3CPTB

Mp1-p14 scaffolding complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
116
structure length
116
Chain Sequence
LRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAADRNGNQAFNEDSLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Mitogen-activated protein kinase kinase 1-interacting protei
publication title Molecular dynamics-solvated interaction energy studies of protein-protein interactions: the MP1-p14 scaffolding complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3cptB00
1SKOA 1K0KA 4FTXA 3NECA 1J3WA 3T1SA 5EVEA 2VK3A 3LGOA 5EM1A 3CHWP 2PRFA 4X1LA 5FEGA 4FUWA 3T1XA 5EV0A 4X25A 3L7HA 4QWOA 1VEUB 2ZL1B 3CPTA 3T1QB 1VEUA 5FDSA 3MS6A 1SKOB 3MSHA 2JKGA 2ZL1A 1FILA 3DAVA 1CJFA 4X1MA 2V8FA 1CQAA 2B95A 2JKFA 2ACGA 3D9YA 3CPTB 1Z09A 3T12B 5FEFA 1SZVA 3KYEA 1ACFA 4D60A 1D1JA 2V8CA 1A0KA 1F2KA 3U4LP 2PAVP 1FIKA 3NULA 4ESPA 1Y4OA 1PFLA 3UB5P 3L9KA 2HZ5A 5EM0A 2BTFP 1PNEA 2PBDP 1AWIA 3LEQA 1HLUP 1G5UA 1CF0A 1YPRA 3T1RA 1VETB 2E8JA 1PRQA 1VETA
chains in the Genus database with same CATH superfamily
4KENB 4PM9A 1OTIA 1W63M 1Y54A 3G2ZA 1J3WA 3UMDA 3HUMA 4NK3A 3LIBA 5F6AA 2O9CA 1ES4A 4X1LA 5F83A 1NXYA 3MBZA 3LCEA 3NIAA 1XA7A 4GD8A 4RX3A 4H8RA 2GDNA 4S2NC 2INWA 4JBFA 3BRMA 2Y2MA 3G30A 3MSHA 5EOOA 3T4OA 4B4XA 2PBYA 3C7VA 5DTSA 3R7WA 2ZBBA 1FILA 1OTDA 4NXFA 2XFSA 3ZFZA 2J7VA 1TS7A 4HJ6A 4X53A 3D9YA 3MXRA 4EBPA 2EXAA 4I3JA 3BLMA 4P6BA 2VGLS 3OPPA 2KLIA 2BLSA 3LEZA 1JNUA 3AGDA 4Y15A 2Y2JA 4L0LA 1K56D 5EECA 4YWZA 4WELA 2M1CA 1I5QA 3LY4A 1LLBA 1BT5A 4QU3A 4QPRA 3C38A 3H82A 4KZ5A 2VA0A 2VEAA 2VGKA 3UMEA 3BJNA 1GA0A 3BQ8A 3PHYA 2OWJA 4I39A 4ARZB 1LSVA 5EUAA 3BFDA 3LYXA 5HARA 3G31A 4L9FA 3VSLA 5EPHA 3NOTC 3VP4A 4DMZA 2OSUA 2DMWA 4MDZA 3UPOA 3MJQA 3IHBA 4UHUA 4N9KA 1XFQA 2V0UA 2NUTC 2A24B 3SS3A 1YLTA 1SKOA 4OPYA 2B5RA 4CPKA 5FSRA 5EFWA 4Y2FA 2WK0A 3BFEA 3VP1A 1FR6A 2WKPA 2XD1A 2ZD8A 3TG9A 1NWZA 4KQQA 4LFUA 2DRWA 4PPRA 5LBRA 1GA9A 4X68A 1XJ2A 2L1MA 4BBVA 4H6JB 3W2ZA 4S2IA 2ACGA 3C4OA 3TOIA 1ES2A 4U3TA 4DRTA 4XUXA 3IWQA 3T12B 3IHAA 1XXMA 3PYPA 1IKIA 3CUEA 4OPZA 4IJGA 1EW0A 3UDFA 2J3TC 3VP0A 1OTEA 1FOFA 2Y2IA 1LSWA 3VSKA 5HL1A 4N9LA 3LI9A 4HI4A 3IT9A 2VJWA 3V3RA 1A0KA 1PW8A 1DJAA 1W7FA 1F2KA 1NRJA 3WRTA 3ITBA 3MFXA 4XUZA 1FSWA 1P0ZA 4S2LA 3MQ0A 4WZ4A 4L9GA 4IUHA 3A3DA 5EVIB 2Y59A 2PR5A 3ZG9B 3RH8B 3A3FA 1KGFA 3Q82A 5CTMA 2YKFA 1HD8A 2W3HA 4XT2B 4OOMA 1UGUA 3UE1A 1YPRA 1K57A 1XGJA 2J9OA 4BWIA 5K5BA 3OCNA 1K38A 1GHMA 3KSFA 2H28A 3CLOA 3E0YA 3NC8A 3IBRA 3TE8A 3FC7A 3QP4A 3IF6A 3QNCA 4OKPA 4JGRA 3P01A 3AGEA 4Y13A 2OWHA 3G6OA 4QWOA 1FCMA 4OQ0A 3HVFA 2VX8A 3QNBA 1ERMA 5AVEA 1PYYA 4N1HA 1MXOA 3N8SA 3V67A 2W27A 4HY8A 3EGXC 4MCWA 3OBFA 3P98A 4KZ3A 2PT7A 1PIOA 1YMXA 4GHIA 1DP6A 2ZC5B 3IBJA 3G32A 3KYEA 3N8LA 2Q9NA 4OOYA 2X71A 4DDSA 3LIDA 3KSGA 3NOUC 2GX5A 2PYRA 5HPFA 2XRNA 4Z9QA 4UA9A 1D1JA 4WMCD 4EQ1A 2ZMAA 3S7QA 4U0XA 2VV8A 3H82B 2KOIA 1KVMA 3SW1A 2PAVP 3QP5A 5GLDA 2WAFA 2PU2A 3TJZC 3FPVA 1MY8A 4IVKA 1N9NA 3L9KA 1YMSA 2HZ5A 3GRJA 1N9OA 1DRMA 4GKUA 4Y0TA 4HH2A 3PBNA 2PBDP 3B33A 1EWZA 3ICYA 4MBFA 5HDCA 1NY0A 1NYYA 5HWTA 3LEQA 4E3IA 3CMZA 3T4TA 4KUKA 3GSGA 3UPNA 5FAOA 1SHVA 4ME4A 4C6YA 4CJNA 1BLCA 1ZTUA 3LGOA 1JWZA 2UV0E 4JXWA 3CHWP 2Y2LA 2PRFA 4PKYG 1NZUA 2V1ZA 4NG2A 5DFYA 1L3LA 1WE4A 4R23A 2J80A 2JKRM 3CPTA 5HSQA 2V0WA 1IYPA 4U0TA 5HFOA 3JVVA 4NXBA 3RFBA 5JYPA 2WGWB 3FZCA 1OT6A 2ZM0A 4GOGA 5FATA 4RQ9A 4ZJ3A 3UE0A 1W8YA 1P9WA 4Q0HA 4D2OA 5CHMA 3BWLA 5U47A 1OTBA 4OPQA 1ZG6A 2DNSA 1YLYA 2RCXA 4NETA 2XK1A 3IS2A 4E3MA 3DWKA 