4OQHA

Crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying r164s mutation in complex with boron-based inhibitor ec25
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extended spectrum beta-lactamase TEM-63
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 97
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oqhA00
2HDSA 5FASA 2UWXA 4OONA 2XQZA 3NIAA 4XXRA 2WZZA 2ZM8A 5GHZA 2HP5A 2ZM2A 1G68A 3HLDA 3P09A 1GCEA 3D4FA 4Z9QA 5AQ9A 2G2WA 4X6TA 3HL9A 3GTCA 4OQGA 4FCFA 5FDHA 3C4PA 3SS3A 1XGIA 5FQ9A 3O3VA 3DW0A 1ES4A 4BD1A 1RGZA 4JF6A 4ZTKA 1PZPA 4DE1A 1EROA 3BFDA 2IWDA 4GD8A 4S2NC 1KVMA 2ZQAA 1JWPA 1YT4A 4WZ4A 5GLAA 1EI5A 3HUNA 2VGKA 4B4ZA 2Y2JA 1K54A 2V1ZA 4PM9A 4S2OA 3HLCA 4U0XA 5GLDA 1YLWA 3UDFA 1BLSA 2FFFB 5EVLA 2Y2GA 4OPYA 1BLHA 1MWTA 2ZLYA 3HLBA 1YQSA 4KG2A 3V50A 2ZC4B 2C5WB 4X56A 4FD8A 5FAPA 4GB7A 4WEKA 2OV5A 5EVIB 1H8ZA 1ONGA 3PBQA 5GHXA 1BUEA 2GDNA 3G31A 3A3IA 3MKEA 4OPRA 5U47A 2EX6A 4PM5A 3Q07A 4R4SA 4KZ4A 1W7FA 2Y2QA 1Q2QA 3QNBA 4WZ5A 1NJ4A 2ZQ8A 1N4OA 2DCFA 5JYPA 4DXBA 1I2SA 5DF7A 1KDSA 3I7JA 5I94A 3QNCA 4DF6A 1LHYA 1K4FA 3NDGA 3IT9A 5A91A 3ZGAB 2XDMA 3HLFA 3C7VA 1PWCA 2XF3A 4OQHA 5FA7A 4GN2A 4P87A 5FATA 3P98A 3VFHA 2JE5A 3G30A 4IBRA 4KZ7A 4BENA 4OQ0A 4BJPA 1KGGA 4RYEA 3PBNA 4R3JA 3HLWA 1U60A 5J8XA 2RL3A 1JTDA 3MXRA 1E4DA 1FCNA 4KQQA 2QPNA 1SCWA 4K91A 1Q2PA 2X71A 3G2ZA 1YLZA 3A3DA 4WBGA 3PAEA 3G32A 5CXWA 4N9KA 2QMIA 3LCEA 3G35A 2IWBA 1VM1A 1Z6FA 4EBPA 2WKEA 2HP9A 5F1FA 2HP6A 3MZFA 3ZHHA 2P9VA 4HEFA 3WRTA 1K54C 3S1YA 2Y2IA 2ZC5B 4R1GA 2Y2OA 4N1HA 1JTGA 3N8SA 4LV2A 1XA1A 3RXWA 1JWZA 5FI6A 2XFTA 3SS4A 2ZJ9A 4DKIA 2QZ6A 3PTEA 1PWGA 1ES3A 3NY4A 3WS4A 4OOMA 4IVIA 4JXVA 4FH4A 4U3TA 4UA6A 5KSCA 2H5SA 1PI4A 1RGYA 1YMXA 3FWLA 1TEMA 3ISGA 1MWUA 5CHJA 5HFOA 4N9LA 3PBTA 1KE0A 4KZ6A 4QD4A 4M3KA 4P6BA 2ZQCA 2ZM0A 3E2LA 5E2HA 2A3UA 4ZJ3A 2WK0A 5CHUA 4B88A 1K56D 4YFMA 4CPKA 1CI8A 3RJUA 1NZUA 5EE8A 1FOFA 2WGWB 1XXMA 3FYZA 4MBHA 3HUMA 3GR2A 4JKTA 5FI2A 1LL9A 1ZC2A 4Y7PA 5TFQA 2ZD8A 4R0QA 3FKVA 3BLMA 3NBLA 5AQ7A 3N8RA 1FCOA 3Q7ZA 4S2KA 1K6RA 2BG1A 3LY3A 4PPRA 5CERA 4C6YA 2XD5A 4RA7A 4DXCA 4NETA 3W4OA 2P74A 1CI9A 1TVFA 1MWSA 1GA9A 2CC1A 3M2JA 4Y0UA 5EUAA 1Y54A 1O7EA 3M6HA 1IELA 3N8LA 4PMAA 1K38A 5BOHA 3VSLA 5M19A 3A3EA 2RCXA 3WS1A 4MEZA 2Q9MA 1K6SA 3V3SA 4DE2A 3V5MA 5FQJA 2PU4A 3ZCZA 1K57A 4KZ8A 5FQKA 3BLSA 3PBSA 4S2JA 3UE3A 1K56A 4JF5A 5IHVA 3ZNTA 5HL1A 4CJNA 3AGEA 2XLNA 3UE0A 5HW3A 4EBLA 1W8QA 4O7DA 4BL2A 4E6XA 4MLLA 1XKZA 4Y0OA 1LL5A 3BFEA 1QMEA 1GA0A 1LI9A 1VQQA 3BYDA 4DE3A 2EXBA 4MBKA 5M1AA 1QMFA 3Q81A 2FFYA 4ZAMA 4LCLA 3VFFA 5M18A 1PW8A 3HLEA 5E2EA 4KZ9A 4Y0TA 3LEZA 1H8YA 1S6RA 4MNRA 3G34A 3WWXA 4OOLA 5E2GA 1YLPA 2BLSA 4FH2A 4OH0A 4X55A 2WGVA 3C7UA 3IF6A 2WKHA 1DY6A 3CMZA 1XP4A 1BULA 1PIOA 3DTMA 3C5AA 3NCKA 4KQRA 4GKUA 3IH8A 4OLDA 4JXGA 3G2YA 1HZOA 4KQOA 1MKIA 3FZCA 5EPHA 4OVDA 3MBZA 1NRFA 4BQMA 2B5RA 4DRTA 4H8RA 4ID4A 3JYIA 3OCNA 3MFDA 2WYXA 4XUXA 3BFCA 4PM6A 3BFGA 3TG9A 5CGXA 5CHMA 2HDRA 4P85A 4DDSA 4L0LA 1S0WA 3EQVA 1IYQA 5DVAA 5HAPA 4WELA 2JBFA 5HAIA 5GHYA 1NZOA 4S2LA 1K57C 4HBTA 2Y2LA 4JXWA 4LENA 3MXSA 3BRMA 5EOOA 1HTZA 1FSYA 2H0YA 4F94A 2R9XA 1DJCA 3N4IA 3VP4A 1IYPA 2EXAA 1M40A 1PWDA 3UDXA 3UNWA 1IEMA 1LLBA 3N7WA 4JF4A 4WEJA 3AGFA 4RVAA 3MZDA 4OKPA 2C6WB 4S2MA 3SH9A 5L2FA 5HX9A 1BT5A 3W4PA 3PAGA 4JXSA 3GVBA 1J9MA 3UPPA 4JBFA 2Y4AA 1BSGA 3WS0A 5JYOA 3HUOA 1I2WA 1HVBA 3SH7A 4LV0A 4Q8IA 1PI5A 1TDLA 1MXOA 1O07A 4KZAA 4P0MA 3IF6B 2HDUA 2WGIA 4OP8A 2Q9NA 5FAOA 3IF6C 4GOGA 3IF5A 1KGFA 1ZKJA 4ZJ1A 1FQGA 3DWKA 2OLVA 3OZHA 5GLBA 1KVLA 2XH9A 3ZG5A 2ZMAA 5CRFA 3ZVTA 1CEGA 1FSWA 2DNSA 4R3BA 3WS5A 5FI7A 1ERQA 4IVKA 1MY8A 1SDNA 5HAQA 1I5QA 1ONHA 1ERMA 2J7VA 4EWFA 3LO7A 5FAQA 5EVID 3M2KA 4E3KA 1DJBA 4LCMA 1L0DA 2EFXA 5CECA 3PBRA 1SHVA 4OPQA 1ESIA 4WMCD 1JVJA 3BEBA 4C3QA 3MZEA 2XGNA 2WAEA 3IHBA 1L0GA 4BD0A 2ZQ7A 1WYCA 2OLUA 4R23A 1OMEA 3QHYA 2PBYA 1E3UD 4E3LA 5DTKA 2Y91A 1TDGA 1GHIA 3WRZA 1YLYA 1HD8A 4XUZA 5E2FA 2P9VB 3ZG8B 2ZC6B 3O87A 5F82A 3IXBA 1W8YA 1IYOA 4E3OA 3OCLA 2XK1A 5EVIA 1L0FA 3ITAA 3B3XA 4R4RA 1ES2A 1L2SA 1ESUA 4KZBA 1PZOA 3E2KA 3OPHA 4OP5A 1ALQA 4KZ5A 3AGDA 4WMCA 1YLJA 2Y59A 4E3MA 3VP1A 2OSUA 1KDWA 1MPLA 4OLGA 1NYYA 5TGFA 5D3OA 3ZFZA 4QJGA 4GZBA 4B4XA 5CGWA 4RX2A 3V3RA 3VP2A 3ITBA 4E3NA 2Z2LB 4QY6A 5KMWA 5FQIA 1K25A 1E3UA 1NXYA 1YMSA 2JCHA 2Z2MB 4C75A 5A90A 3HREA 2Y2PA 4QY5A 2X01A 3ZVWA 3CJMA 5CTMA 3WS2A 3OPRA 3VOYA 2WAFA 3IXHA 1KE4A 1ZG4A 3VSKA 3LY4A 5FQQA 2PU2A 3UO9A 1ZG6A 1BZAA 1CEFA 1G6AA 1YM1A 5TR7A 3UPOA 4GD6A 2A49A 3BM6A 5HARA 4A5RA 5EOEA 3IWIA 5CEBA 1RCJA 3HBRA 2I72A 4MBFA 3IQAA 2XFSA 1FR6A 3NC8A 3V39A 3GSGA 2X02A 4UA7A 5F83A 4GDNA 3BECA 4BLMA 4D2OA 4OQIA 1C3BA 3SS5A 1W79A 1ES5A 1SDEA 2ZQDA 4GDBA 5CTNA 1IYSA 1DJAA 4S2IA 5FSRA 2EX8A 3NI9A 5A92A 3ZG9B 3GMWA 1JWVA 4FSFA 1SKFA 4ZDXA 1BLCA 4ZBEA 5EVIC 3FV7A 4WYYA 5GLCA 3O88A 4EUZA 1W5DA 2IWCA 4E6WA 2H0TA 4UAAA 1M6KA 1BTLA 3G4PA 4HESA 4EQIA 3A3FA 3PBOA 4PM7A 3IXGA 3IXDA 1IKIA 1FCMA 4JPMA 2Y2NA 1XA7A 4X69A 3M6BA 3SOIA 5AQBA 3VP3A 1K4EA 5DF8A 3W4QA 2WGWA 3MKFA 4IEDA 5KZHA 1K55A 1PW1A 5AQAA 3A3JA 4QB8A 3IHAA 2XD1A 5EECA 4RX3A 3Q82A 1EWZA 4KENB 4WM9A 2J9PA 2EX9A 2ZQ9A 5GL9A 2ZC7A 2R9WA 2Y55A 4YINA 4DDYA 3IH9A 1L0EA 3NDEA 3O86A 1BLPA 3Q7VA 3SH8A 3GQZA 4LV1A 3OC2A 1E25A 1LI0A 2XR0A 3UY6A 4NK3A 3VOZA 1FR1A 3IWOA 2Y2KA 4N1XA 2Y2MA 3ZG0A 2DRWA 2HDQA 1H5XA 1WYBA 1XX2A 3OPLA 3IWQA 1PYYA 4OOYA 4KG6A 3HLGA 2EFUA 2J8YA 4ZJ2A 2V20A 1KGEA 1IKGA 2ZC3B 3UDIA 3FKWA 3HVFA 4OPZA 1NY0A 3TSGA 4E3JA 2J9OA 1RP5A 2V2FF 3GV9A 1YLTA 1GHMA 4BL3A 1XPBA 1GHPA 2WZXA 4QHCA 4UA9A 2E8IA 3DWZA 4GNUA 4S2NA 3S22A 3ZDJA 4KZ3A 4WZ5C 5A93A 1CK3A 5KSHA 2XEPA 4HBUA 5F1GA 3UE1A 4EBNA 1MWRA 3VMAA 3C4OA 2EX2A 3GRJA 3W8KA 1KE3A 1K55C 3CZDA 3EQUA 3RXXA 4DE0A 5DF9A 1XGJA 1MBLA 5FQMA 4K0XA 5G18A 1N9BA 5CEDA 3Q1FA 4KG5A 3UN7A 4U0TA 4K0WA 3BFFA 3CG5A 1WE4A 4UHUA 4X53A 3ZG7B 4LV3A 4S2PA 5DTTA 2JC7A 2VGJA 2H10A 4N92A 5E43A 2WKIA 4IBXA 1NYMA 3Q7VB 3VP0A 4E3IA 2WUQA 2WADA 5CGSA 3N6IA 3OPPA 2G2UA 3TOIA 4PM8A 2HPBA 1AXBA 2Y2HA 4QU3A 3UPNA 4X68A 4JLFA 4EV4A 3S4XA 5DTSA 3ZNYA
chains in the Genus database with same CATH superfamily
