3WS1A

N288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (condition-1b)
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
360
structure length
360
Chain Sequence
QTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGQGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTQGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAIDVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Structure of a highly acidic beta-lactamase from the moderate halophile Chromohalobacter sp. 560 and the discovery of a Cs(+)-selective binding site
pubmed doi rcsb
source organism Chromohalobacter sp. 560
total genus 121
structure length 360
sequence length 360
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ws1A00
1MWUA 2QPNA 4UA9A 3A3FA 5EOOA 1IYSA 1W7FA 2IWBA 2Q9MA 3NIAA 4WZ5A 4EWFA 1RGZA 1J9MA 1YLTA 5DF8A 4GDBA 4C6YA 1ESUA 1XGIA 3LY3A 5A93A 2QMIA 1K25A 3RXWA 3HUMA 4U0TA 4UA7A 3ISGA 1SHVA 5DTTA 1W79A 1FQGA 3PBOA 5KZHA 4WM9A 4Z9QA 5EOEA 3D4FA 4S2JA 1BZAA 5CGSA 5G18A 4BJPA 5GHZA 2ZC6B 2E8IA 4JF5A 3GMWA 4X55A 4GDNA 5EVIB 5E2HA 5GLDA 5F1GA 1M6KA 3HREA 4OPYA 3WRZA 5KSHA 4K91A 2DNSA 2JBFA 2HP9A 3MXRA 3Q7ZA 4PM5A 5TFQA 1S0WA 3BLMA 1H8YA 1BT5A 1U60A 1K4EA 5EUAA 2BG1A 2PU4A 3SH9A 3WS2A 2Y55A 4KG5A 3ZNYA 3PBQA 1XGJA 3NDEA 4E3LA 4P85A 1IELA 3HUNA 3GVBA 3A3EA 2GDNA 3IQAA 3ZVTA 1N9BA 1JWVA 1BLSA 3HUOA 4KENB 5FI7A 3OCLA 4OOYA 2A49A 3P09A 5CXWA 5DTSA 3MXSA 3WS0A 3BFDA 3BM6A 1LLBA 1IKGA 3NCKA 5FAOA 3TSGA 1FR1A 2R9XA 1DJAA 4OQGA 1WYCA 5E2FA 2Y4AA 3PBNA 1N4OA 2Q9NA 1KDWA 4FH4A 1DJCA 4M3KA 5TGFA 2X71A 4X69A 4S2KA 1L0EA 2P9VA 3FYZA 1BLHA 1KGGA 2WAFA 4U3TA 1QMFA 1NZUA 3ZVWA 4OP5A 3IF6B 2R9WA 2RCXA 3IHAA 1C3BA 2ZLYA 4PMAA 4KG2A 1K4FA 1YLJA 4R4RA 2V1ZA 2ZJ9A 3VMAA 4EV4A 4QHCA 3MZDA 1XXMA 4RX2A 1ZC2A 3NC8A 1I2WA 4KZ7A 3UO9A 3UE1A 3IH8A 3DWKA 4Y0TA 1M40A 3A3IA 3Q1FA 1DJBA 5GHYA 3LCEA 3VOZA 5J8XA 2ZQ8A 4E6XA 4XUXA 5CECA 1JTGA 5JYPA 3ZGAB 4E3MA 5HAQA 3LEZA 1K57C 2WK0A 3FKVA 4B4XA 1YT4A 2BLSA 3ZG7B 4DXBA 4ZJ3A 1E3UA 1E25A 3Q7VA 5GL9A 2ZQDA 1K54C 5F1FA 2Z2LB 2B5RA 4JXGA 5CHMA 1XA1A 4RX3A 2WKHA 2XDMA 3PTEA 4A5RA 3ZG8B 1JVJA 4L0LA 1IYPA 2H0TA 4K0XA 4WELA 1GHMA 2X01A 1W5DA 3BYDA 2XQZA 4N9KA 3RXXA 4N1HA 4PM7A 4FCFA 3VFHA 4OVDA 3SS4A 3GQZA 3C7VA 1PWDA 5U47A 3IF5A 2WKIA 3EQVA 3GV9A 3HLGA 3ZCZA 4PM8A 1HZOA 2EXAA 4GOGA 4QJGA 2DCFA 1BLCA 5F83A 5FDHA 4KG6A 2XLNA 1KE3A 3FZCA 1NYMA 4WEJA 4UA6A 1ERMA 1ES2A 4QD4A 5CGXA 3EQUA 4LCMA 1Q2PA 2Y2QA 2DRWA 2ZC4B 4WZ5C 3UN7A 4DXCA 4WYYA 1BULA 1PW8A 3IWOA 2ZM8A 1FCMA 4O7DA 2CC1A 1PI4A 1MBLA 1TDGA 1TEMA 2VGJA 3CZDA 4QB8A 4KZ8A 5EECA 5HX9A 4BL3A 2FFYA 4JF6A 3VP0A 2OLVA 4OQ0A 4JXSA 2XH9A 3RJUA 1HTZA 3ZG5A 2H0YA 1Q2QA 3GR2A 1L0GA 4BD0A 4X53A 4BENA 3M2KA 4F94A 1VM1A 3M6BA 3QNBA 4RA7A 3W4QA 4MBFA 4S2NC 3NBLA 3P98A 5GHXA 2HDRA 2XFSA 5CTMA 3ZHHA 1K38A 4YFMA 1ONGA 3BFEA 4ZJ1A 4R1GA 2EX9A 4C75A 4DE3A 4GD8A 4S2LA 2WGWA 2H10A 1MKIA 4WMCA 3PBSA 3VSKA 4S2NA 1WYBA 4X6TA 3W8KA 1CEFA 3MKFA 4OOLA 1KVLA 5A92A 3C7UA 3DW0A 1TVFA 2Y2MA 4ZBEA 1BUEA 3WS1A 2WUQA 4MBKA 4C3QA 1PI5A 1XKZA 4OPQA 3OPPA 4R0QA 3MKEA 4OLDA 4PPRA 2Y91A 4KZ9A 3IXHA 3ZG0A 4YINA 2Y2HA 3VOYA 4WBGA 3VP4A 5HW3A 3GTCA 4ZDXA 4JPMA 1XP4A 4MLLA 5CEDA 4H8RA 3N4IA 3OPLA 4FSFA 3HLBA 4JXVA 4PM6A 4R23A 4EQIA 2P74A 3Q82A 2XFTA 3LY4A 1XX2A 3UPPA 3BLSA 1SDEA 4WMCD 5DTKA 4ZAMA 2PU2A 4HEFA 5HAPA 1ZG6A 4WEKA 3VP1A 2IWDA 3AGEA 4JBFA 2C5WB 4GB7A 4XXRA 4DRTA 4OLGA 4KZ5A 4KQRA 1GHIA 5EE8A 3VSLA 4BLMA 4Q8IA 1YLPA 1NZOA 2WZZA 3BECA 3QNCA 5FATA 3E2LA 5KMWA 5EVIC 2G2WA 2XK1A 3E2KA 3UDXA 3VP3A 2EFXA 2Z2MB 4N1XA 3PBTA 5FQJA 4E3IA 3SH8A 1JTDA 4DKIA 2Y2JA 1DY6A 1PW1A 4DF6A 2WGVA 1FOFA 2EFUA 4OPZA 1Z6FA 5EVIA 5FQMA 1HVBA 4P0MA 4GZBA 2OLUA 4N9LA 3BFGA 1PIOA 5JYOA 1YLYA 3ZDJA 4JF4A 5GLAA 3TG9A 1E4DA 4MBHA 2ZC3B 2HP5A 3MBZA 2HPBA 1SCWA 1KGFA 1IYQA 4WZ4A 5FI6A 3N8RA 3UE3A 3ZNTA 1ONHA 2IWCA 1PWCA 1ES4A 3ITAA 4BL2A 4IVKA 1XPBA 4GD6A 3MFDA 1MPLA 4B4ZA 5CEBA 2Y2GA 1ERQA 1SKFA 1MWTA 4OPRA 3TOIA 2J8YA 4EBNA 1K6RA 1NXYA 4KQQA 4QU3A 3HBRA 4KQOA 2XGNA 3PAGA 3IH9A 4E3OA 4NK3A 4QY5A 5FI2A 5FQQA 4S2OA 5EVID 4E3NA 3WWXA 2Y2KA 4LV0A 5D3OA 1IEMA 2EX8A 2Y2NA 3UE0A 5A90A 5FASA 1CI9A 1H8ZA 2WZXA 4OKPA 5CRFA 2XF3A 5HL1A 4JXWA 2XD1A 3IHBA 1GA0A 1GA9A 3C4OA 3IF6C 3NI9A 1K55A 3OPHA 3IXBA 3S22A 3MZEA 2WADA 1LL9A 4IVIA 3Q07A 4OP8A 5DF9A 4E3JA 2ZMAA 1LI9A 3WS4A 1KE0A 3IF6A 3ITBA 4K0WA 1GCEA 3O86A 3HLEA 1E3UD 3C4PA 1G68A 2JC7A 3IWIA 4Y0OA 1IKIA 2J9OA 5FAPA 1JWZA 2UWXA 1O07A 3G2YA 4UHUA 5TR7A 5BOHA 1NY0A 5FQKA 1FCOA 1ZKJA 4E3KA 1NYYA 4OQIA 4QY6A 2EXBA 1JWPA 3SH7A 4KZ3A 3BEBA 4RYEA 1LL5A 1ZG4A 2EX6A 5E43A 2HP6A 4OONA 1I2SA 4S2PA 2HDQA 3B3XA 5EPHA 1L0FA 3S1YA 3VP2A 3FKWA 4S2IA 4LV1A 2QZ6A 2ZQCA 2A3UA 3G4PA 1S6RA 3S4XA 2H5SA 5I94A 5EVLA 5FSRA 3W4PA 1H5XA 1MWSA 3V39A 1L0DA 1I5QA 3M6HA 4GN2A 2C6WB 5IHVA 1Y54A 3OPRA 5M19A 1EWZA 3HLDA 3WRTA 3G32A 2OSUA 1NJ4A 3CG5A 4IBRA 1GHPA 3C5AA 3G34A 2XD5A 4JLFA 1KVMA 3LO7A 4UAAA 2P9VB 1BLPA 1SDNA 5CGWA 4ZTKA 5GLCA 1YQSA 5HARA 3CJMA 5CERA 1YMSA 1ES5A 1O7EA 1NRFA 4OOMA 1KDSA 2HDUA 1RP5A 2I72A 2FFFB 5CHJA 5CHUA 3ZFZA 2VGKA 1PZPA 3N6IA 3NDGA 4P87A 3OZHA 4OQHA 5KSCA 3A3DA 2OV5A 2ZM2A 1YM1A 3G35A 1BSGA 3G30A 3CMZA 2ZD8A 2XR0A 3ZG9B 1EROA 3PAEA 4KZBA 5DVAA 3BFFA 4LENA 1VQQA 1YLWA 2WAEA 3N7WA 5M1AA 3SOIA 1YMXA 3HLCA 4DE0A 1XA7A 1QMEA 1BTLA 5DF7A 4DE2A 3I7JA 3N8LA 5FQ9A 3GSGA 4BD1A 3Q7VB 4KZ6A 5AQ9A 4PM9A 1FCNA 3DTMA 3IXDA 2Y2IA 4IEDA 2XEPA 3UPOA 2Y2LA 5AQ7A 4E6WA 4DE1A 1CI8A 3UPNA 1K6SA 4CPKA 1IYOA 1W8QA 4D2OA 1KE4A 2WGIA 4BQMA 5AQAA 4EUZA 1L2SA 3OC2A 3QHYA 4KZAA 4B88A 4DDSA 4FH2A 1PYYA 1KGEA 4R4SA 4NETA 3IXGA 4HBUA 2WYXA 2V2FF 4U0XA 1LI0A 2G2UA 1PWGA 5M18A 1LHYA 3V50A 3A3JA 3PBRA 4LV3A 1MWRA 2PBYA 1HD8A 4R3BA 5L2FA 2JCHA 4HESA 3DWZA 4IBXA 4EBPA 4GKUA 4Y7PA 3NY4A 4RVAA 1ES3A 3MZFA 4ID4A 1MXOA 1K56A 1EI5A 3HVFA 3IT9A 4HBTA 1CK3A 3SS3A 3V3SA 1PZOA 1RGYA 3FV7A 3O88A 3Q81A 4JKTA 3UNWA 1FR6A 2V20A 4OH0A 3AGFA 3GRJA 4EBLA 1YLZA 4XUZA 2ZQ7A 1K55C 2J9PA 5CTNA 3N8SA 2HDSA 3HLFA 4X68A 3O87A 2RL3A 1WE4A 1CEGA 4S2MA 2WKEA 2EX2A 3V5MA 4KZ4A 4GNUA 1MY8A 3W4OA 5E2EA 2WGWB 2Y2OA 5GLBA 1ALQA 5A91A 4CJNA 1W8YA 3HL9A 1K57A 2ZQAA 2ZC5B 2Y2PA 3G31A 5HAIA 1OMEA 1FSWA 4FD8A 3M2JA 2ZQ9A 1K56D 2J7VA 1K54A 4ZJ2A 3UY6A 3FWLA 4LCLA 1ESIA 3JYIA 5FQIA 1FSYA 3IWQA 4R3JA 4P6BA 1G6AA 3HLWA 5FA7A 2Y59A 5F82A 4LV2A 2X02A 3WS5A 3V3RA 3O3VA 1RCJA 2JE5A 4MNRA 4N92A 3OCNA 5HFOA 2ZC7A 5E2GA 3UDFA 4DDYA 4Y0UA 3AGDA 3BFCA 3G2ZA 3BRMA 5AQBA 3VFFA 1AXBA 4X56A 2ZM0A 3SS5A 5FAQA 3UDIA 4MEZA 1TDLA
chains in the Genus database with same CATH superfamily