2PHYA 3VOYA 3NCKA 1K25A 3OCLA 3PR6A 3WS1A 5FAPA 3MR0A 2X02A 2LB9A 2UWXA 4R0QA 2VLGA 4QJGA 3VOZA 1YLWA 3NOPC 1YKDA 1K56A 1T19A 4ZJ2A 4E3JA 2C6WB 4CLCB 1YSPA 3QP8A 4GS9B 3G34A 1CI8A 2ZOIA 4B4ZA 1CEGA 4MBKA 3OZHA 1XPBA 4Y3IA 3GTCA 4R38A 3O86A 2WADA 3RJUA 5KZHA 1ZC2A 3G2YA 3GMWA 3NBLA 2ZLYA 3Q7VB 3LICA 5FEGA 1LL8A 1TS8A 2W1TA 3P7NA 5EV0A 4P0MA 5L09A 4QY5A 1PWCA 1BULA 3BLSA 3T4JA 3SZTA 4F3LB 1BLHA 2JE5A 5DJTA 1SKFA 3W4QA 4S2PA 3WS0A 3QHYA 2ZC6B 1FCOA 5CGWA 1IKGA 4EETB 1JTDA 2O9AA 5EVIC 3SH8A 3VE4A 1VB6A 5HWWA 3F1NA 1IYQA 3LR0A 2EXBA 4HNBA 3C8CA 4UAAA 4ZJ1A 3BFCA 4FSFA 1XJ6A 4I5SA 2XSSA 3E2LA 4PM5A 1KE3A 1C3BA 1T1BA 4LRXC 4E3OA 2P9VA 2K31A 1YQSA 2D01A 1BZAA 2HJ9C 1GSWA 4A5RA 4LRZE 4M4XA 1LL5A 5HL6A 1MC0A 2QJ5A 3ZNYA 1H3QA 2RL3A 2M7VA 4HP9A 5I94A 3T4SA 3IX8A 1JWVA 2HP9A 4II7A 1GHIA 1F9IA 3CWFA 4KZ6A 3MXQA 4X25A 4YNRA 2QWSA 5E2GA 3H7WB 5IS1A 4KZ8A 3N8RA 5CXWA 5GHYA 2OLUA 5GHZA 5J3WA 2PD8A 4LCMA 3VP3A 3ZYTA 2IA2A 3IXDA 1MKIA 5FQJA 1SZVA 1G28A 3V50A 5E43A 1PZOA 3IS2B 4OVDA 3KYZA 3E4QA 2OOLA 3LI8A 4ZBEA 5CEDA 3IX4A 1H8ZA 2JN7A 2QYBA 1GCEA 4Q0IA 4X6TA 3SH7A 1TVFA 2WKRA 5JYOA 2XROA 3F1OA 2OAP1 2JC7A 2XF3A 1S67L 3IXHA 4WMCA 4KZ4A 1P9RA 1T18A 1Y28A 4MLLA 1NRFA 5HAPA 1ODVA 4M3KA 1JVJA 1IELA 1OMEA 4O8GA 4B9OA 1KE0A 3JYIA 4OLDA 2Z2MB 1ESUA 4HESA 4BQMA 3L7HA 2EA9A 3DTKA 4CLCE 3PBQA 3T1QB 1MWUA 2IWCA 2JKGA 2ZL1A 4HHDA 5TBMA 4BMWA 4R6LA 4S2NA 1N9BA 5GLAA 4KUOA 4HP4A 3JVUA 3IX3A 4E3NA 1BLSA 3OPHA 4ID4A 4ETZA 2ZQ9A 1KGGA 3C4PA 4OP5A 1IEMA 3B47A 4EU0A 1W8QA 3C30A 1XJ3A 5FEFA 1H5XA 3KYQA 4HQAA 3T4QA 3A3JA 2Z6CA 3QP6A 3F1PA 4ZDXA 5GL9A 1Q2PA 4HBTA 1MWSA 2LB5A 5FL3A 4PAUA 3GDIA 1TD5A 4YINA 4EQIA 5DJUA 3NULA 4FCFA 4FH2A 4QB8A 2WGIA 2P9VB 3UB5P 3EGDC 1QMFA 3DWZA 1NLZA 4Y17A 4FD8A 1G6AA 2WKQA 1LSXA 3CITA 3SS5A 3CJMA 3SH9A 1VQQA 3BQAA 1HLUP 4JGPA 5HPIA 3NI9A 2ZMVA 3BFFA 3FV7A 2A49A 4PHTA 4DJ3A 1KDWA 1E3UD 3PTEA 1OJGA 2HPBA 5FQMA 1E4DA 2QZ6A 4BLMA 1KGEA 1JWPA 3HJKA 2ZC7A 3ISGA 1NJ4A 1CK3A 2J9PA 3ZDJA 5GLBA 1ONHA 4GLQA 1K4FA 3A0SA 2HP6A 3G35A 4R3JA 2HDUA 4LCLA 4ETXA 1CJFA 1G68A 5EVID 3UPPA 1L0GA 4JPMA 5DKLA 1D06A 3ZHHA 1X0OA 4IEDA 4UA7A 3PBSA 2ZQCA 1BYWA 5A93A 3VV4A 1YM1A 4S2JA 4X69A 2QMIA 4HIAA 4JF5A 4DE3A 2Y2KA 3R7WB 4DJ2A 2JKTM 3FPWA 5DF7A 3MQOA 1G6OA 3BYDA 3GECA 1PW1A 4D60A 4Y0OA 3PBOA 2ZQAA 4GZBA 2FZ0A 3ZGAB 4DE1A 3LUQA 4KZ7A 3BFGA 2Y2HA 3G4PA 2W3DA 1HZOA 4KQRA 3C5AA 3A3EA 3M6HA 5G4YA 3FG8A 3MFDA 4OQGA 1AXBA 4B93A 4GCZA 2PR6A 4BBUA 3T4KA 1GHPA 1BTLA 4LLOB 4K08A 5DF8A 4OOLA 3N6IA 4G3VA 2XGNA 1F98A 3ZVWA 1S4RA 4NEED 1G5UA 4UEYA 2V1AA 3VE3A 3M6BA 3TW8A 3V5MA 4GW9A 2J8YA 5E2EA 3IH9A 2QHKA 2JKRI 2O0YA 3T1XA 4CQHA 3ITAA 3MXSA 4EERA 2ZL1B 1CI9A 1IYSA 2ZC4B 1VEUA 2O9BA 1SKOB 2AVXA 5HWVA 3JPUA 1K4EA 4UQIM 1MKMA 4X1MA 3TRCA 1T1AA 3V3SA 1S0WA 3S22A 3IWOA 5DFXA 5TFQA 1ALQA 2L0WA 3N7WA 1XFNA 3VFFA 3N4IA 3CI6A 3E2KA 3ZQ5A 1IYOA 2MJ6A 1YT4A 3SOIA 3S7PA 2W3FA 4DN0A 1IFQA 4JLFA 3KSHA 1N4OA 3QP2A 2FFFB 2XEPA 4G3WA 1Z6FA 3CG5A 4HJ4A 2HJEA 1BSGA 4JGQA 3PAGA 3VP2A 3LR4A 5HD3A 2Y55A 1S1YA 1TS6A 5E2FA 4RX2A 1BUEA 3A0VA 3E4PA 3KX0X 4JKTA 1RCJA 4XXRA 2BG1A 4JGOA 4JXVA 3ZG7B 4Y0UA 3NJAA 1ERQA 3UE6A 2W1RA 5CHJA 1CEFA 3LY3A 2QPNA 2Y2QA 1K54C 4LV1A 1HTZA 4RYEA 2WZXA 2P04A 1SCWA 5DVAA 2PU4A 1DP8A 3RXXA 1M6KA 1NZOA 1S4SA 5F68A 4GD6A 3EWKA 1WYCA 5F82A 3RTYA 2C5WB 4QHCA 5AQ7A 2ZQ7A 2JHEA 1S1ZA 3UO9A 1CQAA 4OPRA 1TS0A 3IF6B 2V9AA 3IXBA 4CLCD 5M1AA 4R4SA 4GB7A 2ZJ9A 1S66L 4EUVA 5DF9A 2XFTA 4WZ5C 2EWVA 5CX7A 5HZHA 1KVLA 4HH3A 4B88A 4DXCA 3FWLA 3HBRA 3HUOA 2HDSA 3PAEA 