2ZOHA

X-ray crystal structure of photoactive yellow protein, wild type, at 295k
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
publication title Low-barrier hydrogen bond in photoactive yellow protein
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2zohA00
4RQ9A 2V9AA 4GS9A 4HJ4A 1TS7A 4HY8A 2QJ5A 4BBVA 3UMDA 1UWPX 4HI4A 1KOUA 2V1AA 3A0RA 5IU1A 4XT2B 2A24A 3F1OB 3LIEA 1OTDA 4R70A 1N9NA 4NXEA 1LT0A 1XJ4A 2OOLA 4LRZE 2PD7A 5HD5A 3UB9A 3H9WA 3H82B 4WN5A 3VE3A 3NOTC 5J4EA 4R3AA 1GSVA 3CWFA 3GECA 1LSWA 4HJ3A 2J80A 2WKRA 5HWTA 3G6OA 3K3DA 1V9YA 2INWA 3UB7A 2K7SA 2YKHA 5G4ZA 2VV6A 4JGRA 2KDKA 3RH8B 2V1BA 3NOPC 3NHQA 3C8CA 1D06A 3F1PB 1T1AA 5A8BA 3MQOA 4I3JA 1TS8A 2ZOIA 3IS2A 2PYRA 4B9OA 5J3WA 4WF0A 4NXFA 2Z6CA 2PYPA 4LRYC 4JGOA 1ODVA 4KQDA 1Y28A 5DKKA 1JNUA 4K08A 2PHYA 1T1BA 4GW9A 3BWLA 4H6JB 4NXBA 4L9EA 2VV7A 1MZUA 2ZBBA 3MQQA 1OTAA 4I38A 1S66L 4GS9B 5KIZA 3ICYA 1F9IA 4I5SA 1S4RA 1OTBA 5HWVA 5HWWA 3E4QA 4JGQA 4HQAA 1UWNX 4WLAA 2A24B 1XJ3A 2PDRA 1OJ5A 1XJ2A 3VOLA 3RTYA 2WKQA 5DJTA 4I39A 4EETB 1G28A 2M1CA 2V0WA 1F98A 4GCZA 2VLGA 3BY9A 4F3LA 1XJ6A 3KX0X 4XT2A 5TBMB 1UGUA 2PR6A 3EWKA 3UB8A 4HH3A 2JN7A 4R6LA 2OWJA 3NJAA 1OT6A 4R38A 3LIFA 2ZOHA 2EA9A 1T19A 2I9VA 3ULFA 4EERA 2Z6DA 2L0WA 3H7WB 4WUJA 3ZQ5A 3UB6A 4BBUA 3LI9A 1XFNA 1X0OA 5HD3A 4PKYA 1NWZA 4L9GA 5HDCA 4YWZA 1S67L 4HJ6A 1TS6A 1GSXA 3F1NB 3MJQA 4HNBA 4JGPA 3IS2B 2CMNA 2QKPA 1DP6A 2W27A 4M4XA 5J7EA 2R78A 4HOIA 2OWHA 3C2WA 1P97A 5DJUA 4NXGA 4GHIA 4EESA 3LYXA 3K3CA 2QHKA 1T18A 2KX6A 1GSWA 2L1MA 3F1PA 3LIDA 1VB6A 1D7EA 1EW0A 2PR5A 1OJGA 1OT9A 2D02A 3MR0A 4E04A 4HH2A 1WA9A 2QJ7A 5AVFA 5EFWA 3D72A 2VEAA 