2ZOHA

X-ray crystal structure of photoactive yellow protein, wild type, at 295k
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Low-barrier hydrogen bond in photoactive yellow protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2zohA00
1Y28A 3E4PA 5HWVA 4F3LB 4HJ3A 3B33A 3BY9A 3A0RA 4WUJA 3UMDA 2YKFA 1OJ5A 3MQOA 4R6LA 4BBVA 3LIDA 2HV1A 4NXBA 3F1NB 4LRXC 2CMNA 4HQAA 3LIFA 3NOTC 3FC7A 3NJAA 1GSVA 2INWA 2W0NA 3RTYA 5J3WA 3MJQA 4LLOB 3LICA 5HSQA 1TS8A 3LIBA 4I39A 1OTDA 2OWJA 1XFNA 2I9VA 2R78A 5DKKA 3A0VA 5KIZA 2ZOHA 3MXQA 1T1CA 2Z6DA 1NWZA 4JGRA 5I5LA 4BBTA 4H6JA 5HDCA 4M4XA 3IBRA 2P7JA 4RQ9A 3P7NA 5HWWA 2J80A 2Z6CA 3HJIA 3CLOA 2A24A 1TS7A 2V1BA 1OJGA 2PYRA 3LYXA 1DP8A 2D02A 2QHKA 3SW1A 3LUQA 5A8BA 3K3CA 4L9GA 4GCZA 2KX6A 5IU1A 1S67L 1EW0A 1N9NA 2K7SA 4KUKA 3LIEA 1LSXA 4KUOA 1S4RA 2YKHA 4HNBA 1OTAA 4I3AA 2PR6A 4NXEA 4KQDA 3MFXA 4R38A 4WL9A 3LI9A 2L4RA 4E04A 2VV6A 4GS9A 4B9OA 1LSWA 2QJ7A 4HH2A 4R3AA 5HDSA 4HH3A 4EW7A 3ULFA 2M1CA 2L0WA 4K08A 1UWPX 2PYPA 3EWKA 1P97A 2W27A 4H6JB 4HY8A 2VEAA 4JGOA 2V0UA 5F68A 3F1PA 5HD3A 1XJ4A 4I38A 3ZQ5A 2A24B 5TBMA 1OTIA 1UGUA 3H82A 4NXFA 2V1AA 5HDDA 3BWLA 4GW9A 4EERA 2H28A 4YWZA 4EQ1A 1UWNX 4EEUA 5J4EA 1JNUA 2WKPA 1T1BA 3VOLA 5AVEA 3MQQA 1KOUA 3GDIA 3IS2A 4JGQA 4BBUA 3NOPC 3UB7A 3UE6A 5F5YA 3C2WA 5F69A 3UB9A 1GSXA 1S1ZA 4HJ4A 5AVFA 3BY8A 2PR5A 2OOLA 2PD8A 2VV8A 4HIAA 4GS9B 3F1OA 3C8CA 2OWHA 4HP4A 2QJ5A 1S66L 2PD7A 2WKRA 3PYPA 2WKQA 4WLAA 1MZUA 3OLOA 1D06A 1DP9A 5F6AA 1OTBA 1OT9A 1WA9A 4MN6A 4HJ6A 1F98A 4L9EA 3F1PB 3H9WA 5HZHA 4I3IA 4L9FA 4LRYC 1G28A 5TBMB 4HI4A 3H82B 4NXGA 3MR0A 3T50A 4EEPA 2B02A 3A0SA 3HJKA 5J7EA 3NOUC 1XJ2A 3NHQA 1ODVA 3E4OA 3IS2B 4DJ3A 1S4SA 1P0ZA 4XT2A 1N9OA 3H7WA 1DP6A 4I5SA 5DJUA 3F1OB 2JN7A 1V9YA 1LT0A 2QKPA 4GHIA 1GSWA 4I3JA 2V0WA 1T1AA 4EXOA 1OT6A 4JGPA 5DJTA 4LRZE 5HWTA 4F3LA 1XJ3A 4LPZA 3GECA 1T18A 3UMEA 3FG8A 2QWSA 1BYWA 1TS0A 4PKYG 2GJ3A 3CAXA 3E4QA 3F1NA 3VE3A 1TS6A 4WF0A 4PKYA 3RH8B 1OTEA 1T19A 1XFQA 4EETB 2PDRA 1V9ZA 1LL8A 3UB8A 3D72A 3PHYA 3UB6A 2ZOIA 5G4ZA 2JHEA 3EEHA 3G6OA 4HHDA 3ICYA 2VV7A 3LI8A 2KDKA 3CWFA 2V9AA 1XJ6A 3LIAA 4MN5A 2D01A 4XT2B 4EESA 1VB6A 2EA9A 1D7EA 2BASA 3VE4A 3H7WB 2L1MA 4HP9A 3K3DA 5IS1A 2ZBBA 1S1YA 5EFWA 1N9LA 1F9IA 3KX0X 2VLGA 2PHYA 1LSVA 4GHIB 4DJ2A 1X0OA 4HOIA 4R70A 4WN5A 5HD5A 5DKLA 1DRMA 5G4YA
chains in the Genus database with same CATH superfamily
5CGWA 5HWVA 4F3LB 4HJ3A 4S2PA 3LGOA 3A0RA 5DFXA 1OPXA 4E3IA 2YKFA 5DF7A 1MWUA 3WS4A 4GD8A 4BD1A 4DE2A 2HV1A 4JXGA 4LRXC 4K0WA 2CMNA 4HQAA 1MWRA 3C5AA 3IWQA 3NJAA 2FFFB 3S7QA 4YNRA 2J9OA 3LCEA 3MJQA 5FEGA 5HSQA 1IELA 3HREA 1TS8A 2HGVA 5FEFA 3LIBA 3L7HA 4X53A 3K2NA 4P85A 1K57A 5GHXA 4MBKA 3A0VA 2Y2QA 3BFGA 4MNRA 1E3UD 3IH8A 3MXQA 3CI6A 4WZ5C 1CF0A 1T1CA 3V67A 2ZM0A 1KDWA 2LB5A 3CZDA 4E3LA 4O8GA 1LHYA 3WS2A 4H6JA 5HDCA 3DW0A 3MZDA 2P7JA 1PRQA 3E0YA 3VP1A 4PM5A 2Z6CA 4FCFA 5EM0A 4Y3IA 1AWIA 3CLOA 4QHCA 3OCNA 3LYXA 1XKZA 1MXOA 3BQ8A 3SW1A 5IHVA 5TR7A 4MN7A 4GB7A 3IXDA 2HJ9C 3K3CA 4IJGA 5HPFA 2EX6A 1S67L 3CJMA 5EVLA 3AGDA 3JVUA 1KGEA 4WELA 3A3JA 2WAEA 4U0XA 1PWDA 1S4RA 3JVVA 4QB8A 2YKHA 4ZTKA 3VP2A 4I3AA 1GA9A 2PR6A 5TGFA 3MF0A 1KGFA 4M3KA 1YSQA 4NXEA 2JKFA 2L4RA 4B9OA 2QJ7A 4P87A 4HH2A 3G4PA 3C4OA 3BRMA 5HDSA 3TOIA 4CJNA 2WGVA 4G3VA 1ACFA 2C6WB 2XA7S 4ZJ2A 1CI9A 1DY6A 4QU3A 2M1CA 3UPNA 1HTZA 3NDEA 2XDMA 4BJPA 1UWPX 2PYPA 1P97A 2ZQDA 3DTIA 2Z2LB 1KVMA 5L07A 2W27A 1W8QA 4Z1WA 1BUEA 2VEAA 1GCEA 1TDLA 1CEGA 4H8RA 4JGOA 4WMCD 3A3EA 2WGIA 3GMWA 3VP0A 1XJ4A 1H3QA 1SDNA 1EWZA 3S7PA 1OTIA 1UGUA 5CRFA 4NXFA 3D9YA 3G2YA 2EWWA 4EERA 3DWKA 4QY5A 3SOIA 3D3OA 3G30A 4EEUA 2J9PA 4ZRRA 3S22A 2ZQ8A 3A3IA 3WWXA 1JWZA 3LFVA 4BL3A 2EFUA 5AVEA 1S6RA 5HPIA 3MQQA 4KZBA 3UDIA 1SKFA 5EUAA 1KOUA 1PW1A 1XGJA 4Y15A 4DXBA 3FPVA 2XROA 1FR6A 2PRFA 3IHAA 4JGQA 3FKWA 4JPMA 2IWDA 2Y2HA 4R3JA 5F69A 2Y79A 1WYBA 1GSXA 2O0YA 5HX9A 4N1HA 3G2ZA 5E2HA 4JBFA 4Q8IA 2AVXA 3NULA 1BLPA 1NXYA 2OOLA 2Q9MA 2VV8A 2R9WA 2Y91A 4DXCA 4HP4A 5CECA 1W7FA 1F5MA 5GLCA 1MZUA 5M1AA 5EM1A 1MY8A 1FCOA 5F6AA 1K56A 4RA7A 3OCLA 4MN6A 3W2ZA 4DE0A 4F94A 4Q0HA 3E98A 2JE5A 2XQZA 4KZ8A 4GDNA 1W79A 4C75A 1CK3A 3CG5A 1G68A 2ZC4B 5DTKA 3GV9A 4E3MA 2XF3A 2Y2GA 3NOUC 3ZG7B 1XJ2A 3O86A 2G2WA 3IS2B 4OP8A 4FUWA 2X02A 3D4FA 1P0ZA 2B18A 3U4LP 3TW8A 4S2MA 2EX2A 2VA0A 2ZM2A 2Y4AA 3B42A 2IWBA 4PPRA 3WS0A 4OOLA 1IEMA 5CXWA 1E25A 1K4EA 1K6RA 4GOGA 4XXRA 2FH5A 3BECA 2PBYA 4XUXA 3EOIA 4Q0JA 4C6YA 1GSWA 4Y0TA 5BOHA 3BFEA 4MMNA 5MC7A 4NETA 4R3BA 5HL6A 1K0KA 2H0TA 2GNXA 4Y17A 2PAVP 3PTEA 1KE0A 5HWTA 4F3LA 2A3UA 4IVIA 2Z2MB 1PFLA 1XJ3A 3T4JA 4O0PA 3GECA 2XD5A 2P04A 3ZNYA 2W3EA 4N92A 3UE1A 3CAXA 4G3KA 1P9WA 3QHYA 1H8YA 1T19A 2JKTI 2ZQAA 2PDRA 3KYZA 4Y0UA 1LL8A 5FASA 3UB8A 3MKFA 2ZM8A 4HBUA 3PHYA 1U60A 4KG6A 5DFYA 5G4ZA 2JHEA 2PU2A 3G6OA 1FR1A 3LR5A 4YOFA 3ICYA 4PM9A 2KDKA 2G7UA 4MLLA 2HP9A 4IEDA 1OMEA 3BFCA 3T1RA 3NIAA 2XR0A 1ZHHB 2EA9A 1D7EA 2BASA 3Q07A 4X6TA 3OPPA 2HP5A 1M40A 3K3DA 4LV1A 1N9BA 3T1SA 3PBOA 3NY4A 3WRZA 4S2KA 3ZNTA 5EFWA 