3FYZA 4ARZA 2JBFA 2V2FF 4G3KA 4C3QA 5I5LA 3DW0A 4GHIB 4I38A 5M18A 5J4EA 4ESPA 4Q8IA 1W63Q 1YSQA 5CGSA 1PFLA 4K0XA 4MMNA 5CTNA 3GQZA 2A24A 2WKIA 1W79A 5J7EA 4WLAA 4L9EA 2H0YA 1TEMA 3V39A 4OH0A 4P85A 5EVLA 2WZZA 3I7JA 1I2WA 2A2LA 3ZG8B 4BL2A 3MZFA 3BY9A 2BASA 5FQQA 4I3AA 2G2WA 2GZAA 2IWDA 1LT0A 2I9VA 3M2JA 3AGFA 5GLCA 4H6JA 4ZRRA 2P08A 2V1BA 3VFHA 2VK3A 4UQIS 4E3LA 1GSVA 2EX2A 5DTTA 4EXOA 1VEUB 3HLDA 4LRYC 2X01A 1VHMA 3W4PA 4EUZA 2I72A 1MBLA 1E3UA 5EE8A 3HLEA 3C7UA 2HP5A 2XQZA 5CERA 4ZAMA 2B95A 2XLNA 1M40A 1P97A 3CPTB 2E8IA 3MMHA 2E8JA 1FQGA 5F5YA 4PM7A 4YFMA 2KDKA 4OONA 3EQVA 3IXGA 2XD5A 5EVIA 5FDHA 4PM8A 5EOEA 2EWWA 2H5SA 1L0FA 2JCHA 3HL9A 3W4OA 4DKIA 4QD4A 1FIKA 2EX9A 1QMEA 1H8MA 4GJ4A 4LENA 5CRFA 4LV2A 4P6ZS 3ZG5A 3O87A 4FOFA 3S4XA 1Y4OA 2A3UA 3C2WA 2WYXA 4Z1WA 2FH5A 3E98A 2OAQ1 5GHXA 1SDEA 2OLVA 2K2NA 4EWFA 3WRZA 1E25A 5KIZA 3UB9A 2Y4AA 4MNRA 3LR3A 2P7JA 3MZEA 2P74A 2Y2NA 3BM6A 1WYBA 4GNUA 3NECA 5AVFA 4OQIA 1D7EA 3HLBA 3FKVA 4WEKA 2QKPA 1TDGA 5EM1A 1PZPA 5HDDA 3O3VA 2ZM8A 3DTEA 5FA7A 5G4ZA 3ZCZA 1MPLA 4O0PA 4EBNA 3PXPA 1LL9A 2HDRA 5HAIA 3MF0A 2Y2PA 2B02A 4F94A 2VKSA 3DTIA 3FKWA 3NDGA 4JF4A 4N1XA 3GVBA 4GDBA 1ZKJA 5AJGA 1OT9A 2W1TB 5TR7A 2JKFA 4LV0A 3A3IA 5E2HA 3A0RA 2EFXA 2VV7A 3CUEC 1XJ4A 2XA7M 4WBGA 3OPRA 1ACFA 4WEJA 2H10A 2ZQ8A 2PD7A 3VOLA 4LV3A 1BLPA 4E6WA 3NDEA 4HEFA 5FASA 2OV5A 2GNXA 4KQDA 2W3GA 3S7OA 3LIFA 2EFUA 4S2MA 1FR1A 1H8YA 3HLCA 5D3OA 3QP1A 3D72A 4Q0JA 1RGZA 3DBAA 3F1NB 3WWXA 3W8KA 2B18A 3UB6A 3DTMA 4JXSA 2ZMFA 4CLCC 4MBHA 1F5MA 1ONGA 4GN2A 2WKEA 5F1FA 5FAQA 2EX8A 2R78A 1AWIA 1TDLA 5L8MA 3T4LA 1K57C 4WUJA 1LHYA 5J8XA 1YAXA 1MWRA 2Y8HA 4LPZA 3ZVTA 4BBTA 3P09A 3BW6A 1SDNA 1VETA 4GDNA 1K0KA 2G7UA 1K6RA 3Q81A 2WGWA 4MEZA 3IF6C 3T1SA 5HD5A 5FI7A 3M2KA 4KG5A 2HF6A 1V9ZA 3WS2A 3HLFA 3O5YA 3IF5A 3Q07A 1OJ5A 5HX9A 3O88A 3CZDA 5AQBA 3UB7A 5L07A 3PBTA 4E6XA 3HCYA 5KSCA 2DCFA 4S2OA 4DXBA 2JKTI 2Y79A 1Z09A 1XKZA 4RVAA 3WS4A 5KSHA 4BENA 2J3WA 4WF0A 4P87A 1XP4A 2ZC3B 4IBXA 1J9MA 1T1CA 1HVBA 2EX6A 4CLCA 5CEBA 3UN7A 1ES5A 4DF6A 4NXGA 4Y5FA 4EBLA 1ZG4A 4C75A 4GS9A 3Q7ZA 5MC7A 1MZUA 4PM6A 1K55C 4KZ9A 4KZAA 5FQKA 2O99A 1VM1A 1MWTA 5EM0A 4WN5A 5FI6A 4LGWA 3K2NA 3Q7VA 1W5DA 3EOIA 3GR2A 3OPLA 4IVIA 3F1OB 3S7NA 1L0EA 1STZA 4BD1A 4S2KA 3T50A 2PDRA 3HLGA 5C5KA 3WS5A 4F3LA 3MQQA 4BJPA 2H0TA 1EROA 1FCNA 4AFIA 5A90A 4IHQA 3LO7A 4KG2A 2M7UA 3E4OA 1IOUA 1O07A 1YLJA 4RA7A 5CHUA 1KOUA 5CECA 5FDSA 3MS6A 5AQ9A 2CC1A 2XA7S 3K3DA 1S6RA 1GSXA 2HGVA 3U2AA 2WAEA 5AQAA 3HUNA 1OPXA 2VV6A 4EEUA 1UWPX 2D02A 2XDMA 4R3AA 3BEBA 5TBMB 5TJJA 5FQIA 4ZTKA 1K55A 1K6SA 4R3BA 3LIEA 1KDSA 3UE3A 4PMAA 3IWIA 3R4KA 4BL3A 2XH9A 4WM9A 3HJIA 3NHQA 1NLYA 3RXWA 2ZQDA 3ZNTA 3F1PB 3OOVA 3GV9A 3OLOA 4EESA 1L0DA 3BECA 5M19A 4OQHA 3KO6A 2WKHA 2Q0OA 1I2SA 2CMNA 3OC2A 1ESIA 2WGVA 1VETB 1N9LA 3K3CA 5IT5A 1U60A 2PYPA 1PRQA 1UWNX 4KZBA 2FFYA 3H7WA 4NXEA 4EV4A 1NYMA 2HV1A 5FQ9A 4YOFA 4O7DA 3KSIA 4P6ZM 1WA9A 2IWBA 3IQAA 4MN5A 5A8BA 1YLZA 4WL9A 1V9YA 1XA1A 4IUKA 5DTKA 1DJBA 5DKKA 4IBRA 2Y2OA 3ULFA 2V8FA 2XR0A 5CGXA 3MKFA 3Q1FA 1H0MA 1ES3A 1EI5A 3EEAA 2ZOHA 5TGFA 3UDIA 2W3EA 4R70A 3B3XA 3CAXA 1DJCA 1RP5A 1FSYA 4I3IA 3PBRA 5L10A 2K7SA 4PKYA 3EQUA 1LI9A 4EEPA 3LR5A 4DE2A 2V8CA 2YKHA 4HJ3A 4MN7A 2VGLM 2Z6DA 1JTGA 4HBUA 1YLPA 3UY6A 5BOHA 1PI5A 3UNWA 5A92A 3HLWA 3SS4A 5L2FA 4K0WA 1TF1A 2GJ3A 2Y91A 4E04A 1PNEA 3UB8A 3D4FA 2G2UA 2WUQA 5F69A 4BD0A 1XX2A 4OLGA 2KX6A 4HOIA 3IH8A 3NY4A 3T1RA 4N92A 3UDXA 3LFVA 1OTAA 4FTXA 1ZHHB 1LI0A 5F1GA 5HDSA 2Y2GA 5EVEA 1K54A 2J3TD 2QJ7A 2Q9MA 4EW7A 4FUWA 1DY6A 5IHVA 3EEHA 4KG6A 1DP9A 3B42A 3VMAA 1PWGA 4QY6A 2V20A 5HAQA 1L2SA 3DAVA 1RGYA 3MZDA 3TSGA 5G18A 4Y7PA 2NUPC 4X55A 2ZM2A 4UA6A 1PI4A 5A91A 4E3KA 4JF6A 4DDYA 5FI2A 3H9WA 4JXGA 3ZG0A 2W0NA 4WZ5A 3S1YA 4R1GA 2VZWA 3HREA 4WYYA 4O01A 1O7EA 5IU1A 2Z2LB 3U4LP 5HW3A 3LIAA 4K91A 1XGIA 5KMWA 1KE4A 1Q2QA 4DE0A 2HDQA 4OP8A 4NKPA 4KQOA 2BTFP 3D3OA 4FH4A 4X56A 4R4RA 3BY8A 1PWDA 3MKEA 2R9WA 1CF0A 4XT2A 4MN6A 2R9XA 2VGJA 2L4RA