2UWXA 4JGPA 3T50A 2ZM8A 3CAXA 3P09A 1GCEA 3D4FA 3QP6A 5AQ9A 2G2WA 4X6TA 3HL9A 4FTXA 3T1XA 4Y15A 1XGIA 4WLAA 4HHDA 4JF6A 4DE1A 1EROA 2WKQA 2ZQAA 1YT4A 1EI5A 2VGKA 2Y79A 4B4ZA 1K54A 3BWLA 3NHQA 4U0XA 4OPYA 3HLBA 1VB6A 4GB7A 1S66L 1BUEA 3G6OA 5U47A 2G7UA 1W7FA 4WZ5A 1NJ4A 1I2SA 4XT2A 1KDSA 3I7JA 4MN7A 4G3KA 4DF6A 1LHYA 3IT9A 3ZGAB 2XDMA 2JKTI 1PWCA 4OQHA 3MQOA 4P87A 3P98A 1OTAA 4OQ0A 1E4DA 1SCWA 1Q2PA 4IUKA 5FEFA 2X71A 2E8JA 4QWOA 4N9KA 3OOVA 3LCEA 3TE8A 2WKEA 2HP6A 2P9VA 3WRTA 4R1GA 3N8SA 1JWZA 2PHYA 3SS4A 3H9WA 4DKIA 2QZ6A 1ES3A 3H7WA 3HJKA 4JXVA 1YMXA 3FWLA 3KO6A 4GJ4A 3E98A 2WK0A 2PD7A 4FUWA 2M7VA 1CI8A 4NXGA 3MQQA 5EE8A 1FOFA 4BMWA 3HUMA 5FI2A 4JKTA 5EM0A 4F3LB 2ZD8A 3BLMA 3NBLA 3N8RA 4S2KA 2XA7M 3UB8A 3LI9A 4C6YA 1CI9A 3QP1A 5J7EA 1GA9A 3M2JA 4Y0UA 3K2NA 4GS9B 1O7EA 3N8LA 3A3EA 5HPFA 3V3SA 4DE2A 2PU4A 3ZCZA 5FQKA 2R78A 5MC7A 3DTEA 4I3AA 2XLNA 3UE0A 3NOPC 1W8QA 4EBLA 4E6XA 2EWWA 3BFEA 1SKOA 2EXBA 5M1AA 3Q81A 4ZAMA 5M18A 1OT6A 5L8MA 4M4XA 5E2EA 2XRNA 1T19A 3G34A 1S1ZA 3C7UA 3IF6A 2WKHA 3NOTC 3VV4A 3IH8A 4OLDA 3OBFA 1F5MA 3CI6A 3E4PA 4Y13A 1MKIA 3MBZA 1L3LA 2V0WA 4H8RA 1NLYA 3MF0A 3MFDA 4X1LA 5HAPA 1DP8A 1NZOA 3CHWP 2FH5A 3DTKA 4JXWA 3FPVA 3IBRA 4I5SA 1FSYA 1DJCA 1T18A 3LR5A 5I5LA 1IYPA 1PWDA 2VEAA 3UNWA 3VP4A 1IEMA 1LLBA 3SH9A 4NEED 4P6ZM 4JXSA 3GVBA 1J9MA 3UPPA 5J4EA 2Y4AA 3WS0A 3S7OA 4PKYA 4KZAA 1OTIA 1O07A 2HDUA 3MXQA 2VKSA 3A0RA 1X0OA 4LRZE 3IF5A 1S4RA 4GCZA 2I9VA 4YWZA 3T1SA 1ZKJA 4ZJ1A 1KOUA 2QJ5A 3BQ8A 4KUOA 4HP4A 2ZMAA 1CEGA 1F2KA 1SDNA 1GSWA 4XT2B 3LO7A 5EVID 3F1PA 3M2KA 4MDZA 2EFXA 4BBVA 1VETA 4ZRRA 2XGNA 3IHBA 2ZQ7A 1WYCA 5DTKA 2Y91A 3C2WA 2D02A 1YLYA 3PYPA 2P9VB 3ZG8B 5F82A 1W8YA 5IT5A 1P9WA 4EETB 3OCLA 2XK1A 1L0FA 3ITAA 5HD3A 3H7WB 4MCWA 1FIKA 4L9GA 4KZ5A 1MPLA 5D3OA 1PNEA 4B4XA 3VP2A 4E3NA 2Z2LB 3F1OA 5KMWA 2Z2MB 1YMSA 2FZ0A 2X01A 4CQHA 3OPRA 2WAFA 1STZA 4LLOB 1YM1A 5TR7A 3UPOA 2ACGA 2A49A 4A5RA 5CEBA 3EGDC 1RCJA 3HBRA 1FR6A 5F83A 2O9AA 1VHMA 2LB5A 1W79A 2ZQDA 3MS6A 5CTNA 3GECA 4WF0A 1D1JA 3LR0A 1W5DA 1SKOB 1M6KA 3G4PA 4Q0IA 2PYRA 3IXGA 3IXDA 4JPMA 3SOIA 3W4QA 3MKFA 4KQDA 1IFQA 2OWHA 2ZQ9A 2HJEA 2KOIA 3NDEA 3SH8A 4Q0JA 4LV1A 1E25A 1PFLA 4ETXA 3UY6A 1F98A 1FR1A 4GW9A 1XJ2A 3S7NA 2Y2KA 2DRWA 2HDQA 1XX2A 3KSIA 2J8YA 1KGEA 3FKWA 3HVFA 3QP5A 2J9OA 1RP5A 2Z6DA 1XPBA 3LR3A 3LIDA 5A93A 4KZ3A 5KSHA 4HBUA 4I39A 1KE3A 1K55C 3RXXA 5G18A 4K0XA 1N9BA 3LFVA 3UN7A 4KG5A 4U0TA 4K0WA 3CG5A 3T1QB 4X53A 3LI8A 4S2PA 2VGJA 1OJ5A 1VEUA 2WKIA 5E43A 4E3IA 3KYEA 2HV1A 4X68A 3S4XA 3P7NA 3R7WA 5FASA 3O5YA 3F1PB 2WKPA 4JGRA 3IX4A 2HP5A 2ZM2A 4PHTA 5TJJA 1TS8A 3PXPA 1VETB 4HP9A 4FCFA 5FQ9A 3O3VA 1RGZA 4ZTKA 4CLCA 2IWDA 3HUNA 1DP6A 5GLDA 4MMNA 3UDFA 1YLWA 1ZTUA 3V50A 1SZVA 4FD8A 5FAPA 2NUTC 4WEKA 2OV5A 1H8ZA 3G31A 2EX6A 2Y2QA 3QNBA 3ZYTA 2ZQ8A 1S67L 4Y2FA 1TS6A 3NJAA 3UB6A 3NDGA 3HLFA 2UV0E 5FA7A 3VFHA 2JE5A 3G30A 1KGGA 1OTEA 3PBNA 1OPXA 1ZHHB 3HLWA 4Z1WA 2RL3A 1H3QA 2QPNA 4GS9A 3E0YA 3NULA 3PAEA 1DP9A 2QMIA 2IA2A 3G35A 2IWBA 2HP9A 4EUVA 1K54C 1LSVA 2Y2OA 2ZJ9A 3WS4A 3MSHA 4UA6A 4FH4A 4U3TA 5KSCA 2VK3A 1RGYA 3ISGA 3CWFA 4M3KA 2VV7A 5E2HA 4ZJ3A 3ZNYA 4B88A 3RJUA 3FYZA 4MBHA 4Y7PA 5F68A 2BG1A 4PPRA 5CERA 2V9AA 1MKMA 1TVFA 2CC1A 1Y54A 1IELA 4PMAA 5M19A 2RCXA 2Q9MA 1K6SA 2DMWA 3V5MA 3B42A 1K57A 3U2AA 5EFWA 1K56A 5HL1A 3L9KA 3AGEA 1XKZA 1LL5A 1VQQA 4G3WA 5EM1A 4LCLA 2V8CA 3VFFA 2PAVP 5E2GA 4HJ4A 4FH2A 4OH0A 4X55A 2NUPC 1DY6A 3CMZA 1BULA 5DKLA 3PR6A 3FZCA 3FPWA 4OVDA 2B5RA 4ID4A 5AJGA 3JYIA 1VEUB 3OCNA 4ESPA 3VE3A 2WYXA 4XUXA 3V67A 4P85A 5HDSA 4DDSA 3EQVA 4II7A 5DVAA 3R7WB 2W0NA 1IOUA 2PD8A 2EA9A 2R9XA 4HH2A 4HH3A 1M40A 4WEJA 4RVAA 1N9NA 2B95A 3MZDA 2BASA 3PAGA 4CLCB 1MZUA 4JBFA 1BSGA 2HGVA 5JYOA 5KIZA 3HUOA 1I2WA 1HVBA 3SH7A 4LV0A 4Q8IA 5EV0A 1MXOA 4P0MA 3JVVA 2WGIA 3MFXA 2Q9NA 3IF6C 4GOGA 3DWKA 3UB9A 1KVLA 2XH9A 4UQIM 5CRFA 2DNSA 5FI7A 1ERQA 4IVKA 2PYPA 1I5QA 4WUJA 2J7VA 2HZ5A 3TW8A 2K31A 2VJWA 5L09A 1G5UA 1DJBA 4LCMA 5AVFA 3PBRA 1SHVA 4WMCD 1JVJA 2WAEA 1L0GA 3QHYA 2V1AA 1E3UD 3T1RA 5A8BA 3WRZA 1OT9A 1BYWA 4XUZA 3UE6A 3NECA 4R4RA 3CPTB 4EU0A 1PZOA 4OP5A 3OPHA 1ALQA 3AGDA 2Y59A 3VP1A 4GZBA 4RX2A 4QY6A 3IS2A 3HCYA 4C75A 3HREA 2Y2PA 3CJMA 3CUEA 3TJZC 3VOYA 1KE4A 2W1RA 3LUQA 1ZG4A 3VSKA 5HL6A 1CF0A 3BM6A 5HARA 3IWIA 3T4KA 3NC8A 3BY8A 2X02A 5HPIA 3BECA 4BLMA 1ES5A 3LGOA 4CLCE 1DJAA 4S2IA 5FSRA 2EX8A 2QWSA 4P6ZS 4FSFA 3T4TA 4L9FA 4ZBEA 2M7UA 1W63Q 5FL3A 4E6WA 4HESA 2ZMVA 3A3FA 3PBOA 1H8MA 1IKIA 2Y2NA 5DF8A 4AFIA 2WGWA 1TD5A 5AQAA 3A3JA 3IHAA 2XD1A 2VGLM 3Q82A 3E4OA 4WM9A 2J9PA 2ZC7A 2R9WA 4DDYA 1BLPA 3D9YA 3OC2A 4NK3A 3VOZA 3IWOA 3SZTA 4WL9A 3OPLA 4DMZA 3HLGA 2EFUA 2V20A 1IKGA 2KLIA 2W3HA 4E3JA 1D7EA 1GHMA 4S2NA 3ZDJA 2XEPA 3T12B 3UE1A 3VMAA 4YOFA 3W8KA 4GHIA 5FQMA 1XGJA 1OTBA 4H6JA 5CEDA 4Y3IA 4UEYA 5HWVA 1WA9A 4UHUA 3QP4A 2H10A 3Q7VB 2QYBA 2WADA 2G2UA 3TOIA 2HPBA 3UPNA 4EV4A 1GSXA 2AVXA 3FC7A 4OONA 3NIAA 2W1TA 1G68A 2GNXA 4Y17A 1EW0A 3QP8A 2HJ9C 5HWTA 4OQGA 5FDHA 2VV6A 3C4PA 2VLGA 3DW0A 1W63M 4BD1A 2OAQ1 1JWPA 4WZ4A 5GLAA 2Y2JA 3LEQA 3HLCA 2ZLYA 3UMDA 1YQSA 4KG2A 2C5WB 1MC0A 2W27A 3A0SA 2P08A 3PBQA 5GHXA 3EGXC 2GDNA 3MKEA 3A3IA 1XJ3A 1Q2QA 3T4QA 4DXBA 1D06A 4R6LA 3QNCA 3IS2B 1K4FA 5A91A 3D72A 3C7VA 3BY9A 4GN2A 5FATA 4BJPA 4BENA 4G3VA 4RYEA 4R3JA 5J8XA 3MXRA 3W2ZA 3JPUA 1FCNA 4KQQA 3IX8A 3G2ZA 1YLZA 3A3DA 3EEAA 4WBGA 5HWWA 4HY8A 3G32A 5CXWA 2W3DA 1T1AA 4CLCC 1Z6FA 3MZFA 2Y2IA 2K2NA 4DJ2A 1XA1A 3RXWA 2XFTA 2KX6A 3NY4A 4OOMA 2W3GA 3UB5P 2H5SA 1PI4A 5HDCA 5HFOA 1TEMA 5CHJA 1MWUA 3DBAA 4QD4A 3PBTA 4KZ6A 4P6BA 2ZQCA 2ZM0A 2A3UA 4MN6A 4HI4A 4CPKA 1NZUA 2WGWB 1XXMA 3GR2A 1LL9A 5DFXA 5TFQA 4IJGA 3FKVA 5AQ7A 4HOIA 2PR5A 4ARZA 4YNRA 5G4ZA 3LY3A 4DJ3A 1YPRA 2XD5A 3W4OA 2P74A 1MWSA 2PR6A 5EUAA 3M6HA 1K38A 3WS1A 5FQJA 4I3IA 1TS0A 4KZ8A 3BLSA 4S2JA 3UE3A 2QKPA 3ZNTA 4CJNA 2Z6CA 5HW3A 2VV8A 4O7DA 4MLLA 4DE3A 4MBKA 1QMFA 1J3WA 3HLEA 4KZ9A 2YKHA 1YLPA 1S1YA 4GHIB 2ZBBA 4IUHA 1XP4A 1PIOA 3DTMA 3C5AA 1G6OA 2ZL1A 4GKUA 4H6JB 3G2YA 1HZOA 4KQOA 4HNBA 4DRTA 3BFGA 5CGXA 1S0WA 1IYQA 4WELA 2JBFA 5HAIA 5GHYA 1K57C 2W1TB 4HBTA 5DJTA 2H0YA 2P7JA 3PHYA 4RQ9A 3KSHA 2EXAA 4JF4A 3AGFA 4OKPA 4S2MA 3W4PA 2O9CA 1H0MA 2PBDP 2Q0OA 1N9LA 2O0YA 4HIAA 3SW1A 4OP8A 1YSQA 5FAOA 3CPTA 1TS7A 2OLVA 3ZG5A 2L0WA 3ZVTA 3R4KA 4R3BA 3FG8A 5HAQA 4EESA 1ONHA 1ERMA 1UWNX 4E3KA 4B93A 4IHQA 4OPQA 1P97A 3BEBA 5TBMA 1Y4OA 4C3QA 3MZEA 1S4SA 4BD0A 1T1BA 1K0KA 5HZHA 2OLUA 2INWA 4R23A 2OAP1 2PBYA 2JN7A 1HD8A 5CX7A 2ZC6B 3C38A 3T4OA 3P01A 1IYOA 5EVIA 3B3XA 1ES2A 3L7HA 5G4YA 1F9IA 3E2KA 4E3MA 1NYYA 3ZFZA 4BBTA 1YKDA 3KX0X 2A24B 1K25A 1NXYA 4LPZA 2P04A 3LY4A 3UO9A 1ZG6A 1G6AA 4ARZB 4GD6A 5EOEA 1LL8A 4BBUA 3IQAA 3EWKA 2XFSA 3EOIA 2OWJA 4UA7A 4ETZA 4D2OA 4OQIA 3VOLA 1SDEA 4GDBA 3NI9A 3ZG9B 1SKFA 1N9OA 1BLCA 2CMNA 2HF6A 4WYYA 1YAXA 2H0TA 2L1MA 4UAAA 4LRXC 5FDSA 4PM7A 1PRQA 3BW6A 5FEGA 1XA7A 3M6BA 4E3OA 3VP3A 5KZHA 1K4EA 2O9BA 4UQIS 4HJ6A 3CUEC 4QB8A 4O0PA 1HLUP 2ZL1B 2EX9A 5GL9A 2Y55A 4K08A 1L0EA 3O86A 3Q7VA 4NG2A 4X1MA 3GQZA 4LGWA 4I38A 1LI0A 4NXEA 2XA7S 4N1XA 2QHKA 2Y2MA 3ZG0A 1WYBA 5F69A 3IWQA 3KSGA 4OOYA 2M1CA 3UDIA 4OPZA 3TSGA 3GV9A 1YLTA 4UA9A 2MJ6A 2E8IA 4GNUA 5IS1A 1CK3A 1NRJA 3B47A 4HQAA 4FOFA 3QP2A 1XFQA 5DF9A 4DE0A 1MBLA 4LFUA 3Q1FA 5HD5A 1G28A 3BFFA 4CLCD 3ZG7B 3F1NA 2JC7A 4N92A 4IBXA 1AWIA 2WUQA 5CGSA 3N6IA 1V9YA 4PM8A 2Y2HA 4QU3A 5DJUA 1XJ6A 2V8FA 2HDSA 4O01A 2XQZA 4XXRA 2WZZA 5GHZA 3HLDA 1CQAA 3TRCA 1Z09A 4Z9QA 2JKGA 2V0UA 