3B33A 2B02A 5F5YA 2L4RA 5F68A 3E4OA 4I3IA 4EQ1A 4EXOA 5HDDA 5AVEA 1S4SA 4MN5A 5HDSA 4EEUA 1XFQA 4KUKA 3A0VA 4F3LB 4LRXC 5F6AA 3PYPA 2QWSA 3T50A 1P0ZA 1OTEA 3P7NA 3VE4A 3F1OA 4L9FA 4DJ2A 1LSXA 3UMEA 3LI8A 3HJIA 5HZHA 3SW1A 2VV8A 1DRMA 2HV1A 4PKYG 1DP9A 2V0UA 3H82A 2BASA 5G4YA 5F69A 3E4PA 1BYWA 4LLOB 4BBTA 1T1CA 4EW7A 5TBMA 3LUQA 3GDIA 3OLOA 3MXQA 4EEPA 3UE6A 3H7WA 4GHIB 3CLOA 4HIAA 2GJ3A 1N9OA 4LPZA 3BY8A 2P7JA 4HHDA 3NOUC 1N9LA 1DP8A 2PD8A 3LIBA 3CAXA 1S1YA 1V9ZA 3FG8A 3F1NA 3LIAA 2W0NA 3EEHA 2JHEA 4HP9A 1OTIA 3FC7A 5HSQA 1LSVA 3MFXA 3IBRA 4MN6A 3HJKA 5IS1A 4KUOA 1S1ZA 4HP4A 3A0SA 4DJ3A 4WL9A 5I5LA 2D01A 2WKPA 4H6JA 1LL8A 3PHYA 2YKFA 4I3AA 3LICA 5DKLA 1TS0A 2H28A
chains in the Genus database with same CATH superfamily
1P9WA 1XPBA 2V9AA 3KO6A 4GS9A 1H8MA 4U0TA 1TS7A 4HY8A 4LCMA 3NECA 3KYQA 4EU0A 5L09A 4X25A 5GHXA 4BD0A 3IBJA 3RXWA 1KOUA 1BZAA 4NKPA 4HBUA 3M6BA 4OQGA 4Z1WA 5LBRA 3QNBA 2FH5A 2A2LA 4NK3A 1YKDA 2W3FA 5HFOA 4QU3A 2HGVA 4OPYA 4UQIS 4WZ5A 2PD7A 3BYDA 5HD5A 3E2KA 3ZDJA 1CF0A 3Q81A 3Q1FA 2Y2JA 1TDGA 2K2NA 4ARZA 2WZZA 5EOOA 2XLNA 4HJ3A 2WKIA 3CZDA 2J80A 3LO7A 5E2EA 3HUNA 4UA6A 3K3DA 5KSHA 2YKHA 4ZBEA 4JF6A 4OPRA 3T1XA 2A49A 2KDKA 2P9VB 3T1SA 1O07A 4KZBA 4WMCD 4X68A 5FI6A 1ZG4A 4WBGA 5FDHA 3BLMA 1VEUB 2X71A 1W63Q 1G6OA 1TS8A 4RX3A 3WS1A 2PYRA 4B9OA 2WGWA 2HP9A 3T4KA 2ZL1B 2Z6CA 2W3DA 4RX2A 3IF5A 2Y8HA 1Y28A 5AQ9A 2IWCA 2BG1A 2Y2HA 3T1QB 5EUAA 5M1AA 2QPNA 4GW9A 2J8YA 4H6JB 4NXBA 2VV7A 3LFVA 4GNUA 1PNEA 1OTAA 1VETB 4I38A 4Q8IA 1RCJA 1BUEA 5KIZA 1QMFA 2PT7A 3IXHA 2WYXA 5I94A 3E4QA 3LGOA 2W3EA 3MSHA 2A24B 4IUKA 1XJ3A 5FAOA 3M2JA 2PDRA 3DBAA 3LR5A 2JCHA 1OJ5A 