4OQHA

Crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying r164s mutation in complex with boron-based inhibitor ec25
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Extended spectrum beta-lactamase TEM-63
total genus 97
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oqhA00
4C75A 2Y2KA 3A3JA 3Q7VA 2OV5A 1ES2A 3E2LA 5CGWA 3WS5A 2XFSA 3O88A 5HW3A 3PBOA 2J9PA 4NETA 4ZTKA 3IWOA 3MZEA 3SS3A 4HBTA 5L2FA 1E3UA 4JXWA 1LL5A 3GVBA 5FQIA 2ZJ9A 1FR1A 4OVDA 1C3BA 3PBSA 3OCNA 1MWRA 1K56D 2WUQA 4OP8A 4P87A 3Q1FA 4R4RA 4DXBA 1BZAA 1XGIA 2Y2QA 1BLSA 3WS4A 5AQAA 5EOEA 2V2FF 5M18A 2XR0A 5CHUA 1TVFA 4XUZA 4MBKA 1GHPA 3LO7A 3RXWA 4OQ0A 4S2KA 3UPPA 3V39A 3O3VA 3OPLA 1XKZA 3TSGA 3C4PA 3VP2A 2X71A 4QJGA 3UO9A 2ZQDA 4BLMA 3M6HA 1BT5A 3SH7A 1E4DA 1QMFA 1KGFA 1DJAA 2ZM2A 3IWIA 3UY6A 4S2JA 4JF6A 3G35A 1IEMA 3QNBA 1CI8A 1ERQA 1JTGA 2QZ6A 4KZ9A 2VGJA 4PM8A 4XXRA 4HESA 4N9KA 1L0EA 5EVID 5FQMA 3M6BA 3ZNYA 2ZQAA 3BECA 4B4XA 4EBPA 5EPHA 5GLBA 4EWFA 4WMCA 1NZUA 1FCMA 3IF6A 4E3JA 1KE3A 1ZG4A 4E3LA 3AGEA 4S2NA 1RGYA 5A92A 1LL9A 3ZNTA 1K38A 5FAQA 4R3JA 1GHMA 5KSHA 4F94A 1H5XA 1K4FA 5FSRA 3HREA 3HUOA 1H8ZA 5EUAA 5F82A 3HLDA 3ZFZA 2WK0A 4BL3A 4D2OA 2HPBA 2ZC5B 2JCHA 3BLSA 4PM9A 1N4OA 4Z9QA 3VOZA 2PBYA 5HAIA 3VSKA 1PI4A 4N92A 3QNCA 4OPYA 5CHJA 5E2HA 5EE8A 5HARA 4S2OA 4BJPA 4E6XA 2JBFA 5HAQA 2RCXA 3SH8A 1PIOA 1XA1A 2B5RA 4C6YA 3HUMA 4N1HA 3ZVWA 1ESUA 4GB7A 3UNWA 1Q2QA 3LY3A 3Q7VB 4OONA 3DTMA 3DW0A 4WYYA 5EOOA 1Z6FA 1PZOA 4X6TA 3C7UA 1L0GA 4LV2A 4MLLA 2JC7A 3ZG9B 4B4ZA 4LV1A 1TDGA 4JF5A 2FFYA 2EX9A 4OOYA 2WGWA 3PBTA 2C5WB 4Y0TA 2E8IA 1XP4A 1ES4A 1XGJA 4OLGA 1ALQA 1YLPA 4YFMA 1SDNA 4JLFA 3UE1A 2ZC4B 2EXBA 3C7VA 4KENB 1YQSA 4QY5A 3GR2A 3V3SA 1BULA 2Y2NA 4IBRA 3E2KA 4R3BA 5FQJA 5TGFA 3PAEA 3IQAA 4A5RA 4BD1A 4OP5A 1LHYA 3A3IA 1EI5A 3VP0A 2HP9A 2XD1A 1NYYA 1MXOA 4CJNA 5A90A 4GDNA 3WS0A 3V50A 3VFHA 2OSUA 3N4IA 5E43A 3IXBA 4K91A 4UAAA 3N6IA 3HVFA 1K54A 3WS1A 3TG9A 2WAEA 2WGVA 1YLWA 3IH8A 5GLDA 3UDFA 4DF6A 3S1YA 3UPOA 3NCKA 4R4SA 3RXXA 3G4PA 4QD4A 1TDLA 4LCMA 3OPRA 4LENA 4PM6A 4E3MA 1MWSA 1I2SA 3VSLA 1JVJA 2Y4AA 4OOLA 5AQ7A 3ZG7B 4EV4A 1BUEA 5CEBA 2H5SA 5FAPA 4ZBEA 5M1AA 3UDIA 4B88A 2Y2GA 5KMWA 4DRTA 1GA0A 3ZVTA 3MKEA 3W4OA 4JBFA 4OQHA 5DF8A 4PPRA 1BLHA 2EFUA 4EQIA 3G2ZA 2Q9MA 4KZBA 2BLSA 3FV7A 5EVLA 3UN7A 3P98A 4GD6A 5E2GA 1NY0A 1VM1A 1ZKJA 2I72A 3MKFA 5FQQA 3G30A 4FSFA 2WYXA 1O07A 4XUXA 4EUZA 2WKIA 1YMXA 2OLUA 2HP5A 2XLNA 4JPMA 3GMWA 5EVIC 3SS4A 2ZM0A 5JYPA 2C6WB 1DY6A 4KZ4A 4BQMA 4Y0OA 4IVIA 1ESIA 3BFDA 4X56A 1NZOA 3MBZA 4PM5A 3HBRA 4KZ7A 3VFFA 1K6SA 1PYYA 3VP3A 5E2EA 2XDMA 1KE4A 2WKEA 2PU2A 5FAOA 2JE5A 1MWUA 1NYMA 5I94A 4GOGA 3TOIA 3NBLA 2QMIA 1I2WA 2A3UA 3CZDA 4OLDA 3ITBA 4X68A 1L0DA 2EFXA 4ZJ1A 2XH9A 1KVLA 4LCLA 4WZ4A 1SCWA 4HBUA 4ZJ3A 5F1FA 2IWDA 5KZHA 3CJMA 2P9VB 3NDGA 4KZAA 4EBNA 4DE2A 1CI9A 4BENA 1ONGA 2Y59A 1FQGA 2DCFA 1KDSA 2Y2MA 5FQ9A 3A3EA 3PAGA 2G2UA 3DWZA 4IBXA 1PI5A 4OH0A 2WZXA 4E3NA 3GV9A 3I7JA 3ISGA 1S6RA 1K55A 1VQQA 1XXMA 3A3FA 2X01A 4FH4A 5FI7A 3UE0A 1PWCA 1DJCA 3V5MA 1MY8A 1LI0A 4NK3A 3NI9A 3N8LA 3OC2A 4HEFA 5EVIB 2A49A 3BYDA 2CC1A 4P0MA 2XD5A 1WYCA 1IKIA 2P9VA 2GDNA 4DXCA 5DVAA 4BD0A 1FR6A 1JWVA 4BL2A 2Y2OA 1IYOA 5CERA 4RVAA 3G34A 2Y2HA 1J9MA 3CMZA 3FKWA 3GTCA 2HDRA 3MXRA 3W4PA 5FA7A 4OPRA 1K56A 4RYEA 1K57A 3LEZA 3G32A 3Q82A 1K57C 1SDEA 5IHVA 2Z2LB 4WZ5A 4IVKA 1S0WA 1DJBA 3Q7ZA 4OQGA 4DKIA 3WS2A 4GDBA 1GA9A 4IEDA 3AGFA 5A91A 4UA7A 3UPNA 2VGKA 4LV0A 2Y2PA 4KG5A 5CTNA 5G18A 3HLBA 4FH2A 4N9LA 1KGEA 3BFEA 3JYIA 4KQOA 1O7EA 4R23A 3G2YA 4YINA 5DTTA 3WWXA 5AQ9A 1PW8A 3IXGA 4JF4A 2H0YA 4OOMA 1K55C 5CGXA 4R0QA 3M2JA 1W5DA 1IYPA 2HDSA 1L2SA 1MKIA 3HLCA 4GD8A 2G2WA 5CRFA 5EVIA 2XEPA 3FKVA 3MZDA 4WMCD 3PTEA 3O87A 1FSWA 3FYZA 5CEDA 3ZG8B 1PW1A 1NRFA 1JWPA 1GHIA 1BLCA 1H8YA 4WM9A 5F83A 2R9WA 2XK1A 1W79A 1EROA 3SS5A 2X02A 5A93A 3IHBA 4K0XA 3HL9A 4Y7PA 1IELA 5DF7A 4MBHA 2EX6A 1JTDA 4FCFA 4RX3A 5M19A 2DRWA 3HLWA 3VOYA 5CTMA 1RGZA 2ZQ8A 4R1GA 2XF3A 2HP6A 2RL3A 2WZZA 4E3OA 2DNSA 3O86A 4ZAMA 2H10A 2HDQA 3W4QA 4QHCA 2V1ZA 2ZC6B 4GNUA 4KZ3A 2Z2MB 4FD8A 3VMAA 2WKHA 5FASA 5DTKA 4QU3A 5HX9A 4N1XA 2J9OA 2WAFA 5CHMA 3ZG0A 1FOFA 5GHYA 4X53A 3Q81A 4DE1A 4X69A 3EQVA 1YLYA 3NY4A 5FATA 4KQQA 5FQKA 5FDHA 4JKTA 5GL9A 1CK3A 1IYQA 1E3UD 2BG1A 3GRJA 3BFCA 1M40A 1Q2PA 2XQZA 3IHAA 4LV3A 3BFFA 2QPNA 1YLZA 5F1GA 5AQBA 1BSGA 1YLJA 3BRMA 3LY4A 3CG5A 5BOHA 2EX8A 1HTZA 1FCOA 1WE4A 1L0FA 2WGWB 3HUNA 3C5AA 1CEFA 5E2FA 3IXDA 3OPHA 4UA9A 3N7WA 5DTSA 4KZ8A 5GLCA 5U47A 5TR7A 2UWXA 2H0TA 5D3OA 3NDEA 3VP1A 1RP5A 4DE0A 2ZQCA 4C3QA 2XFTA 2J8YA 2ZQ7A 3C4OA 3GSGA 3NIAA 4L0LA 4OKPA 5FI6A 4E3IA 4EBLA 4QB8A 3IWQA 1MBLA 1M6KA 3BLMA 3S4XA 2ZLYA 2EXAA 4WZ5C 4S2PA 3OPPA 2ZC7A 4RA7A 5HAPA 1Y54A 1LLBA 4UA6A 1K54C 4KG6A 3W8KA 4X55A 3OCLA 1BLPA 5CECA 2IWBA 3RJUA 1NJ4A 3ITAA 3ZG5A 3V3RA 1OMEA 3LCEA 2V20A 2EX2A 2PU4A 2Y2JA 3M2KA 4OQIA 3B3XA 4U0XA 2ZC3B 4WEKA 5HL1A 1BTLA 1I5QA 3IF5A 3UE3A 3S22A 4PMAA 2Y91A 4OPQA 2ZQ9A 3PBQA 3MFDA 5EECA 1HD8A 1HZOA 1YLTA 1G6AA 3FZCA 4U3TA 5CGSA 4CPKA 2WGIA 4H8RA 1TEMA 4Y0UA 3ZGAB 4KQRA 2ZD8A 4WELA 3WRZA 4JXVA 3D4FA 3IF6B 1FSYA 4E3KA 2HDUA 1KE0A 1YT4A 2ZMAA 4O7DA 3PBRA 5CXWA 5FI2A 3SOIA 5DF9A 1PWDA 4S2NC 3P09A 3QHYA 1FCNA 1U60A 3BM6A 4KZ5A 1XA7A 5GHZA 1K25A 4DE3A 1PZPA 3MZFA 3BEBA 4S2IA 5KSCA 2R9XA 4KG2A 4DDYA 1ES5A 1YM1A 2IWCA 5TFQA 1KVMA 2Y2LA 3N8RA 3IT9A 3NC8A 4DDSA 4UHUA 1JWZA 4ZDXA 3A3DA 5HFOA 1G68A 1MWTA 2Q9NA 1ERMA 1KGGA 3HLEA 3MXSA 3UDXA 2XGNA 1CEGA 4ZJ2A 1XPBA 1W7FA 2WADA 4GZBA 2FFFB 4E6WA 1ES3A 3IH9A 1SHVA 3SH9A 3ZCZA 2P74A 2OLVA 1W8QA 3HLGA 4M3KA 4S2MA 1ZC2A 1WYBA 3HLFA 3WRTA 3Q07A 1E25A 4KZ6A 4S2LA 1EWZA 4MNRA 1KDWA 4QY6A 3DWKA 3G31A 1PWGA 5GLAA 3ZDJA 4PM7A 3BFGA 1HVBA 4GKUA 1K6RA 1ONHA 4WBGA 3ZHHA 3PBNA 1GCEA 1MPLA 1XX2A 1RCJA 3EQUA 4GN2A 3IXHA 2ZM8A 1K4EA 3AGDA 1LI9A 4JXSA 4RX2A 1SKFA 3IF6C 3N8SA 4P85A 1QMEA 4Q8IA 4P6BA 3VP4A 1ZG6A 2Y2IA 5JYOA 5J8XA 4ID4A 1NXYA 1W8YA 2J7VA 4JXGA 4U0TA 1AXBA 1YMSA 4K0WA 1IYSA 5GHXA 4OPZA 3FWLA 2Y55A 4MBFA 4MEZA 4WEJA 1IKGA 3GQZA 3OZHA 1N9BA
chains in the Genus database with same CATH superfamily