5M18A 1ES3A 1H5XA 4OOYA 5CGSA 4GHIB 2ZQ9A 5KZHA 4HOIA 4WN5A 3WS1A 2P08A 1QMEA 5DKLA 3UB5P 5G4YA 4BL2A 3E4PA 3P01A 5AJGA 3B33A 3BY9A 1BZAA 5A92A 4R6LA 1S0WA 2Y2IA 3DWZA 4ARZB 1FILA 4Y13A 1IKGA 3NOTC 3L9KA 3S7OA 1GSVA 3PBTA 4Z9QA 4EV4A 3R7WB 3TRCA 1TEMA 2ZC5B 4LLOB 3LICA 2VGJA 4OPQA 3HBRA 2H0YA 1JWVA 2VGLM 2I9VA 4ID4A 5L10A 3UY6A 3VOYA 3ZYTA 5KMWA 2A49A 3Q1FA 5F82A 3ZCZA 3LEQA 2Y2JA 4N1XA 1M6KA 1ERQA 2Z6DA 5FAPA 5FL3A 2W3FA 4PAUA 5EPHA 2WK0A 4LV3A 4M4XA 3PBNA 5EOOA 4EUZA 5HWWA 4B4XA 2Y2OA 1P9RA 4ME4A 4EU0A 3TE8A 1YLYA 3N8SA 1TS7A 4ZJ1A 1IYSA 4X1MA 1DP8A 1FCMA 2JCHA 4MDZA 5EVIC 4FD8A 2D02A 2QHKA 2J7VA 5CHUA 4BWIA 4Y7PA 4KZ5A 1MKIA 5IU1A 3CUEC 1N9NA 5IT5A 3CUEA 1ONHA 2A2LA 3LIEA 4B4ZA 4OPZA 1K4FA 3T1XA 4LFUA 1JWPA 4KQDA 4R38A 4WL9A 3LI9A 1GA0A 4R23A 1NZUA 1YLJA 4OLDA 4R3AA 2R9XA 2WUQA 4HESA 4EBLA 4ETXA 1LI0A 2K31A 2VGKA 3S7NA 3N8LA 5JYPA 2Y2KA 3QP4A 1QMFA 5HD3A 3VP4A 1K57C 5E2FA 2A24B 1ONGA 1ZG6A 2V1AA 4GW9A 4YWZA 1UWNX 5CTNA 2JKGA 4JF5A 3ZVWA 4IVKA 4QJGA 1T1BA 2FFYA 5FQQA 4WEJA 3HUNA 3IQAA 3MS6A 5FDHA 3ZG9B 2W1RA 1RGZA 4E3JA 4N9LA 3IS2A 3T4QA 5FSRA 4BBUA 5CGXA 5F5YA 1LI9A 1I2WA 3C2WA 1YAXA 1NRFA 3UB9A 1S1ZA 4RYEA 5K5BA 4K91A 2PR5A 1Y4OA 3TG9A 3BEBA 4HIAA 2UV0E 3C8CA 2QJ5A 1S66L 2PD7A 4WZ4A 3PAGA 5A91A 1BT5A 3OLOA 4IUKA 4P6ZS 1DP9A 1HD8A 3CHWP 1NYMA 2J3TD 5E2GA 4ZAMA 5CERA 4OP5A 1RCJA 3KSFA 2WKIA 1YPRA 3ZG5A 4B88A 5CTMA 3F1PB 2Y2PA 3PBQA 2E8IA 4Y2FA 5HZHA 5TBMB 4HI4A 3H82B 2H5SA 3MR0A 1WYCA 3RJUA 1NZOA 3RXWA 1IOUA 1ES2A 4CLCE 5A90A 3E4OA 2Y59A 2ZC3B 4DJ3A 1BTLA 5HFOA 1N4OA 2HJEA 2J8YA 2ZC6B 3VOZA 3B47A 4KZ9A 5J8XA 3M2KA 3VSKA 4KQOA 3SS5A 3LR4A 5FI7A 2J3WA 5M19A 2GZAA 4I5SA 3W4QA 3PAEA 3CITA 2HP6A 3IT9A 3PBSA 3F1OB 2RL3A 3RXXA 2QKPA 3O88A 4GHIA 1F2KA 1XGIA 2Q9NA 1Z6FA 2V0WA 3MFDA 3I7JA 4EXOA 1KE3A 4FOFA 2ZQ7A 3QNCA 2XFTA 4LPZA 2OLVA 3FG8A 3CPTB 4LGWA 2ZD8A 3E4QA 4ARZA 3DTEA 3UPPA 5FQKA 5C5KA 4KZ4A 1SDEA 4WF0A 4OLGA 1FOFA 4ETZA 3SS3A 3R7WA 1V9ZA 4MCWA 3UB6A 4HHDA 1BLSA 3BQAA 1IFQA 1YSPA 2VV7A 4NG2A 3IWOA 1PI5A 3PR6A 2HZ5A 3IX8A 4ZBEA 1MPLA 4MN5A 4XT2B 1Z09A 2JKTM 1LLBA 4EESA 2V2FF 2IA2A 3UE0A 4CLCB 3G31A 3S1YA 2I72A 3H7WB 2EXBA 4OQIA 3EGDC 5F83A 1G6AA 4HP9A 4II7A 1L3LA 2C5WB 3BFFA 2ACGA 4GZBA 2ZBBA 1E3UA 2HPBA 1S1YA 5DVAA 3T4KA 1G5UA 4RX3A 2KOIA 1IKIA 4AFIA 1LSVA 4DJ2A 1XX2A 3MXRA 1I5QA 4LV0A 1BSGA 4DN0A 1K54C 3LY4A 1DRMA 1NYYA 3OPRA 1KVLA 1Y28A 1K54A 2JBFA 4KQQA 4E6XA 3V3SA 1OJ5A 3MQOA 4QWOA 4BBVA 3C38A 3LIDA 3IX3A 4NXBA 4E3NA 3F1NB 5GHYA 1PZOA 1ALQA 3LIFA 1Y54A 1DJBA 3NI9A 2ZQCA 4BD0A 4G3WA 2INWA 3RTYA 1I2SA 3B3XA 2HDUA 1XFNA 2R78A 5DKKA 1KDSA 1A0KA 4KZ6A 1L0EA 1ES5A 4S2NC 5GL9A 1AXBA 5FI6A 5HARA 3HVFA 4S2NA 5DTTA 3SZTA 1JVJA 3W4OA 4OQHA 1NWZA 4JGRA 1RGYA 1SKOB 4OQGA 1YLPA 2Y2LA 3P7NA 2XK1A 3QNBA 3DAVA 4JXVA 3HJIA 4PM7A 1W8YA 4CLCD 3TJZC 2A24A 2V1BA 1OJGA 1PNEA 5GLDA 3C7UA 3HLFA 4MEZA 3RFBA 3ZG8B 2PU4A 4GKUA 3E2KA 3GSGA 1C3BA 3LUQA 4WMCA 1DJCA 5HAPA 4EBPA 1JTGA 2BLSA 2M7VA 5E43A 3M6HA 4UQIS 2EFXA 4GCZA 2KX6A 4EWFA 2O9CA 1O7EA 2K7SA 1O07A 4KUKA 2K2NA 1W63Q 1LSXA 1FIKA 3SH8A 1PW8A 4IHQA 4HNBA 1OTAA 4UEYA 3BJNA 3AGFA 1WE4A 5HL1A 2HDQA 3MBZA 3N6IA 2VV6A 2E8JA 1LSWA 2XGNA 2XA7M 4WBGA 3P09A 3A3FA 4EW7A 3ULFA 4X25A 5F1FA 3N7WA 4A5RA 3EWKA 1H8ZA 1Q2PA 4JXWA 5FATA 3T1QB 1L2SA 3HL9A 1L0GA 1NLYA 3UNWA 4JKTA 5FQMA 2V0UA 5AQBA 5F68A 5CEDA 3F1PA 3N8RA 4I38A 3ZQ5A 1VM1A 2Y2MA 4GD6A 5TBMA 2B5RA 3H82A 3BWLA 1BLHA 2H28A 3EQUA 4EQ1A 3EEAA 4R4RA 2EX9A 3VOLA 5FQIA 3HLGA 3ITBA 1FSYA 2GX5A 1DJAA 2HDRA 4DMZA 3GDIA 2WZZA 3NOPC 1XA1A 3UE6A 4LV2A 4GN2A 3BLSA 5LBRA 4EUVA 1VEUB 2ZC7A 3P98A 2OV5A 5D3OA 4HJ4A 5AVFA 5CX7A 2PD8A 5L09A 3IX4A 4GS9B 2OAQ1 3F1OA 5JYOA 2ZJ9A 5CHMA 2W1TB 4WLAA 2PBDP 4R1GA 4Q0IA 2KLIA 2QMIA 1GHMA 2ZMAA 1PWCA 4YFMA 4NEED 5KSHA 5L2FA 4IBRA 1OTBA 1OT9A 1WA9A 1MKMA 4HJ6A 5EECA 1MWSA 3KYQA 4S2JA 3KSGA 1F98A 3CPTA 3GQZA 4L9EA 4GJ4A 3MXSA 3BM6A 3H9WA 4YINA 4I3IA 4L9FA 4LRYC 3U2AA 1G28A 4X68A 3MKEA 1ZG4A 4NXGA 3ZFZA 3T50A 5AQAA 4EEPA 2B02A 3A0SA 5AQ9A 4JF6A 3HLDA 2XRNA 3QP1A 4DDYA 2DRWA 2ZMVA 4N9KA 3OZHA 2XD1A 4QD4A 4X69A 1ODVA 1JTDA 5EE8A 2CC1A 3QP2A 1J9MA 4EBNA 5GLAA 3KYEA 5CEBA 3FKVA 4OPRA 3NCKA 3FPWA 4CLCC 4XT2A 3O87A 5DF8A 4PM6A 1VETB 4CLCA 1N9OA 3IWIA 3H7WA 3OOVA 3HUOA 2DNSA 3VSLA 1DP6A 4R4SA 3WRTA 1TF1A 4NK3A 3A3DA 4PMAA 5DJUA 1ESUA 1K56D 1V9YA 2JN7A 1PWGA 1PYYA 4KENB 4UA9A 3VFFA 1L0FA 2ZLYA 3VFHA 4DKIA 4R0QA 4OH0A 3C4PA 4JGPA 3Q7VB 4GNUA 2PT7A 3WS5A 4D60A 1T18A 3IXBA 3O5YA 3JPUA 2JKRI 4KG2A 4WZ5A 3F1NA 3VE3A 1NJ4A 4S2LA 5HAQA 3IF6B 4UAAA 3RH8B 1XFQA 4K0XA 4BQMA 2M7UA 4EETB 4IUHA 4RX2A 1W63M 3GRJA 3OPLA 3T4TA 2ZOIA 3EEHA 5A93A 3IXHA 5FDSA 1SCWA 3LI8A 2V9AA 4XUZA 4UQIM 4Y0OA 1XJ6A 3LEZA 2H10A 5U47A 1ZC2A 4MBHA 4DRTA 1XXMA 2VZWA 1SKOA 5EVEA 1TDGA 4BLMA 2P9VB 2L1MA 5L8MA 3LO7A 2O9BA 1EI5A 1CI8A 1N9LA 3IHBA 3KX0X 2PHYA 3VP3A 2O99A 1YT4A 2V20A 1IYQA 5HD5A 4QY6A 3PBRA 3UDFA 1VHMA 5GLBA 4FTXA 4UHUA 4O01A 3BFDA 1LL5A 5TJJA 4HBTA 4FH4A 1YLZA 2ZL1B 3DTMA 4WUJA 3ISGA 3HCYA 3UMDA 4Y5FA 3HUMA 3V39A 2VJWA 3UO9A 