2ZOHA

X-ray crystal structure of photoactive yellow protein, wild type, at 295k
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Low-barrier hydrogen bond in photoactive yellow protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2zohA00
4L9GA 3G6OA 1X0OA 3K3CA 4F3LB 2VV6A 4I5SA 1XJ4A 4DJ3A 1S1YA 3MFXA 3RTYA 3PHYA 4MN5A 4WLAA 3F1PB 2BASA 2KX6A 2V1AA 3H7WA 5F6AA 2PYRA 3MQQA 4R3AA 4WL9A 5AVEA 4I3IA 5G4ZA 1KOUA 4BBVA 2GJ3A 4GW9A 4KQDA 3GDIA 4NXEA 3IS2B 5G4YA 3CAXA 1OTDA 1OTEA 1OTAA 3HJIA 4K08A 3VE3A 4EETB 5A8BA 4LRYC 5F68A 3PYPA 3F1OA 1LSXA 2QHKA 4LRXC 1TS6A 3VOLA 1XFNA 3F1PA 2VV7A 3P7NA 4M4XA 3NOTC 4GS9A 2YKFA 1UGUA 1S67L 3K3DA 3FC7A 3UMEA 3LIAA 4I3JA 3LI9A 2YKHA 5HD3A 4I3AA 2VV8A 4HP4A 2D01A 1F98A 4HH3A 1DRMA 4JGPA 3UB6A 1ODVA 2B02A 2W27A 5I5LA 1Y28A 3NHQA 3LYXA 4HHDA 2WKRA 3SW1A 1S66L 1EW0A 3MQOA 5DJUA 4PKYA 2L1MA 2OWHA 4EW7A 4HNBA 3VE4A 2H28A 1N9LA 4HH2A 2ZBBA 4L9FA 3F1OB 4DJ2A 3KX0X 3UB7A 4RQ9A 4GCZA 3LUQA 2INWA 5HWWA 5DKLA 1OJGA 3C2WA 5HWTA 4EERA 3LIBA 2V0UA 3E4OA 3ZQ5A 1OT6A 3EEHA 2PHYA 2HV1A 1VB6A 4GS9B 3A0VA 3NOPC 4EEPA 2KDKA 4E04A 4KUOA 3BY9A 1MZUA 4PKYG 4YWZA 2D02A 1LL8A 3LIFA 5HDDA 2M1CA 3RH8B 3UB9A 2PR6A 3EWKA 1T19A 1XJ2A 2L0WA 3H82A 3UE6A 4EQ1A 2VLGA 1UWNX 5F69A 1XFQA 1S4RA 4NXFA 4BBUA 2OOLA 3IBRA 1D06A 1GSWA 4EEUA 1UWPX 1V9ZA 5EFWA 3LIEA 3C8CA 3GECA 1XJ3A 3BY8A 2P7JA 2V9AA 5DJTA 3NJAA 4HQAA 1DP9A 2V1BA 1LT0A 3LICA 1OTBA 3E4PA 4H6JA 1G28A 1OT9A 4JGOA 4HJ4A 2WKPA 4WF0A 4B9OA 1BYWA 1S1ZA 4JGQA 2EA9A 4EXOA 2Z6DA 5HD5A 4L9EA 4R6LA 4WN5A 3F1NB 2J80A 4NXBA 1N9NA 3NOUC 2QJ7A 4I38A 3H82B 1JNUA 3MXQA 3ICYA 1LSWA 4R70A 3FG8A 1N9OA 1GSXA 4GHIA 4HP9A 2V0WA 1F9IA 2PDRA 4HIAA 1XJ6A 1TS0A 5IS1A 3MR0A 1T18A 4KUKA 2PR5A 2I9VA 3UMDA 3H9WA 1P97A 4H6JB 3B33A 2A24A 4XT2A 5IU1A 5KIZA 2W0NA 5DKKA 2PD8A 4I39A 3OLOA 5HDCA 2Z6CA 2QJ5A 3UB8A 3CLOA 4HJ6A 4HJ3A 3F1NA 1T1CA 2JN7A 4R38A 2R78A 3BWLA 2WKQA 3LI8A 4HY8A 4NXGA 4GHIB 4JGRA 1NWZA 2VEAA 5HSQA 1S4SA 5J7EA 3MJQA 4EESA 4LPZA 5TBMA 3E4QA 2CMNA 2PD7A 5HZHA 1WA9A 5HDSA 1P0ZA 1V9YA 4MN6A 1T1AA 2OWJA 4F3LA 1T1BA 2A24B 4LLOB 4XT2B 1D7EA 1TS7A 5AVFA 3HJKA 2L4RA 1TS8A 1OJ5A 1LSVA 1OTIA 1GSVA 2ZOHA 3D72A 4LRZE 2QKPA 5HWVA 3A0SA 3H7WB 5F5YA 2JHEA 5J4EA 1DP6A 4WUJA 5J3WA 3T50A 3A0RA 2QWSA 4HOIA 3IS2A 4HI4A 3ULFA 2PYPA 3CWFA 2ZOIA 3LIDA 1DP8A 2K7SA 5TBMB 4BBTA
chains in the Genus database with same CATH superfamily
5FAOA 4CLCB 5CGXA 4DE1A 3RJUA 4F3LB 2GNXA 1XJ4A 1YLYA 1SDNA 1ZHHB 3C5AA 3MFXA 3PHYA 4FSFA 1JWPA 2BLSA 2KLIA 3P98A 5DTTA 4E6XA 4N9KA 1KVLA 3S22A 4WEJA 3QP2A 4UAAA 2PYRA 5LBRA 3MQQA 4R3AA 4WL9A 5AVEA 4I3IA 4R3BA 4MBKA 3SS3A 3TG9A 4IBXA 3NDGA 4NKPA 1KOUA 2Y91A 4BBVA 1YM1A 4MBHA 3GDIA 4NXEA 4DDSA 3IS2B 4OPZA 1BZAA 2OAQ1 1W63M 3M2KA 4OPYA 4GLQA 2ACGA 1M6KA 3O88A 4QJGA 2JCHA 1NLYA 3CG5A 3HJIA 2DRWA 4EETB 1G6OA 1RCJA 3UNWA 3HCYA 1K54C 3BFEA 3W4PA 4EQIA 4LRXC 4LV3A 3VOLA 1NXYA 2PAVP 2NUTC 1MWUA 2WKIA 3MF0A 3O3VA 2PT7A 3P7NA 5FL3A 4X56A 2V8FA 1ALQA 3NOTC 4GS9A 1N4OA 5FQQA 3HLGA 1S67L 5CRFA 5GHYA 4CJNA 4KQQA 3KYEA 3FPVA 2DCFA 2WGWA 1J9MA 3MKFA 4B93A 4IHQA 3GSGA 3OPPA 5I5LA 2HDRA 5EVIB 2O0YA 2WKRA 4PKYA 2J3TD 1PYYA 1RGYA 5KZHA 2ZBBA 4L9FA 3F1OB 4GKUA 4DJ2A 3UPOA 4RQ9A 3O87A 1O07A 2OLVA 2W3FA 4JXSA 5HAQA 3UDXA 1BLCA 4YFMA 3LIBA 4FH4A 4QY6A 3EEHA 2PHYA 1E25A 5F82A 4CLCC 3ZG5A 5GL9A 3T4OA 2JBFA 2KDKA 4DDYA 2PBDP 3ZFZA 2J9PA 4KUOA 1MZUA 4YWZA 1LL5A 3S7OA 1SZVA 3VP4A 3KSGA 3PTEA 3V39A 4QWOA 2M1CA 3UE3A 2IA2A 4YOFA 1PWDA 1QMEA 3V3SA 3DTKA 3IWIA 5CHJA 1L2SA 2M7VA 4E3KA 3UE6A 2VLGA 1XFQA 3ZYTA 5HL6A 4FUWA 4BBUA 5K5BA 3NCKA 1D06A 4EU0A 1GSWA 1YLWA 4UA6A 3LIEA 4WMCD 3BEBA 3WWXA 1VHMA 1IYQA 2J9OA 5J8XA 1CEFA 1NY0A 3NJAA 3HLDA 5HPIA 3NI9A 1G28A 1MWRA 4OLDA 4D60A 2XROA 1CF0A 1IYPA 3BFCA 4PHTA 2WKPA 5CGSA 4RA7A 4EXOA 2ZM2A 3VFHA 3G31A 4BJPA 3W4QA 2IWDA 2Y2HA 4L9EA 3UPPA 3VP1A 4WN5A 1TEMA 3MBZA 3ZHHA 2ZQDA 3IXBA 5E2GA 4FTXA 1WE4A 3MXQA 4GNUA 1LSWA 4R70A 2W3HA 1N9OA 1GSXA 3BYDA 4GHIA 5FDSA 3IX8A 1LI9A 1XJ6A 4H8RA 1ES5A 4EUVA 1W7FA 3MR0A 3CPTB 4KZ6A 2PR5A 5EVIC 4N92A 4B88A 5FQIA 3UMDA 1ESIA 2XFTA 2K2NA 4Y0TA 1YT4A 5F1GA 4ETZA 3IXHA 3GRJA 4P85A 1SDEA 4JF5A 2PD8A 1OPXA 4BWIA 3VP3A 4EWFA 2OV5A 2QJ5A 5TJJA 2EXBA 1XPBA 2ZM8A 3UB8A 3HL9A 3T1QB 4FH2A 4S2NA 2JN7A 2WZXA 1P9RA 3MMHA 4R38A 2I72A 3LR4A 2ZLYA 1BSGA 2QYBA 3BWLA 1RGZA 5HPFA 3C30A 1H8YA 2A2LA 3R7WA 3EEAA 4IVKA 1TVFA 1Y4OA 4Y15A 4Y3IA 4EESA 4LPZA 4KENB 3C4PA 3IF5A 3NIAA 5CERA 1ZG4A 5TBMA 2P04A 3E4QA 3VOYA 3IF6A 1W63Q 5GLAA 5HDSA 4BL2A 1I2SA 4YINA 3A3IA 4R4RA 3BJNA 1FOFA 1NYMA 2QMIA 3T1XA 1D7EA 2EFXA 4FOFA 1ZKJA 4GJ4A 2XA7S 3HJKA 2L4RA 2VGLM 3PXPA 1Q2QA 2JKFA 1OJ5A 1M40A 4LV2A 1OTIA 4Y0OA 1HVBA 2QKPA 4X1LA 4EV4A 5HWVA 3LO7A 2VGKA 5EOOA 4GZBA 2V2FF 3EGXC 3HUOA 2W3GA 3WS5A 2HGVA 3HLCA 1K57A 3LR3A 2JHEA 5J4EA 1LHYA 3T1RA 3TW8A 1DP6A 1W8YA 3G32A 2FFYA 2HP5A 3T4QA 2Y2LA 2X71A 3A0RA 5CHMA 2QWSA 3QP6A 4HOIA 3ULFA 4BLMA 3Q7ZA 4PMAA 4ZDXA 1O7EA 3SZTA 4BBTA 4Y7PA 3K3CA 3KO6A 1G6AA 2IWCA 3CMZA 3G2ZA 4RX3A 2VV6A 5IT5A 4KQOA 2Z2LB 