3BQ8A

Crystal structure of the e.coli phoq sensor domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
144
structure length
142
Chain Sequence
DKTTFRLLRGESNLFYTLAKWENNKLHVELPENIDKQSPTMTLIYDENGQLLWAQRDVPWLMKMIQPDWLKSNGFHEIEADVNDTSLLLSHSIQQQLQEVREDDDDAEMTHSVAVNVYPATSRMPKLTIVVVDTIPVELKSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, transferase
molecule keywords Sensor protein phoQ
publication title Crystal Structure of a Functional Dimer of the PhoQ Sensor Domain.
pubmed doi rcsb
source organism Escherichia coli
total genus 27
structure length 142
sequence length 144
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.140 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3bq8A00
4UEYA 3BQ8A 3BQAA 1YAXA
chains in the Genus database with same CATH superfamily
3C8CA 5EM0A 5HZHA 5AVFA 3PBTA 1G6OA 3UPPA 4HJ3A 4LENA 1Y28A 4MDZA 5EOOA 3ZVWA 5HDCA 4K0WA 1KGGA 3GRJA 5GHXA 2QKPA 4FSFA 4LRZE 1SDNA 2KX6A 1K55C 4JLFA 3VOZA 2J8YA 3KSHA 1EROA 2FZ0A 4CQHA 3OBFA 4Q0IA 4NETA 1MKMA 4EUZA 2WAEA 2Y91A 3IHAA 3CUEC 4Y17A 4FCFA 2HJ9C 5I94A 5F69A 2ZD8A 4ARZB 3LYXA 2XH9A 4JF6A 3NOUC 5GLBA 1WYBA 2ZM2A 4CLCC 2C6WB 2JKTM 3S22A 1OTEA 1MBLA 3HLDA 3VP4A 1BZAA 3MQQA 2XGNA 1W63M 2HV1A 1XA1A 4GS9A 2EXAA 4NXEA 1BULA 1ES4A 3BEBA 1NRJA 1MY8A 2VGJA 2GZAA 3VMAA 3P01A 4HHDA 4KQQA 3SS5A 2V9AA 3BY9A 3CI6A 5D3OA 3UPOA 1EWZA 2WZZA 2UV0E 1VQQA 2B02A 3O5YA 2P9VB 2I72A 4X1MA 3UB7A 5FSRA 2WGWB 1YLTA 3C30A 1UGUA 4NXGA 3GDIA 5CTNA 1FSYA 2XD5A 1OPXA 5CECA 4S2NA 3LIAA 5JYPA 1PW1A 4BJPA 1X0OA 4BBVA 5TJJA 2EXBA 5J3WA 4WZ4A 4MBHA 2V1BA 1IOUA 2WKRA 1C3BA 4PPRA 4IJGA 1K57A 1L0EA 2QZ6A 2X01A 4R1GA 4NG2A 2W1TA 5F5YA 2ZQ8A 2OOLA 5CERA 4EBLA 1MC0A 3A3DA 1OT9A 3C4OA 4HP9A 3IF5A 2ZQCA 3FPVA 2PD8A 3VOLA 1SDEA 2VGKA 5AQBA 3ZG5A 3VSLA 4FH2A 1D06A 2ZC6B 2ZQAA 3A3FA 3BFFA 2JKRM 2PR6A 3ZG8B 4KZ5A 3QP1A 1S4SA 4I3IA 5GHYA 1FCMA 2WUQA 5MC7A 4OQGA 4XXRA 3S7NA 2IWBA 4P0MA 3OCLA 4GOGA 3KYQA 4E3NA 1K4FA 1YAXA 5KIZA 3DBAA 4PAUA 5IU1A 5KZHA 5FA7A 1E4DA 3C38A 5DVAA 4HBUA 3ZCZA 3OOVA 5EVIA 2VEAA 3SS3A 2G7UA 4LRYC 1XJ4A 4UQIM 1JTGA 5CEDA 1BUEA 2J7VA 3Q81A 4HP4A 1LL8A 5FAOA 5FDHA 4E6WA 1IYQA 3EGDC 1KGFA 4RVAA 2VZWA 3NC8A 2OSUA 3G2ZA 3T4JA 3HLEA 4OPZA 1O7EA 1OTIA 1P0ZA 1RP5A 2O9AA 3CZDA 2QYBA 3AGEA 1GA0A 3TW8A 1S66L 5HD3A 5AJGA 1MKIA 1NYYA 3RJUA 1V9YA 3M2JA 3G35A 1DJCA 4YINA 1TEMA 3P09A 3BFGA 4GDNA 2P9VA 1IEMA 1L0DA 2X02A 4MMNA 2WGWA 4JKTA 3G30A 3IXDA 5IT5A 3FWLA 3LR4A 4B4XA 1J3WA 2JCHA 4QPRA 1W79A 1ZKJA 4LV2A 2P08A 3TOIA 3IXHA 4U0TA 4JGRA 4DF6A 2ZOHA 4C6YA 4K0XA 3QP2A 2XR0A 1PWDA 1S67L 2VK3A 4K91A 2H0TA 3W8KA 3NULA 4YNRA 3MZFA 1XPBA 5BOHA 3F1PB 4O8GA 1H3QA 2B95A 4IVIA 4Q0JA 3HLGA 4BLMA 3C2WA 1ES5A 3N8RA 1BLCA 2PRFA 2PAVP 4KQDA 2O0YA 2Y2NA 2XA7S 2EWWA 4KZ8A 4S2IA 4H8RA 2EX2A 4EBPA 2HDQA 3GR2A 4E3LA 4FD8A 3VSKA 4II7A 2QJ5A 4NXFA 3A0VA 3UB6A 5HW3A 3FV7A 3OPLA 1W5DA 4NXBA 5DTKA 3LEQA 1L0FA 3UDIA 1N9BA 3RXWA 4DKIA 1BYWA 1SKOB 1IELA 5A92A 3CPTB 1NLYA 4RX2A 4DRTA 4HH3A 1G6AA 3RH8B 4R38A 1SKFA 5EVID 4I39A 5CXWA 4B93A 2DRWA 1TS7A 4JXGA 2G2WA 1TDGA 5KSCA 3OZHA 4OPYA 1YQSA 4E3IA 3IHBA 3DTEA 4IBXA 5TGFA 3MXSA 1HLUP 1H8MA 2HPBA 2YKFA 5G4YA 1ESIA 1J9MA 5FQ9A 3LIDA 2Y55A 3A3JA 3PYPA 4M4XA 1CQAA 2VX8A 3S1YA 3S7QA 1YSPA 3HL9A 3BLSA 5IS1A 3MFXA 1GHIA 1PI5A 1V9ZA 1T1BA 2PBDP 1NY0A 1L2SA 3LY4A 3ZGAB 3Q1FA 3HUOA 1YLYA 2V20A 4Y5FA 1XJ3A 2PDRA 4R6LA 5EVEA 2Q9MA 2WAFA 2JE5A 4WL9A 3UB9A 4N9LA 3LICA 2R9WA 4U0XA 5EOEA 3T1QB 2ZC3B 1GSVA 3TRCA 2WKIA 2WK0A 3G6OA 3IH8A 2XROA 3BRMA 5CGWA 3S4XA 2ZLYA 1NZUA 4GS9B 1P9RA 5CEBA 2WKPA 3VP3A 2H5SA 1L3LA 5HFOA 2VV8A 5FQQA 2INWA 4R70A 2QWSA 4RX3A 1W7FA 4DXCA 3EOIA 4ZJ2A 3IWQA 3V5MA 3HLWA 4GD8A 3AGDA 1MPLA 5G18A 2ZJ9A 2OWJA 4OQIA 4WM9A 1S1ZA 1PIOA 3QP4A 3V67A 1IKIA 4X6TA 3BFCA 5J7EA 1NLZA 4GLQA 3UE6A 1N9NA 1N9LA 2X71A 3D72A 4BBUA 2KDKA 4DE0A 2A2LA 3IXBA 4OPQA 3H9WA 2W3GA 1IFQA 4PMAA 1Z6FA 3T4KA 1LSXA 2CC1A 2W1RA 1MWTA 3OLOA 2W1TB 3L9KA 4EWFA 2IWCA 2XF3A 4E3OA 3O88A 1LL5A 4BWIA 1KDSA 4I3JA 3FKVA 2WYXA 3SOIA 3BLMA 1K4EA 4NEED 1K25A 5KMWA 4MLLA 5F1GA 4DN0A 3ZFZA 4ZDXA 4D2OA 4N1HA 1GHMA 4R3AA 3LO7A 2EX6A 4HI4A 4PM6A 4X55A 1D7EA 3FG8A 2P74A 3MSHA 3K2NA 1XGJA 2L0WA 3NY4A 4GB7A 4C3QA 2Q9NA 2PHYA 5FI6A 4I5SA 5F83A 5GL9A 3U4LP 2OAP1 4EBNA 4PM8A 3EEHA 5U47A 3KSFA 3KSIA 4S2LA 1XP4A 3P98A 3HREA 3LR3A 5HPIA 2Y4AA 4QB8A 3S7PA 3UB5P 4EQIA 3F1NB 2Y2LA 3CG5A 3MR0A 5EVIB 2D01A 2L1MA 3HVFA 3MF0A 4IBRA 1DP8A 4X1LA 3TSGA 