1KGGA 3FZCA 1CEFA 3FC7A 4B93A 3OBFA 3NC8A 2WGWB 4RVAA 2EX8A 1ZKJA 2W0NA 3UE3A 3M6BA 1SHVA 1FSWA 5J3WA 3SS4A 4I39A 4JF4A 4OONA 1YM1A 1BLCA 1OTDA 2DMWA 4KZAA 2OWJA 2W3DA 3MSHA 4FH2A 2WYXA 4O7DA 4KZ3A 3HLCA 2VGLS 5EVIB 2G2UA 5KIZA 2ZOHA 4EQIA 3LR3A 1MWTA 2EWVA 2W3GA 2Y2NA 3SH9A 5I5LA 3VMAA 1HVBA 4BBTA 2VK3A 3IBRA 4RQ9A 2BG1A 1YLWA 2J80A 2Q0OA 1IYOA 5FA7A 2PYRA 3UDXA 1K38A 2XH9A 3OPHA 3VV4A 4KQRA 3IH9A 4JLFA 3EQVA 3BLMA 3G35A 3NBLA 2ZMFA 4X55A 5A8BA 1ESIA 1K6SA 4L9GA 4IBXA 1H8MA 3ZVTA 3GR2A 4HEFA 5DTSA 3FYZA 1BULA 3Q82A 4S2IA 4D2OA 3EGXC 5G18A 1EW0A 2HF6A 1PZPA 1E4DA 1TD5A 1FCNA 2WZXA 1FQGA 3GVBA 4OVDA 2VX8A 1PIOA 4JXSA 4KUOA 4X56A 5DF9A 1VEUA 2X01A 1Q2QA 4NKPA 1D1JA 3AGEA 5FAOA 3MFXA 2VKSA 1CJFA 2P74A 2OSUA 4E04A 4GS9A 1H0MA 3IF5A 4E6WA 4HH3A 3V50A 4P6BA 4WEKA 3S4XA 2W1TA 2UWXA 2WKEA 1G6OA 2L0WA 4K08A 3GTCA 2XSSA 3M2JA 3DBAA 4C3QA 4LCMA 4H6JB 5GHZA 3KSIA 4HY8A 1MC0A 3UN7A 3V5MA 2V1ZA 3C7VA 4KZ7A 5EVID 4MBFA 2J3TC 2V8CA 3MQ0A 3MMHA 1LL9A 1KE4A 3ZG0A 4ZJ3A 4LCLA 5HDDA 4OOMA 3IBJA 2OAP1 1K55C 5J4EA 1JNUA 1K55A 2WKPA 1PI4A 1RP5A 1HZOA 1XA7A 5HW3A 3T12B 4BMWA 3SH7A 2RCXA 5KSCA 4L0LA 4LENA 2XEPA 3UB7A 3E2LA 3V3RA 1VETA 4UA7A 3HLBA 5EV0A 2V8FA 3BY8A 5I94A 4UA6A 2OWHA 1K25A 3LR0A 3NECA 2WKRA 3PYPA 2WADA 5CHJA 2WKQA 4P6ZM 3NDGA 4KG5A 5F1GA 2B95A 1D06A 4U3TA 3QP5A 3MZFA 5TFQA 3Q7VA 5E2EA 2JC7A 3QP8A 3ZDJA 2X71A 4WM9A 3FV7A 3TSGA 3T4OA 3Q81A 5FAQA 2NUPC 1STZA 2OLUA 3IF6C 4DDSA 3C30A 2LB9A 3IF6A 3KSHA 4P0MA 4E3OA 2EXAA 3HJKA 5J7EA 4BENA 3ZGAB 4ZDXA 3NHQA 4OQ0A 1YMSA 2QYBA 3UPOA 1S4SA 1ERMA 3T4SA 1GHPA 3N4IA 2W3HA 4GDBA 4FSFA 3KO6A 3PXPA 3R4KA 2MJ6A 2P9VA 3ZHHA 4X1LA 1NLZA 1TVFA 5HAIA 4PHTA 2XLNA 1GHIA 1LT0A 1XPBA 1W5DA 3BYDA 4I3JA 2QPNA 5FI2A 3HLWA 2WKHA 4E3KA 3OC2A 3DTKA 4ESPA 1T1AA 1OT6A 4OPYA 4WYYA 4S2OA 5DJTA 4DE3A 4LRZE 2NUTC 1CQAA 2IWCA 2ZL1A 1L0DA 2DCFA 1YLTA 3UMEA 2XFSA 2QWSA 2GDNA 1BYWA 2WAFA 3HLEA 2O9AA 1TS0A 3W8KA 4PKYG 2GJ3A 3W4PA 3O3VA 1TS6A 1NRJA 1EROA 4GLQA 3Q7ZA 4PKYA 1OTEA 2Y8HA 3LY3A 2HDSA 1NY0A 2WGWA 3G32A 1YKDA 3IXGA 4U0TA 5EOEA 3D72A 3MZEA 1ZTUA 2JKRM 2BTFP 3JYIA 4QPRA 3CWFA 1IYPA 5EVIA 5FQJA 3LIAA 2D01A 1J3WA 3FWLA 1VQQA 1MBLA 1VB6A 4DF6A 1YQSA 2FZ0A 3VE4A 4PM8A 3G34A 3ITAA 4CPKA 4OKPA 5IS1A 5FQ9A 3BW6A 5AQ7A 2Y55A 1SZVA 1F9IA 3CMZA 2VLGA 3QP6A 1XP4A 2QZ6A 1X0OA 4CQHA 1HLUP 4R70A 3T4LA 1ES4A 1YMXA 4DE1A
chains in the Genus database with same CATH topology
1Y28A 5TJJA 3E4PA 5HWVA 3P01A 5AJGA 4F3LB 4HJ3A 3B33A 3BY9A 3A0RA 4WUJA 3HCYA 3UMDA 5DFXA 1OPXA 4Y5FA 2YKFA 1OJ5A 3MQOA 4R6LA 2VJWA 4BBVA 3C38A 3LIDA 2HV1A 4NXBA 3F1NB 4ARZB 4LRXC 2CMNA 4HQAA 3LIFA 3NOTC 3FC7A 4B93A 3NJAA 3S7OA 3S7QA 4YNRA 1GSVA 3PBTA 3OBFA 3R7WB 3TRCA 4G3WA 2INWA 2W0NA 3RTYA 3UE3A 5J3WA 3MJQA 4LLOB 3LICA 5HSQA 1TS8A 2HGVA 3LIBA 4I39A 3K2NA 2DMWA 1OTDA 2OWJA 2VGLM 1XFNA 2I9VA 2W3DA 2R78A 5DKKA 3A0VA 3ZYTA 2VGLS 5KIZA 2ZOHA 3MXQA 3CI6A 3LR3A 1T1CA 2EWVA 3V67A 2Z6DA 2LB5A 2W3GA 5FL3A 1NWZA 4JGRA 5I5LA 4O8GA 2W3FA 4PAUA 4BBTA 4H6JA 5HDCA 4M4XA 3IBRA 2P7JA 3E0YA 3PBNA 4RQ9A 3P7NA 5HWWA 2J80A 3HJIA 2Z6CA 4Y3IA 1P9RA 3CLOA 4ME4A 4EU0A 3TE8A 3OCNA 4CLCD 3TJZC 2A24A 1TS7A 2V1BA 1OJGA 2PYRA 3LYXA 1DP8A 4MDZA 3RFBA 2D02A 3BQ8A 2QHKA 3VV4A 3SW1A 3LUQA 4MN7A 3EQVA 5A8BA 2ZMFA 2HJ9C 3K3CA 2M7VA 4BWIA 4IJGA 4L9GA 4UQIS 1H8MA 4GCZA 2KX6A 5HPFA 5IU1A 2O9CA 3CUEC 3EGXC 1S67L 1EW0A 1N9NA 2K7SA 2HF6A 5IT5A 1TD5A 3CUEA 4KUKA 3JVUA 2K2NA 1W63Q 2A2LA 4WELA 3LIEA 2VX8A 1LSXA 4KUOA 5DF9A 1S4RA 3JVVA 4IHQA 2YKHA 4HNBA 1OTAA 4I3AA 2PR6A 4UEYA 3MF0A 4NKPA 1YSQA 4NXEA 3BJNA 4KQDA 3MFXA 2VKSA 4R38A 4WL9A 3LI9A 2L4RA 4E04A 2VV6A 4GS9A 4B9OA 1LSWA 2QJ7A 2XA7M 4HH2A 4R3AA 5HDSA 4HH3A 4G3VA 4EW7A 2XA7S 3ULFA 4WEKA 2W1TA 1G6OA 2M1CA 2L0WA 4K08A 4BJPA 2XSSA 1UWPX 2PYPA 3EWKA 1P97A 4ETXA 2K31A 3DBAA 2W27A 4H6JB 3S7NA 3KSIA 4HY8A 4Z1WA 2VEAA 1NLYA 1MC0A 4JGOA 2V0UA 5F68A 3F1PA 2J3TC 5HD3A 3MQ0A 3MMHA 1XJ4A 4I38A 3ZQ5A 1H3QA 3S7PA 2A24B 5TBMA 1OTIA 1UGUA 3H82A 4NXFA 2V1AA 5HDDA 3BWLA 2EWWA 3IBJA 4GW9A 4OOMA 4EERA 2OAP1 2H28A 3EQUA 4YWZA 4EQ1A 1UWNX 3EEAA 3D3OA 4EEUA 4ZRRA 5J4EA 3LFVA 1JNUA 2WKPA 1T1BA 4WEJA 3VOLA 5AVEA 5HPIA 3MQQA 2W1RA 1KOUA 2GX5A 3FPVA 4DMZA 3GDIA 3IS2A 2XROA 4JGQA 4BMWA 3T4QA 4L0LA 4BBUA 3NOPC 3UB7A 3UE6A 5F5YA 3C2WA 1YAXA 5F69A 3UB9A 2Y79A 1GSXA 1S1ZA 5LBRA 4EUVA 2O0YA 5K5BA 4HJ4A 5AVFA 3BY8A 2PR5A 5CX7A 2OOLA 2PD8A 2VV8A 4HIAA 4GS9B 2OAQ1 3F1OA 3C8CA 2OWHA 4HP4A 2QJ5A 3LR0A 1S66L 2PD7A 2WKRA 3PYPA 2WKQA 4P6ZM 1F5MA 2W1TB 4WLAA 1MZUA 4Q0IA 2KLIA 3OLOA 1D06A 4IUKA 4P6ZS 1DP9A 4NEED 5F6AA 2J3TD 5KSHA 1OTBA 3KSFA 1OT9A 1WA9A 3OCLA 1MKMA 4MN6A 4HJ6A 3W2ZA 3KYQA 3T4OA 3KSGA 1F98A 4Q0HA 3E98A 4L9EA 2NUPC 1STZA 4GJ4A 3F1PB 3PBQA 3H9WA 4Y2FA 3C30A 2LB9A 5HZHA 4I3IA 4L9FA 4LRYC 3U2AA 1G28A 3KSHA 4HI4A 5TBMB 3H82B 4NXGA 3MR0A 3T50A 4EEPA 2B02A 3A0SA 3HJKA 2XRNA 5J7EA 1IOUA 2ZMVA 3NOUC 1XJ2A 3NHQA 4CLCE 1ODVA 3E4OA 2QYBA 3IS2B 4DJ3A 1S4SA 1P0ZA 2B18A 3T4SA 3TW8A 2HJEA 2W3HA 3FPWA 4CLCC 3B47A 4XT2A 2VA0A 4CLCA 1N9OA 4FSFA 3H7WA 3KO6A 3OOVA 