PKY A;  2DMW A;  5EVI D;  4EER A;  4R3A A;  2WZZ A;  4H6J B;  3E2L A;  3PHY A;  4ME4 A;  3EQU A;  1N9B A;  2P04 A;  1SKO A;  4QPR A;  4NET A;  3IWI A;  5EVE A;  5EFW A;  3WS5 A;  2WK0 A;  2QKP A;  1UGU A;  4UAA A;  3ZG7 B;  2JKG A;  3EEH A;  1LI9 A;  2M7V A;  5J4E A;  1JWP A;  1DJB A;  3Q7V B;  5AVE A;  3F1P B;  2MJ6 A;  2PD7 A;  5DKL A;  1K54 C;  4KZ3 A;  3P98 A;  4GS9 B;  4BMW A;  3ICY A;  1JTG A;  2HDQ A;  1BLC A;  3OPR A;  4RQ9 A;  1VEU A;  4MDZ A;  5HAP A;  2ZC4 B;  5AQ9 A;  3LIC A;  5CXW A;  4Z9Q A;  4BQM A;  2M1C A;  1JWV A;  4RYE A;  1GHI A;  3FWL A;  4MBK A;  3P7N A;  1H8Y A;  2ZLY A;  3PBS A;  5M18 A;  1NZU A;  3UO9 A;  3EGD C;  3W8K A;  2WAD A;  3UB8 A;  5FSR A;  4HES A;  1G28 A;  3BQA A;  1CQA A;  3IX8 A;  1HD8 A;  3IX4 A;  3UDX A;  4CLC A;  3T1Q B;  1IYS A;  1ZG6 A;  2KOI A;  2V2F F;  4GDB A;  2L4R A;  4MBF A;  4Y15 A;  3BQ8 A;  5EE8 A;  1H8M A;  1T1B A;  4I5S A;  4X25 A;  3M2J A;  5GLD A;  2EFX A;  3IXD A;  3QHY A;  1HTZ A;  4P6B A;  4GD8 A;  3TRC A;  4OH0 A;  4I39 A;  1YKD A;  3LO7 A;  4Q8I A;  4JXS A;  2ZQ7 A;  2ZL1 B;  3CZD A;  3VP4 A;  3NDG A;  2EFU A;  5F5Y A;  2HJ9 C;  3JPU A;  3H82 B;  2P08 A;  5L07 A;  1FR1 A;  2I72 A;  1NLZ A;  2W1R A;  4EXO A;  4ZBE A;  4HJ6 A;  4PPR A;  4BBT A;  5A8B A;  4ZDX A;  2Q0O A;  2EX6 A;  4LCL A;  2V1B A;  4QJG A;  5GL9 A;  5DFY A;  3NOU C;  1OTE A;  2QYB A;  3MZE A;  3DAV A;  5G4Y A;  3M6H A;  2FFF B;  2P74 A;  4PM5 A;  3MFX A;  3P01 A;  5FAP A;  1YLW A;  2Y2P A;  3MMH A;  2IA2 A;  3W2Z A;  1XA7 A;  4BJP A;  3OLO A;  4PM9 A;  1W5D A;  2H5S A;  2V9A A;  2VKS A;  3ZHH A;  4Y0O A;  3UE0 A;  2Z2M B;  4KZ7 A;  2JC7 A;  3VP0 A;  5HZH A;  4Y3I A;  3T1R A;  2D01 A;  3IF6 A;  1FSY A;  3BFD A;  1SCW A;  1YLJ A;  4LFU A;  2P9V A;  5TBM B;  3DWZ A;  1PFL A;  1YLY A;  1DJA A;  4E6X A;  3W4O A;  3ZVT A;  3GDI A;  4BWI A;  2YKH A;  5EEC A;  2B5R A;  3UY6 A;  2JN7 A;  4XUX A;  1TF1 A;  4UEY A;  3N4I A;  2Z6D A;  4EEP A;  3CIT A;  3ISG A;  4U3T A;  4RA7 A;  1OJ5 A;  3BLM A;  4MN7 A; 
#chains in the Genus database with same CATH homology
