3BQ8A

Crystal structure of the e.coli phoq sensor domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
144
structure length
142
Chain Sequence
DKTTFRLLRGESNLFYTLAKWENNKLHVELPENIDKQSPTMTLIYDENGQLLWAQRDVPWLMKMIQPDWLKSNGFHEIEADVNDTSLLLSHSIQQQLQEVREDDDDAEMTHSVAVNVYPATSRMPKLTIVVVDTIPVELKSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein phoQ
publication title Crystal Structure of a Functional Dimer of the PhoQ Sensor Domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein, transferase
total genus 27
structure length 142
sequence length 144
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.140 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3bq8A00
3BQ8A 3BQAA 1YAXA 4UEYA
chains in the Genus database with same CATH superfamily
3H82B 5FASA 4JXSA 3ZGAB 1BYWA 5DJTA 3HL9A 1LLBA 4HH2A 5FQQA 2OLUA 1NYMA 1HVBA 2LB9A 2WAEA 1K0KA 5F83A 3RTYA 4QD4A 1FIKA 3IF5A 4I39A 4S2JA 5I94A 3IX8A 4UAAA 2VGJA 4XT2A 1L0GA 1RP5A 2XDMA 1L0EA 1PW1A 2JBFA 3FV7A 2UV0E 1PI4A 5TR7A 4EXOA 4MBHA 4LFUA 3UB9A 5M19A 5HFOA 4PM7A 1NWZA 5DF7A 1OJGA 3AGFA 2WUQA 4FCFA 3BJNA 5EVIC 5KZHA 4RX3A 2W3GA 4OP8A 1PZPA 2VZWA 2Y2IA 5A8BA 3ZG5A 3NCKA 3BECA 4XT2B 4BBVA 1PRQA 4UHUA 3CZDA 1Y54A 5M18A 4MNRA 2ZQAA 1IYQA 4Y5FA 5D3OA 3CWFA 5DFYA 2J80A 5AQBA 4ZJ2A 3M2JA 4HESA 3BY9A 4D2OA 4JKTA 4DJ3A 4JF5A 3TG9A 3ZDJA 4JPMA 4NG2A 2XR0A 4DDYA 4LCMA 4OP5A 4CLCC 2VJWA 3JYIA 2WAFA 2EFXA 2Y2QA 5FEGA 2V1ZA 4OH0A 4LV3A 3EQVA 1RGZA 1MXOA 3Q81A 4K91A 4KZBA 4GKUA 4OLGA 1UGUA 3DWZA 3G31A 5FEFA 1J9MA 2Z2LB 1GA0A 1BUEA 3SH9A 3CI6A 4HBUA 4DKIA 3N6IA 4E6WA 3E98A 4JF4A 1T19A 3MJQA 2JKGA 4O7DA 1VM1A 1Q2PA 4O8GA 2Q9NA 4EWFA 3RJUA 4BLMA 3OLOA 1HLUP 5HPIA 5CHUA 1UWNX 2X71A 3HLEA 4S2MA 3MZDA 5A90A 1I2WA 3Q7ZA 4WMCA 4YWZA 4EEUA 3D72A 2PD8A 3B33A 4Y3IA 3C2WA 5A93A 4QB8A 3GECA 1Z09A 3T4JA 1KVLA 1YPRA 4NKPA 3PBSA 4NEED 1SDNA 2XLNA 3G4PA 4OQ0A 1H8ZA 2G7UA 4DE2A 1VB6A 4QHCA 4MBKA 2E8JA 1K6SA 2VV6A 4E3JA 2LB5A 4MN6A 1S67L 2GJ3A 2ZQ8A 2INWA 3ZFZA 1P97A 1T1AA 2KOIA 1X0OA 1SKFA 4PKYA 4GLQA 2EX6A 2Y2MA 3UPNA 1BTLA 3V3RA 5FA7A 4RVAA 2UWXA 3W2ZA 3FKWA 4DDSA 4R0QA 3SH7A 1EI5A 5GHYA 4X55A 3T4OA 1JWZA 4RYEA 4O01A 1CK3A 2ZMVA 1NLZA 3HUMA 3VP0A 4IHQA 3BFCA 3MS6A 4ID4A 3ZNYA 3PXPA 3ITBA 1BLCA 1QMEA 5L10A 3TJZC 3WRZA 3LR5A 1IOUA 2JN7A 2GDNA 2HPBA 1N9BA 2NUPC 4UA7A 3BFDA 4Y7PA 3IQAA 1MY8A 1YT4A 3IHAA 1PFLA 4EESA 1NRFA 3DTIA 4HBTA 3RH8B 3F1PA 3VE4A 1FILA 4PM8A 3ZG0A 2HGVA 2XROA 2W0NA 3ISGA 2V1AA 3FWLA 1DRMA 1LI0A 3G30A 4JXWA 3HLGA 3T1SA 3LI9A 4Z1WA 3UDFA 3OPHA 3ZVWA 4EERA 2Y8HA 3A0VA 4IJGA 3C7VA 4HH3A 4Y2FA 2ZC3B 3F1PB 3KSIA 3TE8A 1S4SA 1KE3A 3D4FA 3O5YA 1BULA 3V50A 4KQDA 4K0WA 4WZ5A 3AGEA 3DW0A 2EWVA 2ZM8A 1H8YA 3HLFA 4B4XA 3E4OA 3MFXA 1MWRA 1RCJA 4WUJA 2B5RA 2XEPA 3GDIA 4ETXA 4Y17A 1LL8A 4NXEA 4MDZA 4WMCD 2V9AA 1IEMA 2XA7S 3WWXA 3VP2A 3BEBA 5EM0A 3NOUC 2CC1A 4EU0A 3QP6A 2ZC5B 1ESIA 4MN7A 3VOZA 2FFYA 4DXCA 1BLHA 1TD5A 5CEBA 1EW0A 3P98A 4BL3A 3C30A 2VLGA 3S4XA 3OZHA 4WBGA 4C6YA 2XRNA 1IFQA 4P87A 4EQ1A 4KG6A 3IF6C 4D60A 1K4FA 1XA7A 4XXRA 4HP9A 1GHPA 1Y4OA 3NBLA 2EX9A 1FR1A 3A0RA 2WKEA 3VP3A 4L9EA 3T1QB 4JF6A 2V0UA 1ONHA 5KIZA 5HD5A 3WS4A 4GHIA 5IHVA 4P6ZM 3OCNA 1H3QA 1W63Q 1FCOA 1HD8A 2VGKA 2PBDP 1YQSA 2HDSA 3ITAA 1BLPA 5CGXA 3KSGA 3GQZA 3PBNA 4EEPA 3IWQA 4KQQA 2MJ6A 4X25A 5DTTA 2NUTC 3LIAA 1EWZA 4NXGA 1MKIA 3HUNA 2QMIA 4GHIB 1ERMA 3FPWA 3S22A 4OVDA 3NDGA 4YNRA 5E2HA 3JVVA 4WLAA 2PHYA 4YFMA 2HDRA 1GA9A 5L2FA 2Z2MB 3L9KA 3NJAA 4DXBA 5IS1A 4GB7A 3N8SA 1PNEA 1SDEA 1TS6A 3S7OA 1XX2A 3PTEA 4CJNA 3VP1A 3H9WA 2XH9A 4S2NA 1N9NA 5HPFA 3PHYA 3DTEA 3GSGA 1I2SA 4OPZA 1H8MA 1CQAA 5HW3A 4RA7A 5GHXA 1FCNA 3BQAA 3KX0X 4I38A 1MPLA 3N8RA 1N4OA 3SS4A 5DTKA 2YKHA 1OTIA 2OSUA 4C3QA 3NI9A 1LSXA 1TS0A 1U60A 3B42A 1S66L 1CI8A 1MC0A 2JKTI 1Q2QA 4BJPA 3F1OA 3LI8A 3WS0A 4HIAA 5HAPA 1IYSA 5FAPA 1CI9A 2L0WA 3VFFA 3KSFA 3V3SA 3CMZA 4PM9A 4B9OA 4AFIA 2D01A 1C3BA 4Y13A 4PKYG 5A92A 2I72A 3AGDA 5EPHA 4DRTA 4F3LA 1NXYA 5HWVA 4UQIM 2XD1A 4ARZA 1MWSA 1YLWA 1UWPX 5EV0A 5U47A 4E3OA 5FAQA 5EOEA 4M3KA 3ZNTA 3F1OB 5G18A 2FFFB 2ZBBA 1MKMA 3PBOA 4JBFA 4ZAMA 3LIEA 5EVEA 3E4PA 3MFDA 2HP5A 4G3WA 3WS5A 4F3LB 5F1FA 2V20A 3K2NA 3T12B 4LCLA 4ARZB 4QY6A 5AQAA 4IEDA 1M6KA 1PW8A 2HF6A 2WGVA 2VX8A 1D7EA 4NK3A 4ZJ3A 4DE3A 5EOOA 2J3TD 5DF9A 2V8FA 1WE4A 5E43A 3T4LA 1W8YA 2Y2OA 4WL9A 1G6OA 4MCWA 3K3DA 4CQHA 2X02A 4UA6A 3NOPC 4E3NA 5LBRA 4Y0TA 1XJ3A 5CEDA 2IWCA 5TFQA 4S2PA 5KSHA 2B95A 