4HQAA 1PFLA 2IWBA 2Q9MA 1YLTA 4DN0A 2VV6A 1ESUA 3LY3A 2Z6CA 1K25A 4U0TA 5DTTA 1SHVA 3PBOA 1FQGA 4ARZB 5KZHA 1BZAA 2ZC6B 2E8IA 2OOLA 5E2HA 3MFXA 3WRZA 3KSHA 2HP9A 2W3DA 3BLMA 1BT5A 1K4EA 5EUAA 3MXQA 3E4QA 3ZQ5A 1JWVA 2A49A 3G6OA 3BFDA 1LLBA 2HJ9C 4Y15A 2R9XA 2Y4AA 1N4OA 2X71A 4X69A 3FYZA 1BLHA 1TS0A 1QMFA 2ZOIA 1OPXA 2ZLYA 4PMAA 4KG2A 1K4FA 2IA2A 3H7WB 3T1SA 3UO9A 1PRQA 3DWKA 4Y0TA 4CLCA 3O5YA 3Q1FA 3VOZA 5J8XA 2ZQ8A 5JYPA 4Q0JA 3RTYA 1K57C 4NEED 1YT4A 1E3UA 1E25A 3Q7VA 2ZQDA 3IS2B 1XA1A 2WKHA 3ZG8B 4O01A 1IYPA 4K0XA 4FCFA 3GQZA 3IF5A 2WKIA 3HLGA 3ZCZA 2VLGA 2EXAA 2PYPA 4QJGA 1BLCA 5FDHA 4Z1WA 3CAXA 1Y28A 4WF0A 4UA6A 4K08A 3EQUA 4LCMA 1Q2PA 1TF1A 2DRWA 4WYYA 2ZM8A 2CC1A 1TEMA 1MBLA 4BL3A 4QB8A 4JXSA 2XH9A 1Q2QA 4X53A 5CX7A 3W4QA 1LT0A 2HDRA 4WL9A 1S4SA 4YFMA 4C75A 5L8MA 4Y17A 4WMCA 4S2NA 1WYBA 4OOLA 1KVLA 2ACGA 3ULFA 4ZBEA 2XRNA 4LLOB 3NHQA 3D3OA 4NG2A 4KZ9A 2K31A 3A0SA 1YKDA 5HW3A 2A24B 4MLLA 4PKYA 3OPLA 3HLBA 4R23A 2P74A 2XFTA 1XX2A 3BLSA 1SDEA 4ZAMA 2PU2A 1ZG6A 3BY9A 2C5WB 3JPUA 4GB7A 4OLGA 3TJZC 3NOTC 3V67A 3VSLA 1NLZA 3BECA 5EVIC 2G2WA 3E2KA 2Z2MB 4N1XA 3DTIA 3SH8A 2Y2JA 4DF6A 2EFUA 1XJ2A 1DP9A 5JYOA 5GLAA 2ZC3B 2HP5A 3B33A 3ZNTA 1PWCA 1T19A 4GD6A 3MFDA 5CEBA 1SKFA 3CPTB 4KQOA 3IH9A 4E3OA 3BQAA 3WWXA 2V8CA 5C5KA 2Y2NA 1CI9A 3CI6A 2XF3A 5HL1A 2XD1A 3IHBA 2J3TD 1GA9A 1PNEA 1LSXA 3NI9A 1K55A 4EESA 2QKPA 3OPHA 2ZBBA 3SW1A 2UV0E 5DF9A 4E3JA 2M7UA 4ETXA 3ITBA 3IF6A 4K0WA 3O86A 2JC7A 3IWIA 3BY8A 1O07A 3G2YA 4NXBA 1ZKJA 1NYYA 4OQIA 2EXBA 3SH7A 3BEBA 4RYEA 2A2LA 2O9AA 3MS6A 3L7HA 3C2WA 1G5UA 4LV1A 3UMEA 3S4XA 2B18A 2H5SA 2QHKA 5FSRA 4BMWA 1MWSA 1L0DA 2C6WB 2WKQA 1OTIA 1EWZA 1K0KA 2OSUA 3C5AA 2XD5A 4BBUA 1KVMA 5CGWA 4ZTKA 1YQSA 5CERA 5MC7A 2PHYA 3DTKA 3ZFZA 1F5MA 2VGKA 4ME4A 3N6IA 3OZHA 2OV5A 4WLAA 3MMHA 4YWZA 4CLCB 5DVAA 2PR6A 3BFFA 5M1AA 1YLWA 3N7WA 1XA7A 1QMEA 1SKOA 2OAP1 3GSGA 2GZAA 4IJGA 3Q7VB 3QP4A 5I5LA 1FCNA 3IXDA 3UPOA 3UPNA 4O8GA 2W1TA 1W8QA 5L07A 2M1CA 3F1PA 5HPFA 5AQAA 4EUZA 4KZAA 2QWSA 4FH2A 1VETB 3LIFA 4HJ6A 1LHYA 2BASA 3V50A 3A3JA 4LV3A 2PBYA 1HD8A 4R3BA 4O0PA 2Y79A 4Y7PA 1P0ZA 3IBRA 3ICYA 1KOUA 3IT9A 3O88A 4Y5FA 1FR6A 5HWWA 4OH0A 3AGFA 1YLZA 4XUZA 1K55C 5CTNA 3HLFA 5F5YA 4IUKA 2PDRA 3V5MA 1CJFA 1V9YA 1MY8A 3GECA 2Y2OA 4EW7A 5GLBA 1YAXA 3FG8A 1OTEA 2ZQAA 2ZC5B 3G31A 1F9IA 1OMEA 4FD8A 4BBTA 1K54A 1ESIA 2Q0OA 1LL8A 3CITA 3CUEA 2HF6A 4FOFA 3T4TA 1G6AA 3HLWA 3UB8A 5FA7A 1T1AA 4LV2A 3NOPC 3O3VA 4G3KA 1AXBA 4X56A 1TS8A 2ZM0A 3C38A 5FAQA 4MEZA 4NXEA 3A3FA 4EWFA 3KYEA 3LYXA 1J9MA 3RFBA 4I5SA 4C6YA 4Y3IA 1XGIA 5A93A 5IU1A 4UA7A 4B9OA 4NXGA 4WM9A 5EOEA 3D4FA 4QPRA 4JF5A 3GMWA 4X55A 3EEHA 5GLDA 3T4OA 4OPYA 5KSHA 4K91A 2DNSA 1N9LA 2JBFA 3MXRA 3HJIA 1S0WA 4LRYC 3A0VA 2Y8HA 3ZNYA 3NDEA 2V0UA 4E3LA 3HUNA 3ZVTA 3MF0A 1N9BA 4HP4A 3A0RA 3OCLA 3MXSA 1IKGA 3TSGA 1FR1A 4OQGA 1WYCA 1S67L 3PBNA 4LPZA 4FH4A 4M3KA 2L1MA 3F1OA 2P9VA 5LBRA 1KGGA 2WAFA 1OTDA 3C8CA 3IF6B 2RCXA 5DJTA 2VX8A 1DRMA 2ZMFA 2V1ZA 2ZJ9A 5G4YA 3VMAA 4RX2A 5EVEA 1ZC2A 3NC8A 1XJ3A 2JKRM 1I2WA 1OTAA 3LEQA 4KZ7A 4M4XA 3A3IA 5GHYA 3LCEA 3SZTA 4XUXA 5DFXA 3OBFA 4E3MA 2WK0A 4NKPA 2VK3A 5GL9A 3FC7A 1K54C 2B5RA 4JXGA 1Z09A 3PTEA 3CUEC 4WELA 3T1XA 2X01A 1W5DA 4X25A 3RXXA 3VFHA 3C7VA 5U47A 1HZOA 5F83A 3QP2A 4KG6A 3FZCA 1NYMA 4WEJA 1ERMA 5CGXA 2ZC4B 4DXCA 1PW8A 1FCMA 3E4PA 4O7DA 1PI4A 1TDGA 4DJ3A 2FFYA 3VP0A 2O0YA 3LGOA 1P9RA 4BENA 1LSVA 3M2KA 4F94A 4UEYA 1SKOB 3M6BA 3H9WA 4RA7A 3NBLA 3K3CA 3ZHHA 1K38A 3BFEA 1Y4OA 2W1TB 2WGWA 1CF0A 1MKIA 3VSKA 3MKFA 3C7UA 5DFYA 2Y91A 3ZG0A 3P7NA 3VOYA 4WBGA 1MZUA 4ZDXA 1WA9A 4JPMA 1XP4A 4JXVA 3UPPA 5DTKA 2P08A 4HEFA 1NRJA 1ODVA 4XXRA 4DRTA 4KZ5A 1GHIA 3EOIA 4JGRA 4DMZA 3QNCA 2XK1A 3UDXA 1TS7A 2EFXA 1IFQA 4LFUA 3U2AA 1JTDA 4I38A 1PW1A 4HOIA 4OPZA 5FQMA 5EVIA 1XFNA 2J3TC 4GZBA 2OLUA 4N9LA 5K5BA 3BFGA 2WKPA 1T1CA 1PIOA 3MQOA 1YLYA 4JF4A 4MBHA 3QP8A 3MBZA 1KGFA 1IYQA 3N8RA 3UE3A 1ONHA 3ITAA 1XPBA 4X1LA 4B4ZA 1MPLA 2Y2GA 4EBNA 1MWTA 3TE8A 4QU3A 3HBRA 3LIBA 2O9CA 2PT7A 5FI2A 4E3NA 2OWJA 2WZXA 2VGLM 5DKLA 1S1ZA 1L3LA 5EFWA 4Y13A 3MZEA 2WADA 1LL9A 3Q07A 1KE0A 1W63Q 4AFIA 3ZYTA 3C4PA 1G68A 5BOHA 1FCOA 4E3KA 3LR4A 4QY6A 2W3EA 5E43A 3OLOA 1MKMA 3UE6A 3S1YA 3VP2A 4KQDA 4P6ZM 2QZ6A 4HH3A 2LB5A 4LRZE 5TBMB 3M6HA 4GN2A 5IHVA 4LRXC 3OPRA 4EERA 3LO7A 3F1OB 4X1MA 2P9VB 1BLPA 1SDNA 5HARA 5GLCA 1O7EA 1KDSA 2HDUA 1RP5A 2K7SA 2FFFB 2LB9A 1OJGA 1OTBA 2KLIA 2V9AA 1PZPA 3NDGA 4P87A 2R78A 3A3DA 3G35A 1BSGA 3G30A 1EROA 1ZTUA 3PAEA 3JVVA 4GHIA 1YMXA 3HLCA 2ZL1A 3CLOA 5DF7A 2JKFA 3N8LA 5FQ9A 4BD1A 3EWKA 5KIZA 5AQ7A 4E6WA 4DE1A 3VE3A 1KE4A 5J7EA 3OC2A 4DDSA 4R4SA 4NETA 2WYXA 3PR6A 4WUJA 2G2UA 1PWGA 2PD8A 3T4QA 2D01A 5M18A 2HJEA 1VEUA 4KUKA 4GKUA 3NY4A 3GDIA 1ES3A 4R70A 2V1BA 1MXOA 2YKHA 3MQQA 3HCYA 4HBTA 1CK3A 1PZOA 3DTEA 3UNWA 2ZQ7A 2HDSA 2RL3A 1CEGA 4S2MA 2EX2A 2WGWB 5A91A 4CJNA 3S7OA 3BQ8A 1S1YA 4HI4A 2VV7A 3M2JA 2ZQ9A 1K56D 4R3AA 2BTFP 4GCZA 3VE4A 2Y59A 5F82A 2X02A 3WS5A 3V3RA 1RCJA 3OCNA 5HFOA 5AQBA 5L10A 2HGVA 1MWUA 1NLYA 4D60A 4WZ5A 3PYPA 4GDBA 2QYBA 4EU0A 3UB9A 3HUMA 3ISGA 1FILA 1W79A 3BW6A 4I3AA 2P7JA 4JGOA 5CGSA 5G18A 2M7VA 4BJPA 3KSIA 2CMNA 4GDNA 5EVIB 5F1GA 1IOUA 3Q7ZA 4PHTA 4EETB 2PRFA 2BG1A 2PU4A 3WS2A 2Y55A 1XGJA 4P85A 1IELA 3A3EA 3UB6A 3F1NA 4OOYA 3P09A 1XJ4A 5CXWA 5DTSA 2XSSA 3WS0A 1A0KA 3BM6A 3NCKA 1DJAA 5E2FA 1DJCA 5TGFA 4S2KA 1L0EA 3B42A 1NZUA 4OP5A 2R9WA 2JKGA 3IHAA 1H3QA 4R4RA 1YLJA 1XXMA 3BWLA 3UE1A 4EXOA 1M40A 3T12B 1DJBA 2W27A 4F3LA 4GLQA 1JTGA 3ZGAB 5HAQA 4Y2FA 2BLSA 2VEAA 4DXBA 3QP1A 1HLUP 2O99A 2Z2LB 1XFQA 1P97A 5HWVA 4A5RA 2XDMA 1UWPX 1JVJA 2W3FA 4L0LA 2H0TA 2HZ5A 2VV8A 1GHMA 5HDCA 2XQZA 4N9KA 2JKTM 4OVDA 3GV9A 3EQVA 5CECA 4CLCD 4PM8A 3UB7A 5G4ZA 1ES2A 4QD4A 4EEUA 4WZ5C 2QJ5A 3UN7A 4L9GA 1BULA 3IWOA 5EECA 3CZDA 4KZ8A 3H7WA 3S7NA 3LI9A 3IX8A 3B47A 4EUVA 3RJUA 1HTZA 3KO6A 1L0GA 4BD0A 2ZL1B 1N9OA 1VM1A 5HWTA 1D1JA 5GHXA 2XFSA 5CTMA 1ONGA 4R1GA 1VB6A 3W8KA 3IS2A 4MMNA 1TVFA 1BUEA 3WS1A 2GJ3A 4MBKA 1PI5A 1XKZA 1S66L 4OPQA 4R0QA 1XJ6A 4OLDA 4PPRA 3IXHA 2Y2HA 3VP4A 5CEDA 4H8RA 5HD3A 4EQIA 1ACFA 3EGDC 4WMCD 4ZRRA 2YKFA 4WEKA 1DP8A 3FPWA 3QP6A 2IWDA 4JBFA 4BLMA 2EWVA 1YLPA 2WZZA 5FATA 4BWIA 1S4RA 3T4LA 4HH2A 3PBTA 4E3IA 4DKIA 1DY6A 1FOFA 1Z6FA 4L9EA 1HVBA 2INWA 4GS9A 3ZDJA 3TG9A 1JNUA 1T18A 2IWCA 3LI8A 4IVKA 3R7WA 1ERQA 1OT9A 2J8YA 2V0WA 1K6RA 1NXYA 3IBJA 5FDSA 3T4JA 4NK3A 5DJUA 3LIDA 5FQQA 3KYQA 2VGLS 2Y2KA 5D3OA 2EX8A 3UE0A 5A90A 5FASA 4ESPA 2GNXA 4OKPA 5CRFA 3LICA 1NWZA 1GA0A 2H28A 3IXBA 3S22A 4HP9A 2VA0A 4G3WA 4IVIA 1VHMA 1LI9A 3WS4A 3KYZA 3NULA 3HLEA 4UQIM 5FAPA 1JWZA 3NJAA 5TR7A 3QP5A 1MC0A 4EEPA 1ZHHB 1JWPA 1SZVA 2HP6A 4P6ZS 4S2PA 2HDQA 3F1NB 2PR5A 1L0FA 3CPTA 2W0NA 3F1PB 2G7UA 5EVLA 3W4PA 5I94A 1I5QA 3L9KA 3HLDA 3WRTA 3CG5A 4R6LA 4JLFA 3G34A 4R38A 3CJMA 2B95A 1YMSA 4I39A 1NRFA 5CHJA 2I72A 5F68A 3VOLA 5CHUA 3EEAA 4I3JA 5FL3A 2VKSA 5EM1A 3H82A 5KSCA 1GSWA 2ZM2A 1YM1A 3DAVA 2XR0A 5HL6A 4LENA 2WAEA 3SOIA 4F3LB 4DE2A 3I7JA 3LR0A 3CHWP 2NUPC 5AQ9A 3DTMA 2Y2IA 4IEDA 2XEPA 1K6SA 1IYOA 3TRCA 4D2OA 4HHDA 2WGIA 1L2SA 2PYRA 1DP6A 3IXGA 2V2FF 4U0XA 1LI0A 3DBAA 3PBRA 3NECA 1MWRA 4L9FA 5L2FA 4HESA 3DWZA 