4KQOA 3B42A 3LR4A 3PXPA 3R4KA 2MJ6A 2J3WA 1DP6A 4OOLA 2GZAA 1NLZA 4I5SA 1TF1A 3CITA 5DJUA 3PBSA 2FH5A 3F1OB 4PHTA 2JN7A 1V9YA 3EOIA 1LT0A 4Q0JA 2QKPA 4GHIA 1GSWA 4I3JA 4MMNA 5MC7A 3OC2A 2V0WA 5HL6A 1T1AA 4EXOA 1OT6A 4JGPA 2GNXA 5DJTA 4FOFA 2PT7A 4LRZE 2NUTC 5HWTA 4F3LA 1XJ3A 3T4JA 4LPZA 4O0PA 3GECA 1T18A 3UMEA 3FG8A 2QWSA 3O5YA 2P04A 1BYWA 2O9AA 2W3EA 2JKRI 1TS0A 4PKYG 2GJ3A 3CAXA 3E4QA 4G3KA 3F1NA 4ARZA 1P9WA 3VE3A 1TS6A 1NRJA 5C5KA 4WF0A 4GLQA 4PKYA 3RH8B 4ETZA 1OTEA 1T19A 1XFQA 2JKTI 2Y8HA 2M7UA 4EETB 4IUHA 3R7WA 1W63M 2PDRA 1YKDA 1V9ZA 3KYZA 1LL8A 4MCWA 3UB8A 3D72A 3T4TA 1ZTUA 3PHYA 3UB6A 2ZOIA 5DFYA 5G4ZA 2JHEA 3EEHA 2JKRM 3G6OA 4HHDA 3LR5A 3BQAA 1IFQA 1YSPA 3ICYA 2VV7A 4YOFA 3LI8A 2KDKA 3CWFA 2V9AA 4QPRA 2G7UA 4UQIM 1XJ6A 3LIAA 3PR6A 4MN5A 2D01A 4XT2B 2JKTM 4EESA 1VB6A 2FZ0A 2IA2A 1ZHHB 4CLCB 2EA9A 1D7EA 2BASA 3VE4A 3H7WB 2VZWA 3EGDC 2L1MA 5L8MA 4HP9A 3K3DA 5IS1A 4II7A 3BW6A 3PBOA 2O9BA 2ZBBA 1S1YA 3T4KA 5EFWA 1N9LA 1F9IA 3KX0X 2VLGA 2KOIA 4AFIA 2PHYA 2O99A 1LSVA 4GHIB 4DJ2A 1X0OA 4HOIA 4CQHA 4R70A 3T4LA 4WN5A 5HD5A 3PBRA 2P08A 4DN0A 5DKLA 1DRMA 1VHMA 5G4YA 4O01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y28 A;  3E4P A;  5HWV A;  4F3L B;  4HJ3 A;  3B33 A;  3BY9 A;  3A0R A;  4WUJ A;  3UMD A;  2YKF A;  1OJ5 A;  3MQO A;  4R6L A;  4BBV A;  3LID A;  2HV1 A;  4NXB A;  3F1N B;  4LRX C;  2CMN A;  4HQA A;  3LIF A;  3NOT C;  3FC7 A;  3NJA A;  1GSV A;  2INW A;  2W0N A;  3RTY A;  5J3W A;  3MJQ A;  4LLO B;  3LIC A;  5HSQ A;  1TS8 A;  3LIB A;  4I39 A;  1OTD A;  2OWJ A;  1XFN A;  2I9V A;  2R78 A;  5DKK A;  3A0V A;  5KIZ A;  2ZOH A;  3MXQ A;  1T1C A;  2Z6D A;  1NWZ A;  4JGR A;  5I5L A;  4BBT A;  4H6J A;  5HDC A;  4M4X A;  3IBR A;  2P7J A;  4RQ9 A;  3P7N A;  5HWW A;  2J80 A;  2Z6C A;  3HJI A;  3CLO A;  2A24 A;  1TS7 A;  2V1B A;  1OJG A;  2PYR A;  3LYX A;  1DP8 A;  2D02 A;  2QHK A;  3SW1 A;  3LUQ A;  5A8B A;  3K3C A;  4L9G A;  4GCZ A;  2KX6 A;  5IU1 A;  1S67 L;  1EW0 A;  1N9N A;  2K7S A;  4KUK A;  3LIE A;  1LSX A;  4KUO A;  1S4R A;  2YKH A;  4HNB A;  1OTA A;  4I3A A;  2PR6 A;  4NXE A;  4KQD A;  3MFX A;  4R38 A;  4WL9 A;  3LI9 A;  2L4R A;  4E04 A;  2VV6 A;  4GS9 A;  4B9O A;  1LSW A;  2QJ7 A;  4HH2 A;  4R3A A;  5HDS A;  4HH3 A;  4EW7 A;  3ULF A;  2M1C A;  2L0W A;  4K08 A;  1UWP X;  2PYP A;  3EWK A;  1P97 A;  2W27 A;  4H6J B;  4HY8 A;  2VEA A;  4JGO A;  2V0U A;  5F68 A;  3F1P A;  5HD3 A;  1XJ4 A;  4I38 A;  3ZQ5 A;  2A24 B;  5TBM A;  1OTI A;  1UGU A;  3H82 A;  4NXF A;  2V1A A;  5HDD A;  3BWL A;  4GW9 A;  4EER A;  2H28 A;  4YWZ A;  4EQ1 A;  1UWN X;  4EEU A;  5J4E A;  1JNU A;  2WKP A;  1T1B A;  3VOL A;  5AVE A;  3MQQ A;  1KOU A;  3GDI A;  3IS2 A;  4JGQ A;  4BBU A;  3NOP C;  3UB7 A;  3UE6 A;  5F5Y A;  3C2W A;  5F69 A;  3UB9 A;  1GSX A;  1S1Z A;  4HJ4 A;  5AVF A;  3BY8 A;  2PR5 A;  2OOL A;  2PD8 A;  2VV8 A;  4HIA A;  4GS9 B;  3F1O A;  3C8C A;  2OWH A;  4HP4 A;  2QJ5 A;  1S66 L;  2PD7 A;  2WKR A;  3PYP A;  2WKQ A;  4WLA A;  1MZU A;  3OLO A;  1D06 A;  1DP9 A;  5F6A A;  1OTB A;  1OT9 A;  1WA9 A;  4MN6 A;  4HJ6 A;  1F98 A;  4L9E A;  3F1P B;  3H9W A;  5HZH A;  4I3I A;  4L9F A;  4LRY C;  1G28 A;  5TBM B;  4HI4 A;  3H82 B;  4NXG A;  3MR0 A;  3T50 A;  4EEP A;  2B02 A;  3A0S A;  3HJK A;  5J7E A;  3NOU C;  1XJ2 A;  3NHQ A;  1ODV A;  3E4O A;  3IS2 B;  4DJ3 A;  1S4S A;  1P0Z A;  4XT2 A;  1N9O A;  3H7W A;  1DP6 A;  4I5S A;  5DJU A;  3F1O B;  2JN7 A;  1V9Y A;  1LT0 A;  2QKP A;  4GHI A;  1GSW A;  4I3J A;  2V0W A;  1T1A A;  4EXO A;  1OT6 A;  4JGP A;  5DJT A;  4LRZ E;  5HWT A;  4F3L A;  1XJ3 A;  4LPZ A;  3GEC A;  1T18 A;  3UME A;  3FG8 A;  2QWS A;  1BYW A;  1TS0 A;  4PKY G;  2GJ3 A;  3CAX A;  3E4Q A;  3F1N A;  3VE3 A;  1TS6 A;  4WF0 A;  4PKY A;  3RH8 B;  1OTE A;  1T19 A;  1XFQ A;  4EET B;  2PDR A;  1V9Z A;  1LL8 A;  3UB8 A;  3D72 A;  3PHY A;  3UB6 A;  2ZOI A;  5G4Z A;  2JHE A;  3EEH A;  3G6O A;  4HHD A;  3ICY A;  2VV7 A;  3LI8 A;  2KDK A;  3CWF A;  2V9A A;  1XJ6 A;  3LIA A;  4MN5 A;  2D01 A;  4XT2 B;  4EES A;  1VB6 A;  2EA9 A;  1D7E A;  2BAS A;  3VE4 A;  3H7W B;  2L1M A;  4HP9 A;  3K3D A;  5IS1 A;  2ZBB A;  1S1Y A;  5EFW A;  1N9L A;  1F9I A;  3KX0 X;  2VLG A;  2PHY A;  1LSV A;  4GHI B;  4DJ2 A;  1X0O A;  4HOI A;  4R70 A;  4WN5 A;  5HD5 A;  5DKL A;  1DRM A;  5G4Y A; 
#chains in the Genus database with same CATH topology
