1L0DA

X-ray crystal structure of ampc s64d mutant beta-lactamase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
358
structure length
351
Chain Sequence
b'APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGDVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactamase
molecule tags Hydrolase
source organism Escherichia coli
publication title Structural bases of stability-function tradeoffs in enzymes.
pubmed doi rcsb
total genus 115
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1l0dA00
4X53A 3Q7VB 4Y0OA 5CTNA 5CEBA 5FASA 3OPRA 1TDLA 5CRFA 3IHBA 4JXVA 1H8YA 5IHVA 4PM6A 1JWVA 4UAAA 3GR2A 1IELA 1LHYA 1YT4A 2Y91A 3HVFA 1KGGA 4OQGA 2P74A 3IH9A 3VOYA 1DJAA 4P85A 4KG6A 4PM9A 5FAQA 5F1FA 5EVIB 2EFUA 3WS0A 4YINA 2X02A 1MWSA 5DTSA 3S4XA 4U0TA 5TFQA 3TG9A 2QMIA 1JTDA 1CK3A 4N9KA 4S2NA 4E3NA 1WYBA 5EUAA 1ZG6A 2J7VA 2P9VA 1KGEA 2FFYA 3E2KA 2HP9A 4PM5A 3G34A 2OSUA 2Z2MB 2VGKA 3LEZA 1IYSA 1EWZA 1PWDA 2PBYA 2ZQ8A 2G2UA 4YFMA 3RXWA 5FI6A 4BD1A 2WZXA 3MZEA 3PAGA 3ZG7B 5E2HA 2ZQAA 3OCLA 4WM9A 5E2GA 3UO9A 1LL5A 4OOYA 2Q9NA 1K6RA 4X68A 3ZNYA 3SS3A 1PIOA 4WEKA 1SKFA 3HLCA 1E4DA 4QB8A 1EI5A 4OLGA 4RA7A 1BUEA 2ZLYA 1GA9A 4P87A 4QY5A 3P09A 1FCMA 5JYPA 3NDEA 2ZQDA 1N9BA 4FCFA 3GMWA 4IVKA 2XD5A 3IF6A 3C4OA 3W4OA 2QZ6A 4U0XA 2RCXA 5FAOA 1K55C 1PZOA 4WMCA 1FR6A 4EV4A 5FAPA 1O07A 4EBLA 5G18A 3WWXA 3NIAA 3VP1A 2H0TA 1S6RA 1GHMA 4GZBA 4Q8IA 5CGWA 4EQIA 3FZCA 4BENA 1ES5A 4DF6A 5CEDA 4GKUA 3IWQA 4EBPA 1IYOA 1N4OA 4OOLA 5FQ9A 4B4XA 4BQMA 3VP0A 3A3DA 4OONA 5A92A 1PYYA 4E6XA 4A5RA 1NY0A 3V50A 1ES2A 1FCOA 3ZG5A 3G2YA 2BG1A 4LV2A 2V20A 1XPBA 2XQZA 1HTZA 1L0FA 3EQVA 3MZFA 1YLTA 1FOFA 1W7FA 3NBLA 3MKFA 3VP2A 5F1GA 1KVLA 3S22A 3ZVTA 3ZGAB 2H10A 2EXAA 2Y55A 5EPHA 5FA7A 2XK1A 1RGZA 1VQQA 3CZDA 4OOMA 1IYPA 2XR0A 2BLSA 3IXDA 5EVIC 1NZOA 3VFFA 2RL3A 4Y0TA 4E6WA 2XGNA 3FWLA 4PM7A 1SDNA 2ZD8A 4OP8A 5J8XA 5FI7A 2DCFA 1JWZA 4WBGA 5HAPA 4DE3A 4E3IA 1WE4A 2B5RA 3SH8A 3UN7A 4KZBA 3QNCA 4KZ4A 2Y2LA 3WRZA 2ZQCA 4S2JA 3VP4A 3CJMA 5HW3A 3NCKA 4DDYA 1KE3A 4F94A 3VP3A 3ZFZA 2WAFA 5HX9A 2JC7A 5CERA 4C75A 1XKZA 1ONGA 2WKEA 3Q82A 1GCEA 5TR7A 2WZZA 2WGVA 1U60A 3CG5A 2HDRA 3TSGA 5KSCA 3Q1FA 4RX2A 3UNWA 4L0LA 1XP4A 1K38A 4EWFA 2ZM2A 1QMFA 3G2ZA 5CGSA 1FSWA 1XA1A 4KZ3A 4E3KA 1MXOA 4OLDA 4QY6A 4RYEA 5AQ9A 5CTMA 1I5QA 4S2KA 3ZVWA 5DF8A 4D2OA 4ZDXA 3LY3A 3E2LA 1G68A 1ONHA 2WKHA 2WYXA 3SH9A 3V3SA 2R9XA 3A3IA 3NC8A 4WZ5A 3HLEA 3ITAA 3V3RA 1YLWA 5M18A 2HP6A 1TVFA 1Z6FA 2XFSA 3HUMA 1K55A 4OPRA 1E25A 2DNSA 2ZC6B 3MZDA 1G6AA 1Y54A 3BEBA 3G30A 3G4PA 1YM1A 1BLPA 3IXBA 3FKWA 3FV7A 4KZ6A 3OPHA 1ERQA 1NJ4A 1PW1A 4JXGA 2OV5A 5FATA 2WADA 4OQ0A 4LCMA 3BECA 4S2NC 3MBZA 2ZC4B 3QNBA 2A49A 3MXRA 3HUOA 3MXSA 3Q7VA 5AQAA 5U47A 2Q9MA 3G31A 4MNRA 2WGWA 3VMAA 4E3LA 1IEMA 4R3JA 4R4SA 3G35A 1Q2QA 2HPBA 2OLVA 3BRMA 2J9OA 5EVIA 4JBFA 1TEMA 4GNUA 5GHZA 3AGDA 3ITBA 3SH7A 3ZCZA 1FSYA 3TOIA 1CI8A 2R9WA 3M6HA 3BM6A 3HL9A 1KE0A 4Z9QA 5GHXA 3WS2A 4JF6A 5M19A 3W4QA 1PWGA 3AGFA 5CHJA 3WRTA 1MKIA 2Y2JA 5GLDA 3IXGA 4ZAMA 3A3FA 5HL1A 1HVBA 1KDSA 3HLWA 3M2KA 1RGYA 1YLZA 2C6WB 4KQQA 5CXWA 4ZJ3A 5JYOA 5E2EA 1BULA 3OCNA 4S2MA 1M40A 3GSGA 2HDSA 4BL3A 5EOEA 3IH8A 1BTLA 4WELA 3LO7A 1CEGA 5GLCA 5A93A 1MWTA 4ZJ1A 5F82A 3PBTA 3IT9A 1SCWA 4EBNA 4MBKA 4HEFA 5AQBA 1ESIA 3SS5A 4H8RA 2WUQA 3N8LA 3LY4A 3VFHA 4K0WA 4KQRA 4N92A 1I2WA 2QPNA 3BLSA 1K54C 1DJBA 3A3JA 3PAEA 3G32A 4BL2A 4KENB 2X71A 1HD8A 1S0WA 2EFXA 4MEZA 4FH4A 2EX2A 4U3TA 4E3OA 4K0XA 5EOOA 1ES4A 1YMXA 1K4FA 4IBRA 5FI2A 1IKIA 4CPKA 2FFFB 2WK0A 3PBQA 3GRJA 2V1ZA 1BZAA 4KZ8A 2DRWA 1GHIA 4QJGA 5E2FA 1NRFA 4OPYA 2HP5A 5GLAA 3O87A 4OVDA 4WYYA 1MY8A 1NYYA 1GHPA 1PI5A 4JF4A 3NDGA 4OQIA 1PWCA 2UWXA 3C5AA 4HESA 4UA9A 1ALQA 1NYMA 2XH9A 4OPZA 4CJNA 3GTCA 5A90A 4B88A 4N1HA 1JTGA 5FQMA 4NETA 4IVIA 1K57A 2Y2IA 3C7UA 4X6TA 3C4PA 2E8IA 2ZMAA 4R0QA 4WZ5C 4JPMA 1MWRA 5CGXA 3HLGA 5FDHA 2GDNA 2HDQA 4HBTA 1L0GA 4DRTA 3DTMA 1ESUA 2I72A 2Y2HA 3OC2A 1YQSA 2ZC7A 2WGWB 4FSFA 3UPPA 3IWIA 3O86A 3HLBA 1MWUA 5CHUA 1ZG4A 3UDFA 5KMWA 3PBSA 4KG5A 2XLNA 2EXBA 3P98A 2XF3A 4KZAA 2ZJ9A 4DE0A 1WYCA 1MPLA 1SDEA 3EQUA 4LENA 4OPQA 4HBUA 5DTTA 3FYZA 3SS4A 5GHYA 4KQOA 3VSLA 3GVBA 2JCHA 3W8KA 2JBFA 1LI0A 3UE1A 1FCNA 3UY6A 1O7EA 3A3EA 4LV3A 2P9VB 4BD0A 5BOHA 2J9PA 3M2JA 4LV1A 4OQHA 4RX3A 4C3QA 3IWOA 1Q2PA 1YMSA 3N4IA 4KZ7A 3ISGA 2XEPA 5HAIA 4MBHA 4PPRA 3SOIA 3WS4A 3B3XA 1E3UD 4K91A 3WS1A 4DXBA 3IF6C 1EROA 1KDWA 4KZ9A 4RVAA 2IWDA 4UHUA 3FKVA 3N8SA 2Y2KA 3UPOA 3OPPA 4IBXA 3UE3A 2WKIA 5FQIA 3GQZA 3NY4A 2Z2LB 3N7WA 4MLLA 1BLSA 4N1XA 4S2OA 3UDIA 3VSKA 1L2SA 1K25A 4GN2A 4LV0A 4P0MA 4S2IA 5KZHA 4KZ5A 2IWBA 4O7DA 1H5XA 2H5SA 2Y2MA 1H8ZA 4XUZA 2IWCA 1K56D 1HZOA 4BJPA 1SHVA 5L2FA 4MBFA 1K6SA 3QHYA 4GD6A 3HLDA 5A91A 3RXXA 5I94A 3IF6B 5TGFA 3PBRA 1DY6A 4GD8A 2OLUA 3VOZA 3WS5A 4E3MA 4DE2A 3M6BA 5FSRA 4R4RA 1DJCA 2XFTA 1JVJA 3RJUA 3LCEA 3W4PA 3O3VA 3BFFA 4OKPA 5HAQA 3MKEA 4DE1A 3JYIA 1PW8A 4Y0UA 5AQ7A 3N6IA 3O88A 3C7VA 5EVLA 3IF5A 1AXBA 2Y2GA 4P6BA 2C5WB 4IEDA 4X56A 4XUXA 2EX6A 4ZBEA 1JWPA 3HBRA 1XGIA 4NK3A 2Y2QA 3DWZA 2HDUA 5KSHA 1BLHA 3UPNA 2G2WA 2ZQ9A 2PU2A 1LL9A 1ES3A 2JE5A 3DWKA 1M6KA 1YLYA 4FD8A 5EVID 2A3UA 2EX8A 4JKTA 4DKIA 1VM1A 4QD4A 4JLFA 4WMCD 3V5MA 3ZG0A 5D3OA 1BLCA 3CMZA 1YLPA 1LI9A 3OZHA 1K56A 2CC1A 5F83A 3N8RA 3ZHHA 5CHMA 4GB7A 1RCJA 3GV9A 4EUZA 1K4EA 3PTEA 5E43A 1TDGA 2XD1A 4DDSA 3BFEA 5CECA 1IKGA 5GL9A 4X55A 3ZG9B 3ZG8B 2Y2NA 4WEJA 4Y7PA 2PU4A 1W8YA 2J8YA 5HARA 4OH0A 3Q7ZA 5DF7A 2XDMA 4M3KA 1FQGA 3IHAA 1K57C 3AGEA 1IYQA 1BT5A 1RP5A 4ID4A 4S2LA 1W5DA 4R3BA 1ZC2A 1XX2A 3HLFA 4KG2A 3OPLA 1MBLA 1BSGA 5GLBA 2H0YA 3DW0A 1XGJA 2Y2OA 4X69A 4R1GA 3BFGA 4LCLA 4PM8A 4QU3A 1CEFA 4XXRA 4R23A 4S2PA 5EE8A 4B4ZA 2Y4AA 3PBNA 4JXWA 2Y59A 1I2SA 1KVMA 2Y2PA 2V2FF 3BYDA 1NXYA 3HREA 4QHCA 1FR1A 5FQJA 3Q81A 3UE0A 1W8QA 2ZQ7A 1KE4A 3V39A 2X01A 2ZM0A 4JXSA 5FQQA 4GDBA 5M1AA 4FH2A 3ZNTA 1C3BA 2VGJA 4JF5A 4OP5A 1CI9A 3NI9A 4E3JA 3ZDJA 1OMEA 1L0DA 4BLMA 2ZC5B 4ZJ2A 5DTKA 5HFOA 5EECA 3MFDA 1L0EA 1PZPA 2ZC3B 3UDXA 4C6YA 4WZ4A 5DF9A 3PBOA 4ZTKA 1J9MA 1K54A 1ERMA 1KGFA 1W79A 1PI4A 3IXHA 5DVAA 4N9LA 4GOGA 1QMEA 1GA0A 1XA7A 3HUNA 4UA6A 1XXMA 3Q07A 2WGIA 5FQKA 1YLJA 3BFDA 3D4FA 4UA7A 3I7JA 2ZM8A 2WAEA 1LLBA 1E3UA 1NZUA 2EX9A 4PMAA 3S1YA 4DXCA 3IQAA 3BLMA 4GDNA 1ZKJA 3BFCA
chains in the Genus database with same CATH superfamily