4H6JA 4IBXA 4EQ1A 4EBPA 1STZA 3MZFA 4ID4A 2ZOHA 4Q0HA 5J3WA 4YOFA 4HJ4A 1RGYA 3FV7A 3Q81A 2V8FA 4JKTA 2V20A 2XA7M 4X68A 2PD7A 5EM0A 1WE4A 5HSQA 2WKEA 2EA9A 2PBDP 5E2EA 3MQ0A 1W8YA 1TS6A 3HL9A 5HAIA 1G28A 2D02A 4ZJ2A 3UY6A 2OWHA 4LCLA 3JYIA 4YNRA 5FQIA 1FSYA 1X0OA 3S7QA 1VETA 4R3JA 4P6BA 1P9WA 1CQAA 2JE5A 4N92A 5E2GA 4DDYA 4Y0UA 3BRMA 2L4RA 3UMDA 3S7PA 3SS5A 5HAPA 1TDLA 2QPNA 4UA9A 5EOOA 1IYSA 1W7FA 2VJWA 3NIAA 1RGZA 5DF8A 2MJ6A 2HV1A 4XT2A 2QMIA 5IT5A 4GW9A 3RXWA 2XROA 5F6AA 2Z6DA 1H0MA 3U4LP 4MN5A 4Z9QA 5HZHA 3CWFA 4S2JA 4PKYG 5GHZA 1M6KA 3HREA 3MR0A 4GS9B 4PM5A 5TFQA 1H8YA 1U60A 3E98A 3SH9A 4KG5A 3LR3A 3PBQA 1W63M 3GVBA 4FTXA 2GDNA 3IQAA 2KOIA 3R7WB 2L0WA 3LR5A 4LGWA 1BLSA 3HUOA 4KENB 5FI7A 2J3WA 4JGQA 3T1RA 5FAOA 2W1RA 2Q9NA 1KDWA 2KX6A 3JVUA 4U3TA 3C30A 3ZVWA 1C3BA 4EV4A 4QHCA 4HJ3A 3MZDA 3PXPA 4QWOA 4CLCC 3K3DA 3IH8A 3VV4A 2I9VA 1TD5A 5FEFA 4E6XA 2JKTI 5HPIA 3LEZA 3FKVA 4B4XA 3ZG7B 4ZJ3A 1D7EA 5F1FA 1UWNX 2FH5A 5CHMA 4RX3A 3BYDA 4N1HA 2B02A 4PM7A 1H8MA 3SS4A 1PWDA 4GOGA 2DCFA 5TJJA 2XLNA 1KE3A 1V9ZA 2Y2QA 3H82B 4IUHA 2WKRA 4G3VA 2VGJA 5HX9A 3E4OA 4JF6A 2OLVA 4OQ0A 5HDDA 3ZG5A 2H0YA 2V1AA 3GR2A 3FPVA 1YSPA 1N9NA 3QNBA 4MBFA 4S2NC 1LSWA 3P98A 4ZJ1A 3TW8A 2EX9A 4DE3A 4GD8A 4S2LA 4CLCE 2H10A 3PBSA 2PAVP 1OJ5A 4X6TA 4Q0IA 3T1QB 1CEFA 5A92A 3DW0A 2Y2MA 4II7A 2WUQA 4C3QA 4JGPA 3OPPA 3MKEA 4PAUA 4IHQA 3KSFA 4YINA 4H6JB 1EW0A 3GTCA 1GSVA 5AVEA 3UB5P 2DMWA 4DJ2A 3N4IA 4FSFA 4PM6A 3Q82A 3LY4A 4HNBA 3VP1A 3KSGA 1J3WA 1G6OA 3AGEA 2JKRI 4KQRA 5EE8A 4Q8IA 1NZOA 3E2LA 5KMWA 4ARZA 3VP3A 2ZMVA 5FQJA 2WGVA 1AWIA 4P0MA 2W3GA 4BBVA 1E4DA 2HPBA 1SCWA 4WZ4A 5FI6A 4CQHA 1OT6A 1ES4A 3K2NA 4BL2A 3D9YA 4KUOA 2J80A 4OPRA 3TOIA 3IX4A 4KQQA 2QJ7A 2XGNA 3PAGA 5DKKA 3MSHA 4QY5A 4S2OA 5EVID 5A8BA 4LV0A 1IEMA 2AVXA 4XT2B 1H8ZA 1GSXA 4JXWA 2KDKA 3C4OA 3IF6C 5IS1A 4UQIS 4OP8A 2ZMAA 4GJ4A 1GCEA 1E3UD 5HDSA 2JHEA 4Y0OA 1IKIA 2J9OA 4HY8A 5AVFA 1D06A 2UWXA 4UHUA 1NY0A 5FQKA 2W3HA 4GHIB 3OOVA 5J4EA 4KZ3A 1LL5A 1ZG4A 2EX6A 4OONA 4FUWA 1I2SA 3B3XA 5EPHA 3FKWA 4S2IA 2ZQCA 2A3UA 3G4PA 1S6RA 1UGUA 2OAQ1 1H5XA 3V39A 3LIAA 3P01A 5EV0A 1Y54A 5M19A 3LUQA 3G32A 1NJ4A 4IBRA 1GHPA 1F98A 5AJGA 4UAAA 4NXFA 1VEUB 1ES5A 2JN7A 4OOMA 1FIKA 3IX3A 4OQHA 4I3IA 1T1BA 3MJQA 3CMZA 2ZD8A 3ZG9B 4RQ9A 4KZBA 1VQQA 4WN5A 4MCWA 4DE0A 1BTLA 2FZ0A 5HD5A 4E04A 2P04A 4KZ6A 4PM9A 2Y2LA 1CI8A 4CPKA 4MN7A 4BQMA 5TBMA 2E8JA 3E0YA 3QHYA 4B88A 3KX0X 1PYYA 1KGEA 4HBUA 1YPRA 1F2KA 2JCHA 3BJNA 3D72A 4MDZA 4RVAA 2A24A 1K56A 1EI5A 2GX5A 4B93A 3HVFA 5F69A 2XA7S 3SS3A 3V3SA 3R4KA 4ETZA 3GRJA 4EBLA 2J9PA 3N8SA 4HIAA 3LFVA 3O87A 4KZ4A 2NUTC 4GNUA 3W4OA 3T4KA 1ALQA 4MN6A 1K57A 1BYWA 2Y2PA 1FSWA 2J7VA 2VZWA 3EGXC 3FWLA 2EWWA 3NOUC 3IWQA 3HJKA 5L09A 3LIEA 3RH8B 3PHYA 1YSQA 2K2NA 4MNRA 5FEGA 3W2ZA 2ZC7A 3UDFA 3AGDA 3BFCA 3G2ZA 3VFFA 3UDIA 2O9BA 3T50A 3T4SA
chains in the Genus database with same CATH topology
1MWUA 2QPNA 4UA9A 3A3FA 5EOOA 1IYSA 1W7FA 2IWBA 2Q9MA 3NIAA 4WZ5A 4EWFA 1RGZA 1J9MA 1YLTA 5DF8A 4GDBA 4C6YA 1ESUA 1XGIA 3LY3A 5A93A 2QMIA 1K25A 3RXWA 3HUMA 4U0TA 4UA7A 3ISGA 1SHVA 5DTTA 1W79A 1FQGA 3PBOA 5KZHA 4WM9A 4Z9QA 5EOEA 3D4FA 4S2JA 1BZAA 5CGSA 5G18A 4BJPA 5GHZA 2ZC6B 2E8IA 4JF5A 3GMWA 4X55A 4GDNA 5EVIB 5E2HA 5GLDA 5F1GA 1M6KA 3HREA 4OPYA 3WRZA 5KSHA 4K91A 2DNSA 2JBFA 2HP9A 3MXRA 3Q7ZA 4PM5A 5TFQA 1S0WA 3BLMA 1H8YA 1BT5A 1U60A 1K4EA 5EUAA 2BG1A 2PU4A 3SH9A 3WS2A 2Y55A 4KG5A 3ZNYA 3PBQA 1XGJA 3NDEA 4E3LA 4P85A 1IELA 3HUNA 3GVBA 3A3EA 2GDNA 3IQAA 3ZVTA 1N9BA 1JWVA 1BLSA 3HUOA 4KENB 5FI7A 3OCLA 4OOYA 2A49A 3P09A 5CXWA 5DTSA 3MXSA 3WS0A 3BFDA 3BM6A 1LLBA 1IKGA 3NCKA 5FAOA 3TSGA 1FR1A 2R9XA 1DJAA 4OQGA 1WYCA 5E2FA 2Y4AA 3PBNA 1N4OA 2Q9NA 1KDWA 4FH4A 1DJCA 4M3KA 5TGFA 2X71A 4X69A 4S2KA 1L0EA 2P9VA 3FYZA 1BLHA 1KGGA 2WAFA 4U3TA 1QMFA 1NZUA 3ZVWA 4OP5A 3IF6B 2R9WA 2RCXA 3IHAA 1C3BA 2ZLYA 4PMAA 4KG2A 1K4FA 1YLJA 4R4RA 2V1ZA 2ZJ9A 3VMAA 4EV4A 4QHCA 3MZDA 1XXMA 4RX2A 1ZC2A 3NC8A 1I2WA 4KZ7A 3UO9A 3UE1A 3IH8A 3DWKA 4Y0TA 1M40A 3A3IA 3Q1FA 1DJBA 5GHYA 3LCEA 3VOZA 5J8XA 2ZQ8A 4E6XA 4XUXA 5CECA 1JTGA 5JYPA 3ZGAB 4E3MA 5HAQA 3LEZA 1K57C 2WK0A 3FKVA 4B4XA 1YT4A 2BLSA 3ZG7B 4DXBA 4ZJ3A 1E3UA 1E25A 3Q7VA 5GL9A 2ZQDA 1K54C 5F1FA 2Z2LB 2B5RA 4JXGA 5CHMA 1XA1A 4RX3A 2WKHA 2XDMA 3PTEA 4A5RA 3ZG8B 1JVJA 4L0LA 1IYPA 2H0TA 4K0XA 4WELA 1GHMA 2X01A 1W5DA 3BYDA 2XQZA 4N9KA 3RXXA 4N1HA 4PM7A 4FCFA 3VFHA 4OVDA 3SS4A 3GQZA 3C7VA 1PWDA 5U47A 3IF5A 2WKIA 3EQVA 3GV9A 3HLGA 3ZCZA 4PM8A 1HZOA 2EXAA 4GOGA 4QJGA 2DCFA 1BLCA 5F83A 5FDHA 4KG6A 2XLNA 1KE3A 3FZCA 1NYMA 4WEJA 4UA6A 1ERMA 1ES2A 4QD4A 5CGXA 3EQUA 4LCMA 1Q2PA 2Y2QA 2DRWA 2ZC4B 4WZ5C 3UN7A 4DXCA 4WYYA 1BULA 1PW8A 3IWOA 2ZM8A 1FCMA 4O7DA 2CC1A 1PI4A 1MBLA 1TDGA 1TEMA 2VGJA 3CZDA 4QB8A 4KZ8A 5EECA 5HX9A 4BL3A 2FFYA 4JF6A 3VP0A 2OLVA 4OQ0A 4JXSA 2XH9A 3RJUA 1HTZA 3ZG5A 2H0YA 1Q2QA 3GR2A 1L0GA 4BD0A 4X53A 4BENA 3M2KA 4F94A 1VM1A 3M6BA 3QNBA 4RA7A 3W4QA 4MBFA 4S2NC 3NBLA 3P98A 5GHXA 2HDRA 2XFSA 5CTMA 3ZHHA 1K38A 4YFMA 1ONGA 3BFEA 4ZJ1A 4R1GA 2EX9A 4C75A 4DE3A 4GD8A 4S2LA 2WGWA 2H10A 1MKIA 4WMCA 3PBSA 3VSKA 4S2NA 1WYBA 4X6TA 3W8KA 1CEFA 3MKFA 4OOLA 1KVLA 5A92A 3C7UA 3DW0A 1TVFA 2Y2MA 4ZBEA 1BUEA 3WS1A 2WUQA 4MBKA 4C3QA 1PI5A 1XKZA 4OPQA 3OPPA 4R0QA 3MKEA 4OLDA 4PPRA 2Y91A 4KZ9A 3IXHA 3ZG0A 4YINA 2Y2HA 3VOYA 4WBGA 3VP4A 5HW3A 3GTCA 4ZDXA 4JPMA 1XP4A 4MLLA 5CEDA 4H8RA 3N4IA 3OPLA 4FSFA 3HLBA 4JXVA 4PM6A 4R23A 4EQIA 2P74A 3Q82A 2XFTA 3LY4A 1XX2A 3UPPA 3BLSA 1SDEA 4WMCD 5DTKA 4ZAMA 2PU2A 4HEFA 5HAPA 1ZG6A 4WEKA 3VP1A 2IWDA 3AGEA 4JBFA 2C5WB 4GB7A 4XXRA 4DRTA 4OLGA 4KZ5A 4KQRA 1GHIA 5EE8A 3VSLA 4BLMA 4Q8IA 1YLPA 1NZOA 2WZZA 3BECA 3QNCA 5FATA 3E2LA 5KMWA 5EVIC 2G2WA 2XK1A 3E2KA 3UDXA 3VP3A 2EFXA 2Z2MB 4N1XA 3PBTA 5FQJA 4E3IA 3SH8A 1JTDA 4DKIA 2Y2JA 1DY6A 1PW1A 4DF6A 2WGVA 1FOFA 2EFUA 4OPZA 1Z6FA 5EVIA 5FQMA 1HVBA 4P0MA 4GZBA 2OLUA 4N9LA 3BFGA 1PIOA 5JYOA 1YLYA 3ZDJA 4JF4A 5GLAA 3TG9A 1E4DA 4MBHA 2ZC3B 2HP5A 3MBZA 2HPBA 1SCWA 1KGFA 1IYQA 4WZ4A 5FI6A 3N8RA 3UE3A 3ZNTA 1ONHA 2IWCA 1PWCA 1ES4A 3ITAA 4BL2A 4IVKA 1XPBA 4GD6A 3MFDA 1MPLA 4B4ZA 5CEBA 2Y2GA 1ERQA 1SKFA 1MWTA 4OPRA 3TOIA 2J8YA 4EBNA 1K6RA 1NXYA 4KQQA 4QU3A 3HBRA 4KQOA 2XGNA 3PAGA 3IH9A 4E3OA 4NK3A 4QY5A 5FI2A 5FQQA 4S2OA 5EVID 4E3NA 3WWXA 2Y2KA 4LV0A 5D3OA 1IEMA 2EX8A 2Y2NA 3UE0A 5A90A 5FASA 1CI9A 1H8ZA 2WZXA 4OKPA 5CRFA 2XF3A 5HL1A 4JXWA 2XD1A 3IHBA 1GA0A 1GA9A 3C4OA 3IF6C 3NI9A 1K55A 3OPHA 3IXBA 3S22A 3MZEA 2WADA 1LL9A 4IVIA 3Q07A 4OP8A 5DF9A 4E3JA 2ZMAA 1LI9A 3WS4A 1KE0A 3IF6A 3ITBA 4K0WA 1GCEA 3O86A 3HLEA 1E3UD 3C4PA 1G68A 2JC7A 3IWIA 4Y0OA 1IKIA 2J9OA 5FAPA 1JWZA 2UWXA 1O07A 3G2YA 4UHUA 5TR7A 5BOHA 1NY0A 5FQKA 1FCOA 1ZKJA 4E3KA 1NYYA 4OQIA 4QY6A 2EXBA 1JWPA 3SH7A 4KZ3A 3BEBA 4RYEA 1LL5A 1ZG4A 2EX6A 5E43A 2HP6A 4OONA 1I2SA 4S2PA 2HDQA 3B3XA 5EPHA 1L0FA 3S1YA 3VP2A 3FKWA 4S2IA 4LV1A 2QZ6A 2ZQCA 