 5CGW A;  5HWV A;  4F3L B;  4HJ3 A;  4S2P A;  3LGO A;  3A0R A;  5DFX A;  1OPX A;  4E3I A;  2YKF A;  5DF7 A;  1MWU A;  3WS4 A;  4GD8 A;  4BD1 A;  4DE2 A;  2HV1 A;  4JXG A;  4LRX C;  4K0W A;  2CMN A;  4HQA A;  1MWR A;  3C5A A;  3IWQ A;  3NJA A;  2FFF B;  3S7Q A;  4YNR A;  2J9O A;  3LCE A;  3MJQ A;  5FEG A;  5HSQ A;  1IEL A;  3HRE A;  1TS8 A;  2HGV A;  5FEF A;  3LIB A;  3L7H A;  4X53 A;  3K2N A;  4P85 A;  1K57 A;  5GHX A;  4MBK A;  3A0V A;  2Y2Q A;  3BFG A;  4MNR A;  1E3U D;  3IH8 A;  3MXQ A;  3CI6 A;  4WZ5 C;  1CF0 A;  1T1C A;  3V67 A;  2ZM0 A;  1KDW A;  2LB5 A;  3CZD A;  4E3L A;  4O8G A;  1LHY A;  3WS2 A;  4H6J A;  5HDC A;  3DW0 A;  3MZD A;  2P7J A;  1PRQ A;  3E0Y A;  3VP1 A;  4PM5 A;  2Z6C A;  4FCF A;  5EM0 A;  4Y3I A;  1AWI A;  3CLO A;  4QHC A;  3OCN A;  3LYX A;  1XKZ A;  1MXO A;  3BQ8 A;  3SW1 A;  5IHV A;  5TR7 A;  4MN7 A;  4GB7 A;  3IXD A;  2HJ9 C;  3K3C A;  4IJG A;  5HPF A;  2EX6 A;  1S67 L;  3CJM A;  5EVL A;  3AGD A;  3JVU A;  1KGE A;  4WEL A;  3A3J A;  2WAE A;  4U0X A;  1PWD A;  1S4R A;  3JVV A;  4QB8 A;  2YKH A;  4ZTK A;  3VP2 A;  4I3A A;  1GA9 A;  2PR6 A;  5TGF A;  3MF0 A;  1KGF A;  4M3K A;  1YSQ A;  4NXE A;  2JKF A;  2L4R A;  4B9O A;  2QJ7 A;  4P87 A;  4HH2 A;  3G4P A;  3C4O A;  3BRM A;  5HDS A;  3TOI A;  4CJN A;  2WGV A;  4G3V A;  1ACF A;  2C6W B;  2XA7 S;  4ZJ2 A;  1CI9 A;  1DY6 A;  4QU3 A;  2M1C A;  3UPN A;  1HTZ A;  3NDE A;  2XDM A;  4BJP A;  1UWP X;  2PYP A;  1P97 A;  2ZQD A;  3DTI A;  2Z2L B;  1KVM A;  5L07 A;  2W27 A;  1W8Q A;  4Z1W A;  1BUE A;  2VEA A;  1GCE A;  1TDL A;  1CEG A;  4H8R A;  4JGO A;  4WMC D;  3A3E A;  2WGI A;  3GMW A;  3VP0 A;  1XJ4 A;  1H3Q A;  1SDN A;  1EWZ A;  3S7P A;  1OTI A;  1UGU A;  5CRF A;  4NXF A;  3D9Y A;  3G2Y A;  2EWW A;  4EER A;  3DWK A;  4QY5 A;  3SOI A;  3D3O A;  3G30 A;  4EEU A;  2J9P A;  4ZRR A;  3S22 A;  2ZQ8 A;  3A3I A;  3WWX A;  1JWZ A;  3LFV A;  4BL3 A;  2EFU A;  5AVE A;  1S6R A;  5HPI A;  3MQQ A;  4KZB A;  3UDI A;  1SKF A;  5EUA A;  1KOU A;  1PW1 A;  1XGJ A;  4Y15 A;  4DXB A;  3FPV A;  2XRO A;  1FR6 A;  2PRF A;  3IHA A;  4JGQ A;  3FKW A;  4JPM A;  2IWD A;  2Y2H A;  4R3J A;  5F69 A;  2Y79 A;  1WYB A;  1GSX A;  2O0Y A;  5HX9 A;  4N1H A;  3G2Z A;  5E2H A;  4JBF A;  4Q8I A;  2AVX A;  3NUL A;  1BLP A;  1NXY A;  2OOL A;  2Q9M A;  2VV8 A;  2R9W A;  2Y91 A;  4DXC A;  4HP4 A;  5CEC A;  1W7F A;  1F5M A;  5GLC A;  1MZU A;  5M1A A;  5EM1 A;  1MY8 A;  1FCO A;  5F6A A;  1K56 A;  4RA7 A;  3OCL A;  4MN6 A;  3W2Z A;  4DE0 A;  4F94 A;  4Q0H A;  3E98 A;  2JE5 A;  2XQZ A;  4KZ8 A;  4GDN A;  1W79 A;  4C75 A;  1CK3 A;  3CG5 A;  1G68 A;  2ZC4 B;  5DTK A;  3GV9 A;  4E3M A;  2XF3 A;  2Y2G A;  3NOU C;  3ZG7 B;  1XJ2 A;  3O86 A;  2G2W A;  3IS2 B;  4OP8 A;  4FUW A;  2X02 A;  3D4F A;  1P0Z A;  2B18 A;  3U4L P;  3TW8 A;  4S2M A;  2EX2 A;  2VA0 A;  2ZM2 A;  2Y4A A;  3B42 A;  2IWB A;  4PPR A;  3WS0 A;  4OOL A;  1IEM A;  5CXW A;  1E25 A;  1K4E A;  1K6R A;  4GOG A;  4XXR A;  2FH5 A;  3BEC A;  2PBY A;  4XUX A;  3EOI A;  4Q0J A;  4C6Y A;  1GSW A;  4Y0T A;  5BOH A;  3BFE A;  4MMN A;  5MC7 A;  4NET A;  4R3B A;  5HL6 A;  1K0K A;  2H0T A;  2GNX A;  4Y17 A;  2PAV P;  3PTE A;  1KE0 A;  5HWT A;  4F3L A;  2A3U A;  4IVI A;  2Z2M B;  1PFL A;  1XJ3 A;  3T4J A;  4O0P A;  3GEC A;  2XD5 A;  2P04 A;  3ZNY A;  2W3E A;  4N92 A;  3UE1 A;  3CAX A;  4G3K A;  1P9W A;  3QHY A;  1H8Y A;  1T19 A;  2JKT I;  2ZQA A;  2PDR A;  3KYZ A;  4Y0U A;  1LL8 A;  5FAS A;  3UB8 A;  3MKF A;  2ZM8 A;  4HBU A;  3PHY A;  1U60 A;  4KG6 A;  5DFY A;  5G4Z A;  2JHE A;  2PU2 A;  3G6O A;  1FR1 A;  3LR5 A;  4YOF A;  3ICY A;  4PM9 A;  2KDK A;  2G7U A;  4MLL A;  2HP9 A;  4IED A;  1OME A;  3BFC A;  3T1R A;  3NIA A;  2XR0 A;  1ZHH B;  2EA9 A;  1D7E A;  2BAS A;  3Q07 A;  4X6T A;  3OPP A;  2HP5 A;  1M40 A;  3K3D A;  4LV1 A;  1N9B A;  3T1S A;  3PBO A;  3NY4 A;  3WRZ A;  4S2K A;  3ZNT A;  5EFW A;  5M18 A;  1ES3 A;  1H5X A;  4OOY A;  5CGS A;  4GHI B;  2ZQ9 A;  5KZH A;  4HOI A;  4WN5 A;  3WS1 A;  2P08 A;  1QME A;  5DKL A;  3UB5 P;  5G4Y A;  4BL2 A;  3E4P A;  3P01 A;  5AJG A;  3B33 A;  3BY9 A;  1BZA A;  5A92 A;  4R6L A;  1S0W A;  2Y2I A;  3DWZ A;  4ARZ B;  1FIL A;  4Y13 A;  1IKG A;  3NOT C;  3L9K A;  3S7O A;  1GSV A;  3PBT A;  4Z9Q A;  4EV4 A;  3R7W B;  3TRC A;  1TEM A;  2ZC5 B;  4LLO B;  3LIC A;  2VGJ A;  4OPQ A;  3HBR A;  2H0Y A;  1JWV A;  2VGL M;  2I9V A;  4ID4 A;  5L10 A;  3UY6 A;  3VOY A;  3ZYT A;  5KMW A;  2A49 A;  3Q1F A;  5F82 A;  3ZCZ A;  3LEQ A;  2Y2J A;  4N1X A;  1M6K A;  1ERQ A;  2Z6D A;  5FAP A;  5FL3 A;  2W3F A;  4PAU A;  5EPH A;  2WK0 A;  4LV3 A;  4M4X A;  3PBN A;  5EOO A;  4EUZ A;  5HWW A;  4B4X A;  2Y2O A;  1P9R A;  4ME4 A;  4EU0 A;  3TE8 A;  1YLY A;  3N8S A;  1TS7 A;  4ZJ1 A;  1IYS A;  4X1M A;  1DP8 A;  1FCM A;  2JCH A;  4MDZ A;  5EVI C;  4FD8 A;  2D02 A;  2QHK A;  2J7V A;  5CHU A;  4BWI A;  4Y7P A;  4KZ5 A;  1MKI A;  5IU1 A;  3CUE C;  1N9N A;  5IT5 A;  3CUE A;  1ONH A;  2A2L A;  3LIE A;  4B4Z A;  4OPZ A;  1K4F A;  3T1X A;  4LFU A;  1JWP A;  4KQD A;  4R38 A;  4WL9 A;  3LI9 A;  1GA0 A;  4R23 A;  1NZU A;  1YLJ A;  4OLD A;  4R3A A;  2R9X A;  2WUQ A;  4HES A;  4EBL A;  4ETX A;  1LI0 A;  2K31 A;  2VGK A;  3S7N A;  3N8L A;  5JYP A;  2Y2K A;  3QP4 A;  1QMF A;  5HD3 A;  3VP4 A;  1K57 C;  5E2F A;  2A24 B;  1ONG A;  1ZG6 A;  2V1A A;  4GW9 A;  4YWZ A;  1UWN X;  5CTN A;  2JKG A;  4JF5 A;  3ZVW A;  4IVK A;  4QJG A;  1T1B A;  2FFY A;  5FQQ A;  4WEJ A;  3HUN A;  3IQA A;  3MS6 A;  5FDH A;  3ZG9 B;  2W1R A;  1RGZ A;  4E3J A;  4N9L A;  3IS2 A;  3T4Q A;  5FSR A;  4BBU A;  5CGX A;  5F5Y A;  1LI9 A;  1I2W A;  3C2W A;  1YAX A;  