4IJGA 4MCWA 5CTNA 5CEBA 2EWWA 2L1MA 3PYPA 5IHVA 1JWVA 4UAAA 1IELA 4OQGA 5F69A 3VOYA 1DJAA 4P85A 4PM9A 5FAQA 1DP9A 5F1FA 5TFQA 4S2NA 2XA7S 4HH3A 1ZG6A 3E2KA 4PM5A 4XT2B 3G34A 2V1AA 2PBYA 2ZQ8A 1VETA 2ZL1A 4HJ6A 4BD1A 3ZG7B 3V67A 2IA2A 2ZQAA 4X68A 4WN5A 5CX7A 4QB8A 4E04A 1IOUA 2ZLYA 3ZQ5A 5DJUA 1W63Q 1TS6A 5JYPA 1T1AA 2ZQDA 1N9BA 3EEHA 3IBRA 4IVKA 5AJGA 3IF6A 3C4OA 4U0XA 4F3LA 1GSVA 1FR6A 4NXEA 3EWKA 3WWXA 1GHMA 2J3TC 5CGWA 4GKUA 3IWQA 4Q0JA 2BASA 4FOFA 2V8FA 3A3DA 5HWWA 3VE4A 2V20A 4JGPA 1HTZA 1L0FA 1YLTA 3D72A 1NLYA 1RGZA 3CZDA 1IYPA 3IXDA 5EVIC 4X25A 3UMDA 3OBFA 3VFFA 4Y0TA 4E6WA 4PM7A 2O99A 4GJ4A 5HAPA 4EESA 3SH8A 2Y2LA 3WRZA 4S2JA 3CJMA 3NCKA 3QP4A 4DDYA 4X1MA 4C75A 4EEPA 1ONGA 4PAUA 4RX2A 1K38A 3G2ZA 1QMFA 4KZ3A 1YSPA 4OLDA 1I5QA 5K5BA 2OWJA 3ZVWA 3LR5A 4D2OA 2VV8A 4ZDXA 1ONHA 4IUHA 3A3IA 3CWFA 3HUMA 4OPRA 2DNSA 1G6AA 1Y54A 3BEBA 2VZWA 4KUOA 3T1RA 5J7EA 4KZ6A 3OPHA 5EM0A 2WADA 2A49A 5AQAA 3NJAA 4E3LA 2WGWA 3VMAA 1MKMA 4R4SA 1Q2QA 2OLVA 2J9OA 5EVIA 3CUEA 4O0PA 1H0MA 3ZCZA 3T4TA 1CI8A 2R9WA 3BM6A 3NOTC 3WS2A 3G6OA 2P04A 3W4QA 1PWGA 3AGFA 4R70A 1MKIA 2Y2JA 2L4RA 5CXWA 2GZAA 3OCNA 4S2MA 4L9EA 2HDSA 3IH8A 1MZUA 1CEGA 5GLCA 2XA7M 3T50A 3BY8A 5FDSA 5AQBA 3H9WA 3SS5A 3BQAA 3N8LA 4K0WA 3D3OA 2QPNA 5HPFA 2X71A 4O8GA 4FH4A 4K0XA 1ES4A 2ZL1B 2PD7A 3PBQA 4KZ8A 2DRWA 3UB8A 1S4RA 5J3WA 3GECA 1GHPA 1T19A 3NDGA 3C5AA 4UA9A 1MC0A 4CJNA 3GTCA 3S7PA 4NETA 4IVIA 2Y2IA 2E8IA 3KYEA 2Y2HA 2HV1A 3OC2A 2ZC7A 3MJQA 3UPPA 3O86A 1MWUA 5KMWA 4KG5A 2XLNA 3P98A 2WKPA 1GSXA 1WYCA 1SDEA 2ZMVA 4LENA 3W8KA 5GHYA 3LIEA 2QJ7A 3A3EA 5G4ZA 5BOHA 2XEPA 3WS4A 4PPRA 1LSWA 3TJZC 1E3UD 4EW7A 3IF6C 1EROA 5I5LA 4UHUA 3OPPA 2Z2LB 4LV0A 1P9RA 4O7DA 4XUZA 1OT9A 2IWCA 2WKQA 1KOUA 4GD6A 5A91A 4E3MA 4G3WA 4IUKA 1IFQA 3W4PA 3MKEA 3JYIA 4WUJA 4Y0UA 5AQ7A 3O88A 4WLAA 1AXBA 2PAVP 2C5WB 1BLHA 3DTIA 4G3KA 2PHYA 3DAVA 1LL9A 1ES3A 2EX8A 4WMCD 1YLPA 2H28A 1K56A 4JGRA 1AWIA 4EETB 5CHMA 3KSIA 1VEUA 2KDKA 2XD1A 2PT7A 5GL9A 4X55A 2PU4A 1V9ZA 4M3KA 1K57C 1IYQA 2W1TB 4ID4A 1W5DA 4R3BA 3HLFA 4KG2A 3UMEA 1BSGA 4CQHA 1XGJA 1CEFA 4XXRA 4S2PA 5TBMA 2Y4AA 4JXWA 1I2SA 2V2FF 3HREA 1FR1A 3V39A 2X01A 3IX3A 3DTEA 1C3BA 2VGJA 4DMZA 1CI9A 4BLMA 1OMEA 1L0DA 4G3VA 5DTKA 2YKFA 3H82A 1PZPA 2ZC3B 1LSVA 3E0YA 3UDXA 4WZ4A 3PBOA 2W1TA 1J9MA 1W79A 1PI4A 5DVAA 1FIKA 1GA0A 4NXGA 2QWSA 1XXMA 1YLJA 4UA7A 4GHIA 3I7JA 1XFNA 2KX6A 2ZM8A 2WAEA 2EX9A 1P0ZA 1OTBA 2OWHA 4Y0OA 4GCZA 4HJ3A 3EGDC 1BYWA 4KUKA 5MC7A 3OPRA 1H8YA 3QP8A 1LHYA 1CJFA 4HJ4A 3VE3A 3HVFA 5HZHA 1KGGA 2P74A 4KG6A 3S7QA 4NEED 2EFUA 4YINA 2X02A 3TG9A 1JTDA 1K0KA 2NUTC 5EUAA 2P9VA 2VGKA 3CI6A 5FI6A 2WZXA 3PAGA 4LRZE 1P9WA 2K7SA 3UO9A 1LL5A 2Q9NA 2V0WA 3SS3A 1S66L 3EOIA 1E4DA 4CLCE 5F5YA 1GA9A 4P87A 2R78A 4FCFA 3P01A 1K55C 1PZOA 3IBJA 4EV4A 1O07A 3LIFA 2Y79A 5EVEA 4K08A 4P6ZS 4E6XA 1NY0A 3V50A 1ES2A 1FCOA 1XJ6A 3G2YA 2BG1A 3EQVA 3CUEC 3MZFA 3NBLA 3QP5A 3CITA 3MKFA 4PKYA 5F1GA 3ZVTA 3ZGAB 2H10A 2EXAA 5EPHA 2XK1A 4OOMA 2XR0A 2KLIA 2BLSA 2RL3A 5IT5A 4WF0A 1S67L 1SDNA 4OP8A 5FI7A 1JWZA 4WBGA 4DE3A 1WE4A 4H6JB 2B5RA 3QNCA 4KZ4A 4F94A 5HX9A 2JC7A 5CERA 1XKZA 2WGVA 1U60A 2D02A 3Q1FA 1J3WA 4L0LA 1VETB 3CPTB 2ZM2A 4Y2FA 1FSWA 1XA1A 3PR6A 1JNUA 3E2LA 1YAXA 3DTKA 2R9XA 4WZ5A 3V3RA 1UGUA 2XFSA 1K55A 3PXPA 3G30A 3G4PA 1YM1A 4YNRA 1BLPA 3LI8A 3FV7A 1NJ4A 5FATA 4YOFA 4I39A 3BECA 4S2NC 3LYXA 3MBZA 2ZC4B 3QNBA 3MXRA 3MXSA 3Q7VA 3G31A 3KO6A 2YKHA 3BRMA 4GNUA 3VV4A 3ITBA 2K2NA 3FG8A 3SW1A 3QP2A 3HL9A 3E98A 5M19A 1NWZA 5C5KA 5CHJA 3WRTA 3A3FA 2QJ5A 2P7JA 4GHIB 1RGYA 2BTFP 2C6WB 2PR6A 4HNBA 1M40A 3GSGA 4JGQA 5F82A 3E4OA 3D9YA 3LR3A 4MBKA 4HEFA 4EEUA 1ESIA 4H8RA 4ARZA 2WUQA 5DFYA 3LY4A 1STZA 4N92A 1I2WA 3PAEA 4BL2A 4PHTA 2EX2A 3SZTA 2M1CA 1K4FA 3KYQA 2PBDP 3GRJA 1YKDA 4QJGA 3IS2A 1PRQA 4X1LA 2PR5A 4OVDA 4EXOA 1MY8A 1PI5A 1XFQA 4JF4A 2XH9A 1JTGA 5FQMA 1K57A 3C7UA 4WZ5C 3K3DA 3HLGA 1ESUA 2I72A 4FSFA 3IWIA 1ZG4A 3UDFA 1XJ3A 2XF3A 2PDRA 2ZJ9A 4KZAA 1XJ2A 5FEGA 2JKRI 1MPLA 2VKSA 4OPQA 3GVBA 2JBFA 3E4QA 3LGOA 1NRJA 4Q0HA 4BD0A 2J9PA 3M2JA 4LV1A 4OQHA 4LRYC 3IWOA 1Q2PA 1TF1A 5HPIA 4MN6A 3ISGA 4Z1WA 3WS1A 5HD3A 2O9CA 1KDWA 3IX8A 4RVAA 3N8SA 2Y2KA 2OOLA 4HHDA 4IBXA 3KX0X 5L10A 2W1RA 4MLLA 3VSKA 3N7WA 1BLSA 4H6JA 2J80A 4P0MA 4S2IA 1XJ4A 2O9AA 1VHMA 4BJPA 5L2FA 3CPTA 1F98A 1K6SA 3RXXA 5I94A 1ODVA 1DY6A 4GD8A 3M6BA 4R4RA 1DJCA 2XFTA 1JVJA 3LCEA 2HJ9C 2L0WA 1S4SA 3BFFA 4GS9B 1D1JA 4DE1A 2XSSA 5CEDA 4XUXA 4X56A 1JWPA 5L07A 4NK3A 2HDUA 3DBAA 2G2WA 2ZQ9A 2JE5A 2A3UA 4DKIA 3HJKA 3F1OB 2VLGA 1DP6A 3K3CA 3OZHA 5F83A 3U2AA 2CMNA 5EV0A 4NXFA 3NULA 4EUZA 1K4EA 3PTEA 3ICYA 2FH5A 3T4KA 3LFVA 2W0NA 2ACGA 4M4XA 4WEJA 3Q7ZA 5DF7A 2GJ3A 2FZ0A 3IHAA 4UQIS 3AGEA 3C8CA 1BT5A 1RP5A 4S2LA 4FTXA 1XX2A 3OPLA 2H0YA 3T1SA 1ZTUA 4QU3A 1CF0A 1KVMA 2Y2PA 2JKGA 2W3EA 4QHCA 1NXYA 4GLQA 1UWNX 3MMHA 1L3LA 5F68A 2M7VA 4GDBA 3ZNTA 4JF5A 4HOIA 3NI9A 2ZC5B 5DF9A 4EUVA 5HWTA 3IXHA 1ERMA 3H7WB 2B18A 3FPVA 4UA6A 5KIZA 1Y4OA 2WGIA 3P7NA 3Q07A 3NOUC 4NG2A 2JKTM 3D4FA 4XT2A 1E3UA 3NECA 1SKOB 5FASA 3IHBA 4PM6A 1YT4A 2Y91A 1D7EA 4I3JA 1T1BA 2VV6A 2B02A 5EVIB 3WS0A 4RQ9A 1MWSA 2QMIA 1CK3A 2QYBA 4N9KA 5HDDA 1WYBA 2FFYA 4R3AA 2Z2MB 1EWZA 1PWDA 2G7UA 2Z6CA 2XRNA 2G2UA 3RXWA 5A8BA 5F6AA 5E2HA 4BWIA 4WM9A 1CQAA 4OOYA 4HQAA 1K6RA 3ZNYA 1GSWA 3A0SA 1PIOA 1SKFA 3HLCA 1EI5A 4OLGA 4RA7A 3TW8A 3BWLA 1FCMA 2VK3A 1YPRA 3NDEA 3GMWA 2P08A 2QZ6A 5TBMB 2V1BA 5FAOA 1V9YA 4EBLA 2GNXA 5G18A 3NIAA 3MSHA 3VP1A 2H0TA 4GS9A 2ZOHA 4GZBA 4QWOA 3FZCA 4BENA 3LR4A 1ES5A 4DF6A 2W27A 3H82B 4EBPA 1IYOA 1N4OA 4OOLA 5FQ9A 4B4XA 1DP8A 4OONA 2Y8HA 1PYYA 4A5RA 4LV2A 1XPBA 2XQZA 1Z09A 3S7NA 1FOFA 2PD8A 1W7FA 5HWVA 3A0RA 3EEAA 5FA7A 2Y55A 4Y5FA 3R7WB 1S1ZA 3LIAA 4P6ZM 2ZD8A 5J8XA 3KSHA 1LT0A 2VJWA 4ETZA 2MJ6A 3LI9A 3UN7A 4KZBA 3VP3A 3ZFZA 2WAFA 3JVVA 3Q82A 2WKEA 5TR7A 3CG5A 1OTIA 3TE8A 1A0KA 1XP4A 4EWFA 4E3KA 1DRMA 3C2WA 5CTMA 4S2KA 5DF8A 2KOIA 3V3SA 1G68A 1OTDA 2WKHA 3NC8A 1N9LA 2M7UA 3ITAA 1W63M 2HP6A 1TVFA 3OLOA 1E25A 4EERA 2ZC6B 4ETXA 3F1NB 1OTEA 3F1NA 2ZBBA 4Q0IA 3IXBA 4B9OA 2PYPA 1ERQA 1PW1A 2OV5A 4LCMA 2VGLM 1ACFA 2QHKA 2Q9MA 4R3JA 3G35A 2HPBA 2ZMFA 4JBFA 4NXBA 5GHZA 1OJGA 2K31A 3SH7A 1FSYA 1S1YA 4Z9QA 1KE0A 1OPXA 5GHXA 4JF6A 2OAQ1 5DKKA 5GLDA 3IXGA 5HL1A 1HVBA 3M2KA 1YLZA 4ZJ3A 5HD5A 5JYOA 5E2EA 1BULA 2HJEA 4PKYG 4BL3A 3LUQA 4WELA 4HIAA 5A93A 4ZJ1A 3UB9A 3IT9A 1OJ5A 4EBNA 2V8CA 3UB5P 4JGOA 3CHWP 2EA9A 1K54C 3R4KA 3A3JA 3G32A 4KENB 1HD8A 1S0WA 3TRCA 4E3OA 5EOOA 1YMXA 5FI2A 2LB5A 4HH2A 2WK0A 1F9IA 2V1ZA 1GHIA 5E2FA 1NRFA 1F2KA 5LBRA 4I3AA 3O87A 4WYYA 1NYYA 4YWZA 4OQIA 1ALQA 1NYMA 4OPZA 4B88A 4N1HA 3T4LA 3C4PA 2ZMAA 4R0QA 5CGXA 4JPMA 3LEQA 3DTMA 1FILA 5L8MA 2EWVA 1YQSA 2W3HA 2EXBA 4DE0A 1UWPX 4HBUA 3FYZA 3SS4A 4KQOA 5HSQA 2JCHA 3BY9A 1FCNA 1O7EA 4LV3A 4CLCA 2P9VB 4RX3A 4C3QA 3EGXC 3MQOA 3N4IA 3SOIA 4MBHA 3B3XA 4K91A 4DXBA 1EW0A 5TJJA 2IWDA 3FKVA 2WKIA 4N1XA 3UDIA 4S2OA 4ARZB 4KZ5A 2H5SA 2JKFA 1H8ZA 4HY8A 1HZOA 1SHVA 3QHYA 3HLDA 3T1XA 2OLUA 3WS5A 3L9KA 3ULFA 3RJUA 2J3WA 3O3VA 2INWA 2V0UA 3N6IA 5EVLA 4P6BA 3RTYA 4ZBEA 4HI4A 2EX6A 1XGIA 3UPNA 5DKLA 3DWKA 1M6KA 4FD8A 4JKTA 4QD4A 5D3OA 2VA0A 3CMZA 3MXQA 3MR0A 2CC1A 2WKRA 5E43A 1TDGA 3L7HA 4GW9A 3OOVA 1IKGA 3QP1A 3C30A 3ZG9B 3ZG8B 2J8YA 5HARA 4OH0A 2XDMA 1FQGA 1LSXA 3H7WA 2VEAA 4IHQA 3JVUA 2HGVA 2Y2OA 4X69A 4F3LB 