2A3UA 3G4PA 1S6RA 3S4XA 2H5SA 5I94A 5EVLA 5FSRA 3W4PA 1H5XA 1MWSA 3V39A 1L0DA 1I5QA 3M6HA 4GN2A 2C6WB 5IHVA 1Y54A 3OPRA 5M19A 1EWZA 3HLDA 3WRTA 3G32A 2OSUA 1NJ4A 3CG5A 4IBRA 1GHPA 3C5AA 3G34A 2XD5A 4JLFA 1KVMA 3LO7A 4UAAA 2P9VB 1BLPA 1SDNA 5CGWA 4ZTKA 5GLCA 1YQSA 5HARA 3CJMA 5CERA 1YMSA 1ES5A 1O7EA 1NRFA 4OOMA 1KDSA 2HDUA 1RP5A 2I72A 2FFFB 5CHJA 5CHUA 3ZFZA 2VGKA 1PZPA 3N6IA 3NDGA 4P87A 3OZHA 4OQHA 5KSCA 3A3DA 2OV5A 2ZM2A 1YM1A 3G35A 1BSGA 3G30A 3CMZA 2ZD8A 2XR0A 3ZG9B 1EROA 3PAEA 4KZBA 5DVAA 3BFFA 4LENA 1VQQA 1YLWA 2WAEA 3N7WA 5M1AA 3SOIA 1YMXA 3HLCA 4DE0A 1XA7A 1QMEA 1BTLA 5DF7A 4DE2A 3I7JA 3N8LA 5FQ9A 3GSGA 4BD1A 3Q7VB 4KZ6A 5AQ9A 4PM9A 1FCNA 3DTMA 3IXDA 2Y2IA 4IEDA 2XEPA 3UPOA 2Y2LA 5AQ7A 4E6WA 4DE1A 1CI8A 3UPNA 1K6SA 4CPKA 1IYOA 1W8QA 4D2OA 1KE4A 2WGIA 4BQMA 5AQAA 4EUZA 1L2SA 3OC2A 3QHYA 4KZAA 4B88A 4DDSA 4FH2A 1PYYA 1KGEA 4R4SA 4NETA 3IXGA 4HBUA 2WYXA 2V2FF 4U0XA 1LI0A 2G2UA 1PWGA 5M18A 1LHYA 3V50A 3A3JA 3PBRA 4LV3A 1MWRA 2PBYA 1HD8A 4R3BA 5L2FA 2JCHA 4HESA 3DWZA 4IBXA 4EBPA 4GKUA 4Y7PA 3NY4A 4RVAA 1ES3A 3MZFA 4ID4A 1MXOA 1K56A 1EI5A 3HVFA 3IT9A 4HBTA 1CK3A 3SS3A 3V3SA 1PZOA 1RGYA 3FV7A 3O88A 3Q81A 4JKTA 3UNWA 1FR6A 2V20A 4OH0A 3AGFA 3GRJA 4EBLA 1YLZA 4XUZA 2ZQ7A 1K55C 2J9PA 5CTNA 3N8SA 2HDSA 3HLFA 4X68A 3O87A 2RL3A 1WE4A 1CEGA 4S2MA 2WKEA 2EX2A 3V5MA 4KZ4A 4GNUA 1MY8A 3W4OA 5E2EA 2WGWB 2Y2OA 5GLBA 1ALQA 5A91A 4CJNA 1W8YA 3HL9A 1K57A 2ZQAA 2ZC5B 2Y2PA 3G31A 5HAIA 1OMEA 1FSWA 4FD8A 3M2JA 2ZQ9A 1K56D 2J7VA 1K54A 4ZJ2A 3UY6A 3FWLA 4LCLA 1ESIA 3JYIA 5FQIA 1FSYA 3IWQA 4R3JA 4P6BA 1G6AA 3HLWA 5FA7A 2Y59A 5F82A 4LV2A 2X02A 3WS5A 3V3RA 3O3VA 1RCJA 2JE5A 4MNRA 4N92A 3OCNA 5HFOA 2ZC7A 5E2GA 3UDFA 4DDYA 4Y0UA 3AGDA 3BFCA 3G2ZA 3BRMA 5AQBA 3VFFA 1AXBA 4X56A 2ZM0A 3SS5A 5FAQA 3UDIA 4MEZA 1TDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MWU A;  2QPN A;  4UA9 A;  3A3F A;  5EOO A;  1IYS A;  1W7F A;  2IWB A;  2Q9M A;  3NIA A;  4WZ5 A;  4EWF A;  1RGZ A;  1J9M A;  1YLT A;  5DF8 A;  4GDB A;  4C6Y A;  1ESU A;  1XGI A;  3LY3 A;  5A93 A;  2QMI A;  1K25 A;  3RXW A;  3HUM A;  4U0T A;  4UA7 A;  3ISG A;  1SHV A;  5DTT A;  1W79 A;  1FQG A;  3PBO A;  5KZH A;  4WM9 A;  4Z9Q A;  5EOE A;  3D4F A;  4S2J A;  1BZA A;  5CGS A;  5G18 A;  4BJP A;  5GHZ A;  2ZC6 B;  2E8I A;  4JF5 A;  3GMW A;  4X55 A;  4GDN A;  5EVI B;  5E2H A;  5GLD A;  5F1G A;  1M6K A;  3HRE A;  4OPY A;  3WRZ A;  5KSH A;  4K91 A;  2DNS A;  2JBF A;  2HP9 A;  3MXR A;  3Q7Z A;  4PM5 A;  5TFQ A;  1S0W A;  3BLM A;  1H8Y A;  1BT5 A;  1U60 A;  1K4E A;  5EUA A;  2BG1 A;  2PU4 A;  3SH9 A;  3WS2 A;  2Y55 A;  4KG5 A;  3ZNY A;  3PBQ A;  1XGJ A;  3NDE A;  4E3L A;  4P85 A;  1IEL A;  3HUN A;  3GVB A;  3A3E A;  2GDN A;  3IQA A;  3ZVT A;  1N9B A;  1JWV A;  1BLS A;  3HUO A;  4KEN B;  5FI7 A;  3OCL A;  4OOY A;  2A49 A;  3P09 A;  5CXW A;  5DTS A;  3MXS A;  3WS0 A;  3BFD A;  3BM6 A;  1LLB A;  1IKG A;  3NCK A;  5FAO A;  3TSG A;  1FR1 A;  2R9X A;  1DJA A;  4OQG A;  1WYC A;  5E2F A;  2Y4A A;  3PBN A;  1N4O A;  2Q9N A;  1KDW A;  4FH4 A;  1DJC A;  4M3K A;  5TGF A;  2X71 A;  4X69 A;  4S2K A;  1L0E A;  2P9V A;  3FYZ A;  1BLH A;  1KGG A;  2WAF A;  4U3T A;  1QMF A;  1NZU A;  3ZVW A;  4OP5 A;  3IF6 B;  2R9W A;  2RCX A;  3IHA A;  1C3B A;  2ZLY A;  4PMA A;  4KG2 A;  1K4F A;  1YLJ A;  4R4R A;  2V1Z A;  2ZJ9 A;  3VMA A;  4EV4 A;  4QHC A;  3MZD A;  1XXM A;  4RX2 A;  1ZC2 A;  3NC8 A;  1I2W A;  4KZ7 A;  3UO9 A;  3UE1 A;  3IH8 A;  3DWK A;  4Y0T A;  1M40 A;  3A3I A;  3Q1F A;  1DJB A;  5GHY A;  3LCE A;  3VOZ A;  5J8X A;  2ZQ8 A;  4E6X A;  4XUX A;  5CEC A;  1JTG A;  5JYP A;  3ZGA B;  4E3M A;  5HAQ A;  3LEZ A;  1K57 C;  2WK0 A;  3FKV A;  4B4X A;  1YT4 A;  2BLS A;  3ZG7 B;  4DXB A;  4ZJ3 A;  1E3U A;  1E25 A;  3Q7V A;  5GL9 A;  2ZQD A;  1K54 C;  5F1F A;  2Z2L B;  2B5R A;  4JXG A;  5CHM A;  1XA1 A;  4RX3 A;  2WKH A;  2XDM A;  3PTE A;  4A5R A;  3ZG8 B;  1JVJ A;  4L0L A;  1IYP A;  2H0T A;  4K0X A;  4WEL A;  1GHM A;  2X01 A;  1W5D A;  3BYD A;  2XQZ A;  4N9K A;  3RXX A;  4N1H A;  4PM7 A;  4FCF A;  3VFH A;  4OVD A;  3SS4 A;  3GQZ A;  3C7V A;  1PWD A;  5U47 A;  3IF5 A;  2WKI A;  3EQV A;  3GV9 A;  3HLG A;  3ZCZ A;  4PM8 A;  1HZO A;  2EXA A;  4GOG A;  4QJG A;  2DCF A;  1BLC A;  5F83 A;  5FDH A;  4KG6 A;  2XLN A;  1KE3 A;  3FZC A;  1NYM A;  4WEJ A;  4UA6 A;  1ERM A;  1ES2 A;  4QD4 A;  5CGX A;  3EQU A;  4LCM A;  1Q2P A;  2Y2Q A;  2DRW A;  2ZC4 B;  4WZ5 C;  3UN7 A;  4DXC A;  4WYY A;  1BUL A;  1PW8 A;  3IWO A;  2ZM8 A;  1FCM A;  4O7D A;  2CC1 A;  1PI4 A;  1MBL A;  1TDG A;  1TEM A;  2VGJ A;  3CZD A;  4QB8 A;  4KZ8 A;  5EEC A;  5HX9 A;  4BL3 A;  2FFY A;  4JF6 A;  3VP0 A;  2OLV A;  4OQ0 A;  4JXS A;  2XH9 A;  3RJU A;  1HTZ A;  3ZG5 A;  2H0Y A;  1Q2Q A;  3GR2 A;  1L0G A;  4BD0 A;  4X53 A;  4BEN A;  3M2K A;  4F94 A;  1VM1 A;  3M6B A;  3QNB A;  4RA7 A;  3W4Q A;  4MBF A;  4S2N C;  3NBL A;  3P98 A;  5GHX A;  2HDR A;  2XFS A;  5CTM A;  3ZHH A;  1K38 A;  4YFM A;  1ONG A;  3BFE A;  4ZJ1 A;  4R1G A;  2EX9 A;  4C75 A;  4DE3 A;  4GD8 A;  4S2L A;  2WGW A;  2H10 A;  1MKI A;  4WMC A;  3PBS A;  3VSK A;  4S2N A;  1WYB A;  4X6T A;  3W8K A;  1CEF A;  3MKF A;  4OOL A;  1KVL A;  5A92 A;  3C7U A;  3DW0 A;  1TVF A;  2Y2M A;  4ZBE A;  1BUE A;  3WS1 A;  2WUQ A;  4MBK A;  4C3Q A;  1PI5 A;  1XKZ A;  4OPQ A;  3OPP A;  4R0Q A;  3MKE A;  4OLD A;  4PPR A;  2Y91 A;  4KZ9 A;  3IXH A;  3ZG0 A;  4YIN A;  2Y2H A;  3VOY A;  4WBG A;  3VP4 A;  5HW3 A;  3GTC A;  4ZDX A;  4JPM A;  1XP4 A;  4MLL A;  5CED A;  4H8R A;  3N4I A;  3OPL A;  4FSF A;  3HLB A;  4JXV A;  4PM6 A;  4R23 A;  4EQI A;  2P74 A;  3Q82 A;  2XFT A;  3LY4 A;  1XX2 A;  3UPP A;  3BLS A;  1SDE A;  4WMC D;  5DTK A;  4ZAM A;  2PU2 A;  4HEF A;  5HAP A;  1ZG6 A;  4WEK A;  3VP1 A;  2IWD A;  3AGE A;  4JBF A;  2C5W B;  4GB7 A;  4XXR A;  4DRT A;  4OLG A;  4KZ5 A;  4KQR A;  1GHI A;  5EE8 A;  3VSL A;  4BLM A;  4Q8I A;  1YLP A;  1NZO A;  2WZZ A;  3BEC A;  3QNC A;  5FAT A;  3E2L A;  5KMW A;  5EVI C;  2G2W A;  2XK1 A;  3E2K A;  3UDX A;  3VP3 A;  2EFX A;  2Z2M B;  4N1X A;  3PBT A;  5FQJ A;  4E3I A;  3SH8 A;  1JTD A;  4DKI A;  2Y2J A;  1DY6 A;  1PW1 A;  4DF6 A;  2WGV A;  1FOF A;  2EFU A;  4OPZ A;  1Z6F A;  5EVI A;  5FQM A;  1HVB A;  4P0M A;  4GZB A;  2OLU A;  4N9L A;  3BFG A;  1PIO A;  5JYO A;  1YLY A;  3ZDJ A;  4JF4 A;  5GLA A;  3TG9 A;  1E4D A;  4MBH A;  2ZC3 B;  2HP5 A;  3MBZ A;  2HPB A;  1SCW A;  1KGF A;  1IYQ A;  4WZ4 A;  5FI6 A;  3N8R A;  3UE3 A;  3ZNT A;  1ONH A;  2IWC A;  1PWC A;  1ES4 A;  3ITA A;  4BL2 A;  4IVK A;  1XPB A;  4GD6 A;  3MFD A;  1MPL A;  4B4Z A;  5CEB A;  2Y2G A;  1ERQ A;  1SKF A;  1MWT A;  4OPR A;  3TOI A;  2J8Y A;  4EBN A;  1K6R A;  1NXY A;  4KQQ A;  4QU3 A;  3HBR A;  4KQO A;  2XGN A;  3PAG A;  3IH9 A;  4E3O A;  4NK3 A;  4QY5 A;  5FI2 A;  5FQQ A;  4S2O A;  5EVI D;  4E3N A;  