3EQUA 3ZYTA 3KX0X 4S2OA 3T4SA 3TG9A 4X25A 2Y59A 2ZMAA 3KO6A 4G3KA 3MFDA 1M40A 1P97A 3MJQA 4QJGA 4LGWA 5KSHA 3CJMA 4QU3A 4WLAA 3N4IA 5CHJA 5G4ZA 4GCZA 1OT6A 1ZTUA 3IBRA 4Y0OA 2VA0A 3HBRA 4BBTA 2EFXA 1EW0A 1TVFA 1LLBA 4CLCE 3E2KA 4F3LB 1KGEA 4UHUA 4Y15A 3CWFA 4JXVA 2G2UA 3WS0A 2OWHA 2BG1A 4UQIS 4DMZA 4MBFA 3HUMA 4KUOA 4WMCA 3M2KA 1L0GA 4QHCA 3UB8A 1YLPA 3IX8A 2EFUA 2J3TC 1OJ5A 1CJFA 3G32A 2FFYA 2RL3A 2PD7A 3QP8A 4NK3A 2BASA 3IX4A 5DFXA 5L10A 2ZQDA 1W8YA 2QMIA 2V0WA 5CTMA 1WYCA 5L8MA 4BD1A 1T18A 4BMWA 4HIAA 3U2AA 3DW0A 3IQAA 2P04A 4LPZA 1FCNA 3ISGA 5E2GA 3CHWP 3LIFA 3B3XA 2LB9A 2QPNA 1SZVA 3LY3A 4KZ4A 4GNUA 3FZCA 1ZC2A 4XT2A 3LCEA 4KQRA 1EI5A 4JGOA 2OLVA 1CI8A 4FUWA 4LCLA 2M7UA 3Q7ZA 5A91A 4CLCB 4FOFA 3WRZA 1BLHA 5HL6A 1XFNA 1K54A 3KYEA 3PBOA 5EFWA 3WRTA 3UY6A 4X69A 1RGYA 3OPRA 5K5BA 3I7JA 3B33A 4HH2A 1G28A 2CMNA 2V1AA 3MMHA 5FAQA 1OTAA 3M6BA 3BJNA 2VJWA 4L9EA 5EECA 4RA7A 3F1NA 2Z2MB 1SHVA 4OQ0A 3H82A 2XRNA 4OOMA 5A8BA 3NOTC 1YLJA 1CI9A 4FH4A 1AWIA 1K6SA 4EU0A 1ALQA 1ONHA 2HGVA 3R4KA 2V1ZA 3DWZA 2HDSA 1RGZA 5HAQA 1FR6A 4HESA 5A90A 4B9OA 2M1CA 3ULFA 4JXSA 1W63Q 4OONA 5A93A 1MWRA 1PI4A 4OPRA 2MJ6A 4HY8A 4QY6A 1YM1A 2EWVA 1FOFA 4MCWA 3LIEA 3FC7A 1FSWA 2BLSA 2NUPC 3W2ZA 1VB6A 4MN5A 4B88A 1ONGA 1OTBA 3UMEA 3HLBA 1F9IA 3IF6C 4KZAA 1JWVA 2Y2OA 3UMDA 3CITA 3IWOA 2EX8A 3WS5A 4H6JA 4WMCD 3W4OA 4F3LA 4R23A 3IXGA 3MQOA 2A24A 2ZQ9A 1PYYA 4P6ZM 4EEPA 1BTLA 5FQKA 1CF0A 1I2WA 4JF5A 5M19A 3PR6A 4WZ5C 1DJAA 4MBKA 1OTDA 1K56A 5J4EA 3W4QA 4ZJ1A 4WF0A 4EEUA 3VP2A 2Z6CA 4ETXA 1ACFA 1K55A 2VGLM 4P87A 3B47A 4F94A 4AFIA 3UE3A 1IYOA 3VV4A 5C5KA 1XKZA 3HLCA 5E43A 2GX5A 2JBFA 3CUEA 3EEAA 4RYEA 3IBJA 2H28A 1VEUA 4KG6A 5DJUA 4DJ2A 3NI9A 3IX3A 4Y0UA 2VV6A 5TBMA 3O86A 3OC2A 5HX9A 2A3UA 1BLPA 4CLCA 4N9KA 4OVDA 4KZ7A 4QWOA 4HQAA 5CHUA 2DCFA 3LR5A 3D4FA 2WZXA 2ACGA 1H8ZA 4KQOA 3MS6A 3H7WA 3QP5A 4L0LA 4OP8A 5CX7A 4UA7A 1MWSA 5HDSA 3BYDA 3SS4A 3PBQA 4HJ6A 3VFFA 5EM1A 1ODVA 4L9FA 3UO9A 2W3HA 1YLZA 4IVKA 5HL1A 5DF7A 2Y2PA 3UDFA 4YOFA 1HD8A 3UE0A 2XK1A 3NDGA 4S2KA 4S2NC 2Y2KA 1KDWA 5E2HA 5AQ7A 3PAGA 2IA2A 3QNCA 5L07A 4OKPA 5AVEA 3RXXA 4E6XA 4LV0A 4B4ZA 1Q2QA 1K6RA 5FEGA 1ERMA 5EVLA 2V2FF 2M7VA 1K57C 3MZEA 4LRXC 4HNBA 1G68A 1PW8A 4MNRA 2W27A 1I5QA 5FL3A 1T19A 5M1AA 1GCEA 3L7HA 3FKWA 4LV3A 4ID4A 4KG2A 4BL2A 1GHPA 4DE2A 3E4OA 1PZPA 3V3RA 2PBYA 4XUZA 4U3TA 5CRFA 1K56D 1LI0A 3ZDJA 5HWWA 4BL3A 2XFTA 2A49A 1OMEA 1VETB 1XGIA 4WN5A 4HEFA 2XLNA 4ESPA 3A3IA 1NYMA 1I2SA 3KYZA 5F1FA 1KOUA 3S7OA 2WGIA 4KENB 1FIKA 4X53A 2J9OA 2OAQ1 4LFUA 3V3SA 3MKFA 1HTZA 3AGFA 4P6BA 2WKQA 3WS4A 4EETB 2WGVA 1SCWA 3HJIA 4HBTA 5FI2A 3A0SA 1Z09A 1W8QA 4GJ4A 5FQIA 1LHYA 5E2EA 4N1XA 5EVIC 4UA6A 2ZOIA 3MKEA 4DDYA 2C5WB 1ES2A 4X68A 4CLCD 1HZOA 1T1AA 1TS8A 2PT7A 1YLWA 1BT5A 1QMEA 4IUKA 3LGOA 3BECA 1DY6A 2WKEA 3IT9A 4KZ6A 1H8YA 1TS6A 4JBFA 1PFLA 3V39A 3VFHA 2HP6A 2LB5A 4E3MA 4BENA 1H0MA 4KZ3A 4WEJA 4Y2FA 2HP9A 1XJ6A 3WS1A 5CGSA 1Y54A 1KE3A 2R78A 3SZTA 3KSGA 3E0YA 5FI7A 1YKDA 5FQMA 1S4RA 2ZBBA 1P9WA 1ZG4A 3G2YA 3HLFA 1GSWA 4DJ3A 3N6IA 4P85A 4GHIB 2ZL1B 3SH8A 4XT2B 5HD5A 1UWNX 3VE3A 5FATA 3LEZA 3SH9A 1FR1A 3BWLA 4M3KA 3K3CA 5HAIA 3ZG0A 2PU2A 4PKYA 2PU4A 4PKYG 4WZ5A 1BLSA 2W0NA 4QD4A 1NRFA 5TFQA 2KOIA 4LLOB 3BQ8A 3H82B 1PWCA 5DTTA 3D3OA 2E8IA 3DAVA 1G5UA 3DTMA 3E98A 3A3EA 4BQMA 3C4PA 3Q07A 4GKUA 4DE1A 2H0YA 3VOYA 3OPPA 4LV1A 2JKGA 3ZNTA 3UE1A 5HPFA 4L9GA 4O0PA 2J80A 1VETA 3LI8A 4EV4A 4ZTKA 1CK3A 4PHTA 1KE0A 2XD1A 4EUVA 3LI9A 3LIBA 1TD5A 3HCYA 1LL9A 3R7WA 1NWZA 5DJTA 1N9OA 3LR0A 2JKFA 2B18A 3GV9A 1IKGA 3C5AA 5EV0A 3GSGA 4H6JB 1GSXA 5HWTA 3PXPA 4K08A 1NZOA 5DF8A 3ZG7B 2AVXA 3T1SA 1TS0A 3G31A 4JGPA 1AXBA 3PBSA 1XX2A 1PZOA 4KUKA 2A24B 1U60A 1YMXA 4ETZA 4FTXA 4E04A 2HF6A 3EGXC 4KZBA 5HDDA 4OOYA 1DRMA 4N92A 3P7NA 5EUAA 2VLGA 2Y8HA 1WA9A 4WELA 5AQAA 4OOLA 5GLAA 2V8CA 5F6AA 4GD6A 2VKSA 2PYRA 2W3DA 1ESUA 5LBRA 2DNSA 1GA9A 1WE4A 1N4OA 3E4PA 2GJ3A 4JPMA 1FQGA 3MZDA 3W4PA 2P7JA 3BFDA 2Z2LB 4XUXA 4ZAMA 4E3JA 3T4TA 4IUHA 2D02A 2XFSA 3ICYA 3ZG9B 4Z9QA 2W3FA 3JYIA 3HUNA 3BFEA 1VEUB 1S6RA 1DP9A 1YSQA 1JWZA 4HJ4A 4IEDA 1JTDA 4GHIA 1XXMA 2ZL1A 4A5RA 5GHZA 5TBMB 2IWDA 3GQZA 5HARA 4PM9A 2ZM8A 3IS2A 1FILA 1JVJA 2GDNA 4P6ZS 5GLCA 3TJZC 3DTKA 5L2FA 4WBGA 1KE4A 3N8SA 3VP0A 3H7WB 2O9BA 3NOPC 1HVBA 5EE8A 2HDRA 1DJBA 4S2PA 1VM1A 4Z1WA 3IH9A 5M18A 4R4RA 4CJNA 4UEYA 3NDEA 3WS2A 2Y2HA 3T1RA 1PRQA 2HZ5A 3BY8A 2NUTC 3F1OB 1JNUA 3SW1A 2VGLS 2J9PA 4CPKA 1LI9A 