1S1YA 1YKDA 2DMWA 3KYQA 4MN5A 3TSGA 1HZOA 3F1PB 2Y2IA 2Y2QA 2BASA 2VX8A 4Z9QA 3P09A 4MDZA 4HBTA 2J8YA 2ZC4B 5F6AA 2AVXA 4BD0A 2Q9MA 2XD1A 2HF6A 4MBFA 1XXMA 2HJ9C 3PR6A 2V8CA 3BLSA 4GW9A 3VFFA 5G4YA 2XGNA 3GVBA 2QZ6A 4QHCA 4BD1A 3V67A 1KDSA 3HLBA 1MBLA 2Y2KA 1WYCA 2JE5A 2HPBA 3G34A 1K57C 4ZRRA 3HUMA 4M3KA 1PI5A 4K08A 2WUQA 5A8BA 4LRYC 4OOLA 3S7NA 3PYPA 5DVAA 1KGEA 3A3JA 4ZJ1A 4BENA 1EWZA 4KZ9A 2QHKA 2EX8A 3UDFA 1FCNA 1KE4A 1Z6FA 3PBSA 1DJCA 3UE1A 3F1PA 1WYBA 2VV7A 4OOYA 5F83A 3PAGA 5FQ9A 5AQBA 1UGUA 1ES3A 1MY8A 3FC7A 3EQVA 3LIAA 5HD3A 2VV8A 3VMAA 5JYPA 4JXGA 1LI0A 2B02A 4QY5A 4X1MA 5FDHA 3FYZA 4DN0A 4MLLA 3PBNA 4ID4A 4EBLA 1Y28A 3LYXA 3OCNA 4HHDA 1K55C 3CUEA 5HX9A 2Y55A 1S66L 1EW0A 1VM1A 2L1MA 1SCWA 2V20A 5A93A 5A91A 2WK0A 5TGFA 4PM5A 1FR6A 4GD8A 4Y0UA 3Q7VA 1I5QA 1PNEA 3LUQA 2XD5A 4OPQA 3A3FA 2INWA 4JBFA 4RYEA 5DKLA 1OJGA 3E4OA 3ZQ5A 4GS9B 4BQMA 3A0VA 4HESA 2R9XA 3NOPC 4JKTA 5TFQA 2ZC3B 3ISGA 1QMFA 2ZJ9A 5G18A 3PBTA 5E2HA 1YLZA 2WYXA 4PKYG 2EX9A 4PM6A 2WGWB 3IHBA 5FAQA 1CI9A 3ZVTA 1S0WA 4WZ5A 4DXBA 1ONGA 3UB9A 2PR6A 4WMCA 3EWKA 4MNRA 4DRTA 4KG2A 4P6ZM 1T19A 1XJ2A 2PU4A 4EQ1A 1S4RA 3ZVWA 4LENA 4NXFA 4CLCE 4JLFA 3IBRA 5DFYA 1FCMA 2VK3A 4S2LA 1TDGA 3GQZA 4LV1A 2K31A 2O9AA 4Y5FA 4WELA 2HJEA 1HTZA 3GECA 2CC1A 3NC8A 1CJFA 5HAPA 2P7JA 2H10A 5DJTA 4O7DA 4HQAA 2V1BA 1GHPA 2PU2A 1OTBA 1Q2PA 3CUEC 4H6JA 3SH8A 3VSKA 2ZQAA 3BECA 4MMNA 3BFGA 3PBRA 4II7A 3GV9A 1TD5A 4BL3A 5I94A 4L0LA 5A90A 5HD5A 3OBFA 4R6LA 2H0TA 1DY6A 4NXBA 4OVDA 1N9NA 5D3OA 3NOUC 3VV4A 3NULA 2PBYA 4I38A 1KE3A 2LB9A 3OPHA 4K0XA 5F1FA 3FG8A 4HP9A 5DF9A 2V0WA 2VA0A 1JWZA 3OOVA 2LB5A 1NRJA 2O9CA 4HIAA 4X55A 1KVMA 4E3MA 4UQIM 1D1JA 3N8LA 1TS0A 5EM0A 4Y13A 4OQGA 2B5RA 3QP1A 3SH7A 2Y59A 3DAVA 3T1SA 3H9WA 5BOHA 4XT2A 2JKGA 4DKIA 1IYOA 3OZHA 3B42A 1IEMA 3UN7A 2W0NA 5HW3A 3OLOA 3LY3A 3RXXA 4HEFA 4JXWA 3FPWA 4XUZA 4HJ6A 4HJ3A 5GLBA 1L0EA 1T1CA 3EGDC 3DBAA 1STZA 4QU3A 2W3DA 4G3KA 5CEDA 3LI8A 3P01A 4D2OA 4ZJ3A 1KGFA 2ZM0A 4GHIB 3ZG8B 3IXDA 3UB5P 4ZTKA 3V5MA 3G35A 4K0WA 4Q8IA 4NG2A 2CMNA 1WA9A 1J3WA 2HDSA 2OWJA 1T1BA 3AGDA 3MXRA 5E43A 4N9LA 3W4OA 4ESPA 3ITBA 1BUEA 1L0GA 4KZ5A 1TS8A 5KSHA 1LSVA 4O8GA 3MS6A 1K4FA 4CLCD 5CECA 4PAUA 3H7WB 4ARZA 4PM9A 5F5YA 1I2WA 3T4JA 5KSCA 2ZMFA 2C6WB 3G30A 1YLJA 2WKHA 3MZEA 4IUKA 3BQAA 4MEZA 2E8JA 1NZUA 5FI7A 5J3WA 1AWIA 1E3UD 2Q9NA 3R7WB 3T50A 4EBNA 2PYPA 3CWFA 3JYIA 1H8MA 2HZ5A 5TBMB 4L9GA 2UWXA 3IF6B 3N4IA 2G2WA 1X0OA 3JVUA 1GHMA 3HLFA 5CEBA 4DJ3A 2VJWA 2XF3A 4A5RA 4GB7A 4U0XA 5DF7A 3S7PA 2JKTM 4WLAA 5EUAA 3IQAA 4OLGA 2V1AA 4G3WA 3H7WA 1HD8A 3JPUA 5G4ZA 5FAPA 3LCEA 3O5YA 4NEED 1ES2A 3C7UA 1PFLA 4O01A 3HREA 3NDEA 1YMSA 3W2ZA 1CEGA 2W1TA 4UEYA 1VETA 5HFOA 3BLMA 3AGEA 5F68A 1Z09A 4Z1WA 3WS2A 3DWKA 3ZDJA 1ESUA 4R23A 1FSWA 3E0YA 1LSXA 4X25A 5EVID 1ERMA 4ME4A 2Y4AA 3Q1FA 2GX5A 2YKFA 1ES4A 3LEZA 4E6WA 1YLPA 3CZDA 4P0MA 2WADA 3BM6A 2IWBA 3LFVA 4F94A 1YQSA 1BLHA 4DE3A 3TE8A 4I3JA 4GDNA 2YKHA 5C5KA 2ZMAA 3N6IA 4I3AA 3ZGAB 4C3QA 4HP4A 2D01A 4KZ7A 1F98A 4O0PA 3IHAA 3M2JA 4HH3A 2PRFA 4JGPA 3PBOA 4RVAA 1YSPA 3LR5A 3KSHA 2O9BA 3VP0A 4S2NC 1XGJA 5FA7A 3ZG9B 4RX2A 3SW1A 4X68A 3DTEA 1FR1A 3CHWP 3MQOA 5DJUA 2OWHA 4E3IA 1FSYA 3UPNA 4B4ZA 2M7UA 1SKFA 4HNBA 5M1AA 1N9LA 3T4LA 2W3EA 3HBRA 4HH2A 3C38A 1BTLA 3IBJA 4WZ4A 3U2AA 3WRTA 1JVJA 5FI2A 4PPRA 5HWWA 3C2WA 2DNSA 5EOEA 5HWTA 5KMWA 3HUNA 5AQAA 3IF6C 2WZZA 1OT6A 3QHYA 1VB6A 3IT9A 3C4OA 4Q0HA 1CI8A 1Y54A 4E04A 2GDNA 2W1RA 3BY9A 1N9BA 3T4KA 5DFXA 3I7JA 5FSRA 2HP6A 4ZBEA 1LL8A 4QD4A 5HDDA 4IEDA 2RL3A 3E2KA 2HP9A 1IKIA 5AQ7A 3RH8B 1BT5A 1H5XA 5HAIA 3WRZA 3KSFA 1DJBA 4IVIA 3H82A 1MPLA 1UWNX 4KZAA 5F69A 1ACFA 2OOLA 4OP8A 3S7QA 1UWPX 1V9ZA 5EFWA 4KZ4A 3C8CA 3Q7VB 2RCXA 3BY8A 1K56D 1PWGA 4DE0A 1KE0A 3A3EA 3LICA 3FZCA 5CX7A 1IYSA 5L07A 2OSUA 1OT9A 4JGOA 1K6RA 4HJ4A 3NECA 4B9OA 1S6RA 1BLSA 2H0YA 3AGFA 4JGQA 2EA9A 5FASA 2MJ6A 1FILA 4GDBA 2ZQ7A 2EX6A 3QNCA 1U60A 3ICYA 1P9WA 2ZC6B 4OQHA 1K54A 1L0FA 1F9IA 2Y2MA 5IHVA 1TDLA 3ZCZA 1H3QA 4OOMA 4KG6A 1W79A 4KZ8A 2ZC7A 5FI6A 2VGLS 1T18A 3L7HA 2I9VA 3UY6A 3L9KA 1L3LA 1P97A 4H6JB 1PW1A 3B33A 1LL9A 5A92A 2A24A 2Z2MB 2JKRM 3UE0A 5DKKA 1EROA 1YSQA 5HDCA 4XUXA 2Y2NA 1K38A 2BTFP 2VGJA 1G5UA 3Q07A 2XRNA 4C75A 2A3UA 5EVEA 1PW8A 3V3RA 4HY8A 2OAP1 4KZ3A 4XXRA 4JGRA 4UA9A 2J3WA 1NWZA 2VEAA 3D3OA 3RXWA 4R1GA 5HSQA 2J3TC 4Y2FA 1MXOA 5J7EA 5CTNA 1NYYA 2XR0A 3VP2A 2FZ0A 1FIKA 4LFUA 1ZG6A 1NJ4A 2PD7A 3HLWA 5HZHA 1NRFA 3U4LP 5DF8A 1SKOB 3MSHA 1P0ZA 1V9YA 4CLCA 3VOZA 4MN6A 2R9WA 4F3LA 4XT2B 4ETXA 3ZNYA 3PAEA 2HDUA 4GD6A 1GA9A 5AVFA 4UA7A 5TR7A 3S1YA 3BFFA 5FQJA 4ZAMA 1E3UA 3SOIA 3LEQA 1GSVA 3K2NA 5EM1A 3D4FA 2O99A 1MC0A 4X69A 2XQZA 5E2EA 1ZC2A 1E4DA 3ZNTA 2KOIA 4JF6A 4PM8A 2QPNA 2NUPC 4R3JA 3B3XA 3IS2A 4HI4A 4MCWA 4N1XA 2UV0E 2H5SA 1K25A 4WZ5C 1XX2A 2BG1A 1XA7A 2K7SA 3NBLA 4GN2A 4P6BA 1XFNA 2WGVA 3G6OA 1SKOA 5EECA 3TJZC 1VEUB 4FCFA 4I5SA 4FD8A 1LLBA 3RTYA 5MC7A 2Q0OA 4E3JA 2KX6A 4ARZB 3TOIA 2GZAA 1JTDA 4IBRA 2ZQ9A 2XA7M 3DW0A 2JKTI 5FQKA 3QNBA 3WS4A 1C3BA 2Y2GA 3ZG7B 5AQ9A 