5TBMB 3GTCA 3LR4A 4NXFA 3SS3A 3MQ0A 1ES4A 5LBRA 1PZPA 3BFDA 4S2NC 4GD8A 1KVMA 3H82A 1OTDA 4S2OA 4PM9A 2V1ZA 3MMHA 5A92A 2PT7A 1BLSA 1T1CA 2FFFB 5EVLA 2Y2GA 2J3TC 1BLHA 1MWTA 5L07A 2ZC4B 4X56A 5F5YA 5EVIB 1ONGA 4EEPA 4OPRA 4PM5A 3Q07A 4R4SA 4KZ4A 2K7SA 3K3DA 3D3OA 3VE4A 4B9OA 2B18A 3T4JA 1N4OA 2DCFA 5JYPA 2VGLS 4EXOA 2GZAA 5DF7A 4GLQA 5I94A 2XF3A 4Y5FA 5A90A 5DFYA 4IBRA 3E4QA 4KZ7A 2GJ3A 1FILA 2D01A 1U60A 3LICA 2KDKA 4EQ1A 1JTDA 3LIAA 4K91A 3KSFA 1P0ZA 1VM1A 4EBPA 5F1FA 3ZHHA 4HEFA 3S1YA 2ZC5B 4N1HA 1JTGA 4LV2A 5FI6A 3ULFA 4NKPA 2PDRA 3PTEA 1PWGA 4IVIA 5DKKA 3KYZA 1JNUA 1NLZA 4BL2A 4N9LA 1KE0A 4D60A 2OOLA 3E2LA 2W3FA 5CHUA 1K56D 4YFMA 3RFBA 3OLOA 3RTYA 2WKRA 1ZC2A 3LIEA 3K3CA 3KYQA 4R0QA 1FCOA 3Q7ZA 1K6RA 1V9ZA 4RA7A 4DXCA 4NETA 3BQAA 5BOHA 1YSPA 3VSLA 4MEZA 3CLOA 4WN5A 1NWZA 3PBSA 4JF5A 5IHVA 4KUKA 4LRYC 2JKRM 4Y0OA 1XJ4A 1QMEA 1GA0A 1LI9A 3BYDA 4R38A 3BJNA 2ZOIA 2FFYA 1PW8A 4Y0TA 3LEZA 1H8YA 1S6RA 4MNRA 3WWXA 4OOLA 4NXBA 2BLSA 4ME4A 2WGVA 4EW7A 3NCKA 4KQRA 4JXGA 5EPHA 3UB7A 1NRFA 4PKYG 2V1BA 4BQMA 3F1NB 1UWPX 3A0VA 3T4SA 2EWVA 3BFCA 4I3JA 4PM6A 3TG9A 5CHMA 2HDRA 4L0LA 1LSXA 3UMEA 4S2LA 3RH8B 3T4LA 2Y2LA 4LENA 3MXSA 3BRMA 5EOOA 1HTZA 4F94A 3N4IA 3ZQ5A 3UDXA 3N7WA 3HJIA 2C6WB 5HSQA 5HX9A 1BT5A 5L2FA 2A2LA 1GSVA 4QPRA 3ICYA 3H82B 4R70A 1PI5A 1TDLA 3IF6B 4L9EA 2QJ7A 3IBJA 1KGFA 1FQGA 3OZHA 5GLBA 4E04A 4HJ3A 1FSWA 3WS5A 1MY8A 2JHEA 3B33A 1CJFA 4EWFA 2A24A 5FAQA 1OJGA 3DAVA 2VX8A 1L0DA 2W3EA 5CECA 1ESIA 3C30A 1UGUA 3IX3A 3JVUA 1OMEA 4E3LA 4MN5A 1TDGA 1GHIA 3DTIA 5K5BA 5E2FA 3O87A 3IXBA 2YKFA 3GDIA 1L2SA 1ESUA 4KZBA 4JGQA 2LB9A 4WMCA 1YLJA 5EVEA 4EEUA 2OSUA 1KDWA 4OLGA 2XROA 1TF1A 5TGFA 2ZMFA 4QJGA 5CGWA 3V3RA 5L10A 3ITBA 1P9RA 5FQIA 1E3UA 2JCHA 4DN0A 4QY5A 3ZVWA 1LSWA 2ZOHA 5CTMA 3WS2A 2JKRI 3IXHA 2O99A 3NOUC 5FQQA 2PU2A 1BZAA 1CEFA 2I72A 4MBFA 3V39A 3GSGA 3EEHA 1DRMA 4GDNA 2PRFA 2VZWA 1C3BA 3MJQA 5IU1A 4EERA 3SS5A 1Y28A 1IYSA 4JGOA 3GMWA 1JWVA 4ZDXA 2JKTM 5EVIC 3FV7A 5GLCA 3O88A 4EUZA 2IWCA 1BTLA 4EQIA 1XFNA 3S7PA 3F1OB 1FCMA 2BTFP 4X69A 4R3AA 2J3WA 5AQBA 3LYXA 4IEDA 1K55A 5J3WA 1PW1A 4F3LA 3S7QA 5EECA 4RX3A 1EWZA 4KENB 2J80A 4BWIA 4YINA 3IH9A 1LT0A 3MR0A 5HDDA 2J3TD 4X25A 2H28A 2JKFA 2XR0A 2XSSA 3LIFA 5AVEA 1ACFA 1H5XA 1PYYA 4PAUA 4O8GA 4KG6A 4ZJ2A 2ZC3B 2GX5A 1NY0A 2V2FF 4BL3A 3C8CA 2Y8HA 1GHPA 2WZXA 4QHCA 3DWZA 3S22A 1ODVA 4WZ5C 3LIBA 4Q0HA 3CITA 2L4RA 5F1GA 4EBNA 1MWRA 3C4OA 2EX2A 5C5KA 3GRJA 2B02A 2VA0A 3CZDA 3EQUA 3U4LP 1WE4A 5F6AA 4LV3A 5DTTA 1NYMA 3VP0A 3OPPA 1AXBA 4JLFA 5DTSA 1A0KA
chains in the Genus database with same CATH topology
2HDSA 5FASA 2UWXA 4OONA 2XQZA 3NIAA 4XXRA 2WZZA 2ZM8A 5GHZA 2HP5A 2ZM2A 1G68A 3HLDA 3P09A 1GCEA 3D4FA 4Z9QA 5AQ9A 2G2WA 4X6TA 3HL9A 3GTCA 4OQGA 4FCFA 5FDHA 3C4PA 3SS3A 1XGIA 5FQ9A 3O3VA 3DW0A 1ES4A 4BD1A 1RGZA 4JF6A 4ZTKA 1PZPA 4DE1A 1EROA 3BFDA 2IWDA 4GD8A 4S2NC 1KVMA 2ZQAA 1JWPA 1YT4A 4WZ4A 5GLAA 1EI5A 3HUNA 2VGKA 4B4ZA 2Y2JA 1K54A 2V1ZA 4PM9A 4S2OA 3HLCA 4U0XA 5GLDA 1YLWA 3UDFA 1BLSA 2FFFB 5EVLA 2Y2GA 4OPYA 1BLHA 1MWTA 2ZLYA 3HLBA 1YQSA 4KG2A 3V50A 2ZC4B 2C5WB 4X56A 4FD8A 5FAPA 4GB7A 4WEKA 2OV5A 5EVIB 1H8ZA 1ONGA 3PBQA 5GHXA 1BUEA 2GDNA 3G31A 3A3IA 3MKEA 4OPRA 5U47A 2EX6A 4PM5A 3Q07A 4R4SA 4KZ4A 1W7FA 2Y2QA 1Q2QA 3QNBA 4WZ5A 1NJ4A 2ZQ8A 1N4OA 2DCFA 5JYPA 4DXBA 1I2SA 5DF7A 1KDSA 3I7JA 5I94A 3QNCA 4DF6A 1LHYA 1K4FA 3NDGA 3IT9A 5A91A 3ZGAB 2XDMA 3HLFA 3C7VA 1PWCA 2XF3A 4OQHA 5FA7A 4GN2A 4P87A 5FATA 3P98A 3VFHA 2JE5A 3G30A 4IBRA 4KZ7A 4BENA 4OQ0A 4BJPA 1KGGA 4RYEA 3PBNA 4R3JA 3HLWA 1U60A 5J8XA 2RL3A 1JTDA 3MXRA 1E4DA 1FCNA 4KQQA 2QPNA 1SCWA 4K91A 1Q2PA 2X71A 3G2ZA 1YLZA 3A3DA 4WBGA 3PAEA 3G32A 5CXWA 4N9KA 2QMIA 3LCEA 3G35A 2IWBA 1VM1A 1Z6FA 4EBPA 2WKEA 2HP9A 5F1FA 2HP6A 3MZFA 3ZHHA 2P9VA 4HEFA 3WRTA 1K54C 3S1YA 2Y2IA 2ZC5B 4R1GA 2Y2OA 4N1HA 1JTGA 3N8SA 4LV2A 1XA1A 3RXWA 1JWZA 5FI6A 2XFTA 3SS4A 2ZJ9A 4DKIA 2QZ6A 3PTEA 1PWGA 1ES3A 3NY4A 3WS4A 4OOMA 4IVIA 4JXVA 4FH4A 4U3TA 4UA6A 5KSCA 2H5SA 1PI4A 1RGYA 1YMXA 3FWLA 1TEMA 3ISGA 1MWUA 5CHJA 5HFOA 4N9LA 3PBTA 1KE0A 4KZ6A 4QD4A 4M3KA 4P6BA 2ZQCA 2ZM0A 3E2LA 5E2HA 2A3UA 4ZJ3A 2WK0A 5CHUA 4B88A 1K56D 4YFMA 4CPKA 1CI8A 3RJUA 1NZUA 5EE8A 1FOFA 2WGWB 1XXMA 3FYZA 4MBHA 3HUMA 3GR2A 4JKTA 5FI2A 1LL9A 1ZC2A 4Y7PA 5TFQA 2ZD8A 4R0QA 3FKVA 3BLMA 3NBLA 5AQ7A 3N8RA 1FCOA 3Q7ZA 4S2KA 1K6RA 2BG1A 3LY3A 4PPRA 5CERA 4C6YA 2XD5A 4RA7A 4DXCA 4NETA 3W4OA 2P74A 1CI9A 1TVFA 1MWSA 1GA9A 2CC1A 3M2JA 4Y0UA 5EUAA 1Y54A 1O7EA 3M6HA 1IELA 3N8LA 4PMAA 1K38A 5BOHA 3VSLA 5M19A 3A3EA 2RCXA 3WS1A 4MEZA 2Q9MA 1K6SA 3V3SA 4DE2A 3V5MA 5FQJA 2PU4A 3ZCZA 1K57A 4KZ8A 5FQKA 3BLSA 3PBSA 4S2JA 3UE3A 1K56A 4JF5A 5IHVA 3ZNTA 5HL1A 4CJNA 3AGEA 2XLNA 3UE0A 5HW3A 4EBLA 1W8QA 4O7DA 4BL2A 4E6XA 4MLLA 1XKZA 4Y0OA 1LL5A 3BFEA 1QMEA 1GA0A 1LI9A 1VQQA 3BYDA 4DE3A 2EXBA 4MBKA 5M1AA 1QMFA 3Q81A 2FFYA 4ZAMA 4LCLA 3VFFA 5M18A 1PW8A 3HLEA 5E2EA 4KZ9A 4Y0TA 3LEZA 1H8YA 1S6RA 4MNRA 3G34A 3WWXA 4OOLA 5E2GA 1YLPA 2BLSA 4FH2A 4OH0A 4X55A 2WGVA 3C7UA 3IF6A 2WKHA 1DY6A 3CMZA 1XP4A 1BULA 1PIOA 3DTMA 3C5AA 3NCKA 4KQRA 4GKUA 3IH8A 4OLDA 4JXGA 3G2YA 1HZOA 4KQOA 1MKIA 3FZCA 5EPHA 4OVDA 3MBZA 1NRFA 4BQMA 2B5RA 4DRTA 4H8RA 4ID4A 3JYIA 3OCNA 3MFDA 2WYXA 4XUXA 3BFCA 4PM6A 3BFGA 3TG9A 5CGXA 5CHMA 2HDRA 4P85A 4DDSA 4L0LA 1S0WA 3EQVA 1IYQA 5DVAA 5HAPA 4WELA 2JBFA 5HAIA 5GHYA 1NZOA 4S2LA 1K57C 4HBTA 2Y2LA 4JXWA 4LENA 3MXSA 3BRMA 5EOOA 1HTZA 1FSYA 2H0YA 4F94A 2R9XA 1DJCA 3N4IA 3VP4A 1IYPA 2EXAA 1M40A 1PWDA 3UDXA 3UNWA 1IEMA 1LLBA 3N7WA 4JF4A 4WEJA 3AGFA 4RVAA 3MZDA 4OKPA 2C6WB 4S2MA 3SH9A 5L2FA 5HX9A 1BT5A 3W4PA 3PAGA 4JXSA 3GVBA 1J9MA 3UPPA 4JBFA 2Y4AA 1BSGA 3WS0A 5JYOA 3HUOA 1I2WA 1HVBA 3SH7A 4LV0A 4Q8IA 1PI5A 1TDLA 1MXOA 1O07A 4KZAA 4P0MA 3IF6B 2HDUA 2WGIA 4OP8A 2Q9NA 5FAOA 3IF6C 4GOGA 3IF5A 1KGFA 1ZKJA 4ZJ1A 1FQGA 3DWKA 2OLVA 3OZHA 5GLBA 1KVLA 2XH9A 3ZG5A 2ZMAA 5CRFA 3ZVTA 1CEGA 1FSWA 2DNSA 4R3BA 3WS5A 5FI7A 1ERQA 4IVKA 1MY8A 1SDNA 5HAQA 1I5QA 1ONHA 1ERMA 2J7VA 4EWFA 3LO7A 5FAQA 5EVID 3M2KA 4E3KA 1DJBA 4LCMA 1L0DA 2EFXA 5CECA 3PBRA 1SHVA 4OPQA 1ESIA 4WMCD 1JVJA 3BEBA 4C3QA 3MZEA 2XGNA 2WAEA 3IHBA 1L0GA 4BD0A 2ZQ7A 1WYCA 2OLUA 4R23A 1OMEA 3QHYA 2PBYA 1E3UD 4E3LA 5DTKA 2Y91A 1TDGA 1GHIA 3WRZA 1YLYA 1HD8A 4XUZA 5E2FA 2P9VB 3ZG8B 2ZC6B 3O87A 5F82A 3IXBA 1W8YA 1IYOA 4E3OA 3OCLA 2XK1A 5EVIA 1L0FA 3ITAA 3B3XA 4R4RA 1ES2A 1L2SA 1ESUA 4KZBA 1PZOA 3E2KA 3OPHA 4OP5A 1ALQA 4KZ5A 3AGDA 4WMCA 1YLJA 2Y59A 4E3MA 3VP1A 2OSUA 1KDWA 1MPLA 4OLGA 1NYYA 5TGFA 5D3OA 3ZFZA 4QJGA 4GZBA 4B4XA 5CGWA 4RX2A 3V3RA 3VP2A 3ITBA 4E3NA 2Z2LB 4QY6A 5KMWA 5FQIA 1K25A 1E3UA 1NXYA 1YMSA 2JCHA 2Z2MB 4C75A 5A90A 3HREA 2Y2PA 4QY5A 2X01A 3ZVWA 3CJMA 5CTMA 3WS2A 3OPRA 3VOYA 2WAFA 3IXHA 1KE4A 1ZG4A 3VSKA 3LY4A 5FQQA 2PU2A 3UO9A 1ZG6A 1BZAA 1CEFA 1G6AA 1YM1A 5TR7A 3UPOA 4GD6A 2A49A 