3BFGA 4LCLA 1N9OA 4B4ZA 1G5UA 3S7OA 3BYDA 3Q81A 3UE0A 1W8QA 1KE4A 1VEUB 2ZM0A 4JXSA 5FQQA 4FH2A 3FC7A 1TS8A 4E3JA 5HFOA 5EECA 4FUWA 3MFDA 1L0EA 3UB6A 4ZTKA 1K54A 3T4QA 1KGFA 4N9LA 4GOGA 4DJ3A 1G6OA 1XA7A 3HUNA 4R6LA 4QPRA 2A2LA 2QKPA 4PMAA 1LLBA 3BW6A 5L09A 4I38A 3IQAA 5EFWA 1ZKJA 4X53A 3Q7VB 1N9NA 4BBUA 1TDLA 5CRFA 4JXVA 4L9GA 3GR2A 1WA9A 3IH9A 4R38A 2W3FA 2NUPC 2W3DA 3LICA 5DTSA 3S4XA 4U0TA 3PHYA 4E3NA 2J7VA 1KGEA 5FEFA 2HP9A 2OSUA 1YSQA 5G4YA 3LEZA 1IYSA 4YFMA 2UV0E 3MZEA 3U4LP 3T1QB 3OCLA 5E2GA 4BBVA 4WEKA 2AVXA 1BUEA 4QY5A 4ZRRA 3P09A 1G28A 2VV7A 3W4OA 2XD5A 4EQ1A 2RCXA 5HDSA 4WMCA 1Y28A 1SKOA 5FAPA 1S6RA 2D01A 4UEYA 4Q8IA 4EQIA 3MQQA 4II7A 5J4EA 4BQMA 3VP0A 5A92A 3W2ZA 3ZG5A 2JN7A 3VP2A 3B42A 1KVLA 3S22A 1VQQA 3UB7A 2A24B 1T1CA 1NZOA 2XGNA 3FWLA 4NKPA 2DCFA 3CLOA 4E3IA 5EM1A 4BMWA 2E8JA 2ZQCA 3C38A 3VP4A 5HW3A 1KE3A 3HJIA 3JPUA 1GCEA 2WZZA 5KSCA 1TS0A 2HDRA 3TSGA 3LIBA 3F1PA 3UNWA 5CGSA 1MXOA 4RYEA 4QY6A 5AQ9A 3LY3A 3SH9A 2WYXA 3A0VA 3HLEA 5M18A 1YLWA 1Z6FA 3VOLA 5AVFA 1OTAA 3BJNA 3MZDA 4DJ2A 5DFXA 1H8MA 3FKWA 3T12B 3KYZA 1TS7A 2J3TD 4JXGA 4OQ0A 1VB6A 3LR0A 3HUOA 5U47A 4MNRA 1SZVA 1IEMA 5DJTA 4LLOB 1TEMA 4Y13A 3AGDA 3TOIA 3FPWA 3M6HA 1D06A 5IU1A 4ZAMA 3HLWA 1KDSA 4KQQA 2VGLS 4I3IA 5EOEA 1BTLA 3LO7A 2V9AA 3R7WA 1MWTA 4L9FA 3T4SA 3PBTA 4LGWA 1SCWA 1NLZA 3RH8B 3MS6A 2VX8A 4KQRA 3VFHA 3BLSA 4MDZA 1DJBA 2EFXA 4MEZA 2W3GA 4U3TA 3ZYTA 4IBRA 4ME4A 1IKIA 4CPKA 2FFFB 4HP9A 5HDCA 1BZAA 3HCYA 2O9BA 4OPYA 2HP5A 1P97A 5GLAA 1PWCA 2UWXA 4HESA 2ZOIA 5A90A 5AVEA 4CLCB 4BBTA 4LPZA 4X6TA 4HP4A 1MWRA 5FDHA 2GDNA 2HDQA 2OAP1 4HBTA 4LRXC 1L0GA 4DRTA 1T18A 2WGWB 1TD5A 3HLBA 5CHUA 2A24A 3PBSA 4D60A 2JKRM 3EQUA 3MF0A 4DN0A 5DTTA 3VSLA 1PNEA 1LI0A 3UE1A 2O0YA 3UY6A 3UE6A 1HLUP 3KSGA 1YMSA 3F1PB 4KZ7A 4CLCD 5HAIA 4MN7A 4KZ9A 4Y3IA 4CLCC 3K2NA 1ZHHB 3UPOA 3UE3A 5FQIA 3GQZA 3NY4A 4O01A 1L2SA 1K25A 4GN2A 5KZHA 2IWBA 3MFXA 1H5XA 2Y2MA 3NHQA 1K56D 2JHEA 3E4PA 4MBFA 3NOPC 3IF6B 5TGFA 3PBRA 3VOZA 3F1OA 4DE2A 5FSRA 4MN5A 1X0OA 3T4OA 4OKPA 3T4JA 5HAQA 2JKTI 1PW8A 3BQ8A 4MMNA 3C7VA 3IF5A 2Y2GA 4IEDA 4Y17A 3HBRA 1H3QA 2Y2QA 3DWZA 5KSHA 2PU2A 4ESPA 4LFUA 1YLYA 2PRFA 5EVID 1VM1A 3V5MA 4JLFA 3B33A 3ZG0A 1BLCA 3O5YA 1LI9A 3IX4A 3N8RA 3ZHHA 4GB7A 4I5SA 1RCJA 3GDIA 3GV9A 2PYRA 2HF6A 4DDSA 3BFEA 5CECA 1OT6A 4KQDA 2Q0OA 3KSFA 5FL3A 2Y2NA 2HZ5A 4EU0A 4Y7PA 1W8YA 2GX5A 2LB9A 1LL8A 3QP6A 3RFBA 1ZC2A 3MQ0A 1MBLA 5GLBA 3DW0A 3B47A 4R1GA 4PM8A 4UQIM 5EE8A 4R23A 3PBNA 2Y59A 2Z6DA 5FQJA 2ZQ7A 5IS1A 4WL9A 5M1AA 1PFLA 2B95A 4OP5A 3ZDJA 3LIDA 4ZJ2A 2XROA 2DMWA 4C6YA 1F5MA 3IS2B 2I9VA 1QMEA 4AFIA 4B93A 5FQKA 3CAXA 3BFDA 4Y15A 5HL6A 1NZUA 4DXCA 3S1YA 3BLMA 4GDNA 3BFCA
chains in the Genus database with same CATH topology
4X53A 3Q7VB 4Y0OA 5CTNA 5CEBA 5FASA 3OPRA 1TDLA 5CRFA 3IHBA 4JXVA 1H8YA 5IHVA 4PM6A 1JWVA 4UAAA 3GR2A 1IELA 1LHYA 1YT4A 2Y91A 3HVFA 1KGGA 4OQGA 2P74A 3IH9A 3VOYA 1DJAA 4P85A 4KG6A 4PM9A 5FAQA 5F1FA 5EVIB 2EFUA 3WS0A 4YINA 2X02A 1MWSA 5DTSA 3S4XA 4U0TA 5TFQA 3TG9A 2QMIA 1JTDA 1CK3A 4N9KA 4S2NA 4E3NA 1WYBA 5EUAA 1ZG6A 2J7VA 2P9VA 1KGEA 2FFYA 3E2KA 2HP9A 4PM5A 3G34A 2OSUA 2Z2MB 2VGKA 3LEZA 1IYSA 1EWZA 1PWDA 2PBYA 2ZQ8A 2G2UA 4YFMA 3RXWA 5FI6A 4BD1A 2WZXA 3MZEA 3PAGA 3ZG7B 5E2HA 2ZQAA 3OCLA 4WM9A 5E2GA 3UO9A 1LL5A 4OOYA 2Q9NA 1K6RA 4X68A 3ZNYA 3SS3A 1PIOA 4WEKA 1SKFA 3HLCA 1E4DA 4QB8A 1EI5A 4OLGA 4RA7A 1BUEA 2ZLYA 1GA9A 4P87A 4QY5A 3P09A 1FCMA 5JYPA 3NDEA 2ZQDA 1N9BA 4FCFA 3GMWA 4IVKA 2XD5A 3IF6A 3C4OA 3W4OA 2QZ6A 4U0XA 2RCXA 5FAOA 1K55C 1PZOA 4WMCA 1FR6A 4EV4A 5FAPA 1O07A 4EBLA 5G18A 3WWXA 3NIAA 3VP1A 2H0TA 1S6RA 1GHMA 4GZBA 4Q8IA 5CGWA 4EQIA 3FZCA 4BENA 1ES5A 4DF6A 5CEDA 4GKUA 3IWQA 4EBPA 1IYOA 1N4OA 4OOLA 5FQ9A 4B4XA 4BQMA 3VP0A 3A3DA 4OONA 5A92A 1PYYA 4E6XA 4A5RA 1NY0A 3V50A 1ES2A 1FCOA 3ZG5A 3G2YA 2BG1A 4LV2A 2V20A 1XPBA 2XQZA 1HTZA 1L0FA 3EQVA 3MZFA 1YLTA 1FOFA 1W7FA 3NBLA 3MKFA 3VP2A 5F1GA 1KVLA 3S22A 3ZVTA 3ZGAB 2H10A 2EXAA 2Y55A 5EPHA 5FA7A 2XK1A 1RGZA 1VQQA 3CZDA 4OOMA 1IYPA 2XR0A 2BLSA 3IXDA 5EVIC 1NZOA 3VFFA 2RL3A 4Y0TA 4E6WA 2XGNA 3FWLA 4PM7A 1SDNA 2ZD8A 4OP8A 5J8XA 5FI7A 2DCFA 1JWZA 4WBGA 5HAPA 4DE3A 4E3IA 1WE4A 2B5RA 3SH8A 3UN7A 4KZBA 3QNCA 4KZ4A 2Y2LA 3WRZA 2ZQCA 4S2JA 3VP4A 3CJMA 5HW3A 3NCKA 4DDYA 1KE3A 4F94A 3VP3A 3ZFZA 2WAFA 5HX9A 2JC7A 5CERA 4C75A 1XKZA 1ONGA 2WKEA 3Q82A 1GCEA 5TR7A 2WZZA 2WGVA 1U60A 3CG5A 2HDRA 3TSGA 5KSCA 3Q1FA 4RX2A 3UNWA 4L0LA 1XP4A 1K38A 4EWFA 2ZM2A 1QMFA 3G2ZA 5CGSA 1FSWA 1XA1A 4KZ3A 4E3KA 1MXOA 4OLDA 4QY6A 4RYEA 5AQ9A 5CTMA 1I5QA 4S2KA 3ZVWA 5DF8A 4D2OA 4ZDXA 3LY3A 3E2LA 1G68A 1ONHA 2WKHA 2WYXA 3SH9A 3V3SA 2R9XA 3A3IA 3NC8A 4WZ5A 3HLEA 3ITAA 3V3RA 1YLWA 5M18A 2HP6A 1TVFA 1Z6FA 2XFSA 3HUMA 1K55A 4OPRA 1E25A 2DNSA 2ZC6B 3MZDA 1G6AA 1Y54A 3BEBA 3G30A 3G4PA 1YM1A 1BLPA 3IXBA 3FKWA 3FV7A 4KZ6A 3OPHA 1ERQA 1NJ4A 1PW1A 4JXGA 2OV5A 5FATA 2WADA 4OQ0A 4LCMA 3BECA 4S2NC 3MBZA 2ZC4B 3QNBA 2A49A 3MXRA 3HUOA 3MXSA 3Q7VA 5AQAA 5U47A 2Q9MA 3G31A 4MNRA 2WGWA 3VMAA 4E3LA 1IEMA 4R3JA 4R4SA 3G35A 1Q2QA 2HPBA 2OLVA 3BRMA 2J9OA 5EVIA 4JBFA 1TEMA 4GNUA 5GHZA 3AGDA 3ITBA 3SH7A 3ZCZA 1FSYA 3TOIA 1CI8A 2R9WA 3M6HA 3BM6A 3HL9A 1KE0A 4Z9QA 5GHXA 3WS2A 4JF6A 5M19A 3W4QA 1PWGA 3AGFA 5CHJA 3WRTA 1MKIA 2Y2JA 5GLDA 3IXGA 4ZAMA 3A3FA 5HL1A 1HVBA 1KDSA 3HLWA 3M2KA 1RGYA 1YLZA 2C6WB 4KQQA 5CXWA 4ZJ3A 5JYOA 5E2EA 1BULA 3OCNA 4S2MA 1M40A 3GSGA 2HDSA 4BL3A 5EOEA 3IH8A 1BTLA 4WELA 3LO7A 1CEGA 5GLCA 5A93A 1MWTA 4ZJ1A 5F82A 3PBTA 3IT9A 1SCWA 4EBNA 4MBKA 4HEFA 5AQBA 1ESIA 3SS5A 4H8RA 2WUQA 3N8LA 3LY4A 3VFHA 4K0WA 4KQRA 4N92A 1I2WA 2QPNA 3BLSA 1K54C 1DJBA 3A3JA 3PAEA 3G32A 4BL2A 4KENB 2X71A 1HD8A 1S0WA 2EFXA 4MEZA 4FH4A 2EX2A 4U3TA 4E3OA 4K0XA 5EOOA 1ES4A 1YMXA 1K4FA 4IBRA 5FI2A 1IKIA 4CPKA 2FFFB 2WK0A 3PBQA 3GRJA 2V1ZA 1BZAA 4KZ8A 2DRWA 1GHIA 4QJGA 5E2FA 1NRFA 4OPYA 2HP5A 5GLAA 3O87A 4OVDA 4WYYA 1MY8A 1NYYA 1GHPA 1PI5A 4JF4A 3NDGA 4OQIA 1PWCA 2UWXA 3C5AA 4HESA 4UA9A 1ALQA 1NYMA 2XH9A 4OPZA 4CJNA 3GTCA 5A90A 4B88A 4N1HA 1JTGA 5FQMA 4NETA 4IVIA 1K57A 2Y2IA 3C7UA 4X6TA 3C4PA 2E8IA 2ZMAA 4R0QA 4WZ5C 4JPMA 1MWRA 5CGXA 3HLGA 5FDHA 2GDNA 2HDQA 4HBTA 1L0GA 4DRTA 3DTMA 1ESUA 2I72A 2Y2HA 3OC2A 1YQSA 2ZC7A 2WGWB 4FSFA 3UPPA 3IWIA 3O86A 3HLBA 1MWUA 5CHUA 1ZG4A 3UDFA 5KMWA 3PBSA 4KG5A 2XLNA 2EXBA 3P98A 2XF3A 4KZAA 2ZJ9A 4DE0A 1WYCA 1MPLA 1SDEA 3EQUA 4LENA 4OPQA 4HBUA 5DTTA 3FYZA 3SS4A 5GHYA 4KQOA 3VSLA 3GVBA 2JCHA 3W8KA 2JBFA 1LI0A 3UE1A 1FCNA 3UY6A 1O7EA 3A3EA 4LV3A 2P9VB 4BD0A 5BOHA 2J9PA 3M2JA 4LV1A 4OQHA 4RX3A 4C3QA 3IWOA 1Q2PA 1YMSA 3N4IA 4KZ7A 3ISGA 2XEPA 5HAIA 4MBHA 4PPRA 3SOIA 3WS4A 3B3XA 1E3UD 4K91A 3WS1A 4DXBA 3IF6C 1EROA 1KDWA 4KZ9A 4RVAA 2IWDA 4UHUA 3FKVA 3N8SA 2Y2KA 3UPOA 3OPPA 4IBXA 3UE3A 2WKIA 5FQIA 3GQZA 3NY4A 2Z2LB 3N7WA 4MLLA 1BLSA 4N1XA 4S2OA 3UDIA 3VSKA 1L2SA 1K25A 4GN2A 4LV0A 4P0MA 4S2IA 5KZHA 