1K38A 2JN7A 3T4OA 4WEKA 4ARZA 3QP6A 2QJ7A 3TE8A 3FPWA 5DKKA 4DDSA 3QHYA 3T12B 4EW7A 1TF1A 4R4SA 3GMWA 4KG5A 4ME4A 1ERQA 3EWKA 3MQ0A 2Y2QA 4WYYA 3E4QA 2I9VA 3K3DA 2JKTI 5F82A 4PM5A 1M6KA 4EESA 3Q7VB 3MBZA 3WWXA 4JF4A 4IHQA 1H5XA 3QNBA 1KVMA 1ES3A 2JHEA 2V0UA 3GECA 3Q82A 4EXOA 3ZQ5A 1LT0A 2EA9A 2O9CA 4DXBA 3A0RA 4YWZA 1VHMA 4ZJ3A 2BTFP 3C7UA 2XEPA 2ZMFA 3JVVA 2H10A 5IHVA 4X56A 3MXRA 2Q0OA 3DWKA 3OCNA 2ZC4B 3DTIA 2Y2GA 2Y2JA 3ZHHA 2R9XA 3C7VA 1PNEA 2VV7A 5DTSA 4UAAA 5L09A 3EQVA 3NIAA 5HWVA 1E3UA 2HP5A 2W3EA 3T50A 4DE3A 2J3WA 3VP1A 3PBNA 4Q0HA 4PM7A 2Y2MA 5I5LA 2HDUA 5TR7A 2Z6DA 5EPHA 3T1XA 2PYPA 3E2LA 3ZNYA 1DP6A 3LFVA 4EQ1A 1F5MA 2K2NA 1IYSA 3ZVTA 3NJAA 2HJEA 2V8FA 4O7DA 2E8JA 3NBLA 1CEFA 1O07A 5FQJA 3PTEA 2B5RA 2FH5A 1F98A 3T4QA 1OJGA 2JKRI 2ZM0A 4G3WA 1XA7A 1NXYA 1F2KA 2K31A 2ZC7A 2XSSA 1RCJA 3PBRA 3D9YA 4JXWA 3F1OA 3IF6B 2ZQ7A 3UNWA 4E3KA 4I38A 2JC7A 3OPHA 2XQZA 4D60A 3O87A 4NKPA 4OQHA 4S2JA 2UWXA 2WADA 4MN7A 2RCXA 3PAEA 3PHYA 4Y13A 1LSWA 4ZRRA 3CLOA 2XDMA 3MXQA 4LCMA 2PR5A 4RQ9A 2O99A 3NCKA 5HAPA 1QMFA 1CEGA 3GTCA 3UDXA 3CAXA 3JVUA 5DFYA 3Q7VA 2K7SA 4C75A 2FFFB 1S1YA 3N7WA 4MEZA 5FASA 1FCOA 4ZBEA 4GZBA 5GLDA 1UWPX 2XA7M 2Y2IA 5FAPA 5J8XA 4JGQA 3BM6A 3CMZA 3HJKA 1E25A 2EX9A 3LUQA 1MXOA 5HSQA 4OLDA 4I3AA 5F68A 4KZ9A 2L4RA 2OLUA 4R0QA 1BSGA 3G4PA 3N8LA 3UPNA 3NECA 4UA9A 3IWIA 1E3UD 2KLIA 4QY5A 2DMWA 1MZUA 1KVLA 3O3VA 5DKLA 5FDSA 3BQAA 1IYPA 3JPUA 1K54C 3R7WB 1JWPA 3SH7A 3ITBA 5FEFA 4R3BA 3VE4A 3F1PA 1ZHHB 1PWGA 3RTYA 1MWUA 5E2FA 2GNXA 4HOIA 5CGXA 3UN7A 3M6HA 5JYOA 3RFBA 3ITAA 3GVBA 4GN2A 5AQ9A 4Q8IA 4GDBA 3T4LA 3BW6A 1XJ2A 3FYZA 2ZC5B 4GW9A 4R3JA 1ZG6A 4OP5A 1TDLA 4WUJA 4BD0A 2QHKA 4Y3IA 4OH0A 2WKHA 1SKOA 4O01A 1S0WA 4S2MA 1A0KA 3CPTA 4Y0TA 1YMSA 3V50A 1Y4OA 1K0KA 1NJ4A 2OV5A 3IF6A 1STZA 1YT4A 1XFQA 4EERA 4G3VA 5DF9A 4YFMA 2YKHA 1D1JA 2Y79A 5CHMA 4MN6A 2ZMVA 3G34A 1T1CA 3B42A 1Q2PA 1YPRA 4OLGA 3NHQA 4Y7PA 1LSVA 2J3TD 3IS2B
chains in the Genus database with same CATH topology
3C8CA 2P7JA 5HZHA 5AVFA 3PBTA 1G6OA 3T4TA 4IUHA 2D02A 4HJ3A 1Y28A 3ICYA 3PR6A 2W3FA 4MDZA 4Y5FA 1XJ3A 2PDRA 5HDCA 1OTDA 4R6LA 5J4EA 1DP9A 1YSQA 4HJ4A 4WL9A 2QKPA 3UB9A 4GHIA 3LICA 4WF0A 5TBMB 4FSFA 4EEUA 4LRZE 2KX6A 2Z6CA 4ETXA 1GSVA 3KSHA 2VGLM 2FZ0A 4CQHA 3IS2A 3OBFA 4Q0IA 3B47A 3TRCA 4AFIA 4P6ZS 3UE3A 1MKMA 3VV4A 3CUEC 3G6OA 5C5KA 2GX5A 2HJ9C 3TJZC 3CUEA 3EEAA 5F69A 2XROA 3IBJA 2H28A 5DJUA 4DJ2A 3H7WB 2O9BA 4ARZB 3LYXA 3NOPC 4GS9B 1P9RA 3NOUC 2WKPA 2VV6A 2VV8A 4Z1WA 5TBMA 2INWA 3OC2A 4UEYA 4R70A 2QWSA 4CLCC 3EOIA 3BY8A 2NUTC 4CLCA 3F1OB 1JNUA 2JKTM 3SW1A 2VGLS 1OTEA 4HQAA 3MQQA 1W63M 3LR5A 2HV1A 2JN7A 3T4OA 4WEKA 4KQOA 3H7WA 4ARZA 2OWJA 4L0LA 4GS9A 4NXEA 5CX7A 2QJ7A 3TE8A 1S1ZA 1NRJA 3V67A 5J7EA 5HDSA 3FPWA 5DKKA 2GZAA 3P01A 1NLZA 4EW7A 3PBQA 4GLQA 4HHDA 1TF1A 2V9AA 3BY9A 3UE6A 4ME4A 3CI6A 3EWKA 1N9NA 3MQ0A 4HJ6A 1N9LA 3E4QA 1ODVA 4L9FA 3D72A 4BBUA 2I9VA 2KDKA 2W3HA 2A2LA 3K3DA 2JKTI 2B02A 3O5YA 3UB7A 3H9WA 4EESA 2W3GA 4IHQA 4YOFA 1IFQA 3T4KA 1LSXA 3C30A 1UGUA 2JHEA 4NXGA 3GDIA 2V0UA 3GECA 4EXOA 2W1RA 1OPXA 3LIAA 3ZQ5A 3OLOA 2IA2A 1LT0A 2W1TB 5AVEA 2EA9A 4BJPA 1X0OA 2O9CA 4BWIA 4I3JA 4BBVA 3A0RA 4YWZA 1VHMA 5TJJA 5J3WA 4NEED 2ZMFA 3JVVA 2V1BA 4DN0A 1IOUA 2WKRA 3OCNA 4R3AA 2M7VA 4HI4A 4IJGA 4LRXC 4HNBA 1D7EA 3FG8A 2W27A 5FL3A 2VV7A 1T19A 3K2NA 2W1TA 5F5YA 3EQVA 2L0WA 2OOLA 1MC0A 1OT9A 4HP9A 2PHYA 3E4OA 4I5SA 5HWVA 3FPVA 2OAP1 2W3EA 2PD8A 3VOLA 3T50A 3EEHA 3KSFA 2J3WA 3KSIA 3PBNA 4Q0HA 5HWWA 5I5LA 3LR3A 5HPIA 1D06A 3S7PA 2Z6DA 4WN5A 2JKRM 3F1NB 2PYPA 3MR0A 2PR6A 3KYZA 1DP6A 2D01A 2L1MA 3MF0A 1KOUA 1DP8A 3LFVA 3S7OA 4EQ1A 1F5MA 1S4SA 2K2NA 3EQUA 3ZYTA 4I3IA 3KX0X 2OAQ1 3T4SA 5MC7A 2WKQA 3KO6A 4G3KA 4EETB 3NJAA 2HJEA 3S7NA 3HJIA 3OCLA 3KYQA 1YAXA 3A0SA 5KIZA 3DBAA 1P97A 3MJQA 4GJ4A 4PAUA 5IU1A 5KSHA 3C38A 4WLAA 2ZOIA 3OOVA 2FH5A 1F98A 3T4QA 1OJGA 2JKRI 2VEAA 2G7UA 4CLCD 4LRYC 4G3WA 1XJ4A 4UQIM 1T1AA 1TS8A 5G4ZA 4GCZA 1OT6A 1ZTUA 2PT7A 3IBRA 2VA0A 2K31A 4HP4A 4IUKA 1LL8A 2XSSA 4BBTA 1EW0A 3PBRA 1TS6A 3F1OA 4I38A 3EGDC 2LB5A 4NKPA 2VZWA 4CLCE 3T4JA 4F3LB 4WEJA 4Y2FA 3CWFA 1XJ6A 4MN7A 1OTIA 1P0ZA 2O9AA 2OWHA 3PHYA 2QYBA 2R78A 1LSWA 4ZRRA 3TW8A 3KSGA 3E0YA 4UQIS 3CLOA 4DMZA 1S66L 3MXQA 4KUOA 5HD3A 5AJGA 2PR5A 4RQ9A 1YKDA 2O99A 1V9YA 3UB8A 2J3TC 1S4RA 1OJ5A 2ZBBA 3CAXA 4MMNA 3JVUA 5DFYA 1P9WA 2K7SA 2PD7A 2BASA 5DFXA 1GSWA 4DJ3A 1S1YA 5IT5A 2V0WA 4GHIB 4XT2B 5HD5A 1UWNX 1UWPX 