3BM6A 5HARA 4A5RA 5EOEA 3IWIA 5CEBA 1RCJA 3HBRA 2I72A 4MBFA 3IQAA 2XFSA 1FR6A 3NC8A 3V39A 3GSGA 2X02A 4UA7A 5F83A 4GDNA 3BECA 4BLMA 4D2OA 4OQIA 1C3BA 3SS5A 1W79A 1ES5A 1SDEA 2ZQDA 4GDBA 5CTNA 1IYSA 1DJAA 4S2IA 5FSRA 2EX8A 3NI9A 5A92A 3ZG9B 3GMWA 1JWVA 4FSFA 1SKFA 4ZDXA 1BLCA 4ZBEA 5EVIC 3FV7A 4WYYA 5GLCA 3O88A 4EUZA 1W5DA 2IWCA 4E6WA 2H0TA 4UAAA 1M6KA 1BTLA 3G4PA 4HESA 4EQIA 3A3FA 3PBOA 4PM7A 3IXGA 3IXDA 1IKIA 1FCMA 4JPMA 2Y2NA 1XA7A 4X69A 3M6BA 3SOIA 5AQBA 3VP3A 1K4EA 5DF8A 3W4QA 2WGWA 3MKFA 4IEDA 5KZHA 1K55A 1PW1A 5AQAA 3A3JA 4QB8A 3IHAA 2XD1A 5EECA 4RX3A 3Q82A 1EWZA 4KENB 4WM9A 2J9PA 2EX9A 2ZQ9A 5GL9A 2ZC7A 2R9WA 2Y55A 4YINA 4DDYA 3IH9A 1L0EA 3NDEA 3O86A 1BLPA 3Q7VA 3SH8A 3GQZA 4LV1A 3OC2A 1E25A 1LI0A 2XR0A 3UY6A 4NK3A 3VOZA 1FR1A 3IWOA 2Y2KA 4N1XA 2Y2MA 3ZG0A 2DRWA 2HDQA 1H5XA 1WYBA 1XX2A 3OPLA 3IWQA 1PYYA 4OOYA 4KG6A 3HLGA 2EFUA 2J8YA 4ZJ2A 2V20A 1KGEA 1IKGA 2ZC3B 3UDIA 3FKWA 3HVFA 4OPZA 1NY0A 3TSGA 4E3JA 2J9OA 1RP5A 2V2FF 3GV9A 1YLTA 1GHMA 4BL3A 1XPBA 1GHPA 2WZXA 4QHCA 4UA9A 2E8IA 3DWZA 4GNUA 4S2NA 3S22A 3ZDJA 4KZ3A 4WZ5C 5A93A 1CK3A 5KSHA 2XEPA 4HBUA 5F1GA 3UE1A 4EBNA 1MWRA 3VMAA 3C4OA 2EX2A 3GRJA 3W8KA 1KE3A 1K55C 3CZDA 3EQUA 3RXXA 4DE0A 5DF9A 1XGJA 1MBLA 5FQMA 4K0XA 5G18A 1N9BA 5CEDA 3Q1FA 4KG5A 3UN7A 4U0TA 4K0WA 3BFFA 3CG5A 1WE4A 4UHUA 4X53A 3ZG7B 4LV3A 4S2PA 5DTTA 2JC7A 2VGJA 2H10A 4N92A 5E43A 2WKIA 4IBXA 1NYMA 3Q7VB 3VP0A 4E3IA 2WUQA 2WADA 5CGSA 3N6IA 3OPPA 2G2UA 3TOIA 4PM8A 2HPBA 1AXBA 2Y2HA 4QU3A 3UPNA 4X68A 4JLFA 4EV4A 3S4XA 5DTSA 3ZNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDS A;  5FAS A;  2UWX A;  4OON A;  2XQZ A;  3NIA A;  4XXR A;  2WZZ A;  2ZM8 A;  5GHZ A;  2HP5 A;  2ZM2 A;  1G68 A;  3HLD A;  3P09 A;  1GCE A;  3D4F A;  4Z9Q A;  5AQ9 A;  2G2W A;  4X6T A;  3HL9 A;  3GTC A;  4OQG A;  4FCF A;  5FDH A;  3C4P A;  3SS3 A;  1XGI A;  5FQ9 A;  3O3V A;  3DW0 A;  1ES4 A;  4BD1 A;  1RGZ A;  4JF6 A;  4ZTK A;  1PZP A;  4DE1 A;  1ERO A;  3BFD A;  2IWD A;  4GD8 A;  4S2N C;  1KVM A;  2ZQA A;  1JWP A;  1YT4 A;  4WZ4 A;  5GLA A;  1EI5 A;  3HUN A;  2VGK A;  4B4Z A;  2Y2J A;  1K54 A;  2V1Z A;  4PM9 A;  4S2O A;  3HLC A;  4U0X A;  5GLD A;  1YLW A;  3UDF A;  1BLS A;  2FFF B;  5EVL A;  2Y2G A;  4OPY A;  1BLH A;  1MWT A;  2ZLY A;  3HLB A;  1YQS A;  4KG2 A;  3V50 A;  2ZC4 B;  2C5W B;  4X56 A;  4FD8 A;  5FAP A;  4GB7 A;  4WEK A;  2OV5 A;  5EVI B;  1H8Z A;  1ONG A;  3PBQ A;  5GHX A;  1BUE A;  2GDN A;  3G31 A;  3A3I A;  3MKE A;  4OPR A;  5U47 A;  2EX6 A;  4PM5 A;  3Q07 A;  4R4S A;  4KZ4 A;  1W7F A;  2Y2Q A;  1Q2Q A;  3QNB A;  4WZ5 A;  1NJ4 A;  2ZQ8 A;  1N4O A;  2DCF A;  5JYP A;  4DXB A;  1I2S A;  5DF7 A;  1KDS A;  3I7J A;  5I94 A;  3QNC A;  4DF6 A;  1LHY A;  1K4F A;  3NDG A;  3IT9 A;  5A91 A;  3ZGA B;  2XDM A;  3HLF A;  3C7V A;  1PWC A;  2XF3 A;  4OQH A;  5FA7 A;  4GN2 A;  4P87 A;  5FAT A;  3P98 A;  3VFH A;  2JE5 A;  3G30 A;  4IBR A;  4KZ7 A;  4BEN A;  4OQ0 A;  4BJP A;  1KGG A;  4RYE A;  3PBN A;  4R3J A;  3HLW A;  1U60 A;  5J8X A;  2RL3 A;  1JTD A;  3MXR A;  1E4D A;  1FCN A;  4KQQ A;  2QPN A;  1SCW A;  4K91 A;  1Q2P A;  2X71 A;  3G2Z A;  1YLZ A;  3A3D A;  4WBG A;  3PAE A;  3G32 A;  5CXW A;  4N9K A;  2QMI A;  3LCE A;  3G35 A;  2IWB A;  1VM1 A;  1Z6F A;  4EBP A;  2WKE A;  2HP9 A;  5F1F A;  2HP6 A;  3MZF A;  3ZHH A;  2P9V A;  4HEF A;  3WRT A;  1K54 C;  3S1Y A;  2Y2I A;  2ZC5 B;  4R1G A;  2Y2O A;  4N1H A;  1JTG A;  3N8S A;  4LV2 A;  1XA1 A;  3RXW A;  1JWZ A;  5FI6 A;  2XFT A;  3SS4 A;  2ZJ9 A;  4DKI A;  2QZ6 A;  3PTE A;  1PWG A;  1ES3 A;  3NY4 A;  3WS4 A;  4OOM A;  4IVI A;  4JXV A;  4FH4 A;  4U3T A;  4UA6 A;  5KSC A;  2H5S A;  1PI4 A;  1RGY A;  1YMX A;  3FWL A;  1TEM A;  3ISG A;  1MWU A;  5CHJ A;  5HFO A;  4N9L A;  3PBT A;  1KE0 A;  4KZ6 A;  4QD4 A;  4M3K A;  4P6B A;  2ZQC A;  2ZM0 A;  3E2L A;  5E2H A;  2A3U A;  4ZJ3 A;  2WK0 A;  5CHU A;  4B88 A;  1K56 D;  4YFM A;  4CPK A;  1CI8 A;  3RJU A;  1NZU A;  5EE8 A;  1FOF A;  2WGW B;  1XXM A;  3FYZ A;  4MBH A;  3HUM A;  3GR2 A;  4JKT A;  5FI2 A;  1LL9 A;  1ZC2 A;  4Y7P A;  5TFQ A;  2ZD8 A;  4R0Q A;  3FKV A;  3BLM A;  3NBL A;  5AQ7 A;  3N8R A;  1FCO A;  3Q7Z A;  4S2K A;  1K6R A;  2BG1 A;  3LY3 A;  4PPR A;  5CER A;  4C6Y A;  2XD5 A;  4RA7 A;  4DXC A;  4NET A;  3W4O A;  2P74 A;  1CI9 A;  1TVF A;  1MWS A;  1GA9 A;  2CC1 A;  3M2J A;  4Y0U A;  5EUA A;  1Y54 A;  1O7E A;  3M6H A;  1IEL A;  3N8L A;  4PMA A;  1K38 A;  5BOH A;  3VSL A;  5M19 A;  3A3E A;  2RCX A;  3WS1 A;  4MEZ A;  2Q9M A;  1K6S A;  3V3S A;  4DE2 A;  3V5M A;  5FQJ A;  2PU4 A;  3ZCZ A;  1K57 A;  4KZ8 A;  5FQK A;  3BLS A;  3PBS A;  4S2J A;  3UE3 A;  1K56 A;  4JF5 A;  5IHV A;  3ZNT A;  5HL1 A;  4CJN A;  3AGE A;  2XLN A;  3UE0 A;  5HW3 A;  4EBL A;  1W8Q A;  4O7D A;  4BL2 A;  4E6X A;  4MLL A;  1XKZ A;  4Y0O A;  1LL5 A;  3BFE A;  1QME A;  1GA0 A;  1LI9 A;  1VQQ A;  3BYD A;  4DE3 A;  2EXB A;  4MBK A;  5M1A A;  1QMF A;  3Q81 A;  2FFY A;  4ZAM A;  4LCL A;  3VFF A;  5M18 A;  1PW8 A;  3HLE A;  5E2E A;  4KZ9 A;  4Y0T A;  3LEZ A;  1H8Y A;  1S6R A;  4MNR A;  3G34 A;  3WWX A;  4OOL A;  5E2G A;  1YLP A;  2BLS A;  4FH2 A;  4OH0 A;  4X55 A;  2WGV A;  3C7U A;  3IF6 A;  2WKH A;  1DY6 A;  3CMZ A;  1XP4 A;  1BUL A;  1PIO A;  3DTM A;  3C5A A;  3NCK A;  4KQR A;  4GKU A;  3IH8 A;  4OLD A;  4JXG A;  3G2Y A;  1HZO A;  4KQO A;  1MKI A;  3FZC A;  5EPH A;  4OVD A;  3MBZ A;  1NRF A;  4BQM A;  2B5R A;  4DRT A;  4H8R A;  4ID4 A;  3JYI A;  3OCN A;  3MFD A;  2WYX A;  4XUX A;  3BFC A;  4PM6 A;  3BFG A;  3TG9 A;  5CGX A;  5CHM A;  2HDR A;  4P85 A;  4DDS A;  4L0L A;  1S0W A;  3EQV A;  1IYQ A;  5DVA A;  5HAP A;  4WEL A;  2JBF A;  5HAI A;  5GHY A;  1NZO A;  4S2L A;  1K57 C;  4HBT A;  2Y2L A;  4JXW A;  4LEN A;  3MXS A;  3BRM A;  5EOO A;  1HTZ A;  1FSY A;  2H0Y A;  4F94 A;  2R9X A;  1DJC A;  3N4I A;  3VP4 A;  1IYP A;  2EXA A;  1M40 A;  1PWD A;  3UDX A;  3UNW A;  1IEM A;  1LLB A;  3N7W A;  4JF4 A;  4WEJ A;  3AGF A;  4RVA A;  3MZD A;  4OKP A;  2C6W B;  4S2M A;  3SH9 A;  5L2F A;  5HX9 A;  1BT5 A;  3W4P A;  3PAG A;  4JXS A;  3GVB A;  1J9M A;  3UPP A;  4JBF A;  2Y4A A;  1BSG A;  3WS0 A;  5JYO A;  3HUO A;  1I2W A;  1HVB A;  3SH7 A;  4LV0 A;  4Q8I A;  1PI5 A;  1TDL A;  1MXO A;  1O07 A;  4KZA A;  4P0M A;  3IF6 B;  2HDU A;  2WGI A;  4OP8 A;  2Q9N A;  5FAO A;  3IF6 C;  4GOG A;  3IF5 A;  1KGF A;  1ZKJ A;  4ZJ1 A;  1FQG A;  3DWK A;  2OLV A;  3OZH A;  5GLB A;  1KVL A;  2XH9 A;  3ZG5 A;  2ZMA A;  5CRF A;  3ZVT A;  1CEG A;  1FSW A;  2DNS A;  4R3B A;  3WS5 A;  5FI7 A;  1ERQ A;  4IVK A;  1MY8 A;  1SDN A;  5HAQ A;  1I5Q A;  1ONH A;  1ERM A;  2J7V A;  4EWF A;  3LO7 A;  5FAQ A;  5EVI D;  3M2K A;  4E3K A;  1DJB A;  4LCM A;  1L0D A;  2EFX A;  5CEC A;  3PBR A;  1SHV A;  4OPQ A;  1ESI A;  4WMC D;  1JVJ A;  3BEB