4KZ5A 2IWBA 4O7DA 1H5XA 2H5SA 2Y2MA 1H8ZA 4XUZA 2IWCA 1K56D 1HZOA 4BJPA 1SHVA 5L2FA 4MBFA 1K6SA 3QHYA 4GD6A 3HLDA 5A91A 3RXXA 5I94A 3IF6B 5TGFA 3PBRA 1DY6A 4GD8A 2OLUA 3VOZA 3WS5A 4E3MA 4DE2A 3M6BA 5FSRA 4R4RA 1DJCA 2XFTA 1JVJA 3RJUA 3LCEA 3W4PA 3O3VA 3BFFA 4OKPA 5HAQA 3MKEA 4DE1A 3JYIA 1PW8A 4Y0UA 5AQ7A 3N6IA 3O88A 3C7VA 5EVLA 3IF5A 1AXBA 2Y2GA 4P6BA 2C5WB 4IEDA 4X56A 4XUXA 2EX6A 4ZBEA 1JWPA 3HBRA 1XGIA 4NK3A 2Y2QA 3DWZA 2HDUA 5KSHA 1BLHA 3UPNA 2G2WA 2ZQ9A 2PU2A 1LL9A 1ES3A 2JE5A 3DWKA 1M6KA 1YLYA 4FD8A 5EVID 2A3UA 2EX8A 4JKTA 4DKIA 1VM1A 4QD4A 4JLFA 4WMCD 3V5MA 3ZG0A 5D3OA 1BLCA 3CMZA 1YLPA 1LI9A 3OZHA 1K56A 2CC1A 5F83A 3N8RA 3ZHHA 5CHMA 4GB7A 1RCJA 3GV9A 4EUZA 1K4EA 3PTEA 5E43A 1TDGA 2XD1A 4DDSA 3BFEA 5CECA 1IKGA 5GL9A 4X55A 3ZG9B 3ZG8B 2Y2NA 4WEJA 4Y7PA 2PU4A 1W8YA 2J8YA 5HARA 4OH0A 3Q7ZA 5DF7A 2XDMA 4M3KA 1FQGA 3IHAA 1K57C 3AGEA 1IYQA 1BT5A 1RP5A 4ID4A 4S2LA 1W5DA 4R3BA 1ZC2A 1XX2A 3HLFA 4KG2A 3OPLA 1MBLA 1BSGA 5GLBA 2H0YA 3DW0A 1XGJA 2Y2OA 4X69A 4R1GA 3BFGA 4LCLA 4PM8A 4QU3A 1CEFA 4XXRA 4R23A 4S2PA 5EE8A 4B4ZA 2Y4AA 3PBNA 4JXWA 2Y59A 1I2SA 1KVMA 2Y2PA 2V2FF 3BYDA 1NXYA 3HREA 4QHCA 1FR1A 5FQJA 3Q81A 3UE0A 1W8QA 2ZQ7A 1KE4A 3V39A 2X01A 2ZM0A 4JXSA 5FQQA 4GDBA 5M1AA 4FH2A 3ZNTA 1C3BA 2VGJA 4JF5A 4OP5A 1CI9A 3NI9A 4E3JA 3ZDJA 1OMEA 1L0DA 4BLMA 2ZC5B 4ZJ2A 5DTKA 5HFOA 5EECA 3MFDA 1L0EA 1PZPA 2ZC3B 3UDXA 4C6YA 4WZ4A 5DF9A 3PBOA 4ZTKA 1J9MA 1K54A 1ERMA 1KGFA 1W79A 1PI4A 3IXHA 5DVAA 4N9LA 4GOGA 1QMEA 1GA0A 1XA7A 3HUNA 4UA6A 1XXMA 3Q07A 2WGIA 5FQKA 1YLJA 3BFDA 3D4FA 4UA7A 3I7JA 2ZM8A 2WAEA 1LLBA 1E3UA 1NZUA 2EX9A 4PMAA 3S1YA 4DXCA 3IQAA 3BLMA 4GDNA 1ZKJA 3BFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X53 A;  3Q7V B;  4Y0O A;  5CTN A;  5CEB A;  5FAS A;  3OPR A;  1TDL A;  5CRF A;  3IHB A;  4JXV A;  1H8Y A;  5IHV A;  4PM6 A;  1JWV A;  4UAA A;  3GR2 A;  1IEL A;  1LHY A;  1YT4 A;  2Y91 A;  3HVF A;  1KGG A;  4OQG A;  2P74 A;  3IH9 A;  3VOY A;  1DJA A;  4P85 A;  4KG6 A;  4PM9 A;  5FAQ A;  5F1F A;  5EVI B;  2EFU A;  3WS0 A;  4YIN A;  2X02 A;  1MWS A;  5DTS A;  3S4X A;  4U0T A;  5TFQ A;  3TG9 A;  2QMI A;  1JTD A;  1CK3 A;  4N9K A;  4S2N A;  4E3N A;  1WYB A;  5EUA A;  1ZG6 A;  2J7V A;  2P9V A;  1KGE A;  2FFY A;  3E2K A;  2HP9 A;  4PM5 A;  3G34 A;  2OSU A;  2Z2M B;  2VGK A;  3LEZ A;  1IYS A;  1EWZ A;  1PWD A;  2PBY A;  2ZQ8 A;  2G2U A;  4YFM A;  3RXW A;  5FI6 A;  4BD1 A;  2WZX A;  3MZE A;  3PAG A;  3ZG7 B;  5E2H A;  2ZQA A;  3OCL A;  4WM9 A;  5E2G A;  3UO9 A;  1LL5 A;  4OOY A;  2Q9N A;  1K6R A;  4X68 A;  3ZNY A;  3SS3 A;  1PIO A;  4WEK A;  1SKF A;  3HLC A;  1E4D A;  4QB8 A;  1EI5 A;  4OLG A;  4RA7 A;  1BUE A;  2ZLY A;  1GA9 A;  4P87 A;  4QY5 A;  3P09 A;  1FCM A;  5JYP A;  3NDE A;  2ZQD A;  1N9B A;  4FCF A;  3GMW A;  4IVK A;  2XD5 A;  3IF6 A;  3C4O A;  3W4O A;  2QZ6 A;  4U0X A;  2RCX A;  5FAO A;  1K55 C;  1PZO A;  4WMC A;  1FR6 A;  4EV4 A;  5FAP A;  1O07 A;  4EBL A;  5G18 A;  3WWX A;  3NIA A;  3VP1 A;  2H0T A;  1S6R A;  1GHM A;  4GZB A;  4Q8I A;  5CGW A;  4EQI A;  3FZC A;  4BEN A;  1ES5 A;  4DF6 A;  5CED A;  4GKU A;  3IWQ A;  4EBP A;  1IYO A;  1N4O A;  4OOL A;  5FQ9 A;  4B4X A;  4BQM A;  3VP0 A;  3A3D A;  4OON A;  5A92 A;  1PYY A;  4E6X A;  4A5R A;  1NY0 A;  3V50 A;  1ES2 A;  1FCO A;  3ZG5 A;  3G2Y A;  2BG1 A;  4LV2 A;  2V20 A;  1XPB A;  2XQZ A;  1HTZ A;  1L0F A;  3EQV A;  3MZF A;  1YLT A;  1FOF A;  1W7F A;  3NBL A;  3MKF A;  3VP2 A;  5F1G A;  1KVL A;  3S22 A;  3ZVT A;  3ZGA B;  2H10 A;  2EXA A;  2Y55 A;  5EPH A;  5FA7 A;  2XK1 A;  1RGZ A;  1VQQ A;  3CZD A;  4OOM A;  1IYP A;  2XR0 A;  2BLS A;  3IXD A;  5EVI C;  1NZO A;  3VFF A;  2RL3 A;  4Y0T A;  4E6W A;  2XGN A;  3FWL A;  4PM7 A;  1SDN A;  2ZD8 A;  4OP8 A;  5J8X A;  5FI7 A;  2DCF A;  1JWZ A;  4WBG A;  5HAP A;  4DE3 A;  4E3I A;  1WE4 A;  2B5R A;  3SH8 A;  3UN7 A;  4KZB A;  3QNC A;  4KZ4 A;  2Y2L A;  3WRZ A;  2ZQC A;  4S2J A;  3VP4 A;  3CJM A;  5HW3 A;  3NCK A;  4DDY A;  1KE3 A;  4F94 A;  3VP3 A;  3ZFZ A;  2WAF A;  5HX9 A;  2JC7 A;  5CER A;  4C75 A;  1XKZ A;  1ONG A;  2WKE A;  3Q82 A;  1GCE A;  5TR7 A;  2WZZ A;  2WGV A;  1U60 A;  3CG5 A;  2HDR A;  3TSG A;  5KSC A;  3Q1F A;  4RX2 A;  3UNW A;  4L0L A;  1XP4 A;  1K38 A;  4EWF A;  2ZM2 A;  1QMF A;  3G2Z A;  5CGS A;  1FSW A;  1XA1 A;  4KZ3 A;  4E3K A;  1MXO A;  4OLD A;  4QY6 A;  4RYE A;  5AQ9 A;  5CTM A;  1I5Q A;  4S2K A;  3ZVW A;  5DF8 A;  4D2O A;  4ZDX A;  3LY3 A;  3E2L A;  1G68 A;  1ONH A;  2WKH A;  2WYX A;  3SH9 A;  3V3S A;  2R9X A;  3A3I A;  3NC8 A;  4WZ5 A;  3HLE A;  3ITA A;  3V3R A;  1YLW A;  5M18 A;  2HP6 A;  1TVF A;  1Z6F A;  2XFS A;  3HUM A;  1K55 A;  4OPR A;  1E25 A;  2DNS A;  2ZC6 B;  3MZD A;  1G6A A;  1Y54 A;  3BEB A;  3G30 A;  3G4P A;  1YM1 A;  1BLP A;  3IXB A;  3FKW A;  3FV7 A;  4KZ6 A;  3OPH A;  1ERQ A;  1NJ4 A;  1PW1 A;  4JXG A;  2OV5 A;  5FAT A;  2WAD A;  4OQ0 A;  4LCM A;  3BEC A;  4S2N C;  3MBZ A;  2ZC4 B;  3QNB A;  2A49 A;  3MXR A;  3HUO A;  3MXS A;  3Q7V A;  5AQA A;  5U47 A;  2Q9M A;  3G31 A;  4MNR A;  2WGW A;  3VMA A;  4E3L A;  1IEM A;  4R3J A;  4R4S A;  3G35 A;  1Q2Q A;  2HPB A;  2OLV A;  3BRM A;  2J9O A;  5EVI A;  4JBF A;  1TEM A;  4GNU A;  5GHZ A;  3AGD A;  3ITB A;  3SH7 A;  3ZCZ A;  1FSY A;  3TOI A;  1CI8 A;  2R9W A;  3M6H A;  3BM6 A;  3HL9 A;  1KE0 A;  4Z9Q A;  5GHX A;  3WS2 A;  4JF6 A;  5M19 A;  3W4Q A;  1PWG A;  3AGF A;  5CHJ A;  3WRT A;  1MKI A;  2Y2J A;  5GLD A;  3IXG A;  4ZAM A;  3A3F A;  5HL1 A;  1HVB A;  1KDS A;  3HLW A;  3M2K A;  1RGY A;  1YLZ A;  2C6W B;  4KQQ A;  5CXW A;  4ZJ3 A;  5JYO A;  5E2E A;  1BUL A;  3OCN A;  4S2M A;  1M40 A;  3GSG A;  2HDS A;  4BL3 A;  5EOE A;  3IH8 A;  1BTL A;  4WEL A;  3LO7 A;  1CEG A;  5GLC A;  5A93 A;  1MWT A;  4ZJ1 A;  5F82 A;  3PBT A;  3IT9 A;  1SCW A;  4EBN A;  4MBK A;  4HEF A;  5AQB A;  1ESI A;  3SS5 A;  4H8R A;  2WUQ A;  3N8L A;  3LY4 A;  3VFH A;  4K0W A;  4KQR A;  4N92 A;  1I2W A;  2QPN A;  3BLS A;  1K54 C;  1DJB A;  3A3J A;  3PAE A;  3G32 A;  4BL2 A;  4KEN B;  2X71 A;  1HD8 A;  1S0W A;  2EFX A;  4MEZ A;  4FH4 A;  2EX2 A;  4U3T A;  4E3O A;  4K0X A;  5EOO A;  1ES4 A;  1YMX A;  1K4F A;  4IBR A;  5FI2 A;  1IKI A;  4CPK A;  2FFF B;  2WK0 A;  3PBQ A;  3GRJ A;  2V1Z A;  1BZA A;  4KZ8 A;  2DRW A;  1GHI A;  4QJG A;  5E2F A;  1NRF A;  4OPY A;  2HP5 A;  5GLA A;  3O87 A;  4OVD A;  4WYY A;  1MY8 A;  1NYY A;  1GHP A;  1PI5 A;  4JF4 A;  3NDG A;  4OQI A;  1PWC A;  2UWX A;  3C5A A;  4HES A;  4UA9 A;  1ALQ A;  1NYM A;  2XH9 A;  4OPZ A;  4CJN A;  3GTC A;  5A90 A;  4B88 A;  4N1H A;  1JTG A;  5FQM A;  4NET A;  4IVI A;  1K57 A;  2Y2I A;  3C7U A;  4X6T A;  3C4P A;  2E8I A;  2ZMA A;  4R0Q A;  4WZ5 C;  4JPM A;  1MWR A;  5CGX A;  3HLG A;  5FDH A;  2GDN A;  2HDQ A;  4HBT A;  1L0G A;  4DRT A;  3DTM A;  1ESU A;  2I72 A;  2Y2H A;  