2XA7M 3LR4A 3VE3A 5L8MA 4JGQA 1T18A 4BMWA 4HIAA 4QPRA 3HJKA 3BWLA 3U2AA 3K3CA 3LUQA 5HSQA 2P08A 2P04A 4LPZA 4JGRA 2ZOHA 4I3AA 4PKYA 1S67L 3LIFA 2LB9A 5F68A 4YNRA 4PKYG 2L4RA 3F1PB 4O8GA 1H3QA 2W0NA 4Q0JA 3C2WA 2KLIA 2KOIA 4LLOB 4XT2A 2DMWA 1MZUA 5DKLA 4JGOA 3BQ8A 4KQDA 3H82B 2O0YA 2XA7S 3BQAA 2EWWA 2M7UA 3D3OA 4CLCB 4FOFA 5HL6A 3E98A 1XFNA 3R7WB 4II7A 3PBOA 2QJ5A 5EFWA 5K5BA 4NXFA 3A0VA 3B33A 4HH2A 1G28A 2CMNA 2V1AA 3MMHA 3UB6A 3VE4A 1OTAA 3F1PA 1ZHHB 5HPFA 3BJNA 2VJWA 4L9GA 3RTYA 4O0PA 2J80A 3LI8A 4NXBA 4L9EA 3F1NA 2GNXA 4PHTA 4HOIA 3H82A 2XRNA 4OOMA 5A8BA 3NOTC 1BYWA 4EUVA 3LI9A 3LIBA 3RFBA 1TD5A 3HCYA 1NLYA 3R7WA 1NWZA 5DJTA 1N9OA 3LR0A 4HH3A 4EU0A 3RH8B 2B18A 4R38A 2HGVA 3BW6A 3R4KA 3T4LA 4I39A 1XJ2A 4B93A 1TS7A 4H6JB 1GSXA 5HWTA 3PXPA 4K08A 1TS0A 4GW9A 4B9OA 2M1CA 4JGPA 3ULFA 1W63Q 3PBSA 4WUJA 2QHKA 4Y3IA 4KUKA 2A24B 2MJ6A 4HY8A 4ETZA 2EWVA 4E04A 2HF6A 3EGXC 4MCWA 4O01A 5HDDA 1H8MA 3LIEA 3FC7A 1DRMA 2NUPC 3P7NA 3W2ZA 1VB6A 2YKFA 4MN5A 5G4YA 1OTBA 3UMEA 2VLGA 1F9IA 3LIDA 2Y8HA 1WA9A 4WELA 4OOLA 3UMDA 1STZA 3PYPA 1XFQA 3CITA 5F6AA 4EERA 4G3VA 4M4XA 5DF9A 2VKSA 2YKHA 4H6JA 2PYRA 2VX8A 2Y79A 3S7QA 2W3DA 1YSPA 4MN6A 5LBRA 4F3LA 2ZMVA 1T1CA 3B42A 3E4PA 3MFXA 5IS1A 3MQOA 2GJ3A 3NHQA 1V9ZA 2A24A 1LSVA 1T1BA 2J3TD 4P6ZM 3IS2B 4EEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UEY A;  3BQ8 A;  3BQA A;  1YAX A; 
#chains in the Genus database with same CATH topology
 3C8C A;  5EM0 A;  5HZH A;  5AVF A;  3PBT A;  1G6O A;  3UPP A;  4HJ3 A;  4LEN A;  1Y28 A;  4MDZ A;  5EOO A;  3ZVW A;  5HDC A;  4K0W A;  1KGG A;  3GRJ A;  5GHX A;  2QKP A;  4FSF A;  4LRZ E;  1SDN A;  2KX6 A;  1K55 C;  4JLF A;  3VOZ A;  2J8Y A;  3KSH A;  1ERO A;  2FZ0 A;  4CQH A;  3OBF A;  4Q0I A;  4NET A;  1MKM A;  4EUZ A;  2WAE A;  2Y91 A;  3IHA A;  3CUE C;  4Y17 A;  4FCF A;  2HJ9 C;  5I94 A;  5F69 A;  2ZD8 A;  4ARZ B;  3LYX A;  2XH9 A;  4JF6 A;  3NOU C;  5GLB A;  1WYB A;  2ZM2 A;  4CLC C;  2C6W B;  2JKT M;  3S22 A;  1OTE A;  1MBL A;  3HLD A;  3VP4 A;  1BZA A;  3MQQ A;  2XGN A;  1W63 M;  2HV1 A;  1XA1 A;  4GS9 A;  2EXA A;  4NXE A;  1BUL A;  1ES4 A;  3BEB A;  1NRJ A;  1MY8 A;  2VGJ A;  2GZA A;  3VMA A;  3P01 A;  4HHD A;  4KQQ A;  3SS5 A;  2V9A A;  3BY9 A;  3CI6 A;  5D3O A;  3UPO A;  1EWZ A;  2WZZ A;  2UV0 E;  1VQQ A;  2B02 A;  3O5Y A;  2P9V B;  2I72 A;  4X1M A;  3UB7 A;  5FSR A;  2WGW B;  1YLT A;  3C30 A;  1UGU A;  4NXG A;  3GDI A;  5CTN A;  1FSY A;  2XD5 A;  1OPX A;  5CEC A;  4S2N A;  3LIA A;  5JYP A;  1PW1 A;  4BJP A;  1X0O A;  4BBV A;  5TJJ A;  2EXB A;  5J3W A;  4WZ4 A;  4MBH A;  2V1B A;  1IOU A;  2WKR A;  1C3B A;  4PPR A;  4IJG A;  1K57 A;  1L0E A;  2QZ6 A;  2X01 A;  4R1G A;  4NG2 A;  2W1T A;  5F5Y A;  2ZQ8 A;  2OOL A;  5CER A;  4EBL A;  1MC0 A;  3A3D A;  1OT9 A;  3C4O A;  4HP9 A;  3IF5 A;  2ZQC A;  3FPV A;  2PD8 A;  3VOL A;  1SDE A;  2VGK A;  5AQB A;  3ZG5 A;  3VSL A;  4FH2 A;  1D06 A;  2ZC6 B;  2ZQA A;  3A3F A;  3BFF A;  2JKR M;  2PR6 A;  3ZG8 B;  4KZ5 A;  3QP1 A;  1S4S A;  4I3I A;  5GHY A;  1FCM A;  2WUQ A;  5MC7 A;  4OQG A;  4XXR A;  3S7N A;  2IWB A;  4P0M A;  3OCL A;  4GOG A;  3KYQ A;  4E3N A;  1K4F A;  1YAX A;  5KIZ A;  3DBA A;  4PAU A;  5IU1 A;  5KZH A;  5FA7 A;  1E4D A;  3C38 A;  5DVA A;  4HBU A;  3ZCZ A;  3OOV A;  5EVI A;  2VEA A;  3SS3 A;  2G7U A;  4LRY C;  1XJ4 A;  4UQI M;  1JTG A;  5CED A;  1BUE A;  2J7V A;  3Q81 A;  4HP4 A;  1LL8 A;  5FAO A;  5FDH A;  4E6W A;  1IYQ A;  3EGD C;  1KGF A;  4RVA A;  2VZW A;  3NC8 A;  2OSU A;  3G2Z A;  3T4J A;  3HLE A;  4OPZ A;  1O7E A;  1OTI A;  1P0Z A;  1RP5 A;  2O9A A;  3CZD A;  2QYB A;  3AGE A;  1GA0 A;  3TW8 A;  1S66 L;  5HD3 A;  5AJG A;  1MKI A;  1NYY A;  3RJU A;  1V9Y A;  3M2J A;  3G35 A;  1DJC A;  4YIN A;  1TEM A;  3P09 A;  3BFG A;  4GDN A;  2P9V A;  1IEM A;  1L0D A;  2X02 A;  4MMN A;  2WGW A;  4JKT A;  3G30 A;  3IXD A;  5IT5 A;  3FWL A;  3LR4 A;  4B4X A;  1J3W A;  2JCH A;  4QPR A;  1W79 A;  1ZKJ A;  4LV2 A;  2P08 A;  3TOI A;  3IXH A;  4U0T A;  4JGR A;  4DF6 A;  2ZOH A;  4C6Y A;  4K0X A;  3QP2 A;  2XR0 A;  1PWD A;  1S67 L;  2VK3 A;  4K91 A;  2H0T A;  3W8K A;  3NUL A;  4YNR A;  3MZF A;  1XPB A;  5BOH A;  3F1P B;  4O8G A;  1H3Q A;  2B95 A;  4IVI A;  4Q0J A;  3HLG A;  4BLM A;  3C2W A;  1ES5 A;  3N8R A;  1BLC A;  2PRF A;  2PAV P;  4KQD A;  2O0Y A;  2Y2N A;  2XA7 S;  2EWW A;  4KZ8 A;  4S2I A;  4H8R A;  2EX2 A;  4EBP A;  2HDQ A;  3GR2 