2W3GA 3T4OA 5HW3A 3EEHA 3SS3A 2L4RA 2V9AA 1V9YA 5FQIA 3OCNA 1K56D 2OAQ1 4R4RA 1XGIA 1BLSA 3WS4A 1OJ5A 5EOEA 2V2FF 5CHUA 4XUZA 2B95A 3FG8A 3OPLA 3UO9A 1TD5A 2ZQDA 4NKPA 4NEED 1E4DA 1QMFA 1KGFA 4Y5FA 2PYPA 3IWIA 4S2JA 1IEMA 3EEAA 2QZ6A 3NOUC 4CLCB 4N9KA 5FQMA 4HJ4A 3BECA 3ZNYA 4B4XA 5EPHA 5GLBA 4EWFA 1NZUA 1KE3A 3LR4A 4S2NA 3ZNTA 1GHMA 5KSHA 4BWIA 4F94A 1H5XA 3LEQA 1XJ6A 2JCHA 2HZ5A 3VSKA 1PI4A 4OPYA 4E6XA 4S2OA 2JBFA 3HUMA 1ESUA 1PFLA 5EVEA 4GB7A 3LY3A 5EOOA 3ZG9B 4X6TA 4LV2A 5DKKA 2EX9A 1N9LA 1ES4A 1YLPA 2ZC4B 4KENB 3MQQA 3KSIA 3DTIA 4A5RA 4HQAA 2PT7A 2XRNA 3WS0A 3VFHA 3N4IA 5E43A 1T18A 2VKSA 4UAAA 1VETB 3N6IA 3HVFA 3WS1A 3TG9A 2WAEA 1YLWA 3UDFA 4DF6A 3G4PA 2Y8HA 3QP2A 1MWSA 1I2SA 3EGXC 2Y4AA 4OOLA 4CLCD 4ZBEA 4B88A 2BTFP 3ZVTA 1LSWA 3G2ZA 3T4KA 3NECA 3UN7A 4GD6A 1KOUA 1VM1A 3MKFA 4CQHA 1NRJA 3G30A 4QWOA 1O07A 4GJ4A 2WKIA 5CX7A 3SS4A 2ZM0A 5L10A 3EGDC 5JYPA 2C6WB 5AJGA 1DY6A 4Y0OA 1NZOA 3MBZA 4LGWA 3VFFA 4DMZA 2WKEA 2PU2A 4I38A 1I2WA 2A3UA 3CZDA 4OLDA 4ZJ1A 2KX6A 1KVLA 1SCWA 2IWDA 3CJMA 4KZAA 3R4KA 3H82B 2DCFA 2Y2MA 3DAVA 3A3EA 1Y4OA 2G2UA 4EUVA 2WZXA 4EESA 1XXMA 2MJ6A 3V5MA 2WKPA 2XD5A 2K2NA 2PR5A 4ARZA 4BD0A 4BL2A 1JWVA 1IYOA 2Q0OA 5CERA 3BWLA 2Y2HA 3CMZA 3FKWA 3TW8A 5FDSA 3G32A 1ZTUA 4IVKA 1YAXA 4JGRA 3S7OA 3WS2A 3A0VA 3AGFA 2Y2PA 3LR5A 3GDIA 1KGEA 5DTTA 4JF4A 1STZA 1IYPA 2A24B 1L2SA 5EVIA 2HJ9C 1DP6A 4XT2B 3FKVA 3O87A 3FYZA 1PW1A 1JWPA 1BLCA 2X02A 3IHBA 4Y7PA 4ETZA 5M19A 3KYEA 2ZQ8A 5KIZA 2DNSA 2H10A 2V1ZA 4GS9A 4KZ3A 4FD8A 3VMAA 5DTKA 4N1XA 1W63Q 4MCWA 2PD7A 3Q81A 3EQVA 1YLYA 3OBFA 4KQQA 4JKTA 2BASA 4R38A 1OT9A 1M40A 1Q2PA 4LV3A 3BFFA 1D1JA 1TS0A 5BOHA 1YLJA 5F69A 5FEGA 1F9IA 2EX8A 1HTZA 1XJ4A 5HWVA 2WGWB 1FILA 3HUNA 3LIDA 5E2FA 4UA9A 3MFXA 4XT2A 3PYPA 5TR7A 2UWXA 3NDEA 1RP5A 1NLZA 3RFBA 2ZQ7A 5L07A 4QB8A 3IWQA 3QP5A 1M6KA 3BLMA 2QWSA 1ODVA 4S2PA 2GZAA 4RA7A 3VE4A 4B9OA 2LB5A 1LLBA 3T50A 3RJUA 3ZG5A 3V3RA 1OMEA 1ZHHB 4EETB 3B3XA 4U0XA 4P6ZM 1TS6A 3S7PA 4OPQA 2ZQ9A 3PBQA 3MFDA 5EECA 1YLTA 1YKDA 5CGSA 3IX3A 3LIAA 4HJ6A 4Y0UA 5L8MA 3ZGAB 2ZD8A 4ARZB 4O7DA 2QJ7A 5FI2A 4S2NC 3TRCA 2M7UA 3T4TA 1K25A 4AFIA 4S2IA 3BEBA 5EM0A 4DDYA 1ES5A 1YM1A 1KVMA 2VGLM 3A3DA 1BYWA 2Q9NA 4HP4A 1S1ZA 3MXSA 2XGNA 1N9NA 4UQIM 1XPBA 5K5BA 3KYZA 4E6WA 1ZC2A 4FUWA 4KZ6A 3UB6A 3R7WA 1KDWA 2IA2A 2E8JA 1PWGA 4HHDA 1OTEA 1HVBA 3BFGA 1OTBA 1XX2A 4GN2A 3ZDJA 1K4EA 4JXSA 2JKFA 3JPUA 1J3WA 3E0YA 4WF0A 1YSPA 4P6BA 3VP4A 1ZG6A 4LRZE 5JYOA 5J8XA 4K0WA 3FC7A 3VE3A 2Y55A 1CQAA 3OZHA 4JGOA 4C75A 3E2LA 1OPXA 2XFSA 4CLCA 2J9PA 4NETA 4ZTKA 3IWOA 1F98A 2ZBBA 4MN5A 1E3UA 1C3BA 1MWRA 4OP8A 3Q1FA 3EOIA 2LB9A 5AQAA 5AVEA 4GLQA 2XR0A 3UPPA 3RXWA 3TSGA 2PAVP 4L9GA 1DJAA 2ZM2A 3UY6A 2ZOIA 2M7VA 4D60A 4I5SA 3G35A 2YKHA 1ERQA 1JTGA 4KZ9A 2VGJA 3K3DA 5EVID 4EBPA 3IF6A 5HDDA 1ZG4A 4E3LA 3AGEA 4EEPA 1K38A 5FAQA 1IOUA 3HREA 2VA0A 1H8ZA 2EWVA 2WK0A 3QP6A 2L1MA 4D2OA 2HPBA 2GX5A 2H28A 1T1CA 2V0UA 3LR0A 3R7WB 3VOZA 4N92A 1P97A 3QNCA 2RCXA 3SH8A 2K7SA 5HPFA 4G3WA 1N9OA 3UNWA 3D3OA 3F1NB 4LV1A 4JF5A 3T4SA 2FFYA 4Y0TA 2C5WB 1XP4A 3FPVA 4Y3IA 4OLGA 5HDSA 1SDNA 4JLFA 2EXBA 3C7VA 3PAEA 3IS2A 4OP5A 3A3IA 4EERA 2OAP1 3VP0A 2XD1A 1NYYA 4LFUA 1LSXA 2OSUA 2VV7A 3IXBA 2L0WA 3IH8A 5GLDA 3S1YA 4HOIA 3UPOA 3NCKA 4O0PA 4R4SA 3RXXA 4NXBA 2O9CA 3OPRA 4LENA 4PM6A 2V0WA 4F3LB 5AQ7A 4EV4A 2I9VA 3UDIA 4YWZA 2O9BA 3RH8B 1GA0A 2QHKA 3IX8A 4GHIB 1BLHA 4EQIA 4KZBA 1DP9A 5EVLA 2O9AA 1NY0A 2PBDP 2I72A 5FQQA 2WYXA 4K08A 2P04A 2XLNA 4JPMA 3GMWA 5EVIC 3LIBA 3H7WB 4BQMA 4IVIA 3CHWP 4X56A 3P7NA 5E2EA 2GJ3A 4BBVA 1KE4A 1NYMA 5I94A 4GOGA 3TOIA 3MQ0A 2V8CA 3ITBA 1D7EA 4X68A 1L0DA 2EFXA 4P6ZS 2XH9A 5HZHA 4WZ4A 4ZJ3A 2P9VB 3NDGA 4EBNA 4DE2A 4BENA 1FQGA 2EA9A 3MF0A 4MN7A 4OH0A 1SKOB 1S6RA 1K55A 4Y17A 3U4LP 4CLCE 3N8LA 3RTYA 4DJ2A 3IBJA 5EVIB 4RQ9A 1WYCA 1IKIA 4DXCA 5DVAA 1MKMA 1J9MA 2PDRA 3MXRA 1VHMA 4OPRA 3Q82A 1K57C 3U2AA 1SDEA 3L9KA 2Z2LB 2R78A 1DJBA 3ZYTA 3Q7ZA 4GDBA 3UB8A 4E04A 4UA7A 2VGKA 1S66L 5HL6A 4NXEA 4N9LA 4HIAA 3JYIA 4YINA 1PW8A 1P9WA 1G28A 3M2JA 1EW0A 4GD8A 4Y2FA 3EWKA 4WMCD 3PTEA 5F83A 2R9WA 4PKYG 3QP4A 4EU0A 5HSQA 3SS5A 5DJTA 1TS8A 2XA7M 3UMDA 3HL9A 1IELA 2KLIA 2EX6A 1JTDA 4FCFA 1H3QA 2DRWA 3VOYA 3CUEC 1GSXA 4R1GA 1HLUP 1K0KA 3T4QA 3LR3A 4GNUA 2Z2MB 4QU3A 2WAFA 1T1BA 3ZG0A 4X69A 5FATA 5FDHA 1TS7A 2K31A 3BFCA 1YPRA 3IHAA 3MJQA 1YLZA 3CG5A 4GCZA 4LLOB 3C5AA 3IXDA 3C38A 3N7WA 3T4JA 4KZ8A 5D3OA 4DE0A 2ZQCA 2XFTA 2J3TC 2J8YA 3GSGA 4LRXC 4E3IA 1V9ZA 3T12B 3K3CA 2VV6A 4WZ5C 5J7EA 3OPPA 5IT5A 2ZC7A 5HAPA 1NJ4A 3ITAA 4EEUA 3M2KA 4OQIA 5HL1A 2ZC3B 4ME4A 3W2ZA 3IF5A 1I5QA 3UE3A 2OOLA 4H8RA 4KQRA 3WRZA 2QYBA 2D01A 1KE0A 3MMHA 5CXWA 1YSQA 3JVVA 3SOIA 5DF9A 1VEUA 1PWDA 4GHIA 3TE8A 1Y28A 2D02A 5KSCA 4DDSA 2Y2LA 3N8RA 4UHUA 2V1AA 5HFOA 1G68A 1NWZA 4HJ3A 3CWFA 4GZBA 2FFFB 3ZCZA 2OLVA 3HLGA 4NG2A 3BY8A 2W3EA 1E25A 3DWKA 2W1RA 5J3WA 2W1TA 4WBGA 3F1OA 3PBNA 1F5MA 4WLAA 1LSVA 5FL3A 2J7VA 4U0TA 1AXBA 1YMSA 2B02A 3GQZA 1N9BA 2Y2KA 3SZTA 3A3JA 3Q7VA 2OV5A 3SW1A 2Z6CA 3E4OA 5CGWA 3F1OB 1JNUA 2WKRA 4HBTA 5L2FA 2J3TD 2ZJ9A 4OVDA 3PBSA 4H6JA 4DXBA 4P87A 3S7QA 2V8FA 5M18A 1TVFA 3T1RA 3V39A 3TJZC 1XKZA 3VP2A 1BT5A 3SH7A 3E4QA 2XROA 5TBMA 5F68A 1CI8A 4ETXA 4XXRA 4HESA 1L0EA 4JGQA 3M6BA 2PHYA 2ZQAA 5I5LA 1OTAA 3F1PB 4E3JA 4Q0IA 1RGYA 1LL9A 4DJ3A 5EUAA 3HLDA 3ZFZA 1G5UA 2PRFA 2ZC5B 1N4OA 2PBYA 4GW9A 4KUOA 5E2HA 5HARA 5CHJA 5EE8A 1PIOA 2PR6A 1XA1A 3JVUA 2VZWA 1Q2QA 3Q7VB 3DW0A 4WYYA 1Z6FA 5IU1A 1PZOA 3HJIA 2JC7A 4MLLA 2W3HA 4YOFA 4BBUA 1TDGA 1GSVA 2OWHA 5HWWA 2E8IA 2JKTM 4B93A 4IUKA 1XGJA 3VOLA 4YFMA 3UE1A 3GECA 1DP8A 4QPRA 2ZMVA 4QY5A 3V3SA 4Y13A 2Y2NA 4IBRA 3T4LA 4R3BA 5FQJA 5TGFA 3IQAA 5EM1A 2W1TB 2V1BA 4BD1A 4FOFA 2HP9A 3KSGA 4CJNA 5A90A 2ZL1A 4GDNA 4MN6A 4K91A 1K54A 2WGVA 4NXFA 3LFVA 1UGUA 4Z1WA 1TDLA 2QJ5A 4E3MA 5DFXA 3HJKA 5HWTA 3B33A 3DTEA 5CEBA 1S1YA 2G7UA 5DFYA 2Y2GA 2EWWA 3CI6A 2HGVA 5C5KA 4DRTA 3MKEA 3W4OA 2VJWA 5DF8A 4PPRA 2EFUA 5TJJA 2BLSA 3P98A 5E2GA 1ACFA 4FSFA 4XUXA 1YMXA 2OLUA 2HP5A 4HP9A 5G4YA 4WL9A 3BFDA 3MXQA 2M1CA 2NUPC 4KZ7A 2VK3A 1K6SA 3VP3A 3LICA 3QP1A 2XDMA 1G6OA 5FAOA 1MWUA 3CUEA 4WN5A 3NBLA 5AVFA 1OJGA 2Y79A 4JGPA 5F1FA 5KZHA 4BBTA 3NHQA 1CI9A 4LPZA 1KDSA 3PAGA 3DWZA 1PI5A 2JN7A 3I7JA 3T1SA 2X01A 3A3FA 5FI7A 3UE0A 1PWCA 1DJCA 1LI0A 4NK3A 3NI9A 1OTIA 3LI8A 2CMNA 2CC1A 4P0MA 2P9VA 2GDNA 3LIEA 1FR6A 2KOIA 5A8BA 3E4PA 3GTCA 4M4XA 5MC7A 5FA7A 1K57A 3ICYA 3BW6A 5IHVA 2JKTI 4WZ5A 1S0WA 2HJEA 4DKIA 4EW7A 1GA9A 1LT0A 4IEDA 3MSHA 3C2WA 1X0OA 5G18A 4R70A 3HLBA 3HCYA 4KQOA 1O7EA 3G2YA 5AQ9A 3IXGA 4OOMA 3CPTB 2HDSA 1MKIA 3HLCA 2A24A 5CRFA 2XEPA 4PHTA 2JKRI 4MDZA 5CEDA 3ZG8B 1GHIA 2XSSA 2XK1A 1W79A 5EV0A 5A93A 4K0XA 2ACGA 4MBHA 2XF3A 4IHQA 2HP6A 2RL3A 2WZZA 4E3OA 4ZAMA 3W4QA 4QHCA 2ZC6B 2J80A 2WKHA 5HD5A 2J9OA 1FOFA 3IX4A 4X53A 4DE1A 3IS2B 1IYQA 3GRJA 1XJ3A 3V67A 3CAXA 5F1GA 5AQBA 1BSGA 3LY4A 2W3DA 5HD3A 1FCOA 1WE4A 1NLYA 1CEFA 3OPHA 2ZOHA 3F1NA 1WA9A 5DTSA 3L7HA 4II7A 5GLCA 2H0TA 3VP1A 4Q0JA 5FI6A 3CPTA 3NIAA 3O5YA 4OKPA 4NXGA 1MBLA 3BQ8A 2ZLYA 2EXAA 2AVXA 2PYRA 4FTXA 1Y54A 4UA6A 1K54C 4X55A 2QKPA 5CECA 2IWBA 2EX2A 2Y2JA 3KYQA 4WEKA 4Y15A 1BTLA 3D9YA 1PRQA 3LIFA 1HD8A 1HZOA 4U3TA 1G6AA 4CPKA 1UWNX 4WELA 4JXVA 3IF6B 4KUKA 2ZL1B 1T19A 1YT4A 1H8MA 2Z6DA 3P09A 1FCNA 1U60A 3BM6A 3UB7A 2R9XA 4KG2A 2IWCA 2P08A 5TFQA 3NC8A 3E98A 3NJAA 1ERMA 3HLEA 4R6LA 5L09A 1CEGA 4ZJ2A 1W7FA 2JKRM 1ES3A 4UEYA 1S4RA 1SHVA 3SH9A 2P74A 2ZMFA 1W8QA 1VETA 1WYBA 1L3LA 1CF0A 3Q07A 3UE6A 4MNRA 5GLAA 2VX8A 