4GZBA 4S2OA 5AQ9A 1XA1A 2EX8A 3NC8A 1W5DA 2GX5A 1GSVA 2CMNA 5L8MA 4BMWA 2I9VA 3RXXA 5DKKA 1CEFA 5HL6A 3K3CA 2Y2KA 3GMWA 2W3DA 3E2KA 3LIDA 3TRCA 3NHQA 3BFGA 4Q0IA 3HLCA 1OTBA 1YLZA 1E3UA 4HOIA 2VV7A 2Y2PA 3QNCA 5HAQA 1DP9A 1XJ6A 5FI6A 3EEHA 1XP4A 4IUKA 4KZ5A 2H28A 4ZTKA 1ACFA 3VOYA 4KZAA 1MZUA 2BTFP 4KZ8A 5FATA 5HD3A 2ZM0A 1OTAA 2V1BA 1KOUA 3VP4A 3UNWA 3QNBA 5G4ZA 4XUXA 1XFNA 5CERA 4GJ4A 4E6XA 1IKIA 3UN7A 4GNUA 5HX9A 1G5UA 3UB8A 4X68A 1EROA 1E25A 3IXGA 4MEZA 1ES4A 3T1XA 2VGLM 5HL1A 5EVIA 2ZM2A 1KGGA 3U4LP 5CHMA 1L0FA 3PBRA 4XUZA 1IYOA 2JKRM 5JYOA 4WYYA 3KSHA 5FAOA 2ZQDA 5BOHA 4A5RA 2HDUA 3A3EA 1OT6A 3CUEA 1RGYA 3BM6A 5GLBA 3MQ0A 2O9CA 4JGPA 3LYXA 3UB6A 1ALQA 2DCFA 3A3FA 4GDNA 3PR6A 3HJIA 5EVIB 4N9LA 2PRFA 3IWIA 2HV1A 1Y28A 4YOFA 4PMAA 2IA2A 4QWOA 1K57A 2EX2A 5F1GA 1TDGA 3MXQA 3PAEA 3EGDC 3OCLA 4CPKA 1K56A 3BY8A 4CLCA 4P6BA 1GHMA 3N4IA 3VE3A 4EV4A 1K38A 1BLSA 4C75A 2W3EA 3VOLA 5DVAA 2QKPA 1K55A 4R3BA 3U2AA 3GRJA 3GV9A 2ZD8A 3OPPA 5DTSA 2PU2A 3PBTA 5J7EA 3SS3A 1YM1A 2WGWA 5L09A 3HUOA 3KO6A 2ZQ7A 2OLVA 4CLCB 4EW7A 2IWDA 1OMEA 2QZ6A 3UDXA 2O9BA 1AXBA 2WKRA 1JVJA 3E2LA 5DFXA 4KUKA 3A3IA 1DP8A 2WGWB 4OONA 3VSLA 2PR5A 3PYPA 2J3WA 3S7NA 4P0MA 2XQZA 5CHJA 5F6AA 4PM6A 4DN0A 1E3UD 2Z6DA 1FOFA 3EOIA 3ZG8B 2Y2HA 4WZ5C 3C5AA 4ZDXA 2OAQ1 5DKLA 3A3JA 2XSSA 3PBQA 2P04A 1KDSA 3MXSA 2B18A 4IBRA 2EXBA 5FQJA 2VK3A 3MQQA 5GL9A 4Z9QA 1LSWA 2FZ0A 4Y15A 4ME4A 2PYPA 2KX6A 4H8RA 5FL3A 1LL5A 2V2FF 5CTNA 3SH8A 3N8LA 4E3MA 4IBXA 4B4ZA 4R38A 2G2WA 2R9XA 4U0XA 1GSWA 1XJ2A 3EWKA 1H5XA 5EVID 2R78A 4BENA 2J3TC 4HJ4A 1STZA 5AVEA 3R4KA 1YLYA 3OPRA 3CLOA 4JGOA 4Y0UA 5EUAA 1FSYA 4HY8A 1JNUA 4ZBEA 3ZG9B 5FQIA 1IELA 4S2LA 2ZJ9A 5CGWA 5HDSA 1K4EA 3V5MA 2JCHA 3ZCZA 1W7FA 2Y91A 4KZ9A 4X56A 1FSWA 2ACGA 4NXFA 3O88A 3LR0A 2XD5A 3VFHA 3G34A 3BLMA 1OTDA 2M1CA 1K56D 4N1HA 3E4QA 5IT5A 2HP9A 5AVFA 3C4PA 4Q0HA 4F94A 1DJAA 1L0DA 1TDLA 5M1AA 2ZC7A 1LHYA 1S0WA 5F69A 1KGEA 3MQOA 3ZVTA 5KMWA 1IKGA 5DJUA 3ZHHA 3D3OA 5EM1A 3KYEA 3D9YA 2WKIA 1WYCA 2O99A 2WZXA 3QP2A 5C5KA 3W8KA 2A24A 3UPOA 4L9GA 1DY6A 1F5MA 3R7WA 2PR6A 1ESUA 5CXWA 1DJCA 3LEQA 2HJEA 4ETZA 1SCWA 1YMXA 1OJ5A 3Q1FA 3S7QA 3CPTA 1TS7A 2O9AA 3BWLA 5MC7A 3O87A 3HVFA 4MLLA 3IXHA 4R1GA 1K25A 2ZLYA 2GZAA 3NIAA 4FH4A 4I3AA 4KZ6A 4PPRA 3DTKA 2PD7A 3UO9A 2P74A 2DMWA 3R7WB 3IWOA 4MBFA 1BZAA 2OV5A 1YSPA 4MN5A 2Q0OA 5E2EA 4GN2A 2BLSA 1LSVA 3CPTB 2K7SA 1PYYA 4YINA 1F2KA 1TF1A 3BLSA 1HTZA 2V8CA 4LV2A 4UEYA 1T1BA 4U0TA 2X01A 4OOLA 3ICYA 2ZMAA 2L4RA 2Q9MA 5E2GA 3IBJA 4BWIA 3ZQ5A 2OWJA 3KYZA 1YLTA 1KVMA 4LRZE 2QPNA 4L0LA 1MWUA 1MWTA 1KE4A 2Y2JA 4Y0OA 4WF0A 4E3IA 2VA0A 3IT9A 2XK1A 3G2ZA 2PU4A 3LGOA 3A0SA 1O07A 3P09A 1T18A 1PI5A 2JE5A 3O3VA 3UMDA 5E2FA 4N1XA 2WKHA 4KZ7A 1XPBA 4E04A 5K5BA 2W1RA 5EE8A 3GVBA 2H10A 1GHIA 2JHEA 4G3VA 4S2KA 1SHVA 2C6WB 4X6TA 1BSGA 2ZQCA 1PWCA 2WGIA 5CX7A 1ZHHB 3BFFA 4IUHA 4O0PA 4I5SA 3LR3A 5L07A 3UDIA 1XXMA 1F98A 1ES3A 3IX3A 2OOLA 1BT5A 3LY3A 4OKPA 2G2UA 4BBUA 1GCEA 1S1ZA 3LIBA 4OQIA 5A91A 4U3TA 4QY5A 2QJ5A 3C8CA 3HCYA 1N9OA 4KUOA 3UB7A 1KGFA 1A0KA 3SOIA 1XKZA 5I5LA 3RXWA 5F68A 3DWKA 3L7HA 4IVIA 3M2KA 4OPYA 3T1RA 4BL2A 2A2LA 5FDSA 3PAGA 2A3UA 4R3AA 4ZJ1A 5TJJA 3LICA 1S4RA 3V39A 2Y79A 4LV1A 1CJFA 2J9OA 4I3JA 3GTCA 2ZOIA 1YLPA 3EQUA 3IH9A 4ESPA 5HDDA 2C5WB 4QPRA 2P08A 3M6BA 2ZC4B 4JXGA 1K6RA 4P85A 2K31A 4R4RA 2Y59A 4LLOB 3UMEA 1K54A 3MBZA 2H0YA 5FQMA 1V9YA 4HNBA 4FUWA 3G32A 2QJ7A 2YKFA 1JTGA 2H0TA 1W79A 5EVLA 1CF0A 4WEJA 2ZL1A 1AWIA 1SKOA 4KG5A 1PWDA 4WM9A 4P6ZS 1QMFA 2OWHA 3CUEC 5F82A 3S1YA 4L9FA 3HLBA 3T4TA 4K08A 3H7WA 4LRYC 1KE0A 2W1TA 4N92A 1FCMA 2PAVP 5FDHA 3QHYA 1P0ZA 1PIOA 1JWVA 2BG1A 2VV8A 2B02A 1G68A 3LIFA 4BBTA 2O0YA 2ZL1B 1P9RA 4S2IA 1SKOB 5GLDA 4HEFA 1K57C 4OOYA 5KSCA 2XA7M 3A3DA 3F1NA 1IYPA 2DRWA 3H7WB 2W1TB 3BW6A 4BQMA 4Q0JA 5FSRA 4GOGA 3M6HA 4WELA 4GW9A 1YSQA 3WS1A 3MZEA 1LI9A 1K55C 3FPVA 3JPUA 3DBAA 2PDRA 5IU1A 4B93A 3LEZA 5FI2A 1J3WA 4E3LA 3WRTA 2DNSA 4OQHA 1TEMA 3C4OA 1NYYA 3SS5A 3F1NB 1XGIA 2BASA 1XGJA 4KQOA 3P01A 2RCXA 3W4PA 4EBNA 1LL9A 2EXAA 3BYDA 3CITA 4JXVA 4X1MA 4HQAA 3NOTC 3T50A 3MR0A 1NY0A 3UE0A 1NZOA 3MXRA 2WKPA 3UE1A 2FH5A 4JGQA 1KDWA 1PWGA 4HJ3A 4OQGA 4PAUA 5F5YA 2E8IA 3FKVA 2EFUA 5EECA 1OPXA 1Z6FA 3IX4A 1YKDA 3LR4A 5AQ7A 4HP4A 4UQIS 4DF6A 3G6OA 3IHBA 4GD8A 3T4SA 4GS9A 5CTMA 2L1MA 2XGNA 4N9KA 3T4KA 3EGXC 5AJGA 5J4EA 4EQIA 4FOFA 3LO7A 1VHMA 4I3IA 3BFEA 1YMSA 3I7JA 1JWPA 4H6JA 1ZG4A 1VEUA 2WYXA 5GLAA 