3WWX A;  2Y2K A;  4LV0 A;  5D3O A;  1IEM A;  2EX8 A;  2Y2N A;  3UE0 A;  5A90 A;  5FAS A;  1CI9 A;  1H8Z A;  2WZX A;  4OKP A;  5CRF A;  2XF3 A;  5HL1 A;  4JXW A;  2XD1 A;  3IHB A;  1GA0 A;  1GA9 A;  3C4O A;  3IF6 C;  3NI9 A;  1K55 A;  3OPH A;  3IXB A;  3S22 A;  3MZE A;  2WAD A;  1LL9 A;  4IVI A;  3Q07 A;  4OP8 A;  5DF9 A;  4E3J A;  2ZMA A;  1LI9 A;  3WS4 A;  1KE0 A;  3IF6 A;  3ITB A;  4K0W A;  1GCE A;  3O86 A;  3HLE A;  1E3U D;  3C4P A;  1G68 A;  2JC7 A;  3IWI A;  4Y0O A;  1IKI A;  2J9O A;  5FAP A;  1JWZ A;  2UWX A;  1O07 A;  3G2Y A;  4UHU A;  5TR7 A;  5BOH A;  1NY0 A;  5FQK A;  1FCO A;  1ZKJ A;  4E3K A;  1NYY A;  4OQI A;  4QY6 A;  2EXB A;  1JWP A;  3SH7 A;  4KZ3 A;  3BEB A;  4RYE A;  1LL5 A;  1ZG4 A;  2EX6 A;  5E43 A;  2HP6 A;  4OON A;  1I2S A;  4S2P A;  2HDQ A;  3B3X A;  5EPH A;  1L0F A;  3S1Y A;  3VP2 A;  3FKW A;  4S2I A;  4LV1 A;  2QZ6 A;  2ZQC A;  2A3U A;  3G4P A;  1S6R A;  3S4X A;  2H5S A;  5I94 A;  5EVL A;  5FSR A;  3W4P A;  1H5X A;  1MWS A;  3V39 A;  1L0D A;  1I5Q A;  3M6H A;  4GN2 A;  2C6W B;  5IHV A;  1Y54 A;  3OPR A;  5M19 A;  1EWZ A;  3HLD A;  3WRT A;  3G32 A;  2OSU A;  1NJ4 A;  3CG5 A;  4IBR A;  1GHP A;  3C5A A;  3G34 A;  2XD5 A;  4JLF A;  1KVM A;  3LO7 A;  4UAA A;  2P9V B;  1BLP A;  1SDN A;  5CGW A;  4ZTK A;  5GLC A;  1YQS A;  5HAR A;  3CJM A;  5CER A;  1YMS A;  1ES5 A;  1O7E A;  1NRF A;  4OOM A;  1KDS A;  2HDU A;  1RP5 A;  2I72 A;  2FFF B;  5CHJ A;  5CHU A;  3ZFZ A;  2VGK A;  1PZP A;  3N6I A;  3NDG A;  4P87 A;  3OZH A;  4OQH A;  5KSC A;  3A3D A;  2OV5 A;  2ZM2 A;  1YM1 A;  3G35 A;  1BSG A;  3G30 A;  3CMZ A;  2ZD8 A;  2XR0 A;  3ZG9 B;  1ERO A;  3PAE A;  4KZB A;  5DVA A;  3BFF A;  4LEN A;  1VQQ A;  1YLW A;  2WAE A;  3N7W A;  5M1A A;  3SOI A;  1YMX A;  3HLC A;  4DE0 A;  1XA7 A;  1QME A;  1BTL A;  5DF7 A;  4DE2 A;  3I7J A;  3N8L A;  5FQ9 A;  3GSG A;  4BD1 A;  3Q7V B;  4KZ6 A;  5AQ9 A;  4PM9 A;  1FCN A;  3DTM A;  3IXD A;  2Y2I A;  4IED A;  2XEP A;  3UPO A;  2Y2L A;  5AQ7 A;  4E6W A;  4DE1 A;  1CI8 A;  3UPN A;  1K6S A;  4CPK A;  1IYO A;  1W8Q A;  4D2O A;  1KE4 A;  2WGI A;  4BQM A;  5AQA A;  4EUZ A;  1L2S A;  3OC2 A;  3QHY A;  4KZA A;  4B88 A;  4DDS A;  4FH2 A;  1PYY A;  1KGE A;  4R4S A;  4NET A;  3IXG A;  4HBU A;  2WYX A;  2V2F F;  4U0X A;  1LI0 A;  2G2U A;  1PWG A;  5M18 A;  1LHY A;  3V50 A;  3A3J A;  3PBR A;  4LV3 A;  1MWR A;  2PBY A;  1HD8 A;  4R3B A;  5L2F A;  2JCH A;  4HES A;  3DWZ A;  4IBX A;  4EBP A;  4GKU A;  4Y7P A;  3NY4 A;  4RVA A;  1ES3 A;  3MZF A;  4ID4 A;  1MXO A;  1K56 A;  1EI5 A;  3HVF A;  3IT9 A;  4HBT A;  1CK3 A;  3SS3 A;  3V3S A;  1PZO A;  1RGY A;  3FV7 A;  3O88 A;  3Q81 A;  4JKT A;  3UNW A;  1FR6 A;  2V20 A;  4OH0 A;  3AGF A;  3GRJ A;  4EBL A;  1YLZ A;  4XUZ A;  2ZQ7 A;  1K55 C;  2J9P A;  5CTN A;  3N8S A;  2HDS A;  3HLF A;  4X68 A;  3O87 A;  2RL3 A;  1WE4 A;  1CEG A;  4S2M A;  2WKE A;  2EX2 A;  3V5M A;  4KZ4 A;  4GNU A;  1MY8 A;  3W4O A;  5E2E A;  2WGW B;  2Y2O A;  5GLB A;  1ALQ A;  5A91 A;  4CJN A;  1W8Y A;  3HL9 A;  1K57 A;  2ZQA A;  2ZC5 B;  2Y2P A;  3G31 A;  5HAI A;  1OME A;  1FSW A;  4FD8 A;  3M2J A;  2ZQ9 A;  1K56 D;  2J7V A;  1K54 A;  4ZJ2 A;  3UY6 A;  3FWL A;  4LCL A;  1ESI A;  3JYI A;  5FQI A;  1FSY A;  3IWQ A;  4R3J A;  4P6B A;  1G6A A;  3HLW A;  5FA7 A;  2Y59 A;  5F82 A;  4LV2 A;  2X02 A;  3WS5 A;  3V3R A;  3O3V A;  1RCJ A;  2JE5 A;  4MNR A;  4N92 A;  3OCN A;  5HFO A;  2ZC7 A;  5E2G A;  3UDF A;  4DDY A;  4Y0U A;  3AGD A;  3BFC A;  3G2Z A;  3BRM A;  5AQB A;  3VFF A;  1AXB A;  4X56 A;  2ZM0 A;  3SS5 A;  5FAQ A;  3UDI A;  4MEZ A;  1TDL A; 
#chains in the Genus database with same CATH topology
 4HQA A;  1PFL A;  2IWB A;  2Q9M A;  1YLT A;  4DN0 A;  2VV6 A;  1ESU A;  3LY3 A;  2Z6C A;  1K25 A;  4U0T A;  5DTT A;  1SHV A;  3PBO A;  1FQG A;  4ARZ B;  5KZH A;  1BZA A;  2ZC6 B;  2E8I A;  2OOL A;  5E2H A;  3MFX A;  3WRZ A;  3KSH A;  2HP9 A;  2W3D A;  3BLM A;  1BT5 A;  1K4E A;  5EUA A;  3MXQ A;  3E4Q A;  3ZQ5 A;  1JWV A;  2A49 A;  3G6O A;  3BFD A;  1LLB A;  2HJ9 C;  4Y15 A;  2R9X A;  2Y4A A;  1N4O A;  2X71 A;  4X69 A;  3FYZ A;  1BLH A;  1TS0 A;  1QMF A;  2ZOI A;  1OPX A;  2ZLY A;  4PMA A;  4KG2 A;  1K4F A;  2IA2 A;  3H7W B;  3T1S A;  3UO9 A;  1PRQ A;  3DWK A;  4Y0T A;  4CLC A;  3O5Y A;  3Q1F A;  3VOZ A;  5J8X A;  2ZQ8 A;  5JYP A;  4Q0J A;  3RTY A;  1K57 C;  4NEE D;  1YT4 A;  1E3U A;  1E25 A;  3Q7V A;  2ZQD A;  3IS2 B;  1XA1 A;  2WKH A;  3ZG8 B;  4O01 A;  1IYP A;  4K0X A;  4FCF A;  3GQZ A;  3IF5 A;  2WKI A;  3HLG A;  3ZCZ A;  2VLG A;  2EXA A;  2PYP A;  4QJG A;  1BLC A;  5FDH A;  4Z1W A;  3CAX A;  1Y28 A;  4WF0 A;  4UA6 A;  4K08 A;  3EQU A;  4LCM A;  1Q2P A;  1TF1 A;  2DRW A;  4WYY A;  2ZM8 A;  2CC1 A;  1TEM A;  1MBL A;  4BL3 A;  4QB8 A;  4JXS A;  2XH9 A;  1Q2Q A;  4X53 A;  5CX7 A;  3W4Q A;  1LT0 A;  2HDR A;  4WL9 A;  1S4S A;  4YFM A;  4C75 A;  5L8M A;  4Y17 A;  4WMC A;  4S2N A;  1WYB A;  4OOL A;  1KVL A;  2ACG A;  3ULF A;  4ZBE A;  2XRN A;  4LLO B;  3NHQ A;  3D3O A;  4NG2 A;  4KZ9 A;  2K31 A;  3A0S A;  1YKD A;  5HW3 A;  2A24 B;  4MLL A;  4PKY A;  3OPL A;  3HLB A;  4R23 A;  2P74 A;  2XFT A;  1XX2 A;  3BLS A;  1SDE A;  4ZAM A;  2PU2 A;  1ZG6 A;  3BY9 A;  2C5W B;  3JPU A;  4GB7 A;  4OLG A;  3TJZ C;  3NOT C;  3V67 A;  3VSL A;  1NLZ A;  3BEC A;  5EVI C;  2G2W A;  3E2K A;  2Z2M B;  4N1X A;  3DTI A;  3SH8 A;  2Y2J A;  4DF6 A;  2EFU A;  1XJ2 A;  1DP9 A;  5JYO A;  5GLA A;  2ZC3 B;  2HP5 A;  3B33 A;  3ZNT A;  1PWC A;  1T19 A;  4GD6 A;  3MFD A;  5CEB A;  1SKF A;  3CPT B;  4KQO A;  3IH9 A;  4E3O A;  3BQA A;  3WWX A;  2V8C A;  5C5K A;  2Y2N A;  1CI9 A;  3CI6 A;  2XF3 A;  5HL1 A;  2XD1 A;  3IHB A;  2J3T D;  1GA9 A;  1PNE A;  1LSX A;  3NI9 A;  1K55 A;  4EES A;  2QKP A;  3OPH A;  2ZBB A;  3SW1 A;  2UV0 E;  5DF9 A;  4E3J A;  2M7U A;  4ETX A;  3ITB A;  3IF6 A;  4K0W A;  3O86 A;  2JC7 A;  3IWI A;  3BY8 A;  1O07 A;  3G2Y A;  4NXB A;  1ZKJ A;  1NYY A;  4OQI A;  2EXB A;  3SH7 A;  3BEB A;  4RYE A;  2A2L A;  2O9A A;  3MS6 A;  3L7H A;  3C2W A;  1G5U A;  4LV1 A;  3UME A;  3S4X A;  2B18 A;  2H5S A;  2QHK A;  5FSR A;  4BMW A;  1MWS A;  1L0D A;  2C6W B;  2WKQ A;  1OTI A;  1EWZ A;  1K0K A;  2OSU A;  3C5A A;  2XD5 A;  4BBU A;  1KVM A;  5CGW A;  4ZTK A;  1YQS A;  5CER A;  5MC7 A;  2PHY A;  3DTK A;  3ZFZ A;  1F5M A;  2VGK A;  4ME4 A;  3N6I A;  3OZH A;  2OV5 A;  4WLA A;  3MMH A;  4YWZ A;  4CLC B;  5DVA A;  2PR6 A;  3BFF A;  5M1A A;  1YLW A;  3N7W A;  1XA7 A;  1QME A;  1SKO A;  2OAP 1;  3GSG A;  2GZA A;  4IJG A;  3Q7V B;  3QP4 A;  5I5L A;  1FCN A;  3IXD A;  3UPO A;  3UPN A;  4O8G A;  2W1T A;  1W8Q A;  5L07 A;  2M1C A;  3F1P A;  5HPF A;  5AQA A;  4EUZ A;  4KZA A;  2QWS A;  4FH2 A;  1VET B;  3LIF A;  4HJ6 A;  1LHY A;  2BAS A;  3V50 A;  3A3J A;  4LV3 A;  2PBY A;  1HD8 A;  4R3B A;  4O0P A;  2Y79 A;  4Y7P