chains in the Genus database with same CATH topology
1SKOA 1K0KA 4FTXA 3NECA 1J3WA 3T1SA 5EVEA 2VK3A 3LGOA 5EM1A 3CHWP 2PRFA 4X1LA 5FEGA 4FUWA 3T1XA 5EV0A 4X25A 3L7HA 4QWOA 1VEUB 2ZL1B 3CPTA 3T1QB 1VEUA 5FDSA 3MS6A 1SKOB 3MSHA 2JKGA 2ZL1A 1FILA 3DAVA 1CJFA 4X1MA 2V8FA 1CQAA 2B95A 2JKFA 2ACGA 3D9YA 3CPTB 1Z09A 3T12B 5FEFA 1SZVA 3KYEA 1ACFA 4D60A 1D1JA 2V8CA 1A0KA 1F2KA 3U4LP 2PAVP 1FIKA 3NULA 4ESPA 1Y4OA 1PFLA 3UB5P 3L9KA 2HZ5A 5EM0A 2BTFP 1PNEA 2PBDP 1AWIA 3LEQA 1HLUP 1G5UA 1CF0A 1YPRA 3T1RA 1VETB 2E8JA 1PRQA 1VETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SKO A;  1K0K A;  4FTX A;  3NEC A;  1J3W A;  3T1S A;  5EVE A;  2VK3 A;  3LGO A;  5EM1 A;  3CHW P;  2PRF A;  4X1L A;  5FEG A;  4FUW A;  3T1X A;  5EV0 A;  4X25 A;  3L7H A;  4QWO A;  1VEU B;  2ZL1 B;  3CPT A;  3T1Q B;  1VEU A;  5FDS A;  3MS6 A;  1SKO B;  3MSH A;  2JKG A;  2ZL1 A;  1FIL A;  3DAV A;  1CJF A;  4X1M A;  2V8F A;  1CQA A;  2B95 A;  2JKF A;  2ACG A;  3D9Y A;  3CPT B;  1Z09 A;  3T12 B;  5FEF A;  1SZV A;  3KYE A;  1ACF A;  4D60 A;  1D1J A;  2V8C A;  1A0K A;  1F2K A;  3U4L P;  2PAV P;  1FIK A;  3NUL A;  4ESP A;  1Y4O A;  1PFL A;  3UB5 P;  3L9K A;  2HZ5 A;  5EM0 A;  2BTF P;  1PNE A;  2PBD P;  1AWI A;  3LEQ A;  1HLU P;  1G5U A;  1CF0 A;  1YPR A;  3T1R A;  1VET B;  2E8J A;  1PRQ A;  1VET A; 
#chains in the Genus database with same CATH topology
 4KEN B;  4PM9 A;  1OTI A;  1W63 M;  1Y54 A;  3G2Z A;  1J3W A;  3UMD A;  3HUM A;  4NK3 A;  3LIB A;  5F6A A;  2O9C A;  1ES4 A;  4X1L A;  5F83 A;  1NXY A;  3MBZ A;  3LCE A;  3NIA A;  1XA7 A;  4GD8 A;  4RX3 A;  4H8R A;  2GDN A;  4S2N C;  2INW A;  4JBF A;  3BRM A;  2Y2M A;  3G30 A;  3MSH A;  5EOO A;  3T4O A;  4B4X A;  2PBY A;  3C7V A;  5DTS A;  3R7W A;  2ZBB A;  1FIL A;  1OTD A;  4NXF A;  2XFS A;  3ZFZ A;  2J7V A;  1TS7 A;  4HJ6 A;  4X53 A;  3D9Y A;  3MXR A;  4EBP A;  2EXA A;  4I3J A;  3BLM A;  4P6B A;  2VGL S;  3OPP A;  2KLI A;  2BLS A;  3LEZ A;  1JNU A;  3AGD A;  4Y15 A;  2Y2J A;  4L0L A;  1K56 D;  5EEC A;  4YWZ A;  4WEL A;  2M1C A;  1I5Q A;  3LY4 A;  1LLB A;  1BT5 A;  4QU3 A;  4QPR A;  3C38 A;  3H82 A;  4KZ5 A;  2VA0 A;  2VEA A;  2VGK A;  3UME A;  3BJN A;  1GA0 A;  3BQ8 A;  3PHY A;  2OWJ A;  4I39 A;  4ARZ B;  1LSV A;  5EUA A;  3BFD A;  3LYX A;  5HAR A;  3G31 A;  4L9F A;  3VSL A;  5EPH A;  3NOT C;  3VP4 A;  4DMZ A;  2OSU A;  2DMW A;  4MDZ A;  3UPO A;  3MJQ A;  3IHB A;  4UHU A;  4N9K A;  1XFQ A;  2V0U A;  2NUT C;  2A24 B;  3SS3 A;  1YLT A;  1SKO A;  4OPY A;  2B5R A;  4CPK A;  5FSR A;  5EFW A;  4Y2F A;  2WK0 A;  3BFE A;  3VP1 A;  1FR6 A;  2WKP A;  2XD1 A;  2ZD8 A;  3TG9 A;  1NWZ A;  4KQQ A;  4LFU A;  2DRW A;  4PPR A;  5LBR A;  1GA9 A;  4X68 A;  1XJ2 A;  2L1M A;  4BBV A;  4H6J B;  3W2Z A;  4S2I A;  2ACG A;  3C4O A;  3TOI A;  1ES2 A;  4U3T A;  4DRT A;  4XUX A;  3IWQ A;  3T12 B;  3IHA A;  1XXM A;  3PYP A;  1IKI A;  3CUE A;  4OPZ A;  4IJG A;  1EW0 A;  3UDF A;  2J3T C;  3VP0 A;  1OTE A;  1FOF A;  2Y2I A;  1LSW A;  3VSK A;  5HL1 A;  4N9L A;  3LI9 A;  4HI4 A;  3IT9 A;  2VJW A;  3V3R A;  