4K0XA 1NLYA 2KDKA 1JTDA 4WN5A 4GS9B 1ZTUA 3HREA 3T4QA 3MMHA 4LGWA 1WYBA 2GNXA 3HBRA 1T1CA 2WADA 2Y4AA 3Q7VA 2J8YA 1ERQA 4OPRA 4GDBA 4BD1A 4H6JB 1VEUB 3LUQA 1ES5A 3VMAA 1N9LA 4X1LA 4EUVA 4CLCE 3UY6A 3CJMA 5FQKA 2JKRI 2Y55A 1WA9A 3NULA 2PYRA 2Y2NA 3Q7VB 5FQ9A 4JGRA 3FYZA 1V9ZA 2JC7A 3TW8A 3RFBA 2Y2GA 4X69A 1ES2A 5TBMA 2ZMFA 1ZKJA 2PT7A 1OTEA 4MMNA 3TSGA 1W8QA 4PHTA 3CHWP 1NJ4A 4HI4A 3UPPA 5J8XA 4M4XA 1L3LA 3Q82A 4R3JA 1ONGA 1NZUA 3WS2A 2Y2LA 1OT9A 4QU3A 5G4YA 3SZTA 5TBMB 2WKQA 4NETA 3NDEA 2IWBA 1D1JA 3OC2A 4KG2A 3ZYTA 3MF0A 4R6LA 2WK0A 3CAXA 1P9WA 3QP4A 5FI7A 2XF3A 3TOIA 3HLWA 2HP6A 3ULFA 2VKSA 3UB5P 4QJGA 2A49A 4II7A 4WEKA 4KZ3A 1DP6A 1ODVA 2VEAA 4DJ2A 4FD8A 3UE6A 3BQ8A 3VV4A 1ZC2A 1NRJA 3IS2A 3QP8A 3BRMA 2VGLS 4CLCD 2JKTM 3IBRA 3CG5A 4EUZA 2HJ9C 1YLJA 1I5QA 1TVFA 3LCEA 4NXBA 3NECA 4LV0A 2AVXA 2ZOHA 3P7NA 1VETA 3VSKA 2H5SA 5HAIA 2QWSA 3G2YA 4RX2A 1L2SA 1O7EA 3IS2B 4LPZA 5HWTA 3LFVA 2D02A 3EEAA 4S2NC 2HZ5A 4Q8IA 5HZHA 3MZFA 4LENA 3FG8A 2WZZA 3GR2A 2QHKA 3MKEA 3C38A 5CECA 4KZ4A 4B88A 4HJ6A 4OPQA 5EFWA 1VETB 4LRXC 2EWWA 3S7PA 4RQ9A 5HSQA 2A24B 2KLIA 2ZC6B 4HHDA 1YAXA 3SW1A 5CGSA 3N7WA 3DTMA 5CRFA 3FZCA 4R70A 2M7VA 1LT0A 1S6RA 3QP5A 3IF6A 2K2NA 1ZG6A 1G28A 3B3XA 4GD6A 3NY4A 5DF8A 3HJKA 4PM5A 1G6AA 1FQGA 4JLFA 3UE3A 2XFSA 1FR6A 4ZRRA 3HLDA 3OBFA 1DJBA 4OLDA 3G35A 1CEGA 3IF6B 2P7JA 4FSFA 3B47A 3C7UA 4EETB 3IXDA 3KYQA 2QYBA 2R9WA 2HDQA 3LY4A 1XJ4A 3MSHA 1XFQA 1SZVA 3JVUA 3DAVA 2RL3A 1S1YA 1TS8A 4GCZA 3E0YA 4WZ4A 5J3WA 5GLCA 3FC7A 3W4QA 3O86A 3QP1A 3V67A 4DE1A 4BD0A 4KQRA 2M7UA 3OOVA 4EBPA 2J9PA 5TGFA 1F9IA 5JYPA 2OAP1 4IVKA 1E4DA 4EBLA 4E3KA 1W63M 2P9VA 2JKFA 1GSXA 3MKFA 1D06A 2V0WA 1H0MA 2XFTA 5GHZA 1M40A 2PBYA 3W4OA 3H82A 4R23A 3Q07A 3IXBA 2W27A 5HARA 2J7VA 4OOMA 3OPLA 2Z6CA 1PZOA 4FH2A 1HZOA 4KENB 1MBLA 4DE0A 3ZG7B 4DMZA 4R4SA 1K54C 2W3HA 3IH8A 2P9VB 4UA9A 5HDCA 4X53A 5HWWA 2ZQ9A 4FTXA 1VQQA 4G3KA 2EA9A 2W3FA
chains in the Genus database with same CATH topology
3F1NB 2BASA 3H82B 5FL3A 4KQOA 4GHIB 3P01A 1BYWA 5DJTA 4HH2A 3FPWA 3CITA 4YNRA 3JVVA 4WLAA 4HQAA 2LB9A 3NOTC 3T50A 3RTYA 2PHYA 3MR0A 4R38A 4I39A 1GSWA 2WKPA 1XJ2A 3EWKA 2FH5A 4JGQA 3NJAA 4HJ3A 2R78A 5IS1A 4PAUA 2J3TC 5F5YA 4XT2A 4HJ4A 1TS6A 3S7OA 1OPXA 1STZA 5AVEA 1YKDA 3H9WA 3LR4A 3R4KA 3CLOA 4EXOA 1N9NA 4JGOA 4HP4A 3UB9A 4UQIS 5HPFA 3G6OA 3PHYA 1NWZA 3T4SA 4GS9A 4HY8A 1JNUA 2L1MA 1OJGA 3T4KA 1H8MA 3BJNA 2W3GA 3EGXC 3BQAA 3KX0X 4I38A 5AJGA 2VZWA 5J4EA 4FOFA 5HDSA 2YKHA 5A8BA 1OTIA 1VHMA 4I3IA 1LSXA 4XT2B 1TS0A 4BBVA 3B42A 1S66L 1MC0A 2JKTI 4BJPA 3F1OA 3LI8A 4HIAA 4NXFA 4H6JA 3LR0A 2L0WA 3KSFA 4B9OA 1NLYA 2KDKA 4AFIA 2D01A 4PKYG 1OTDA 4WN5A 4GS9B 1ZTUA 4Y5FA 3T4QA 2M1CA 3CWFA 3E4QA 3MMHA 5IT5A 5DFYA 2J80A 4Q0HA 5AVFA 4F3LA 2GNXA 1T1CA 5HWVA 4UQIM 4ARZA 1UWPX 3BY9A 5F69A 3MQOA 4DJ3A 5DJUA 3D3OA 3F1OB 4H6JB 2ZBBA 1MKMA 3PBOA 2O99A 3LUQA 4CLCC 2VJWA 1N9LA 3LIEA 5C5KA 2A24A 3E4PA 4L9GA 4EUVA 1F5MA 3EQVA 3R7WA 4NXGA 4CLCE 4G3WA 2PR6A 4F3LB 2JKRI 1WA9A 2PYRA 2HJEA 3K2NA 4ETZA 4ARZB 1UGUA 1OJ5A 3S7QA 4JGRA 1TS7A 1V9ZA 2HF6A 2O9AA 3TW8A 2VX8A 3BWLA 3RFBA 5MC7A 1D7EA 5TBMA 3CI6A 2J3TD 5DF9A 2GZAA 2ZMFA 3E98A 1T19A 2PT7A 1OTEA 3MJQA 4MMNA 4O8GA 4I3AA 2PD7A 4PHTA 3T4LA 4WL9A 4HI4A 1G6OA 2DMWA 3R7WB 3OLOA 4MCWA 1YSPA 4M4XA 4MN5A 5HPIA 1UWNX 3K3DA 4CQHA 3NOPC 1LSVA 4YWZA 5LBRA 4EEUA 2K7SA 3D72A 2PD8A 1XJ3A 3B33A 4Y3IA 3C2WA 1OT9A 5G4YA 3GECA 5TBMB 1TF1A 4UEYA 2WKQA 5KSHA 1T1BA 3T4JA 4NKPA 3OC2A 4OOLA 3ZYTA 2GX5A 3ICYA 3MF0A 3PBSA 4NEED 4R6LA 1GSVA 2CMNA 2L4RA 5L8MA 3CAXA 3IBJA 1P9WA 4BMWA 2I9VA 4BWIA 3ZQ5A 2G7UA 2OWJA 3KYZA 5DKKA 1VB6A 4LRZE 3ULFA 2VKSA 4L0LA 5HL6A 3K3CA 4II7A 2VV6A 2W3DA 4WF0A 4WEKA 3LIDA 2LB5A 1DP6A 3TRCA 3NHQA 4MN6A 4Q0IA 1ODVA 1S67L 2VA0A 1OTBA 2GJ3A 2VEAA 4DJ2A 4HOIA 2VV7A 2INWA 3UE6A 3A0SA 3BQ8A 1DP9A 3VV4A 1XJ6A 1P97A 1T1AA 1NRJA 2KOIA 3EEHA 1T18A 1X0OA 3IS2A 4IUKA 3UMDA 4PKYA 2VGLS 4CLCD 4E04A 4GLQA 2JKTM 5K5BA 2W1RA 3IBRA 2HJ9C 2H28A 3W2ZA 1MZUA 2JHEA 4G3VA 4NXBA 5HD3A 2ZOHA 3T4OA 1OTAA 3P7NA 2V1BA 4O01A 1KOUA 2ZMVA 1NLZA 5G4ZA 2QWSA 4IHQA 5CX7A 1XFNA 1ZHHB 4GJ4A 3IS2B 4LPZA 5HWTA 3PXPA 3LFVA 4IUHA 2D02A 3EEAA 4O0PA 4I5SA 5HZHA 3TJZC 3UB8A 3LR3A 3LR5A 1IOUA 2JN7A 3FG8A 2QHKA 1F98A 2NUPC 2OOLA 3C38A 2VGLM 4BBUA 1S1ZA 3LIBA 4HJ6A 5EFWA 3PBRA 4EESA 2QJ5A 2JKRM 3C8CA 4LRXC 3RH8B 3KSHA 3F1PA 3HCYA 3VE4A 1N9OA 1OT6A 2EWWA 2HGVA 4KUOA 3CUEA 3S7PA 2XROA 4RQ9A 5HSQA 2A24B 2W0NA 2KLIA 