1NRF A;  3UB9 A;  1S1Z A;  4RYE A;  5K5B A;  4K91 A;  2PR5 A;  1Y4O A;  3TG9 A;  3BEB A;  4HIA A;  2UV0 E;  3C8C A;  2QJ5 A;  1S66 L;  2PD7 A;  4WZ4 A;  3PAG A;  5A91 A;  1BT5 A;  3OLO A;  4IUK A;  4P6Z S;  1DP9 A;  1HD8 A;  3CHW P;  1NYM A;  2J3T D;  5E2G A;  4ZAM A;  5CER A;  4OP5 A;  1RCJ A;  3KSF A;  2WKI A;  1YPR A;  3ZG5 A;  4B88 A;  5CTM A;  3F1P B;  2Y2P A;  3PBQ A;  2E8I A;  4Y2F A;  5HZH A;  5TBM B;  4HI4 A;  3H82 B;  2H5S A;  3MR0 A;  1WYC A;  3RJU A;  1NZO A;  3RXW A;  1IOU A;  1ES2 A;  4CLC E;  5A90 A;  3E4O A;  2Y59 A;  2ZC3 B;  4DJ3 A;  1BTL A;  5HFO A;  1N4O A;  2HJE A;  2J8Y A;  2ZC6 B;  3VOZ A;  3B47 A;  4KZ9 A;  5J8X A;  3M2K A;  3VSK A;  4KQO A;  3SS5 A;  3LR4 A;  5FI7 A;  2J3W A;  5M19 A;  2GZA A;  4I5S A;  3W4Q A;  3PAE A;  3CIT A;  2HP6 A;  3IT9 A;  3PBS A;  3F1O B;  2RL3 A;  3RXX A;  2QKP A;  3O88 A;  4GHI A;  1F2K A;  1XGI A;  2Q9N A;  1Z6F A;  2V0W A;  3MFD A;  3I7J A;  4EXO A;  1KE3 A;  4FOF A;  2ZQ7 A;  3QNC A;  2XFT A;  4LPZ A;  2OLV A;  3FG8 A;  3CPT B;  4LGW A;  2ZD8 A;  3E4Q A;  4ARZ A;  3DTE A;  3UPP A;  5FQK A;  5C5K A;  4KZ4 A;  1SDE A;  4WF0 A;  4OLG A;  1FOF A;  4ETZ A;  3SS3 A;  3R7W A;  1V9Z A;  4MCW A;  3UB6 A;  4HHD A;  1BLS A;  3BQA A;  1IFQ A;  1YSP A;  2VV7 A;  4NG2 A;  3IWO A;  1PI5 A;  3PR6 A;  2HZ5 A;  3IX8 A;  4ZBE A;  1MPL A;  4MN5 A;  4XT2 B;  1Z09 A;  2JKT M;  1LLB A;  4EES A;  2V2F F;  2IA2 A;  3UE0 A;  4CLC B;  3G31 A;  3S1Y A;  2I72 A;  3H7W B;  2EXB A;  4OQI A;  3EGD C;  5F83 A;  1G6A A;  4HP9 A;  4II7 A;  1L3L A;  2C5W B;  3BFF A;  2ACG A;  4GZB A;  2ZBB A;  1E3U A;  2HPB A;  1S1Y A;  5DVA A;  3T4K A;  1G5U A;  4RX3 A;  2KOI A;  1IKI A;  4AFI A;  1LSV A;  4DJ2 A;  1XX2 A;  3MXR A;  1I5Q A;  4LV0 A;  1BSG A;  4DN0 A;  1K54 C;  3LY4 A;  1DRM A;  1NYY A;  3OPR A;  1KVL A;  1Y28 A;  1K54 A;  2JBF A;  4KQQ A;  4E6X A;  3V3S A;  1OJ5 A;  3MQO A;  4QWO A;  4BBV A;  3C38 A;  3LID A;  3IX3 A;  4NXB A;  4E3N A;  3F1N B;  5GHY A;  1PZO A;  1ALQ A;  3LIF A;  1Y54 A;  1DJB A;  3NI9 A;  2ZQC A;  4BD0 A;  4G3W A;  2INW A;  3RTY A;  1I2S A;  3B3X A;  2HDU A;  1XFN A;  2R78 A;  5DKK A;  1KDS A;  1A0K A;  4KZ6 A;  1L0E A;  1ES5 A;  4S2N C;  5GL9 A;  1AXB A;  5FI6 A;  5HAR A;  3HVF A;  4S2N A;  5DTT A;  3SZT A;  1JVJ A;  3W4O A;  4OQH A;  1NWZ A;  4JGR A;  1RGY A;  1SKO B;  4OQG A;  1YLP A;  2Y2L A;  3P7N A;  2XK1 A;  3QNB A;  3DAV A;  4JXV A;  3HJI A;  4PM7 A;  1W8Y A;  4CLC D;  3TJZ C;  2A24 A;  2V1B A;  1OJG A;  1PNE A;  5GLD A;  3C7U A;  3HLF A;  4MEZ A;  3RFB A;  3ZG8 B;  2PU4 A;  4GKU A;  3E2K A;  3GSG A;  1C3B A;  3LUQ A;  4WMC A;  1DJC A;  5HAP A;  4EBP A;  1JTG A;  2BLS A;  2M7V A;  5E43 A;  3M6H A;  4UQI S;  2EFX A;  4GCZ A;  2KX6 A;  4EWF A;  2O9C A;  1O7E A;  2K7S A;  1O07 A;  4KUK A;  2K2N A;  1W63 Q;  1LSX A;  1FIK A;  3SH8 A;  1PW8 A;  4IHQ A;  4HNB A;  1OTA A;  4UEY A;  3BJN A;  3AGF A;  1WE4 A;  5HL1 A;  2HDQ A;  3MBZ A;  3N6I A;  2VV6 A;  2E8J A;  1LSW A;  2XGN A;  2XA7 M;  4WBG A;  3P09 A;  3A3F A;  4EW7 A;  3ULF A;  4X25 A;  5F1F A;  3N7W A;  4A5R A;  3EWK A;  1H8Z A;  1Q2P A;  4JXW A;  5FAT A;  3T1Q B;  1L2S A;  3HL9 A;  1L0G A;  1NLY A;  3UNW A;  4JKT A;  5FQM A;  2V0U A;  5AQB A;  5F68 A;  5CED A;  3F1P A;  3N8R A;  4I38 A;  3ZQ5 A;  1VM1 A;  2Y2M A;  4GD6 A;  5TBM A;  2B5R A;  3H82 A;  3BWL A;  1BLH A;  2H28 A;  3EQU A;  4EQ1 A;  3EEA A;  4R4R A;  2EX9 A;  3VOL A;  5FQI A;  3HLG A;  3ITB A;  1FSY A;  2GX5 A;  1DJA A;  2HDR A;  4DMZ A;  3GDI A;  2WZZ A;  3NOP C;  1XA1 A;  3UE6 A;  4LV2 A;  4GN2 A;  3BLS A;  5LBR A;  4EUV A;  1VEU B;  2ZC7 A;  3P98 A;  2OV5 A;  5D3O A;  4HJ4 A;  5AVF A;  5CX7 A;  2PD8 A;  5L09 A;  3IX4 A;  4GS9 B;  2OAQ 1;  3F1O A;  5JYO A;  2ZJ9 A;  5CHM A;  2W1T B;  4WLA A;  2PBD P;  4R1G A;  4Q0I A;  2KLI A;  2QMI A;  1GHM A;  2ZMA A;  1PWC A;  4YFM A;  4NEE D;  5KSH A;  5L2F A;  4IBR A;  1OTB A;  1OT9 A;  1WA9 A;  1MKM A;  4HJ6 A;  5EEC A;  1MWS A;  3KYQ A;  4S2J A;  3KSG A;  1F98 A;  3CPT A;  3GQZ A;  4L9E A;  4GJ4 A;  3MXS A;  3BM6 A;  3H9W A;  4YIN A;  4I3I A;  4L9F A;  4LRY C;  3U2A A;  1G28 A;  4X68 A;  3MKE A;  1ZG4 A;  4NXG A;  3ZFZ A;  3T50 A;  5AQA A;  4EEP A;  2B02 A;  3A0S A;  5AQ9 A;  4JF6 A;  3HLD A;  2XRN A;  3QP1 A;  4DDY A;  2DRW A;  2ZMV A;  4N9K A;  3OZH A;  2XD1 A;  4QD4 A;  4X69 A;  1ODV A;  1JTD A;  5EE8 A;  2CC1 A;  3QP2 A;  1J9M A;  4EBN A;  5GLA A;  3KYE A;  5CEB A;  3FKV A;  4OPR A;  3NCK A;  3FPW A;  4CLC C;  4XT2 A;  3O87 A;  5DF8 A;  4PM6 A;  1VET B;  4CLC A;  1N9O A;  3IWI A;  3H7W A;  3OOV A;  3HUO A;  2DNS A;  3VSL A;  1DP6 A;  4R4S A;  3WRT A;  1TF1 A;  4NK3 A;  3A3D A;  4PMA A;  5DJU A;  1ESU A;  1K56 D;  1V9Y A;  2JN7 A;  1PWG A;  1PYY A;  4KEN B;  4UA9 A;  3VFF A;  1L0F A;  2ZLY A;  3VFH A;  4DKI A;  4R0Q A;  4OH0 A;  3C4P A;  4JGP A;  3Q7V B;  4GNU A;  2PT7 A;  3WS5 A;  4D60 A;  1T18 A;  3IXB A;  3O5Y A;  3JPU A;  2JKR I;  4KG2 A;  4WZ5 A;  3F1N A;  3VE3 A;  1NJ4 A;  4S2L