2GJ3A 3CI6A 4KZBA 3VSLA 1MWSA 4KQDA 2V1ZA 1MKIA 5L10A 3KSIA 3WS1A 3CAXA 5EVIA 3OPRA 4YNRA 1OMEA 1OTDA 4S2IA 4S2JA 2JC7A 1OTEA 3DTMA 4KQRA 1OTAA 5FEFA 3VE3A 5EE8A 3SS4A 1VEUA 2ZMVA 1L0DA 3IXGA 3F1OA 2P74A 3GR2A 2G2UA 4CQHA 1TS6A 3G2YA 1PIOA 1JWVA 4OONA 1YPRA 5AJGA 5DTKA 3FWLA 2XLNA 3MZDA 5EVLA 4M4XA 3BFDA 2EWVA 2ZQ8A 1IOUA 4P87A 3K3DA 1PI4A 4P6ZS 1H0MA 1IELA 3MKEA 3UMEA 1GCEA 3LI9A 2XFSA 2EFUA 2EX2A 3IWOA 4K91A 4HBUA 1DRMA 3UB6A 1HLUP 1A0KA 5DTSA 1ODVA 2W27A 2WGIA 3G4PA 3BW6A 3JVVA 2X02A 1TF1A 3NHQA 2VKSA 2W1TB 2WKEA 5GLCA 4S2MA 3A3DA 1F2KA 1VETB 2XEPA 1MKMA 4EW7A 4UHUA 3UDIA 3UO9A 3VE4A 2H28A 5GLDA 1PWCA 4R0QA 3RFBA 4EBPA 4EUZA 1K0KA 3LGOA 1CK3A 3QP8A 3KX0X 3UB7A 4GCZA 1XKZA 3O86A 3IX4A 3LY4A 3D9YA 4B4XA 4EERA 3FKVA 2V0UA 3Q82A 3DTIA 2HV1A 1KGGA 3E98A 2G7UA 5L2FA 4EEPA 2Y2JA 4Y17A 3KYZA 4WEKA 2WAFA 3QP4A 1ONHA 1GHIA 3IX3A 4IUHA 3M6BA 4E3OA 4DF6A 1FQGA 2D02A 2J7VA 3LIFA 1F5MA 4QPRA 5FATA 3ZG0A 3M6HA 2HDQA 4UQIS 4S2KA 2L0WA 3IWQA 5GHZA 1K56A 4CPKA 3NY4A 4PM7A 3BQ8A 4X6TA 2Y8HA 1KDWA 5HARA 3V50A 4R4SA 5CHUA 4EEUA 1W5DA 4LGWA 3SS5A 1XJ3A 2V9AA 4LCLA 3CPTA 4X53A 3HVFA 1XA1A 1ERQA 1DP9A 1LT0A 3OPLA 4OQIA 3E4PA 4OQ0A 2FH5A 1PRQA 2E8IA 3OC2A 2XDMA 5U47A 1FCOA 1XGIA 2EWWA 3N7WA 1YAXA 4S2PA 3DWZA 3IH8A 1IFQA 4WF0A 4E3NA 1ZTUA 2ZL1B 1BYWA 3N8SA 1AXBA 1S1ZA 3MQ0A 4NK3A 2B95A 4OP5A 1YMXA 4AFIA 2Z6DA 3C7VA 3R4KA 3S4XA 3F1NB 2J80A 1MWTA 2FFFB 2QJ7A 3EOIA 1JTGA 3H82B 1JNUA 5L8MA 1VQQA 3ITAA 4G3VA 2Y2OA 2Y2PA 3QP5A 4WYYA 3IH9A 2PDRA 5EPHA 3T4TA 2OLUA 3MFDA 3Q81A 2EXAA 5M18A 3N8RA 5IS1A 3WS0A 4KUKA 3FV7A 1XP4A 2P08A 4Q0JA 3CITA 5IU1A 5GHXA 5KIZA 3B47A 1PZOA 3GMWA 2ZQCA 2ZL1A 3CJMA 4DMZA 4OH0A 4I39A 4WM9A 3MZFA 3E2LA 3SH9A 4JPMA 2Z6CA 4BMWA 2A49A 1EI5A 4MN7A 2B18A 3CLOA 3F1NA 3LR0A 3PBQA 1PZPA 3BRMA 3FKWA 5JYOA 2XK1A 2JKRI 5CXWA 3OCLA 1BLPA 1K55A 4KG5A 4LV0A 2R78A 2WKQA 3EQUA 1DJAA 4S2OA 4NXGA 1H8ZA 2WAEA 3W8KA 1K4EA 1S4SA 4DE2A 1SHVA 3MJQA 4OPRA 4NETA 4JXVA 3TRCA 2P9VB 1G68A 5FEGA 5L09A 5E2FA 1GA0A 3T12B 1NZOA 5CTMA 1T1AA 1NLZA 5M19A 4C6YA 2A24B 5FQMA 4LLOB 3MXSA 1TS7A 2ZC5B 3GTCA 4U3TA 1CQAA 4Q0IA 4ZJ2A 3T4SA 4WBGA 4LCMA 1K6SA 5HL1A 4N1HA 4U0TA 4GOGA 2ZOHA 2XSSA 2ZD8A 3D72A 1YLTA 4LRZE 1IKGA 1RP5A 4JF4A 3A0SA 1BULA 3HLEA 1W8QA 4E3LA 2Y79A 4QB8A 4IJGA 2VZWA 4WUJA 2X01A 5EV0A 2C5WB 4DXCA 4OKPA 2ZOIA 2XH9A 5CGWA 2P9VA 3LIDA 1DP8A
chains in the Genus database with same CATH topology
4L9GA 3G6OA 1X0OA 3K3CA 3KO6A 4CLCB 3JVUA 3TJZC 4F3LB 2VV6A 2GNXA 4I5SA 1XJ4A 4DJ3A 5IT5A 2VJWA 4KQOA 1S1YA 1YKDA 2DMWA 1ZHHB 3KYQA 3MFXA 3RTYA 3S7PA 3PHYA 4MN5A 5TBMB 2JKTM 5MC7A 4FSFA 4WLAA 2KLIA 3F1PB 2BASA 2VX8A 2KX6A 2V1AA 4MDZA 4G3WA 4WEJA 4ARZB 3H7WA 5F6AA 2GZAA 2PYRA 5LBRA 2HF6A 3MQQA 4R3AA 4WL9A 5AVEA 2XA7M 2HJ9C 4I3IA 2JKTI 5G4ZA 3O5YA 3PR6A 4NEED 4NKPA 1KOUA 4BBVA 2GJ3A 3CI6A 4GW9A 4KQDA 4O01A 3GDIA 4NXEA 3IS2B 5G4YA 3W2ZA 3V67A 3KSIA 2OAQ1 1W63M 4GLQA 3CAXA 2W1TA 1NLYA 4YNRA 1OTDA 4UEYA 1OTEA 4ZRRA 1OTAA 3HJIA 4K08A 3VE3A 4EETB 1G6OA 5A8BA 4LRYC 5F68A 4OOLA 2ZMVA 4Z1WA 3S7NA 3PYPA 3HCYA 3F1OA 3E0YA 1LSXA 2QHKA 4LRXC 1TS6A 4CQHA 3VOLA 3PBSA 2NUTC 3F1PA 5AJGA 2VV7A 3MF0A 4ME4A 2PT7A 3P7NA 5FL3A 4M4XA 3NOTC 4GS9A 2GX5A 2YKFA 1UGUA 2EWVA 1IOUA 3LFVA 1S67L 3K3DA 4P6ZS 3FC7A 3EQVA 3UMEA 3TE8A 3LIAA 4I3JA 3FPVA 3LI9A 2YKHA 5HD3A 5C5KA 4I3AA 2VV8A 4HP4A 2D01A 1F98A 4O0PA 4HH3A 1DRMA 4B93A 4JGPA 3UB6A 3PBOA 4IHQA 1YSPA 1ODVA 2B02A 2W27A 3LR5A 3KSHA 3BW6A 2O9BA 4DN0A 3PBNA 3JVVA 5I5LA 1Y28A 1TF1A 3NHQA 2VKSA 2W1TB 3LYXA 2O0YA 3OCNA 4HHDA 2WKRA 3CUEA 3SW1A 1S66L 1EW0A 3MQOA 5DJUA 4PKYA 2L1MA 1MKMA 2J3TD 2OWHA 4EW7A 2M7UA 4HNBA 3VE4A 2H28A 1N9LA 3T4LA 2W3EA 4HH2A 3RFBA 2ZBBA 4L9FA 3F1OB 3C38A 4DJ2A 3IBJA 3KX0X 3UB7A 4RQ9A 4GCZA 3LUQA 3U2AA 2W3FA 2INWA 5HWWA 5DKLA 1OJGA 3C2WA 5HWTA 4EERA 3LIBA 2V0UA 3E4OA 3ZQ5A 1OT6A 3EEHA 2PHYA 2HV1A 1VB6A 4CLCC 3E98A 2G7UA 4GS9B 3A0VA 3NOPC 4Q0HA 4EEPA 3T4OA 2KDKA 3KYZA 4WEKA 4E04A 4IUHA 4KUOA 2W1RA 1MZUA 3BY9A 3PBTA 3T4KA 5DFXA 4PKYG 4YWZA 3S7OA 2D02A 1LL8A 3LIFA 3KSGA 1F5MA 5HDDA 2M1CA 4QPRA 3RH8B 3UE3A 3UB9A 2IA2A 4YOFA 2PR6A 3EWKA 3KSFA 4P6ZM 1T19A 1XJ2A 4UQIS 2M7VA 2L0WA 3H82A 3UE6A 4EQ1A 2VLGA 1UWNX 5F69A 1XFQA 1S4RA 5HL6A 4NXFA 3ZYTA 4BBUA 4CLCE 3BQ8A 2OOLA 2Y8HA 3IBRA 5DFYA 5K5BA 3S7QA 1D06A 4EU0A 1GSWA 4EEUA 1UWPX 1V9ZA 5EFWA 2K31A 2O9AA 4Y5FA 4WELA 3LIEA 2HJEA 3C8CA 3GECA 1XJ3A 1VHMA 3BY8A 2P7JA 2V9AA 5DJTA 3NJAA 4HQAA 1DP9A 2V1BA 1LT0A 3LICA 5HPIA 1OTBA 3E4PA 3CUEC 4H6JA 5CX7A 2FH5A 1G28A 3OC2A 2XROA 2EWWA 1OT9A 4MMNA 1YAXA 4JGOA 4PHTA 4HJ4A 1IFQA 2WKPA 3PBRA 4WF0A 4II7A 1ZTUA 4B9OA 1TD5A 1BYWA 1S1ZA 3MQ0A 4L0LA 4JGQA 2EA9A 4EXOA 4BJPA 4AFIA 2Z6DA 5HD5A 3OBFA 4L9EA 3R4KA 4R6LA 4WN5A 2MJ6A 3F1NB 2J80A 4NXBA 1N9NA 3NOUC 3VV4A 2QJ7A 3EOIA 4I38A 2LB9A 3H82B 1JNUA 3MXQA 5L8MA 4G3VA 3ICYA 1LSWA 4R70A 2W3HA 3FG8A 1N9OA 1GSXA 4GHIA 4HP9A 1P9WA 5DF9A 2V0WA 2VA0A 1F9IA 2PDRA 3OOVA 1H3QA 4OOMA 2LB5A 1NRJA 2O9CA 4HIAA 3T4TA 1XJ6A 4UQIM 2VGLS 4EUVA 1TS0A 5IS1A 3MR0A 1T18A 4KUKA 2PR5A 2I9VA 3UMDA 