3UB7A 4HHDA 2V1AA 3MQ0A 1YAXA 3SW1A 2O9CA 1DRMA 4JGPA 5I5LA 3LYXA 3UB6A 5F68A 4R70A 3LI9A 2M7VA 1LT0A 2A2LA 3PR6A 4Z1WA 3HJIA 4EERA 2K2NA 2HV1A 1Y28A 1G28A 2Y8HA 4YOFA 3A0VA 4IJGA 4R3AA 5TJJA 2IA2A 4HH3A 3LICA 3HJKA 4Y2FA 3F1PB 1S4RA 3KSIA 3TE8A 1S4SA 3UE3A 2Y79A 3O5YA 4KQDA 4I3JA 4ZRRA 3MXQA 2ZOIA 3EGDC 3OCLA 3EQUA 5HDDA 2EWVA 3BY8A 4CLCA 4QPRA 2P08A 3E4OA 3MFXA 3OBFA 3VE3A 2W3EA 3VOLA 2K31A 2P7JA 2QKPA 3U2AA 4LLOB 4FSFA 4WUJA 3UMEA 1V9YA 4HNBA 3B47A 4EETB 3GDIA 4ETXA 3KYQA 2QYBA 1LL8A 4NXEA 4MDZA 2V9AA 1XJ4A 2QJ7A 3PBTA 2YKFA 2XA7S 5J7EA 1XFQA 3JVUA 1S1YA 3NOUC 1TS8A 4WEJA 3KO6A 4EU0A 4GCZA 3E0YA 4P6ZS 4CLCB 2OWHA 3CUEC 4MN7A 4EW7A 5J3WA 4L9FA 3T4TA 4K08A 3FC7A 1TD5A 2O9BA 3H7WA 1EW0A 3C30A 2VLGA 4LRYC 2W1TA 2XRNA 3V67A 2WKRA 2M7UA 1IFQA 3OOVA 1P0ZA 5DFXA 4EQ1A 1F9IA 4KUKA 2VV8A 1DP8A 2B02A 2OAP1 3LIFA 4BBTA 1W63M 2PR5A 4HP9A 3PYPA 2J3WA 2O0YA 1GSXA 1P9RA 1D06A 3S7NA 2V0WA 3A0RA 5F6AA 4DN0A 4L9EA 2XA7M 2Z6DA 3EOIA 3F1NA 3H82A 2V0UA 2PYPA 2OAQ1 5KIZA 5HD5A 3H7WB 4GHIA 5DKLA 2W27A 2W1TB 3BW6A 4P6ZM 4OOMA 4Q0JA 3OCNA 1H3QA 1W63Q 2Z6CA 4WELA 2XSSA 1YSQA 4GW9A 3PBQA 2P04A 4DMZA 3KSGA 2B18A 2W3HA 3FPVA 3DBAA 3PBNA 2PDRA 5IU1A 4B93A 4EEPA 5HDCA 3MQQA 2MJ6A 5HWWA 2NUTC 1LSWA 2FZ0A 3LIAA 4G3KA 4ME4A 2EA9A 2KX6A 2W3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BQ8 A;  3BQA A;  1YAX A;  4UEY A; 
#chains in the Genus database with same CATH topology
 3H82 B;  5FAS A;  4JXS A;  3ZGA B;  1BYW A;  5DJT A;  3HL9 A;  1LLB A;  4HH2 A;  5FQQ A;  2OLU A;  1NYM A;  1HVB A;  2LB9 A;  2WAE A;  1K0K A;  5F83 A;  3RTY A;  4QD4 A;  1FIK A;  3IF5 A;  4I39 A;  4S2J A;  5I94 A;  3IX8 A;  4UAA A;  2VGJ A;  4XT2 A;  1L0G A;  1RP5 A;  2XDM A;  1L0E A;  1PW1 A;  2JBF A;  3FV7 A;  2UV0 E;  1PI4 A;  5TR7 A;  4EXO A;  4MBH A;  4LFU A;  3UB9 A;  5M19 A;  5HFO A;  4PM7 A;  1NWZ A;  5DF7 A;  1OJG A;  3AGF A;  2WUQ A;  4FCF A;  3BJN A;  5EVI C;  5KZH A;  4RX3 A;  2W3G A;  4OP8 A;  1PZP A;  2VZW A;  2Y2I A;  5A8B A;  3ZG5 A;  3NCK A;  3BEC A;  4XT2 B;  4BBV A;  1PRQ A;  4UHU A;  3CZD A;  1Y54 A;  5M18 A;  4MNR A;  2ZQA A;  1IYQ A;  4Y5F A;  5D3O A;  3CWF A;  5DFY A;  2J80 A;  5AQB A;  4ZJ2 A;  3M2J A;  4HES A;  3BY9 A;  4D2O A;  4JKT A;  4DJ3 A;  4JF5 A;  3TG9 A;  3ZDJ A;  4JPM A;  4NG2 A;  2XR0 A;  4DDY A;  4LCM A;  4OP5 A;  4CLC C;  2VJW A;  3JYI A;  2WAF A;  2EFX A;  2Y2Q A;  5FEG A;  2V1Z A;  4OH0 A;  4LV3 A;  3EQV A;  1RGZ A;  1MXO A;  3Q81 A;  4K91 A;  4KZB A;  4GKU A;  4OLG A;  1UGU A;  3DWZ A;  3G31 A;  5FEF A;  1J9M A;  2Z2L B;  1GA0 A;  1BUE A;  3SH9 A;  3CI6 A;  4HBU A;  4DKI A;  3N6I A;  4E6W A;  3E98 A;  4JF4 A;  1T19 A;  3MJQ A;  2JKG A;  4O7D A;  1VM1 A;  1Q2P A;  4O8G A;  2Q9N A;  4EWF A;  3RJU A;  4BLM A;  3OLO A;  1HLU P;  5HPI A;  5CHU A;  1UWN X;  2X71 A;  3HLE A;  4S2M A;  3MZD A;  5A90 A;  1I2W A;  3Q7Z A;  4WMC A;  4YWZ A;  4EEU A;  3D72 A;  2PD8 A;  3B33 A;  4Y3I A;  3C2W A;  5A93 A;  4QB8 A;  3GEC A;  1Z09 A;  3T4J A;  1KVL A;  1YPR A;  4NKP A;  3PBS A;  4NEE D;  1SDN A;  2XLN A;  3G4P A;  4OQ0 A;  1H8Z A;  2G7U A;  4DE2 A;  1VB6 A;  4QHC A;  4MBK A;  2E8J A;  1K6S A;  2VV6 A;  4E3J A;  2LB5 A;  4MN6 A;  1S67 L;  2GJ3 A;  2ZQ8 A;  2INW A;  3ZFZ A;  1P97 A;  1T1A A;  2KOI A;  1X0O A;  1SKF A;  4PKY A;  4GLQ A;  2EX6 A;  2Y2M A;  3UPN A;  1BTL A;  3V3R A;  5FA7 A;  4RVA A;  2UWX A;  3W2Z A;  3FKW A;  4DDS A;  4R0Q A;  3SH7 A;  1EI5 A;  5GHY A;  4X55 A;  3T4O A;  1JWZ A;  4RYE A;  4O01 A;  1CK3 A;  2ZMV A;  1NLZ A;  3HUM A;  3VP0 A;  4IHQ A;  3BFC A;  3MS6 A;  4ID4 A;  3ZNY A;  3PXP A;  3ITB A;  1BLC A;  1QME A;  5L10 A;  3TJZ C;  3WRZ A;  3LR5 A;  1IOU A;  2JN7 A;  2GDN A;  2HPB A;  1N9B A;  2NUP C;  4UA7 A;  3BFD A;  4Y7P A;  3IQA A;  1MY8 A;  1YT4 A;  3IHA A;  1PFL A;  4EES A;  1NRF A;  3DTI A;  4HBT A;  3RH8 B;  3F1P A;  3VE4 A;  1FIL A;  4PM8 A;  3ZG0 A;  2HGV A;  2XRO A;  2W0N A;  3ISG A;  2V1A A;  3FWL A;  1DRM A;  1LI0 A;  3G30 A;  4JXW A;  3HLG A;  3T1S A;  3LI9 A;  4Z1W A;  3UDF A;  3OPH A;  3ZVW A;  4EER A;  2Y8H A;  3A0V A;  4IJG A;  3C7V A;  4HH3 A;  4Y2F A;  2ZC3 B;  3F1P B;  3KSI A;  3TE8 A;  1S4S A;  1KE3 A;  3D4F A;  3O5Y A;  1BUL A;  3V50 A;  4KQD A;  4K0W A;  4WZ5 A;  3AGE A;  3DW0 A;  2EWV A;  2ZM8 A;  1H8Y A;  3HLF A;  4B4X A;  3E4O A;  3MFX A;  1MWR A;  1RCJ A;  4WUJ A;  2B5R A;  2XEP A;  3GDI A;  4ETX A;  4Y17 A;  1LL8 A;  