A;  4C3Q A;  3MZE A;  2XGN A;  2WAE A;  3IHB A;  1L0G A;  4BD0 A;  2ZQ7 A;  1WYC A;  2OLU A;  4R23 A;  1OME A;  3QHY A;  2PBY A;  1E3U D;  4E3L A;  5DTK A;  2Y91 A;  1TDG A;  1GHI A;  3WRZ A;  1YLY A;  1HD8 A;  4XUZ A;  5E2F A;  2P9V B;  3ZG8 B;  2ZC6 B;  3O87 A;  5F82 A;  3IXB A;  1W8Y A;  1IYO A;  4E3O A;  3OCL A;  2XK1 A;  5EVI A;  1L0F A;  3ITA A;  3B3X A;  4R4R A;  1ES2 A;  1L2S A;  1ESU A;  4KZB A;  1PZO A;  3E2K A;  3OPH A;  4OP5 A;  1ALQ A;  4KZ5 A;  3AGD A;  4WMC A;  1YLJ A;  2Y59 A;  4E3M A;  3VP1 A;  2OSU A;  1KDW A;  1MPL A;  4OLG A;  1NYY A;  5TGF A;  5D3O A;  3ZFZ A;  4QJG A;  4GZB A;  4B4X A;  5CGW A;  4RX2 A;  3V3R A;  3VP2 A;  3ITB A;  4E3N A;  2Z2L B;  4QY6 A;  5KMW A;  5FQI A;  1K25 A;  1E3U A;  1NXY A;  1YMS A;  2JCH A;  2Z2M B;  4C75 A;  5A90 A;  3HRE A;  2Y2P A;  4QY5 A;  2X01 A;  3ZVW A;  3CJM A;  5CTM A;  3WS2 A;  3OPR A;  3VOY A;  2WAF A;  3IXH A;  1KE4 A;  1ZG4 A;  3VSK A;  3LY4 A;  5FQQ A;  2PU2 A;  3UO9 A;  1ZG6 A;  1BZA A;  1CEF A;  1G6A A;  1YM1 A;  5TR7 A;  3UPO A;  4GD6 A;  2A49 A;  3BM6 A;  5HAR A;  4A5R A;  5EOE A;  3IWI A;  5CEB A;  1RCJ A;  3HBR A;  2I72 A;  4MBF A;  3IQA A;  2XFS A;  1FR6 A;  3NC8 A;  3V39 A;  3GSG A;  2X02 A;  4UA7 A;  5F83 A;  4GDN A;  3BEC A;  4BLM A;  4D2O A;  4OQI A;  1C3B A;  3SS5 A;  1W79 A;  1ES5 A;  1SDE A;  2ZQD A;  4GDB A;  5CTN A;  1IYS A;  1DJA A;  4S2I A;  5FSR A;  2EX8 A;  3NI9 A;  5A92 A;  3ZG9 B;  3GMW A;  1JWV A;  4FSF A;  1SKF A;  4ZDX A;  1BLC A;  4ZBE A;  5EVI C;  3FV7 A;  4WYY A;  5GLC A;  3O88 A;  4EUZ A;  1W5D A;  2IWC A;  4E6W A;  2H0T A;  4UAA A;  1M6K A;  1BTL A;  3G4P A;  4HES A;  4EQI A;  3A3F A;  3PBO A;  4PM7 A;  3IXG A;  3IXD A;  1IKI A;  1FCM A;  4JPM A;  2Y2N A;  1XA7 A;  4X69 A;  3M6B A;  3SOI A;  5AQB A;  3VP3 A;  1K4E A;  5DF8 A;  3W4Q A;  2WGW A;  3MKF A;  4IED A;  5KZH A;  1K55 A;  1PW1 A;  5AQA A;  3A3J A;  4QB8 A;  3IHA A;  2XD1 A;  5EEC A;  4RX3 A;  3Q82 A;  1EWZ A;  4KEN B;  4WM9 A;  2J9P A;  2EX9 A;  2ZQ9 A;  5GL9 A;  2ZC7 A;  2R9W A;  2Y55 A;  4YIN A;  4DDY A;  3IH9 A;  1L0E A;  3NDE A;  3O86 A;  1BLP A;  3Q7V A;  3SH8 A;  3GQZ A;  4LV1 A;  3OC2 A;  1E25 A;  1LI0 A;  2XR0 A;  3UY6 A;  4NK3 A;  3VOZ A;  1FR1 A;  3IWO A;  2Y2K A;  4N1X A;  2Y2M A;  3ZG0 A;  2DRW A;  2HDQ A;  1H5X A;  1WYB A;  1XX2 A;  3OPL A;  3IWQ A;  1PYY A;  4OOY A;  4KG6 A;  3HLG A;  2EFU A;  2J8Y A;  4ZJ2 A;  2V20 A;  1KGE A;  1IKG A;  2ZC3 B;  3UDI A;  3FKW A;  3HVF A;  4OPZ A;  1NY0 A;  3TSG A;  4E3J A;  2J9O A;  1RP5 A;  2V2F F;  3GV9 A;  1YLT A;  1GHM A;  4BL3 A;  1XPB A;  1GHP A;  2WZX A;  4QHC A;  4UA9 A;  2E8I A;  3DWZ A;  4GNU A;  4S2N A;  3S22 A;  3ZDJ A;  4KZ3 A;  4WZ5 C;  5A93 A;  1CK3 A;  5KSH A;  2XEP A;  4HBU A;  5F1G A;  3UE1 A;  4EBN A;  1MWR A;  3VMA A;  3C4O A;  2EX2 A;  3GRJ A;  3W8K A;  1KE3 A;  1K55 C;  3CZD A;  3EQU A;  3RXX A;  4DE0 A;  5DF9 A;  1XGJ A;  1MBL A;  5FQM A;  4K0X A;  5G18 A;  1N9B A;  5CED A;  3Q1F A;  4KG5 A;  3UN7 A;  4U0T A;  4K0W A;  3BFF A;  3CG5 A;  1WE4 A;  4UHU A;  4X53 A;  3ZG7 B;  4LV3 A;  4S2P A;  5DTT A;  2JC7 A;  2VGJ A;  2H10 A;  4N92 A;  5E43 A;  2WKI A;  4IBX A;  1NYM A;  3Q7V B;  3VP0 A;  4E3I A;  2WUQ A;  2WAD A;  5CGS A;  3N6I A;  3OPP A;  2G2U A;  3TOI A;  4PM8 A;  2HPB A;  1AXB A;  2Y2H A;  4QU3 A;  3UPN A;  4X68 A;  4JLF A;  4EV4 A;  3S4X A;  5DTS A;  3ZNY A; 
#chains in the Genus database with same CATH topology
 2UWX A;  4JGP A;  3T50 A;  2ZM8 A;  3CAX A;  3P09 A;  1GCE A;  3D4F A;  3QP6 A;  5AQ9 A;  2G2W A;  4X6T A;  3HL9 A;  4FTX A;  3T1X A;  4Y15 A;  1XGI A;  4WLA A;  4HHD A;  4JF6 A;  4DE1 A;  1ERO A;  2WKQ A;  2ZQA A;  1YT4 A;  1EI5 A;  2VGK A;  2Y79 A;  4B4Z A;  1K54 A;  3BWL A;  3NHQ A;  4U0X A;  4OPY A;  3HLB A;  1VB6 A;  4GB7 A;  1S66 L;  1BUE A;  3G6O A;  5U47 A;  2G7U A;  1W7F A;  4WZ5 A;  1NJ4 A;  1I2S A;  4XT2 A;  1KDS A;  3I7J A;  4MN7 A;  4G3K A;  4DF6 A;  1LHY A;  3IT9 A;  3ZGA B;  2XDM A;  2JKT I;  1PWC A;  4OQH A;  3MQO A;  4P87 A;  3P98 A;  1OTA A;  4OQ0 A;  1E4D A;  1SCW A;  1Q2P A;  4IUK A;  5FEF A;  2X71 A;  2E8J A;  4QWO A;  4N9K A;  3OOV A;  3LCE A;  3TE8 A;  2WKE A;  2HP6 A;  2P9V A;  3WRT A;  4R1G A;  3N8S A;  1JWZ A;  2PHY A;  3SS4 A;  3H9W A;  4DKI A;  2QZ6 A;  1ES3 A;  3H7W A;  3HJK A;  4JXV A;  1YMX A;  3FWL A;  3KO6 A;  4GJ4 A;  3E98 A;  2WK0 A;  2PD7 A;  4FUW A;  2M7V A;  1CI8 A;  4NXG A;  3MQQ A;  5EE8 A;  1FOF A;  4BMW A;  3HUM A;  5FI2 A;  4JKT A;  5EM0 A;  4F3L B;  2ZD8 A;  3BLM A;  3NBL A;  3N8R A;  4S2K A;  2XA7 M;  3UB8 A;  3LI9 A;  4C6Y A;  1CI9 A;  3QP1 A;  5J7E A;  1GA9 A;  3M2J A;  4Y0U A;  3K2N A;  4GS9 B;  1O7E A;  3N8L A;  3A3E A;  5HPF A;  3V3S A;  4DE2 A;  2PU4 A;  3ZCZ A;  5FQK A;  2R78 A;  5MC7 A;  3DTE A;  4I3A A;  2XLN A;  3UE0 A;  3NOP C;  1W8Q A;  4EBL A;  4E6X A;  2EWW A;  3BFE A;  1SKO A;  2EXB A;  5M1A A;  3Q81 A;  4ZAM A;  5M18 A;  1OT6 A;  5L8M A;  4M4X A;  5E2E A;  2XRN A;  1T19 A;  3G34 A;  1S1Z A;  3C7U A;  3IF6 A;  2WKH A;  3NOT C;  3VV4 A;  3IH8 A;  4OLD A;  3OBF A;  1F5M A;  3CI6 A;  3E4P A;  4Y13 A;  1MKI A;  3MBZ A;  1L3L A;  2V0W A;  4H8R A;  1NLY A;  3MF0 A;  3MFD A;  4X1L A;  5HAP A;  1DP8 A;  1NZO A;  3CHW P;  2FH5 A;  3DTK A;  4JXW A;  3FPV A;  3IBR A;  4I5S A;  1FSY A;  1DJC A;  1T18 A;  3LR5 A;  5I5L A;  1IYP A;  1PWD A;  2VEA A;  3UNW A;  3VP4 A;  1IEM A;  1LLB A;  3SH9 A;  4NEE D;  4P6Z M;  4JXS A;  3GVB A;  1J9M A;  3UPP A;  5J4E A;  2Y4A A;  3WS0 A;  3S7O A;  4PKY A;  4KZA A;  1OTI A;  1O07 A;  2HDU A;  3MXQ A;  2VKS A;  3A0R A;  1X0O A;  4LRZ E;  3IF5 A;  1S4R A;  4GCZ A;  2I9V A;  4YWZ A;  3T1S A;  1ZKJ A;  4ZJ1 A;  1KOU A;  2QJ5 A;  3BQ8 A;  4KUO A;  4HP4 A;  2ZMA A;  1CEG A;  1F2K A;  1SDN A;  1GSW A;  4XT2 B;  3LO7 A;  5EVI D;  3F1P A;  3M2K A;  4MDZ A;  2EFX A;  4BBV A;  1VET A;  4ZRR A;  2XGN A;  3IHB A;  2ZQ7 A;  1WYC A;  5DTK A;  2Y91 A;  3C2W A;  2D02 A;  1YLY A;  3PYP A;  2P9V B;  3ZG8 B;  5F82 A;  1W8Y A;  5IT5 A;  1P9W A;  4EET B;  3OCL A;  2XK1 A;  1L0F A;  3ITA A;  5HD3 A;  3H7W B;  4MCW A;  1FIK A;  4L9G A;  4KZ5 A;  1MPL A;  5D3O A;  1PNE A;  4B4X A;  3VP2 A;  4E3N A;  2Z2L B;  3F1O A;  5KMW A;  2Z2M B;  1YMS A;  2FZ0 A;  2X01 A;  4CQH A;  3OPR A;  2WAF A;  1STZ A;  4LLO B;  1YM1 A;  5TR7 A;  3UPO A;  2ACG A;  2A49 A;  4A5R A;  5CEB A;  3EGD C;  1RCJ A;  3HBR A;  1FR6 A;  5F83 A;  2O9A A;  1VHM A;  2LB5 A;  1W79 A;  2ZQD A;  3MS6 A;  5CTN A;  3GEC A;  4WF0 A;  1D1J A;  3LR0 A;  1W5D A;  1SKO B;  1M6K A;  3G4P A;  4Q0I A;  2PYR A;  3IXG A;  3IXD A;  4JPM A;  3SOI A;  3W4Q A;  3MKF A;  4KQD A;  1IFQ A;  2OWH A;  2ZQ9 A;  2HJE A;  2KOI A;  3NDE A;  3SH8 A;  4Q0J A;  4LV1 A;  1E25 A;  1PFL A;  4ETX A;  3UY6 A;  1F98 A;  1FR1 