A;  4E3L A;  4FD8 A;  3VSK A;  4II7 A;  2QJ5 A;  4NXF A;  3A0V A;  3UB6 A;  5HW3 A;  3FV7 A;  3OPL A;  1W5D A;  4NXB A;  5DTK A;  3LEQ A;  1L0F A;  3UDI A;  1N9B A;  3RXW A;  4DKI A;  1BYW A;  1SKO B;  1IEL A;  5A92 A;  3CPT B;  1NLY A;  4RX2 A;  4DRT A;  4HH3 A;  1G6A A;  3RH8 B;  4R38 A;  1SKF A;  5EVI D;  4I39 A;  5CXW A;  4B93 A;  2DRW A;  1TS7 A;  4JXG A;  2G2W A;  1TDG A;  5KSC A;  3OZH A;  4OPY A;  1YQS A;  4E3I A;  3IHB A;  3DTE A;  4IBX A;  5TGF A;  3MXS A;  1HLU P;  1H8M A;  2HPB A;  2YKF A;  5G4Y A;  1ESI A;  1J9M A;  5FQ9 A;  3LID A;  2Y55 A;  3A3J A;  3PYP A;  4M4X A;  1CQA A;  2VX8 A;  3S1Y A;  3S7Q A;  1YSP A;  3HL9 A;  3BLS A;  5IS1 A;  3MFX A;  1GHI A;  1PI5 A;  1V9Z A;  1T1B A;  2PBD P;  1NY0 A;  1L2S A;  3LY4 A;  3ZGA B;  3Q1F A;  3HUO A;  1YLY A;  2V20 A;  4Y5F A;  1XJ3 A;  2PDR A;  4R6L A;  5EVE A;  2Q9M A;  2WAF A;  2JE5 A;  4WL9 A;  3UB9 A;  4N9L A;  3LIC A;  2R9W A;  4U0X A;  5EOE A;  3T1Q B;  2ZC3 B;  1GSV A;  3TRC A;  2WKI A;  2WK0 A;  3G6O A;  3IH8 A;  2XRO A;  3BRM A;  5CGW A;  3S4X A;  2ZLY A;  1NZU A;  4GS9 B;  1P9R A;  5CEB A;  2WKP A;  3VP3 A;  2H5S A;  1L3L A;  5HFO A;  2VV8 A;  5FQQ A;  2INW A;  4R70 A;  2QWS A;  4RX3 A;  1W7F A;  4DXC A;  3EOI A;  4ZJ2 A;  3IWQ A;  3V5M A;  3HLW A;  4GD8 A;  3AGD A;  1MPL A;  5G18 A;  2ZJ9 A;  2OWJ A;  4OQI A;  4WM9 A;  1S1Z A;  1PIO A;  3QP4 A;  3V67 A;  1IKI A;  4X6T A;  3BFC A;  5J7E A;  1NLZ A;  4GLQ A;  3UE6 A;  1N9N A;  1N9L A;  2X71 A;  3D72 A;  4BBU A;  2KDK A;  4DE0 A;  2A2L A;  3IXB A;  4OPQ A;  3H9W A;  2W3G A;  1IFQ A;  4PMA A;  1Z6F A;  3T4K A;  1LSX A;  2CC1 A;  2W1R A;  1MWT A;  3OLO A;  2W1T B;  3L9K A;  4EWF A;  2IWC A;  2XF3 A;  4E3O A;  3O88 A;  1LL5 A;  4BWI A;  1KDS A;  4I3J A;  3FKV A;  2WYX A;  3SOI A;  3BLM A;  1K4E A;  4NEE D;  1K25 A;  5KMW A;  4MLL A;  5F1G A;  4DN0 A;  3ZFZ A;  4ZDX A;  4D2O A;  4N1H A;  1GHM A;  4R3A A;  3LO7 A;  2EX6 A;  4HI4 A;  4PM6 A;  4X55 A;  1D7E A;  3FG8 A;  2P74 A;  3MSH A;  3K2N A;  1XGJ A;  2L0W A;  3NY4 A;  4GB7 A;  4C3Q A;  2Q9N A;  2PHY A;  5FI6 A;  4I5S A;  5F83 A;  5GL9 A;  3U4L P;  2OAP 1;  4EBN A;  4PM8 A;  3EEH A;  5U47 A;  3KSF A;  3KSI A;  4S2L A;  1XP4 A;  3P98 A;  3HRE A;  3LR3 A;  5HPI A;  2Y4A A;  4QB8 A;  3S7P A;  3UB5 P;  4EQI A;  3F1N B;  2Y2L A;  3CG5 A;  3MR0 A;  5EVI B;  2D01 A;  2L1M A;  3HVF A;  3MF0 A;  4IBR A;  1DP8 A;  4X1L A;  3TSG A;  3EQU A;  3ZYT A;  3KX0 X;  4S2O A;  3T4S A;  3TG9 A;  4X25 A;  2Y59 A;  2ZMA A;  3KO6 A;  4G3K A;  3MFD A;  1M40 A;  1P97 A;  3MJQ A;  4QJG A;  4LGW A;  5KSH A;  3CJM A;  4QU3 A;  4WLA A;  3N4I A;  5CHJ A;  5G4Z A;  4GCZ A;  1OT6 A;  1ZTU A;  3IBR A;  4Y0O A;  2VA0 A;  3HBR A;  4BBT A;  2EFX A;  1EW0 A;  1TVF A;  1LLB A;  4CLC E;  3E2K A;  4F3L B;  1KGE A;  4UHU A;  4Y15 A;  3CWF A;  4JXV A;  2G2U A;  3WS0 A;  2OWH A;  2BG1 A;  4UQI S;  4DMZ A;  4MBF A;  3HUM A;  4KUO A;  4WMC A;  3M2K A;  1L0G A;  4QHC A;  3UB8 A;  1YLP A;  3IX8 A;  2EFU A;  2J3T C;  1OJ5 A;  1CJF A;  3G32 A;  2FFY A;  2RL3 A;  2PD7 A;  3QP8 A;  4NK3 A;  2BAS A;  3IX4 A;  5DFX A;  5L10 A;  2ZQD A;  1W8Y A;  2QMI A;  2V0W A;  5CTM A;  1WYC A;  5L8M A;  4BD1 A;  1T18 A;  4BMW A;  4HIA A;  3U2A A;  3DW0 A;  3IQA A;  2P04 A;  4LPZ A;  1FCN A;  3ISG A;  5E2G A;  3CHW P;  3LIF A;  3B3X A;  2LB9 A;  2QPN A;  1SZV A;  3LY3 A;  4KZ4 A;  4GNU A;  3FZC A;  1ZC2 A;  4XT2 A;  3LCE A;  4KQR A;  1EI5 A;  4JGO A;  2OLV A;  1CI8 A;  4FUW A;  4LCL A;  2M7U A;  3Q7Z A;  5A91 A;  4CLC B;  4FOF A;  3WRZ A;  1BLH A;  5HL6 A;  1XFN A;  1K54 A;  3KYE A;  3PBO A;  5EFW A;  3WRT A;  3UY6 A;  4X69 A;  1RGY A;  3OPR A;  5K5B A;  3I7J A;  3B33 A;  4HH2 A;  1G28 A;  2CMN A;  2V1A A;  3MMH A;  5FAQ A;  1OTA A;  3M6B A;  3BJN A;  2VJW A;  4L9E A;  5EEC A;  4RA7 A;  3F1N A;  2Z2M B;  1SHV A;  4OQ0 A;  3H82 A;  2XRN A;  4OOM A;  5A8B A;  3NOT C;  1YLJ A;  1CI9 A;  4FH4 A;  1AWI A;  1K6S A;  4EU0 A;  1ALQ A;  1ONH A;  2HGV A;  3R4K A;  2V1Z A;  3DWZ A;  2HDS A;  1RGZ A;  5HAQ A;  1FR6 A;  4HES A;  5A90 A;  4B9O A;  2M1C A;  3ULF A;  4JXS A;  1W63 Q;  4OON A;  5A93 A;  1MWR A;  1PI4 A;  4OPR A;  2MJ6 A;  4HY8 A;  4QY6 A;  1YM1 A;  2EWV A;  1FOF A;  4MCW A;  3LIE A;  3FC7 A;  1FSW A;  2BLS A;  2NUP C;  3W2Z A;  1VB6 A;  4MN5 A;  4B88 A;  1ONG A;  1OTB A;  3UME A;  3HLB A;  1F9I A;  3IF6 C;  4KZA A;  1JWV A;  2Y2O A;  3UMD A;  3CIT