3OC2 A;  1YQS A;  2ZC7 A;  2WGW B;  4FSF A;  3UPP A;  3IWI A;  3O86 A;  3HLB A;  1MWU A;  5CHU A;  1ZG4 A;  3UDF A;  5KMW A;  3PBS A;  4KG5 A;  2XLN A;  2EXB A;  3P98 A;  2XF3 A;  4KZA A;  2ZJ9 A;  4DE0 A;  1WYC A;  1MPL A;  1SDE A;  3EQU A;  4LEN A;  4OPQ A;  4HBU A;  5DTT A;  3FYZ A;  3SS4 A;  5GHY A;  4KQO A;  3VSL A;  3GVB A;  2JCH A;  3W8K A;  2JBF A;  1LI0 A;  3UE1 A;  1FCN A;  3UY6 A;  1O7E A;  3A3E A;  4LV3 A;  2P9V B;  4BD0 A;  5BOH A;  2J9P A;  3M2J A;  4LV1 A;  4OQH A;  4RX3 A;  4C3Q A;  3IWO A;  1Q2P A;  1YMS A;  3N4I A;  4KZ7 A;  3ISG A;  2XEP A;  5HAI A;  4MBH A;  4PPR A;  3SOI A;  3WS4 A;  3B3X A;  1E3U D;  4K91 A;  3WS1 A;  4DXB A;  3IF6 C;  1ERO A;  1KDW A;  4KZ9 A;  4RVA A;  2IWD A;  4UHU A;  3FKV A;  3N8S A;  2Y2K A;  3UPO A;  3OPP A;  4IBX A;  3UE3 A;  2WKI A;  5FQI A;  3GQZ A;  3NY4 A;  2Z2L B;  3N7W A;  4MLL A;  1BLS A;  4N1X A;  4S2O A;  3UDI A;  3VSK A;  1L2S A;  1K25 A;  4GN2 A;  4LV0 A;  4P0M A;  4S2I A;  5KZH A;  4KZ5 A;  2IWB A;  4O7D A;  1H5X A;  2H5S A;  2Y2M A;  1H8Z A;  4XUZ A;  2IWC A;  1K56 D;  1HZO A;  4BJP A;  1SHV A;  5L2F A;  4MBF A;  1K6S A;  3QHY A;  4GD6 A;  3HLD A;  5A91 A;  3RXX A;  5I94 A;  3IF6 B;  5TGF A;  3PBR A;  1DY6 A;  4GD8 A;  2OLU A;  3VOZ A;  3WS5 A;  4E3M A;  4DE2 A;  3M6B A;  5FSR A;  4R4R A;  1DJC A;  2XFT A;  1JVJ A;  3RJU A;  3LCE A;  3W4P A;  3O3V A;  3BFF A;  4OKP A;  5HAQ A;  3MKE A;  4DE1 A;  3JYI A;  1PW8 A;  4Y0U A;  5AQ7 A;  3N6I A;  3O88 A;  3C7V A;  5EVL A;  3IF5 A;  1AXB A;  2Y2G A;  4P6B A;  2C5W B;  4IED A;  4X56 A;  4XUX A;  2EX6 A;  4ZBE A;  1JWP A;  3HBR A;  1XGI A;  4NK3 A;  2Y2Q A;  3DWZ A;  2HDU A;  5KSH A;  1BLH A;  3UPN A;  2G2W A;  2ZQ9 A;  2PU2 A;  1LL9 A;  1ES3 A;  2JE5 A;  3DWK A;  1M6K A;  1YLY A;  4FD8 A;  5EVI D;  2A3U A;  2EX8 A;  4JKT A;  4DKI A;  1VM1 A;  4QD4 A;  4JLF A;  4WMC D;  3V5M A;  3ZG0 A;  5D3O A;  1BLC A;  3CMZ A;  1YLP A;  1LI9 A;  3OZH A;  1K56 A;  2CC1 A;  5F83 A;  3N8R A;  3ZHH A;  5CHM A;  4GB7 A;  1RCJ A;  3GV9 A;  4EUZ A;  1K4E A;  3PTE A;  5E43 A;  1TDG A;  2XD1 A;  4DDS A;  3BFE A;  5CEC A;  1IKG A;  5GL9 A;  4X55 A;  3ZG9 B;  3ZG8 B;  2Y2N A;  4WEJ A;  4Y7P A;  2PU4 A;  1W8Y A;  2J8Y A;  5HAR A;  4OH0 A;  3Q7Z A;  5DF7 A;  2XDM A;  4M3K A;  1FQG A;  3IHA A;  1K57 C;  3AGE A;  1IYQ A;  1BT5 A;  1RP5 A;  4ID4 A;  4S2L A;  1W5D A;  4R3B A;  1ZC2 A;  1XX2 A;  3HLF A;  4KG2 A;  3OPL A;  1MBL A;  1BSG A;  5GLB A;  2H0Y A;  3DW0 A;  1XGJ A;  2Y2O A;  4X69 A;  4R1G A;  3BFG A;  4LCL A;  4PM8 A;  4QU3 A;  1CEF A;  4XXR A;  4R23 A;  4S2P A;  5EE8 A;  4B4Z A;  2Y4A A;  3PBN A;  4JXW A;  2Y59 A;  1I2S A;  1KVM A;  2Y2P A;  2V2F F;  3BYD A;  1NXY A;  3HRE A;  4QHC A;  1FR1 A;  5FQJ A;  3Q81 A;  3UE0 A;  1W8Q A;  2ZQ7 A;  1KE4 A;  3V39 A;  2X01 A;  2ZM0 A;  4JXS A;  5FQQ A;  4GDB A;  5M1A A;  4FH2 A;  3ZNT A;  1C3B A;  2VGJ A;  4JF5 A;  4OP5 A;  1CI9 A;  3NI9 A;  4E3J A;  3ZDJ A;  1OME A;  1L0D A;  4BLM A;  2ZC5 B;  4ZJ2 A;  5DTK A;  5HFO A;  5EEC A;  3MFD A;  1L0E A;  1PZP A;  2ZC3 B;  3UDX A;  4C6Y A;  4WZ4 A;  5DF9 A;  3PBO A;  4ZTK A;  1J9M A;  1K54 A;  1ERM A;  1KGF A;  1W79 A;  1PI4 A;  3IXH A;  5DVA A;  4N9L A;  4GOG A;  1QME A;  1GA0 A;  1XA7 A;  3HUN A;  4UA6 A;  1XXM A;  3Q07 A;  2WGI A;  5FQK A;  1YLJ A;  3BFD A;  3D4F A;  4UA7 A;  3I7J A;  2ZM8 A;  2WAE A;  1LLB A;  1E3U A;  1NZU A;  2EX9 A;  4PMA A;  3S1Y A;  4DXC A;  3IQA A;  3BLM A;  4GDN A;  1ZKJ A;  3BFC A; 
#chains in the Genus database with same CATH topology
 4IJG A;  4MCW A;  5CTN A;  5CEB A;  2EWW A;  2L1M A;  3PYP A;  5IHV A;  1JWV A;  4UAA A;  1IEL A;  4OQG A;  5F69 A;  3VOY A;  1DJA A;  4P85 A;  4PM9 A;  5FAQ A;  1DP9 A;  5F1F A;  5TFQ A;  4S2N A;  2XA7 S;  4HH3 A;  1ZG6 A;  3E2K A;  4PM5 A;  4XT2 B;  3G34 A;  2V1A A;  2PBY A;  2ZQ8 A;  1VET A;  2ZL1 A;  4HJ6 A;  4BD1 A;  3ZG7 B;  3V67 A;  2IA2 A;  2ZQA A;  4X68 A;  4WN5 A;  5CX7 A;  4QB8 A;  4E04 A;  1IOU A;  2ZLY A;  3ZQ5 A;  5DJU A;  1W63 Q;  1TS6 A;  5JYP A;  1T1A A;  2ZQD A;  1N9B A;  3EEH A;  3IBR A;  4IVK A;  5AJG A;  3IF6 A;  3C4O A;  4U0X A;  4F3L A;  1GSV A;  1FR6 A;  4NXE A;  3EWK A;  3WWX A;  1GHM A;  2J3T C;  5CGW A;  4GKU A;  3IWQ A;  4Q0J A;  2BAS A;  4FOF A;  2V8F A;  3A3D A;  5HWW A;  3VE4 A;  2V20 A;  4JGP A;  1HTZ A;  1L0F A;  1YLT A;  3D72 A;  1NLY A;  1RGZ A;  3CZD A;  1IYP A;  3IXD A;  5EVI C;  4X25 A;  3UMD A;  3OBF A;  3VFF A;  4Y0T A;  4E6W A;  4PM7 A;  2O99 A;  4GJ4 A;  5HAP A;  4EES A;  3SH8 A;  2Y2L A;  3WRZ A;  4S2J A;  3CJM A;  3NCK A;  3QP4 A;  4DDY A;  4X1M A;  4C75 A;  4EEP A;  1ONG A;  4PAU A;  4RX2 A;  1K38 A;  3G2Z A;  1QMF A;  4KZ3 A;  1YSP A;  4OLD A;  1I5Q A;  5K5B A;  2OWJ A;  3ZVW A;  3LR5 A;  4D2O A;  2VV8 A;  4ZDX A;  1ONH A;  4IUH A;  3A3I A;  3CWF A;  3HUM A;  4OPR A;  2DNS A;  1G6A A;  1Y54 A;  3BEB A;  2VZW A;  4KUO A;  3T1R A;  5J7E A;  4KZ6 A;  3OPH A;  5EM0 A;  2WAD A;  2A49 A;  5AQA A;  3NJA A;  4E3L A;  2WGW A;  3VMA A;  1MKM A;  4R4S A;  1Q2Q A;  2OLV A;  2J9O A;  5EVI A;  3CUE A;  4O0P A;  1H0M A;  3ZCZ A;  3T4T A;  1CI8 A;  2R9W A;  3BM6 A;  3NOT C;  3WS2 A;  3G6O A;  2P04 A;  3W4Q A;  1PWG A;  3AGF A;  4R70 A;  1MKI A;  2Y2J A;  2L4R A;  5CXW A;  2GZA A;  3OCN A;  4S2M A;  4L9E A;  2HDS A;  3IH8 A;  1MZU A;  1CEG A;  5GLC A;  2XA7 M;  3T50 A;  3BY8 A;  5FDS A;  5AQB A;  3H9W A;  3SS5 A;  3BQA A;  3N8L A;  4K0W A;  3D3O A;  2QPN A;  5HPF A;  2X71 A;  4O8G A;  4FH4 A;  4K0X A;  1ES4 A;  2ZL1 B;  2PD7 A;  3PBQ A;  4KZ8 A;  2DRW A;  3UB8 A;  1S4R A;  5J3W A;  3GEC A;  1GHP A;  1T19 A;  3NDG A;  3C5A A;  4UA9 A;  1MC0 A;  4CJN A;  3GTC A;  3S7P A;  4NET A;  4IVI A;  2Y2I A;  2E8I A;  3KYE A;  2Y2H A;  2HV1 A;  3OC2 A;  2ZC7 A;  3MJQ A;  3UPP A;  3O86 A;  1MWU A;  5KMW A;  4KG5 A;  2XLN A;  3P98 A;  2WKP A;  1GSX A;  1WYC A;  1SDE A;  2ZMV A;  4LEN A;  3W8K A;  5GHY A;  3LIE A;  2QJ7 A;  3A3E A;  5G4Z A;  5BOH A;  2XEP A;  3WS4 A;  4PPR A;  1LSW A;  3TJZ C;  1E3U D;  4EW7 A;  3IF6 C;  1ERO A;  5I5L A;  4UHU A;  3OPP A;  2Z2L B;  4LV0 A;  1P9R A;  4O7D A;  4XUZ A;  1OT9 A;  2IWC A;  2WKQ A;  1KOU A;  4GD6 A;  5A91 A;  4E3M A;  4G3W A;  4IUK A;  1IFQ A;  3W4P A;  3MKE A;  3JYI A;  4WUJ A;  4Y0U A;  5AQ7 A;  3O88 A;  4WLA A;  1AXB A;  2PAV P;  2C5W B;  1BLH A;  3DTI A;  4G3K A;  2PHY A;  3DAV A;  1LL9 A;  1ES3 A;  2EX8 A;  4WMC D;  1YLP A;  2H28 A;  1K56 A;  4JGR A;  1AWI A;  4EET B;  5CHM A;  3KSI A;  1VEU A;  2KDK A;  2XD1 A;  2PT7 A;  5GL9 A;  4X55 A;  2PU4 A;  1V9Z A;  4M3K A;  1K57 C;  1IYQ A;  2W1T B;  4ID4 A;  1W5D A;  4R3B A;  3HLF A;  4KG2 A;  3UME A;  1BSG A;  4CQH A;  1XGJ A;  1CEF A;  4XXR A;  4S2P A;  5TBM A;  2Y4A A;  4JXW A;  1I2S A;  2V2F F;  3HRE A;  1FR1 A;  3V39 A;  2X01 A;  3IX3 