3UB9A 1ONHA 3OLOA 3ZHHA 1GCEA 1RCJA 2ZM8A 3IF6C 3C30A 4Q8IA 4L9FA 4ID4A 1NXYA 1W8YA 3B42A 5GHXA 3FWLA 4HH3A 2VGLS 4MBFA 4WEJA 5FAPA 4G3VA 1P0ZA 2VEAA 1ES2A 4I3JA 4G3KA 5DKLA 3WS5A 3O88A 3PBOA 1P9RA 3MZEA 4JXWA 1LL5A 3GVBA 3C8CA 1FR1A 2WUQA 2W0NA 1BZAA 2Y2QA 3T1QB 1XFNA 4MBKA 1GHPA 3LO7A 4OQ0A 4S2KA 3O3VA 3C4PA 2X71A 4QJGA 4BLMA 3M6HA 2J3WA 3NOPC 2FH5A 3A0RA 4H6JB 4JF6A 4I39A 3PR6A 3QNBA 3BJNA 4PM8A 3CITA 1MC0A 1VEUB 5F5YA 4WMCA 3ZQ5A 1FCMA 5A92A 4R3JA 4I3IA 5LBRA 1K4FA 5FSRA 3HUOA 5F82A 4ESPA 3QP8A 2VV8A 4BL3A 2KDKA 2NUTC 3BLSA 4PM9A 4Z9QA 3KSFA 5HAIA 2W27A 1S4SA 5HAQA 4BJPA 4X1LA 4O01A 2B5RA 4C6YA 4N1HA 3ZVWA 4OONA 3DTMA 4L9EA 3C7UA 1L0GA 4B4ZA 3IBRA 4OOYA 2WGWA 3PBTA 1S67L 1ALQA 1YQSA 3KO6A 3GR2A 3MS6A 1BULA 3E2KA 3OOVA 1W63M 3NULA 1LHYA 4HNBA 1EI5A 1MXOA 3T1XA 5TBMB 3V50A 3KSHA 5HDCA 3CLOA 2W3FA 3KX0X 4QD4A 4LCMA 3VSLA 1JVJA 4Q0HA 3ZG7B 4EXOA 4R3AA 1BUEA 2H5SA 4DN0A 5M1AA 5KMWA 3H9WA 1A0KA 4UQIS 1AWIA 2FZ0A 4JBFA 4OQHA 2Q9MA 3A0SA 4PKYA 3FV7A 3G6OA 3LYXA 1ZKJA 1IFQA 2VLGA 4EUZA 4X1MA 1F2KA 2WKQA 4KZ4A 1ESIA 4PM5A 3HBRA 1PYYA 5F6AA 3FPWA 2JE5A 1T1AA 2QMIA 1PNEA 4MMNA 4LCLA 4HBUA 1ONGA 2Y59A 5FQ9A 1XFQA 4IBXA 4E3NA 3GV9A 5EFWA 3ISGA 4KQDA 1VQQA 4FH4A 1OTDA 1MY8A 3OC2A 2P7JA 4HEFA 3B47A 3BQAA 2A49A 3BYDA 1VB6A 3K2NA 4YNRA 2Y2OA 4RVAA 2GNXA 4HY8A 3G34A 2HDRA 2DMWA 2B18A 3W4PA 4GS9B 1K56A 4IUHA 4RYEA 3LEZA 4OQGA 2JHEA 2O99A 5HPIA 5A91A 3UPNA 4LV0A 4KG5A 5CTNA 5DJUA 2A2LA 4FH2A 1MZUA 3BFEA 4R23A 3WWXA 2H0YA 4X25A 1K55C 5CGXA 4R0QA 1W5DA 3DBAA 1TF1A 2G2WA 3MZDA 1FSWA 2OWJA 2PD8A 1NRFA 1H8YA 4WM9A 3P01A 1EROA 4F3LA 1LL8A 5DF7A 3S7NA 1DRMA 4RX3A 3HLWA 5CTMA 1RGZA 3O86A 2HDQA 2HV1A 4LRYC 5FASA 3UB5P 3D72A 5HX9A 4HI4A 3MQOA 1GSWA 5CHMA 5GHYA 3NY4A 5FQKA 5GL9A 1CK3A 3DTKA 2INWA 1E3UD 2BG1A 1CJFA 2XQZA 2QPNA 3BRMA 1Z09A 1L0FA 4EQ1A 5U47A 3H82A 4C3QA 3C4OA 4L0LA 4EBLA 3S4XA 4BMWA 5IS1A 1SZVA 4IJGA 2O0YA 4KG6A 5J4EA 3W8KA 3OCLA 1BLPA 3ULFA 3LUQA 3LCEA 2V20A 1XJ2A 3VV4A 2PU4A 3S22A 4PMAA 2Y91A 1H0MA 3BY9A 3FZCA 2WGIA 3MR0A 1TEMA 2HF6A 3D4FA 4HH2A 1FSYA 4E3KA 2HDUA 4O8GA 2ZMAA 3PBRA 4PAUA 3QHYA 3LGOA 4KZ5A 1XA7A 5GHZA 4DE3A 1PZPA 3MZFA 5G4ZA 3IT9A 1SKOA 1JWZA 4ZDXA 1MWTA 1KGGA 3UDXA 3LI9A 3PHYA 4I3AA 1FIKA 2WADA 3PXPA 3IH9A 4ZRRA 4M3KA 4S2MA 1UWPX 2XA7S 3HLFA 3WRTA 4S2LA 1EWZA 3NOTC 1OT6A 4QY6A 1D06A 3G31A 4PM7A 4GKUA 1K6RA 1MPLA 3UMEA 3EQUA 3IXHA 3AGDA 1LI9A 2YKFA 4RX2A 1SKFA 3N8SA 4P85A 1QMEA 2JKGA 2UV0E 2Y2IA 3H7WA 4JXGA 4CLCC 1IYSA 4OPZA 4WUJA 5FEFA 3F1PA 4MEZA 1IKGA
chains in the Genus database with same CATH topology
4C75A 2Y2KA 3A3JA 3Q7VA 2OV5A 1ES2A 3E2LA 5CGWA 3WS5A 2XFSA 3O88A 5HW3A 3PBOA 2J9PA 4NETA 4ZTKA 3IWOA 3MZEA 3SS3A 4HBTA 5L2FA 1E3UA 4JXWA 1LL5A 3GVBA 5FQIA 2ZJ9A 1FR1A 4OVDA 1C3BA 3PBSA 3OCNA 1MWRA 1K56D 2WUQA 4OP8A 4P87A 3Q1FA 4R4RA 4DXBA 1BZAA 1XGIA 2Y2QA 1BLSA 3WS4A 5AQAA 5EOEA 2V2FF 5M18A 2XR0A 5CHUA 1TVFA 4XUZA 4MBKA 1GHPA 3LO7A 3RXWA 4OQ0A 4S2KA 3UPPA 3V39A 3O3VA 3OPLA 1XKZA 3TSGA 3C4PA 3VP2A 2X71A 4QJGA 3UO9A 2ZQDA 4BLMA 3M6HA 1BT5A 3SH7A 1E4DA 1QMFA 1KGFA 1DJAA 2ZM2A 3IWIA 3UY6A 4S2JA 4JF6A 3G35A 1IEMA 3QNBA 1CI8A 1ERQA 1JTGA 2QZ6A 4KZ9A 2VGJA 4PM8A 4XXRA 4HESA 4N9KA 1L0EA 5EVID 5FQMA 3M6BA 3ZNYA 2ZQAA 3BECA 4B4XA 4EBPA 5EPHA 5GLBA 4EWFA 4WMCA 1NZUA 1FCMA 3IF6A 4E3JA 1KE3A 1ZG4A 4E3LA 3AGEA 4S2NA 1RGYA 5A92A 1LL9A 3ZNTA 1K38A 5FAQA 4R3JA 1GHMA 5KSHA 4F94A 1H5XA 1K4FA 5FSRA 3HREA 3HUOA 1H8ZA 5EUAA 5F82A 3HLDA 3ZFZA 2WK0A 4BL3A 4D2OA 2HPBA 2ZC5B 2JCHA 3BLSA 4PM9A 1N4OA 4Z9QA 3VOZA 2PBYA 5HAIA 3VSKA 1PI4A 4N92A 3QNCA 4OPYA 5CHJA 5E2HA 5EE8A 5HARA 4S2OA 4BJPA 4E6XA 2JBFA 5HAQA 2RCXA 3SH8A 1PIOA 1XA1A 2B5RA 4C6YA 3HUMA 4N1HA 3ZVWA 1ESUA 4GB7A 3UNWA 1Q2QA 3LY3A 3Q7VB 4OONA 3DTMA 3DW0A 4WYYA 5EOOA 1Z6FA 1PZOA 4X6TA 3C7UA 1L0GA 4LV2A 4MLLA 2JC7A 3ZG9B 4B4ZA 4LV1A 1TDGA 4JF5A 2FFYA 2EX9A 4OOYA 2WGWA 3PBTA 2C5WB 4Y0TA 2E8IA 1XP4A 1ES4A 1XGJA 4OLGA 1ALQA 1YLPA 4YFMA 1SDNA 4JLFA 3UE1A 2ZC4B 2EXBA 3C7VA 4KENB 1YQSA 4QY5A 3GR2A 3V3SA 1BULA 2Y2NA 4IBRA 3E2KA 4R3BA 5FQJA 5TGFA 3PAEA 3IQAA 4A5RA 4BD1A 4OP5A 1LHYA 3A3IA 1EI5A 3VP0A 2HP9A 2XD1A 1NYYA 1MXOA 4CJNA 5A90A 4GDNA 3WS0A 3V50A 3VFHA 2OSUA 3N4IA 5E43A 3IXBA 4K91A 4UAAA 3N6IA 3HVFA 1K54A 3WS1A 3TG9A 2WAEA 2WGVA 1YLWA 3IH8A 5GLDA 3UDFA 4DF6A 3S1YA 3UPOA 3NCKA 4R4SA 3RXXA 3G4PA 4QD4A 1TDLA 4LCMA 3OPRA 4LENA 4PM6A 4E3MA 1MWSA 1I2SA 3VSLA 1JVJA 2Y4AA 4OOLA 5AQ7A 3ZG7B 4EV4A 1BUEA 5CEBA 2H5SA 5FAPA 4ZBEA 5M1AA 3UDIA 4B88A 2Y2GA 5KMWA 4DRTA 1GA0A 3ZVTA 3MKEA 3W4OA 4JBFA 4OQHA 5DF8A 4PPRA 1BLHA 2EFUA 4EQIA 3G2ZA 2Q9MA 4KZBA 2BLSA 3FV7A 5EVLA 3UN7A 3P98A 4GD6A 5E2GA 1NY0A 1VM1A 1ZKJA 2I72A 3MKFA 5FQQA 3G30A 4FSFA 2WYXA 1O07A 4XUXA 4EUZA 2WKIA 1YMXA 2OLUA 2HP5A 2XLNA 4JPMA 3GMWA 5EVIC 3SS4A 2ZM0A 5JYPA 2C6WB 1DY6A 4KZ4A 4BQMA 4Y0OA 4IVIA 1ESIA 3BFDA 4X56A 1NZOA 3MBZA 4PM5A 3HBRA 4KZ7A 3VFFA 1K6SA 1PYYA 3VP3A 5E2EA 2XDMA 1KE4A 2WKEA 2PU2A 5FAOA 2JE5A 1MWUA 1NYMA 5I94A 4GOGA 3TOIA 3NBLA 2QMIA 1I2WA 2A3UA 3CZDA 4OLDA 3ITBA 4X68A 1L0DA 2EFXA 4ZJ1A 2XH9A 1KVLA 4LCLA 4WZ4A 1SCWA 4HBUA 4ZJ3A 5F1FA 2IWDA 5KZHA 3CJMA 2P9VB 3NDGA 4KZAA 4EBNA 4DE2A 1CI9A 4BENA 1ONGA 2Y59A 1FQGA 2DCFA 1KDSA 2Y2MA 5FQ9A 3A3EA 3PAGA 2G2UA 3DWZA 4IBXA 1PI5A 4OH0A 2WZXA 4E3NA 3GV9A 3I7JA 3ISGA 1S6RA 1K55A 1VQQA 1XXMA 3A3FA 2X01A 4FH4A 5FI7A 3UE0A 1PWCA 1DJCA 3V5MA 1MY8A 1LI0A 4NK3A 3NI9A 3N8LA 3OC2A 4HEFA 5EVIB 2A49A 3BYDA 2CC1A 4P0MA 2XD5A 1WYCA 1IKIA 2P9VA 2GDNA 4DXCA 5DVAA 4BD0A 1FR6A 1JWVA 4BL2A 2Y2OA 1IYOA 5CERA 4RVAA 3G34A 2Y2HA 1J9MA 3CMZA 3FKWA 3GTCA 2HDRA 3MXRA 3W4PA 5FA7A 4OPRA 1K56A 4RYEA 1K57A 3LEZA 3G32A 3Q82A 1K57C 1SDEA 5IHVA 2Z2LB 4WZ5A 4IVKA 1S0WA 1DJBA 3Q7ZA 4OQGA 4DKIA 3WS2A 4GDBA 1GA9A 4IEDA 3AGFA 5A91A 4UA7A 3UPNA 2VGKA 4LV0A 2Y2PA 4KG5A 5CTNA 5G18A 3HLBA 4FH2A 4N9LA 1KGEA 3BFEA 3JYIA 4KQOA 1O7EA 4R23A 3G2YA 4YINA 5DTTA 3WWXA 5AQ9A 1PW8A 3IXGA 4JF4A 2H0YA 4OOMA 1K55C 5CGXA 4R0QA 3M2JA 1W5DA 1IYPA 2HDSA 1L2SA 1MKIA 3HLCA 4GD8A 2G2WA 5CRFA 5EVIA 2XEPA 3FKVA 3MZDA 4WMCD 3PTEA 3O87A 1FSWA 3FYZA 5CEDA 3ZG8B 1PW1A 1NRFA 1JWPA 1GHIA 1BLCA 1H8YA 4WM9A 5F83A 2R9WA 2XK1A 1W79A 1EROA 3SS5A 2X02A 5A93A 3IHBA 4K0XA 3HL9A 4Y7PA 1IELA 5DF7A 4MBHA 2EX6A 1JTDA 4FCFA 4RX3A 5M19A 2DRWA 3HLWA 3VOYA 5CTMA 1RGZA 2ZQ8A 4R1GA 2XF3A 2HP6A 2RL3A 2WZZA 4E3OA 2DNSA 3O86A 4ZAMA 2H10A 2HDQA 3W4QA 4QHCA 2V1ZA 2ZC6B 4GNUA 4KZ3A 2Z2MB 4FD8A 3VMAA 2WKHA 5FASA 5DTKA 4QU3A 5HX9A 4N1XA 2J9OA 2WAFA 5CHMA 3ZG0A 1FOFA 5GHYA 4X53A 3Q81A 4DE1A 4X69A 3EQVA 1YLYA 3NY4A 5FATA 4KQQA 5FQKA 5FDHA 4JKTA 5GL9A 1CK3A 1IYQA 1E3UD 2BG1A 3GRJA 3BFCA 1M40A 1Q2PA 2XQZA 3IHAA 4LV3A 3BFFA 2QPNA 1YLZA 5F1GA 5AQBA 1BSGA 1YLJA 3BRMA 3LY4A 3CG5A 5BOHA 2EX8A 1HTZA 1FCOA 1WE4A 1L0FA 2WGWB 3HUNA 3C5AA 1CEFA 5E2FA 3IXDA 3OPHA 4UA9A 3N7WA 5DTSA 4KZ8A 5GLCA 5U47A 5TR7A 