 2XGN A;  4OP5 A;  3BRM A;  4OLG A;  2WKH A;  4OKP A;  4JKT A;  3CMZ A;  4EBN A;  3UE1 A;  1L0F A;  1ES2 A;  3AGE A;  3MZF A;  1G6A A;  4R4S A;  3SOI A;  1IEM A;  4PM6 A;  4GD6 A;  4JF5 A;  1XPB A;  1H8Z A;  4FSF A;  4IVK A;  3N7W A;  5DTK A;  4MNR A;  5CGX A;  4K91 A;  5DF9 A;  1FSW A;  1L0D A;  1TVF A;  2ZQC A;  4KZB A;  3RJU A;  2Y2J A;  2Y59 A;  5FQI A;  2WYX A;  4EBP A;  4P0M A;  1RCJ A;  3I7J A;  1K55 C;  3QNB A;  5GLA A;  5A90 A;  3PBR A;  2QPN A;  1KGF A;  3NDE A;  4RX2 A;  3SS5 A;  2VGJ A;  5HAQ A;  4FD8 A;  4S2K A;  3UNW A;  4C6Y A;  4Y7P A;  3OPL A;  5DF7 A;  5FI2 A;  3A3J A;  2E8I A;  1Y54 A;  2OLU A;  3V5M A;  3NBL A;  2FFY A;  3WS2 A;  4K0X A;  4L0L A;  4QY6 A;  3VP2 A;  3O88 A;  3Q81 A;  3OPP A;  5CHJ A;  4EV4 A;  4QB8 A;  3HLW A;  4JBF A;  2OSU A;  3NC8 A;  4KZ9 A;  4C75 A;  2OV5 A;  5GLB A;  1PZP A;  2BLS A;  2J9P A;  3IXH A;  2EX9 A;  2XR0 A;  1QME A;  1FCO A;  3WRZ A;  1EI5 A;  3WS0 A;  1TDL A;  3ZNT A;  3UPN A;  1N4O A;  4HBU A;  1YT4 A;  4OOM A;  3W4P A;  4P87 A;  2JE5 A;  4KEN B;  3FKV A;  1VQQ A;  3RXX A;  1XA1 A;  4LV2 A;  2QZ6 A;  3ZG9 B;  3G32 A;  4BLM A;  3LCE A;  5EOO A;  1XX2 A;  3BFC A;  3WS4 A;  3PAG A;  4KG6 A;  3TOI A;  2J8Y A;  3VP3 A;  3A3I A;  1NJ4 A;  3G34 A;  1BT5 A;  2ZQ9 A;  3LEZ A;  2J7V A;  2ZC6 B;  4LV0 A;  5IHV A;  1KE0 A;  1ZKJ A;  4PM8 A;  1BLS A;  5CTM A;  1PI5 A;  4S2J A;  1KE3 A;  4QU3 A;  4E6W A;  1K4E A;  5FQM A;  5U47 A;  1ALQ A;  1MWR A;  1SKF A;  3EQV A;  2XEP A;  4R4R A;  1BUE A;  3OCN A;  4S2O A;  5E2H A;  3BYD A;  4DXC A;  2H10 A;  4EUZ A;  1AXB A;  2Y2L A;  4JXW A;  4X6T A;  3CJM A;  1IYO A;  3MKF A;  3HLB A;  4LEN A;  3GVB A;  3G4P A;  3V3S A;  4GB7 A;  3GSG A;  1O7E A;  4BD1 A;  1MWT A;  5J8X A;  5HW3 A;  4BL3 A;  2HDS A;  3DW0 A;  3ITA A;  3JYI A;  5CGS A;  4N92 A;  1IEL A;  1YLT A;  2XD5 A;  1PYY A;  2ZD8 A;  5EUA A;  1ES5 A;  1FR6 A;  1KDS A;  4E3O A;  3WWX A;  2V1Z A;  3IWO A;  5D3O A;  5A93 A;  4ZTK A;  4GZB A;  4EBL A;  4X55 A;  1J9M A;  3IF6 C;  3BM6 A;  2EXB A;  4CPK A;  4JPM A;  4E3K A;  3UPO A;  3HL9 A;  4LV1 A;  4OQH A;  3S4X A;  1FCM A;  2C5W B;  1KGE A;  2ZM2 A;  5FQQ A;  1KVL A;  