4DDYA 5DFXA 3JPUA 1YAXA 5DJTA 3O87A 4I39A 4EETB 2JKTM 2V0WA 1SDNA 4DXCA 2OAP1 2ZQDA 1PFLA 2W1TB 3GVBA 4Y3IA 4KZ4A 2Y2LA 3BY9A 2XFTA 2Y4AA 2ACGA 2O9AA 2O99A 1L3LA 3ZG5A 3OPRA 4EWFA 4XXRA 1FR6A 3RXXA 1WE4A 2EXBA 3BFFA 2I9VA 2XD1A 4KQOA 4EERA 2L0WA 3H7WB 1MKIA 1SDEA 1TF1A 2XFSA 1CQAA 1LHYA 5U47A 5L10A 1S67L 4ZJ1A 5EPHA 2PAVP 2H0TA 4JGPA 3ZG8B 2CMNA 3EEAA 1IYOA 1IELA 1GHPA 1J9MA 3UO9A 4GOGA 3O3VA 4B4XA 5FI7A 1DJAA 4NXGA 4GHIA 5TR7A 1KVLA 1J3WA 1FOFA 2JBFA 3HLCA 1PW1A 2XA7M 4OQIA 4OONA 2Z2LB 3QP2A 1T18A 1YLWA 2KLIA 1L0EA 4PM7A 3NY4A 1G5UA 2Y2OA 1EW0A 2PR5A 1OT9A 3TOIA 4MBFA 3MR0A 4Y0UA 4E04A 4HH2A 1WA9A 5AQAA 3NDEA 2VEAA 5EVID 3B33A 4OOLA 4F94A 5F5YA 2L4RA 3G35A 3NCKA 2J9PA 1YLJA 3FZCA 3NBLA 1SHVA 5EOEA 4BQMA 3ZHHA 4PM5A 2WZXA 1CK3A 3C5AA 1YMSA 4FUWA 4UEYA 3G32A 1ACFA 4IVKA 4WELA 3IHBA 3OPLA 5GL9A 3EQUA 1H5XA 4UA9A 5L07A 1XX2A 1XFQA 3SS3A 3N8SA 2VGLS 3VP3A 5KMWA 4X1LA 1LLBA 3B3XA 2XDMA 3T50A 4S2KA 5HW3A 1K57C 3SZTA 3VE4A 1ERMA 3N8LA 2V2FF 1OPXA 3LI8A 3QP6A 2E8JA 1ERQA 2P04A 1G6AA 1DJCA 2VV8A 4OLDA 2XROA 1DP9A 4EUVA 2CC1A 3AGEA 3H82A 3NI9A 2O9BA 1SCWA 1IYSA 1K55C 4RA7A 3E4PA 4P6ZM 2Y2GA 1BLHA 3LUQA 3GDIA 3TW8A 4E3MA 4ZAMA 2VGJA 3MS6A 3FKVA 4EEPA 5C5KA 2ZD8A 4JBFA 1YSQA 1PI4A 4Z9QA 3H7WA 2GJ3A 1N9OA 4LFUA 4EBPA 1HD8A 5MC7A 1JTGA 4K0WA 2R9WA 3CAXA 3U4LP 3IF6A 3P98A 3FG8A 3LIAA 4IHQA 3EEHA 3T4LA 2J9OA 4DXBA 3OOVA 1ZC2A 4N92A 1H8ZA 5CXWA 5E43A 2R9XA 3UE1A 4KUOA 4E3KA 5EVLA 3GQZA 3BQAA 4KZ3A 4O8GA 2OLVA 3A0SA 5GLCA 3G2YA 4WL9A 4XUZA 2WAFA 4KZ5A 2WKPA 4IBXA 3PHYA 3BFEA 4I3AA 2WKEA 3P01A 4S2LA 4BD1A 1BT5A 2EWWA 1CEFA 4HJ4A 1BLPA 5FQJA 1K4FA 1YLTA 1NZUA 1SKOB 3WS2A 3S22A 