2UWXA 2H0TA 5D3OA 3NDEA 3VP1A 1RP5A 4DE0A 2ZQCA 4C3QA 2XFTA 2J8YA 2ZQ7A 3C4OA 3GSGA 3NIAA 4L0LA 4OKPA 5FI6A 4E3IA 4EBLA 4QB8A 3IWQA 1MBLA 1M6KA 3BLMA 3S4XA 2ZLYA 2EXAA 4WZ5C 4S2PA 3OPPA 2ZC7A 4RA7A 5HAPA 1Y54A 1LLBA 4UA6A 1K54C 4KG6A 3W8KA 4X55A 3OCLA 1BLPA 5CECA 2IWBA 3RJUA 1NJ4A 3ITAA 3ZG5A 3V3RA 1OMEA 3LCEA 2V20A 2EX2A 2PU4A 2Y2JA 3M2KA 4OQIA 3B3XA 4U0XA 2ZC3B 4WEKA 5HL1A 1BTLA 1I5QA 3IF5A 3UE3A 3S22A 4PMAA 2Y91A 4OPQA 2ZQ9A 3PBQA 3MFDA 5EECA 1HD8A 1HZOA 1YLTA 1G6AA 3FZCA 4U3TA 5CGSA 4CPKA 2WGIA 4H8RA 1TEMA 4Y0UA 3ZGAB 4KQRA 2ZD8A 4WELA 3WRZA 4JXVA 3D4FA 3IF6B 1FSYA 4E3KA 2HDUA 1KE0A 1YT4A 2ZMAA 4O7DA 3PBRA 5CXWA 5FI2A 3SOIA 5DF9A 1PWDA 4S2NC 3P09A 3QHYA 1FCNA 1U60A 3BM6A 4KZ5A 1XA7A 5GHZA 1K25A 4DE3A 1PZPA 3MZFA 3BEBA 4S2IA 5KSCA 2R9XA 4KG2A 4DDYA 1ES5A 1YM1A 2IWCA 5TFQA 1KVMA 2Y2LA 3N8RA 3IT9A 3NC8A 4DDSA 4UHUA 1JWZA 4ZDXA 3A3DA 5HFOA 1G68A 1MWTA 2Q9NA 1ERMA 1KGGA 3HLEA 3MXSA 3UDXA 2XGNA 1CEGA 4ZJ2A 1XPBA 1W7FA 2WADA 4GZBA 2FFFB 4E6WA 1ES3A 3IH9A 1SHVA 3SH9A 3ZCZA 2P74A 2OLVA 1W8QA 3HLGA 4M3KA 4S2MA 1ZC2A 1WYBA 3HLFA 3WRTA 3Q07A 1E25A 4KZ6A 4S2LA 1EWZA 4MNRA 1KDWA 4QY6A 3DWKA 3G31A 1PWGA 5GLAA 3ZDJA 4PM7A 3BFGA 1HVBA 4GKUA 1K6RA 1ONHA 4WBGA 3ZHHA 3PBNA 1GCEA 1MPLA 1XX2A 1RCJA 3EQUA 4GN2A 3IXHA 2ZM8A 1K4EA 3AGDA 1LI9A 4JXSA 4RX2A 1SKFA 3IF6C 3N8SA 4P85A 1QMEA 4Q8IA 4P6BA 3VP4A 1ZG6A 2Y2IA 5JYOA 5J8XA 4ID4A 1NXYA 1W8YA 2J7VA 4JXGA 4U0TA 1AXBA 1YMSA 4K0WA 1IYSA 5GHXA 4OPZA 3FWLA 2Y55A 4MBFA 4MEZA 4WEJA 1IKGA 3GQZA 3OZHA 1N9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C75 A;  2Y2K A;  3A3J A;  3Q7V A;  2OV5 A;  1ES2 A;  3E2L A;  5CGW A;  3WS5 A;  2XFS A;  3O88 A;  5HW3 A;  3PBO A;  2J9P A;  4NET A;  4ZTK A;  3IWO A;  3MZE A;  3SS3 A;  4HBT A;  5L2F A;  1E3U A;  4JXW A;  1LL5 A;  3GVB A;  5FQI A;  2ZJ9 A;  1FR1 A;  4OVD A;  1C3B A;  3PBS A;  3OCN A;  1MWR A;  1K56 D;  2WUQ A;  4OP8 A;  4P87 A;  3Q1F A;  4R4R A;  4DXB A;  1BZA A;  1XGI A;  2Y2Q A;  1BLS A;  3WS4 A;  5AQA A;  5EOE A;  2V2F F;  5M18 A;  2XR0 A;  5CHU A;  1TVF A;  4XUZ A;  4MBK A;  1GHP A;  3LO7 A;  3RXW A;  4OQ0 A;  4S2K A;  3UPP A;  3V39 A;  3O3V A;  3OPL A;  1XKZ A;  3TSG A;  3C4P A;  3VP2 A;  2X71 A;  4QJG A;  3UO9 A;  2ZQD A;  4BLM A;  3M6H A;  1BT5 A;  3SH7 A;  1E4D A;  1QMF A;  1KGF A;  1DJA A;  2ZM2 A;  3IWI A;  3UY6 A;  4S2J A;  4JF6 A;  3G35 A;  1IEM A;  3QNB A;  1CI8 A;  1ERQ A;  1JTG A;  2QZ6 A;  4KZ9 A;  2VGJ A;  4PM8 A;  4XXR A;  4HES A;  4N9K A;  1L0E A;  5EVI D;  5FQM A;  3M6B A;  3ZNY A;  2ZQA A;  3BEC A;  4B4X A;  4EBP A;  5EPH A;  5GLB A;  4EWF A;  4WMC A;  1NZU A;  1FCM A;  3IF6 A;  4E3J A;  1KE3 A;  1ZG4 A;  4E3L A;  3AGE A;  4S2N A;  1RGY A;  5A92 A;  1LL9 A;  3ZNT A;  1K38 A;  5FAQ A;  4R3J A;  1GHM A;  5KSH A;  4F94 A;  1H5X A;  1K4F A;  5FSR A;  3HRE A;  3HUO A;  1H8Z A;  5EUA A;  5F82 A;  3HLD A;  3ZFZ A;  2WK0 A;  4BL3 A;  4D2O A;  2HPB A;  2ZC5 B;  2JCH A;  3BLS A;  4PM9 A;  1N4O A;  4Z9Q A;  3VOZ A;  2PBY A;  5HAI A;  3VSK A;  1PI4 A;  4N92 A;  3QNC A;  4OPY A;  5CHJ A;  5E2H A;  5EE8 A;  5HAR A;  4S2O A;  4BJP A;  4E6X A;  2JBF A;  5HAQ A;  2RCX A;  3SH8 A;  1PIO A;  1XA1 A;  2B5R A;  4C6Y A;  3HUM A;  4N1H A;  3ZVW A;  1ESU A;  4GB7 A;  3UNW A;  1Q2Q A;  3LY3 A;  3Q7V B;  4OON A;  3DTM A;  3DW0 A;  4WYY A;  5EOO A;  1Z6F A;  1PZO A;  4X6T A;  3C7U A;  1L0G A;  4LV2 A;  4MLL A;  2JC7 A;  3ZG9 B;  4B4Z A;  4LV1 A;  1TDG A;  4JF5 A;  2FFY A;  2EX9 A;  4OOY A;  2WGW A;  3PBT A;  2C5W B;  4Y0T A;  2E8I A;  1XP4 A;  1ES4 A;  1XGJ A;  4OLG A;  1ALQ A;  1YLP A;  4YFM A;  1SDN A;  4JLF A;  3UE1 A;  2ZC4 B;  2EXB A;  3C7V A;  4KEN B;  1YQS A;  4QY5 A;  3GR2 A;  3V3S A;  1BUL A;  2Y2N A;  4IBR A;  3E2K A;  4R3B A;  5FQJ A;  5TGF A;  3PAE A;  3IQA A;  4A5R A;  4BD1 A;  4OP5 A;  1LHY A;  3A3I A;  1EI5 A;  3VP0 A;  2HP9 A;  2XD1 A;  1NYY A;  1MXO A;  4CJN A;  5A90 A;  4GDN A;  3WS0 A;  3V50 A;  3VFH A;  2OSU A;  3N4I A;  5E43 A;  3IXB A;  4K91 A;  4UAA A;  3N6I A;  3HVF A;  1K54 A;  3WS1 A;  3TG9 A;  2WAE A;  2WGV A;  1YLW A;  3IH8 A;  5GLD A;  3UDF A;  4DF6 A;  3S1Y A;  3UPO A;  3NCK A;  4R4S A;  3RXX A;  3G4P A;  4QD4 A;  1TDL A;  4LCM A;  3OPR A;  4LEN A;  4PM6 A;  4E3M A;  1MWS A;  1I2S A;  3VSL A;  1JVJ A;  2Y4A A;  4OOL A;  5AQ7 A;  3ZG7 B;  4EV4 A;  1BUE A;  5CEB A;  2H5S A;  5FAP A;  4ZBE A;  5M1A A;  3UDI A;  4B88 A;  2Y2G A;  5KMW A;  4DRT A;  1GA0 A;  3ZVT A;  3MKE A;  3W4O A;  4JBF A;  4OQH A;  5DF8 A;  4PPR A;  1BLH A;  2EFU A;  4EQI A;  3G2Z A;  2Q9M A;  4KZB A;  2BLS A;  3FV7 A;  5EVL A;  3UN7 A;  3P98 A;  4GD6 A;  5E2G A;  1NY0 A;  1VM1 A;  1ZKJ A;  2I72 A;  3MKF A;  5FQQ A;  3G30 A;  4FSF A;  2WYX A;  1O07 A;  4XUX A;  4EUZ A;  2WKI A;  1YMX A;  2OLU A;  2HP5 A;  2XLN A;  4JPM A;  3GMW A;  5EVI C;  3SS4 A;  2ZM0 A;  5JYP A;  2C6W B;  1DY6 A;  4KZ4 A;  4BQM A;  4Y0O A;  4IVI A;  1ESI A;  3BFD A;  4X56 A;  1NZO A;  3MBZ A;  4PM5 A;  3HBR A;  4KZ7 A;  3VFF A;  1K6S A;  1PYY A;  3VP3 A;  5E2E A;  2XDM A;  1KE4 A;  2WKE A;  2PU2 A;  5FAO A;  2JE5 A;  1MWU A;  1NYM A;  5I94 A;  4GOG A;  3TOI A;  3NBL A;  2QMI A;  1I2W A;  2A3U A;  3CZD A;  4OLD A;  3ITB A;  4X68 A;  1L0D A;  2EFX A;  4ZJ1 A;  2XH9 A;  1KVL A;  4LCL A;  4WZ4 A;  1SCW A;  4HBU A;  4ZJ3 A;  5F1F A;  2IWD A;  5KZH A;  3CJM A;  2P9V B;  3NDG A;  4KZA A;  4EBN A;  4DE2 A;  1CI9 A;  4BEN A;  1ONG A;  2Y59 A;  1FQG A;  2DCF A;  1KDS A;  2Y2M A;  5FQ9 A;  3A3E A;  3PAG A;  2G2U A;  3DWZ A;  4IBX A;  1PI5 A;  4OH0 A;  2WZX A;  4E3N A;  3GV9 A;  3I7J A;  3ISG A;  1S6R A;  1K55 A;  1VQQ A;  1XXM A;  3A3F A;  2X01 A;  4FH4 A;  5FI7 A;  3UE0 A;  1PWC A;  1DJC A;  3V5M A;  1MY8 A;  1LI0 A;  4NK3 A;  3NI9 A;  3N8L A;  3OC2 A;  4HEF A;  5EVI B;  2A49 A;  3BYD A;  2CC1 A;  4P0M A;  2XD5 A;  1WYC A;  1IKI A;  2P9V A;  2GDN A;  4DXC A;  5DVA A;  4BD0 A;  1FR6 A;  1JWV A;  4BL2 A;  2Y2O A;  1IYO A;  5CER A;  4RVA A;  3G34 A;  2Y2H A;  1J9M A;  3CMZ A;  3FKW A;  3GTC A;  2HDR A;  3MXR A;  3W4P A;  5FA7 A;  4OPR A;  1K56 A;  4RYE A;  1K57 A;  3LEZ A;  3G32 A;  3Q82 A;  1K57 C;  1SDE A;  5IHV A;  2Z2L B;  4WZ5 A;  4IVK A;  1S0W A;  1DJB A;  3Q7Z A;  4OQG A;  4DKI A;  3WS2 A;  4GDB A;  1GA9 A;  4IED A;  3AGF A;  5A91 A;  4UA7 A;  3UPN A;  2VGK A;  4LV0 A;  2Y2P A;  4KG5 A;  5CTN A;  5G18 A;  3HLB A;  4FH2 A;  4N9L A;  1KGE A;  3BFE A;  3JYI A;  4KQO A;  1O7E A;  4R23 A;  3G2Y A;  4YIN A;  5DTT A;  3WWX A;  5AQ9 A;  1PW8 A;  3IXG A;  4JF4 A;  2H0Y A;  4OOM A;  1K55 C;  5CGX A;  4R0Q A;  3M2J A;  1W5D A;  1IYP A;  2HDS A;  1L2S A;  1MKI A;  3HLC A;  4GD8 A;  2G2W A;  5CRF A;  5EVI A;  2XEP A;  3FKV A;  3MZD A;  4WMC D;  3PTE A;  3O87 A;  1FSW A;  3FYZ A;  5CED A;  3ZG8 B;  1PW1 A;  1NRF A;  1JWP A;  