3H9WA 1P97A 2P08A 4H6JB 4Q0JA 3B33A 2A24A 2K2NA 4XT2A 3CITA 5IU1A 4ETZA 2JKRM 5KIZA 3B47A 3B42A 2W0NA 5DKKA 2PD8A 4DMZA 4I39A 1OPXA 3OLOA 4BWIA 1YSQA 5HDCA 2Z6CA 4BMWA 2QJ5A 5TJJA 3FPWA 4MN7A 2B18A 3UB8A 3CLOA 4HJ6A 4HJ3A 3F1NA 3LR0A 1T1CA 3PBQA 2JN7A 2XRNA 3EGDC 3DBAA 2JKRI 3OCLA 1P9RA 3MMHA 4R38A 3LR4A 1STZA 2W3DA 2QYBA 2R78A 3BWLA 4G3KA 2WKQA 3EQUA 5HPFA 3LI8A 2OAP1 3P01A 3C30A 4HY8A 2A2LA 4NXGA 4GHIB 3R7WA 4JGRA 3EEAA 2J3WA 1NWZA 2VEAA 3D3OA 5HSQA 1S4SA 2J3TC 4Y2FA 5J7EA 3MJQA 4Y3IA 4EESA 4LPZA 3TRCA 2FZ0A 5TBMA 2P04A 3E4QA 2CMNA 2PD7A 5HZHA 1WA9A 1W63Q 5HDSA 1P0ZA 1V9YA 4CLCA 3BJNA 4MN6A 1T1AA 1NLZA 2OWJA 4F3LA 1T1BA 2A24B 4LLOB 4XT2B 4ETXA 1D7EA 1TS7A 4FOFA 4Q0IA 3T4SA 5AVFA 4GJ4A 2XA7S 3HJKA 2L4RA 2VGLM 3PXPA 1TS8A 5KSHA 1OJ5A 1LSVA 1OTIA 4O8GA 1GSVA 2ZOHA 2XSSA 3D72A 2QKPA 3K2NA 4LRZE 5HWVA 2O99A 4CLCD 4PAUA 3A0SA 1MC0A 3H7WB 4ARZA 5F5YA 3EGXC 3T4JA 2W3GA 2ZMFA 2HGVA 3LR3A 2KOIA 4IUKA 2Y79A 2JHEA 4IJGA 5J4EA 3BQAA 2VZWA 3TW8A 1DP6A 4WUJA 5J3WA 2NUPC 3T4QA 3R7WB 3T50A 3A0RA 2QWSA 4HOIA 3IS2A 4HI4A 4MCWA 3ULFA 2PYPA 3CWFA 2ZOIA 3LIDA 1DP8A 1H8MA 2K7SA 1XFNA 4BBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9G A;  3G6O A;  1X0O A;  3K3C A;  4F3L B;  2VV6 A;  4I5S A;  1XJ4 A;  4DJ3 A;  1S1Y A;  3MFX A;  3RTY A;  3PHY A;  4MN5 A;  4WLA A;  3F1P B;  2BAS A;  2KX6 A;  2V1A A;  3H7W A;  5F6A A;  2PYR A;  3MQQ A;  4R3A A;  4WL9 A;  5AVE A;  4I3I A;  5G4Z A;  1KOU A;  4BBV A;  2GJ3 A;  4GW9 A;  4KQD A;  3GDI A;  4NXE A;  3IS2 B;  5G4Y A;  3CAX A;  1OTD A;  1OTE A;  1OTA A;  3HJI A;  4K08 A;  3VE3 A;  4EET B;  5A8B A;  4LRY C;  5F68 A;  3PYP A;  3F1O A;  1LSX A;  2QHK A;  4LRX C;  1TS6 A;  3VOL A;  1XFN A;  3F1P A;  2VV7 A;  3P7N A;  4M4X A;  3NOT C;  4GS9 A;  2YKF A;  1UGU A;  1S67 L;  3K3D A;  3FC7 A;  3UME A;  3LIA A;  4I3J A;  3LI9 A;  2YKH A;  5HD3 A;  4I3A A;  2VV8 A;  4HP4 A;  2D01 A;  1F98 A;  4HH3 A;  1DRM A;  4JGP A;  3UB6 A;  1ODV A;  2B02 A;  2W27 A;  5I5L A;  1Y28 A;  3NHQ A;  3LYX A;  4HHD A;  2WKR A;  3SW1 A;  1S66 L;  1EW0 A;  3MQO A;  5DJU A;  4PKY A;  2L1M A;  2OWH A;  4EW7 A;  4HNB A;  3VE4 A;  2H28 A;  1N9L A;  4HH2 A;  2ZBB A;  4L9F A;  3F1O B;  4DJ2 A;  3KX0 X;  3UB7 A;  4RQ9 A;  4GCZ A;  3LUQ A;  2INW A;  5HWW A;  5DKL A;  1OJG A;  3C2W A;  5HWT A;  4EER A;  3LIB A;  2V0U A;  3E4O A;  3ZQ5 A;  1OT6 A;  3EEH A;  2PHY A;  2HV1 A;  1VB6 A;  4GS9 B;  3A0V A;  3NOP C;  4EEP A;  2KDK A;  4E04 A;  4KUO A;  3BY9 A;  1MZU A;  4PKY G;  4YWZ A;  2D02 A;  1LL8 A;  3LIF A;  5HDD A;  2M1C A;  3RH8 B;  3UB9 A;  2PR6 A;  3EWK A;  1T19 A;  1XJ2 A;  2L0W A;  3H82 A;  3UE6 A;  4EQ1 A;  2VLG A;  1UWN X;  5F69 A;  1XFQ A;  1S4R A;  4NXF A;  4BBU A;  2OOL A;  3IBR A;  1D06 A;  1GSW A;  4EEU A;  1UWP X;  1V9Z A;  5EFW A;  3LIE A;  3C8C A;  3GEC A;  1XJ3 A;  3BY8 A;  2P7J A;  2V9A A;  5DJT A;  3NJA A;  4HQA A;  1DP9 A;  2V1B A;  1LT0 A;  3LIC A;  1OTB A;  3E4P A;  4H6J A;  1G28 A;  1OT9 A;  4JGO A;  4HJ4 A;  2WKP A;  4WF0 A;  4B9O A;  1BYW A;  1S1Z A;  4JGQ A;  2EA9 A;  4EXO A;  2Z6D A;  5HD5 A;  4L9E A;  4R6L A;  4WN5 A;  3F1N B;  2J80 A;  4NXB A;  1N9N A;  3NOU C;  2QJ7 A;  4I38 A;  3H82 B;  1JNU A;  3MXQ A;  3ICY A;  1LSW A;  4R70 A;  3FG8 A;  1N9O A;  1GSX A;  4GHI A;  4HP9 A;  2V0W A;  1F9I A;  2PDR A;  4HIA A;  1XJ6 A;  1TS0 A;  5IS1 A;  3MR0 A;  1T18 A;  4KUK A;  2PR5 A;  2I9V A;  3UMD A;  3H9W A;  1P97 A;  4H6J B;  3B33 A;  2A24 A;  4XT2 A;  5IU1 A;  5KIZ A;  2W0N A;  5DKK A;  2PD8 A;  4I39 A;  3OLO A;  5HDC A;  2Z6C A;  2QJ5 A;  3UB8 A;  3CLO A;  4HJ6 A;  4HJ3 A;  3F1N A;  1T1C A;  2JN7 A;  4R38 A;  2R78 A;  3BWL A;  2WKQ A;  3LI8 A;  4HY8 A;  4NXG A;  4GHI B;  4JGR A;  1NWZ A;  2VEA A;  5HSQ A;  1S4S A;  5J7E A;  3MJQ A;  4EES A;  4LPZ A;  5TBM A;  3E4Q A;  2CMN A;  2PD7 A;  5HZH A;  1WA9 A;  5HDS A;  1P0Z A;  1V9Y A;  4MN6 A;  1T1A A;  2OWJ A;  4F3L A;  1T1B A;  2A24 B;  4LLO B;  4XT2 B;  1D7E A;  1TS7 A;  5AVF A;  3HJK A;  2L4R A;  1TS8 A;  1OJ5 A;  1LSV A;  1OTI A;  1GSV A;  2ZOH A;  3D72 A;  4LRZ E;  2QKP A;  5HWV A;  3A0S A;  3H7W B;  5F5Y A;  2JHE A;  5J4E A;  1DP6 A;  4WUJ A;  5J3W A;  3T50 A;  3A0R A;  2QWS A;  4HOI A;  3IS2 A;  4HI4 A;  3ULF A;  2PYP A;  3CWF A;  2ZOI A;  3LID A;  1DP8 A;  2K7S A;  5TBM B;  4BBT A; 
#chains in the Genus database with same CATH topology