1UWPX 3RJUA 1PI5A 4IBRA 4KZ9A 4X69A 5FAPA 1MBLA 5AJGA 1NYYA 4R3BA 3F1OB 3LIEA 3ZG0A 4R70A 5HAPA 4ZRRA 4NXEA 4YOFA 2OOLA 5A91A 4OQHA 3QP8A 1FCOA 3R7WB 4DF6A 1XGIA 3NOTC 1JTDA 5TFQA 1YSPA 5TGFA 1GSVA 3KYZA 3GECA 1WYCA 1LSWA 3W4QA 2HDRA 5CHUA 3BFCA 5HAIA 3IHAA 5FSRA 1LL5A 4OLGA 1ZG6A 4UAAA 1V9YA 3UB7A 3IH8A 2LB9A 4MCWA 4JGRA 3V3RA 3RH8B 4P0MA 1Z6FA 4NG2A 3PAEA 1YMXA 2V1BA 3O86A 4GD6A 4GD8A 3QHYA 3C8CA 2EX2A 5EV0A 5CGSA 3LR0A 5DF8A 5A8BA 3DW0A 4I3JA 1K0KA 5A92A 4YINA 1ZHHB 1K6RA 3IS2A 1I5QA 4NXFA 5K5BA 4LCLA 4GJ4A 3V39A 1QMEA 3JVUA 4JGOA 3DAVA 1KE4A 1T1BA 5FATA 4KQQA 4LENA 2P74A 2WKHA 3BWLA 1F5MA 4L9EA 2B18A 4UQIM 5HPIA 2HP5A 4KZ7A 1XA7A 2ZBBA 3MQQA 3UDXA 4JF5A 2V8FA 4WMCA 3IQAA 4HEFA 2FZ0A 4OOYA 2W1RA 4LV0A 3CUEA 2HP6A 5HWWA 2HJ9C 4JGQA 4HQAA 2DCFA 4S2NA 1UWNX 3D4FA 4WLAA 2A3UA 1PW8A 4U0XA 5DF7A 4C75A 3VOLA 5EVIB 5CEBA 3MXRA 4E3OA 3UNWA 3VFFA 1G28A 4G3VA 4EQIA 2BTFP 4DRTA 4NEED 4S2IA 5BOHA 4F3LA 4JF4A 4LV1A 2ZQAA 3ITBA 5TBMB 1UGUA 1K25A 3EWKA 5CGXA 5F83A 2B95A 3K2NA 2K31A 3NIAA 3NJAA 1OT6A 5HL6A 4R0QA 5F1FA 2ZOHA 4IUHA 4O01A 4CPKA 4LV2A 3UB6A 4CQHA 3LY3A 4DN0A 1LI0A 5FASA 4E3LA 1K54C 4WZ4A 3B47A 4MNRA 1W5DA 3L9KA 3W2ZA 1LL9A 4CLCC 4X55A 4QPRA 4L9GA 2ZC6B 4HJ6A 4QHCA 4ZTKA 3PBSA 1OMEA 3I7JA 1GSXA 3F1NB 4E3NA 5FEGA 3HREA 2QKPA 1DP6A 2W27A 1KE3A 5EECA 2ZM0A 1IYPA 4KG5A 3C2WA 4BMWA 3HL9A 2LB5A 2VKSA 1W79A 3LYXA 2G2WA 3K3CA 1MKMA 4H8RA 1GSWA 2L1MA 2C6WB 4PHTA 4A5RA 1IFQA 3AGDA 2D02A 3IF6C 4DKIA 3T4SA 3S7QA 2HDQA 3UE3A 5FQIA 2ZQCA 5AVFA 5EFWA 3LCEA 5F1GA 3PBQA 2B5RA 3KYEA 4C3QA 2B02A 5M18A 4PMAA 4YNRA 4Y17A 2VGKA 3T4TA 5CTMA 3U2AA 2HF6A 4OVDA 4RYEA 4EXOA 3HLWA 1N9BA 2XSSA 