A;  1P0Z A;  3IBR A;  3ICY A;  1KOU A;  3IT9 A;  3O88 A;  4Y5F A;  1FR6 A;  5HWW A;  4OH0 A;  3AGF A;  1YLZ A;  4XUZ A;  1K55 C;  5CTN A;  3HLF A;  5F5Y A;  4IUK A;  2PDR A;  3V5M A;  1CJF A;  1V9Y A;  1MY8 A;  3GEC A;  2Y2O A;  4EW7 A;  5GLB A;  1YAX A;  3FG8 A;  1OTE A;  2ZQA A;  2ZC5 B;  3G31 A;  1F9I A;  1OME A;  4FD8 A;  4BBT A;  1K54 A;  1ESI A;  2Q0O A;  1LL8 A;  3CIT A;  3CUE A;  2HF6 A;  4FOF A;  3T4T A;  1G6A A;  3HLW A;  3UB8 A;  5FA7 A;  1T1A A;  4LV2 A;  3NOP C;  3O3V A;  4G3K A;  1AXB A;  4X56 A;  1TS8 A;  2ZM0 A;  3C38 A;  5FAQ A;  4MEZ A;  4NXE A;  3A3F A;  4EWF A;  3KYE A;  3LYX A;  1J9M A;  3RFB A;  4I5S A;  4C6Y A;  4Y3I A;  1XGI A;  5A93 A;  5IU1 A;  4UA7 A;  4B9O A;  4NXG A;  4WM9 A;  5EOE A;  3D4F A;  4QPR A;  4JF5 A;  3GMW A;  4X55 A;  3EEH A;  5GLD A;  3T4O A;  4OPY A;  5KSH A;  4K91 A;  2DNS A;  1N9L A;  2JBF A;  3MXR A;  3HJI A;  1S0W A;  4LRY C;  3A0V A;  2Y8H A;  3ZNY A;  3NDE A;  2V0U A;  4E3L A;  3HUN A;  3ZVT A;  3MF0 A;  1N9B A;  4HP4 A;  3A0R A;  3OCL A;  3MXS A;  1IKG A;  3TSG A;  1FR1 A;  4OQG A;  1WYC A;  1S67 L;  3PBN A;  4LPZ A;  4FH4 A;  4M3K A;  2L1M A;  3F1O A;  2P9V A;  5LBR A;  1KGG A;  2WAF A;  1OTD A;  3C8C A;  3IF6 B;  2RCX A;  5DJT A;  2VX8 A;  1DRM A;  2ZMF A;  2V1Z A;  2ZJ9 A;  5G4Y A;  3VMA A;  4RX2 A;  5EVE A;  1ZC2 A;  3NC8 A;  1XJ3 A;  2JKR M;  1I2W A;  1OTA A;  3LEQ A;  4KZ7 A;  4M4X A;  3A3I A;  5GHY A;  3LCE A;  3SZT A;  4XUX A;  5DFX A;  3OBF A;  4E3M A;  2WK0 A;  4NKP A;  2VK3 A;  5GL9 A;  3FC7 A;  1K54 C;  2B5R A;  4JXG A;  1Z09 A;  3PTE A;  3CUE C;  4WEL A;  3T1X A;  2X01 A;  1W5D A;  4X25 A;  3RXX A;  3VFH A;  3C7V A;  5U47 A;  1HZO A;  5F83 A;  3QP2 A;  4KG6 A;  3FZC A;  1NYM A;  4WEJ A;  1ERM A;  5CGX A;  2ZC4 B;  4DXC A;  1PW8 A;  1FCM A;  3E4P A;  4O7D A;  1PI4 A;  1TDG A;  4DJ3 A;  2FFY A;  3VP0 A;  2O0Y A;  3LGO A;  1P9R A;  4BEN A;  1LSV A;  3M2K A;  4F94 A;  4UEY A;  1SKO B;  3M6B A;  3H9W A;  4RA7 A;  3NBL A;  3K3C A;  3ZHH A;  1K38 A;  3BFE A;  1Y4O A;  2W1T B;  2WGW A;  1CF0 A;  1MKI A;  3VSK A;  3MKF A;  3C7U A;  5DFY A;  2Y91 A;  3ZG0 A;  3P7N A;  3VOY A;  4WBG A;  1MZU A;  4ZDX A;  1WA9 A;  4JPM A;  1XP4 A;  4JXV A;  3UPP A;  5DTK A;  2P08 A;  4HEF A;  1NRJ A;  1ODV A;  4XXR A;  4DRT A;  4KZ5 A;  1GHI A;  3EOI A;  4JGR A;  4DMZ A;  3QNC A;  2XK1 A;  3UDX A;  1TS7 A;  2EFX A;  1IFQ A;  4LFU A;  3U2A A;  1JTD A;  4I38 A;  1PW1 A;  4HOI A;  4OPZ A;  5FQM A;  5EVI A;  1XFN A;  2J3T C;  4GZB A;  2OLU A;  4N9L A;  5K5B A;  3BFG A;  2WKP A;  1T1C A;  1PIO A;  3MQO A;  1YLY A;  4JF4 A;  4MBH A;  3QP8 A;  3MBZ A;  1KGF A;  1IYQ A;  3N8R A;  3UE3 A;  1ONH A;  3ITA A;  1XPB A;  4X1L A;  4B4Z A;  1MPL A;  2Y2G A;  4EBN A;  1MWT A;  3TE8 A;  4QU3 A;  3HBR A;  3LIB A;  2O9C A;  2PT7 A;  5FI2 A;  4E3N A;  2OWJ A;  2WZX A;  2VGL M;  5DKL A;  1S1Z A;  1L3L A;  5EFW A;  4Y13 A;  3MZE A;  2WAD A;  1LL9 A;  3Q07 A;  1KE0 A;  1W63 Q;  4AFI A;  3ZYT A;  3C4P A;  1G68 A;  5BOH A;  1FCO A;  4E3K A;  3LR4 A;  4QY6 A;  2W3E A;  5E43 A;  3OLO A;  1MKM A;  3UE6 A;  3S1Y A;  3VP2 A;  4KQD A;  4P6Z M;  2QZ6 A;  4HH3 A;  2LB5 A;  4LRZ E;  5TBM B;  3M6H A;  4GN2 A;  5IHV A;  4LRX C;  3OPR A;  4EER A;  3LO7 A;  3F1O B;  4X1M A;  2P9V B;  1BLP A;  1SDN A;  5HAR A;  5GLC A;  1O7E A;  1KDS A;  2HDU A;  1RP5 A;  2K7S A;  2FFF B;  2LB9 A;  1OJG A;  1OTB A;  2KLI A;  2V9A A;  1PZP A;  3NDG A;  4P87 A;  2R78 A;  3A3D A;  3G35 A;  1BSG A;  3G30 A;  1ERO A;  1ZTU A;  3PAE A;  3JVV A;  4GHI A;  1YMX A;  3HLC A;  2ZL1 A;  3CLO A;  5DF7 A;  2JKF A;  3N8L A;  5FQ9 A;  4BD1 A;  3EWK A;  5KIZ A;  5AQ7 A;  4E6W A;  4DE1 A;  3VE3 A;  1KE4 A;  5J7E A;  3OC2 A;  4DDS A;  4R4S A;  4NET A;  2WYX A;  3PR6 A;  4WUJ A;  2G2U A;  1PWG A;  2PD8 A;  3T4Q A;  2D01 A;  5M18 A;  2HJE A;  1VEU A;  4KUK A;  4GKU A;  3NY4 A;  3GDI A;  1ES3 A;  4R70 A;  2V1B A;  1MXO A;  2YKH A;  3MQQ A;  3HCY A;  4HBT A;  1CK3 A;  1PZO A;  3DTE A;  3UNW A;  2ZQ7 A;  2HDS A;  2RL3 A;  1CEG A;  4S2M A;  2EX2 A;  2WGW B;  5A91 A;  4CJN A;  3S7O A;  3BQ8 A;  1S1Y A;  4HI4 A;  2VV7 A;  3M2J A;  2ZQ9 A;  1K56 D;  4R3A A;  2BTF P;  4GCZ A;  3VE4 A;  2Y59 A;  5F82 A;  2X02 A;  3WS5 A;  3V3R A;  1RCJ A;  3OCN A;  5HFO A;  5AQB A;  5L10 A;  2HGV A;  1MWU A;  1NLY A;  4D60 A;  4WZ5 A;  3PYP A;  4GDB A;  2QYB A;  4EU0 A;  3UB9 A;  3HUM A;  3ISG A;  1FIL A;  1W79 A;  3BW6 A;  4I3A A;  2P7J A;  4JGO A;  5CGS A;  5G18 A;  2M7V A;  4BJP A;  3KSI A;  2CMN A;  4GDN A;  5EVI B;  5F1G A;  1IOU A;  3Q7Z A;  4PHT A;  4EET B;  2PRF A;  2BG1 A;  2PU4 A;  3WS2 A;  2Y55 A;  1XGJ A;  4P85 A;  1IEL A;  3A3E A;  3UB6 A;  3F1N A;  4OOY A;  3P09 A;  1XJ4 A;  5CXW A;  5DTS A;  2XSS A;  3WS0 A;  1A0K A;  3BM6 A;  3NCK A;  1DJA A;  5E2F A;  1DJC A;  5TGF A;  4S2K A;  1L0E A;  3B42 A;  1NZU A;  4OP5 A;  2R9W A;  2JKG A;  3IHA A;  1H3Q A;  4R4R A;  1YLJ A;  1XXM A;  3BWL A;  3UE1 A;  4EXO A;  1M40 A;  3T12 B;  1DJB A;  2W27 A;  4F3L A;  4GLQ A;  1JTG A;  3ZGA B;  5HAQ A;  4Y2F A;  2BLS A;  2VEA A;  4DXB A;  3QP1 A;  1HLU P;  2O99 A;  2Z2L B;  1XFQ A;  1P97 A;  5HWV A;  4A5R A;  2XDM A;  1UWP X;  1JVJ A;  2W3F A;  4L0L A;  2H0T A;  2HZ5 A;  2VV8 A;  1GHM A;  5HDC A;  2XQZ A;  4N9K A;  2JKT M;  4OVD A;  3GV9 A;  3EQV A;  5CEC A;  4CLC D;  4PM8 A;  3UB7 A;  5G4Z A;  1ES2 A;  4QD4 A;  4EEU A;  4WZ5 C;  2QJ5 A;  3UN7 A;  4L9G A;  1BUL A;  3IWO A;  5EEC A;  3CZD A;  4KZ8 A;  3H7W A;  3S7N A;  3LI9 A;  3IX8 A;  3B47 A;  4EUV A;  3RJU A;  1HTZ A;  3KO6 A;  1L0G A;  4BD0 A;  2ZL1 B;  1N9O A;  1VM1 A;  5HWT A;  1D1J A;  5GHX A;  2XFS A;  5CTM A;  1ONG A;  4R1G A;  1VB6 A;  3W8K A;  3IS2 A;  4MMN A;  1TVF A;  1BUE A;  3WS1 A;  2GJ3 A;  4MBK A;  1PI5 A;  1XKZ A;  1S66 L;  4OPQ A;  4R0Q A;  1XJ6 A;  4OLD A;  4PPR A;  3IXH A;  2Y2H A;  3VP4 A;  5CED A;  4H8R A;  5HD3 A;  4EQI A;  1ACF A;  3EGD C;  4WMC D;  4ZRR A;  2YKF A;  4WEK A;  1DP8 A;  3FPW A;  3QP6 A;  2IWD A;  4JBF A;  4BLM A;  2EWV A;  1YLP A;  2WZZ A;  5FAT A;  4BWI A;  1S4R A;  3T4L A;  4HH2 A;  3PBT A;  4E3I A;  4DKI A;  1DY6 A;  1FOF A;  1Z6F A;  4L9E A;  1HVB A;  2INW A;  4GS9 A;  3ZDJ A;  3TG9 A;  1JNU A;  1T18 A;  2IWC A;  3LI8 A;  4IVK A;  3R7W A;  1ERQ A;  1OT9 A;  2J8Y A;  2V0W A;  1K6R A;  1NXY A;  3IBJ A;  5FDS A;  3T4J A;  4NK3 A;  5DJU A;  3LID A;  5FQQ A;  3KYQ A;  2VGL S;  2Y2K A;  5D3O A;  2EX8 A;  3UE0 A;  5A90 A;  5FAS A;  4ESP A;  2GNX A;  4OKP A;  5CRF A;  3LIC A;  1NWZ A;  1GA0 A;  2H28 A;  3IXB A;  3S22 A;  4HP9 A;  2VA0 A;  4G3W A;  4IVI A;  1VHM A;  1LI9 A;  3WS4 A;  3KYZ A;  3NUL A;  3HLE A;  4UQI M;  5FAP A;  1JWZ A;  3NJA A;  5TR7 A;  3QP5 A;  1MC0 A;  4EEP A;  1ZHH B;  1JWP A;  1SZV A;  2HP6 A;  4P6Z S;  4S2P A;  2HDQ A;  3F1N B;  2PR5 A;  1L0F A;  3CPT A;  