 5FAO A;  4CLC B;  5CGX A;  4DE1 A;  3RJU A;  4F3L B;  2GNX A;  1XJ4 A;  1YLY A;  1SDN A;  1ZHH B;  3C5A A;  3MFX A;  3PHY A;  4FSF A;  1JWP A;  2BLS A;  2KLI A;  3P98 A;  5DTT A;  4E6X A;  4N9K A;  1KVL A;  3S22 A;  4WEJ A;  3QP2 A;  4UAA A;  2PYR A;  5LBR A;  3MQQ A;  4R3A A;  4WL9 A;  5AVE A;  4I3I A;  4R3B A;  4MBK A;  3SS3 A;  3TG9 A;  4IBX A;  3NDG A;  4NKP A;  1KOU A;  2Y91 A;  4BBV A;  1YM1 A;  4MBH A;  3GDI A;  4NXE A;  4DDS A;  3IS2 B;  4OPZ A;  1BZA A;  2OAQ 1;  1W63 M;  3M2K A;  4OPY A;  4GLQ A;  2ACG A;  1M6K A;  3O88 A;  4QJG A;  2JCH A;  1NLY A;  3CG5 A;  3HJI A;  2DRW A;  4EET B;  1G6O A;  1RCJ A;  3UNW A;  3HCY A;  1K54 C;  3BFE A;  3W4P A;  4EQI A;  4LRX C;  4LV3 A;  3VOL A;  1NXY A;  2PAV P;  2NUT C;  1MWU A;  2WKI A;  3MF0 A;  3O3V A;  2PT7 A;  3P7N A;  5FL3 A;  4X56 A;  2V8F A;  1ALQ A;  3NOT C;  4GS9 A;  1N4O A;  5FQQ A;  3HLG A;  1S67 L;  5CRF A;  5GHY A;  4CJN A;  4KQQ A;  3KYE A;  3FPV A;  2DCF A;  2WGW A;  1J9M A;  3MKF A;  4B93 A;  4IHQ A;  3GSG A;  3OPP A;  5I5L A;  2HDR A;  5EVI B;  2O0Y A;  2WKR A;  4PKY A;  2J3T D;  1PYY A;  1RGY A;  5KZH A;  2ZBB A;  4L9F A;  3F1O B;  4GKU A;  4DJ2 A;  3UPO A;  4RQ9 A;  3O87 A;  1O07 A;  2OLV A;  2W3F A;  4JXS A;  5HAQ A;  3UDX A;  1BLC A;  4YFM A;  3LIB A;  4FH4 A;  4QY6 A;  3EEH A;  2PHY A;  1E25 A;  5F82 A;  4CLC C;  3ZG5 A;  5GL9 A;  3T4O A;  2JBF A;  2KDK A;  4DDY A;  2PBD P;  3ZFZ A;  2J9P A;  4KUO A;  1MZU A;  4YWZ A;  1LL5 A;  3S7O A;  1SZV A;  3VP4 A;  3KSG A;  3PTE A;  3V39 A;  4QWO A;  2M1C A;  3UE3 A;  2IA2 A;  4YOF A;  1PWD A;  1QME A;  3V3S A;  3DTK A;  3IWI A;  5CHJ A;  1L2S A;  2M7V A;  4E3K A;  3UE6 A;  2VLG A;  1XFQ A;  3ZYT A;  5HL6 A;  4FUW A;  4BBU A;  5K5B A;  3NCK A;  1D06 A;  4EU0 A;  1GSW A;  1YLW A;  4UA6 A;  3LIE A;  4WMC D;  3BEB A;  3WWX A;  1VHM A;  1IYQ A;  2J9O A;  5J8X A;  1CEF A;  1NY0 A;  3NJA A;  3HLD A;  5HPI A;  3NI9 A;  1G28 A;  1MWR A;  4OLD A;  4D60 A;  2XRO A;  1CF0 A;  1IYP A;  3BFC A;  4PHT A;  2WKP A;  5CGS A;  4RA7 A;  4EXO A;  2ZM2 A;  3VFH A;  3G31 A;  4BJP A;  3W4Q A;  2IWD A;  2Y2H A;  4L9E A;  3UPP A;  3VP1 A;  4WN5 A;  1TEM A;  3MBZ A;  3ZHH A;  2ZQD A;  3IXB A;  5E2G A;  4FTX A;  1WE4 A;  3MXQ A;  4GNU A;  1LSW A;  4R70 A;  2W3H A;  1N9O A;  1GSX A;  3BYD A;  4GHI A;  5FDS A;  3IX8 A;  1LI9 A;  1XJ6 A;  4H8R A;  1ES5 A;  4EUV A;  1W7F A;  3MR0 A;  3CPT B;  4KZ6 A;  2PR5 A;  5EVI C;  4N92 A;  4B88 A;  5FQI A;  3UMD A;  1ESI A;  2XFT A;  2K2N A;  4Y0T A;  1YT4 A;  5F1G A;  4ETZ A;  3IXH A;  3GRJ A;  4P85 A;  1SDE A;  4JF5 A;  2PD8 A;  1OPX A;  4BWI A;  3VP3 A;  4EWF A;  2OV5 A;  2QJ5 A;  5TJJ A;  2EXB A;  1XPB A;  2ZM8 A;  3UB8 A;  3HL9 A;  3T1Q B;  4FH2 A;  4S2N A;  2JN7 A;  2WZX A;  1P9R A;  3MMH A;  4R38 A;  2I72 A;  3LR4 A;  2ZLY A;  1BSG A;  2QYB A;  3BWL A;  1RGZ A;  5HPF A;  3C30 A;  1H8Y A;  2A2L A;  3R7W A;  3EEA A;  4IVK A;  1TVF A;  1Y4O A;  4Y15 A;  4Y3I A;  4EES A;  4LPZ A;  4KEN B;  3C4P A;  3IF5 A;  3NIA A;  5CER A;  1ZG4 A;  5TBM A;  2P04 A;  3E4Q A;  3VOY A;  3IF6 A;  1W63 Q;  5GLA A;  5HDS A;  4BL2 A;  1I2S A;  4YIN A;  3A3I A;  4R4R A;  3BJN A;  1FOF A;  1NYM A;  2QMI A;  3T1X A;  1D7E A;  2EFX A;  4FOF A;  1ZKJ A;  4GJ4 A;  2XA7 S;  3HJK A;  2L4R A;  2VGL M;  3PXP A;  1Q2Q A;  2JKF A;  1OJ5 A;  1M40 A;  4LV2 A;  1OTI A;  4Y0O A;  1HVB A;  2QKP A;  4X1L A;  4EV4 A;  5HWV A;  3LO7 A;  2VGK A;  5EOO A;  4GZB A;  2V2F F;  3EGX C;  3HUO A;  2W3G A;  3WS5 A;  2HGV A;  3HLC A;  1K57 A;  3LR3 A;  2JHE A;  5J4E A;  1LHY A;  3T1R A;  3TW8 A;  1DP6 A;  1W8Y A;  3G32 A;  2FFY A;  2HP5 A;  3T4Q A;  2Y2L A;  2X71 A;  3A0R A;  5CHM A;  2QWS A;  3QP6 A;  4HOI A;  3ULF A;  4BLM A;  3Q7Z A;  4PMA A;  4ZDX A;  1O7E A;  3SZT A;  4BBT A;  4Y7P A;  3K3C A;  3KO6 A;  1G6A A;  2IWC A;  3CMZ A;  3G2Z A;  4RX3 A;  2VV6 A;  5IT5 A;  4KQO A;  2Z2L B;  1S1Y A;  1YKD A;  2DMW A;  3KYQ A;  4MN5 A;  3TSG A;  1HZO A;  3F1P B;  2Y2I A;  2Y2Q A;  2BAS A;  2VX8 A;  4Z9Q A;  3P09 A;  4MDZ A;  4HBT A;  2J8Y A;  2ZC4 B;  5F6A A;  2AVX A;  4BD0 A;  2Q9M A;  2XD1 A;  2HF6 A;  4MBF A;  1XXM A;  2HJ9 C;  3PR6 A;  2V8C A;  3BLS A;  4GW9 A;  3VFF A;  5G4Y A;  2XGN A;  3GVB A;  2QZ6 A;  4QHC A;  4BD1 A;  3V67 A;  1KDS A;  3HLB A;  1MBL A;  2Y2K A;  1WYC A;  2JE5 A;  2HPB A;  3G34 A;  1K57 C;  4ZRR A;  3HUM A;  4M3K A;  1PI5 A;  4K08 A;  2WUQ A;  5A8B A;  4LRY C;  4OOL A;  3S7N A;  3PYP A;  5DVA A;  1KGE A;  3A3J A;  4ZJ1 A;  4BEN A;  1EWZ A;  4KZ9 A;  2QHK A;  2EX8 A;  3UDF A;  1FCN A;  1KE4 A;  1Z6F A;  3PBS A;  1DJC A;  3UE1 A;  3F1P A;  1WYB A;  2VV7 A;  4OOY A;  5F83 A;  3PAG A;  5FQ9 A;  5AQB A;  1UGU A;  1ES3 A;  1MY8 A;  3FC7 A;  3EQV A;  3LIA A;  5HD3 A;  2VV8 A;  3VMA A;  5JYP A;  4JXG A;  1LI0 A;  2B02 A;  4QY5 A;  4X1M A;  5FDH A;  3FYZ A;  4DN0 A;  4MLL A;  3PBN A;  4ID4 A;  4EBL A;  1Y28 A;  3LYX A;  3OCN A;  4HHD A;  1K55 C;  3CUE A;  5HX9 A;  2Y55 A;  1S66 L;  1EW0 A;  1VM1 A;  2L1M A;  1SCW A;  2V20 A;  5A93 A;  5A91 A;  2WK0 A;  5TGF A;  4PM5 A;  1FR6 A;  4GD8 A;  4Y0U A;  3Q7V A;  1I5Q A;  1PNE A;  3LUQ A;  2XD5 A;  4OPQ A;  3A3F A;  2INW A;  4JBF A;  4RYE A;  5DKL A;  1OJG A;  3E4O A;  3ZQ5 A;  4GS9 B;  4BQM A;  3A0V A;  4HES A;  2R9X A;  3NOP C;  4JKT A;  5TFQ A;  2ZC3 B;  3ISG A;  1QMF A;  2ZJ9 A;  5G18 A;  3PBT A;  5E2H A;  1YLZ A;  2WYX A;  4PKY G;  2EX9 A;  4PM6 A;  2WGW B;  3IHB A;  5FAQ A;  1CI9 A;  3ZVT A;  1S0W A;  4WZ5 A;  4DXB A;  1ONG A;  3UB9 A;  2PR6 A;  4WMC A;  3EWK A;  4MNR A;  4DRT A;  4KG2 A;  4P6Z M;  1T19 A;  1XJ2 A;  2PU4 A;  4EQ1 A;  1S4R A;  3ZVW A;  