3PAE A;  4N9K A;  1M6K A;  2XFS A;  1K54 A;  2RL3 A;  3SH9 A;  2HP6 A;  1IYQ A;  4HEF A;  1ONH A;  5EVI B;  3ZG8 B;  1MXO A;  4MBH A;  2EX8 A;  4QHC A;  1YQS A;  3UPP A;  1PZO A;  4IBR A;  1CI9 A;  4FCF A;  4GNU A;  2X02 A;  1JVJ A;  2ZM8 A;  4Y0U A;  5HAR A;  3NI9 A;  1BTL A;  3IF5 A;  4P85 A;  3UDF A;  1PWG A;  4S2N A;  5A91 A;  5FQJ A;  3VSK A;  3PBT A;  3QNC A;  3IXB A;  1G68 A;  2DNS A;  5E43 A;  1W8Y A;  1K4F A;  3SS3 A;  5DTS A;  5CED A;  4UA6 A;  1C3B A;  3LY3 A;  1ES4 A;  4ZJ1 A;  5I94 A;  1BSG A;  1LL5 A;  3ITB A;  3C7U A;  5FAS A;  4WMC A;  5KSH A;  4OVD A;  4XXR A;  2Y2O A;  3MBZ A;  3D4F A;  1MY8 A;  3W4Q A;  1K6R A;  5G18 A;  2PBY A;  3Q1F A;  2Q9N A;  4IVI A;  1ZG4 A;  4OQ0 A;  5GHZ A;  1GA9 A;  3HRE A;  4R3J A;  1ERQ A;  3UDI A;  1Q2Q A;  4RX3 A;  3UE3 A;  1XGI A;  2HP5 A;  2ZQD A;  4UA7 A;  2R9W A;  5FAO A;  2EXA A;  4D2O A;  3HBR A;  3HUN A;  4FH4 A;  4KQO A;  5JYO A;  3Q07 A;  5JYP A;  3DTM A;  4H8R A;  1HZO A;  3HLC A;  4U0T A;  5EVI A;  4UA9 A;  1I2S A;  5TFQ A;  3S22 A;  1WYC A;  3HLF A;  1FOF A;  5F83 A;  2Y55 A;  2Y2I A;  4N9L A;  5M1A A;  2JCH A;  1L0G A;  4WM9 A;  1MPL A;  4DDY A;  3IT9 A;  2HDR A;  2Q9M A;  3GV9 A;  1SHV A;  1YMS A;  4OPY A;  4QD4 A;  5EOE A;  1PI4 A;  4KG5 A;  4DE1 A;  1ERO A;  4OQI A;  3G35 A;  1IYP A;  3N8R A;  3C4O A;  3ZVW A;  3PTE A;  3MFD A;  1CEF A;  1W7F A;  3IH9 A;  5FQK A;  1MKI A;  1NYY A;  3OCL A;  4MLL A;  4R23 A;  1PW1 A;  4YFM A;  2WKI A;  4RVA A;  4WMC D;  2QMI A;  4BD0 A;  1NY0 A;  4KQQ A;  1BUL A;  2WGI A;  4E3L A;  3N8S A;  1KVM A;  4F94 A;  1O07 A;  2XFT A;  3IWQ A;  4ID4 A;  1YLP A;  1FCN A;  3VFH A;  3ZG5 A;  3BEB A;  4R1G A;  3FZC A;  5KZH A;  3PBO A;  3BLS A;  5AQA A;  3AGD A;  2G2W A;  5AQB A;  1BLH A;  5HAI A;  2X01 A;  4DDS A;  5M19 A;  1LLB A;  2A49 A;  2XD1 A;  3NY4 A;  4ZJ2 A;  2ZMA A;  2VGK A;  4PM7 A;  2WAF A;  2G2U A;  3SS4 A;  1LHY A;  1U60 A;  3UN7 A;  3MXR A;  4WEL A;  5EVI D;  4R3B A;  2Y2N A;  2ZM0 A;  3FKW A;  1MWS A;  5GHY A;  2WZZ A;  3E2L A;  3G31 A;  1PWC A;  4QY5 A;  1NRF A;  5TGF A;  1W79 A;  3G2Z A;  3ZG0 A;  2ZC7 A;  4DF6 