2W0N A;  3F1P B;  2G7U A;  5EVL A;  3W4P A;  5I94 A;  1I5Q A;  3L9K A;  3HLD A;  3WRT A;  3CG5 A;  4R6L A;  4JLF A;  3G34 A;  4R38 A;  3CJM A;  2B95 A;  1YMS A;  4I39 A;  1NRF A;  5CHJ A;  2I72 A;  5F68 A;  3VOL A;  5CHU A;  3EEA A;  4I3J A;  5FL3 A;  2VKS A;  5EM1 A;  3H82 A;  5KSC A;  1GSW A;  2ZM2 A;  1YM1 A;  3DAV A;  2XR0 A;  5HL6 A;  4LEN A;  2WAE A;  3SOI A;  4F3L B;  4DE2 A;  3I7J A;  3LR0 A;  3CHW P;  2NUP C;  5AQ9 A;  3DTM A;  2Y2I A;  4IED A;  2XEP A;  1K6S A;  1IYO A;  3TRC A;  4D2O A;  4HHD A;  2WGI A;  1L2S A;  2PYR A;  1DP6 A;  3IXG A;  2V2F F;  4U0X A;  1LI0 A;  3DBA A;  3PBR A;  3NEC A;  1MWR A;  4L9F A;  5L2F A;  4HES A;  3DWZ A;  4H6J A;  4IBX A;  4EQ1 A;  4EBP A;  1STZ A;  3MZF A;  4ID4 A;  2ZOH A;  4Q0H A;  5J3W A;  4YOF A;  4HJ4 A;  1RGY A;  3FV7 A;  3Q81 A;  2V8F A;  4JKT A;  2V20 A;  2XA7 M;  4X68 A;  2PD7 A;  5EM0 A;  1WE4 A;  5HSQ A;  2WKE A;  2EA9 A;  2PBD P;  5E2E A;  3MQ0 A;  1W8Y A;  1TS6 A;  3HL9 A;  5HAI A;  1G28 A;  2D02 A;  4ZJ2 A;  3UY6 A;  2OWH A;  4LCL A;  3JYI A;  4YNR A;  5FQI A;  1FSY A;  1X0O A;  3S7Q A;  1VET A;  4R3J A;  4P6B A;  1P9W A;  1CQA A;  2JE5 A;  4N92 A;  5E2G A;  4DDY A;  4Y0U A;  3BRM A;  2L4R A;  3UMD A;  3S7P A;  3SS5 A;  5HAP A;  1TDL A;  2QPN A;  4UA9 A;  5EOO A;  1IYS A;  1W7F A;  2VJW A;  3NIA A;  1RGZ A;  5DF8 A;  2MJ6 A;  2HV1 A;  4XT2 A;  2QMI A;  5IT5 A;  4GW9 A;  3RXW A;  2XRO A;  5F6A A;  2Z6D A;  1H0M A;  3U4L P;  4MN5 A;  4Z9Q A;  5HZH A;  3CWF A;  4S2J A;  4PKY G;  5GHZ A;  1M6K A;  3HRE A;  3MR0 A;  4GS9 B;  4PM5 A;  5TFQ A;  1H8Y A;  1U60 A;  3E98 A;  3SH9 A;  4KG5 A;  3LR3 A;  3PBQ A;  1W63 M;  3GVB A;  4FTX A;  2GDN A;  3IQA A;  2KOI A;  3R7W B;  2L0W A;  3LR5 A;  4LGW A;  1BLS A;  3HUO A;  4KEN B;  5FI7 A;  2J3W A;  4JGQ A;  3T1R A;  5FAO A;  2W1R A;  2Q9N A;  1KDW A;  2KX6 A;  3JVU A;  4U3T A;  3C30 A;  3ZVW A;  1C3B A;  4EV4 A;  4QHC A;  4HJ3 A;  3MZD A;  3PXP A;  4QWO A;  4CLC C;  3K3D A;  3IH8 A;  3VV4 A;  2I9V A;  1TD5 A;  5FEF A;  4E6X A;  2JKT I;  5HPI A;  3LEZ A;  3FKV A;  4B4X A;  3ZG7 B;  4ZJ3 A;  1D7E A;  5F1F A;  1UWN X;  2FH5 A;  5CHM A;  4RX3 A;  3BYD A;  4N1H A;  2B02 A;  4PM7 A;  1H8M A;  3SS4 A;  1PWD A;  4GOG A;  2DCF A;  5TJJ A;  2XLN A;  1KE3 A;  1V9Z A;  2Y2Q A;  3H82 B;  4IUH A;  2WKR A;  4G3V A;  2VGJ A;  5HX9 A;  3E4O A;  4JF6 A;  2OLV A;  4OQ0 A;  5HDD A;  3ZG5 A;  2H0Y A;  2V1A A;  3GR2 A;  3FPV A;  1YSP A;  1N9N A;  3QNB A;  4MBF A;  4S2N C;  1LSW A;  3P98 A;  4ZJ1 A;  3TW8 A;  2EX9 A;  4DE3 A;  4GD8 A;  4S2L A;  4CLC E;  2H10 A;  3PBS A;  2PAV P;  1OJ5 A;  4X6T A;  4Q0I A;  3T1Q B;  1CEF A;  5A92 A;  3DW0 A;  2Y2M A;  4II7 A;  2WUQ A;  4C3Q A;  4JGP A;  3OPP A;  3MKE A;  4PAU A;  4IHQ A;  3KSF A;  4YIN A;  4H6J B;  1EW0 A;  3GTC A;  1GSV A;  5AVE A;  3UB5 P;  2DMW A;  4DJ2 A;  3N4I A;  4FSF A;  4PM6 A;  3Q82 A;  3LY4 A;  4HNB A;  3VP1 A;  3KSG A;  1J3W A;  1G6O A;  3AGE A;  2JKR I;  4KQR A;  5EE8 A;  4Q8I A;  1NZO A;  3E2L A;  5KMW A;  4ARZ A;  3VP3 A;  2ZMV A;  5FQJ A;  2WGV A;  1AWI A;  4P0M A;  2W3G A;  4BBV A;  1E4D A;  2HPB A;  1SCW A;  4WZ4 A;  5FI6 A;  4CQH A;  1OT6 A;  1ES4 A;  3K2N A;  4BL2 A;  3D9Y A;  4KUO A;  2J80 A;  4OPR A;  3TOI A;  3IX4 A;  4KQQ A;  2QJ7 A;  2XGN A;  3PAG A;  5DKK A;  3MSH A;  4QY5 A;  4S2O A;  5EVI D;  5A8B A;  4LV0 A;  1IEM A;  2AVX A;  4XT2 B;  1H8Z A;  1GSX A;  4JXW A;  2KDK A;  3C4O A;  3IF6 C;  5IS1 A;  4UQI S;  4OP8 A;  2ZMA A;  4GJ4 A;  1GCE A;  1E3U D;  5HDS A;  2JHE A;  4Y0O A;  1IKI A;  2J9O A;  4HY8 A;  5AVF A;  1D06 A;  2UWX A;  4UHU A;  1NY0 A;  5FQK A;  2W3H A;  4GHI B;  3OOV A;  5J4E A;  4KZ3 A;  1LL5 A;  1ZG4 A;  2EX6 A;  4OON A;  4FUW A;  1I2S A;  3B3X A;  5EPH A;  3FKW A;  4S2I A;  2ZQC A;  2A3U A;  3G4P A;  1S6R A;  1UGU A;  2OAQ 1;  1H5X A;  3V39 A;  3LIA A;  3P01 A;  5EV0 A;  1Y54 A;  5M19 A;  3LUQ A;  3G32 A;  1NJ4 A;  4IBR A;  1GHP A;  1F98 A;  5AJG A;  4UAA A;  4NXF A;  1VEU B;  1ES5 A;  2JN7 A;  4OOM A;  1FIK A;  3IX3 A;  4OQH A;  4I3I A;  1T1B A;  3MJQ A;  3CMZ A;  2ZD8 A;  3ZG9 B;  4RQ9 A;  4KZB A;  1VQQ A;  4WN5 A;  4MCW A;  4DE0 A;  1BTL A;  2FZ0 A;  5HD5 A;  4E04 A;  2P04 A;  4KZ6 A;  4PM9 A;  2Y2L A;  1CI8 A;  4CPK A;  4MN7 A;  4BQM A;  5TBM A;  2E8J A;  3E0Y A;  3QHY A;  4B88 A;  3KX0 X;  1PYY A;  1KGE A;  4HBU A;  1YPR A;  1F2K A;  2JCH A;  3BJN A;  3D72 A;  4MDZ A;  4RVA A;  2A24 A;  1K56 A;  1EI5 A;  2GX5 A;  4B93 A;  3HVF A;  5F69 A;  2XA7 S;  3SS3 A;  3V3S A;  3R4K A;  4ETZ A;  3GRJ A;  4EBL A;  2J9P A;  3N8S A;  4HIA A;  3LFV A;  3O87 A;  4KZ4 A;  2NUT C;  4GNU A;  3W4O A;  3T4K A;  1ALQ A;  4MN6 A;  1K57 A;  1BYW A;  2Y2P A;  1FSW A;  2J7V A;  2VZW A;  3EGX C;  3FWL A;  2EWW A;  3NOU C;  3IWQ A;  3HJK A;  5L09 A;  3LIE A;  3RH8 B;  3PHY A;  1YSQ A;  2K2N A;  4MNR A;  5FEG A;  3W2Z A;  2ZC7 A;  3UDF A;  3AGD A;  3BFC A;  3G2Z A;  3VFF A;  3UDI A;  2O9B A;  3T50 A;  3T4S A; 
#chains in the Genus database with same CATH homology
 1MWU A;  2QPN A;  4UA9 A;  3A3F A;  5EOO A;  1IYS A;  1W7F A;  2IWB A;  2Q9M A;  3NIA A;  4WZ5 A;  4EWF A;  1RGZ A;  1J9M A;  1YLT A;  5DF8 A;  4GDB A;  4C6Y A;  1ESU A;  1XGI A;  3LY3 A;  5A93 A;  2QMI A;  1K25 A;  3RXW A;  3HUM A;  4U0T A;  4UA7 A;  3ISG A;  1SHV A;  5DTT A;  1W79 A;  1FQG A;  3PBO A;  5KZH A;  4WM9 A;  4Z9Q A;  5EOE A;  3D4F A;  4S2J A;  1BZA A;  5CGS A;  5G18 A;  4BJP A;  5GHZ A;  2ZC6 B;  2E8I A;  4JF5 A;  3GMW A;  4X55 A;  4GDN A;  5EVI B;  5E2H A;  5GLD A;  5F1G A;  1M6K A;  3HRE A;  4OPY A;  3WRZ A;  5KSH A;  4K91 A;  2DNS A;  2JBF A;  2HP9 A;  3MXR A;  3Q7Z A;  4PM5 A;  5TFQ A;  1S0W A;  3BLM A;  1H8Y A;  1BT5 A;  1U60 A;  1K4E A;  5EUA A;  2BG1 A;  2PU4 A;  3SH9 A;  3WS2 A;  2Y55 A;  4KG5 A;  3ZNY A;  3PBQ A;  1XGJ A;  3NDE A;  4E3L A;  4P85 A;  1IEL A;  3HUN A;  3GVB A;  3A3E A;  2GDN A;  3IQA A;  3ZVT A;  1N9B A;  1JWV A;  1BLS A;  3HUO A;  4KEN B;  5FI7 A;  3OCL A;  4OOY A;  2A49 A;  3P09 A;  5CXW A;  5DTS A;  3MXS A;  3WS0 A;  3BFD A;  3BM6 A;  1LLB A;  1IKG A;  3NCK A;  5FAO A;  3TSG A;  1FR1 A;  2R9X A;  1DJA A;  4OQG A;  1WYC A;  5E2F A;  2Y4A A;  3PBN A;  1N4O A;  2Q9N A;  1KDW A;  4FH4 A;  1DJC A;  4M3K A;  5TGF A;  2X71 A;  4X69 A;  4S2K A;  1L0E A;  2P9V A;  3FYZ A;  1BLH A;  1KGG A;  2WAF A;  4U3T A;  1QMF A;  1NZU A;  3ZVW A;  4OP5 A;  3IF6 B;  2R9W A;  2RCX A;  3IHA A;  1C3B A;  2ZLY A;  4PMA A;  4KG2 A;  1K4F A;  1YLJ A;  4R4R A;  2V1Z A;  2ZJ9 A;  3VMA A;  4EV4 A;  4QHC A;  3MZD A;  1XXM A;  4RX2 A;  1ZC2 A;  3NC8 A;  1I2W A;  4KZ7 A;  3UO9 A;  3UE1 A;  3IH8 A;  3DWK A;  4Y0T A;  1M40 A;  3A3I A;  3Q1F A;  1DJB A;  5GHY A;  3LCE A;  3VOZ A;  5J8X A;  2ZQ8 A;  4E6X A;  4XUX A;  5CEC A;  1JTG A;  5JYP A;  3ZGA B;  4E3M A;  5HAQ A;  3LEZ A;  1K57 C;  