4LEN A;  4NXF A;  4CLC E;  4JLF A;  3IBR A;  5DFY A;  1FCM A;  2VK3 A;  4S2L A;  1TDG A;  3GQZ A;  4LV1 A;  2K31 A;  2O9A A;  4Y5F A;  4WEL A;  2HJE A;  1HTZ A;  3GEC A;  2CC1 A;  3NC8 A;  1CJF A;  5HAP A;  2P7J A;  2H10 A;  5DJT A;  4O7D A;  4HQA A;  2V1B A;  1GHP A;  2PU2 A;  1OTB A;  1Q2P A;  3CUE C;  4H6J A;  3SH8 A;  3VSK A;  2ZQA A;  3BEC A;  4MMN A;  3BFG A;  3PBR A;  4II7 A;  3GV9 A;  1TD5 A;  4BL3 A;  5I94 A;  4L0L A;  5A90 A;  5HD5 A;  3OBF A;  4R6L A;  2H0T A;  1DY6 A;  4NXB A;  4OVD A;  1N9N A;  5D3O A;  3NOU C;  3VV4 A;  3NUL A;  2PBY A;  4I38 A;  1KE3 A;  2LB9 A;  3OPH A;  4K0X A;  5F1F A;  3FG8 A;  4HP9 A;  5DF9 A;  2V0W A;  2VA0 A;  1JWZ A;  3OOV A;  2LB5 A;  1NRJ A;  2O9C A;  4HIA A;  4X55 A;  1KVM A;  4E3M A;  4UQI M;  1D1J A;  3N8L A;  1TS0 A;  5EM0 A;  4Y13 A;  4OQG A;  2B5R A;  3QP1 A;  3SH7 A;  2Y59 A;  3DAV A;  3T1S A;  3H9W A;  5BOH A;  4XT2 A;  2JKG A;  4DKI A;  1IYO A;  3OZH A;  3B42 A;  1IEM A;  3UN7 A;  2W0N A;  5HW3 A;  3OLO A;  3LY3 A;  3RXX A;  4HEF A;  4JXW A;  3FPW A;  4XUZ A;  4HJ6 A;  4HJ3 A;  5GLB A;  1L0E A;  1T1C A;  3EGD C;  3DBA A;  1STZ A;  4QU3 A;  2W3D A;  4G3K A;  5CED A;  3LI8 A;  3P01 A;  4D2O A;  4ZJ3 A;  1KGF A;  2ZM0 A;  4GHI B;  3ZG8 B;  3IXD A;  3UB5 P;  4ZTK A;  3V5M A;  3G35 A;  4K0W A;  4Q8I A;  4NG2 A;  2CMN A;  1WA9 A;  1J3W A;  2HDS A;  2OWJ A;  1T1B A;  3AGD A;  3MXR A;  5E43 A;  4N9L A;  3W4O A;  4ESP A;  3ITB A;  1BUE A;  1L0G A;  4KZ5 A;  1TS8 A;  5KSH A;  1LSV A;  4O8G A;  3MS6 A;  1K4F A;  4CLC D;  5CEC A;  4PAU A;  3H7W B;  4ARZ A;  4PM9 A;  5F5Y A;  1I2W A;  3T4J A;  5KSC A;  2ZMF A;  2C6W B;  3G30 A;  1YLJ A;  2WKH A;  3MZE A;  4IUK A;  3BQA A;  4MEZ A;  2E8J A;  1NZU A;  5FI7 A;  5J3W A;  1AWI A;  1E3U D;  2Q9N A;  3R7W B;  3T50 A;  4EBN A;  2PYP A;  3CWF A;  3JYI A;  1H8M A;  2HZ5 A;  5TBM B;  4L9G A;  2UWX A;  3IF6 B;  3N4I A;  2G2W A;  1X0O A;  3JVU A;  1GHM A;  3HLF A;  5CEB A;  4DJ3 A;  2VJW A;  2XF3 A;  4A5R A;  4GB7 A;  4U0X A;  5DF7 A;  3S7P A;  2JKT M;  4WLA A;  5EUA A;  3IQA A;  4OLG A;  2V1A A;  4G3W A;  3H7W A;  1HD8 A;  3JPU A;  5G4Z A;  5FAP A;  3LCE A;  3O5Y A;  4NEE D;  1ES2 A;  3C7U A;  1PFL A;  4O01 A;  3HRE A;  3NDE A;  1YMS A;  3W2Z A;  1CEG A;  2W1T A;  4UEY A;  1VET A;  5HFO A;  3BLM A;  3AGE A;  5F68 A;  1Z09 A;  4Z1W A;  3WS2 A;  3DWK A;  3ZDJ A;  1ESU A;  4R23 A;  1FSW A;  3E0Y A;  1LSX A;  4X25 A;  5EVI D;  1ERM A;  4ME4 A;  2Y4A A;  3Q1F A;  2GX5 A;  2YKF A;  1ES4 A;  3LEZ A;  4E6W A;  1YLP A;  3CZD A;  4P0M A;  2WAD A;  3BM6 A;  2IWB A;  3LFV A;  4F94 A;  1YQS A;  1BLH A;  4DE3 A;  3TE8 A;  4I3J A;  4GDN A;  2YKH A;  5C5K A;  2ZMA A;  3N6I A;  4I3A A;  3ZGA B;  4C3Q A;  4HP4 A;  2D01 A;  4KZ7 A;  1F98 A;  4O0P A;  3IHA A;  3M2J A;  4HH3 A;  2PRF A;  4JGP A;  3PBO A;  4RVA A;  1YSP A;  3LR5 A;  3KSH A;  2O9B A;  3VP0 A;  4S2N C;  1XGJ A;  5FA7 A;  3ZG9 B;  4RX2 A;  3SW1 A;  4X68 A;  3DTE A;  1FR1 A;  3CHW P;  3MQO A;  5DJU A;  2OWH A;  4E3I A;  1FSY A;  3UPN A;  4B4Z A;  2M7U A;  1SKF A;  4HNB A;  5M1A A;  1N9L A;  3T4L A;  2W3E A;  3HBR A;  4HH2 A;  3C38 A;  1BTL A;  3IBJ A;  4WZ4 A;  3U2A A;  3WRT A;  1JVJ A;  5FI2 A;  4PPR A;  5HWW A;  3C2W A;  2DNS A;  5EOE A;  5HWT A;  5KMW A;  3HUN A;  5AQA A;  3IF6 C;  2WZZ A;  1OT6 A;  3QHY A;  1VB6 A;  3IT9 A;  3C4O A;  4Q0H A;  1CI8 A;  1Y54 A;  4E04 A;  2GDN A;  2W1R A;  3BY9 A;  1N9B A;  3T4K A;  5DFX A;  3I7J A;  5FSR A;  2HP6 A;  4ZBE A;  1LL8 A;  4QD4 A;  5HDD A;  4IED A;  2RL3 A;  3E2K A;  2HP9 A;  1IKI A;  5AQ7 A;  3RH8 B;  1BT5 A;  1H5X A;  5HAI A;  3WRZ A;  3KSF A;  1DJB A;  4IVI A;  3H82 A;  1MPL A;  1UWN X;  4KZA A;  5F69 A;  1ACF A;  2OOL A;  4OP8 A;  3S7Q A;  1UWP X;  1V9Z A;  5EFW A;  4KZ4 A;  3C8C A;  3Q7V B;  2RCX A;  3BY8 A;  1K56 D;  1PWG A;  4DE0 A;  1KE0 A;  3A3E A;  3LIC A;  3FZC A;  5CX7 A;  1IYS A;  5L07 A;  2OSU A;  1OT9 A;  4JGO A;  1K6R A;  4HJ4 A;  3NEC A;  4B9O A;  1S6R A;  1BLS A;  2H0Y A;  3AGF A;  4JGQ A;  2EA9 A;  5FAS A;  2MJ6 A;  1FIL A;  4GDB A;  2ZQ7 A;  2EX6 A;  3QNC A;  1U60 A;  3ICY A;  1P9W A;  2ZC6 B;  4OQH A;  1K54 A;  1L0F A;  1F9I A;  2Y2M A;  5IHV A;  1TDL A;  3ZCZ A;  1H3Q A;  4OOM A;  4KG6 A;  1W79 A;  4KZ8 A;  2ZC7 A;  5FI6 A;  2VGL S;  1T18 A;  3L7H A;  2I9V A;  3UY6 A;  3L9K A;  1L3L A;  1P97 A;  4H6J B;  1PW1 A;  3B33 A;  1LL9 A;  5A92 A;  2A24 A;  2Z2M B;  2JKR M;  3UE0 A;  5DKK A;  1ERO A;  1YSQ A;  5HDC A;  4XUX A;  2Y2N A;  1K38 A;  2BTF P;  2VGJ A;  1G5U A;  3Q07 A;  2XRN A;  4C75 A;  2A3U A;  5EVE A;  1PW8 A;  3V3R A;  4HY8 A;  2OAP 1;  4KZ3 A;  4XXR A;  4JGR A;  4UA9 A;  2J3W A;  1NWZ A;  2VEA A;  3D3O A;  3RXW A;  4R1G A;  5HSQ A;  2J3T C;  4Y2F A;  1MXO A;  5J7E A;  5CTN A;  1NYY A;  2XR0 A;  3VP2 A;  2FZ0 A;  1FIK A;  4LFU A;  1ZG6 A;  1NJ4 A;  2PD7 A;  3HLW A;  5HZH A;  1NRF A;  3U4L P;  5DF8 A;  1SKO B;  3MSH A;  1P0Z A;  1V9Y A;  4CLC A;  3VOZ A;  4MN6 A;  2R9W A;  4F3L A;  4XT2 B;  4ETX