1GHI A;  1BLC A;  1H8Y A;  4WM9 A;  5F83 A;  2R9W A;  2XK1 A;  1W79 A;  1ERO A;  3SS5 A;  2X02 A;  5A93 A;  3IHB A;  4K0X A;  3HL9 A;  4Y7P A;  1IEL A;  5DF7 A;  4MBH A;  2EX6 A;  1JTD A;  4FCF A;  4RX3 A;  5M19 A;  2DRW A;  3HLW A;  3VOY A;  5CTM A;  1RGZ A;  2ZQ8 A;  4R1G A;  2XF3 A;  2HP6 A;  2RL3 A;  2WZZ A;  4E3O A;  2DNS A;  3O86 A;  4ZAM A;  2H10 A;  2HDQ A;  3W4Q A;  4QHC A;  2V1Z A;  2ZC6 B;  4GNU A;  4KZ3 A;  2Z2M B;  4FD8 A;  3VMA A;  2WKH A;  5FAS A;  5DTK A;  4QU3 A;  5HX9 A;  4N1X A;  2J9O A;  2WAF A;  5CHM A;  3ZG0 A;  1FOF A;  5GHY A;  4X53 A;  3Q81 A;  4DE1 A;  4X69 A;  3EQV A;  1YLY A;  3NY4 A;  5FAT A;  4KQQ A;  5FQK A;  5FDH A;  4JKT A;  5GL9 A;  1CK3 A;  1IYQ A;  1E3U D;  2BG1 A;  3GRJ A;  3BFC A;  1M40 A;  1Q2P A;  2XQZ A;  3IHA A;  4LV3 A;  3BFF A;  2QPN A;  1YLZ A;  5F1G A;  5AQB A;  1BSG A;  1YLJ A;  3BRM A;  3LY4 A;  3CG5 A;  5BOH A;  2EX8 A;  1HTZ A;  1FCO A;  1WE4 A;  1L0F A;  2WGW B;  3HUN A;  3C5A A;  1CEF A;  5E2F A;  3IXD A;  3OPH A;  4UA9 A;  3N7W A;  5DTS A;  4KZ8 A;  5GLC A;  5U47 A;  5TR7 A;  2UWX A;  2H0T A;  5D3O A;  3NDE A;  3VP1 A;  1RP5 A;  4DE0 A;  2ZQC A;  4C3Q A;  2XFT A;  2J8Y A;  2ZQ7 A;  3C4O A;  3GSG A;  3NIA A;  4L0L A;  4OKP A;  5FI6 A;  4E3I A;  4EBL A;  4QB8 A;  3IWQ A;  1MBL A;  1M6K A;  3BLM A;  3S4X A;  2ZLY A;  2EXA A;  4WZ5 C;  4S2P A;  3OPP A;  2ZC7 A;  4RA7 A;  5HAP A;  1Y54 A;  1LLB A;  4UA6 A;  1K54 C;  4KG6 A;  3W8K A;  4X55 A;  3OCL A;  1BLP A;  5CEC A;  2IWB A;  3RJU A;  1NJ4 A;  3ITA A;  3ZG5 A;  3V3R A;  1OME A;  3LCE A;  2V20 A;  2EX2 A;  2PU4 A;  2Y2J A;  3M2K A;  4OQI A;  3B3X A;  4U0X A;  2ZC3 B;  4WEK A;  5HL1 A;  1BTL A;  1I5Q A;  3IF5 A;  3UE3 A;  3S22 A;  4PMA A;  2Y91 A;  4OPQ A;  2ZQ9 A;  3PBQ A;  3MFD A;  5EEC A;  1HD8 A;  1HZO A;  1YLT A;  1G6A A;  3FZC A;  4U3T A;  5CGS A;  4CPK A;  2WGI A;  4H8R A;  1TEM A;  4Y0U A;  3ZGA B;  4KQR A;  2ZD8 A;  4WEL A;  3WRZ A;  4JXV A;  3D4F A;  3IF6 B;  1FSY A;  4E3K A;  2HDU A;  1KE0 A;  1YT4 A;  2ZMA A;  4O7D A;  3PBR A;  5CXW A;  5FI2 A;  3SOI A;  5DF9 A;  1PWD A;  4S2N C;  3P09 A;  3QHY A;  1FCN A;  1U60 A;  3BM6 A;  4KZ5 A;  1XA7 A;  5GHZ A;  1K25 A;  4DE3 A;  1PZP A;  3MZF A;  3BEB A;  4S2I A;  5KSC A;  2R9X A;  4KG2 A;  4DDY A;  1ES5 A;  1YM1 A;  2IWC A;  5TFQ A;  1KVM A;  2Y2L A;  3N8R A;  3IT9 A;  3NC8 A;  4DDS A;  4UHU A;  1JWZ A;  4ZDX A;  3A3D A;  5HFO A;  1G68 A;  1MWT A;  2Q9N A;  1ERM A;  1KGG A;  3HLE A;  3MXS A;  3UDX A;  2XGN A;  1CEG A;  4ZJ2 A;  1XPB A;  1W7F A;  2WAD A;  4GZB A;  2FFF B;  4E6W A;  1ES3 A;  3IH9 A;  1SHV A;  3SH9 A;  3ZCZ A;  2P74 A;  2OLV A;  1W8Q A;  3HLG A;  4M3K A;  4S2M A;  1ZC2 A;  1WYB A;  3HLF A;  3WRT A;  3Q07 A;  1E25 A;  4KZ6 A;  4S2L A;  1EWZ A;  4MNR A;  1KDW A;  4QY6 A;  3DWK A;  3G31 A;  1PWG A;  5GLA A;  3ZDJ A;  4PM7 A;  3BFG A;  1HVB A;  4GKU A;  1K6R A;  1ONH A;  4WBG A;  3ZHH A;  3PBN A;  1GCE A;  1MPL A;  1XX2 A;  1RCJ A;  3EQU A;  4GN2 A;  3IXH A;  2ZM8 A;  1K4E A;  3AGD A;  1LI9 A;  4JXS A;  4RX2 A;  1SKF A;  3IF6 C;  3N8S A;  4P85 A;  1QME A;  4Q8I A;  4P6B A;  3VP4 A;  1ZG6 A;  2Y2I A;  5JYO A;  5J8X A;  4ID4 A;  1NXY A;  1W8Y A;  2J7V A;  4JXG A;  4U0T A;  1AXB A;  1YMS A;  4K0W A;  1IYS A;  5GHX A;  4OPZ A;  3FWL A;  2Y55 A;  4MBF A;  4MEZ A;  4WEJ A;  1IKG A;  3GQZ A;  3OZH A;  1N9B A; 
#chains in the Genus database with same CATH topology
 2W3G A;  3T4O A;  5HW3 A;  3EEH A;  3SS3 A;  2L4R A;  2V9A A;  1V9Y A;  5FQI A;  3OCN A;  1K56 D;  2OAQ 1;  4R4R A;  1XGI A;  1BLS A;  3WS4 A;  1OJ5 A;  5EOE A;  2V2F F;  5CHU A;  4XUZ A;  2B95 A;  3FG8 A;  3OPL A;  3UO9 A;  1TD5 A;  2ZQD A;  4NKP A;  4NEE D;  1E4D A;  1QMF A;  1KGF A;  4Y5F A;  2PYP A;  3IWI A;  4S2J A;  1IEM A;  3EEA A;  2QZ6 A;  3NOU C;  4CLC B;  4N9K A;  5FQM A;  4HJ4 A;  3BEC A;  3ZNY A;  4B4X A;  5EPH A;  5GLB A;  4EWF A;  1NZU A;  1KE3 A;  3LR4 A;  4S2N A;  3ZNT A;  1GHM A;  5KSH A;  4BWI A;  4F94 A;  1H5X A;  3LEQ A;  1XJ6 A;  2JCH A;  2HZ5 A;  3VSK A;  1PI4 A;  4OPY A;  4E6X A;  4S2O A;  2JBF A;  3HUM A;  1ESU A;  1PFL A;  5EVE A;  4GB7 A;  3LY3 A;  5EOO A;  3ZG9 B;  4X6T A;  4LV2 A;  5DKK A;  2EX9 A;  1N9L A;  1ES4 A;  1YLP A;  2ZC4 B;  4KEN B;  3MQQ A;  3KSI A;  3DTI A;  4A5R A;  4HQA A;  2PT7 A;  2XRN A;  3WS0 A;  3VFH A;  3N4I A;  5E43 A;  1T18 A;  2VKS A;  4UAA A;  1VET B;  3N6I A;  3HVF A;  3WS1 A;  3TG9 A;  2WAE A;  1YLW A;  3UDF A;  4DF6 A;  3G4P A;  2Y8H A;  3QP2 A;  1MWS A;  1I2S A;  3EGX C;  2Y4A A;  4OOL A;  4CLC D;  4ZBE A;  4B88 A;  2BTF P;  3ZVT A;  1LSW A;  3G2Z A;  3T4K A;  3NEC A;  3UN7 A;  4GD6 A;  1KOU A;  1VM1 A;  3MKF A;  4CQH A;  1NRJ A;  3G30 A;  4QWO A;  1O07 A;  4GJ4 A;  2WKI A;  5CX7 A;  3SS4 A;  2ZM0 A;  5L10 A;  3EGD C;  5JYP A;  2C6W B;  5AJG A;  1DY6 A;  4Y0O A;  1NZO A;  3MBZ A;  4LGW A;  3VFF A;  4DMZ A;  2WKE A;  2PU2 A;  4I38 A;  1I2W A;  2A3U A;  3CZD A;  4OLD A;  4ZJ1 A;  2KX6 A;  1KVL A;  1SCW A;  2IWD A;  3CJM A;  4KZA A;  3R4K A;  3H82 B;  2DCF A;  2Y2M A;  3DAV A;  3A3E A;  1Y4O A;  2G2U A;  4EUV A;  2WZX A;  4EES A;  1XXM A;  2MJ6 A;  3V5M A;  2WKP A;  2XD5 A;  2K2N A;  2PR5 A;  4ARZ A;  4BD0 A;  4BL2 A;  1JWV A;  1IYO A;  2Q0O A;  5CER A;  3BWL A;  2Y2H A;  3CMZ A;  3FKW A;  3TW8 A;  5FDS A;  3G32 A;  1ZTU A;  4IVK A;  1YAX A;  4JGR A;  3S7O A;  3WS2 A;  3A0V A;  3AGF A;  2Y2P A;  3LR5 A;  3GDI A;  1KGE A;  5DTT A;  4JF4 A;  1STZ A;  1IYP A;  2A24 B;  1L2S A;  5EVI A;  2HJ9 C;  1DP6 A;  4XT2 B;  3FKV A;  3O87 A;  3FYZ A;  1PW1 A;  1JWP A;  1BLC A;  2X02 A;  3IHB A;  4Y7P A;  4ETZ A;  5M19 A;  3KYE A;  2ZQ8 A;  5KIZ A;  2DNS A;  2H10 A;  2V1Z A;  4GS9 A;  4KZ3 A;  4FD8 A;  3VMA A;  5DTK A;  4N1X A;  1W63 Q;  4MCW A;  2PD7 A;  3Q81 A;  3EQV A;  1YLY A;  3OBF A;  4KQQ A;  4JKT A;  2BAS A;  4R38 A;  1OT9 A;  1M40 A;  1Q2P A;  4LV3 A;  3BFF A;  1D1J A;  1TS0 A;  5BOH A;  1YLJ A;  5F69 A;  5FEG A;  1F9I A;  2EX8 A;  1HTZ A;  1XJ4 A;  5HWV A;  2WGW B;  1FIL A;  3HUN A;  3LID A;  5E2F A;  4UA9 A;  3MFX A;  4XT2 A;  3PYP A;  5TR7 A;  2UWX A;  3NDE A;  1RP5 A;  1NLZ A;  3RFB A;  2ZQ7 A;  5L07 A;  4QB8 A;  3IWQ A;  3QP5 A;  1M6K A;  3BLM A;  2QWS A;  1ODV A;  4S2P A;  2GZA A;  4RA7 A;  3VE4 A;  4B9O A;  2LB5 A;  1LLB A;  3T50 A;  3RJU A;  3ZG5 A;  3V3R A;  1OME A;  1ZHH B;  4EET B;  3B3X A;  4U0X A;  4P6Z M;  1TS6 A;  3S7P A;  4OPQ A;  2ZQ9 A;  3PBQ A;  3MFD A;  5EEC A;  1YLT A;  1YKD A;  5CGS A;  3IX3 A;  3LIA A;  4HJ6 A;  4Y0U A;  5L8M A;  3ZGA B;  2ZD8 A;  4ARZ B;  4O7D A;  2QJ7 A;  5FI2 A;  4S2N C;  3TRC A;  2M7U A;  3T4T A;  1K25 A;  4AFI A;  4S2I A;  3BEB A;  5EM0 A;  4DDY A;  1ES5 A;  1YM1 A;  1KVM A;  2VGL M;  3A3D A;  1BYW A;  2Q9N A;  4HP4 A;  1S1Z A;  3MXS