4NXE A;  4MDZ A;  4WMC D;  2V9A A;  1IEM A;  2XA7 S;  3WWX A;  3VP2 A;  3BEB A;  5EM0 A;  3NOU C;  2CC1 A;  4EU0 A;  3QP6 A;  2ZC5 B;  1ESI A;  4MN7 A;  3VOZ A;  2FFY A;  4DXC A;  1BLH A;  1TD5 A;  5CEB A;  1EW0 A;  3P98 A;  4BL3 A;  3C30 A;  2VLG A;  3S4X A;  3OZH A;  4WBG A;  4C6Y A;  2XRN A;  1IFQ A;  4P87 A;  4EQ1 A;  4KG6 A;  3IF6 C;  4D60 A;  1K4F A;  1XA7 A;  4XXR A;  4HP9 A;  1GHP A;  1Y4O A;  3NBL A;  2EX9 A;  1FR1 A;  3A0R A;  2WKE A;  3VP3 A;  4L9E A;  3T1Q B;  4JF6 A;  2V0U A;  1ONH A;  5KIZ A;  5HD5 A;  3WS4 A;  4GHI A;  5IHV A;  4P6Z M;  3OCN A;  1H3Q A;  1W63 Q;  1FCO A;  1HD8 A;  2VGK A;  2PBD P;  1YQS A;  2HDS A;  3ITA A;  1BLP A;  5CGX A;  3KSG A;  3GQZ A;  3PBN A;  4EEP A;  3IWQ A;  4KQQ A;  2MJ6 A;  4X25 A;  5DTT A;  2NUT C;  3LIA A;  1EWZ A;  4NXG A;  1MKI A;  3HUN A;  2QMI A;  4GHI B;  1ERM A;  3FPW A;  3S22 A;  4OVD A;  3NDG A;  4YNR A;  5E2H A;  3JVV A;  4WLA A;  2PHY A;  4YFM A;  2HDR A;  1GA9 A;  5L2F A;  2Z2M B;  3L9K A;  3NJA A;  4DXB A;  5IS1 A;  4GB7 A;  3N8S A;  1PNE A;  1SDE A;  1TS6 A;  3S7O A;  1XX2 A;  3PTE A;  4CJN A;  3VP1 A;  3H9W A;  2XH9 A;  4S2N A;  1N9N A;  5HPF A;  3PHY A;  3DTE A;  3GSG A;  1I2S A;  4OPZ A;  1H8M A;  1CQA A;  5HW3 A;  4RA7 A;  5GHX A;  1FCN A;  3BQA A;  3KX0 X;  4I38 A;  1MPL A;  3N8R A;  1N4O A;  3SS4 A;  5DTK A;  2YKH A;  1OTI A;  2OSU A;  4C3Q A;  3NI9 A;  1LSX A;  1TS0 A;  1U60 A;  3B42 A;  1S66 L;  1CI8 A;  1MC0 A;  2JKT I;  1Q2Q A;  4BJP A;  3F1O A;  3LI8 A;  3WS0 A;  4HIA A;  5HAP A;  1IYS A;  5FAP A;  1CI9 A;  2L0W A;  3VFF A;  3KSF A;  3V3S A;  3CMZ A;  4PM9 A;  4B9O A;  4AFI A;  2D01 A;  1C3B A;  4Y13 A;  4PKY G;  5A92 A;  2I72 A;  3AGD A;  5EPH A;  4DRT A;  4F3L A;  1NXY A;  5HWV A;  4UQI M;  2XD1 A;  4ARZ A;  1MWS A;  1YLW A;  1UWP X;  5EV0 A;  5U47 A;  4E3O A;  5FAQ A;  5EOE A;  4M3K A;  3ZNT A;  3F1O B;  5G18 A;  2FFF B;  2ZBB A;  1MKM A;  3PBO A;  4JBF A;  4ZAM A;  3LIE A;  5EVE A;  3E4P A;  3MFD A;  2HP5 A;  4G3W A;  3WS5 A;  4F3L B;  5F1F A;  2V20 A;  3K2N A;  3T12 B;  4LCL A;  4ARZ B;  4QY6 A;  5AQA A;  4IED A;  1M6K A;  1PW8 A;  2HF6 A;  2WGV A;  2VX8 A;  1D7E A;  4NK3 A;  4ZJ3 A;  4DE3 A;  5EOO A;  2J3T D;  5DF9 A;  2V8F A;  1WE4 A;  5E43 A;  3T4L A;  1W8Y A;  2Y2O A;  4WL9 A;  1G6O A;  4MCW A;  3K3D A;  4CQH A;  2X02 A;  4UA6 A;  3NOP C;  4E3N A;  5LBR A;  4Y0T A;  1XJ3 A;  5CED A;  2IWC A;  5TFQ A;  4S2P A;  5KSH A;  2B95 A;  4GZB A;  4S2O A;  5AQ9 A;  1XA1 A;  2EX8 A;  3NC8 A;  1W5D A;  2GX5 A;  1GSV A;  2CMN A;  5L8M A;  4BMW A;  2I9V A;  3RXX A;  5DKK A;  1CEF A;  5HL6 A;  3K3C A;  2Y2K A;  3GMW A;  2W3D A;  3E2K A;  3LID A;  3TRC A;  3NHQ A;  3BFG A;  4Q0I A;  3HLC A;  1OTB A;  1YLZ A;  1E3U A;  4HOI A;  2VV7 A;  2Y2P A;  3QNC A;  5HAQ A;  1DP9 A;  1XJ6 A;  5FI6 A;  3EEH A;  1XP4 A;  4IUK A;  4KZ5 A;  2H28 A;  4ZTK A;  1ACF A;  3VOY A;  4KZA A;  1MZU A;  2BTF P;  4KZ8 A;  5FAT A;  5HD3 A;  2ZM0 A;  1OTA A;  2V1B A;  1KOU A;  3VP4 A;  3UNW A;  3QNB A;  5G4Z A;  4XUX A;  1XFN A;  5CER A;  4GJ4 A;  4E6X A;  1IKI A;  3UN7 A;  4GNU A;  5HX9 A;  1G5U A;  3UB8 A;  4X68 A;  1ERO A;  1E25 A;  3IXG A;  4MEZ A;  1ES4 A;  3T1X A;  2VGL M;  5HL1 A;  5EVI A;  2ZM2 A;  1KGG A;  3U4L P;  5CHM A;  1L0F A;  3PBR A;  4XUZ A;  1IYO A;  2JKR M;  5JYO A;  4WYY A;  3KSH A;  5FAO A;  2ZQD A;  5BOH A;  4A5R A;  2HDU A;  3A3E A;  1OT6 A;  3CUE A;  1RGY A;  3BM6 A;  5GLB A;  3MQ0 A;  2O9C A;  4JGP A;  3LYX A;  3UB6 A;  1ALQ A;  2DCF A;  3A3F A;  4GDN A;  3PR6 A;  3HJI A;  5EVI B;  4N9L A;  2PRF A;  3IWI A;  2HV1 A;  1Y28 A;  4YOF A;  4PMA A;  2IA2 A;  4QWO A;  1K57 A;  2EX2 A;  5F1G A;  1TDG A;  3MXQ A;  3PAE A;  3EGD C;  3OCL A;  4CPK A;  1K56 A;  3BY8 A;  4CLC A;  4P6B A;  1GHM A;  3N4I A;  3VE3 A;  4EV4 A;  1K38 A;  1BLS A;  4C75 A;  2W3E A;  3VOL A;  5DVA A;  2QKP A;  1K55 A;  4R3B A;  3U2A A;  3GRJ A;  3GV9 A;  2ZD8 A;  3OPP A;  5DTS A;  2PU2 A;  3PBT A;  5J7E A;  3SS3 A;  1YM1 A;  2WGW A;  5L09 A;  3HUO A;  3KO6 A;  2ZQ7 A;  2OLV A;  4CLC B;  4EW7 A;  2IWD A;  1OME A;  2QZ6 A;  3UDX A;  2O9B A;  1AXB A;  2WKR A;  1JVJ A;  3E2L A;  5DFX A;  4KUK A;  3A3I A;  1DP8 A;  2WGW B;  4OON A;  3VSL A;  2PR5 A;  3PYP A;  2J3W A;  3S7N A;  4P0M A;  2XQZ A;  5CHJ A;  5F6A A;  4PM6 A;  4DN0 A;  1E3U D;  2Z6D A;  1FOF A;  3EOI A;  3ZG8 B;  2Y2H A;  4WZ5 C;  3C5A A;  4ZDX A;  2OAQ 1;  5DKL