1A0K A;  1PW8 A;  1DJA A;  1W7F A;  1F2K A;  1NRJ A;  3WRT A;  3ITB A;  3MFX A;  4XUZ A;  1FSW A;  1P0Z A;  4S2L A;  3MQ0 A;  4WZ4 A;  4L9G A;  4IUH A;  3A3D A;  5EVI B;  2Y59 A;  2PR5 A;  3ZG9 B;  3RH8 B;  3A3F A;  1KGF A;  3Q82 A;  5CTM A;  2YKF A;  1HD8 A;  2W3H A;  4XT2 B;  4OOM A;  1UGU A;  3UE1 A;  1YPR A;  1K57 A;  1XGJ A;  2J9O A;  4BWI A;  5K5B A;  3OCN A;  1K38 A;  1GHM A;  3KSF A;  2H28 A;  3CLO A;  3E0Y A;  3NC8 A;  3IBR A;  3TE8 A;  3FC7 A;  3QP4 A;  3IF6 A;  3QNC A;  4OKP A;  4JGR A;  3P01 A;  3AGE A;  4Y13 A;  2OWH A;  3G6O A;  4QWO A;  1FCM A;  4OQ0 A;  3HVF A;  2VX8 A;  3QNB A;  1ERM A;  5AVE A;  1PYY A;  4N1H A;  1MXO A;  3N8S A;  3V67 A;  2W27 A;  4HY8 A;  3EGX C;  4MCW A;  3OBF A;  3P98 A;  4KZ3 A;  2PT7 A;  1PIO A;  1YMX A;  4GHI A;  1DP6 A;  2ZC5 B;  3IBJ A;  3G32 A;  3KYE A;  3N8L A;  2Q9N A;  4OOY A;  2X71 A;  4DDS A;  3LID A;  3KSG A;  3NOU C;  2GX5 A;  2PYR A;  5HPF A;  2XRN A;  4Z9Q A;  4UA9 A;  1D1J A;  4WMC D;  4EQ1 A;  2ZMA A;  3S7Q A;  4U0X A;  2VV8 A;  3H82 B;  2KOI A;  1KVM A;  3SW1 A;  2PAV P;  3QP5 A;  5GLD A;  2WAF A;  2PU2 A;  3TJZ C;  3FPV A;  1MY8 A;  4IVK A;  1N9N A;  3L9K A;  1YMS A;  2HZ5 A;  3GRJ A;  1N9O A;  1DRM A;  4GKU A;  4Y0T A;  4HH2 A;  3PBN A;  2PBD P;  3B33 A;  1EWZ A;  3ICY A;  4MBF A;  5HDC A;  1NY0 A;  1NYY A;  5HWT A;  3LEQ A;  4E3I A;  3CMZ A;  3T4T A;  4KUK A;  3GSG A;  3UPN A;  5FAO A;  1SHV A;  4ME4 A;  4C6Y A;  4CJN A;  1BLC A;  1ZTU A;  3LGO A;  1JWZ A;  2UV0 E;  4JXW A;  3CHW P;  2Y2L A;  2PRF A;  4PKY G;  1NZU A;  2V1Z A;  4NG2 A;  5DFY A;  1L3L A;  1WE4 A;  4R23 A;  2J80 A;  2JKR M;  3CPT A;  5HSQ A;  2V0W A;  1IYP A;  4U0T A;  5HFO A;  3JVV A;  4NXB A;  3RFB A;  5JYP A;  2WGW B;  3FZC A;  1OT6 A;  2ZM0 A;  4GOG A;  5FAT A;  4RQ9 A;  4ZJ3 A;  3UE0 A;  1W8Y A;  1P9W A;  4Q0H A;  4D2O A;  5CHM A;  3BWL A;  5U47 A;  1OTB A;  4OPQ A;  1ZG6 A;  2DNS A;  1YLY A;  2RCX A;  4NET A;  2XK1 A;  3IS2 A;  4E3M A;  3DWK A;  2PHY A;  3VOY A;  3NCK A;  1K25 A;  3OCL A;  3PR6 A;  3WS1 A;  5FAP A;  3MR0 A;  2X02 A;  2LB9 A;  2UWX A;  4R0Q A;  2VLG A;  4QJG A;  3VOZ A;  1YLW A;  3NOP C;  1YKD A;  1K56 A;  1T19 A;  4ZJ2 A;  4E3J A;  2C6W B;  4CLC B;  1YSP A;  3QP8 A;  4GS9 B;  3G34 A;  1CI8 A;  2ZOI A;  4B4Z A;  1CEG A;  4MBK A;  3OZH A;  1XPB A;  4Y3I A;  3GTC A;  4R38 A;  3O86 A;  2WAD A;  3RJU A;  5KZH A;  1ZC2 A;  3G2Y A;  3GMW A;  3NBL A;  2ZLY A;  3Q7V B;  3LIC A;  5FEG A;  1LL8 A;  1TS8 A;  2W1T A;  3P7N A;  5EV0 A;  4P0M A;  5L09 A;  4QY5 A;  1PWC A;  1BUL A;  3BLS A;  3T4J A;  3SZT A;  4F3L B;  1BLH A;  2JE5 A;  5DJT A;  1SKF A;  3W4Q A;  4S2P A;  3WS0 A;  3QHY A;  2ZC6 B;  1FCO A;  5CGW A;  1IKG A;  4EET B;  1JTD A;  2O9A A;  5EVI C;  3SH8 A;  3VE4 A;  1VB6 A;  5HWW A;  3F1N A;  1IYQ A;  3LR0 A;  2EXB A;  4HNB A;  3C8C A;  4UAA A;  4ZJ1 A;  3BFC A;  4FSF A;  1XJ6 A;  4I5S A;  2XSS A;  3E2L A;  4PM5 A;  1KE3 A;  1C3B A;  1T1B A;  4LRX C;  4E3O A;  2P9V A;  2K31 A;  1YQS A;  2D01 A;  1BZA A;  2HJ9 C;  1GSW A;  4A5R A;  4LRZ E;  4M4X A;  1LL5 A;  5HL6 A;  1MC0 A;  2QJ5 A;  3ZNY A;  1H3Q A;  2RL3 A;  2M7V A;  4HP9 A;  5I94 A;  3T4S A;  3IX8 A;  1JWV A;  2HP9 A;  4II7 A;  1GHI A;  1F9I A;  3CWF A;  4KZ6 A;  3MXQ A;  4X25 A;  4YNR A;  2QWS A;  5E2G A;  3H7W B;  5IS1 A;  4KZ8 A;  3N8R A;  5CXW A;  5GHY A;  2OLU A;  5GHZ A;  5J3W A;  2PD8 A;  4LCM A;  3VP3 A;  3ZYT A;  2IA2 A;  3IXD A;  1MKI A;  5FQJ A;  1SZV A;  1G28 A;  3V50 A;  5E43 A;  1PZO A;  3IS2 B;  