A;  2XGN A;  1N9N A;  4UQI M;  1XPB A;  5K5B A;  3KYZ A;  4E6W A;  1ZC2 A;  4FUW A;  4KZ6 A;  3UB6 A;  3R7W A;  1KDW A;  2IA2 A;  2E8J A;  1PWG A;  4HHD A;  1OTE A;  1HVB A;  3BFG A;  1OTB A;  1XX2 A;  4GN2 A;  3ZDJ A;  1K4E A;  4JXS A;  2JKF A;  3JPU A;  1J3W A;  3E0Y A;  4WF0 A;  1YSP A;  4P6B A;  3VP4 A;  1ZG6 A;  4LRZ E;  5JYO A;  5J8X A;  4K0W A;  3FC7 A;  3VE3 A;  2Y55 A;  1CQA A;  3OZH A;  4JGO A;  4C75 A;  3E2L A;  1OPX A;  2XFS A;  4CLC A;  2J9P A;  4NET A;  4ZTK A;  3IWO A;  1F98 A;  2ZBB A;  4MN5 A;  1E3U A;  1C3B A;  1MWR A;  4OP8 A;  3Q1F A;  3EOI A;  2LB9 A;  5AQA A;  5AVE A;  4GLQ A;  2XR0 A;  3UPP A;  3RXW A;  3TSG A;  2PAV P;  4L9G A;  1DJA A;  2ZM2 A;  3UY6 A;  2ZOI A;  2M7V A;  4D60 A;  4I5S A;  3G35 A;  2YKH A;  1ERQ A;  1JTG A;  4KZ9 A;  2VGJ A;  3K3D A;  5EVI D;  4EBP A;  3IF6 A;  5HDD A;  1ZG4 A;  4E3L A;  3AGE A;  4EEP A;  1K38 A;  5FAQ A;  1IOU A;  3HRE A;  2VA0 A;  1H8Z A;  2EWV A;  2WK0 A;  3QP6 A;  2L1M A;  4D2O A;  2HPB A;  2GX5 A;  2H28 A;  1T1C A;  2V0U A;  3LR0 A;  3R7W B;  3VOZ A;  4N92 A;  1P97 A;  3QNC A;  2RCX A;  3SH8 A;  2K7S A;  5HPF A;  4G3W A;  1N9O A;  3UNW A;  3D3O A;  3F1N B;  4LV1 A;  4JF5 A;  3T4S A;  2FFY A;  4Y0T A;  2C5W B;  1XP4 A;  3FPV A;  4Y3I A;  4OLG A;  5HDS A;  1SDN A;  4JLF A;  2EXB A;  3C7V A;  3PAE A;  3IS2 A;  4OP5 A;  3A3I A;  4EER A;  2OAP 1;  3VP0 A;  2XD1 A;  1NYY A;  4LFU A;  1LSX A;  2OSU A;  2VV7 A;  3IXB A;  2L0W A;  3IH8 A;  5GLD A;  3S1Y A;  4HOI A;  3UPO A;  3NCK A;  4O0P A;  4R4S A;  3RXX A;  4NXB A;  2O9C A;  3OPR A;  4LEN A;  4PM6 A;  2V0W A;  4F3L B;  5AQ7 A;  4EV4 A;  2I9V A;  3UDI A;  4YWZ A;  2O9B A;  3RH8 B;  1GA0 A;  2QHK A;  3IX8 A;  4GHI B;  1BLH A;  4EQI A;  4KZB A;  1DP9 A;  5EVL A;  2O9A A;  1NY0 A;  2PBD P;  2I72 A;  5FQQ A;  2WYX A;  4K08 A;  2P04 A;  2XLN A;  4JPM A;  3GMW A;  5EVI C;  3LIB A;  3H7W B;  4BQM A;  4IVI A;  3CHW P;  4X56 A;  3P7N A;  5E2E A;  2GJ3 A;  4BBV A;  1KE4 A;  1NYM A;  5I94 A;  4GOG A;  3TOI A;  3MQ0 A;  2V8C A;  3ITB A;  1D7E A;  4X68 A;  1L0D A;  2EFX A;  4P6Z S;  2XH9 A;  5HZH A;  4WZ4 A;  4ZJ3 A;  2P9V B;  3NDG A;  4EBN A;  4DE2 A;  4BEN A;  1FQG A;  2EA9 A;  3MF0 A;  4MN7 A;  4OH0 A;  1SKO B;  1S6R A;  1K55 A;  4Y17 A;  3U4L P;  4CLC E;  3N8L A;  3RTY A;  4DJ2 A;  3IBJ A;  5EVI B;  4RQ9 A;  1WYC A;  1IKI A;  4DXC A;  5DVA A;  1MKM A;  1J9M A;  2PDR A;  3MXR A;  1VHM A;  4OPR A;  3Q82 A;  1K57 C;  3U2A A;  1SDE A;  3L9K A;  2Z2L B;  2R78 A;  1DJB A;  3ZYT A;  3Q7Z A;  4GDB A;  3UB8 A;  4E04 A;  4UA7 A;  2VGK A;  1S66 L;  5HL6 A;  4NXE A;  4N9L A;  4HIA A;  3JYI A;  4YIN A;  1PW8 A;  1P9W A;  1G28 A;  3M2J A;  1EW0 A;  4GD8 A;  4Y2F A;  3EWK A;  4WMC D;  3PTE A;  5F83 A;  2R9W A;  4PKY G;  3QP4 A;  4EU0 A;  5HSQ A;  3SS5 A;  5DJT A;  1TS8 A;  2XA7 M;  3UMD A;  3HL9 A;  1IEL A;  2KLI A;  2EX6 A;  1JTD A;  4FCF A;  1H3Q A;  2DRW A;  3VOY A;  3CUE C;  1GSX A;  4R1G A;  1HLU P;  1K0K A;  3T4Q A;  3LR3 A;  4GNU A;  2Z2M B;  4QU3 A;  2WAF A;  1T1B A;  3ZG0 A;  4X69 A;  5FAT A;  5FDH A;  1TS7 A;  2K31 A;  3BFC A;  1YPR A;  3IHA A;  3MJQ A;  1YLZ A;  3CG5 A;  4GCZ A;  4LLO B;  3C5A A;  3IXD A;  3C38 A;  3N7W A;  3T4J A;  4KZ8 A;  5D3O A;  4DE0 A;  2ZQC A;  2XFT A;  2J3T C;  2J8Y A;  3GSG A;  4LRX C;  4E3I A;  1V9Z A;  3T12 B;  3K3C A;  2VV6 A;  4WZ5 C;  5J7E A;  3OPP A;  5IT5 A;  2ZC7 A;  5HAP A;  1NJ4 A;  3ITA A;  4EEU A;  3M2K A;  4OQI A;  5HL1 A;  2ZC3 B;  4ME4 A;  3W2Z A;  3IF5 A;  1I5Q A;  3UE3 A;  2OOL A;  4H8R A;  4KQR A;  3WRZ A;  2QYB A;  2D01 A;  1KE0 A;  3MMH A;  5CXW A;  1YSQ A;  3JVV A;  3SOI A;  5DF9 A;  1VEU A;  1PWD A;  4GHI A;  3TE8 A;  1Y28 A;  2D02 A;  5KSC A;  4DDS A;  2Y2L A;  3N8R A;  4UHU A;  2V1A A;  5HFO A;  1G68 A;  1NWZ A;  4HJ3 A;  3CWF A;  4GZB A;  2FFF B;  3ZCZ A;  2OLV A;  3HLG A;  4NG2 A;  3BY8 A;  2W3E A;  1E25 A;  3DWK A;  2W1R A;  5J3W A;  2W1T A;  4WBG A;  3F1O A;  3PBN A;  1F5M A;  4WLA A;  1LSV A;  5FL3 A;  2J7V A;  4U0T A;  1AXB A;  1YMS A;  2B02 A;  3GQZ A;  1N9B A;  2Y2K A;  3SZT A;  3A3J A;  3Q7V A;  2OV5 A;  3SW1 A;  2Z6C A;  3E4O A;  5CGW A;  3F1O B;  1JNU A;  2WKR A;  4HBT A;  5L2F A;  2J3T D;  2ZJ9 A;  4OVD A;  3PBS A;  4H6J A;  4DXB A;  4P87 A;  3S7Q A;  2V8F A;  5M18 A;  1TVF A;  3T1R A;  3V39 A;  3TJZ C;  1XKZ A;  3VP2 A;  1BT5 A;  3SH7 A;  3E4Q A;  2XRO A;  5TBM A;  5F68 A;  1CI8 A;  4ETX A;  4XXR A;  4HES A;  1L0E A;  4JGQ A;  3M6B A;  2PHY A;  2ZQA A;  5I5L A;  1OTA A;  3F1P B;  4E3J A;  4Q0I A;  1RGY A;  1LL9 A;  4DJ3 A;  5EUA A;  3HLD A;  3ZFZ A;  1G5U A;  2PRF A;  2ZC5 B;  1N4O A;  2PBY A;  4GW9 A;  4KUO A;  5E2H A;  5HAR A;  5CHJ A;  5EE8 A;  1PIO A;  2PR6 A;  1XA1 A;  3JVU A;  2VZW A;  1Q2Q A;  3Q7V B;  3DW0 A;  4WYY A;  1Z6F A;  5IU1 A;  1PZO A;  3HJI A;  2JC7 A;  4MLL A;  2W3H A;  4YOF A;  4BBU A;  1TDG A;  1GSV A;  2OWH A;  5HWW A;  2E8I A;  2JKT M;  4B93 A;  4IUK A;  1XGJ A;  3VOL A;  4YFM A;  3UE1 A;  3GEC A;  1DP8 A;  4QPR A;  2ZMV A;  4QY5 A;  3V3S A;  4Y13 A;  2Y2N A;  4IBR A;  3T4L A;  4R3B A;  5FQJ A;  5TGF A;  3IQA A;  5EM1 A;  2W1T B;  2V1B A;  4BD1 A;  4FOF A;  2HP9 A;  3KSG A;  4CJN A;  5A90 A;  2ZL1 A;  4GDN A;  4MN6 A;  4K91 A;  1K54 A;  2WGV A;  4NXF A;  3LFV A;  1UGU A;  4Z1W A;  1TDL A;  2QJ5 A;  4E3M A;  5DFX A;  3HJK A;  5HWT A;  3B33 A;  3DTE A;  5CEB A;  1S1Y A;  2G7U A;  5DFY A;  2Y2G A;  2EWW A;  3CI6 A;  2HGV A;  5C5K A;  4DRT A;  3MKE A;  3W4O A;  2VJW A;  5DF8 A;  4PPR A;  2EFU A;  5TJJ A;  2BLS A;  3P98 A;  5E2G A;  1ACF A;  4FSF A;  4XUX A;  1YMX A;  2OLU A;  2HP5 A;  4HP9 A;  5G4Y A;  4WL9 A;  3BFD A;  3MXQ A;  2M1C A;  2NUP C;  4KZ7 A;  2VK3 A;  1K6S A;  3VP3 A;  3LIC A;  3QP1 A;  2XDM A;  1G6O A;  5FAO A;  1MWU A;  3CUE A;  4WN5 A;  3NBL A;  5AVF A;  1OJG A;  2Y79 A;  4JGP A;  5F1F A;  5KZH A;  4BBT A;  3NHQ A;  1CI9 A;  4LPZ A;  1KDS A;  3PAG A;  3DWZ A;  1PI5 A;  2JN7 A;  3I7J A;  3T1S A;  2X01 A;  3A3F A;  5FI7 A;  3UE0 A;  1PWC A;  1DJC A;  1LI0 A;  4NK3 A;  3NI9 A;  1OTI A;  3LI8 A;  2CMN A;  2CC1 A;  4P0M A;  2P9V A;  2GDN A;  3LIE A;  1FR6 A;  2KOI A;  5A8B A;  3E4P A;  3GTC A;  4M4X A;  5MC7 A;  5FA7 A;  1K57 A;  3ICY A;  3BW6 A;  5IHV A;  2JKT I;  4WZ5 A;  1S0W A;  2HJE A;  4DKI A;  4EW7 A;  1GA9 A;  1LT0 A;  4IED A;  3MSH A;  3C2W A;  1X0O A;  5G18 A;  4R70 A;  3HLB A;  3HCY A;  4KQO A;  1O7E A;  3G2Y A;  5AQ9 A;  3IXG A;  4OOM A;  3CPT B;  2HDS A;  1MKI A;  3HLC A;  2A24 A;  5CRF A;  2XEP A;  4PHT A;  2JKR I;  4MDZ A;  5CED A;  3ZG8 B;  1GHI A;  2XSS A;  2XK1 A;  1W79 A;  5EV0 A;  5A93 A;  4K0X A;  2ACG A;  4MBH A;  2XF3 A;  4IHQ A;  2HP6 A;  2RL3 A;  2WZZ A;  4E3O A;  4ZAM A;  3W4Q A;  4QHC A;  2ZC6 B;  2J80 A;  2WKH A;  5HD5 