A;  4GW9 A;  1XJ2 A;  3S7N A;  2Y2K A;  2DRW A;  2HDQ A;  1XX2 A;  3KSI A;  2J8Y A;  1KGE A;  3FKW A;  3HVF A;  3QP5 A;  2J9O A;  1RP5 A;  2Z6D A;  1XPB A;  3LR3 A;  3LID A;  5A93 A;  4KZ3 A;  5KSH A;  4HBU A;  4I39 A;  1KE3 A;  1K55 C;  3RXX A;  5G18 A;  4K0X A;  1N9B A;  3LFV A;  3UN7 A;  4KG5 A;  4U0T A;  4K0W A;  3CG5 A;  3T1Q B;  4X53 A;  3LI8 A;  4S2P A;  2VGJ A;  1OJ5 A;  1VEU A;  2WKI A;  5E43 A;  4E3I A;  3KYE A;  2HV1 A;  4X68 A;  3S4X A;  3P7N A;  3R7W A;  5FAS A;  3O5Y A;  3F1P B;  2WKP A;  4JGR A;  3IX4 A;  2HP5 A;  2ZM2 A;  4PHT A;  5TJJ A;  1TS8 A;  3PXP A;  1VET B;  4HP9 A;  4FCF A;  5FQ9 A;  3O3V A;  1RGZ A;  4ZTK A;  4CLC A;  2IWD A;  3HUN A;  1DP6 A;  5GLD A;  4MMN A;  3UDF A;  1YLW A;  1ZTU A;  3V50 A;  1SZV A;  4FD8 A;  5FAP A;  2NUT C;  4WEK A;  2OV5 A;  1H8Z A;  3G31 A;  2EX6 A;  2Y2Q A;  3QNB A;  3ZYT A;  2ZQ8 A;  1S67 L;  4Y2F A;  1TS6 A;  3NJA A;  3UB6 A;  3NDG A;  3HLF A;  2UV0 E;  5FA7 A;  3VFH A;  2JE5 A;  3G30 A;  1KGG A;  1OTE A;  3PBN A;  1OPX A;  1ZHH B;  3HLW A;  4Z1W A;  2RL3 A;  1H3Q A;  2QPN A;  4GS9 A;  3E0Y A;  3NUL A;  3PAE A;  1DP9 A;  2QMI A;  2IA2 A;  3G35 A;  2IWB A;  2HP9 A;  4EUV A;  1K54 C;  1LSV A;  2Y2O A;  2ZJ9 A;  3WS4 A;  3MSH A;  4UA6 A;  4FH4 A;  4U3T A;  5KSC A;  2VK3 A;  1RGY A;  3ISG A;  3CWF A;  4M3K A;  2VV7 A;  5E2H A;  4ZJ3 A;  3ZNY A;  4B88 A;  3RJU A;  3FYZ A;  4MBH A;  4Y7P A;  5F68 A;  2BG1 A;  4PPR A;  5CER A;  2V9A A;  1MKM A;  1TVF A;  2CC1 A;  1Y54 A;  1IEL A;  4PMA A;  5M19 A;  2RCX A;  2Q9M A;  1K6S A;  2DMW A;  3V5M A;  3B42 A;  1K57 A;  3U2A A;  5EFW A;  1K56 A;  5HL1 A;  3L9K A;  3AGE A;  1XKZ A;  1LL5 A;  1VQQ A;  4G3W A;  5EM1 A;  4LCL A;  2V8C A;  3VFF A;  2PAV P;  5E2G A;  4HJ4 A;  4FH2 A;  4OH0 A;  4X55 A;  2NUP C;  1DY6 A;  3CMZ A;  1BUL A;  5DKL A;  3PR6 A;  3FZC A;  3FPW A;  4OVD A;  2B5R A;  4ID4 A;  5AJG A;  3JYI A;  1VEU B;  3OCN A;  4ESP A;  3VE3 A;  2WYX A;  4XUX A;  3V67 A;  4P85 A;  5HDS A;  4DDS A;  3EQV A;  4II7 A;  5DVA A;  3R7W B;  2W0N A;  1IOU A;  2PD8 A;  2EA9 A;  2R9X A;  4HH2 A;  4HH3 A;  1M40 A;  4WEJ A;  4RVA A;  1N9N A;  2B95 A;  3MZD A;  2BAS A;  3PAG A;  4CLC B;  1MZU A;  4JBF A;  1BSG A;  2HGV A;  5JYO A;  5KIZ A;  3HUO A;  1I2W A;  1HVB A;  3SH7 A;  4LV0 A;  4Q8I A;  5EV0 A;  1MXO A;  4P0M A;  3JVV A;  2WGI A;  3MFX A;  2Q9N A;  3IF6 C;  4GOG A;  3DWK A;  3UB9 A;  1KVL A;  2XH9 A;  4UQI M;  5CRF A;  2DNS A;  5FI7 A;  1ERQ A;  4IVK A;  2PYP A;  1I5Q A;  4WUJ A;  2J7V A;  2HZ5 A;  3TW8 A;  2K31 A;  2VJW A;  5L09 A;  1G5U A;  1DJB A;  4LCM A;  5AVF A;  3PBR A;  1SHV A;  4WMC D;  1JVJ A;  2WAE A;  1L0G A;  3QHY A;  2V1A A;  1E3U D;  3T1R A;  5A8B A;  3WRZ A;  1OT9 A;  1BYW A;  4XUZ A;  3UE6 A;  3NEC A;  4R4R A;  3CPT B;  4EU0 A;  1PZO A;  4OP5 A;  3OPH A;  1ALQ A;  3AGD A;  2Y59 A;  3VP1 A;  4GZB A;  4RX2 A;  4QY6 A;  3IS2 A;  3HCY A;  4C75 A;  3HRE A;  2Y2P A;  3CJM A;  3CUE A;  3TJZ C;  3VOY A;  1KE4 A;  2W1R A;  3LUQ A;  1ZG4 A;  3VSK A;  5HL6 A;  1CF0 A;  3BM6 A;  5HAR A;  3IWI A;  3T4K A;  3NC8 A;  3BY8 A;  2X02 A;  5HPI A;  3BEC A;  4BLM A;  1ES5 A;  3LGO A;  4CLC E;  1DJA A;  4S2I A;  5FSR A;  2EX8 A;  2QWS A;  4P6Z S;  4FSF A;  3T4T A;  4L9F A;  4ZBE A;  2M7U A;  1W63 Q;  5FL3 A;  4E6W A;  4HES A;  2ZMV A;  3A3F A;  3PBO A;  1H8M A;  1IKI A;  2Y2N A;  5DF8 A;  4AFI A;  2WGW A;  1TD5 A;  5AQA A;  3A3J A;  3IHA A;  2XD1 A;  2VGL M;  3Q82 A;  3E4O A;  4WM9 A;  2J9P A;  2ZC7 A;  2R9W A;  4DDY A;  1BLP A;  3D9Y A;  3OC2 A;  4NK3 A;  3VOZ A;  3IWO A;  3SZT A;  4WL9 A;  3OPL A;  4DMZ A;  3HLG A;  2EFU A;  2V20 A;  1IKG A;  2KLI A;  2W3H A;  4E3J A;  1D7E A;  1GHM A;  4S2N A;  3ZDJ A;  2XEP A;  3T12 B;  3UE1 A;  3VMA A;  4YOF A;  3W8K A;  4GHI A;  5FQM A;  1XGJ A;  1OTB A;  4H6J A;  5CED A;  4Y3I A;  4UEY A;  5HWV A;  1WA9 A;  4UHU A;  3QP4 A;  2H10 A;  3Q7V B;  2QYB A;  2WAD A;  2G2U A;  3TOI A;  2HPB A;  3UPN A;  4EV4 A;  1GSX A;  2AVX A;  3FC7 A;  4OON A;  3NIA A;  2W1T A;  1G68 A;  2GNX A;  4Y17 A;  1EW0 A;  3QP8 A;  2HJ9 C;  5HWT A;  4OQG A;  5FDH A;  2VV6 A;  3C4P A;  2VLG A;  3DW0 A;  1W63 M;  4BD1 A;  2OAQ 1;  1JWP A;  4WZ4 A;  5GLA A;  2Y2J A;  3LEQ A;  3HLC A;  2ZLY A;  3UMD A;  1YQS A;  4KG2 A;  2C5W B;  1MC0 A;  2W27 A;  3A0S A;  2P08 A;  3PBQ A;  5GHX A;  3EGX C;  2GDN A;  3MKE A;  3A3I A;  1XJ3 A;  1Q2Q A;  3T4Q A;  4DXB A;  1D06 A;  4R6L A;  3QNC A;  3IS2 B;  1K4F A;  5A91 A;  3D72 A;  3C7V A;  3BY9 A;  4GN2 A;  5FAT A;  4BJP A;  4BEN A;  4G3V A;  4RYE A;  4R3J A;  5J8X A;  3MXR A;  3W2Z A;  3JPU A;  1FCN A;  4KQQ A;  3IX8 A;  3G2Z A;  1YLZ A;  3A3D A;  3EEA A;  4WBG A;  5HWW A;  4HY8 A;  3G32 A;  5CXW A;  2W3D A;  1T1A A;  4CLC C;  1Z6F A;  3MZF A;  2Y2I A;  2K2N A;  4DJ2 A;  1XA1 A;  3RXW A;  2XFT A;  2KX6 A;  3NY4 A;  4OOM A;  2W3G A;  3UB5 P;  2H5S A;  1PI4 A;  5HDC A;  5HFO A;  1TEM A;  5CHJ A;  1MWU A;  3DBA A;  4QD4 A;  3PBT A;  4KZ6 A;  4P6B A;  2ZQC A;  2ZM0 A;  2A3U A;  4MN6 A;  4HI4 A;  4CPK A;  1NZU A;  2WGW B;  1XXM A;  3GR2 A;  1LL9 A;  5DFX A;  5TFQ A;  4IJG A;  3FKV A;  5AQ7 A;  4HOI A;  2PR5 A;  4ARZ A;  4YNR A;  5G4Z A;  3LY3 A;  4DJ3 A;  1YPR A;  2XD5 A;  3W4O A;  2P74 A;  1MWS A;  2PR6 A;  5EUA A;  3M6H A;  1K38 A;  3WS1 A;  5FQJ A;  4I3I A;  1TS0 A;  4KZ8 A;  3BLS A;  4S2J A;  3UE3 A;  2QKP A;  3ZNT A;  4CJN A;  2Z6C A;  5HW3 A;  2VV8 A;  4O7D A;  4MLL A;  4DE3 A;  4MBK A;  1QMF A;  1J3W A;  3HLE A;  4KZ9 A;  2YKH A;  1YLP A;  1S1Y A;  4GHI B;  2ZBB A;  4IUH A;  1XP4 A;  1PIO A;  3DTM A;  3C5A A;  1G6O A;  2ZL1 A;  4GKU A;  4H6J B;  3G2Y A;  1HZO A;  4KQO A;  4HNB A;  4DRT A;  3BFG A;  5CGX A;  1S0W A;  1IYQ A;  4WEL A;  2JBF A;  5HAI A;  5GHY A;  1K57 C;  2W1T B;  4HBT A;  5DJT A;  2H0Y A;  2P7J A;  3PHY A;  4RQ9 A;  3KSH A;  2EXA A;  4JF4 A;  3AGF A;  4OKP A;  4S2M A;  3W4P A;  2O9C A;  1H0M A;  2PBD P;  2Q0O A;  1N9L A;  2O0Y A;  4HIA A;  3SW1 A;  4OP8 A;  1YSQ A;  5FAO A;  3CPT A;  1TS7 A;  2OLV A;  3ZG5 A;  2L0W A;  3ZVT A;  3R4K A;  4R3B A;  3FG8 A;  5HAQ A;  4EES A;  1ONH A;  1ERM A;  1UWN X;  4E3K A;  4B93 A;  4IHQ A;  4OPQ A;  1P97 A;  3BEB A;  5TBM A;  1Y4O A;  4C3Q A;  3MZE A;  1S4S A;  4BD0 A;  1T1B A;  1K0K A;  5HZH A;  2OLU A;  2INW A;  4R23 A;  2OAP 1;  2PBY A;  2JN7 A;  1HD8 A;  5CX7 A;  2ZC6 B;  3C38 A;  3T4O A;  3P01 A;  1IYO A;  5EVI A;  3B3X A;  1ES2 A;  3L7H A;  5G4Y A;  1F9I A;  3E2K A;  4E3M A;  1NYY A;  3ZFZ A;  4BBT A;  1YKD A;  3KX0 X;  2A24 B;  1K25 A;  1NXY A;  4LPZ A;  2P04 A;  3LY4 A;  3UO9 A;  1ZG6 A;  1G6A A;  4ARZ B;  4GD6 A;  5EOE A;  1LL8 A;  4BBU A;  3IQA A;  3EWK A;  2XFS A;  3EOI A;  2OWJ A;  4UA7 A;  4ETZ A;  4D2O A;  4OQI A;  3VOL A;  1SDE A;  4GDB A;  3NI9 A;  3ZG9 