A;  3M6B A;  4OP8 A;  3EQU A;  1N9B A;  2Y2M A;  4X69 A;  3N8L A;  1DJC A;  1K57 A;  1CEG A;  1S0W A;  2V20 A;  4NET A;  3O86 A;  3IWI A;  4C3Q A;  5EPH A;  5EVL A;  4EWF A;  3S1Y A;  2PU2 A;  2WKE A;  3G30 A;  1HVB A;  3MXS A;  4KZA A;  2DRW A;  3WS5 A;  4OOY A;  2WK0 A;  2EX2 A;  3IHA A;  3FV7 A;  5CTN A;  1GHP A;  2Y2K A;  5A92 A;  1YMX A;  1XKZ A;  4UAA A;  2HP9 A;  3HLG A;  3HVF A;  3P09 A;  4UHU A;  5CHM A;  1LI9 A;  3VOY A;  3ZG7 B;  1ONG A;  2C6W B;  2X71 A;  1JWP A;  2XLN A;  4WZ4 A;  1NYM A;  1DJB A;  3Q7V B;  5CEB A;  1MWU A;  4JF4 A;  4KZ4 A;  4WZ5 A;  2WGW B;  1QMF A;  4FH2 A;  5CEC A;  1LI0 A;  1K54 C;  4KZ3 A;  3P98 A;  2ZJ9 A;  3VOZ A;  3ZCZ A;  3OZH A;  5TR7 A;  3NIA A;  2Z2L B;  2CC1 A;  1JTG A;  3IH8 A;  1M40 A;  1YM1 A;  2HDQ A;  1BLC A;  4DXB A;  3OPR A;  4B4Z A;  1MBL A;  1FQG A;  3PBQ A;  4U0X A;  4S2N C;  5HAP A;  1JWZ A;  2ZC4 B;  2OLV A;  5AQ9 A;  5CXW A;  4Z9Q A;  3G2Y A;  5FAQ A;  1W8Q A;  4BQM A;  1JWV A;  4RYE A;  2XDM A;  1GHI A;  2Y91 A;  3FWL A;  4MBK A;  4X56 A;  1NXY A;  1ESU A;  1OME A;  1L0E A;  1H8Y A;  5FA7 A;  1KDW A;  5CGW A;  4DRT A;  4E3N A;  2ZLY A;  2Y2H A;  2J9O A;  3PBS A;  5M18 A;  1NZU A;  4B4X A;  5L2F A;  3UO9 A;  4E3J A;  3PBN A;  5CER A;  1WYB A;  1K25 A;  1S6R A;  3B3X A;  2XQZ A;  3W8K A;  1H5X A;  2WAD A;  2Y2G A;  2ZQ8 A;  5F1F A;  4KZ5 A;  4N1X A;  5DTT A;  3BEC A;  1K6S A;  5FSR A;  4HES A;  3C4P A;  4OOL A;  3GR2 A;  1E25 A;  3Q82 A;  3Q7V A;  5FI6 A;  2ZC5 B;  2WGW A;  2A3U A;  1I2W A;  3SH8 A;  4EQI A;  1HD8 A;  3MZD A;  2XH9 A;  1IKG A;  4ZAM A;  4Y0T A;  3BFF A;  3UDX A;  2JBF A;  3A3D A;  2XK1 A;  4R0Q A;  5EVI C;  4S2M A;  1K55 A;  1K38 A;  4M3K A;  5CRF A;  1XP4 A;  1IYS A;  1ZG6 A;  4GDB A;  1PIO A;  2V2F F;  3BFG A;  5E2E A;  1XGJ A;  4MBF A;  4A5R A;  2IWC A;  4KG2 A;  4KQR A;  3SH7 A;  5F1G A;  3V3R A;  4BEN A;  4LCM A;  5EE8 A;  5GHX A;  3HLD A;  4GKU A;  1E3U D;  4OPZ A;  3M2J A;  3AGF A;  4GOG A;  5E2G A;  5AQ7 A;  5GLD A;  2EFX A;  3IXD A;  1K56 D;  3QHY A;  4PMA A;  5HFO A;  1HTZ A;  4P6B A;  4JXV A;  2UWX A;  3WS1 A;  4GD8 A;  3Q7Z A;  