A;  2J9O A;  1FOF A;  3IX4 A;  4X53 A;  4DE1 A;  3IS2 B;  1IYQ A;  3GRJ A;  1XJ3 A;  3V67 A;  3CAX A;  5F1G A;  5AQB A;  1BSG A;  3LY4 A;  2W3D A;  5HD3 A;  1FCO A;  1WE4 A;  1NLY A;  1CEF A;  3OPH A;  2ZOH A;  3F1N A;  1WA9 A;  5DTS A;  3L7H A;  4II7 A;  5GLC A;  2H0T A;  3VP1 A;  4Q0J A;  5FI6 A;  3CPT A;  3NIA A;  3O5Y A;  4OKP A;  4NXG A;  1MBL A;  3BQ8 A;  2ZLY A;  2EXA A;  2AVX A;  2PYR A;  4FTX A;  1Y54 A;  4UA6 A;  1K54 C;  4X55 A;  2QKP A;  5CEC A;  2IWB A;  2EX2 A;  2Y2J A;  3KYQ A;  4WEK A;  4Y15 A;  1BTL A;  3D9Y A;  1PRQ A;  3LIF A;  1HD8 A;  1HZO A;  4U3T A;  1G6A A;  4CPK A;  1UWN X;  4WEL A;  4JXV A;  3IF6 B;  4KUK A;  2ZL1 B;  1T19 A;  1YT4 A;  1H8M A;  2Z6D A;  3P09 A;  1FCN A;  1U60 A;  3BM6 A;  3UB7 A;  2R9X A;  4KG2 A;  2IWC A;  2P08 A;  5TFQ A;  3NC8 A;  3E98 A;  3NJA A;  1ERM A;  3HLE A;  4R6L A;  5L09 A;  1CEG A;  4ZJ2 A;  1W7F A;  2JKR M;  1ES3 A;  4UEY A;  1S4R A;  1SHV A;  3SH9 A;  2P74 A;  2ZMF A;  1W8Q A;  1VET A;  1WYB A;  1L3L A;  1CF0 A;  3Q07 A;  3UE6 A;  4MNR A;  5GLA A;  2VX8 A;  3UB9 A;  1ONH A;  3OLO A;  3ZHH A;  1GCE A;  1RCJ A;  2ZM8 A;  3IF6 C;  3C30 A;  4Q8I A;  4L9F A;  4ID4 A;  1NXY A;  1W8Y A;  3B42 A;  5GHX A;  3FWL A;  4HH3 A;  2VGL S;  4MBF A;  4WEJ A;  5FAP A;  4G3V A;  1P0Z A;  2VEA A;  1ES2 A;  4I3J A;  4G3K A;  5DKL A;  3WS5 A;  3O88 A;  3PBO A;  1P9R A;  3MZE A;  4JXW A;  1LL5 A;  3GVB A;  3C8C A;  1FR1 A;  2WUQ A;  2W0N A;  1BZA A;  2Y2Q A;  3T1Q B;  1XFN A;  4MBK A;  1GHP A;  3LO7 A;  4OQ0 A;  4S2K A;  3O3V A;  3C4P A;  2X71 A;  4QJG A;  4BLM A;  3M6H A;  2J3W A;  3NOP C;  2FH5 A;  3A0R A;  4H6J B;  4JF6 A;  4I39 A;  3PR6 A;  3QNB A;  3BJN A;  4PM8 A;  3CIT A;  1MC0 A;  1VEU B;  5F5Y A;  4WMC A;  3ZQ5 A;  1FCM A;  5A92 A;  4R3J A;  4I3I A;  5LBR A;  1K4F A;  5FSR A;  3HUO A;  5F82 A;  4ESP A;  3QP8 A;  2VV8 A;  4BL3 A;  2KDK A;  2NUT C;  3BLS A;  4PM9 A;  4Z9Q A;  3KSF A;  5HAI A;  2W27 A;  1S4S A;  5HAQ A;  4BJP A;  4X1L A;  4O01 A;  2B5R A;  4C6Y A;  4N1H A;  3ZVW A;  4OON A;  3DTM A;  4L9E A;  3C7U A;  1L0G A;  4B4Z A;  3IBR A;  4OOY A;  2WGW A;  3PBT A;  1S67 L;  1ALQ A;  1YQS A;  3KO6 A;  3GR2 A;  3MS6 A;  1BUL A;  3E2K A;  3OOV A;  1W63 M;  3NUL A;  1LHY A;  4HNB A;  1EI5 A;  1MXO A;  3T1X A;  5TBM B;  3V50 A;  3KSH A;  5HDC A;  3CLO A;  2W3F A;  3KX0 X;  4QD4 A;  4LCM A;  3VSL A;  1JVJ A;  4Q0H A;  3ZG7 B;  4EXO A;  4R3A A;  1BUE A;  2H5S A;  4DN0 A;  5M1A A;  5KMW A;  3H9W A;  1A0K A;  4UQI S;  1AWI A;  2FZ0 A;  4JBF A;  4OQH A;  2Q9M A;  3A0S A;  4PKY A;  3FV7 A;  3G6O A;  3LYX A;  1ZKJ A;  1IFQ A;  2VLG A;  4EUZ A;  4X1M A;  1F2K A;  2WKQ A;  4KZ4 A;  1ESI A;  4PM5 A;  3HBR A;  1PYY A;  5F6A A;  3FPW A;  2JE5 A;  1T1A A;  2QMI A;  1PNE A;  4MMN A;  4LCL A;  4HBU A;  1ONG A;  2Y59 A;  5FQ9 A;  1XFQ A;  4IBX A;  4E3N A;  3GV9 A;  5EFW A;  3ISG A;  4KQD A;  1VQQ A;  4FH4 A;  1OTD A;  1MY8 A;  3OC2 A;  2P7J A;  4HEF A;  3B47 A;  3BQA A;  2A49 A;  3BYD A;  1VB6 A;  3K2N A;  4YNR A;  2Y2O A;  4RVA A;  2GNX A;  4HY8 A;  3G34 A;  2HDR A;  2DMW A;  2B18 A;  3W4P A;  4GS9 B;  1K56 A;  4IUH A;  4RYE A;  3LEZ A;  4OQG A;  2JHE A;  2O99 A;  5HPI A;  5A91 A;  3UPN A;  4LV0 A;  4KG5 A;  5CTN A;  5DJU A;  2A2L A;  4FH2 A;  1MZU A;  3BFE A;  4R23 A;  3WWX A;  2H0Y A;  4X25 A;  1K55 C;  5CGX A;  4R0Q A;  1W5D A;  3DBA A;  1TF1 A;  2G2W A;  3MZD A;  1FSW A;  2OWJ A;  2PD8 A;  1NRF A;  1H8Y A;  4WM9 A;  3P01 A;  1ERO A;  4F3L A;  1LL8 A;  5DF7 A;  3S7N A;  1DRM A;  4RX3 A;  3HLW A;  5CTM A;  1RGZ A;  3O86 A;  2HDQ A;  2HV1 A;  4LRY C;  5FAS A;  3UB5 P;  3D72 A;  5HX9 A;  4HI4 A;  3MQO A;  1GSW A;  5CHM A;  5GHY A;  3NY4 A;  5FQK A;  5GL9 A;  1CK3 A;  3DTK A;  2INW A;  1E3U D;  2BG1 A;  1CJF A;  2XQZ A;  2QPN A;  3BRM A;  1Z09 A;  1L0F A;  4EQ1 A;  5U47 A;  3H82 A;  4C3Q A;  3C4O A;  4L0L A;  4EBL A;  3S4X A;  4BMW A;  5IS1 A;  1SZV A;  4IJG A;  2O0Y A;  4KG6 A;  5J4E A;  3W8K A;  3OCL A;  1BLP A;  3ULF A;  3LUQ A;  3LCE A;  2V20 A;  1XJ2 A;  3VV4 A;  2PU4 A;  3S22 A;  4PMA A;  2Y91 A;  1H0M A;  3BY9 A;  3FZC A;  2WGI A;  3MR0 A;  1TEM A;  2HF6 A;  3D4F A;  4HH2 A;  1FSY A;  4E3K A;  2HDU A;  4O8G A;  2ZMA A;  3PBR A;  4PAU A;  3QHY A;  3LGO A;  4KZ5 A;  1XA7 A;  5GHZ A;  4DE3 A;  1PZP A;  3MZF A;  5G4Z A;  3IT9 A;  1SKO A;  1JWZ A;  4ZDX A;  1MWT A;  1KGG A;  3UDX A;  3LI9 A;  3PHY A;  4I3A A;  1FIK A;  2WAD A;  3PXP A;  3IH9 A;  4ZRR A;  4M3K A;  4S2M A;  1UWP X;  2XA7 S;  3HLF A;  3WRT A;  4S2L A;  1EWZ A;  3NOT C;  1OT6 A;  4QY6 A;  1D06 A;  3G31 A;  4PM7 A;  4GKU A;  1K6R A;  1MPL A;  3UME A;  3EQU A;  3IXH A;  3AGD A;  1LI9 A;  2YKF A;  4RX2 A;  1SKF A;  3N8S A;  4P85 A;  1QME A;  2JKG A;  2UV0 E;  2Y2I A;  3H7W A;  4JXG A;  4CLC C;  1IYS A;  4OPZ A;  4WUJ A;  5FEF A;  3F1P A;  4MEZ A;  1IKG A; 
#chains in the Genus database with same CATH homology
 4C75 A;  2Y2K A;  3A3J A;  3Q7V A;  2OV5 A;  1ES2 A;  3E2L A;  5CGW A;  3WS5 A;  2XFS A;  3O88 A;  5HW3 A;  3PBO A;  2J9P A;  4NET A;  4ZTK A;  3IWO A;  3MZE A;  3SS3 A;  4HBT A;  5L2F A;  1E3U A;  4JXW A;  1LL5 A;  3GVB A;  5FQI A;  2ZJ9 A;  1FR1 A;  4OVD A;  1C3B A;  3PBS A;  3OCN A;  1MWR A;  1K56 D;  2WUQ A;  4OP8 A;  4P87 A;  3Q1F A;  4R4R A;  4DXB A;  1BZA A;  1XGI A;  2Y2Q A;  1BLS A;  3WS4 A;  5AQA A;  5EOE A;  2V2F F;  5M18 A;  2XR0 A;  5CHU A;  1TVF A;  4XUZ A;  4MBK A;  1GHP A;  3LO7 A;  3RXW A;  4OQ0 A;  4S2K A;  3UPP A;  3V39 A;  3O3V A;  3OPL A;  1XKZ A;  3TSG A;  3C4P A;  3VP2 A;  2X71 A;  4QJG A;  3UO9 A;  2ZQD A;  4BLM A;  3M6H A;  1BT5 A;  3SH7 A;  1E4D A;  1QMF A;  1KGF A;  1DJA A;  2ZM2 A;  3IWI A;  3UY6 A;  4S2J A;  4JF6 A;  3G35 A;  1IEM A;  3QNB A;  1CI8 A;  1ERQ A;  1JTG A;  2QZ6 A;  4KZ9 A;  2VGJ A;  4PM8 A;  4XXR A;  4HES A;  4N9K A;  1L0E A;  5EVI D;  5FQM A;  3M6B A;  3ZNY A;  2ZQA A;  3BEC A;  4B4X A;  4EBP A;  5EPH A;  5GLB A;  4EWF A;  4WMC A;  1NZU A;  1FCM A;  3IF6 A;  4E3J A;  1KE3 A;  1ZG4 A;  4E3L A;  3AGE A;  4S2N A;  1RGY A;  5A92 A;  1LL9 A;  3ZNT A;  1K38 A;  5FAQ A;  4R3J A;  1GHM A;  5KSH A;  4F94 A;  1H5X A;  1K4F A;  5FSR A;  3HRE A;  3HUO A;  1H8Z A;  5EUA A;  5F82 A;  3HLD A;  3ZFZ A;  2WK0 A;  4BL3 A;  4D2O A;  2HPB A;  2ZC5 B;  2JCH A;  3BLS A;  4PM9 A;  1N4O A;  4Z9Q A;  3VOZ A;  2PBY A;  5HAI A;  3VSK A;  1PI4 A;  4N92 A;  3QNC A;  4OPY A;  5CHJ A;  5E2H A;  5EE8 A;  5HAR A;  4S2O A;  4BJP A;  4E6X A;  2JBF A;  5HAQ A;  2RCX A;  3SH8 A;  1PIO A;  1XA1 A;  2B5R A;  4C6Y A;  3HUM A;  4N1H A;  3ZVW A;  1ESU A;  4GB7 A;  3UNW A;  1Q2Q A;  3LY3 A;  3Q7V B;  4OON A;  3DTM A;  3DW0 A;  4WYY A;  5EOO A;  1Z6F A;  1PZO A;  4X6T A;  3C7U A;  1L0G A;  4LV2 A;  4MLL A;  2JC7 A;  3ZG9 B;  4B4Z A;  4LV1 A;  