A;  3DTE A;  1C3B A;  2VGJ A;  4DMZ A;  1CI9 A;  4BLM A;  1OME A;  1L0D A;  4G3V A;  5DTK A;  2YKF A;  3H82 A;  1PZP A;  2ZC3 B;  1LSV A;  3E0Y A;  3UDX A;  4WZ4 A;  3PBO A;  2W1T A;  1J9M A;  1W79 A;  1PI4 A;  5DVA A;  1FIK A;  1GA0 A;  4NXG A;  2QWS A;  1XXM A;  1YLJ A;  4UA7 A;  4GHI A;  3I7J A;  1XFN A;  2KX6 A;  2ZM8 A;  2WAE A;  2EX9 A;  1P0Z A;  1OTB A;  2OWH A;  4Y0O A;  4GCZ A;  4HJ3 A;  3EGD C;  1BYW A;  4KUK A;  5MC7 A;  3OPR A;  1H8Y A;  3QP8 A;  1LHY A;  1CJF A;  4HJ4 A;  3VE3 A;  3HVF A;  5HZH A;  1KGG A;  2P74 A;  4KG6 A;  3S7Q A;  4NEE D;  2EFU A;  4YIN A;  2X02 A;  3TG9 A;  1JTD A;  1K0K A;  2NUT C;  5EUA A;  2P9V A;  2VGK A;  3CI6 A;  5FI6 A;  2WZX A;  3PAG A;  4LRZ E;  1P9W A;  2K7S A;  3UO9 A;  1LL5 A;  2Q9N A;  2V0W A;  3SS3 A;  1S66 L;  3EOI A;  1E4D A;  4CLC E;  5F5Y A;  1GA9 A;  4P87 A;  2R78 A;  4FCF A;  3P01 A;  1K55 C;  1PZO A;  3IBJ A;  4EV4 A;  1O07 A;  3LIF A;  2Y79 A;  5EVE A;  4K08 A;  4P6Z S;  4E6X A;  1NY0 A;  3V50 A;  1ES2 A;  1FCO A;  1XJ6 A;  3G2Y A;  2BG1 A;  3EQV A;  3CUE C;  3MZF A;  3NBL A;  3QP5 A;  3CIT A;  3MKF A;  4PKY A;  5F1G A;  3ZVT A;  3ZGA B;  2H10 A;  2EXA A;  5EPH A;  2XK1 A;  4OOM A;  2XR0 A;  2KLI A;  2BLS A;  2RL3 A;  5IT5 A;  4WF0 A;  1S67 L;  1SDN A;  4OP8 A;  5FI7 A;  1JWZ A;  4WBG A;  4DE3 A;  1WE4 A;  4H6J B;  2B5R A;  3QNC A;  4KZ4 A;  4F94 A;  5HX9 A;  2JC7 A;  5CER A;  1XKZ A;  2WGV A;  1U60 A;  2D02 A;  3Q1F A;  1J3W A;  4L0L A;  1VET B;  3CPT B;  2ZM2 A;  4Y2F A;  1FSW A;  1XA1 A;  3PR6 A;  1JNU A;  3E2L A;  1YAX A;  3DTK A;  2R9X A;  4WZ5 A;  3V3R A;  1UGU A;  2XFS A;  1K55 A;  3PXP A;  3G30 A;  3G4P A;  1YM1 A;  4YNR A;  1BLP A;  3LI8 A;  3FV7 A;  1NJ4 A;  5FAT A;  4YOF A;  4I39 A;  3BEC A;  4S2N C;  3LYX A;  3MBZ A;  2ZC4 B;  3QNB A;  3MXR A;  3MXS A;  3Q7V A;  3G31 A;  3KO6 A;  2YKH A;  3BRM A;  4GNU A;  3VV4 A;  3ITB A;  2K2N A;  3FG8 A;  3SW1 A;  3QP2 A;  3HL9 A;  3E98 A;  5M19 A;  1NWZ A;  5C5K A;  5CHJ A;  3WRT A;  3A3F A;  2QJ5 A;  2P7J A;  4GHI B;  1RGY A;  2BTF P;  2C6W B;  2PR6 A;  4HNB A;  1M40 A;  3GSG A;  4JGQ A;  5F82 A;  3E4O A;  3D9Y A;  3LR3 A;  4MBK A;  4HEF A;  4EEU A;  1ESI A;  4H8R A;  4ARZ A;  2WUQ A;  5DFY A;  3LY4 A;  1STZ A;  4N92 A;  1I2W A;  3PAE A;  4BL2 A;  4PHT A;  2EX2 A;  3SZT A;  2M1C A;  1K4F A;  3KYQ A;  2PBD P;  3GRJ A;  1YKD A;  4QJG A;  3IS2 A;  1PRQ A;  4X1L A;  2PR5 A;  4OVD A;  4EXO A;  1MY8 A;  1PI5 A;  1XFQ A;  4JF4 A;  2XH9 A;  1JTG A;  5FQM A;  1K57 A;  3C7U A;  4WZ5 C;  3K3D A;  3HLG A;  1ESU A;  2I72 A;  4FSF A;  3IWI A;  1ZG4 A;  3UDF A;  1XJ3 A;  2XF3 A;  2PDR A;  2ZJ9 A;  4KZA A;  1XJ2 A;  5FEG A;  2JKR I;  1MPL A;  2VKS A;  4OPQ A;  3GVB A;  2JBF A;  3E4Q A;  3LGO A;  1NRJ A;  4Q0H A;  4BD0 A;  2J9P A;  3M2J A;  4LV1 A;  4OQH A;  4LRY C;  3IWO A;  1Q2P A;  1TF1 A;  5HPI A;  4MN6 A;  3ISG A;  4Z1W A;  3WS1 A;  5HD3 A;  2O9C A;  1KDW A;  3IX8 A;  4RVA A;  3N8S A;  2Y2K A;  2OOL A;  4HHD A;  4IBX A;  3KX0 X;  5L10 A;  2W1R A;  4MLL A;  3VSK A;  3N7W A;  1BLS A;  4H6J A;  2J80 A;  4P0M A;  4S2I A;  1XJ4 A;  2O9A A;  1VHM A;  4BJP A;  5L2F A;  3CPT A;  1F98 A;  1K6S A;  3RXX A;  5I94 A;  1ODV A;  1DY6 A;  4GD8 A;  3M6B A;  4R4R A;  1DJC A;  2XFT A;  1JVJ A;  3LCE A;  2HJ9 C;  2L0W A;  1S4S A;  3BFF A;  4GS9 B;  1D1J A;  4DE1 A;  2XSS A;  5CED A;  4XUX A;  4X56 A;  1JWP A;  5L07 A;  4NK3 A;  2HDU A;  3DBA A;  2G2W A;  2ZQ9 A;  2JE5 A;  2A3U A;  4DKI A;  3HJK A;  3F1O B;  2VLG A;  1DP6 A;  3K3C A;  3OZH A;  5F83 A;  3U2A A;  2CMN A;  5EV0 A;  4NXF A;  3NUL A;  4EUZ A;  1K4E A;  3PTE A;  3ICY A;  2FH5 A;  3T4K A;  3LFV A;  2W0N A;  2ACG A;  4M4X A;  4WEJ A;  3Q7Z A;  5DF7 A;  2GJ3 A;  2FZ0 A;  3IHA A;  4UQI S;  3AGE A;  3C8C A;  1BT5 A;  1RP5 A;  4S2L A;  4FTX A;  1XX2 A;  3OPL A;  2H0Y A;  3T1S A;  1ZTU A;  4QU3 A;  1CF0 A;  1KVM A;  2Y2P A;  2JKG A;  2W3E A;  4QHC A;  1NXY A;  4GLQ A;  1UWN X;  3MMH A;  1L3L A;  5F68 A;  2M7V A;  4GDB A;  3ZNT A;  4JF5 A;  4HOI A;  3NI9 A;  2ZC5 B;  5DF9 A;  4EUV A;  5HWT A;  3IXH A;  1ERM A;  3H7W B;  2B18 A;  3FPV A;  4UA6 A;  5KIZ A;  1Y4O A;  2WGI A;  3P7N A;  3Q07 A;  3NOU C;  4NG2 A;  2JKT M;  3D4F A;  4XT2 A;  1E3U A;  3NEC A;  1SKO B;  5FAS A;  3IHB A;  4PM6 A;  1YT4 A;  2Y91 A;  1D7E A;  4I3J A;  1T1B A;  2VV6 A;  2B02 A;  5EVI B;  3WS0 A;  4RQ9 A;  1MWS A;  2QMI A;  1CK3 A;  2QYB A;  4N9K A;  5HDD A;  1WYB A;  2FFY A;  4R3A A;  2Z2M B;  1EWZ A;  1PWD A;  2G7U A;  2Z6C A;  2XRN A;  2G2U A;  3RXW A;  5A8B A;  5F6A A;  5E2H A;  4BWI A;  4WM9 A;  1CQA A;  4OOY A;  4HQA A;  1K6R A;  3ZNY A;  1GSW A;  3A0S A;  1PIO A;  1SKF A;  3HLC A;  1EI5 A;  4OLG A;  4RA7 A;  3TW8 A;  3BWL A;  1FCM A;  2VK3 A;  1YPR A;  3NDE A;  3GMW A;  2P08 A;  2QZ6 A;  5TBM B;  2V1B A;  5FAO A;  1V9Y A;  4EBL A;  2GNX A;  5G18 A;  3NIA A;  3MSH A;  3VP1 A;  2H0T A;  4GS9 A;  2ZOH A;  4GZB A;  4QWO A;  3FZC A;  4BEN A;  3LR4 A;  1ES5 A;  4DF6 A;  2W27 A;  3H82 B;  4EBP A;  1IYO A;  1N4O A;  4OOL A;  5FQ9 A;  4B4X A;  1DP8 A;  4OON A;  2Y8H A;  1PYY A;  4A5R A;  4LV2 A;  1XPB A;  2XQZ A;  1Z09 A;  3S7N A;  1FOF A;  2PD8 A;  1W7F A;  5HWV A;  3A0R A;  3EEA A;  5FA7 A;  2Y55 A;  4Y5F A;  3R7W B;  1S1Z A;  3LIA A;  4P6Z M;  2ZD8 A;  5J8X A;  3KSH A;  1LT0 A;  2VJW A;  4ETZ A;  2MJ6 A;  3LI9 A;  3UN7 A;  4KZB A;  3VP3 A;  3ZFZ A;  2WAF A;  3JVV A;  3Q82 A;  2WKE A;  5TR7 A;  3CG5 A;  1OTI A;  3TE8 A;  1A0K A;  1XP4 A;  4EWF A;  4E3K A;  1DRM A;  3C2W A;  5CTM A;  4S2K A;  5DF8 A;  2KOI A;  3V3S A;  1G68 A;  1OTD A;  2WKH A;  3NC8 A;  1N9L A;  2M7U A;  3ITA A;  1W63 M;  2HP6 A;  1TVF A;  3OLO A;  1E25 A;  4EER A;  2ZC6 B;  4ETX A;  3F1N B;  1OTE A;  3F1N A;  2ZBB A;  4Q0I A;  3IXB A;  4B9O A;  2PYP A;  1ERQ A;  1PW1 A;  2OV5 A;  4LCM A;  2VGL M;  1ACF A;  2QHK A;  2Q9M A;  4R3J A;  3G35 A;  2HPB A;  2ZMF A;  4JBF A;  4NXB A;  5GHZ A;  1OJG A;  2K31 A;  3SH7 A;  1FSY A;  1S1Y A;  4Z9Q A;  1KE0 A;  1OPX A;  5GHX A;  4JF6 A;  2OAQ 1;  5DKK A;  5GLD A;  3IXG A;  5HL1 A;  1HVB A;  3M2K A;  1YLZ A;  4ZJ3 A;  5HD5 A;  5JYO A;  5E2E A;  1BUL A;  2HJE A;  4PKY G;  4BL3 A;  3LUQ A;  4WEL A;  4HIA A;  5A93 A;  4ZJ1 A;  3UB9 A;  3IT9 A;  1OJ5 A;  4EBN A;  2V8C A;  3UB5 P;  4JGO A;  3CHW P;  2EA9 A;  1K54 C;  3R4K A;  3A3J A;  3G32 A;  4KEN B;  1HD8 A;  1S0W A;  3TRC A;  4E3O A;  5EOO A;  1YMX A;  5FI2 A;  2LB5 A;  4HH2 A;  2WK0 A;  1F9I A;  2V1Z A;  1GHI A;  5E2F A;  1NRF A;  1F2K A;  5LBR A;  4I3A A;  3O87 A;  4WYY A;  1NYY A;  4YWZ A;  4OQI A;  1ALQ A;  1NYM A;  4OPZ A;  4B88 A;  4N1H A;  3T4L A;  3C4P A;  2ZMA A;  4R0Q A;  5CGX A;  4JPM A;  3LEQ A;  3DTM A;  1FIL A;  5L8M A;  2EWV A;  1YQS A;  2W3H A;  2EXB A;  4DE0 A;  1UWP X;  4HBU A;  3FYZ A;  3SS4 