4OVD A;  3KYZ A;  3E4Q A;  2OOL A;  3LI8 A;  4ZBE A;  5CED A;  3IX4 A;  1H8Z A;  2JN7 A;  2QYB A;  1GCE A;  4Q0I A;  4X6T A;  3SH7 A;  1TVF A;  2WKR A;  5JYO A;  2XRO A;  3F1O A;  2OAP 1;  2JC7 A;  2XF3 A;  1S67 L;  3IXH A;  4WMC A;  4KZ4 A;  1P9R A;  1T18 A;  1Y28 A;  4MLL A;  1NRF A;  5HAP A;  1ODV A;  4M3K A;  1JVJ A;  1IEL A;  1OME A;  4O8G A;  4B9O A;  1KE0 A;  3JYI A;  4OLD A;  2Z2M B;  1ESU A;  4HES A;  4BQM A;  3L7H A;  2EA9 A;  3DTK A;  4CLC E;  3PBQ A;  3T1Q B;  1MWU A;  2IWC A;  2JKG A;  2ZL1 A;  4HHD A;  5TBM A;  4BMW A;  4R6L A;  4S2N A;  1N9B A;  5GLA A;  4KUO A;  4HP4 A;  3JVU A;  3IX3 A;  4E3N A;  1BLS A;  3OPH A;  4ID4 A;  4ETZ A;  2ZQ9 A;  1KGG A;  3C4P A;  4OP5 A;  1IEM A;  3B47 A;  4EU0 A;  1W8Q A;  3C30 A;  1XJ3 A;  5FEF A;  1H5X A;  3KYQ A;  4HQA A;  3T4Q A;  3A3J A;  2Z6C A;  3QP6 A;  3F1P A;  4ZDX A;  5GL9 A;  1Q2P A;  4HBT A;  1MWS A;  2LB5 A;  5FL3 A;  4PAU A;  3GDI A;  1TD5 A;  4YIN A;  4EQI A;  5DJU A;  3NUL A;  4FCF A;  4FH2 A;  4QB8 A;  2WGI A;  2P9V B;  3UB5 P;  3EGD C;  1QMF A;  3DWZ A;  1NLZ A;  4Y17 A;  4FD8 A;  1G6A A;  2WKQ A;  1LSX A;  3CIT A;  3SS5 A;  3CJM A;  3SH9 A;  1VQQ A;  3BQA A;  1HLU P;  4JGP A;  5HPI A;  3NI9 A;  2ZMV A;  3BFF A;  3FV7 A;  2A49 A;  4PHT A;  4DJ3 A;  1KDW A;  1E3U D;  3PTE A;  1OJG A;  2HPB A;  5FQM A;  1E4D A;  2QZ6 A;  4BLM A;  1KGE A;  1JWP A;  3HJK A;  2ZC7 A;  3ISG A;  1NJ4 A;  1CK3 A;  2J9P A;  3ZDJ A;  5GLB A;  1ONH A;  4GLQ A;  1K4F A;  3A0S A;  2HP6 A;  3G35 A;  4R3J A;  2HDU A;  4LCL A;  4ETX A;  1CJF A;  1G68 A;  5EVI D;  3UPP A;  1L0G A;  4JPM A;  5DKL A;  1D06 A;  3ZHH A;  1X0O A;  4IED A;  4UA7 A;  3PBS A;  2ZQC A;  1BYW A;  5A93 A;  3VV4 A;  1YM1 A;  4S2J A;  4X69 A;  2QMI A;  4HIA A;  4JF5 A;  4DE3 A;  2Y2K A;  3R7W B;  4DJ2 A;  2JKT M;  3FPW A;  5DF7 A;  3MQO A;  1G6O A;  3BYD A;  3GEC A;  1PW1 A;  4D60 A;  4Y0O A;  3PBO A;  2ZQA A;  4GZB A;  2FZ0 A;  3ZGA B;  4DE1 A;  3LUQ A;  4KZ7 A;  3BFG A;  2Y2H A;  3G4P A;  2W3D A;  1HZO A;  4KQR A;  3C5A A;  3A3E A;  3M6H A;  5G4Y A;  3FG8 A;  3MFD A;  4OQG A;  1AXB A;  4B93 A;  4GCZ A;  2PR6 A;  4BBU A;  3T4K A;  1GHP A;  1BTL A;  4LLO B;  4K08 A;  5DF8 A;  4OOL A;  3N6I A;  4G3V A;  2XGN A;  1F98 A;  3ZVW A;  1S4R A;  4NEE D;  1G5U A;  4UEY A;  2V1A A;  3VE3 A;  3M6B A;  3TW8 A;  3V5M A;  4GW9 A;  2J8Y A;  5E2E A;  3IH9 A;  2QHK A;  2JKR I;  2O0Y A;  3T1X A;  4CQH A;  3ITA A;  3MXS A;  4EER A;  2ZL1 B;  1CI9 A;  1IYS A;  2ZC4 B;  1VEU A;  2O9B A;  1SKO B;  2AVX A;  5HWV A;  3JPU A;  1K4E A;  4UQI M;  1MKM A;  4X1M A;  3TRC A;  1T1A A;  3V3S A;  1S0W A;  3S22 A;  3IWO A;  5DFX A;  5TFQ A;  1ALQ A;  2L0W A;  3N7W A;  1XFN A;  3VFF A;  3N4I A;  3CI6 A;  3E2K A;  3ZQ5 A;  1IYO A;  2MJ6 A;  1YT4 A;  3SOI A;  3S7P A;  2W3F A;  4DN0 A;  1IFQ A;  4JLF A;  3KSH A;  1N4O A;  3QP2 A;  2FFF B;  2XEP A;  4G3W A;  1Z6F A;  3CG5 A;  4HJ4 A;  2HJE A;  1BSG A;  4JGQ A;  3PAG A;  3VP2 A;  3LR4 A;  5HD3 A;  2Y55 A;  1S1Y A;  1TS6 A;  5E2F A;  4RX2 A;  1BUE A;  3A0V A;  3E4P A;  3KX0 X;  4JKT A;  1RCJ A;  4XXR A;  2BG1 A;  4JGO A;  4JXV A;  3ZG7 B;  4Y0U A;  3NJA A;  1ERQ A;  3UE6 A;  2W1R A;  5CHJ A;  1CEF A;  3LY3 A;  2QPN A;  2Y2Q A;  1K54 C;  4LV1 A;  1HTZ A;  4RYE A;  2WZX A;  2P04 A;  1SCW A;  5DVA A;  2PU4 A;  1DP8 A;  3RXX A;  1M6K A;  1NZO A;  1S4S A;  5F68 A;  4GD6 A;  3EWK A;  1WYC A;  5F82 A;  3RTY A;  2C5W B;  4QHC A;  5AQ7 A;  2ZQ7 A;  2JHE A;  1S1Z A;  3UO9 A;  1CQA A;  4OPR A;  1TS0 A;  3IF6 