1TDG A;  4JF5 A;  2FFY A;  2EX9 A;  4OOY A;  2WGW A;  3PBT A;  2C5W B;  4Y0T A;  2E8I A;  1XP4 A;  1ES4 A;  1XGJ A;  4OLG A;  1ALQ A;  1YLP A;  4YFM A;  1SDN A;  4JLF A;  3UE1 A;  2ZC4 B;  2EXB A;  3C7V A;  4KEN B;  1YQS A;  4QY5 A;  3GR2 A;  3V3S A;  1BUL A;  2Y2N A;  4IBR A;  3E2K A;  4R3B A;  5FQJ A;  5TGF A;  3PAE A;  3IQA A;  4A5R A;  4BD1 A;  4OP5 A;  1LHY A;  3A3I A;  1EI5 A;  3VP0 A;  2HP9 A;  2XD1 A;  1NYY A;  1MXO A;  4CJN A;  5A90 A;  4GDN A;  3WS0 A;  3V50 A;  3VFH A;  2OSU A;  3N4I A;  5E43 A;  3IXB A;  4K91 A;  4UAA A;  3N6I A;  3HVF A;  1K54 A;  3WS1 A;  3TG9 A;  2WAE A;  2WGV A;  1YLW A;  3IH8 A;  5GLD A;  3UDF A;  4DF6 A;  3S1Y A;  3UPO A;  3NCK A;  4R4S A;  3RXX A;  3G4P A;  4QD4 A;  1TDL A;  4LCM A;  3OPR A;  4LEN A;  4PM6 A;  4E3M A;  1MWS A;  1I2S A;  3VSL A;  1JVJ A;  2Y4A A;  4OOL A;  5AQ7 A;  3ZG7 B;  4EV4 A;  1BUE A;  5CEB A;  2H5S A;  5FAP A;  4ZBE A;  5M1A A;  3UDI A;  4B88 A;  2Y2G A;  5KMW A;  4DRT A;  1GA0 A;  3ZVT A;  3MKE A;  3W4O A;  4JBF A;  4OQH A;  5DF8 A;  4PPR A;  1BLH A;  2EFU A;  4EQI A;  3G2Z A;  2Q9M A;  4KZB A;  2BLS A;  3FV7 A;  5EVL A;  3UN7 A;  3P98 A;  4GD6 A;  5E2G A;  1NY0 A;  1VM1 A;  1ZKJ A;  2I72 A;  3MKF A;  5FQQ A;  3G30 A;  4FSF A;  2WYX A;  1O07 A;  4XUX A;  4EUZ A;  2WKI A;  1YMX A;  2OLU A;  2HP5 A;  2XLN A;  4JPM A;  3GMW A;  5EVI C;  3SS4 A;  2ZM0 A;  5JYP A;  2C6W B;  1DY6 A;  4KZ4 A;  4BQM A;  4Y0O A;  4IVI A;  1ESI A;  3BFD A;  4X56 A;  1NZO A;  3MBZ A;  4PM5 A;  3HBR A;  4KZ7 A;  3VFF A;  1K6S A;  1PYY A;  3VP3 A;  5E2E A;  2XDM A;  1KE4 A;  2WKE A;  2PU2 A;  5FAO A;  2JE5 A;  1MWU A;  1NYM A;  5I94 A;  4GOG A;  3TOI A;  3NBL A;  2QMI A;  1I2W A;  2A3U A;  3CZD A;  4OLD A;  3ITB A;  4X68 A;  1L0D A;  2EFX A;  4ZJ1 A;  2XH9 A;  1KVL A;  4LCL A;  4WZ4 A;  1SCW A;  4HBU A;  4ZJ3 A;  5F1F A;  2IWD A;  5KZH A;  3CJM A;  2P9V B;  3NDG A;  4KZA A;  4EBN A;  4DE2 A;  1CI9 A;  4BEN A;  1ONG A;  2Y59 A;  1FQG A;  2DCF A;  1KDS A;  2Y2M A;  5FQ9 A;  3A3E A;  3PAG A;  2G2U A;  3DWZ A;  4IBX A;  1PI5 A;  4OH0 A;  2WZX A;  4E3N A;  3GV9 A;  3I7J A;  3ISG A;  1S6R A;  1K55 A;  1VQQ A;  1XXM A;  3A3F A;  2X01 A;  4FH4 A;  5FI7 A;  3UE0 A;  1PWC A;  1DJC A;  3V5M A;  1MY8 A;  1LI0 A;  4NK3 A;  3NI9 A;  3N8L A;  3OC2 A;  4HEF A;  5EVI B;  2A49 A;  3BYD A;  2CC1 A;  4P0M A;  2XD5 A;  1WYC A;  1IKI A;  2P9V A;  2GDN A;  4DXC A;  5DVA A;  4BD0 A;  1FR6 A;  1JWV A;  4BL2 A;  2Y2O A;  1IYO A;  5CER A;  4RVA A;  3G34 A;  2Y2H A;  1J9M A;  3CMZ A;  3FKW A;  3GTC A;  2HDR A;  3MXR A;  3W4P A;  5FA7 A;  4OPR A;  1K56 A;  4RYE A;  1K57 A;  3LEZ A;  3G32 A;  3Q82 A;  1K57 C;  1SDE A;  5IHV A;  2Z2L B;  4WZ5 A;  4IVK A;  1S0W A;  1DJB A;  3Q7Z A;  4OQG A;  4DKI A;  3WS2 A;  4GDB A;  1GA9 A;  4IED A;  3AGF A;  5A91 A;  4UA7 A;  3UPN A;  2VGK A;  4LV0 A;  2Y2P A;  4KG5 A;  5CTN A;  5G18 A;  3HLB A;  4FH2 A;  4N9L A;  1KGE A;  3BFE A;  3JYI A;  4KQO A;  1O7E A;  4R23 A;  3G2Y A;  4YIN A;  5DTT A;  3WWX A;  5AQ9 A;  1PW8 A;  3IXG A;  4JF4 A;  2H0Y A;  4OOM A;  1K55 C;  5CGX A;  4R0Q A;  3M2J A;  1W5D A;  1IYP A;  2HDS A;  1L2S A;  1MKI A;  3HLC A;  4GD8 A;  2G2W A;  5CRF A;  5EVI A;  2XEP A;  3FKV A;  3MZD A;  4WMC D;  3PTE A;  3O87 A;  1FSW A;  3FYZ A;  5CED A;  3ZG8 B;  1PW1 A;  1NRF A;  1JWP A;  1GHI A;  1BLC A;  1H8Y A;  4WM9 A;  5F83 A;  2R9W A;  2XK1 A;  1W79 A;  1ERO A;  3SS5 A;  2X02 A;  5A93 A;  3IHB A;  4K0X A;  3HL9 A;  4Y7P A;  1IEL A;  5DF7 A;  4MBH A;  2EX6 A;  1JTD A;  4FCF A;  4RX3 A;  5M19 A;  2DRW A;  3HLW A;  3VOY A;  5CTM A;  1RGZ A;  2ZQ8 A;  4R1G A;  2XF3 A;  2HP6 A;  2RL3 A;  2WZZ A;  4E3O A;  2DNS A;  3O86 A;  4ZAM A;  2H10 A;  2HDQ A;  3W4Q A;  4QHC A;  2V1Z A;  2ZC6 B;  4GNU A;  4KZ3 A;  2Z2M B;  4FD8 A;  3VMA A;  2WKH A;  5FAS A;  5DTK A;  4QU3 A;  5HX9 A;  4N1X A;  2J9O A;  2WAF A;  5CHM A;  3ZG0 A;  1FOF A;  5GHY A;  4X53 A;  3Q81 A;  4DE1 A;  4X69 A;  3EQV A;  1YLY A;  3NY4 A;  5FAT A;  4KQQ A;  5FQK A;  5FDH A;  4JKT A;  5GL9 A;  1CK3 A;  1IYQ A;  1E3U D;  2BG1 A;  3GRJ A;  3BFC A;  1M40 A;  1Q2P A;  2XQZ A;  3IHA A;  4LV3 A;  3BFF A;  2QPN A;  1YLZ A;  5F1G A;  5AQB A;  1BSG A;  1YLJ A;  3BRM A;  3LY4 A;  3CG5 A;  5BOH A;  2EX8 A;  1HTZ A;  1FCO A;  1WE4 A;  1L0F A;  2WGW B;  3HUN A;  3C5A A;  1CEF A;  5E2F A;  3IXD A;  3OPH A;  4UA9 A;  3N7W A;  5DTS A;  4KZ8 A;  5GLC A;  5U47 A;  5TR7 A;  2UWX A;  2H0T A;  5D3O A;  3NDE A;  3VP1 A;  1RP5 A;  4DE0 A;  2ZQC A;  4C3Q A;  2XFT A;  2J8Y A;  2ZQ7 A;  3C4O A;  3GSG A;  3NIA A;  4L0L A;  4OKP A;  5FI6 A;  4E3I A;  4EBL A;  4QB8 A;  3IWQ A;  1MBL A;  1M6K A;  3BLM A;  3S4X A;  2ZLY A;  2EXA A;  4WZ5 C;  4S2P A;  3OPP A;  2ZC7 A;  4RA7 A;  5HAP A;  1Y54 A;  1LLB A;  4UA6 A;  1K54 C;  4KG6 A;  3W8K A;  4X55 A;  3OCL A;  1BLP A;  5CEC A;  2IWB A;  3RJU A;  1NJ4 A;  3ITA A;  3ZG5 A;  3V3R A;  1OME A;  3LCE A;  2V20 A;  2EX2 A;  2PU4 A;  2Y2J A;  3M2K A;  4OQI A;  3B3X A;  4U0X A;  2ZC3 B;  4WEK A;  5HL1 A;  1BTL A;  1I5Q A;  3IF5 A;  3UE3 A;  3S22 A;  4PMA A;  2Y91 A;  4OPQ A;  2ZQ9 A;  3PBQ A;  3MFD A;  5EEC A;  1HD8 A;  1HZO A;  1YLT A;  1G6A A;  3FZC A;  4U3T A;  5CGS A;  4CPK A;  2WGI A;  4H8R A;  1TEM A;  4Y0U A;  3ZGA B;  4KQR A;  2ZD8 A;  4WEL A;  3WRZ A;  4JXV A;  3D4F A;  3IF6 B;  1FSY A;  4E3K A;  2HDU A;  1KE0 A;  1YT4 A;  2ZMA A;  4O7D A;  3PBR A;  5CXW A;  5FI2 A;  3SOI A;  5DF9 A;  1PWD A;  4S2N C;  3P09 A;  3QHY A;  1FCN A;  1U60 A;  3BM6 A;  4KZ5 A;  1XA7 A;  5GHZ A;  1K25 A;  4DE3 A;  1PZP A;  3MZF A;  3BEB A;  4S2I A;  5KSC A;  2R9X A;  4KG2 A;  4DDY A;  1ES5 A;  1YM1 A;  2IWC A;  5TFQ A;  1KVM A;  2Y2L A;  3N8R A;  3IT9 A;  3NC8 A;  4DDS A;  4UHU A;  1JWZ A;  4ZDX A;  3A3D A;  5HFO A;  1G68 A;  1MWT A;  2Q9N A;  1ERM A;  1KGG A;  3HLE A;  3MXS A;  3UDX A;  2XGN A;  1CEG A;  4ZJ2 A;  1XPB A;  1W7F A;  2WAD A;  4GZB A;  2FFF B;  4E6W A;  1ES3 A;  3IH9 A;  1SHV A;  3SH9 A;  3ZCZ A;  2P74 A;  2OLV A;  1W8Q A;  3HLG A;  4M3K A;  4S2M A;  1ZC2 A;  1WYB A;  3HLF A;  3WRT A;  3Q07 A;  1E25 A;  4KZ6 A;  4S2L A;  1EWZ A;  4MNR A;  1KDW A;  4QY6 A;  3DWK A;  3G31 A;  1PWG A;  5GLA A;  3ZDJ A;  4PM7 A;  3BFG A;  1HVB A;  4GKU A;  1K6R A;  1ONH A;  4WBG A;  3ZHH A;  3PBN A;  1GCE A;  1MPL A;  1XX2 A;  1RCJ A;  3EQU A;  4GN2 A;  3IXH A;  2ZM8 A;  1K4E A;  3AGD A;  1LI9 A;  4JXS A;  4RX2 A;  1SKF A;  3IF6 C;  3N8S A;  4P85 A;  1QME A;  4Q8I A;  4P6B A;  3VP4 A;  1ZG6 A;  2Y2I A;  5JYO A;  5J8X A;  4ID4 A;  1NXY A;  1W8Y A;  2J7V A;  4JXG A;  4U0T A;  1AXB A;  1YMS A;  4K0W A;  1IYS A;  5GHX A;  4OPZ A;  3FWL A;  2Y55 A;  4MBF A;  4MEZ A;  4WEJ A;  1IKG A;  3GQZ A;  3OZH A;  1N9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...