A;  5HAQ A;  3IF6 B;  4UAA A;  3RH8 B;  1XFQ A;  4K0X A;  4BQM A;  2M7U A;  4EET B;  4IUH A;  4RX2 A;  1W63 M;  3GRJ A;  3OPL A;  3T4T A;  2ZOI A;  3EEH A;  5A93 A;  3IXH A;  5FDS A;  1SCW A;  3LI8 A;  2V9A A;  4XUZ A;  4UQI M;  4Y0O A;  1XJ6 A;  3LEZ A;  2H10 A;  5U47 A;  1ZC2 A;  4MBH A;  4DRT A;  1XXM A;  2VZW A;  1SKO A;  5EVE A;  1TDG A;  4BLM A;  2P9V B;  2L1M A;  5L8M A;  3LO7 A;  2O9B A;  1EI5 A;  1CI8 A;  1N9L A;  3IHB A;  3KX0 X;  2PHY A;  3VP3 A;  2O99 A;  1YT4 A;  2V20 A;  1IYQ A;  5HD5 A;  4QY6 A;  3PBR A;  3UDF A;  1VHM A;  5GLB A;  4FTX A;  4UHU A;  4O01 A;  3BFD A;  1LL5 A;  5TJJ A;  4HBT A;  4FH4 A;  1YLZ A;  2ZL1 B;  3DTM A;  4WUJ A;  3ISG A;  3HCY A;  3UMD A;  4Y5F A;  3HUM A;  3V39 A;  2VJW A;  3UO9 A;  1KGG A;  3FZC A;  1CEF A;  3FC7 A;  4B93 A;  3OBF A;  3NC8 A;  2WGW B;  4RVA A;  2EX8 A;  1ZKJ A;  2W0N A;  3UE3 A;  3M6B A;  1SHV A;  1FSW A;  5J3W A;  3SS4 A;  4I39 A;  4JF4 A;  4OON A;  1YM1 A;  1BLC A;  1OTD A;  2DMW A;  4KZA A;  2OWJ A;  2W3D A;  3MSH A;  4FH2 A;  2WYX A;  4O7D A;  4KZ3 A;  3HLC A;  2VGL S;  5EVI B;  2G2U A;  5KIZ A;  2ZOH A;  4EQI A;  3LR3 A;  1MWT A;  2EWV A;  2W3G A;  2Y2N A;  3SH9 A;  5I5L A;  3VMA A;  1HVB A;  4BBT A;  2VK3 A;  3IBR A;  4RQ9 A;  2BG1 A;  1YLW A;  2J80 A;  2Q0O A;  1IYO A;  5FA7 A;  2PYR A;  3UDX A;  1K38 A;  2XH9 A;  3OPH A;  3VV4 A;  4KQR A;  3IH9 A;  4JLF A;  3EQV A;  3BLM A;  3G35 A;  3NBL A;  2ZMF A;  4X55 A;  5A8B A;  1ESI A;  1K6S A;  4L9G A;  4IBX A;  1H8M A;  3ZVT A;  3GR2 A;  4HEF A;  5DTS A;  3FYZ A;  1BUL A;  3Q82 A;  4S2I A;  4D2O A;  3EGX C;  5G18 A;  1EW0 A;  2HF6 A;  1PZP A;  1E4D A;  1TD5 A;  1FCN A;  2WZX A;  1FQG A;  3GVB A;  4OVD A;  2VX8 A;  1PIO A;  4JXS A;  4KUO A;  4X56 A;  5DF9 A;  1VEU A;  2X01 A;  1Q2Q A;  4NKP A;  1D1J A;  3AGE A;  5FAO A;  3MFX A;  2VKS A;  1CJF A;  2P74 A;  2OSU A;  4E04 A;  4GS9 A;  1H0M A;  3IF5 A;  4E6W A;  4HH3 A;  3V50 A;  4P6B A;  4WEK A;  3S4X A;  2W1T A;  2UWX A;  2WKE A;  1G6O A;  2L0W A;  4K08 A;  3GTC A;  2XSS A;  3M2J A;  3DBA A;  4C3Q A;  4LCM A;  4H6J B;  5GHZ A;  3KSI A;  4HY8 A;  1MC0 A;  3UN7 A;  3V5M A;  2V1Z A;  3C7V A;  4KZ7 A;  5EVI D;  4MBF A;  2J3T C;  2V8C A;  3MQ0 A;  3MMH A;  1LL9 A;  1KE4 A;  3ZG0 A;  4ZJ3 A;  4LCL A;  5HDD A;  4OOM A;  3IBJ A;  2OAP 1;  1K55 C;  5J4E A;  1JNU A;  1K55 A;  2WKP A;  1PI4 A;  1RP5 A;  1HZO A;  1XA7 A;  5HW3 A;  3T12 B;  4BMW A;  3SH7 A;  2RCX A;  5KSC A;  4L0L A;  4LEN A;  2XEP A;  3UB7 A;  3E2L A;  3V3R A;  1VET A;  4UA7 A;  3HLB A;  5EV0 A;  2V8F A;  3BY8 A;  5I94 A;  4UA6 A;  2OWH A;  1K25 A;  3LR0 A;  3NEC A;  2WKR A;  3PYP A;  2WAD A;  5CHJ A;  2WKQ A;  4P6Z M;  3NDG A;  4KG5 A;  5F1G A;  2B95 A;  1D06 A;  4U3T A;  3QP5 A;  3MZF A;  5TFQ A;  3Q7V A;  5E2E A;  2JC7 A;  3QP8 A;  3ZDJ A;  2X71 A;  4WM9 A;  3FV7 A;  3TSG A;  3T4O A;  3Q81 A;  5FAQ A;  2NUP C;  1STZ A;  2OLU A;  3IF6 C;  4DDS A;  3C30 A;  2LB9 A;  3IF6 A;  3KSH A;  4P0M A;  4E3O A;  2EXA A;  3HJK A;  5J7E A;  4BEN A;  3ZGA B;  4ZDX A;  3NHQ A;  4OQ0 A;  1YMS A;  2QYB A;  3UPO A;  1S4S A;  1ERM A;  3T4S A;  1GHP A;  3N4I A;  2W3H A;  4GDB A;  4FSF A;  3KO6 A;  3PXP A;  3R4K A;  2MJ6 A;  2P9V A;  3ZHH A;  4X1L A;  1NLZ A;  1TVF A;  5HAI A;  4PHT A;  2XLN A;  1GHI A;  1LT0 A;  1XPB A;  1W5D A;  3BYD A;  4I3J A;  2QPN A;  5FI2 A;  3HLW A;  2WKH A;  4E3K A;  3OC2 A;  3DTK A;  4ESP A;  1T1A A;  1OT6 A;  4OPY A;  4WYY A;  4S2O A;  5DJT A;  4DE3 A;  4LRZ E;  2NUT C;  1CQA A;  2IWC A;  2ZL1 A;  1L0D A;  2DCF A;  1YLT A;  3UME A;  2XFS A;  2QWS A;  2GDN A;  1BYW A;  2WAF A;  3HLE A;  2O9A A;  1TS0 A;  3W8K A;  4PKY G;  2GJ3 A;  3W4P A;  3O3V A;  1TS6 A;  1NRJ A;  1ERO A;  4GLQ A;  3Q7Z A;  4PKY A;  1OTE A;  2Y8H A;  3LY3 A;  2HDS A;  1NY0 A;  2WGW A;  3G32 A;  1YKD A;  3IXG A;  4U0T A;  5EOE A;  3D72 A;  3MZE A;  1ZTU A;  2JKR M;  2BTF P;  3JYI A;  4QPR A;  3CWF A;  1IYP A;  5EVI A;  5FQJ A;  3LIA A;  2D01 A;  1J3W A;  3FWL A;  1VQQ A;  1MBL A;  1VB6 A;  4DF6 A;  1YQS A;  2FZ0 A;  3VE4 A;  4PM8 A;  3G34 A;  3ITA A;  4CPK A;  4OKP A;  5IS1 A;  5FQ9 A;  3BW6 A;  5AQ7 A;  2Y55 A;  1SZV A;  1F9I A;  3CMZ A;  2VLG A;  3QP6 A;  1XP4 A;  2QZ6 A;  1X0O A;  4CQH A;  1HLU P;  4R70 A;  3T4L A;  1ES4 A;  1YMX A;  4DE1 A; 
#chains in the Genus database with same CATH homology