A;  3A3J A;  2XSS A;  3PBQ A;  2P04 A;  1KDS A;  3MXS A;  2B18 A;  4IBR A;  2EXB A;  5FQJ A;  2VK3 A;  3MQQ A;  5GL9 A;  4Z9Q A;  1LSW A;  2FZ0 A;  4Y15 A;  4ME4 A;  2PYP A;  2KX6 A;  4H8R A;  5FL3 A;  1LL5 A;  2V2F F;  5CTN A;  3SH8 A;  3N8L A;  4E3M A;  4IBX A;  4B4Z A;  4R38 A;  2G2W A;  2R9X A;  4U0X A;  1GSW A;  1XJ2 A;  3EWK A;  1H5X A;  5EVI D;  2R78 A;  4BEN A;  2J3T C;  4HJ4 A;  1STZ A;  5AVE A;  3R4K A;  1YLY A;  3OPR A;  3CLO A;  4JGO A;  4Y0U A;  5EUA A;  1FSY A;  4HY8 A;  1JNU A;  4ZBE A;  3ZG9 B;  5FQI A;  1IEL A;  4S2L A;  2ZJ9 A;  5CGW A;  5HDS A;  1K4E A;  3V5M A;  2JCH A;  3ZCZ A;  1W7F A;  2Y91 A;  4KZ9 A;  4X56 A;  1FSW A;  2ACG A;  4NXF A;  3O88 A;  3LR0 A;  2XD5 A;  3VFH A;  3G34 A;  3BLM A;  1OTD A;  2M1C A;  1K56 D;  4N1H A;  3E4Q A;  5IT5 A;  2HP9 A;  5AVF A;  3C4P A;  4Q0H A;  4F94 A;  1DJA A;  1L0D A;  1TDL A;  5M1A A;  2ZC7 A;  1LHY A;  1S0W A;  5F69 A;  1KGE A;  3MQO A;  3ZVT A;  5KMW A;  1IKG A;  5DJU A;  3ZHH A;  3D3O A;  5EM1 A;  3KYE A;  3D9Y A;  2WKI A;  1WYC A;  2O99 A;  2WZX A;  3QP2 A;  5C5K A;  3W8K A;  2A24 A;  3UPO A;  4L9G A;  1DY6 A;  1F5M A;  3R7W A;  2PR6 A;  1ESU A;  5CXW A;  1DJC A;  3LEQ A;  2HJE A;  4ETZ A;  1SCW A;  1YMX A;  1OJ5 A;  3Q1F A;  3S7Q A;  3CPT A;  1TS7 A;  2O9A A;  3BWL A;  5MC7 A;  3O87 A;  3HVF A;  4MLL A;  3IXH A;  4R1G A;  1K25 A;  2ZLY A;  2GZA A;  3NIA A;  4FH4 A;  4I3A A;  4KZ6 A;  4PPR A;  3DTK A;  2PD7 A;  3UO9 A;  2P74 A;  2DMW A;  3R7W B;  3IWO A;  4MBF A;  1BZA A;  2OV5 A;  1YSP A;  4MN5 A;  2Q0O A;  5E2E A;  4GN2 A;  2BLS A;  1LSV A;  3CPT B;  2K7S A;  1PYY A;  4YIN A;  1F2K A;  1TF1 A;  3BLS A;  1HTZ A;  2V8C A;  4LV2 A;  4UEY A;  1T1B A;  4U0T A;  2X01 A;  4OOL A;  3ICY A;  2ZMA A;  2L4R A;  2Q9M A;  5E2G A;  3IBJ A;  4BWI A;  3ZQ5 A;  2OWJ A;  3KYZ A;  1YLT A;  1KVM A;  4LRZ E;  2QPN A;  4L0L A;  1MWU A;  1MWT A;  1KE4 A;  2Y2J A;  4Y0O A;  4WF0 A;  4E3I A;  2VA0 A;  3IT9 A;  2XK1 A;  3G2Z A;  2PU4 A;  3LGO A;  3A0S A;  1O07 A;  3P09 A;  1T18 A;  1PI5 A;  2JE5 A;  3O3V A;  3UMD A;  5E2F A;  4N1X A;  2WKH A;  4KZ7 A;  1XPB A;  4E04 A;  5K5B A;  2W1R A;  5EE8 A;  3GVB A;  2H10 A;  1GHI A;  2JHE A;  4G3V A;  4S2K A;  1SHV A;  2C6W B;  4X6T A;  1BSG A;  2ZQC A;  1PWC A;  2WGI A;  5CX7 A;  1ZHH B;  3BFF A;  4IUH A;  4O0P A;  4I5S A;  3LR3 A;  5L07 A;  3UDI A;  1XXM A;  1F98 A;  1ES3 A;  3IX3 A;  2OOL A;  1BT5 A;  3LY3 A;  4OKP A;  2G2U A;  4BBU A;  1GCE A;  1S1Z A;  3LIB A;  4OQI A;  5A91 A;  4U3T A;  4QY5 A;  2QJ5 A;  3C8C A;  3HCY A;  1N9O A;  4KUO A;  3UB7 A;  1KGF A;  1A0K A;  3SOI A;  1XKZ A;  5I5L A;  3RXW A;  5F68 A;  3DWK A;  3L7H A;  4IVI A;  3M2K A;  4OPY A;  3T1R A;  4BL2 A;  2A2L A;  5FDS A;  3PAG A;  2A3U A;  4R3A A;  4ZJ1 A;  5TJJ A;  3LIC A;  1S4R A;  3V39 A;  2Y79 A;  4LV1 A;  1CJF A;  2J9O A;  4I3J A;  3GTC A;  2ZOI A;  1YLP A;  3EQU A;  3IH9 A;  4ESP A;  5HDD A;  2C5W B;  4QPR A;  2P08 A;  3M6B A;  2ZC4 B;  4JXG A;  1K6R A;  4P85 A;  2K31 A;  4R4R A;  2Y59 A;  4LLO B;  3UME A;  1K54 A;  3MBZ A;  2H0Y A;  5FQM A;  1V9Y A;  4HNB A;  4FUW A;  3G32 A;  2QJ7 A;  2YKF A;  1JTG A;  2H0T A;  1W79 A;  5EVL A;  1CF0 A;  4WEJ A;  2ZL1 A;  1AWI A;  1SKO A;  4KG5 A;  1PWD A;  4WM9 A;  4P6Z S;  1QMF A;  2OWH A;  3CUE C;  5F82 A;  3S1Y A;  4L9F A;  3HLB A;  3T4T A;  4K08 A;  3H7W A;  4LRY C;  1KE0 A;  2W1T A;  4N92 A;  1FCM A;  2PAV P;  5FDH A;  3QHY A;  1P0Z A;  1PIO A;  1JWV A;  2BG1 A;  2VV8 A;  2B02 A;  1G68 A;  3LIF A;  4BBT A;  2O0Y A;  2ZL1 B;  1P9R A;  4S2I A;  1SKO B;  5GLD A;  4HEF A;  1K57 C;  4OOY A;  5KSC A;  2XA7 M;  3A3D A;  3F1N A;  1IYP A;  2DRW A;  3H7W B;  2W1T B;  3BW6 A;  4BQM A;  4Q0J A;  5FSR A;  4GOG A;  3M6H A;  4WEL A;  4GW9 A;  1YSQ A;  3WS1 A;  3MZE A;  1LI9 A;  1K55 C;  3FPV A;  3JPU A;  3DBA A;  2PDR A;  5IU1 A;  4B93 A;  3LEZ A;  5FI2 A;  1J3W A;  4E3L A;  3WRT A;  2DNS A;  4OQH A;  1TEM A;  3C4O A;  1NYY A;  3SS5 A;  3F1N B;  1XGI A;  2BAS A;  1XGJ A;  4KQO A;  3P01 A;  2RCX A;  3W4P A;  4EBN A;  1LL9 A;  2EXA A;  3BYD A;  3CIT A;  4JXV A;  4X1M A;  4HQA A;  3NOT C;  3T50 A;  3MR0 A;  1NY0 A;  3UE0 A;  1NZO A;  3MXR A;  2WKP A;  3UE1 A;  2FH5 A;  4JGQ A;  1KDW A;  1PWG A;  4HJ3 A;  4OQG A;  4PAU A;  5F5Y A;  2E8I A;  3FKV A;  2EFU A;  5EEC A;  1OPX A;  1Z6F A;  3IX4 A;  1YKD A;  3LR4 A;  5AQ7 A;  4HP4 A;  4UQI S;  4DF6 A;  3G6O A;  