A;  3ZNY A;  3PAE A;  2HDU A;  4GD6 A;  1GA9 A;  5AVF A;  4UA7 A;  5TR7 A;  3S1Y A;  3BFF A;  5FQJ A;  4ZAM A;  1E3U A;  3SOI A;  3LEQ A;  1GSV A;  3K2N A;  5EM1 A;  3D4F A;  2O99 A;  1MC0 A;  4X69 A;  2XQZ A;  5E2E A;  1ZC2 A;  1E4D A;  3ZNT A;  2KOI A;  4JF6 A;  4PM8 A;  2QPN A;  2NUP C;  4R3J A;  3B3X A;  3IS2 A;  4HI4 A;  4MCW A;  4N1X A;  2UV0 E;  2H5S A;  1K25 A;  4WZ5 C;  1XX2 A;  2BG1 A;  1XA7 A;  2K7S A;  3NBL A;  4GN2 A;  4P6B A;  1XFN A;  2WGV A;  3G6O A;  1SKO A;  5EEC A;  3TJZ C;  1VEU B;  4FCF A;  4I5S A;  4FD8 A;  1LLB A;  3RTY A;  5MC7 A;  2Q0O A;  4E3J A;  2KX6 A;  4ARZ B;  3TOI A;  2GZA A;  1JTD A;  4IBR A;  2ZQ9 A;  2XA7 M;  3DW0 A;  2JKT I;  5FQK A;  3QNB A;  3WS4 A;  1C3B A;  2Y2G A;  3ZG7 B;  5AQ9 A;  2GJ3 A;  3CI6 A;  4KZB A;  3VSL A;  1MWS A;  4KQD A;  2V1Z A;  1MKI A;  5L10 A;  3KSI A;  3WS1 A;  3CAX A;  5EVI A;  3OPR A;  4YNR A;  1OME A;  1OTD A;  4S2I A;  4S2J A;  2JC7 A;  1OTE A;  3DTM A;  4KQR A;  1OTA A;  5FEF A;  3VE3 A;  5EE8 A;  3SS4 A;  1VEU A;  2ZMV A;  1L0D A;  3IXG A;  3F1O A;  2P74 A;  3GR2 A;  2G2U A;  4CQH A;  1TS6 A;  3G2Y A;  1PIO A;  1JWV A;  4OON A;  1YPR A;  5AJG A;  5DTK A;  3FWL A;  2XLN A;  3MZD A;  5EVL A;  4M4X A;  3BFD A;  2EWV A;  2ZQ8 A;  1IOU A;  4P87 A;  3K3D A;  1PI4 A;  4P6Z S;  1H0M A;  1IEL A;  3MKE A;  3UME A;  1GCE A;  3LI9 A;  2XFS A;  2EFU A;  2EX2 A;  3IWO A;  4K91 A;  4HBU A;  1DRM A;  3UB6 A;  1HLU P;  1A0K A;  5DTS A;  1ODV A;  2W27 A;  2WGI A;  3G4P A;  3BW6 A;  3JVV A;  2X02 A;  1TF1 A;  3NHQ A;  2VKS A;  2W1T B;  2WKE A;  5GLC A;  4S2M A;  3A3D A;  1F2K A;  1VET B;  2XEP A;  1MKM A;  4EW7 A;  4UHU A;  3UDI A;  3UO9 A;  3VE4 A;  2H28 A;  5GLD A;  1PWC A;  4R0Q A;  3RFB A;  4EBP A;  4EUZ A;  1K0K A;  3LGO A;  1CK3 A;  3QP8 A;  3KX0 X;  3UB7 A;  4GCZ A;  1XKZ A;  3O86 A;  3IX4 A;  3LY4 A;  3D9Y A;  4B4X A;  4EER A;  3FKV A;  2V0U A;  3Q82 A;  3DTI A;  2HV1 A;  1KGG A;  3E98 A;  2G7U A;  5L2F A;  4EEP A;  2Y2J A;  4Y17 A;  3KYZ A;  4WEK A;  2WAF A;  3QP4 A;  1ONH A;  1GHI A;  3IX3 A;  4IUH A;  3M6B A;  4E3O A;  4DF6 A;  1FQG A;  2D02 A;  2J7V A;  3LIF A;  1F5M A;  4QPR A;  5FAT A;  3ZG0 A;  3M6H A;  2HDQ A;  4UQI S;  4S2K A;  2L0W A;  3IWQ A;  5GHZ A;  1K56 A;  4CPK A;  3NY4 A;  4PM7 A;  3BQ8 A;  4X6T A;  2Y8H A;  1KDW A;  5HAR A;  3V50 A;  4R4S A;  5CHU A;  4EEU A;  1W5D A;  4LGW A;  3SS5 A;  1XJ3 A;  2V9A A;  4LCL A;  3CPT A;  4X53 A;  3HVF A;  1XA1 A;  1ERQ A;  1DP9 A;  1LT0 A;  3OPL A;  4OQI A;  3E4P A;  4OQ0 A;  2FH5 A;  1PRQ A;  2E8I A;  3OC2 A;  2XDM A;  5U47 A;  1FCO A;  1XGI A;  2EWW A;  3N7W A;  1YAX A;  4S2P A;  3DWZ A;  3IH8 A;  1IFQ A;  4WF0 A;  4E3N A;  1ZTU A;  2ZL1 B;  1BYW A;  3N8S A;  1AXB A;  1S1Z A;  3MQ0 A;  4NK3 A;  2B95 A;  4OP5 A;  1YMX A;  4AFI A;  2Z6D A;  3C7V A;  3R4K A;  3S4X A;  3F1N B;  2J80 A;  1MWT A;  2FFF B;  2QJ7 A;  3EOI A;  1JTG A;  3H82 B;  1JNU A;  5L8M A;  1VQQ A;  3ITA A;  4G3V A;  2Y2O A;  2Y2P A;  3QP5 A;  4WYY A;  3IH9 A;  2PDR A;  5EPH A;  3T4T A;  2OLU A;  3MFD A;  3Q81 A;  2EXA A;  5M18 A;  3N8R A;  5IS1 A;  3WS0 A;  4KUK A;  3FV7 A;  1XP4 A;  2P08 A;  4Q0J A;  3CIT A;  5IU1 A;  5GHX A;  5KIZ A;  3B47 A;  1PZO A;  3GMW A;  2ZQC A;  2ZL1 A;  3CJM A;  4DMZ A;  4OH0 A;  4I39 A;  4WM9 A;  3MZF A;  3E2L A;  3SH9 A;  4JPM A;  2Z6C A;  4BMW A;  2A49 A;  1EI5 A;  4MN7 A;  2B18 A;  3CLO A;  3F1N A;  3LR0 A;  3PBQ A;  1PZP A;  3BRM A;  3FKW A;  5JYO A;  2XK1 A;  2JKR I;  5CXW A;  3OCL A;  1BLP A;  1K55 A;  4KG5 A;  4LV0 A;  2R78 A;  2WKQ A;  3EQU A;  1DJA A;  4S2O A;  4NXG A;  1H8Z A;  2WAE A;  3W8K A;  1K4E A;  1S4S A;  4DE2 A;  1SHV A;  3MJQ A;  4OPR A;  4NET A;  4JXV A;  3TRC A;  2P9V B;  1G68 A;  5FEG A;  5L09 A;  5E2F A;  1GA0 A;  3T12 B;  1NZO A;  5CTM A;  1T1A A;  1NLZ A;  5M19 A;  4C6Y A;  2A24 B;  5FQM A;  4LLO B;  3MXS A;  1TS7 A;  2ZC5 B;  3GTC A;  4U3T A;  1CQA A;  4Q0I A;  4ZJ2 A;  3T4S A;  4WBG A;  4LCM A;  1K6S A;  5HL1 A;  4N1H A;  4U0T A;  4GOG A;  2ZOH A;  2XSS A;  2ZD8 A;  3D72 A;  1YLT A;  4LRZ E;  1IKG A;  1RP5 A;  4JF4 A;  3A0S A;  1BUL A;  3HLE A;  1W8Q A;  4E3L A;  2Y79 A;  4QB8 A;  4IJG A;  2VZW A;  4WUJ A;  2X01 A;  5EV0 A;  2C5W B;  4DXC A;  4OKP A;  2ZOI A;  2XH9 A;  5CGW A;  2P9V A;  3LID A;  1DP8 A; 
#chains in the Genus database with same CATH homology