4JXGA 3UPPA 4MN5A 1H8YA 5HDSA 2IA2A 4MEZA 4EEUA 2GZAA 3P09A 3AGFA 5F6AA 3SOIA 4N9LA 3WS5A 2QWSA 1XGJA 2O9CA 1P0ZA 1OTEA 4N1HA 3P7NA 4R1GA 3OPHA 3UMEA 1SZVA 1KGFA 1ALQA 3VP0A 2FFFB 4PKYG 4E3JA 2M7UA 2HJEA 5G4YA 2WGIA 1EI5A 3S7OA 1BYWA 4BBTA 1T1CA 4P6BA 3T4JA 2VX8A 4MLLA 5TBMA 1NLYA 4Y5FA 5CECA 2XK1A 3S7PA 3FPVA 4JKTA 4EV4A 2DNSA 1GA9A 4HBTA 3IX8A 1LI9A 3CLOA 4LPZA 4P85A 3BY8A 5EE8A 2P7JA 4HHDA 2P9VA 1N9LA 3MZDA 3E0YA 4JXSA 5J8XA 4PPRA 4JXWA 3LIBA 5EVEA 2JKRI 3DTIA 3G2ZA 3VOZA 1VEUA 4FD8A 1MWRA 4OP5A 3F1NA 2W0NA 4R4RA 3OPPA 5CHMA 2VGLM 3FC7A 4K91A 5HSQA 5IT5A 3V67A 3BM6A 4MDZA 2ZMFA 3MFDA 4BJPA 2ZL1A 4DDSA 3MFXA 5FEFA 5FQKA 3FPWA 4MN6A 3HJKA 4KZ6A 3VOYA 1BLSA 1KVMA 1ES2A 1S1ZA 3S4XA 2Q0OA 3Q7ZA 1YQSA 2ZC7A 4OQ0A 1N4OA 1PZOA 3KSIA 4H6JA 2YKFA 1ESIA 2IWDA 1WYBA 4IEDA 1VETA 4RQ9A 1H0MA 3SH9A 1MC0A 1STZA 2QJ5A 1BULA 4ME4A 4DMZA 2H0YA 4HI4A 3JYIA 2V1AA 5JYPA 4S2PA 2JC7A 4P87A 5IU1A 4XT2B 1K56D 2A24A 2WK0A 2KOIA 1OTDA 3GR2A 1N9NA 1E25A 1LT0A 1XJ4A 3UDIA 4LRZE 1NJ4A 1AXBA 4S2NC 3BJNA 5CRFA 2C5WB 3IWQA 2VZWA 1W8QA 3UB9A 1NY0A 3H9WA 3VE3A 3LR3A 1PWGA 3Q82A 2W1TA 4ESPA 5J4EA 2Y2QA 4KENB 1E3UD 4WZ5C 3CWFA 1ES4A 4E6XA 3G6OA 3HCYA 4X56A 3MMHA 2K7SA 3NC8A 2O0YA 2WGVA 2JKGA 5G18A 3NOPC 1JWPA 5D3OA 3LR4A 1C3BA 3F1PB 2PBYA 2VK3A 1T1AA 2Y55A 1TEMA 1IKIA 2ZOIA 5J3WA 1KE0A 2QZ6A 2PYPA 4LRYC 5CX7A 1ODVA 4KQDA 2WAEA 5DKKA 1JNUA 1DJBA 3OBFA 2PHYA 1XP4A 3Q7VB 3PTEA 5FL3A 3N6IA 4S2JA 2J3WA 4N1XA 5GLBA 1Y54A 3IXBA 1I2SA 4GS9B 4ETZA 2W3HA 5F82A 3E2LA 5A93A 3IX3A 2J7VA 4BL3A 5EM1A 2GNXA 5HWVA 4CLCD 3ITAA 3GTCA 1JWVA 3C4OA 4JPMA 3GRJA 1Q2PA 4X6TA 3T1RA 1XJ2A 2W3GA 1FQGA 3IX4A 3IWOA 3RTYA 