A;  3IWO A;  2EX8 A;  3WS5 A;  4H6J A;  4WMC D;  3W4O A;  4F3L A;  4R23 A;  3IXG A;  3MQO A;  2A24 A;  2ZQ9 A;  1PYY A;  4P6Z M;  4EEP A;  1BTL A;  5FQK A;  1CF0 A;  1I2W A;  4JF5 A;  5M19 A;  3PR6 A;  4WZ5 C;  1DJA A;  4MBK A;  1OTD A;  1K56 A;  5J4E A;  3W4Q A;  4ZJ1 A;  4WF0 A;  4EEU A;  3VP2 A;  2Z6C A;  4ETX A;  1ACF A;  1K55 A;  2VGL M;  4P87 A;  3B47 A;  4F94 A;  4AFI A;  3UE3 A;  1IYO A;  3VV4 A;  5C5K A;  1XKZ A;  3HLC A;  5E43 A;  2GX5 A;  2JBF A;  3CUE A;  3EEA A;  4RYE A;  3IBJ A;  2H28 A;  1VEU A;  4KG6 A;  5DJU A;  4DJ2 A;  3NI9 A;  3IX3 A;  4Y0U A;  2VV6 A;  5TBM A;  3O86 A;  3OC2 A;  5HX9 A;  2A3U A;  1BLP A;  4CLC A;  4N9K A;  4OVD A;  4KZ7 A;  4QWO A;  4HQA A;  5CHU A;  2DCF A;  3LR5 A;  3D4F A;  2WZX A;  2ACG A;  1H8Z A;  4KQO A;  3MS6 A;  3H7W A;  3QP5 A;  4L0L A;  4OP8 A;  5CX7 A;  4UA7 A;  1MWS A;  5HDS A;  3BYD A;  3SS4 A;  3PBQ A;  4HJ6 A;  3VFF A;  5EM1 A;  1ODV A;  4L9F A;  3UO9 A;  2W3H A;  1YLZ A;  4IVK A;  5HL1 A;  5DF7 A;  2Y2P A;  3UDF A;  4YOF A;  1HD8 A;  3UE0 A;  2XK1 A;  3NDG A;  4S2K A;  4S2N C;  2Y2K A;  1KDW A;  5E2H A;  5AQ7 A;  3PAG A;  2IA2 A;  3QNC A;  5L07 A;  4OKP A;  5AVE A;  3RXX A;  4E6X A;  4LV0 A;  4B4Z A;  1Q2Q A;  1K6R A;  5FEG A;  1ERM A;  5EVL A;  2V2F F;  2M7V A;  1K57 C;  3MZE A;  4LRX C;  4HNB A;  1G68 A;  1PW8 A;  4MNR A;  2W27 A;  1I5Q A;  5FL3 A;  1T19 A;  5M1A A;  1GCE A;  3L7H A;  3FKW A;  4LV3 A;  4ID4 A;  4KG2 A;  4BL2 A;  1GHP A;  4DE2 A;  3E4O A;  1PZP A;  3V3R A;  2PBY A;  4XUZ A;  4U3T A;  5CRF A;  1K56 D;  1LI0 A;  3ZDJ A;  5HWW A;  4BL3 A;  2XFT A;  2A49 A;  1OME A;  1VET B;  1XGI A;  4WN5 A;  4HEF A;  2XLN A;  4ESP A;  3A3I A;  1NYM A;  1I2S A;  3KYZ A;  5F1F A;  1KOU A;  3S7O A;  2WGI A;  4KEN B;  1FIK A;  4X53 A;  2J9O A;  2OAQ 1;  4LFU A;  3V3S A;  3MKF A;  1HTZ A;  3AGF A;  4P6B A;  2WKQ A;  3WS4 A;  4EET B;  2WGV A;  1SCW A;  3HJI A;  4HBT A;  5FI2 A;  3A0S A;  1Z09 A;  1W8Q A;  4GJ4 A;  5FQI A;  1LHY A;  5E2E A;  4N1X A;  5EVI C;  4UA6 A;  2ZOI A;  3MKE A;  4DDY A;  2C5W B;  1ES2 A;  4X68 A;  4CLC D;  1HZO A;  1T1A A;  1TS8 A;  2PT7 A;  1YLW A;  1BT5 A;  1QME A;  4IUK A;  3LGO A;  3BEC A;  1DY6 A;  2WKE A;  3IT9 A;  4KZ6 A;  1H8Y A;  1TS6 A;  4JBF A;  1PFL A;  3V39 A;  3VFH A;  2HP6 A;  2LB5 A;  4E3M A;  4BEN A;  1H0M A;  4KZ3 A;  4WEJ A;  4Y2F A;  2HP9 A;  1XJ6 A;  3WS1 A;  5CGS A;  1Y54 A;  1KE3 A;  2R78 A;  3SZT A;  3KSG A;  3E0Y A;  5FI7 A;  1YKD A;  5FQM A;  1S4R A;  2ZBB A;  1P9W A;  1ZG4 A;  3G2Y A;  3HLF A;  1GSW A;  4DJ3 A;  3N6I A;  4P85 A;  4GHI B;  2ZL1 B;  3SH8 A;  4XT2 B;  5HD5 A;  1UWN X;  3VE3 A;  5FAT A;  3LEZ A;  3SH9 A;  1FR1 A;  3BWL A;  4M3K A;  3K3C A;  5HAI A;  3ZG0 A;  2PU2 A;  4PKY A;  2PU4 A;  4PKY G;  4WZ5 A;  1BLS A;  2W0N A;  4QD4 A;  1NRF A;  5TFQ A;  2KOI A;  4LLO B;  3BQ8 A;  3H82 B;  1PWC A;  5DTT A;  3D3O A;  2E8I A;  3DAV A;  1G5U A;  3DTM A;  3E98 A;  3A3E A;  4BQM A;  3C4P A;  3Q07 A;  4GKU A;  4DE1 A;  2H0Y A;  3VOY A;  3OPP A;  4LV1 A;  2JKG A;  3ZNT A;  3UE1 A;  5HPF A;  4L9G A;  4O0P A;  2J80 A;  1VET A;  3LI8 A;  4EV4 A;  4ZTK A;  1CK3 A;  4PHT A;  1KE0 A;  2XD1 A;  4EUV A;  3LI9 A;  3LIB A;  1TD5 A;  3HCY A;  1LL9 A;  3R7W A;  1NWZ A;  5DJT A;  1N9O A;  3LR0 A;  2JKF A;  2B18 A;  3GV9 A;  1IKG A;  3C5A A;  5EV0 A;  3GSG A;  4H6J B;  1GSX A;  5HWT A;  3PXP A;  4K08 A;  1NZO A;  5DF8 A;  3ZG7 B;  2AVX A;  3T1S A;  1TS0 A;  3G31 A;  4JGP A;  1AXB A;  3PBS A;  1XX2 A;  1PZO A;  4KUK A;  2A24 B;  1U60 A;  1YMX A;  4ETZ A;  4FTX A;  4E04 A;  2HF6 A;  3EGX C;  4KZB A;  5HDD A;  4OOY A;  1DRM A;  4N92 A;  3P7N A;  5EUA A;  2VLG A;  2Y8H A;  1WA9 A;  4WEL A;  5AQA A;  4OOL A;  5GLA A;  2V8C A;  5F6A A;  4GD6 A;  2VKS A;  2PYR A;  2W3D A;  1ESU A;  5LBR A;  2DNS A;  1GA9 A;  1WE4 A;  1N4O A;  3E4P A;  2GJ3 A;  4JPM A;  1FQG A;  3MZD A;  3W4P A;  2P7J A;  3BFD A;  2Z2L B;  4XUX A;  4ZAM A;  4E3J A;  3T4T A;  4IUH A;  2D02 A;  2XFS A;  3ICY A;  3ZG9 B;  4Z9Q A;  2W3F A;  3JYI A;  3HUN A;  3BFE A;  1VEU B;  1S6R A;  1DP9 A;  1YSQ A;  1JWZ A;  4HJ4 A;  4IED A;  1JTD A;  4GHI A;  1XXM A;  2ZL1 A;  4A5R A;  5GHZ A;  5TBM B;  2IWD A;  3GQZ A;  5HAR A;  4PM9 A;  2ZM8 A;  3IS2 A;  1FIL A;  1JVJ A;  2GDN A;  4P6Z S;  5GLC A;  3TJZ C;  3DTK A;  5L2F A;  4WBG A;  1KE4 A;  3N8S A;  3VP0 A;  3H7W B;  2O9B A;  3NOP C;  1HVB A;  5EE8 A;  2HDR A;  