B;  2V9A A;  3IXB A;  4CLC D;  5M1A A;  4R4S A;  4GB7 A;  2ZJ9 A;  1S66 L;  4EUV A;  5DF9 A;  2XFT A;  4WZ5 C;  2EWV A;  5CX7 A;  5HZH A;  1KVL A;  4HH3 A;  4B88 A;  4DXC A;  3FWL A;  3HBR A;  3HUO A;  2HDS A;  3PAE A;  3FYZ A;  4ARZ A;  2JBF A;  2V2F F;  4G3K A;  4C3Q A;  5I5L A;  3DW0 A;  4GHI B;  4I38 A;  5M18 A;  5J4E A;  4ESP A;  4Q8I A;  1W63 Q;  1YSQ A;  5CGS A;  1PFL A;  4K0X A;  4MMN A;  5CTN A;  3GQZ A;  2A24 A;  2WKI A;  1W79 A;  5J7E A;  4WLA A;  4L9E A;  2H0Y A;  1TEM A;  3V39 A;  4OH0 A;  4P85 A;  5EVL A;  2WZZ A;  3I7J A;  1I2W A;  2A2L A;  3ZG8 B;  4BL2 A;  3MZF A;  3BY9 A;  2BAS A;  5FQQ A;  4I3A A;  2G2W A;  2GZA A;  2IWD A;  1LT0 A;  2I9V A;  3M2J A;  3AGF A;  5GLC A;  4H6J A;  4ZRR A;  2P08 A;  2V1B A;  3VFH A;  2VK3 A;  4UQI S;  4E3L A;  1GSV A;  2EX2 A;  5DTT A;  4EXO A;  1VEU B;  3HLD A;  4LRY C;  2X01 A;  1VHM A;  3W4P A;  4EUZ A;  2I72 A;  1MBL A;  1E3U A;  5EE8 A;  3HLE A;  3C7U A;  2HP5 A;  2XQZ A;  5CER A;  4ZAM A;  2B95 A;  2XLN A;  1M40 A;  1P97 A;  3CPT B;  2E8I A;  3MMH A;  2E8J A;  1FQG A;  5F5Y A;  4PM7 A;  4YFM A;  2KDK A;  4OON A;  3EQV A;  3IXG A;  2XD5 A;  5EVI A;  5FDH A;  4PM8 A;  5EOE A;  2EWW A;  2H5S A;  1L0F A;  2JCH A;  3HL9 A;  3W4O A;  4DKI A;  4QD4 A;  1FIK A;  2EX9 A;  1QME A;  1H8M A;  4GJ4 A;  4LEN A;  5CRF A;  4LV2 A;  4P6Z S;  3ZG5 A;  3O87 A;  4FOF A;  3S4X A;  1Y4O A;  2A3U A;  3C2W A;  2WYX A;  4Z1W A;  2FH5 A;  3E98 A;  2OAQ 1;  5GHX A;  1SDE A;  2OLV A;  2K2N A;  4EWF A;  3WRZ A;  1E25 A;  5KIZ A;  3UB9 A;  2Y4A A;  4MNR A;  3LR3 A;  2P7J A;  3MZE A;  2P74 A;  2Y2N A;  3BM6 A;  1WYB A;  4GNU A;  3NEC A;  5AVF A;  4OQI A;  1D7E A;  3HLB A;  3FKV A;  4WEK A;  2QKP A;  1TDG A;  5EM1 A;  1PZP A;  5HDD A;  3O3V A;  2ZM8 A;  3DTE A;  5FA7 A;  5G4Z A;  3ZCZ A;  1MPL A;  4O0P A;  4EBN A;  3PXP A;  1LL9 A;  2HDR A;  5HAI A;  3MF0 A;  2Y2P A;  2B02 A;  4F94 A;  2VKS A;  3DTI A;  3FKW A;  3NDG A;  4JF4 A;  4N1X A;  3GVB A;  4GDB A;  1ZKJ A;  5AJG A;  1OT9 A;  2W1T B;  5TR7 A;  2JKF A;  4LV0 A;  3A3I A;  5E2H A;  3A0R A;  2EFX A;  2VV7 A;  3CUE C;  1XJ4 A;  2XA7 M;  4WBG A;  3OPR A;  1ACF A;  4WEJ A;  2H10 A;  2ZQ8 A;  2PD7 A;  3VOL A;  4LV3 A;  1BLP A;  4E6W A;  3NDE A;  4HEF A;  5FAS A;  2OV5 A;  2GNX A;  4KQD A;  2W3G A;  3S7O A;  3LIF A;  2EFU A;  4S2M A;  1FR1 A;  1H8Y A;  3HLC A;  5D3O A;  3QP1 A;  3D72 A;  4Q0J A;  1RGZ A;  3DBA A;  3F1N B;  3WWX A;  3W8K A;  2B18 A;  3UB6 A;  3DTM A;  4JXS A;  2ZMF A;  4CLC C;  4MBH A;  1F5M A;  1ONG A;  4GN2 A;  2WKE A;  5F1F A;  5FAQ A;  2EX8 A;  2R78 A;  1AWI A;  1TDL A;  5L8M A;  3T4L A;  1K57 C;  4WUJ A;  1LHY A;  5J8X A;  1YAX A;  1MWR A;  2Y8H A;  4LPZ A;  3ZVT A;  4BBT A;  3P09 A;  3BW6 A;  1SDN A;  1VET A;  4GDN A;  1K0K A;  2G7U A;  1K6R A;  3Q81 A;  2WGW A;  4MEZ A;  3IF6 C;  3T1S A;  5HD5 A;  5FI7 A;  3M2K A;  4KG5 A;  2HF6 A;  1V9Z A;  3WS2 A;  3HLF A;  3O5Y A;  3IF5 A;  3Q07 A;  1OJ5 A;  5HX9 A;  3O88 A;  3CZD A;  5AQB A;  3UB7 A;  5L07 A;  3PBT A;  4E6X A;  3HCY A;  5KSC A;  2DCF A;  4S2O A;  4DXB A;  2JKT I;  2Y79 A;  1Z09 A;  1XKZ A;  4RVA A;  3WS4 A;  5KSH A;  4BEN A;  2J3W A;  4WF0 A;  4P87 A;  1XP4 A;  2ZC3 B;  4IBX A;  1J9M A;  1T1C A;  1HVB A;  2EX6 A;  4CLC A;  5CEB A;  3UN7 A;  1ES5 A;  4DF6 A;  4NXG A;  4Y5F A;  4EBL A;  1ZG4 A;  4C75 A;  4GS9 A;  3Q7Z A;  5MC7 A;  1MZU A;  4PM6 A;  1K55 C;  4KZ9 A;  4KZA A;  5FQK A;  2O99 A;  1VM1 A;  1MWT A;  5EM0 A;  4WN5 A;  5FI6 A;  4LGW A;  3K2N A;  3Q7V