3IHB A;  4GD8 A;  3T4S A;  4GS9 A;  5CTM A;  2L1M A;  2XGN A;  4N9K A;  3T4K A;  3EGX C;  5AJG A;  5J4E A;  4EQI A;  4FOF A;  3LO7 A;  1VHM A;  4I3I A;  3BFE A;  1YMS A;  3I7J A;  1JWP A;  4H6J A;  1ZG4 A;  1VEU A;  2WYX A;  5GLA A;  4K0X A;  1NLY A;  2KDK A;  1JTD A;  4WN5 A;  4GS9 B;  1ZTU A;  3HRE A;  3T4Q A;  3MMH A;  4LGW A;  1WYB A;  2GNX A;  3HBR A;  1T1C A;  2WAD A;  2Y4A A;  3Q7V A;  2J8Y A;  1ERQ A;  4OPR A;  4GDB A;  4BD1 A;  4H6J B;  1VEU B;  3LUQ A;  1ES5 A;  3VMA A;  1N9L A;  4X1L A;  4EUV A;  4CLC E;  3UY6 A;  3CJM A;  5FQK A;  2JKR I;  2Y55 A;  1WA9 A;  3NUL A;  2PYR A;  2Y2N A;  3Q7V B;  5FQ9 A;  4JGR A;  3FYZ A;  1V9Z A;  2JC7 A;  3TW8 A;  3RFB A;  2Y2G A;  4X69 A;  1ES2 A;  5TBM A;  2ZMF A;  1ZKJ A;  2PT7 A;  1OTE A;  4MMN A;  3TSG A;  1W8Q A;  4PHT A;  3CHW P;  1NJ4 A;  4HI4 A;  3UPP A;  5J8X A;  4M4X A;  1L3L A;  3Q82 A;  4R3J A;  1ONG A;  1NZU A;  3WS2 A;  2Y2L A;  1OT9 A;  4QU3 A;  5G4Y A;  3SZT A;  5TBM B;  2WKQ A;  4NET A;  3NDE A;  2IWB A;  1D1J A;  3OC2 A;  4KG2 A;  3ZYT A;  3MF0 A;  4R6L A;  2WK0 A;  3CAX A;  1P9W A;  3QP4 A;  5FI7 A;  2XF3 A;  3TOI A;  3HLW A;  2HP6 A;  3ULF A;  2VKS A;  3UB5 P;  4QJG A;  2A49 A;  4II7 A;  4WEK A;  4KZ3 A;  1DP6 A;  1ODV A;  2VEA A;  4DJ2 A;  4FD8 A;  3UE6 A;  3BQ8 A;  3VV4 A;  1ZC2 A;  1NRJ A;  3IS2 A;  3QP8 A;  3BRM A;  2VGL S;  4CLC D;  2JKT M;  3IBR A;  3CG5 A;  4EUZ A;  2HJ9 C;  1YLJ A;  1I5Q A;  1TVF A;  3LCE A;  4NXB A;  3NEC A;  4LV0 A;  2AVX A;  2ZOH A;  3P7N A;  1VET A;  3VSK A;  2H5S A;  5HAI A;  2QWS A;  3G2Y A;  4RX2 A;  1L2S A;  1O7E A;  3IS2 B;  4LPZ A;  5HWT A;  3LFV A;  2D02 A;  3EEA A;  4S2N C;  2HZ5 A;  4Q8I A;  5HZH A;  3MZF A;  4LEN A;  3FG8 A;  2WZZ A;  3GR2 A;  2QHK A;  3MKE A;  3C38 A;  5CEC A;  4KZ4 A;  4B88 A;  4HJ6 A;  4OPQ A;  5EFW A;  1VET B;  4LRX C;  2EWW A;  3S7P A;  4RQ9 A;  5HSQ A;  2A24 B;  2KLI A;  2ZC6 B;  4HHD A;  1YAX A;  3SW1 A;  5CGS A;  3N7W A;  3DTM A;  5CRF A;  3FZC A;  4R70 A;  2M7V A;  1LT0 A;  1S6R A;  3QP5 A;  3IF6 A;  2K2N A;  1ZG6 A;  1G28 A;  3B3X A;  4GD6 A;  3NY4 A;  5DF8 A;  3HJK A;  4PM5 A;  1G6A A;  1FQG A;  4JLF A;  3UE3 A;  2XFS A;  1FR6 A;  4ZRR A;  3HLD A;  3OBF A;  1DJB A;  4OLD A;  3G35 A;  1CEG A;  3IF6 B;  2P7J A;  4FSF A;  3B47 A;  3C7U A;  4EET B;  3IXD A;  3KYQ A;  2QYB A;  2R9W A;  2HDQ A;  3LY4 A;  1XJ4 A;  3MSH A;  1XFQ A;  1SZV A;  3JVU A;  3DAV A;  2RL3 A;  1S1Y A;  1TS8 A;  4GCZ A;  3E0Y A;  4WZ4 A;  5J3W A;  5GLC A;  3FC7 A;  3W4Q A;  3O86 A;  3QP1 A;  3V67 A;  4DE1 A;  4BD0 A;  4KQR A;  2M7U A;  3OOV A;  4EBP A;  2J9P A;  5TGF A;  1F9I A;  5JYP A;  2OAP 1;  4IVK A;  1E4D A;  4EBL A;  4E3K A;  1W63 M;  2P9V A;  2JKF A;  1GSX A;  3MKF A;  1D06 A;  2V0W A;  1H0M A;  2XFT A;  5GHZ A;  1M40 A;  2PBY A;  3W4O A;  3H82 A;  4R23 A;  3Q07 A;  3IXB A;  2W27 A;  5HAR A;  2J7V A;  4OOM A;  3OPL A;  2Z6C A;  1PZO A;  4FH2 A;  1HZO A;  4KEN B;  1MBL A;  4DE0 A;  3ZG7 B;  4DMZ A;  4R4S A;  1K54 C;  2W3H A;  3IH8 A;  2P9V B;  4UA9 A;  5HDC A;  4X53 A;  5HWW A;  2ZQ9 A;  4FTX A;  1VQQ A;  4G3K A;  2EA9 A;  2W3F A; 
#chains in the Genus database with same CATH homology
 3F1N B;  2BAS A;  3H82 B;  5FL3 A;  4KQO A;  4GHI B;  3P01 A;  1BYW A;  5DJT A;  4HH2 A;  3FPW A;  3CIT A;  4YNR A;  3JVV A;  4WLA A;  4HQA A;  2LB9 A;  3NOT C;  3T50 A;  3RTY A;  2PHY A;  3MR0 A;  4R38 A;  4I39 A;  1GSW A;  2WKP A;  1XJ2 A;  3EWK A;  2FH5 A;  4JGQ A;  3NJA A;  4HJ3 A;  2R78 A;  5IS1 A;  4PAU A;  2J3T C;  5F5Y A;  4XT2 A;  4HJ4 A;  1TS6 A;  3S7O A;  1OPX A;  1STZ A;  5AVE A;  1YKD A;  3H9W A;  3LR4 A;  3R4K A;  3CLO A;  4EXO A;  1N9N A;  4JGO A;  4HP4 A;  3UB9 A;  4UQI S;  5HPF A;  3G6O A;  3PHY A;  1NWZ A;  3T4S A;  4GS9 A;  4HY8 A;  1JNU A;  2L1M A;  1OJG A;  3T4K A;  1H8M A;  3BJN A;  2W3G A;  3EGX C;  3BQA A;  3KX0 X;  4I38 A;  5AJG A;  2VZW A;  5J4E A;  4FOF A;  5HDS A;  2YKH A;  5A8B A;  1OTI A;  1VHM A;  4I3I A;  1LSX A;  4XT2 B;  1TS0 A;  4BBV A;  3B42 A;  1S66 L;  1MC0 A;  2JKT I;  4BJP A;  3F1O A;  3LI8 A;  4HIA A;  4NXF A;  4H6J A;  3LR0 A;  2L0W A;  3KSF A;  4B9O A;  1NLY A;  2KDK A;  4AFI A;  2D01 A;  4PKY G;  1OTD A;  4WN5 A;  4GS9 B;  1ZTU A;  4Y5F A;  3T4Q A;  2M1C A;  3CWF A;  3E4Q A;  3MMH A;  5IT5 A;  5DFY A;  2J80 A;  4Q0H A;  5AVF A;  4F3L A;  2GNX A;  1T1C A;  5HWV A;  4UQI M;  4ARZ A;  1UWP X;  3BY9 A;  5F69 A;  