1DJB A;  4S2P A;  1VM1 A;  4Z1W A;  3IH9 A;  5M18 A;  4R4R A;  4CJN A;  4UEY A;  3NDE A;  3WS2 A;  2Y2H A;  3T1R A;  1PRQ A;  2HZ5 A;  3BY8 A;  2NUT C;  3F1O B;  1JNU A;  3SW1 A;  2VGL S;  2J9P A;  4CPK A;  1LI9 A;  1K38 A;  2JN7 A;  3T4O A;  4WEK A;  4ARZ A;  3QP6 A;  2QJ7 A;  3TE8 A;  3FPW A;  5DKK A;  4DDS A;  3QHY A;  3T12 B;  4EW7 A;  1TF1 A;  4R4S A;  3GMW A;  4KG5 A;  4ME4 A;  1ERQ A;  3EWK A;  3MQ0 A;  2Y2Q A;  4WYY A;  3E4Q A;  2I9V A;  3K3D A;  2JKT I;  5F82 A;  4PM5 A;  1M6K A;  4EES A;  3Q7V B;  3MBZ A;  3WWX A;  4JF4 A;  4IHQ A;  1H5X A;  3QNB A;  1KVM A;  1ES3 A;  2JHE A;  2V0U A;  3GEC A;  3Q82 A;  4EXO A;  3ZQ5 A;  1LT0 A;  2EA9 A;  2O9C A;  4DXB A;  3A0R A;  4YWZ A;  1VHM A;  4ZJ3 A;  2BTF P;  3C7U A;  2XEP A;  2ZMF A;  3JVV A;  2H10 A;  5IHV A;  4X56 A;  3MXR A;  2Q0O A;  3DWK A;  3OCN A;  2ZC4 B;  3DTI A;  2Y2G A;  2Y2J A;  3ZHH A;  2R9X A;  3C7V A;  1PNE A;  2VV7 A;  5DTS A;  4UAA A;  5L09 A;  3EQV A;  3NIA A;  5HWV A;  1E3U A;  2HP5 A;  2W3E A;  3T50 A;  4DE3 A;  2J3W A;  3VP1 A;  3PBN A;  4Q0H A;  4PM7 A;  2Y2M A;  5I5L A;  2HDU A;  5TR7 A;  2Z6D A;  5EPH A;  3T1X A;  2PYP A;  3E2L A;  3ZNY A;  1DP6 A;  3LFV A;  4EQ1 A;  1F5M A;  2K2N A;  1IYS A;  3ZVT A;  3NJA A;  2HJE A;  2V8F A;  4O7D A;  2E8J A;  3NBL A;  1CEF A;  1O07 A;  5FQJ A;  3PTE A;  2B5R A;  2FH5 A;  1F98 A;  3T4Q A;  1OJG A;  2JKR I;  2ZM0 A;  4G3W A;  1XA7 A;  1NXY A;  1F2K A;  2K31 A;  2ZC7 A;  2XSS A;  1RCJ A;  3PBR A;  3D9Y A;  4JXW A;  3F1O A;  3IF6 B;  2ZQ7 A;  3UNW A;  4E3K A;  4I38 A;  2JC7 A;  3OPH A;  2XQZ A;  4D60 A;  3O87 A;  4NKP A;  4OQH A;  4S2J A;  2UWX A;  2WAD A;  4MN7 A;  2RCX A;  3PAE A;  3PHY A;  4Y13 A;  1LSW A;  4ZRR A;  3CLO A;  2XDM A;  3MXQ A;  4LCM A;  2PR5 A;  4RQ9 A;  2O99 A;  3NCK A;  5HAP A;  1QMF A;  1CEG A;  3GTC A;  3UDX A;  3CAX A;  3JVU A;  5DFY A;  3Q7V A;  2K7S A;  4C75 A;  2FFF B;  1S1Y A;  3N7W A;  4MEZ A;  5FAS A;  1FCO A;  4ZBE A;  4GZB A;  5GLD A;  1UWP X;  2XA7 M;  2Y2I A;  5FAP A;  5J8X A;  4JGQ A;  3BM6 A;  3CMZ A;  3HJK A;  1E25 A;  2EX9 A;  3LUQ A;  1MXO A;  5HSQ A;  4OLD A;  4I3A A;  5F68 A;  4KZ9 A;  2L4R A;  2OLU A;  4R0Q A;  1BSG A;  3G4P A;  3N8L A;  3UPN A;  3NEC A;  4UA9 A;  3IWI A;  1E3U D;  2KLI A;  4QY5 A;  2DMW A;  1MZU A;  1KVL A;  3O3V A;  5DKL A;  5FDS A;  3BQA A;  1IYP A;  3JPU A;  1K54 C;  3R7W B;  1JWP A;  3SH7 A;  3ITB A;  5FEF A;  4R3B A;  3VE4 A;  3F1P A;  1ZHH B;  1PWG A;  3RTY A;  1MWU A;  5E2F A;  2GNX A;  4HOI A;  5CGX A;  3UN7 A;  3M6H A;  5JYO A;  3RFB A;  3ITA A;  3GVB A;  4GN2 A;  5AQ9 A;  4Q8I A;  4GDB A;  3T4L A;  3BW6 A;  1XJ2 A;  3FYZ A;  2ZC5 B;  4GW9 A;  4R3J A;  1ZG6 A;  4OP5 A;  1TDL A;  4WUJ A;  4BD0 A;  2QHK A;  4Y3I A;  4OH0 A;  2WKH A;  1SKO A;  4O01 A;  1S0W A;  4S2M A;  1A0K A;  3CPT A;  4Y0T A;  1YMS A;  3V50 A;  1Y4O A;  1K0K A;  1NJ4 A;  2OV5 A;  3IF6 A;  1STZ A;  1YT4 A;  1XFQ A;  4EER A;  4G3V A;  5DF9 A;  4YFM A;  2YKH A;  1D1J A;  2Y79 A;  5CHM A;  4MN6 A;  2ZMV A;  3G34 A;  1T1C A;  3B42 A;  1Q2P A;  1YPR A;  4OLG A;  3NHQ A;  4Y7P A;  1LSV A;  2J3T D;  3IS2 B; 
#chains in the Genus database with same CATH homology
 3C8C A;  2P7J A;  5HZH A;  5AVF A;  3PBT A;  1G6O A;  3T4T A;  4IUH A;  2D02 A;  4HJ3 A;  1Y28 A;  3ICY A;  3PR6 A;  2W3F A;  4MDZ A;  4Y5F A;  1XJ3 A;  2PDR A;  5HDC A;  1OTD A;  4R6L A;  5J4E A;  1DP9 A;  1YSQ A;  4HJ4 A;  4WL9 A;  2QKP A;  3UB9 A;  4GHI A;  3LIC A;  4WF0 A;  5TBM B;  4FSF A;  4EEU A;  4LRZ E;  2KX6 A;  2Z6C A;  4ETX A;  1GSV A;  3KSH A;  2VGL M;  2FZ0 A;  4CQH A;  3IS2 A;  3OBF A;  4Q0I A;  3B47 A;  3TRC A;  4AFI A;  4P6Z S;  3UE3 A;  1MKM A;  3VV4 A;  3CUE C;  3G6O A;  5C5K A;  2GX5 A;  2HJ9 C;  3TJZ C;  3CUE A;  3EEA A;  5F69 A;  2XRO A;  3IBJ A;  2H28 A;  5DJU A;  4DJ2 A;  3H7W B;  2O9B A;  4ARZ B;  3LYX A;  3NOP C;  4GS9 B;  1P9R A;  3NOU C;  2WKP A;  2VV6 A;  2VV8 A;  4Z1W A;  5TBM A;  2INW A;  3OC2 A;  4UEY A;  4R70 A;  2QWS A;  4CLC C;  3EOI A;  3BY8 A;  2NUT C;  4CLC A;  3F1O B;  1JNU A;  2JKT M;  3SW1 A;  2VGL S;  1OTE A;  4HQA A;  3MQQ A;  1W63 M;  3LR5 A;  2HV1 A;  2JN7 A;  3T4O A;  4WEK A;  4KQO A;  3H7W A;  4ARZ A;  2OWJ A;  4L0L A;  4GS9 A;  4NXE A;  5CX7 A;  2QJ7 A;  3TE8 A;  1S1Z A;  1NRJ A;  3V67 A;  5J7E A;  5HDS A;  3FPW A;  5DKK A;  2GZA A;  3P01 A;  1NLZ A;  4EW7 A;  3PBQ A;  4GLQ A;  4HHD A;  1TF1 A;  2V9A A;  