2WK0 A;  3FKV A;  4B4X A;  1YT4 A;  2BLS A;  3ZG7 B;  4DXB A;  4ZJ3 A;  1E3U A;  1E25 A;  3Q7V A;  5GL9 A;  2ZQD A;  1K54 C;  5F1F A;  2Z2L B;  2B5R A;  4JXG A;  5CHM A;  1XA1 A;  4RX3 A;  2WKH A;  2XDM A;  3PTE A;  4A5R A;  3ZG8 B;  1JVJ A;  4L0L A;  1IYP A;  2H0T A;  4K0X A;  4WEL A;  1GHM A;  2X01 A;  1W5D A;  3BYD A;  2XQZ A;  4N9K A;  3RXX A;  4N1H A;  4PM7 A;  4FCF A;  3VFH A;  4OVD A;  3SS4 A;  3GQZ A;  3C7V A;  1PWD A;  5U47 A;  3IF5 A;  2WKI A;  3EQV A;  3GV9 A;  3HLG A;  3ZCZ A;  4PM8 A;  1HZO A;  2EXA A;  4GOG A;  4QJG A;  2DCF A;  1BLC A;  5F83 A;  5FDH A;  4KG6 A;  2XLN A;  1KE3 A;  3FZC A;  1NYM A;  4WEJ A;  4UA6 A;  1ERM A;  1ES2 A;  4QD4 A;  5CGX A;  3EQU A;  4LCM A;  1Q2P A;  2Y2Q A;  2DRW A;  2ZC4 B;  4WZ5 C;  3UN7 A;  4DXC A;  4WYY A;  1BUL A;  1PW8 A;  3IWO A;  2ZM8 A;  1FCM A;  4O7D A;  2CC1 A;  1PI4 A;  1MBL A;  1TDG A;  1TEM A;  2VGJ A;  3CZD A;  4QB8 A;  4KZ8 A;  5EEC A;  5HX9 A;  4BL3 A;  2FFY A;  4JF6 A;  3VP0 A;  2OLV A;  4OQ0 A;  4JXS A;  2XH9 A;  3RJU A;  1HTZ A;  3ZG5 A;  2H0Y A;  1Q2Q A;  3GR2 A;  1L0G A;  4BD0 A;  4X53 A;  4BEN A;  3M2K A;  4F94 A;  1VM1 A;  3M6B A;  3QNB A;  4RA7 A;  3W4Q A;  4MBF A;  4S2N C;  3NBL A;  3P98 A;  5GHX A;  2HDR A;  2XFS A;  5CTM A;  3ZHH A;  1K38 A;  4YFM A;  1ONG A;  3BFE A;  4ZJ1 A;  4R1G A;  2EX9 A;  4C75 A;  4DE3 A;  4GD8 A;  4S2L A;  2WGW A;  2H10 A;  1MKI A;  4WMC A;  3PBS A;  3VSK A;  4S2N A;  1WYB A;  4X6T A;  3W8K A;  1CEF A;  3MKF A;  4OOL A;  1KVL A;  5A92 A;  3C7U A;  3DW0 A;  1TVF A;  2Y2M A;  4ZBE A;  1BUE A;  3WS1 A;  2WUQ A;  4MBK A;  4C3Q A;  1PI5 A;  1XKZ A;  4OPQ A;  3OPP A;  4R0Q A;  3MKE A;  4OLD A;  4PPR A;  2Y91 A;  4KZ9 A;  3IXH A;  3ZG0 A;  4YIN A;  2Y2H A;  3VOY A;  4WBG A;  3VP4 A;  5HW3 A;  3GTC A;  4ZDX A;  4JPM A;  1XP4 A;  4MLL A;  5CED A;  4H8R A;  3N4I A;  3OPL A;  4FSF A;  3HLB A;  4JXV A;  4PM6 A;  4R23 A;  4EQI A;  2P74 A;  3Q82 A;  2XFT A;  3LY4 A;  1XX2 A;  3UPP A;  3BLS A;  1SDE A;  4WMC D;  5DTK A;  4ZAM A;  2PU2 A;  4HEF A;  5HAP A;  1ZG6 A;  4WEK A;  3VP1 A;  2IWD A;  3AGE A;  4JBF A;  2C5W B;  4GB7 A;  4XXR A;  4DRT A;  4OLG A;  4KZ5 A;  4KQR A;  1GHI A;  5EE8 A;  3VSL A;  4BLM A;  4Q8I A;  1YLP A;  1NZO A;  2WZZ A;  3BEC A;  3QNC A;  5FAT A;  3E2L A;  5KMW A;  5EVI C;  2G2W A;  2XK1 A;  3E2K A;  3UDX A;  3VP3 A;  2EFX A;  2Z2M B;  4N1X A;  3PBT A;  5FQJ A;  4E3I A;  3SH8 A;  1JTD A;  4DKI A;  2Y2J A;  1DY6 A;  1PW1 A;  4DF6 A;  2WGV A;  1FOF A;  2EFU A;  4OPZ A;  1Z6F A;  5EVI A;  5FQM A;  1HVB A;  4P0M A;  4GZB A;  2OLU A;  4N9L A;  3BFG A;  1PIO A;  5JYO A;  1YLY A;  3ZDJ A;  4JF4 A;  5GLA A;  3TG9 A;  1E4D A;  4MBH A;  2ZC3 B;  2HP5 A;  3MBZ A;  2HPB A;  1SCW A;  1KGF A;  1IYQ A;  4WZ4 A;  5FI6 A;  3N8R A;  3UE3 A;  3ZNT A;  1ONH A;  2IWC A;  1PWC A;  1ES4 A;  3ITA A;  4BL2 A;  4IVK A;  1XPB A;  4GD6 A;  3MFD A;  1MPL A;  4B4Z A;  5CEB A;  2Y2G A;  1ERQ A;  1SKF A;  1MWT A;  4OPR A;  3TOI A;  2J8Y A;  4EBN A;  1K6R A;  1NXY A;  4KQQ A;  4QU3 A;  3HBR A;  4KQO A;  2XGN A;  3PAG A;  3IH9 A;  4E3O A;  4NK3 A;  4QY5 A;  5FI2 A;  5FQQ A;  4S2O A;  5EVI D;  4E3N A;  3WWX A;  2Y2K A;  4LV0 A;  5D3O A;  1IEM A;  2EX8 A;  2Y2N A;  3UE0 A;  5A90 A;  5FAS A;  1CI9 A;  1H8Z A;  2WZX A;  4OKP A;  5CRF A;  2XF3 A;  5HL1 A;  4JXW A;  2XD1 A;  3IHB A;  1GA0 A;  1GA9 A;  3C4O A;  3IF6 C;  3NI9 A;  1K55 A;  3OPH A;  3IXB A;  3S22 A;  3MZE A;  2WAD A;  1LL9 A;  4IVI A;  3Q07 A;  4OP8 A;  5DF9 A;  4E3J A;  2ZMA A;  1LI9 A;  3WS4 A;  1KE0 A;  3IF6 A;  3ITB A;  4K0W A;  1GCE A;  3O86 A;  3HLE A;  1E3U D;  3C4P A;  1G68 A;  2JC7 A;  3IWI A;  4Y0O A;  1IKI A;  2J9O A;  5FAP A;  1JWZ A;  2UWX A;  1O07 A;  3G2Y A;  4UHU A;  5TR7 A;  5BOH A;  1NY0 A;  5FQK A;  1FCO A;  1ZKJ A;  4E3K A;  1NYY A;  4OQI A;  4QY6 A;  2EXB A;  1JWP A;  3SH7 A;  4KZ3 A;  3BEB A;  4RYE A;  1LL5 A;  1ZG4 A;  2EX6 A;  5E43 A;  2HP6 A;  4OON A;  1I2S A;  4S2P A;  2HDQ A;  3B3X A;  5EPH A;  1L0F A;  3S1Y A;  3VP2 A;  3FKW A;  4S2I A;  4LV1 A;  2QZ6 A;  2ZQC A;  2A3U A;  3G4P A;  1S6R A;  3S4X A;  2H5S A;  5I94 A;  5EVL A;  5FSR A;  3W4P A;  1H5X A;  1MWS A;  3V39 A;  1L0D A;  1I5Q A;  3M6H A;  4GN2 A;  2C6W B;  5IHV A;  1Y54 A;  3OPR A;  5M19 A;  1EWZ A;  3HLD A;  3WRT A;  3G32 A;  2OSU A;  1NJ4 A;  3CG5 A;  4IBR A;  1GHP A;  3C5A A;  3G34 A;  2XD5 A;  4JLF A;  1KVM A;  3LO7 A;  4UAA A;  2P9V B;  1BLP A;  1SDN A;  5CGW A;  4ZTK A;  5GLC A;  1YQS A;  5HAR A;  3CJM A;  5CER A;  1YMS A;  1ES5 A;  1O7E A;  1NRF A;  4OOM A;  1KDS A;  2HDU A;  1RP5 A;  2I72 A;  2FFF B;  5CHJ A;  5CHU A;  3ZFZ A;  2VGK A;  1PZP A;  3N6I A;  3NDG A;  4P87 A;  3OZH A;  4OQH A;  5KSC A;  3A3D A;  2OV5 A;  2ZM2 A;  1YM1 A;  3G35 A;  1BSG A;  3G30 A;  3CMZ A;  2ZD8 A;  2XR0 A;  3ZG9 B;  1ERO A;  3PAE A;  4KZB A;  5DVA A;  3BFF A;  4LEN A;  1VQQ A;  1YLW A;  2WAE A;  3N7W A;  5M1A A;  3SOI A;  1YMX A;  3HLC A;  4DE0 A;  1XA7 A;  1QME A;  1BTL A;  5DF7 A;  4DE2 A;  3I7J A;  3N8L A;  5FQ9 A;  3GSG A;  4BD1 A;  3Q7V B;  4KZ6 A;  5AQ9 A;  4PM9 A;  1FCN A;  3DTM A;  3IXD A;  2Y2I A;  4IED A;  2XEP A;  3UPO A;  2Y2L A;  5AQ7 A;  4E6W A;  4DE1 A;  1CI8 A;  3UPN A;  1K6S A;  4CPK A;  1IYO A;  1W8Q A;  4D2O A;  1KE4 A;  2WGI A;  4BQM A;  5AQA A;  4EUZ A;  1L2S A;  3OC2 A;  3QHY A;  4KZA A;  4B88 A;  4DDS A;  4FH2 A;  1PYY A;  1KGE A;  4R4S A;  4NET A;  3IXG A;  4HBU A;  2WYX A;  2V2F F;  4U0X A;  1LI0 A;  2G2U A;  1PWG A;  5M18 A;  1LHY A;  3V50 A;  3A3J A;  3PBR A;  4LV3 A;  1MWR A;  2PBY A;  1HD8 A;  4R3B A;  5L2F A;  2JCH A;  4HES A;  3DWZ A;  4IBX A;  4EBP A;  4GKU A;  4Y7P A;  3NY4 A;  4RVA A;  1ES3 A;  3MZF A;  4ID4 A;  1MXO A;  1K56 A;  1EI5 A;  3HVF A;  3IT9 A;  4HBT A;  1CK3 A;  3SS3 A;  3V3S A;  1PZO A;  1RGY A;  3FV7 A;  3O88 A;  3Q81 A;  4JKT A;  3UNW A;  1FR6 A;  2V20 A;  4OH0 A;  3AGF A;  3GRJ A;  4EBL A;  1YLZ A;  4XUZ A;  2ZQ7 A;  1K55 C;  2J9P A;  5CTN A;  3N8S A;  2HDS A;  3HLF A;  4X68 A;  3O87 A;  2RL3 A;  1WE4 A;  1CEG A;  4S2M A;  2WKE A;  2EX2 A;  3V5M A;  4KZ4 A;  4GNU A;  1MY8 A;  3W4O A;  5E2E A;  2WGW B;  2Y2O A;  5GLB A;  1ALQ A;  5A91 A;  4CJN A;  1W8Y A;  3HL9 A;  1K57 A;  2ZQA A;  2ZC5 B;  2Y2P A;  3G31 A;  5HAI A;  1OME A;  1FSW A;  4FD8 A;  3M2J A;  2ZQ9 A;  1K56 D;  2J7V A;  1K54 A;  4ZJ2 A;  3UY6 A;  3FWL A;  4LCL A;  1ESI A;  3JYI A;  5FQI A;  1FSY A;  3IWQ A;  4R3J A;  4P6B A;  1G6A A;  3HLW A;  5FA7 A;  2Y59 A;  5F82 A;  4LV2 A;  2X02 A;  3WS5 A;  3V3R A;  3O3V A;  1RCJ A;  2JE5 A;  4MNR A;  4N92 A;  3OCN A;  5HFO A;  2ZC7 A;  5E2G A;  3UDF A;  4DDY A;  4Y0U A;  3AGD A;  3BFC A;  3G2Z A;  3BRM A;  5AQB A;  3VFF A;  1AXB A;  4X56 A;  2ZM0 A;  3SS5 A;  5FAQ A;  3UDI A;  4MEZ A;  1TDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...