 1Y28 A;  5TJJ A;  3E4P A;  5HWV A;  3P01 A;  5AJG A;  4F3L B;  4HJ3 A;  3B33 A;  3BY9 A;  3A0R A;  4WUJ A;  3HCY A;  3UMD A;  5DFX A;  1OPX A;  4Y5F A;  2YKF A;  1OJ5 A;  3MQO A;  4R6L A;  2VJW A;  4BBV A;  3C38 A;  3LID A;  2HV1 A;  4NXB A;  3F1N B;  4ARZ B;  4LRX C;  2CMN A;  4HQA A;  3LIF A;  3NOT C;  3FC7 A;  4B93 A;  3NJA A;  3S7O A;  3S7Q A;  4YNR A;  1GSV A;  3PBT A;  3OBF A;  3R7W B;  3TRC A;  4G3W A;  2INW A;  2W0N A;  3RTY A;  3UE3 A;  5J3W A;  3MJQ A;  4LLO B;  3LIC A;  5HSQ A;  1TS8 A;  2HGV A;  3LIB A;  4I39 A;  3K2N A;  2DMW A;  1OTD A;  2OWJ A;  2VGL M;  1XFN A;  2I9V A;  2W3D A;  2R78 A;  5DKK A;  3A0V A;  3ZYT A;  2VGL S;  5KIZ A;  2ZOH A;  3MXQ A;  3CI6 A;  3LR3 A;  1T1C A;  2EWV A;  3V67 A;  2Z6D A;  2LB5 A;  2W3G A;  5FL3 A;  1NWZ A;  4JGR A;  5I5L A;  4O8G A;  2W3F A;  4PAU A;  4BBT A;  4H6J A;  5HDC A;  4M4X A;  3IBR A;  2P7J A;  3E0Y A;  3PBN A;  4RQ9 A;  3P7N A;  5HWW A;  2J80 A;  3HJI A;  2Z6C A;  4Y3I A;  1P9R A;  3CLO A;  4ME4 A;  4EU0 A;  3TE8 A;  3OCN A;  4CLC D;  3TJZ C;  2A24 A;  1TS7 A;  2V1B A;  1OJG A;  2PYR A;  3LYX A;  1DP8 A;  4MDZ A;  3RFB A;  2D02 A;  3BQ8 A;  2QHK A;  3VV4 A;  3SW1 A;  3LUQ A;  4MN7 A;  3EQV A;  5A8B A;  2ZMF A;  2HJ9 C;  3K3C A;  2M7V A;  4BWI A;  4IJG A;  4L9G A;  4UQI S;  1H8M A;  4GCZ A;  2KX6 A;  5HPF A;  5IU1 A;  2O9C A;  3CUE C;  3EGX C;  1S67 L;  1EW0 A;  1N9N A;  2K7S A;  2HF6 A;  5IT5 A;  1TD5 A;  3CUE A;  4KUK A;  3JVU A;  2K2N A;  1W63 Q;  2A2L A;  4WEL A;  3LIE A;  2VX8 A;  1LSX A;  4KUO A;  5DF9 A;  1S4R A;  3JVV A;  4IHQ A;  2YKH A;  4HNB A;  1OTA A;  4I3A A;  2PR6 A;  4UEY A;  3MF0 A;  4NKP A;  1YSQ A;  4NXE A;  3BJN A;  4KQD A;  3MFX A;  2VKS A;  4R38 A;  4WL9 A;  3LI9 A;  2L4R A;  4E04 A;  2VV6 A;  4GS9 A;  4B9O A;  1LSW A;  2QJ7 A;  2XA7 M;  4HH2 A;  4R3A A;  5HDS A;  4HH3 A;  4G3V A;  4EW7 A;  2XA7 S;  3ULF A;  4WEK A;  2W1T A;  1G6O A;  2M1C A;  2L0W A;  4K08 A;  4BJP A;  2XSS A;  1UWP X;  2PYP A;  3EWK A;  1P97 A;  4ETX A;  2K31 A;  3DBA A;  2W27 A;  4H6J B;  3S7N A;  3KSI A;  4HY8 A;  4Z1W A;  2VEA A;  1NLY A;  1MC0 A;  4JGO A;  2V0U A;  5F68 A;  3F1P A;  2J3T C;  5HD3 A;  3MQ0 A;  3MMH A;  1XJ4 A;  4I38 A;  3ZQ5 A;  1H3Q A;  3S7P A;  2A24 B;  5TBM A;  1OTI A;  1UGU A;  3H82 A;  4NXF A;  2V1A A;  5HDD A;  3BWL A;  2EWW A;  3IBJ A;  4GW9 A;  4OOM A;  4EER A;  2OAP 1;  2H28 A;  3EQU A;  4YWZ A;  4EQ1 A;  1UWN X;  3EEA A;  3D3O A;  4EEU A;  4ZRR A;  5J4E A;  3LFV A;  1JNU A;  2WKP A;  1T1B A;  4WEJ A;  3VOL A;  5AVE A;  5HPI A;  3MQQ A;  2W1R A;  1KOU A;  2GX5 A;  3FPV A;  4DMZ A;  3GDI A;  3IS2 A;  2XRO A;  4JGQ A;  4BMW A;  3T4Q A;  4L0L A;  4BBU A;  3NOP C;  3UB7 A;  3UE6 A;  5F5Y A;  3C2W A;  1YAX A;  5F69 A;  3UB9 A;  2Y79 A;  1GSX A;  1S1Z A;  5LBR A;  4EUV A;  2O0Y A;  5K5B A;  4HJ4 A;  5AVF A;  3BY8 A;  2PR5 A;  5CX7 A;  2OOL A;  2PD8 A;  2VV8 A;  4HIA A;  4GS9 B;  2OAQ 1;  3F1O A;  3C8C A;  2OWH A;  4HP4 A;  2QJ5 A;  3LR0 A;  1S66 L;  2PD7 A;  2WKR A;  3PYP A;  2WKQ A;  4P6Z M;  1F5M A;  2W1T B;  4WLA A;  1MZU A;  4Q0I A;  2KLI A;  3OLO A;  1D06 A;  4IUK A;  4P6Z S;  1DP9 A;  4NEE D;  5F6A A;  2J3T D;  5KSH A;  1OTB A;  3KSF A;  1OT9 A;  1WA9 A;  3OCL A;  1MKM A;  4MN6 A;  4HJ6 A;  3W2Z A;  3KYQ A;  3T4O A;  3KSG A;  1F98 A;  4Q0H A;  3E98 A;  4L9E A;  2NUP C;  1STZ A;  4GJ4 A;  3F1P B;  3PBQ A;  3H9W A;  4Y2F A;  3C30 A;  2LB9 A;  5HZH A;  4I3I A;  4L9F A;  4LRY C;  3U2A A;  1G28 A;  3KSH A;  4HI4 A;  5TBM B;  3H82 B;  4NXG A;  3MR0 A;  3T50 A;  4EEP A;  2B02 A;  3A0S A;  3HJK A;  2XRN A;  5J7E A;  1IOU A;  2ZMV A;  3NOU C;  1XJ2 A;  3NHQ A;  4CLC E;  1ODV A;  3E4O A;  2QYB A;  3IS2 B;  4DJ3 A;  1S4S A;  1P0Z A;  2B18 A;  3T4S A;  3TW8 A;  2HJE A;  2W3H A;  3FPW A;  4CLC C;  3B47 A;  4XT2 A;  2VA0 A;  4CLC A;  1N9O A;  4FSF A;  3H7W A;  3KO6 A;  3OOV A;  4KQO A;  3B42 A;  3LR4 A;  3PXP A;  3R4K A;  2MJ6 A;  2J3W A;  1DP6 A;  4OOL A;  2GZA A;  1NLZ A;  4I5S A;  1TF1 A;  3CIT A;  5DJU A;  3PBS A;  2FH5 A;  3F1O B;  4PHT A;  2JN7 A;  1V9Y A;  3EOI A;  1LT0 A;  4Q0J A;  2QKP A;  4GHI A;  1GSW A;  4I3J A;  4MMN A;  5MC7 A;  3OC2 A;  2V0W A;  5HL6 A;  1T1A A;  4EXO A;  1OT6 A;  4JGP A;  2GNX A;  5DJT A;  4FOF A;  2PT7 A;  4LRZ E;  2NUT C;  5HWT A;  4F3L A;  1XJ3 A;  3T4J A;  4LPZ A;  4O0P A;  3GEC A;  1T18 A;  3UME A;  3FG8 A;  2QWS A;  3O5Y A;  2P04 A;  1BYW A;  2O9A A;  2W3E A;  2JKR I;  1TS0 A;  4PKY G;  2GJ3 A;  3CAX A;  3E4Q A;  4G3K A;  3F1N A;  4ARZ A;  1P9W A;  3VE3 A;  1TS6 A;  1NRJ A;  5C5K A;  4WF0 A;  4GLQ A;  4PKY A;  3RH8 B;  4ETZ A;  1OTE A;  1T19 A;  1XFQ A;  2JKT I;  2Y8H A;  2M7U A;  4EET B;  4IUH A;  3R7W A;  1W63 M;  2PDR A;  1YKD A;  1V9Z A;  3KYZ A;  1LL8 A;  4MCW A;  3UB8 A;  3D72 A;  3T4T A;  1ZTU A;  3PHY A;  3UB6 A;  2ZOI A;  5DFY A;  5G4Z A;  2JHE A;  3EEH A;  2JKR M;  3G6O A;  4HHD A;  3LR5 A;  3BQA A;  1IFQ A;  1YSP A;  3ICY A;  2VV7 A;  4YOF A;  3LI8 A;  2KDK A;  3CWF A;  2V9A A;  4QPR A;  2G7U A;  4UQI M;  1XJ6 A;  3LIA A;  3PR6 A;  4MN5 A;  2D01 A;  4XT2 B;  2JKT M;  4EES A;  1VB6 A;  2FZ0 A;  2IA2 A;  1ZHH B;  4CLC B;  2EA9 A;  1D7E A;  2BAS A;  3VE4 A;  3H7W B;  2VZW A;  3EGD C;  2L1M A;  5L8M A;  4HP9 A;  3K3D A;  5IS1 A;  4II7 A;  3BW6 A;  3PBO A;  2O9B A;  2ZBB A;  1S1Y A;  3T4K A;  5EFW A;  1N9L A;  1F9I A;  3KX0 X;  2VLG A;  2KOI A;  4AFI A;  2PHY A;  2O99 A;  1LSV A;  4GHI B;  4DJ2 A;  1X0O A;  4HOI A;  4CQH A;  4R70 A;  3T4L A;  4WN5 A;  5HD5 A;  3PBR A;  2P08 A;  4DN0 A;  5DKL A;  1DRM A;  1VHM A;  5G4Y A;  4O01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...