A;  4KQO A;  5HSQ A;  2JCH A;  3BY9 A;  1FCN A;  1O7E A;  4LV3 A;  4CLC A;  2P9V B;  4RX3 A;  4C3Q A;  3EGX C;  3MQO A;  3N4I A;  3SOI A;  4MBH A;  3B3X A;  4K91 A;  4DXB A;  1EW0 A;  5TJJ A;  2IWD A;  3FKV A;  2WKI A;  4N1X A;  3UDI A;  4S2O A;  4ARZ B;  4KZ5 A;  2H5S A;  2JKF A;  1H8Z A;  4HY8 A;  1HZO A;  1SHV A;  3QHY A;  3HLD A;  3T1X A;  2OLU A;  3WS5 A;  3L9K A;  3ULF A;  3RJU A;  2J3W A;  3O3V A;  2INW A;  2V0U A;  3N6I A;  5EVL A;  4P6B A;  3RTY A;  4ZBE A;  4HI4 A;  2EX6 A;  1XGI A;  3UPN A;  5DKL A;  3DWK A;  1M6K A;  4FD8 A;  4JKT A;  4QD4 A;  5D3O A;  2VA0 A;  3CMZ A;  3MXQ A;  3MR0 A;  2CC1 A;  2WKR A;  5E43 A;  1TDG A;  3L7H A;  4GW9 A;  3OOV A;  1IKG A;  3QP1 A;  3C30 A;  3ZG9 B;  3ZG8 B;  2J8Y A;  5HAR A;  4OH0 A;  2XDM A;  1FQG A;  1LSX A;  3H7W A;  2VEA A;  4IHQ A;  3JVU A;  2HGV A;  2Y2O A;  4X69 A;  4F3L B;  3BFG A;  4LCL A;  1N9O A;  4B4Z A;  1G5U A;  3S7O A;  3BYD A;  3Q81 A;  3UE0 A;  1W8Q A;  1KE4 A;  1VEU B;  2ZM0 A;  4JXS A;  5FQQ A;  4FH2 A;  3FC7 A;  1TS8 A;  4E3J A;  5HFO A;  5EEC A;  4FUW A;  3MFD A;  1L0E A;  3UB6 A;  4ZTK A;  1K54 A;  3T4Q A;  1KGF A;  4N9L A;  4GOG A;  4DJ3 A;  1G6O A;  1XA7 A;  3HUN A;  4R6L A;  4QPR A;  2A2L A;  2QKP A;  4PMA A;  1LLB A;  3BW6 A;  5L09 A;  4I38 A;  3IQA A;  5EFW A;  1ZKJ A;  4X53 A;  3Q7V B;  1N9N A;  4BBU A;  1TDL A;  5CRF A;  4JXV A;  4L9G A;  3GR2 A;  1WA9 A;  3IH9 A;  4R38 A;  2W3F A;  2NUP C;  2W3D A;  3LIC A;  5DTS A;  3S4X A;  4U0T A;  3PHY A;  4E3N A;  2J7V A;  1KGE A;  5FEF A;  2HP9 A;  2OSU A;  1YSQ A;  5G4Y A;  3LEZ A;  1IYS A;  4YFM A;  2UV0 E;  3MZE A;  3U4L P;  3T1Q B;  3OCL A;  5E2G A;  4BBV A;  4WEK A;  2AVX A;  1BUE A;  4QY5 A;  4ZRR A;  3P09 A;  1G28 A;  2VV7 A;  3W4O A;  2XD5 A;  4EQ1 A;  2RCX A;  5HDS A;  4WMC A;  1Y28 A;  1SKO A;  5FAP A;  1S6R A;  2D01 A;  4UEY A;  4Q8I A;  4EQI A;  3MQQ A;  4II7 A;  5J4E A;  4BQM A;  3VP0 A;  5A92 A;  3W2Z A;  3ZG5 A;  2JN7 A;  3VP2 A;  3B42 A;  1KVL A;  3S22 A;  1VQQ A;  3UB7 A;  2A24 B;  1T1C A;  1NZO A;  2XGN A;  3FWL A;  4NKP A;  2DCF A;  3CLO A;  4E3I A;  5EM1 A;  4BMW A;  2E8J A;  2ZQC A;  3C38 A;  3VP4 A;  5HW3 A;  1KE3 A;  3HJI A;  3JPU A;  1GCE A;  2WZZ A;  5KSC A;  1TS0 A;  2HDR A;  3TSG A;  3LIB A;  3F1P A;  3UNW A;  5CGS A;  1MXO A;  4RYE A;  4QY6 A;  5AQ9 A;  3LY3 A;  3SH9 A;  2WYX A;  3A0V A;  3HLE A;  5M18 A;  1YLW A;  1Z6F A;  3VOL A;  5AVF A;  1OTA A;  3BJN A;  3MZD A;  4DJ2 A;  5DFX A;  1H8M A;  3FKW A;  3T12 B;  3KYZ A;  1TS7 A;  2J3T D;  4JXG A;  4OQ0 A;  1VB6 A;  3LR0 A;  3HUO A;  5U47 A;  4MNR A;  1SZV A;  1IEM A;  5DJT A;  4LLO B;  1TEM A;  4Y13 A;  3AGD A;  3TOI A;  3FPW A;  3M6H A;  1D06 A;  5IU1 A;  4ZAM A;  3HLW A;  1KDS A;  4KQQ A;  2VGL S;  4I3I A;  5EOE A;  1BTL A;  3LO7 A;  2V9A A;  3R7W A;  1MWT A;  4L9F A;  3T4S A;  3PBT A;  4LGW A;  1SCW A;  1NLZ A;  3RH8 B;  3MS6 A;  2VX8 A;  4KQR A;  3VFH A;  3BLS A;  4MDZ A;  1DJB A;  2EFX A;  4MEZ A;  2W3G A;  4U3T A;  3ZYT A;  4IBR A;  4ME4 A;  1IKI A;  4CPK A;  2FFF B;  4HP9 A;  5HDC A;  1BZA A;  3HCY A;  2O9B A;  4OPY A;  2HP5 A;  1P97 A;  5GLA A;  1PWC A;  2UWX A;  4HES A;  2ZOI A;  5A90 A;  5AVE A;  4CLC B;  4BBT A;  4LPZ A;  4X6T A;  4HP4 A;  1MWR A;  5FDH A;  2GDN A;  2HDQ A;  2OAP 1;  4HBT A;  4LRX C;  1L0G A;  4DRT A;  1T18 A;  2WGW B;  1TD5 A;  3HLB A;  5CHU A;  2A24 A;  3PBS A;  4D60 A;  2JKR M;  3EQU A;  3MF0 A;  4DN0 A;  5DTT A;  3VSL A;  1PNE A;  1LI0 A;  3UE1 A;  2O0Y A;  3UY6 A;  3UE6 A;  1HLU P;  3KSG A;  1YMS A;  3F1P B;  4KZ7 A;  4CLC D;  5HAI A;  4MN7 A;  4KZ9 A;  4Y3I A;  4CLC C;  3K2N A;  1ZHH B;  3UPO A;  3UE3 A;  5FQI A;  3GQZ A;  3NY4 A;  4O01 A;  1L2S A;  1K25 A;  4GN2 A;  5KZH A;  2IWB A;  3MFX A;  1H5X A;  2Y2M A;  3NHQ A;  1K56 D;  2JHE A;  3E4P A;  4MBF A;  3NOP C;  3IF6 B;  5TGF A;  3PBR A;  3VOZ A;  3F1O A;  4DE2 A;  5FSR A;  4MN5 A;  1X0O A;  3T4O A;  4OKP A;  3T4J A;  5HAQ A;  2JKT I;  1PW8 A;  3BQ8 A;  4MMN A;  3C7V A;  3IF5 A;  2Y2G A;  4IED A;  4Y17 A;  3HBR A;  1H3Q A;  2Y2Q A;  3DWZ A;  5KSH A;  2PU2 A;  4ESP A;  4LFU A;  1YLY A;  2PRF A;  5EVI D;  1VM1 A;  3V5M A;  4JLF A;  3B33 A;  3ZG0 A;  1BLC A;  3O5Y A;  1LI9 A;  3IX4 A;  3N8R A;  3ZHH A;  4GB7 A;  4I5S A;  1RCJ A;  3GDI A;  3GV9 A;  2PYR A;  2HF6 A;  4DDS A;  3BFE A;  5CEC A;  1OT6 A;  4KQD A;  2Q0O A;  3KSF A;  5FL3 A;  2Y2N A;  2HZ5 A;  4EU0 A;  4Y7P A;  1W8Y A;  2GX5 A;  2LB9 A;  1LL8 A;  3QP6 A;  3RFB A;  1ZC2 A;  3MQ0 A;  1MBL A;  5GLB A;  3DW0 A;  3B47 A;  4R1G A;  4PM8 A;  4UQI M;  5EE8 A;  4R23 A;  3PBN A;  2Y59 A;  2Z6D A;  5FQJ A;  2ZQ7 A;  5IS1 A;  4WL9 A;  5M1A A;  1PFL A;  2B95 A;  4OP5 A;  3ZDJ A;  3LID A;  4ZJ2 A;  2XRO A;  2DMW A;  4C6Y A;  1F5M A;  3IS2 B;  2I9V A;  1QME A;  4AFI A;  4B93 A;  5FQK A;  3CAX A;  3BFD A;  4Y15 A;  5HL6 A;  1NZU A;  4DXC A;  3S1Y A;  3BLM A;  4GDN A;  3BFC A; 
#chains in the Genus database with same CATH homology
 4X53 A;  3Q7V B;  4Y0O A;  5CTN A;  5CEB A;  5FAS A;  3OPR A;  1TDL A;  5CRF A;  3IHB A;  4JXV A;  1H8Y A;  5IHV A;  4PM6 A;  1JWV A;  4UAA A;  3GR2 A;  1IEL A;  1LHY A;  1YT4 A;  2Y91 A;  3HVF A;  1KGG A;  4OQG A;  2P74 A;  3IH9 A;  3VOY A;  1DJA A;  4P85 A;  4KG6 A;  4PM9 A;  5FAQ A;  5F1F A;  5EVI B;  2EFU A;  3WS0 A;  4YIN A;  2X02 A;  1MWS A;  5DTS A;  3S4X A;  4U0T A;  5TFQ A;  3TG9 A;  2QMI A;  1JTD A;  1CK3 A;  4N9K A;  4S2N A;  4E3N A;  1WYB A;  5EUA A;  1ZG6 A;  2J7V A;  2P9V A;  1KGE A;  2FFY A;  3E2K A;  2HP9 A;  4PM5 A;  3G34 A;  2OSU A;  2Z2M B;  2VGK A;  3LEZ A;  1IYS A;  1EWZ A;  1PWD A;  2PBY A;  2ZQ8 A;  2G2U A;  4YFM A;  3RXW A;  5FI6 A;  4BD1 A;  2WZX A;  3MZE A;  3PAG A;  3ZG7 B;  5E2H A;  2ZQA A;  3OCL A;  4WM9 A;  5E2G A;  3UO9 A;  1LL5 A;  4OOY A;  2Q9N A;  1K6R A;  4X68 A;  3ZNY A;  3SS3 A;  1PIO A;  4WEK A;  1SKF A;  3HLC A;  1E4D A;  4QB8 A;  1EI5 A;  4OLG A;  4RA7 A;  1BUE A;  2ZLY A;  1GA9 A;  4P87 A;  4QY5 A;  3P09 A;  1FCM A;  5JYP A;  3NDE A;  2ZQD A;  1N9B A;  4FCF A;  3GMW A;  4IVK A;  2XD5 A;  3IF6 A;  3C4O A;  3W4O A;  2QZ6 A;  4U0X A;  2RCX A;  5FAO A;  1K55 C;  1PZO A;  4WMC A;  1FR6 A;  4EV4 A;  5FAP A;  1O07 A;  4EBL A;  5G18 A;  3WWX A;  3NIA A;  3VP1 A;  2H0T A;  1S6R A;  1GHM A;  4GZB A;  4Q8I A;  5CGW A;  4EQI A;  3FZC A;  4BEN A;  1ES5 A;  4DF6 A;  5CED A;  4GKU A;  3IWQ A;  4EBP A;  1IYO A;  1N4O A;  4OOL A;  5FQ9 A;  4B4X A;  4BQM A;  3VP0 A;  3A3D A;  4OON A;  5A92 A;  1PYY A;  4E6X A;  4A5R A;  1NY0 A;  3V50 A;  1ES2 A;  1FCO A;  3ZG5 A;  3G2Y A;  2BG1 A;  4LV2 A;  2V20 A;  1XPB A;  2XQZ A;  1HTZ A;  1L0F A;  3EQV A;  3MZF A;  1YLT A;  1FOF A;  1W7F A;  3NBL A;  3MKF A;  3VP2 A;  5F1G A;  1KVL A;  3S22 A;  3ZVT A;  3ZGA B;  2H10 A;  2EXA A;  2Y55 A;  5EPH A;  5FA7 A;  