B;  1SKF A;  1N9O A;  1BLC A;  2CMN A;  2HF6 A;  4WYY A;  1YAX A;  2H0T A;  2L1M A;  4UAA A;  4LRX C;  5FDS A;  4PM7 A;  1PRQ A;  3BW6 A;  5FEG A;  1XA7 A;  3M6B A;  4E3O A;  3VP3 A;  5KZH A;  1K4E A;  2O9B A;  4UQI S;  4HJ6 A;  3CUE C;  4QB8 A;  4O0P A;  1HLU P;  2ZL1 B;  2EX9 A;  5GL9 A;  2Y55 A;  4K08 A;  1L0E A;  3O86 A;  3Q7V A;  4NG2 A;  4X1M A;  3GQZ A;  4LGW A;  4I38 A;  1LI0 A;  4NXE A;  2XA7 S;  4N1X A;  2QHK A;  2Y2M A;  3ZG0 A;  1WYB A;  5F69 A;  3IWQ A;  3KSG A;  4OOY A;  2M1C A;  3UDI A;  4OPZ A;  3TSG A;  3GV9 A;  1YLT A;  4UA9 A;  2MJ6 A;  2E8I A;  4GNU A;  5IS1 A;  1CK3 A;  1NRJ A;  3B47 A;  4HQA A;  4FOF A;  3QP2 A;  1XFQ A;  5DF9 A;  4DE0 A;  1MBL A;  4LFU A;  3Q1F A;  5HD5 A;  1G28 A;  3BFF A;  4CLC D;  3ZG7 B;  3F1N A;  2JC7 A;  4N92 A;  4IBX A;  1AWI A;  2WUQ A;  5CGS A;  3N6I A;  1V9Y A;  4PM8 A;  2Y2H A;  4QU3 A;  5DJU A;  1XJ6 A;  2V8F A;  2HDS A;  4O01 A;  2XQZ A;  4XXR A;  2WZZ A;  5GHZ A;  3HLD A;  1CQA A;  3TRC A;  1Z09 A;  4Z9Q A;  2JKG A;  2V0U A;  5TBM B;  3GTC A;  3LR4 A;  4NXF A;  3SS3 A;  3MQ0 A;  1ES4 A;  5LBR A;  1PZP A;  3BFD A;  4S2N C;  4GD8 A;  1KVM A;  3H82 A;  1OTD A;  4S2O A;  4PM9 A;  2V1Z A;  3MMH A;  5A92 A;  2PT7 A;  1BLS A;  1T1C A;  2FFF B;  5EVL A;  2Y2G A;  2J3T C;  1BLH A;  1MWT A;  5L07 A;  2ZC4 B;  4X56 A;  5F5Y A;  5EVI B;  1ONG A;  4EEP A;  4OPR A;  4PM5 A;  3Q07 A;  4R4S A;  4KZ4 A;  2K7S A;  3K3D A;  3D3O A;  3VE4 A;  4B9O A;  2B18 A;  3T4J A;  1N4O A;  2DCF A;  5JYP A;  2VGL S;  4EXO A;  2GZA A;  5DF7 A;  4GLQ A;  5I94 A;  2XF3 A;  4Y5F A;  5A90 A;  5DFY A;  4IBR A;  3E4Q A;  4KZ7 A;  2GJ3 A;  1FIL A;  2D01 A;  1U60 A;  3LIC A;  2KDK A;  4EQ1 A;  1JTD A;  3LIA A;  4K91 A;  3KSF A;  1P0Z A;  1VM1 A;  4EBP A;  5F1F A;  3ZHH A;  4HEF A;  3S1Y A;  2ZC5 B;  4N1H A;  1JTG A;  4LV2 A;  5FI6 A;  3ULF A;  4NKP A;  2PDR A;  3PTE A;  1PWG A;  4IVI A;  5DKK A;  3KYZ A;  1JNU A;  1NLZ A;  4BL2 A;  4N9L A;  1KE0 A;  4D60 A;  2OOL A;  3E2L A;  2W3F A;  5CHU A;  1K56 D;  4YFM A;  3RFB A;  3OLO A;  3RTY A;  2WKR A;  1ZC2 A;  3LIE A;  3K3C A;  3KYQ A;  4R0Q A;  1FCO A;  3Q7Z A;  1K6R A;  1V9Z A;  4RA7 A;  4DXC A;  4NET A;  3BQA A;  5BOH A;  1YSP A;  3VSL A;  4MEZ A;  3CLO A;  4WN5 A;  1NWZ A;  3PBS A;  4JF5 A;  5IHV A;  4KUK A;  4LRY C;  2JKR M;  4Y0O A;  1XJ4 A;  1QME A;  1GA0 A;  1LI9 A;  3BYD A;  4R38 A;  3BJN A;  2ZOI A;  2FFY A;  1PW8 A;  4Y0T A;  3LEZ A;  1H8Y A;  1S6R A;  4MNR A;  3WWX A;  4OOL A;  4NXB A;  2BLS A;  4ME4 A;  2WGV A;  4EW7 A;  3NCK A;  4KQR A;  4JXG A;  5EPH A;  3UB7 A;  1NRF A;  4PKY G;  2V1B A;  4BQM A;  3F1N B;  1UWP X;  3A0V A;  3T4S A;  2EWV A;  3BFC A;  4I3J A;  4PM6 A;  3TG9 A;  5CHM A;  2HDR A;  4L0L A;  1LSX A;  3UME A;  4S2L A;  3RH8 B;  3T4L A;  2Y2L A;  4LEN A;  3MXS A;  3BRM A;  5EOO A;  1HTZ A;  4F94 A;  3N4I A;  3ZQ5 A;  3UDX A;  3N7W A;  3HJI A;  2C6W B;  5HSQ A;  5HX9 A;  1BT5 A;  5L2F A;  2A2L A;  1GSV A;  4QPR A;  3ICY A;  3H82 B;  4R70 A;  1PI5 A;  1TDL A;  3IF6 B;  4L9E A;  2QJ7 A;  3IBJ A;  1KGF A;  1FQG A;  3OZH A;  5GLB A;  4E04 A;  4HJ3 A;  1FSW A;  3WS5 A;  1MY8 A;  2JHE A;  3B33 A;  1CJF A;  4EWF A;  2A24 A;  5FAQ A;  1OJG A;  3DAV A;  2VX8 A;  1L0D A;  2W3E A;  5CEC A;  1ESI A;  3C30 A;  1UGU A;  3IX3 A;  3JVU A;  1OME A;  4E3L A;  4MN5 A;  1TDG A;  1GHI A;  3DTI A;  5K5B A;  5E2F A;  3O87 A;  3IXB A;  2YKF A;  3GDI A;  1L2S A;  1ESU A;  4KZB A;  4JGQ A;  2LB9 A;  4WMC A;  1YLJ A;  5EVE A;  4EEU A;  2OSU A;  1KDW A;  4OLG A;  2XRO A;  1TF1 A;  5TGF A;  2ZMF A;  4QJG A;  5CGW A;  3V3R A;  5L10 A;  3ITB A;  1P9R A;  5FQI A;  1E3U A;  2JCH A;  4DN0 A;  4QY5 A;  3ZVW A;  1LSW A;  2ZOH A;  5CTM A;  3WS2 A;  2JKR I;  3IXH A;  2O99 A;  3NOU C;  5FQQ A;  2PU2 A;  1BZA A;  1CEF A;  2I72 A;  4MBF A;  3V39 A;  3GSG A;  3EEH A;  1DRM A;  4GDN A;  2PRF A;  2VZW A;  1C3B A;  3MJQ A;  5IU1 A;  4EER A;  3SS5 A;  1Y28 A;  1IYS A;  4JGO A;  3GMW A;  1JWV A;  4ZDX A;  2JKT M;  5EVI C;  3FV7 A;  5GLC A;  3O88 A;  4EUZ A;  2IWC A;  1BTL A;  4EQI A;  1XFN A;  3S7P A;  3F1O B;  1FCM A;  2BTF P;  4X69 A;  4R3A A;  2J3W A;  5AQB A;  3LYX A;  4IED A;  1K55 A;  5J3W A;  1PW1 A;  4F3L A;  3S7Q A;  5EEC A;  4RX3 A;  1EWZ A;  4KEN B;  2J80 A;  4BWI A;  4YIN A;  3IH9 A;  1LT0 A;  3MR0 A;  5HDD A;  2J3T D;  4X25 A;  2H28 A;  2JKF A;  2XR0 A;  2XSS A;  3LIF A;  5AVE A;  1ACF A;  1H5X A;  1PYY A;  4PAU A;  4O8G A;  4KG6 A;  4ZJ2 A;  2ZC3 B;  2GX5 A;  1NY0 A;  2V2F F;  4BL3 A;  3C8C A;  2Y8H A;  1GHP A;  2WZX A;  4QHC A;  3DWZ A;  3S22 A;  1ODV A;  4WZ5 C;  3LIB A;  4Q0H A;  3CIT A;  2L4R A;  5F1G A;  4EBN A;  1MWR A;  3C4O A;  2EX2 A;  5C5K A;  3GRJ A;  2B02 A;  2VA0 A;  3CZD A;  3EQU A;  3U4L P;  1WE4 A;  5F6A A;  4LV3 A;  5DTT A;  1NYM A;  3VP0 A;  3OPP A;  1AXB A;  4JLF A;  5DTS A;  1A0K A; 
#chains in the Genus database with same CATH homology
 2HDS A;  5FAS A;  2UWX A;  4OON A;  2XQZ A;  3NIA A;  4XXR A;  2WZZ A;  2ZM8 A;  5GHZ A;  2HP5 A;  2ZM2 A;  1G68 A;  3HLD A;  3P09 A;  1GCE A;  3D4F A;  4Z9Q A;  5AQ9 A;  2G2W A;  4X6T A;  3HL9 A;  3GTC A;  4OQG A;  4FCF A;  5FDH A;  3C4P A;  3SS3 A;  1XGI A;  5FQ9 A;  3O3V A;  3DW0 A;  1ES4 A;  4BD1 A;  1RGZ A;  4JF6 A;  4ZTK A;  1PZP A;  4DE1 A;  1ERO A;  3BFD A;  2IWD A;  4GD8 A;  4S2N C;  1KVM A;  2ZQA A;  1JWP A;  1YT4 A;  4WZ4 A;  5GLA A;  1EI5 A;  3HUN A;  2VGK A;  4B4Z A;  2Y2J A;  1K54 A;  2V1Z A;  4PM9 A;  4S2O A;  3HLC A;  4U0X A;  5GLD A;  1YLW A;  3UDF A;  1BLS A;  2FFF B;  5EVL A;  2Y2G A;  4OPY A;  1BLH A;  1MWT A;  2ZLY A;  3HLB A;  1YQS A;  4KG2 A;  3V50 A;  2ZC4 B;  2C5W B;  4X56 A;  4FD8 A;  5FAP A;  4GB7 A;  4WEK A;  2OV5 A;  5EVI B;  1H8Z A;  1ONG A;  3PBQ A;  5GHX A;  1BUE A;  2GDN A;  3G31 A;  3A3I A;  3MKE A;  4OPR A;  5U47 A;  2EX6 A;  4PM5 A;  3Q07 A;  4R4S A;  4KZ4 A;  1W7F A;  2Y2Q A;  1Q2Q A;  3QNB A;  4WZ5 A;  1NJ4 A;  2ZQ8 A;  1N4O A;  2DCF A;  5JYP A;  4DXB A;  1I2S A;  5DF7 A;  1KDS A;  3I7J A;  5I94 A;  3QNC A;  4DF6 A;  1LHY A;  1K4F A;  3NDG A;  3IT9 A;  5A91 A;  3ZGA B;  2XDM A;  3HLF A;  3C7V A;  1PWC A;  2XF3 A;  4OQH A;  5FA7 A;  4GN2 A;  4P87 A;  5FAT A;  3P98 A;  3VFH A;  2JE5 A;  3G30 A;  4IBR A;  4KZ7 A;  4BEN A;  4OQ0 A;  4BJP A;  1KGG A;  4RYE A;  3PBN A;  4R3J A;  3HLW A;  1U60 A;  5J8X A;  2RL3 A;  1JTD A;  3MXR A;  1E4D A;  1FCN A;  4KQQ A;  2QPN A;  1SCW A;  4K91 A;  1Q2P A;  2X71 A;  3G2Z A;  1YLZ A;  3A3D A;  4WBG A;  3PAE A;  3G32 A;  5CXW A;  4N9K A;  2QMI A;  3LCE A;  3G35 A;  2IWB A;  1VM1 A;  1Z6F A;  4EBP A;  2WKE A;  2HP9 A;  5F1F A;  2HP6 A;  3MZF A;  3ZHH A;  2P9V A;  4HEF A;  3WRT A;  1K54 C;  3S1Y A;  2Y2I A;  2ZC5 B;  4R1G A;  2Y2O A;  4N1H A;  1JTG A;  3N8S A;  4LV2 A;  1XA1 