3BY9 A;  3UE6 A;  4ME4 A;  3CI6 A;  3EWK A;  1N9N A;  3MQ0 A;  4HJ6 A;  1N9L A;  3E4Q A;  1ODV A;  4L9F A;  3D72 A;  4BBU A;  2I9V A;  2KDK A;  2W3H A;  2A2L A;  3K3D A;  2JKT I;  2B02 A;  3O5Y A;  3UB7 A;  3H9W A;  4EES A;  2W3G A;  4IHQ A;  4YOF A;  1IFQ A;  3T4K A;  1LSX A;  3C30 A;  1UGU A;  2JHE A;  4NXG A;  3GDI A;  2V0U A;  3GEC A;  4EXO A;  2W1R A;  1OPX A;  3LIA A;  3ZQ5 A;  3OLO A;  2IA2 A;  1LT0 A;  2W1T B;  5AVE A;  2EA9 A;  4BJP A;  1X0O A;  2O9C A;  4BWI A;  4I3J A;  4BBV A;  3A0R A;  4YWZ A;  1VHM A;  5TJJ A;  5J3W A;  4NEE D;  2ZMF A;  3JVV A;  2V1B A;  4DN0 A;  1IOU A;  2WKR A;  3OCN A;  4R3A A;  2M7V A;  4HI4 A;  4IJG A;  4LRX C;  4HNB A;  1D7E A;  3FG8 A;  2W27 A;  5FL3 A;  2VV7 A;  1T19 A;  3K2N A;  2W1T A;  5F5Y A;  3EQV A;  2L0W A;  2OOL A;  1MC0 A;  1OT9 A;  4HP9 A;  2PHY A;  3E4O A;  4I5S A;  5HWV A;  3FPV A;  2OAP 1;  2W3E A;  2PD8 A;  3VOL A;  3T50 A;  3EEH A;  3KSF A;  2J3W A;  3KSI A;  3PBN A;  4Q0H A;  5HWW A;  5I5L A;  3LR3 A;  5HPI A;  1D06 A;  3S7P A;  2Z6D A;  4WN5 A;  2JKR M;  3F1N B;  2PYP A;  3MR0 A;  2PR6 A;  3KYZ A;  1DP6 A;  2D01 A;  2L1M A;  3MF0 A;  1KOU A;  1DP8 A;  3LFV A;  3S7O A;  4EQ1 A;  1F5M A;  1S4S A;  2K2N A;  3EQU A;  3ZYT A;  4I3I A;  3KX0 X;  2OAQ 1;  3T4S A;  5MC7 A;  2WKQ A;  3KO6 A;  4G3K A;  4EET B;  3NJA A;  2HJE A;  3S7N A;  3HJI A;  3OCL A;  3KYQ A;  1YAX A;  3A0S A;  5KIZ A;  3DBA A;  1P97 A;  3MJQ A;  4GJ4 A;  4PAU A;  5IU1 A;  5KSH A;  3C38 A;  4WLA A;  2ZOI A;  3OOV A;  2FH5 A;  1F98 A;  3T4Q A;  1OJG A;  2JKR I;  2VEA A;  2G7U A;  4CLC D;  4LRY C;  4G3W A;  1XJ4 A;  4UQI M;  1T1A A;  1TS8 A;  5G4Z A;  4GCZ A;  1OT6 A;  1ZTU A;  2PT7 A;  3IBR A;  2VA0 A;  2K31 A;  4HP4 A;  4IUK A;  1LL8 A;  2XSS A;  4BBT A;  1EW0 A;  3PBR A;  1TS6 A;  3F1O A;  4I38 A;  3EGD C;  2LB5 A;  4NKP A;  2VZW A;  4CLC E;  3T4J A;  4F3L B;  4WEJ A;  4Y2F A;  3CWF A;  1XJ6 A;  4MN7 A;  1OTI A;  1P0Z A;  2O9A A;  2OWH A;  3PHY A;  2QYB A;  2R78 A;  1LSW A;  4ZRR A;  3TW8 A;  3KSG A;  3E0Y A;  4UQI S;  3CLO A;  4DMZ A;  1S66 L;  3MXQ A;  4KUO A;  5HD3 A;  5AJG A;  2PR5 A;  4RQ9 A;  1YKD A;  2O99 A;  1V9Y A;  3UB8 A;  2J3T C;  1S4R A;  1OJ5 A;  2ZBB A;  3CAX A;  4MMN A;  3JVU A;  5DFY A;  1P9W A;  2K7S A;  2PD7 A;  2BAS A;  5DFX A;  1GSW A;  4DJ3 A;  1S1Y A;  5IT5 A;  2V0W A;  4GHI B;  4XT2 B;  5HD5 A;  1UWN X;  1UWP X;  2XA7 M;  3LR4 A;  3VE3 A;  5L8M A;  4JGQ A;  1T18 A;  4BMW A;  4HIA A;  4QPR A;  3HJK A;  3BWL A;  3U2A A;  3K3C A;  3LUQ A;  5HSQ A;  2P08 A;  2P04 A;  4LPZ A;  4JGR A;  2ZOH A;  4I3A A;  4PKY A;  1S67 L;  3LIF A;  2LB9 A;  5F68 A;  4YNR A;  4PKY G;  2L4R A;  3F1P B;  4O8G A;  1H3Q A;  2W0N A;  4Q0J A;  3C2W A;  2KLI A;  2KOI A;  4LLO B;  4XT2 A;  2DMW A;  1MZU A;  5DKL A;  4JGO A;  3BQ8 A;  4KQD A;  3H82 B;  2O0Y A;  2XA7 S;  3BQA A;  2EWW A;  2M7U A;  3D3O A;  4CLC B;  4FOF A;  5HL6 A;  3E98 A;  1XFN A;  3R7W B;  4II7 A;  3PBO A;  2QJ5 A;  5EFW A;  5K5B A;  4NXF A;  3A0V A;  3B33 A;  4HH2 A;  1G28 A;  2CMN A;  2V1A A;  3MMH A;  3UB6 A;  3VE4 A;  1OTA A;  3F1P A;  1ZHH B;  5HPF A;  3BJN A;  2VJW A;  4L9G A;  3RTY A;  4O0P A;  2J80 A;  3LI8 A;  4NXB A;  4L9E A;  3F1N A;  2GNX A;  4PHT A;  4HOI A;  3H82 A;  2XRN A;  4OOM A;  5A8B A;  3NOT C;  1BYW A;  4EUV A;  3LI9 A;  3LIB A;  3RFB A;  1TD5 A;  3HCY A;  1NLY A;  3R7W A;  1NWZ A;  5DJT A;  1N9O A;  3LR0 A;  4HH3 A;  4EU0 A;  3RH8 B;  2B18 A;  4R38 A;  2HGV A;  3BW6 A;  3R4K A;  3T4L A;  4I39 A;  1XJ2 A;  4B93 A;  1TS7 A;  4H6J B;  1GSX A;  5HWT A;  3PXP A;  4K08 A;  1TS0 A;  4GW9 A;  4B9O A;  2M1C A;  4JGP A;  3ULF A;  1W63 Q;  3PBS A;  4WUJ A;  2QHK A;  4Y3I A;  4KUK A;  2A24 B;  2MJ6 A;  4HY8 A;  4ETZ A;  2EWV A;  4E04 A;  2HF6 A;  3EGX C;  4MCW A;  4O01 A;  5HDD A;  1H8M A;  3LIE A;  3FC7 A;  1DRM A;  2NUP C;  3P7N A;  3W2Z A;  1VB6 A;  2YKF A;  4MN5 A;  5G4Y A;  1OTB A;  3UME A;  2VLG A;  1F9I A;  3LID A;  2Y8H A;  1WA9 A;  4WEL A;  4OOL A;  3UMD A;  1STZ A;  3PYP A;  1XFQ A;  3CIT A;  5F6A A;  4EER A;  4G3V A;  4M4X A;  5DF9 A;  2VKS A;  2YKH A;  4H6J A;  2PYR A;  2VX8 A;  2Y79 A;  3S7Q A;  2W3D A;  1YSP A;  4MN6 A;  5LBR A;  4F3L A;  2ZMV A;  1T1C A;  3B42 A;  3E4P A;  3MFX A;  5IS1 A;  3MQO A;  2GJ3 A;  3NHQ A;  1V9Z A;  2A24 A;  1LSV A;  1T1B A;  2J3T D;  4P6Z M;  3IS2 B;  4EEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...