4OH0 A;  4JLF A;  1PW8 A;  3FYZ A;  4DE3 A;  2Y4A A;  3LO7 A;  4NK3 A;  4Q8I A;  4JXS A;  2ZQ7 A;  1RP5 A;  3CZD A;  3VP4 A;  3HLE A;  3NDG A;  5E2F A;  2H0T A;  2EFU A;  3HUM A;  1DY6 A;  4LV3 A;  3ZNY A;  3A3E A;  3CG5 A;  1FR1 A;  2I72 A;  4GDN A;  4S2P A;  5HL1 A;  3IF6 B;  4ZBE A;  1ESI A;  3O87 A;  4JF6 A;  4PPR A;  1SDN A;  2HDU A;  2P9V B;  3VMA A;  3VFF A;  4ZDX A;  3MKE A;  2EX6 A;  4B88 A;  3A3F A;  3GRJ A;  4LCL A;  1CI8 A;  3ZFZ A;  4X53 A;  5GL9 A;  4QJG A;  4WBG A;  2DCF A;  1ERM A;  3MZE A;  3NCK A;  3E2K A;  3M6H A;  1GCE A;  2FFF B;  2HPB A;  3TG9 A;  3DWK A;  5FAT A;  1RGY A;  2P74 A;  4DE0 A;  4PM5 A;  4IBX A;  1GA0 A;  5FAP A;  1EWZ A;  3WRT A;  3IHB A;  2R9X A;  1YLW A;  3V50 A;  1E4D A;  2Y2P A;  3ZGA B;  3N6I A;  1XA7 A;  4GN2 A;  2Y2Q A;  2PU4 A;  4BJP A;  4PM9 A;  1BLP A;  1W5D A;  3TSG A;  2H5S A;  4OON A;  5FDH A;  4CJN A;  1K57 C;  3C5A A;  1BZA A;  1PWD A;  4HBT A;  3ZHH A;  5FI7 A;  2ZQA A;  4Y0O A;  3UE0 A;  1KGG A;  2Z2M B;  4OPQ A;  5GLC A;  2WAE A;  3OC2 A;  4OQG A;  1TEM A;  3BFE A;  4OPR A;  4KZ7 A;  4XUZ A;  1NZO A;  4X68 A;  2JC7 A;  4IED A;  3VP0 A;  1I5Q A;  1L2S A;  1LL9 A;  2GDN A;  4JXG A;  2H0Y A;  2IWD A;  3GTC A;  3V39 A;  4DE2 A;  4KZ8 A;  5CHU A;  1Q2P A;  1RGZ A;  3IF6 A;  4S2I A;  4S2L A;  1IKI A;  3HUO A;  4DKI A;  1FSY A;  3M2K A;  4KZ6 A;  3BFD A;  1SCW A;  1YLJ A;  2P9V A;  4WEJ A;  5HX9 A;  3IXG A;  1GHM A;  1CK3 A;  4WZ5 C;  3DWZ A;  1VM1 A;  3IQA A;  5BOH A;  4K0W A;  1YLZ A;  4WEK A;  5DVA A;  2WGV A;  1E3U A;  3GQZ A;  1KE4 A;  4N1H A;  1YLY A;  1K56 A;  1ZC2 A;  4OLD A;  1DJA A;  4E6X A;  1SDE A;  3W4O A;  3ZVT A;  5KMW A;  4YIN A;  3ZDJ A;  1XXM A;  1ES3 A;  3GMW A;  1JTD A;  4BL2 A;  4E3M A;  5EEC A;  2B5R A;  3C7V A;  5F82 A;  3OPH A;  1TDG A;  4WYY A;  2IWB A;  4O7D A;  1Z6F A;  3UY6 A;  5DF8 A;  4XUX A;  2ZC3 B;  1WE4 A;  2XF3 A;  3N4I A;  4E3I A;  3RXW A;  2WZX A;  4ZJ3 A;  3O3V A;  4MEZ A;  3ISG A;  5KSC A;  5FQ9 A;  3VSL A;  3LY4 A;  2BG1 A;  4U3T A;  4RA7 A;  2WUQ A;  3BLM A;  2RCX A;  3VP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...