2XK1 A;  1RGZ A;  1VQQ A;  3CZD A;  4OOM A;  1IYP A;  2XR0 A;  2BLS A;  3IXD A;  5EVI C;  1NZO A;  3VFF A;  2RL3 A;  4Y0T A;  4E6W A;  2XGN A;  3FWL A;  4PM7 A;  1SDN A;  2ZD8 A;  4OP8 A;  5J8X A;  5FI7 A;  2DCF A;  1JWZ A;  4WBG A;  5HAP A;  4DE3 A;  4E3I A;  1WE4 A;  2B5R A;  3SH8 A;  3UN7 A;  4KZB A;  3QNC A;  4KZ4 A;  2Y2L A;  3WRZ A;  2ZQC A;  4S2J A;  3VP4 A;  3CJM A;  5HW3 A;  3NCK A;  4DDY A;  1KE3 A;  4F94 A;  3VP3 A;  3ZFZ A;  2WAF A;  5HX9 A;  2JC7 A;  5CER A;  4C75 A;  1XKZ A;  1ONG A;  2WKE A;  3Q82 A;  1GCE A;  5TR7 A;  2WZZ A;  2WGV A;  1U60 A;  3CG5 A;  2HDR A;  3TSG A;  5KSC A;  3Q1F A;  4RX2 A;  3UNW A;  4L0L A;  1XP4 A;  1K38 A;  4EWF A;  2ZM2 A;  1QMF A;  3G2Z A;  5CGS A;  1FSW A;  1XA1 A;  4KZ3 A;  4E3K A;  1MXO A;  4OLD A;  4QY6 A;  4RYE A;  5AQ9 A;  5CTM A;  1I5Q A;  4S2K A;  3ZVW A;  5DF8 A;  4D2O A;  4ZDX A;  3LY3 A;  3E2L A;  1G68 A;  1ONH A;  2WKH A;  2WYX A;  3SH9 A;  3V3S A;  2R9X A;  3A3I A;  3NC8 A;  4WZ5 A;  3HLE A;  3ITA A;  3V3R A;  1YLW A;  5M18 A;  2HP6 A;  1TVF A;  1Z6F A;  2XFS A;  3HUM A;  1K55 A;  4OPR A;  1E25 A;  2DNS A;  2ZC6 B;  3MZD A;  1G6A A;  1Y54 A;  3BEB A;  3G30 A;  3G4P A;  1YM1 A;  1BLP A;  3IXB A;  3FKW A;  3FV7 A;  4KZ6 A;  3OPH A;  1ERQ A;  1NJ4 A;  1PW1 A;  4JXG A;  2OV5 A;  5FAT A;  2WAD A;  4OQ0 A;  4LCM A;  3BEC A;  4S2N C;  3MBZ A;  2ZC4 B;  3QNB A;  2A49 A;  3MXR A;  3HUO A;  3MXS A;  3Q7V A;  5AQA A;  5U47 A;  2Q9M A;  3G31 A;  4MNR A;  2WGW A;  3VMA A;  4E3L A;  1IEM A;  4R3J A;  4R4S A;  3G35 A;  1Q2Q A;  2HPB A;  2OLV A;  3BRM A;  2J9O A;  5EVI A;  4JBF A;  1TEM A;  4GNU A;  5GHZ A;  3AGD A;  3ITB A;  3SH7 A;  3ZCZ A;  1FSY A;  3TOI A;  1CI8 A;  2R9W A;  3M6H A;  3BM6 A;  3HL9 A;  1KE0 A;  4Z9Q A;  5GHX A;  3WS2 A;  4JF6 A;  5M19 A;  3W4Q A;  1PWG A;  3AGF A;  5CHJ A;  3WRT A;  1MKI A;  2Y2J A;  5GLD A;  3IXG A;  4ZAM A;  3A3F A;  5HL1 A;  1HVB A;  1KDS A;  3HLW A;  3M2K A;  1RGY A;  1YLZ A;  2C6W B;  4KQQ A;  5CXW A;  4ZJ3 A;  5JYO A;  5E2E A;  1BUL A;  3OCN A;  4S2M A;  1M40 A;  3GSG A;  2HDS A;  4BL3 A;  5EOE A;  3IH8 A;  1BTL A;  4WEL A;  3LO7 A;  1CEG A;  5GLC A;  5A93 A;  1MWT A;  4ZJ1 A;  5F82 A;  3PBT A;  3IT9 A;  1SCW A;  4EBN A;  4MBK A;  4HEF A;  5AQB A;  1ESI A;  3SS5 A;  4H8R A;  2WUQ A;  3N8L A;  3LY4 A;  3VFH A;  4K0W A;  4KQR A;  4N92 A;  1I2W A;  2QPN A;  3BLS A;  1K54 C;  1DJB A;  3A3J A;  3PAE A;  3G32 A;  4BL2 A;  4KEN B;  2X71 A;  1HD8 A;  1S0W A;  2EFX A;  4MEZ A;  4FH4 A;  2EX2 A;  4U3T A;  4E3O A;  4K0X A;  5EOO A;  1ES4 A;  1YMX A;  1K4F A;  4IBR A;  5FI2 A;  1IKI A;  4CPK A;  2FFF B;  2WK0 A;  3PBQ A;  3GRJ A;  2V1Z A;  1BZA A;  4KZ8 A;  2DRW A;  1GHI A;  4QJG A;  5E2F A;  1NRF A;  4OPY A;  2HP5 A;  5GLA A;  3O87 A;  4OVD A;  4WYY A;  1MY8 A;  1NYY A;  1GHP A;  1PI5 A;  4JF4 A;  3NDG A;  4OQI A;  1PWC A;  2UWX A;  3C5A A;  4HES A;  4UA9 A;  1ALQ A;  1NYM A;  2XH9 A;  4OPZ A;  4CJN A;  3GTC A;  5A90 A;  4B88 A;  4N1H A;  1JTG A;  5FQM A;  4NET A;  4IVI A;  1K57 A;  2Y2I A;  3C7U A;  4X6T A;  3C4P A;  2E8I A;  2ZMA A;  4R0Q A;  4WZ5 C;  4JPM A;  1MWR A;  5CGX A;  3HLG A;  5FDH A;  2GDN A;  2HDQ A;  4HBT A;  1L0G A;  4DRT A;  3DTM A;  1ESU A;  2I72 A;  2Y2H A;  3OC2 A;  1YQS A;  2ZC7 A;  2WGW B;  4FSF A;  3UPP A;  3IWI A;  3O86 A;  3HLB A;  1MWU A;  5CHU A;  1ZG4 A;  3UDF A;  5KMW A;  3PBS A;  4KG5 A;  2XLN A;  2EXB A;  3P98 A;  2XF3 A;  4KZA A;  2ZJ9 A;  4DE0 A;  1WYC A;  1MPL A;  1SDE A;  3EQU A;  4LEN A;  4OPQ A;  4HBU A;  5DTT A;  3FYZ A;  3SS4 A;  5GHY A;  4KQO A;  3VSL A;  3GVB A;  2JCH A;  3W8K A;  2JBF A;  1LI0 A;  3UE1 A;  1FCN A;  3UY6 A;  1O7E A;  3A3E A;  4LV3 A;  2P9V B;  4BD0 A;  5BOH A;  2J9P A;  3M2J A;  4LV1 A;  4OQH A;  4RX3 A;  4C3Q A;  3IWO A;  1Q2P A;  1YMS A;  3N4I A;  4KZ7 A;  3ISG A;  2XEP A;  5HAI A;  4MBH A;  4PPR A;  3SOI A;  3WS4 A;  3B3X A;  1E3U D;  4K91 A;  3WS1 A;  4DXB A;  3IF6 C;  1ERO A;  1KDW A;  4KZ9 A;  4RVA A;  2IWD A;  4UHU A;  3FKV A;  3N8S A;  2Y2K A;  3UPO A;  3OPP A;  4IBX A;  3UE3 A;  2WKI A;  5FQI A;  3GQZ A;  3NY4 A;  2Z2L B;  3N7W A;  4MLL A;  1BLS A;  4N1X A;  4S2O A;  3UDI A;  3VSK A;  1L2S A;  1K25 A;  4GN2 A;  4LV0 A;  4P0M A;  4S2I A;  5KZH A;  4KZ5 A;  2IWB A;  4O7D A;  1H5X A;  2H5S A;  2Y2M A;  1H8Z A;  4XUZ A;  2IWC A;  1K56 D;  1HZO A;  4BJP A;  1SHV A;  5L2F A;  4MBF A;  1K6S A;  3QHY A;  4GD6 A;  3HLD A;  5A91 A;  3RXX A;  5I94 A;  3IF6 B;  5TGF A;  3PBR A;  1DY6 A;  4GD8 A;  2OLU A;  3VOZ A;  3WS5 A;  4E3M A;  4DE2 A;  3M6B A;  5FSR A;  4R4R A;  1DJC A;  2XFT A;  1JVJ A;  3RJU A;  3LCE A;  3W4P A;  3O3V A;  3BFF A;  4OKP A;  5HAQ A;  3MKE A;  4DE1 A;  3JYI A;  1PW8 A;  4Y0U A;  5AQ7 A;  3N6I A;  3O88 A;  3C7V A;  5EVL A;  3IF5 A;  1AXB A;  2Y2G A;  4P6B A;  2C5W B;  4IED A;  4X56 A;  4XUX A;  2EX6 A;  4ZBE A;  1JWP A;  3HBR A;  1XGI A;  4NK3 A;  2Y2Q A;  3DWZ A;  2HDU A;  5KSH A;  1BLH A;  3UPN A;  2G2W A;  2ZQ9 A;  2PU2 A;  1LL9 A;  1ES3 A;  2JE5 A;  3DWK A;  1M6K A;  1YLY A;  4FD8 A;  5EVI D;  2A3U A;  2EX8 A;  4JKT A;  4DKI A;  1VM1 A;  4QD4 A;  4JLF A;  4WMC D;  3V5M A;  3ZG0 A;  5D3O A;  1BLC A;  3CMZ A;  1YLP A;  1LI9 A;  3OZH A;  1K56 A;  2CC1 A;  5F83 A;  3N8R A;  3ZHH A;  5CHM A;  4GB7 A;  1RCJ A;  3GV9 A;  4EUZ A;  1K4E A;  3PTE A;  5E43 A;  1TDG A;  2XD1 A;  4DDS A;  3BFE A;  5CEC A;  1IKG A;  5GL9 A;  4X55 A;  3ZG9 B;  3ZG8 B;  2Y2N A;  4WEJ A;  4Y7P A;  2PU4 A;  1W8Y A;  2J8Y A;  5HAR A;  4OH0 A;  3Q7Z A;  5DF7 A;  2XDM A;  4M3K A;  1FQG A;  3IHA A;  1K57 C;  3AGE A;  1IYQ A;  1BT5 A;  1RP5 A;  4ID4 A;  4S2L A;  1W5D A;  4R3B A;  1ZC2 A;  1XX2 A;  3HLF A;  4KG2 A;  3OPL A;  1MBL A;  1BSG A;  5GLB A;  2H0Y A;  3DW0 A;  1XGJ A;  2Y2O A;  4X69 A;  4R1G A;  3BFG A;  4LCL A;  4PM8 A;  4QU3 A;  1CEF A;  4XXR A;  4R23 A;  4S2P A;  5EE8 A;  4B4Z A;  2Y4A A;  3PBN A;  4JXW A;  2Y59 A;  1I2S A;  1KVM A;  2Y2P A;  2V2F F;  3BYD A;  1NXY A;  3HRE A;  4QHC A;  1FR1 A;  5FQJ A;  3Q81 A;  3UE0 A;  1W8Q A;  2ZQ7 A;  1KE4 A;  3V39 A;  2X01 A;  2ZM0 A;  4JXS A;  5FQQ A;  4GDB A;  5M1A A;  4FH2 A;  3ZNT A;  1C3B A;  2VGJ A;  4JF5 A;  4OP5 A;  1CI9 A;  3NI9 A;  4E3J A;  3ZDJ A;  1OME A;  1L0D A;  4BLM A;  2ZC5 B;  4ZJ2 A;  5DTK A;  5HFO A;  5EEC A;  3MFD A;  1L0E A;  1PZP A;  2ZC3 B;  3UDX A;  4C6Y A;  4WZ4 A;  5DF9 A;  3PBO A;  4ZTK A;  1J9M A;  1K54 A;  1ERM A;  1KGF A;  1W79 A;  1PI4 A;  3IXH A;  5DVA A;  4N9L A;  4GOG A;  1QME A;  1GA0 A;  1XA7 A;  3HUN A;  4UA6 A;  1XXM A;  3Q07 A;  2WGI A;  5FQK A;  1YLJ A;  3BFD A;  3D4F A;  4UA7 A;  3I7J A;  2ZM8 A;  2WAE A;  1LLB A;  1E3U A;  1NZU A;  2EX9 A;  4PMA A;  3S1Y A;  4DXC A;  3IQA A;  3BLM A;  4GDN A;  1ZKJ A;  3BFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...