A;  3RXW A;  1JWZ A;  5FI6 A;  2XFT A;  3SS4 A;  2ZJ9 A;  4DKI A;  2QZ6 A;  3PTE A;  1PWG A;  1ES3 A;  3NY4 A;  3WS4 A;  4OOM A;  4IVI A;  4JXV A;  4FH4 A;  4U3T A;  4UA6 A;  5KSC A;  2H5S A;  1PI4 A;  1RGY A;  1YMX A;  3FWL A;  1TEM A;  3ISG A;  1MWU A;  5CHJ A;  5HFO A;  4N9L A;  3PBT A;  1KE0 A;  4KZ6 A;  4QD4 A;  4M3K A;  4P6B A;  2ZQC A;  2ZM0 A;  3E2L A;  5E2H A;  2A3U A;  4ZJ3 A;  2WK0 A;  5CHU A;  4B88 A;  1K56 D;  4YFM A;  4CPK A;  1CI8 A;  3RJU A;  1NZU A;  5EE8 A;  1FOF A;  2WGW B;  1XXM A;  3FYZ A;  4MBH A;  3HUM A;  3GR2 A;  4JKT A;  5FI2 A;  1LL9 A;  1ZC2 A;  4Y7P A;  5TFQ A;  2ZD8 A;  4R0Q A;  3FKV A;  3BLM A;  3NBL A;  5AQ7 A;  3N8R A;  1FCO A;  3Q7Z A;  4S2K A;  1K6R A;  2BG1 A;  3LY3 A;  4PPR A;  5CER A;  4C6Y A;  2XD5 A;  4RA7 A;  4DXC A;  4NET A;  3W4O A;  2P74 A;  1CI9 A;  1TVF A;  1MWS A;  1GA9 A;  2CC1 A;  3M2J A;  4Y0U A;  5EUA A;  1Y54 A;  1O7E A;  3M6H A;  1IEL A;  3N8L A;  4PMA A;  1K38 A;  5BOH A;  3VSL A;  5M19 A;  3A3E A;  2RCX A;  3WS1 A;  4MEZ A;  2Q9M A;  1K6S A;  3V3S A;  4DE2 A;  3V5M A;  5FQJ A;  2PU4 A;  3ZCZ A;  1K57 A;  4KZ8 A;  5FQK A;  3BLS A;  3PBS A;  4S2J A;  3UE3 A;  1K56 A;  4JF5 A;  5IHV A;  3ZNT A;  5HL1 A;  4CJN A;  3AGE A;  2XLN A;  3UE0 A;  5HW3 A;  4EBL A;  1W8Q A;  4O7D A;  4BL2 A;  4E6X A;  4MLL A;  1XKZ A;  4Y0O A;  1LL5 A;  3BFE A;  1QME A;  1GA0 A;  1LI9 A;  1VQQ A;  3BYD A;  4DE3 A;  2EXB A;  4MBK A;  5M1A A;  1QMF A;  3Q81 A;  2FFY A;  4ZAM A;  4LCL A;  3VFF A;  5M18 A;  1PW8 A;  3HLE A;  5E2E A;  4KZ9 A;  4Y0T A;  3LEZ A;  1H8Y A;  1S6R A;  4MNR A;  3G34 A;  3WWX A;  4OOL A;  5E2G A;  1YLP A;  2BLS A;  4FH2 A;  4OH0 A;  4X55 A;  2WGV A;  3C7U A;  3IF6 A;  2WKH A;  1DY6 A;  3CMZ A;  1XP4 A;  1BUL A;  1PIO A;  3DTM A;  3C5A A;  3NCK A;  4KQR A;  4GKU A;  3IH8 A;  4OLD A;  4JXG A;  3G2Y A;  1HZO A;  4KQO A;  1MKI A;  3FZC A;  5EPH A;  4OVD A;  3MBZ A;  1NRF A;  4BQM A;  2B5R A;  4DRT A;  4H8R A;  4ID4 A;  3JYI A;  3OCN A;  3MFD A;  2WYX A;  4XUX A;  3BFC A;  4PM6 A;  3BFG A;  3TG9 A;  5CGX A;  5CHM A;  2HDR A;  4P85 A;  4DDS A;  4L0L A;  1S0W A;  3EQV A;  1IYQ A;  5DVA A;  5HAP A;  4WEL A;  2JBF A;  5HAI A;  5GHY A;  1NZO A;  4S2L A;  1K57 C;  4HBT A;  2Y2L A;  4JXW A;  4LEN A;  3MXS A;  3BRM A;  5EOO A;  1HTZ A;  1FSY A;  2H0Y A;  4F94 A;  2R9X A;  1DJC A;  3N4I A;  3VP4 A;  1IYP A;  2EXA A;  1M40 A;  1PWD A;  3UDX A;  3UNW A;  1IEM A;  1LLB A;  3N7W A;  4JF4 A;  4WEJ A;  3AGF A;  4RVA A;  3MZD A;  4OKP A;  2C6W B;  4S2M A;  3SH9 A;  5L2F A;  5HX9 A;  1BT5 A;  3W4P A;  3PAG A;  4JXS A;  3GVB A;  1J9M A;  3UPP A;  4JBF A;  2Y4A A;  1BSG A;  3WS0 A;  5JYO A;  3HUO A;  1I2W A;  1HVB A;  3SH7 A;  4LV0 A;  4Q8I A;  1PI5 A;  1TDL A;  1MXO A;  1O07 A;  4KZA A;  4P0M A;  3IF6 B;  2HDU A;  2WGI A;  4OP8 A;  2Q9N A;  5FAO A;  3IF6 C;  4GOG A;  3IF5 A;  1KGF A;  1ZKJ A;  4ZJ1 A;  1FQG A;  3DWK A;  2OLV A;  3OZH A;  5GLB A;  1KVL A;  2XH9 A;  3ZG5 A;  2ZMA A;  5CRF A;  3ZVT A;  1CEG A;  1FSW A;  2DNS A;  4R3B A;  3WS5 A;  5FI7 A;  1ERQ A;  4IVK A;  1MY8 A;  1SDN A;  5HAQ A;  1I5Q A;  1ONH A;  1ERM A;  2J7V A;  4EWF A;  3LO7 A;  5FAQ A;  5EVI D;  3M2K A;  4E3K A;  1DJB A;  4LCM A;  1L0D A;  2EFX A;  5CEC A;  3PBR A;  1SHV A;  4OPQ A;  1ESI A;  4WMC D;  1JVJ A;  3BEB A;  4C3Q A;  3MZE A;  2XGN A;  2WAE A;  3IHB A;  1L0G A;  4BD0 A;  2ZQ7 A;  1WYC A;  2OLU A;  4R23 A;  1OME A;  3QHY A;  2PBY A;  1E3U D;  4E3L A;  5DTK A;  2Y91 A;  1TDG A;  1GHI A;  3WRZ A;  1YLY A;  1HD8 A;  4XUZ A;  5E2F A;  2P9V B;  3ZG8 B;  2ZC6 B;  3O87 A;  5F82 A;  3IXB A;  1W8Y A;  1IYO A;  4E3O A;  3OCL A;  2XK1 A;  5EVI A;  1L0F A;  3ITA A;  3B3X A;  4R4R A;  1ES2 A;  1L2S A;  1ESU A;  4KZB A;  1PZO A;  3E2K A;  3OPH A;  4OP5 A;  1ALQ A;  4KZ5 A;  3AGD A;  4WMC A;  1YLJ A;  2Y59 A;  4E3M A;  3VP1 A;  2OSU A;  1KDW A;  1MPL A;  4OLG A;  1NYY A;  5TGF A;  5D3O A;  3ZFZ A;  4QJG A;  4GZB A;  4B4X A;  5CGW A;  4RX2 A;  3V3R A;  3VP2 A;  3ITB A;  4E3N A;  2Z2L B;  4QY6 A;  5KMW A;  5FQI A;  1K25 A;  1E3U A;  1NXY A;  1YMS A;  2JCH A;  2Z2M B;  4C75 A;  5A90 A;  3HRE A;  2Y2P A;  4QY5 A;  2X01 A;  3ZVW A;  3CJM A;  5CTM A;  3WS2 A;  3OPR A;  3VOY A;  2WAF A;  3IXH A;  1KE4 A;  1ZG4 A;  3VSK A;  3LY4 A;  5FQQ A;  2PU2 A;  3UO9 A;  1ZG6 A;  1BZA A;  1CEF A;  1G6A A;  1YM1 A;  5TR7 A;  3UPO A;  4GD6 A;  2A49 A;  3BM6 A;  5HAR A;  4A5R A;  5EOE A;  3IWI A;  5CEB A;  1RCJ A;  3HBR A;  2I72 A;  4MBF A;  3IQA A;  2XFS A;  1FR6 A;  3NC8 A;  3V39 A;  3GSG A;  2X02 A;  4UA7 A;  5F83 A;  4GDN A;  3BEC A;  4BLM A;  4D2O A;  4OQI A;  1C3B A;  3SS5 A;  1W79 A;  1ES5 A;  1SDE A;  2ZQD A;  4GDB A;  5CTN A;  1IYS A;  1DJA A;  4S2I A;  5FSR A;  2EX8 A;  3NI9 A;  5A92 A;  3ZG9 B;  3GMW A;  1JWV A;  4FSF A;  1SKF A;  4ZDX A;  1BLC A;  4ZBE A;  5EVI C;  3FV7 A;  4WYY A;  5GLC A;  3O88 A;  4EUZ A;  1W5D A;  2IWC A;  4E6W A;  2H0T A;  4UAA A;  1M6K A;  1BTL A;  3G4P A;  4HES A;  4EQI A;  3A3F A;  3PBO A;  4PM7 A;  3IXG A;  3IXD A;  1IKI A;  1FCM A;  4JPM A;  2Y2N A;  1XA7 A;  4X69 A;  3M6B A;  3SOI A;  5AQB A;  3VP3 A;  1K4E A;  5DF8 A;  3W4Q A;  2WGW A;  3MKF A;  4IED A;  5KZH A;  1K55 A;  1PW1 A;  5AQA A;  3A3J A;  4QB8 A;  3IHA A;  2XD1 A;  5EEC A;  4RX3 A;  3Q82 A;  1EWZ A;  4KEN B;  4WM9 A;  2J9P A;  2EX9 A;  2ZQ9 A;  5GL9 A;  2ZC7 A;  2R9W A;  2Y55 A;  4YIN A;  4DDY A;  3IH9 A;  1L0E A;  3NDE A;  3O86 A;  1BLP A;  3Q7V A;  3SH8 A;  3GQZ A;  4LV1 A;  3OC2 A;  1E25 A;  1LI0 A;  2XR0 A;  3UY6 A;  4NK3 A;  3VOZ A;  1FR1 A;  3IWO A;  2Y2K A;  4N1X A;  2Y2M A;  3ZG0 A;  2DRW A;  2HDQ A;  1H5X A;  1WYB A;  1XX2 A;  3OPL A;  3IWQ A;  1PYY A;  4OOY A;  4KG6 A;  3HLG A;  2EFU A;  2J8Y A;  4ZJ2 A;  2V20 A;  1KGE A;  1IKG A;  2ZC3 B;  3UDI A;  3FKW A;  3HVF A;  4OPZ A;  1NY0 A;  3TSG A;  4E3J A;  2J9O A;  1RP5 A;  2V2F F;  3GV9 A;  1YLT A;  1GHM A;  4BL3 A;  1XPB A;  1GHP A;  2WZX A;  4QHC A;  4UA9 A;  2E8I A;  3DWZ A;  4GNU A;  4S2N A;  3S22 A;  3ZDJ A;  4KZ3 A;  4WZ5 C;  5A93 A;  1CK3 A;  5KSH A;  2XEP A;  4HBU A;  5F1G A;  3UE1 A;  4EBN A;  1MWR A;  3VMA A;  3C4O A;  2EX2 A;  3GRJ A;  3W8K A;  1KE3 A;  1K55 C;  3CZD A;  3EQU A;  3RXX A;  4DE0 A;  5DF9 A;  1XGJ A;  1MBL A;  5FQM A;  4K0X A;  5G18 A;  1N9B A;  5CED A;  3Q1F A;  4KG5 A;  3UN7 A;  4U0T A;  4K0W A;  3BFF A;  3CG5 A;  1WE4 A;  4UHU A;  4X53 A;  3ZG7 B;  4LV3 A;  4S2P A;  5DTT A;  2JC7 A;  2VGJ A;  2H10 A;  4N92 A;  5E43 A;  2WKI A;  4IBX A;  1NYM A;  3Q7V B;  3VP0 A;  4E3I A;  2WUQ A;  2WAD A;  5CGS A;  3N6I A;  3OPP A;  2G2U A;  3TOI A;  4PM8 A;  2HPB A;  1AXB A;  2Y2H A;  4QU3 A;  3UPN A;  4X68 A;  4JLF A;  4EV4 A;  3S4X A;  5DTS A;  3ZNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...