A;  1W5D A;  3EOI A;  3GR2 A;  3OPL A;  4IVI A;  3F1O B;  3S7N A;  1L0E A;  1STZ A;  4BD1 A;  4S2K A;  3T50 A;  2PDR A;  3HLG A;  5C5K A;  3WS5 A;  4F3L A;  3MQQ A;  4BJP A;  2H0T A;  1ERO A;  1FCN A;  4AFI A;  5A90 A;  4IHQ A;  3LO7 A;  4KG2 A;  2M7U A;  3E4O A;  1IOU A;  1O07 A;  1YLJ A;  4RA7 A;  5CHU A;  1KOU A;  5CEC A;  5FDS A;  3MS6 A;  5AQ9 A;  2CC1 A;  2XA7 S;  3K3D A;  1S6R A;  1GSX A;  2HGV A;  3U2A A;  2WAE A;  5AQA A;  3HUN A;  1OPX A;  2VV6 A;  4EEU A;  1UWP X;  2D02 A;  2XDM A;  4R3A A;  3BEB A;  5TBM B;  5TJJ A;  5FQI A;  4ZTK A;  1K55 A;  1K6S A;  4R3B A;  3LIE A;  1KDS A;  3UE3 A;  4PMA A;  3IWI A;  3R4K A;  4BL3 A;  2XH9 A;  4WM9 A;  3HJI A;  3NHQ A;  1NLY A;  3RXW A;  2ZQD A;  3ZNT A;  3F1P B;  3OOV A;  3GV9 A;  3OLO A;  4EES A;  1L0D A;  3BEC A;  5M19 A;  4OQH A;  3KO6 A;  2WKH A;  2Q0O A;  1I2S A;  2CMN A;  3OC2 A;  1ESI A;  2WGV A;  1VET B;  1N9L A;  3K3C A;  5IT5 A;  1U60 A;  2PYP A;  1PRQ A;  1UWN X;  4KZB A;  2FFY A;  3H7W A;  4NXE A;  4EV4 A;  1NYM A;  2HV1 A;  5FQ9 A;  4YOF A;  4O7D A;  3KSI A;  4P6Z M;  1WA9 A;  2IWB A;  3IQA A;  4MN5 A;  5A8B A;  1YLZ A;  4WL9 A;  1V9Y A;  1XA1 A;  4IUK A;  5DTK A;  1DJB A;  5DKK A;  4IBR A;  2Y2O A;  3ULF A;  2V8F A;  2XR0 A;  5CGX A;  3MKF A;  3Q1F A;  1H0M A;  1ES3 A;  1EI5 A;  3EEA A;  2ZOH A;  5TGF A;  3UDI A;  2W3E A;  4R70 A;  3B3X A;  3CAX A;  1DJC A;  1RP5 A;  1FSY A;  4I3I A;  3PBR A;  5L10 A;  2K7S A;  4PKY A;  3EQU A;  1LI9 A;  4EEP A;  3LR5 A;  4DE2 A;  2V8C A;  2YKH A;  4HJ3 A;  4MN7 A;  2VGL M;  2Z6D A;  1JTG A;  4HBU A;  1YLP A;  3UY6 A;  5BOH A;  1PI5 A;  3UNW A;  5A92 A;  3HLW A;  3SS4 A;  5L2F A;  4K0W A;  1TF1 A;  2GJ3 A;  2Y91 A;  4E04 A;  1PNE A;  3UB8 A;  3D4F A;  2G2U A;  2WUQ A;  5F69 A;  4BD0 A;  1XX2 A;  4OLG A;  2KX6 A;  4HOI A;  3IH8 A;  3NY4 A;  3T1R A;  4N92 A;  3UDX A;  3LFV A;  1OTA A;  4FTX A;  1ZHH B;  1LI0 A;  5F1G A;  5HDS A;  2Y2G A;  5EVE A;  1K54 A;  2J3T D;  2QJ7 A;  2Q9M A;  4EW7 A;  4FUW A;  1DY6 A;  5IHV A;  3EEH A;  4KG6 A;  1DP9 A;  3B42 A;  3VMA A;  1PWG A;  4QY6 A;  2V20 A;  5HAQ A;  1L2S A;  3DAV A;  1RGY A;  3MZD A;  3TSG A;  5G18 A;  4Y7P A;  2NUP C;  4X55 A;  2ZM2 A;  4UA6 A;  1PI4 A;  5A91 A;  4E3K A;  4JF6 A;  4DDY A;  5FI2 A;  3H9W A;  4JXG A;  3ZG0 A;  2W0N A;  4WZ5 A;  3S1Y A;  4R1G A;  2VZW A;  3HRE A;  4WYY A;  4O01 A;  1O7E A;  5IU1 A;  2Z2L B;  3U4L P;  5HW3 A;  3LIA A;  4K91 A;  1XGI A;  5KMW A;  1KE4 A;  1Q2Q A;  4DE0 A;  2HDQ A;  4OP8 A;  4NKP A;  4KQO A;  2BTF P;  3D3O A;  4FH4 A;  4X56 A;  4R4R A;  3BY8 A;  1PWD A;  3MKE A;  2R9W A;  1CF0 A;  4XT2 A;  4MN6 A;  2R9X A;  2VGJ A;  2L4R A; 
#chains in the Genus database with same CATH homology
 1SKO A;  1K0K A;  4FTX A;  3NEC A;  1J3W A;  3T1S A;  5EVE A;  2VK3 A;  3LGO A;  5EM1 A;  3CHW P;  2PRF A;  4X1L A;  5FEG A;  4FUW A;  3T1X A;  5EV0 A;  4X25 A;  3L7H A;  4QWO A;  1VEU B;  2ZL1 B;  3CPT A;  3T1Q B;  1VEU A;  5FDS A;  3MS6 A;  1SKO B;  3MSH A;  2JKG A;  2ZL1 A;  1FIL A;  3DAV A;  1CJF A;  4X1M A;  2V8F A;  1CQA A;  2B95 A;  2JKF A;  2ACG A;  3D9Y A;  3CPT B;  1Z09 A;  3T12 B;  5FEF A;  1SZV A;  3KYE A;  1ACF A;  4D60 A;  1D1J A;  2V8C A;  1A0K A;  1F2K A;  3U4L P;  2PAV P;  1FIK A;  3NUL A;  4ESP A;  1Y4O A;  1PFL A;  3UB5 P;  3L9K A;  2HZ5 A;  5EM0 A;  2BTF P;  1PNE A;  2PBD P;  1AWI A;  3LEQ A;  1HLU P;  1G5U A;  1CF0 A;  1YPR A;  3T1R A;  1VET B;  2E8J A;  1PRQ A;  1VET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...