3MQO A;  4DJ3 A;  5DJU A;  3D3O A;  3F1O B;  4H6J B;  2ZBB A;  1MKM A;  3PBO A;  2O99 A;  3LUQ A;  4CLC C;  2VJW A;  1N9L A;  3LIE A;  5C5K A;  2A24 A;  3E4P A;  4L9G A;  4EUV A;  1F5M A;  3EQV A;  3R7W A;  4NXG A;  4CLC E;  4G3W A;  2PR6 A;  4F3L B;  2JKR I;  1WA9 A;  2PYR A;  2HJE A;  3K2N A;  4ETZ A;  4ARZ B;  1UGU A;  1OJ5 A;  3S7Q A;  4JGR A;  1TS7 A;  1V9Z A;  2HF6 A;  2O9A A;  3TW8 A;  2VX8 A;  3BWL A;  3RFB A;  5MC7 A;  1D7E A;  5TBM A;  3CI6 A;  2J3T D;  5DF9 A;  2GZA A;  2ZMF A;  3E98 A;  1T19 A;  2PT7 A;  1OTE A;  3MJQ A;  4MMN A;  4O8G A;  4I3A A;  2PD7 A;  4PHT A;  3T4L A;  4WL9 A;  4HI4 A;  1G6O A;  2DMW A;  3R7W B;  3OLO A;  4MCW A;  1YSP A;  4M4X A;  4MN5 A;  5HPI A;  1UWN X;  3K3D A;  4CQH A;  3NOP C;  1LSV A;  4YWZ A;  5LBR A;  4EEU A;  2K7S A;  3D72 A;  2PD8 A;  1XJ3 A;  3B33 A;  4Y3I A;  3C2W A;  1OT9 A;  5G4Y A;  3GEC A;  5TBM B;  1TF1 A;  4UEY A;  2WKQ A;  5KSH A;  1T1B A;  3T4J A;  4NKP A;  3OC2 A;  4OOL A;  3ZYT A;  2GX5 A;  3ICY A;  3MF0 A;  3PBS A;  4NEE D;  4R6L A;  1GSV A;  2CMN A;  2L4R A;  5L8M A;  3CAX A;  3IBJ A;  1P9W A;  4BMW A;  2I9V A;  4BWI A;  3ZQ5 A;  2G7U A;  2OWJ A;  3KYZ A;  5DKK A;  1VB6 A;  4LRZ E;  3ULF A;  2VKS A;  4L0L A;  5HL6 A;  3K3C A;  4II7 A;  2VV6 A;  2W3D A;  4WF0 A;  4WEK A;  3LID A;  2LB5 A;  1DP6 A;  3TRC A;  3NHQ A;  4MN6 A;  4Q0I A;  1ODV A;  1S67 L;  2VA0 A;  1OTB A;  2GJ3 A;  2VEA A;  4DJ2 A;  4HOI A;  2VV7 A;  2INW A;  3UE6 A;  3A0S A;  3BQ8 A;  1DP9 A;  3VV4 A;  1XJ6 A;  1P97 A;  1T1A A;  1NRJ A;  2KOI A;  3EEH A;  1T18 A;  1X0O A;  3IS2 A;  4IUK A;  3UMD A;  4PKY A;  2VGL S;  4CLC D;  4E04 A;  4GLQ A;  2JKT M;  5K5B A;  2W1R A;  3IBR A;  2HJ9 C;  2H28 A;  3W2Z A;  1MZU A;  2JHE A;  4G3V A;  4NXB A;  5HD3 A;  2ZOH A;  3T4O A;  1OTA A;  3P7N A;  2V1B A;  4O01 A;  1KOU A;  2ZMV A;  1NLZ A;  5G4Z A;  2QWS A;  4IHQ A;  5CX7 A;  1XFN A;  1ZHH B;  4GJ4 A;  3IS2 B;  4LPZ A;  5HWT A;  3PXP A;  3LFV A;  4IUH A;  2D02 A;  3EEA A;  4O0P A;  4I5S A;  5HZH A;  3TJZ C;  3UB8 A;  3LR3 A;  3LR5 A;  1IOU A;  2JN7 A;  3FG8 A;  2QHK A;  1F98 A;  2NUP C;  2OOL A;  3C38 A;  2VGL M;  4BBU A;  1S1Z A;  3LIB A;  4HJ6 A;  5EFW A;  3PBR A;  4EES A;  2QJ5 A;  2JKR M;  3C8C A;  4LRX C;  3RH8 B;  3KSH A;  3F1P A;  3HCY A;  3VE4 A;  1N9O A;  1OT6 A;  2EWW A;  2HGV A;  4KUO A;  3CUE A;  3S7P A;  2XRO A;  4RQ9 A;  5HSQ A;  2A24 B;  2W0N A;  2KLI A;  3UB7 A;  4HHD A;  2V1A A;  3MQ0 A;  1YAX A;  3SW1 A;  2O9C A;  1DRM A;  4JGP A;  5I5L A;  3LYX A;  3UB6 A;  5F68 A;  4R70 A;  3LI9 A;  2M7V A;  1LT0 A;  2A2L A;  3PR6 A;  4Z1W A;  3HJI A;  4EER A;  2K2N A;  2HV1 A;  1Y28 A;  1G28 A;  2Y8H A;  4YOF A;  3A0V A;  4IJG A;  4R3A A;  5TJJ A;  2IA2 A;  4HH3 A;  3LIC A;  3HJK A;  4Y2F A;  3F1P B;  1S4R A;  3KSI A;  3TE8 A;  1S4S A;  3UE3 A;  2Y79 A;  3O5Y A;  4KQD A;  4I3J A;  4ZRR A;  3MXQ A;  2ZOI A;  3EGD C;  3OCL A;  3EQU A;  5HDD A;  2EWV A;  3BY8 A;  4CLC A;  4QPR A;  2P08 A;  3E4O A;  3MFX A;  3OBF A;  3VE3 A;  2W3E A;  3VOL A;  2K31 A;  2P7J A;  2QKP A;  3U2A A;  4LLO B;  4FSF A;  4WUJ A;  3UME A;  1V9Y A;  4HNB A;  3B47 A;  4EET B;  3GDI A;  4ETX A;  3KYQ A;  2QYB A;  1LL8 A;  4NXE A;  4MDZ A;  2V9A A;  1XJ4 A;  2QJ7 A;  3PBT A;  2YKF A;  2XA7 S;  5J7E A;  1XFQ A;  3JVU A;  1S1Y A;  3NOU C;  1TS8 A;  4WEJ A;  3KO6 A;  4EU0 A;  4GCZ A;  3E0Y A;  4P6Z S;  4CLC B;  2OWH A;  3CUE C;  4MN7 A;  4EW7 A;  5J3W A;  4L9F A;  3T4T A;  4K08 A;  3FC7 A;  1TD5 A;  2O9B A;  3H7W A;  1EW0 A;  3C30 A;  2VLG A;  4LRY C;  2W1T A;  2XRN A;  3V67 A;  2WKR A;  2M7U A;  1IFQ A;  3OOV A;  1P0Z A;  5DFX A;  4EQ1 A;  1F9I A;  4KUK A;  2VV8 A;  1DP8 A;  2B02 A;  2OAP 1;  3LIF A;  4BBT A;  1W63 M;  2PR5 A;  4HP9 A;  3PYP A;  2J3W A;  2O0Y A;  1GSX A;  1P9R A;  1D06 A;  3S7N A;  2V0W A;  3A0R A;  5F6A A;  4DN0 A;  4L9E A;  2XA7 M;  2Z6D A;  3EOI A;  3F1N A;  3H82 A;  2V0U A;  2PYP A;  2OAQ 1;  5KIZ A;  5HD5 A;  3H7W B;  4GHI A;  5DKL A;  2W27 A;  2W1T B;  3BW6 A;  4P6Z M;  4OOM A;  4Q0J A;  3OCN A;  1H3Q A;  1W63 Q;  2Z6C A;  4WEL A;  2XSS A;  1YSQ A;  4GW9 A;  3PBQ A;  2P04 A;  4DMZ A;  3KSG A;  2B18 A;  2W3H A;  3FPV A;  3DBA A;  3PBN A;  2PDR A;  5IU1 A;  4B93 A;  4EEP A;  5HDC A;  3MQQ A;  2MJ6 A;  5HWW A;  2NUT C;  1LSW A;  2FZ0 A;  3LIA A;  4G3K A;  4ME4 A;  2EA9 A;  2KX6 A;  2W3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...