 4L9G A;  3G6O A;  1X0O A;  3K3C A;  3KO6 A;  4CLC B;  3JVU A;  3TJZ C;  4F3L B;  2VV6 A;  2GNX A;  4I5S A;  1XJ4 A;  4DJ3 A;  5IT5 A;  2VJW A;  4KQO A;  1S1Y A;  1YKD A;  2DMW A;  1ZHH B;  3KYQ A;  3MFX A;  3RTY A;  3S7P A;  3PHY A;  4MN5 A;  5TBM B;  2JKT M;  5MC7 A;  4FSF A;  4WLA A;  2KLI A;  3F1P B;  2BAS A;  2VX8 A;  2KX6 A;  2V1A A;  4MDZ A;  4G3W A;  4WEJ A;  4ARZ B;  3H7W A;  5F6A A;  2GZA A;  2PYR A;  5LBR A;  2HF6 A;  3MQQ A;  4R3A A;  4WL9 A;  5AVE A;  2XA7 M;  2HJ9 C;  4I3I A;  2JKT I;  5G4Z A;  3O5Y A;  3PR6 A;  4NEE D;  4NKP A;  1KOU A;  4BBV A;  2GJ3 A;  3CI6 A;  4GW9 A;  4KQD A;  4O01 A;  3GDI A;  4NXE A;  3IS2 B;  5G4Y A;  3W2Z A;  3V67 A;  3KSI A;  2OAQ 1;  1W63 M;  4GLQ A;  3CAX A;  2W1T A;  1NLY A;  4YNR A;  1OTD A;  4UEY A;  1OTE A;  4ZRR A;  1OTA A;  3HJI A;  4K08 A;  3VE3 A;  4EET B;  1G6O A;  5A8B A;  4LRY C;  5F68 A;  4OOL A;  2ZMV A;  4Z1W A;  3S7N A;  3PYP A;  3HCY A;  3F1O A;  3E0Y A;  1LSX A;  2QHK A;  4LRX C;  1TS6 A;  4CQH A;  3VOL A;  3PBS A;  2NUT C;  3F1P A;  5AJG A;  2VV7 A;  3MF0 A;  4ME4 A;  2PT7 A;  3P7N A;  5FL3 A;  4M4X A;  3NOT C;  4GS9 A;  2GX5 A;  2YKF A;  1UGU A;  2EWV A;  1IOU A;  3LFV A;  1S67 L;  3K3D A;  4P6Z S;  3FC7 A;  3EQV A;  3UME A;  3TE8 A;  3LIA A;  4I3J A;  3FPV A;  3LI9 A;  2YKH A;  5HD3 A;  5C5K A;  4I3A A;  2VV8 A;  4HP4 A;  2D01 A;  1F98 A;  4O0P A;  4HH3 A;  1DRM A;  4B93 A;  4JGP A;  3UB6 A;  3PBO A;  4IHQ A;  1YSP A;  1ODV A;  2B02 A;  2W27 A;  3LR5 A;  3KSH A;  3BW6 A;  2O9B A;  4DN0 A;  3PBN A;  3JVV A;  5I5L A;  1Y28 A;  1TF1 A;  3NHQ A;  2VKS A;  2W1T B;  3LYX A;  2O0Y A;  3OCN A;  4HHD A;  2WKR A;  3CUE A;  3SW1 A;  1S66 L;  1EW0 A;  3MQO A;  5DJU A;  4PKY A;  2L1M A;  1MKM A;  2J3T D;  2OWH A;  4EW7 A;  2M7U A;  4HNB A;  3VE4 A;  2H28 A;  1N9L A;  3T4L A;  2W3E A;  4HH2 A;  3RFB A;  2ZBB A;  4L9F A;  3F1O B;  3C38 A;  4DJ2 A;  3IBJ A;  3KX0 X;  3UB7 A;  4RQ9 A;  4GCZ A;  3LUQ A;  3U2A A;  2W3F A;  2INW A;  5HWW A;  5DKL A;  1OJG A;  3C2W A;  5HWT A;  4EER A;  3LIB A;  2V0U A;  3E4O A;  3ZQ5 A;  1OT6 A;  3EEH A;  2PHY A;  2HV1 A;  1VB6 A;  4CLC C;  3E98 A;  2G7U A;  4GS9 B;  3A0V A;  3NOP C;  4Q0H A;  4EEP A;  3T4O A;  2KDK A;  3KYZ A;  4WEK A;  4E04 A;  4IUH A;  4KUO A;  2W1R A;  1MZU A;  3BY9 A;  3PBT A;  3T4K A;  5DFX A;  4PKY G;  4YWZ A;  3S7O A;  2D02 A;  1LL8 A;  3LIF A;  3KSG A;  1F5M A;  5HDD A;  2M1C A;  4QPR A;  3RH8 B;  3UE3 A;  3UB9 A;  2IA2 A;  4YOF A;  2PR6 A;  3EWK A;  3KSF A;  4P6Z M;  1T19 A;  1XJ2 A;  4UQI S;  2M7V A;  2L0W A;  3H82 A;  3UE6 A;  4EQ1 A;  2VLG A;  1UWN X;  5F69 A;  1XFQ A;  1S4R A;  5HL6 A;  4NXF A;  3ZYT A;  4BBU A;  4CLC E;  3BQ8 A;  2OOL A;  2Y8H A;  3IBR A;  5DFY A;  5K5B A;  3S7Q A;  1D06 A;  4EU0 A;  1GSW A;  4EEU A;  1UWP X;  1V9Z A;  5EFW A;  2K31 A;  2O9A A;  4Y5F A;  4WEL A;  3LIE A;  2HJE A;  3C8C A;  3GEC A;  1XJ3 A;  1VHM A;  3BY8 A;  2P7J A;  2V9A A;  5DJT A;  3NJA A;  4HQA A;  1DP9 A;  2V1B A;  1LT0 A;  3LIC A;  5HPI A;  1OTB A;  3E4P A;  3CUE C;  4H6J A;  5CX7 A;  2FH5 A;  1G28 A;  3OC2 A;  2XRO A;  2EWW A;  1OT9 A;  4MMN A;  1YAX A;  4JGO A;  4PHT A;  4HJ4 A;  1IFQ A;  2WKP A;  3PBR A;  4WF0 A;  4II7 A;  1ZTU A;  4B9O A;  1TD5 A;  1BYW A;  1S1Z A;  3MQ0 A;  4L0L A;  4JGQ A;  2EA9 A;  4EXO A;  4BJP A;  4AFI A;  2Z6D A;  5HD5 A;  3OBF A;  4L9E A;  3R4K A;  4R6L A;  4WN5 A;  2MJ6 A;  3F1N B;  2J80 A;  4NXB A;  1N9N A;  3NOU C;  3VV4 A;  2QJ7 A;  3EOI A;  4I38 A;  2LB9 A;  3H82 B;  1JNU A;  3MXQ A;  5L8M A;  4G3V A;  3ICY A;  1LSW A;  4R70 A;  2W3H A;  3FG8 A;  1N9O A;  1GSX A;  4GHI A;  4HP9 A;  1P9W A;  5DF9 A;  2V0W A;  2VA0 A;  1F9I A;  2PDR A;  3OOV A;  1H3Q A;  4OOM A;  2LB5 A;  1NRJ A;  2O9C A;  4HIA A;  3T4T A;  1XJ6 A;  4UQI M;  2VGL S;  4EUV A;  1TS0 A;  5IS1 A;  3MR0 A;  1T18 A;  4KUK A;  2PR5 A;  2I9V A;  3UMD A;  3H9W A;  1P97 A;  2P08 A;  4H6J B;  4Q0J A;  3B33 A;  2A24 A;  2K2N A;  4XT2 A;  3CIT A;  5IU1 A;  4ETZ A;  2JKR M;  5KIZ A;  3B47 A;  3B42 A;  2W0N A;  5DKK A;  2PD8 A;  4DMZ A;  4I39 A;  1OPX A;  3OLO A;  4BWI A;  1YSQ A;  5HDC A;  2Z6C A;  4BMW A;  2QJ5 A;  5TJJ A;  3FPW A;  4MN7 A;  2B18 A;  3UB8 A;  3CLO A;  4HJ6 A;  4HJ3 A;  3F1N A;  3LR0 A;  1T1C A;  3PBQ A;  2JN7 A;  2XRN A;  3EGD C;  3DBA A;  2JKR I;  3OCL A;  1P9R A;  3MMH A;  4R38 A;  3LR4 A;  1STZ A;  2W3D A;  2QYB A;  2R78 A;  3BWL A;  4G3K A;  2WKQ A;  3EQU A;  5HPF A;  3LI8 A;  2OAP 1;  3P01 A;  3C30 A;  4HY8 A;  2A2L A;  4NXG A;  4GHI B;  3R7W A;  4JGR A;  3EEA A;  2J3W A;  1NWZ A;  2VEA A;  3D3O A;  5HSQ A;  1S4S A;  2J3T C;  4Y2F A;  5J7E A;  3MJQ A;  4Y3I A;  4EES A;  4LPZ A;  3TRC A;  2FZ0 A;  5TBM A;  2P04 A;  3E4Q A;  2CMN A;  2PD7 A;  5HZH A;  1WA9 A;  1W63 Q;  5HDS A;  1P0Z A;  1V9Y A;  4CLC A;  3BJN A;  4MN6 A;  1T1A A;  1NLZ A;  2OWJ A;  4F3L A;  1T1B A;  2A24 B;  4LLO B;  4XT2 B;  4ETX A;  1D7E A;  1TS7 A;  4FOF A;  4Q0I A;  3T4S A;  5AVF A;  4GJ4 A;  2XA7 S;  3HJK A;  2L4R A;  2VGL M;  3PXP A;  1TS8 A;  5KSH A;  1OJ5 A;  1LSV A;  1OTI A;  4O8G A;  1GSV A;  2ZOH A;  2XSS A;  3D72 A;  2QKP A;  3K2N A;  4LRZ E;  5HWV A;  2O99 A;  4CLC D;  4PAU A;  3A0S A;  1MC0 A;  3H7W B;  4ARZ A;  5F5Y A;  3EGX C;  3T4J A;  2W3G A;  2ZMF A;  2HGV A;  3LR3 A;  2KOI A;  4IUK A;  2Y79 A;  2JHE A;  4IJG A;  5J4E A;  3BQA A;  2VZW A;  3TW8 A;  1DP6 A;  4WUJ A;  5J3W A;  2NUP C;  3T4Q A;  3R7W B;  3T50 A;  3A0R A;  2QWS A;  4HOI A;  3IS2 A;  4HI4 A;  4MCW A;  3ULF A;  2PYP A;  3CWF A;  2ZOI A;  3LID A;  1DP8 A;  1H8M A;  2K7S A;  1XFN A;  4BBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...