2WKQA 5A90A 2M1CA 2EFUA 1F98A 3ISGA 2ZQ7A 4GCZA 2EWVA 2VLGA 4GKUA 3EGDC 1YLZA 5TJJA 3KX0X 4XT2A 2G2UA 5JYOA 1BSGA 2J3TC 1U60A 2JN7A 4R6LA 2OWJA 4G3WA 4GDNA 3UPOA 2GDNA 3LIFA 1L0GA 1O7EA 1T19A 1TDLA 4Y2FA 1MWUA 2Z6DA 1NXYA 2GX5A 1S6RA 4WUJA 3DTMA 3PBNA 3ZQ5A 4BBUA 1XXMA 1ZTUA 3LI9A 1XFNA 1X0OA 3GSGA 4PKYA 1K6SA 4R4SA 1JWZA 2Y2NA 2ZC5B 2E8IA 3C7UA 4D2OA 4M4XA 3UB5P 1KDSA 3QP1A 4HOIA 4IVIA 4WYYA 5DJUA 3DTKA 1TVFA 4GB7A 4OOMA 5HL1A 1GHMA 1TD5A 3VV4A 4BENA 5L2FA 3O88A 4U3TA 2PRFA 2PBDP 3W4PA 3PXPA 2QYBA 2V8CA 3MKEA 2KX6A 3F1PA 3PBOA 4GLQA 4Q0IA 2NUPC 4EBNA 2ZQ8A 2XGNA 2FFYA 2V1ZA 1MXOA 3PAGA 4JXVA 3VFHA 4Y0TA 3PBRA 1K4EA 3D72A 3S7NA 3B42A 3OZHA 5HAQA 2ZJ9A 5CTNA 2Y2KA 5DF9A 1YLPA 5F68A 5GLDA 3T4OA 3E4OA 2XD5A 4WM9A 1H3QA 4BLMA 4EQ1A 3CPTB 4K0XA 3ZCZA 3VP2A 5HDDA 2X01A 3BW6A 5AVEA 4B93A 3N8RA 4FCFA 1K57A 2IWBA 4KUKA 3IXDA 3HLEA 2XR0A 1SKOA 4PM8A 5E2FA 4QY5A 4LRXC 2JKFA 3TRCA 1M6KA 3S1YA 1W63M 3F1OA 3A3JA 1HTZA 1NZOA 4L9FA 4JLFA 5CERA 1K55A 3D3OA 3SW1A 2EX8A 3ZFZA 1FCNA 1DRMA 2HV1A 1XKZA 3R7WA 5F69A 4LLOB 3TG9A 3T4QA 1IYQA 3MF0A 1BTLA 4ZJ3A 3FYZA 2Q9MA 2ZC3B 5AQBA 1L0FA 3PBTA 4IJGA 4LV3A 4GHIB 1FSWA 2VA0A 3BLSA 3G34A 3BQ8A 4BWIA 3MZFA 1Y4OA 3WRZA 2XQZA 3MXSA 2JKRM 4ZDXA 4ETXA 1S1YA 4GZBA 3OCLA 3WS0A 4QWOA 2RL3A 5CEDA 2JHEA 4WEKA 5HPFA 4HP9A 1PYYA 3HLBA 4PAUA 1OTIA 3SS4A 4LGWA 2OLUA 1LSVA 3UY6A 3IBRA 3SH8A 1NYMA 1MWSA 5IS1A 4II7A 4B88A 2Y2IA 5AQ7A 4L0LA 2HZ5A 3BFDA 2MJ6A 2OAQ1 4DJ3A 1RGYA 4KQRA 3CJMA 1LL8A 3CI6A 3LICA 5DKLA 1TS0A 1ESUA 2AVXA 1PWCA 3IXGA 4BBVA 3G30A 5FA7A 3UMDA 1FR1A 3TJZC 3A3DA 4FH4A 3HLDA 4KZ8A 1P9RA 5FQ9A 4R3JA 3A0RA 5DTTA 2VJWA 1A0KA 1EROA 3CMZA 1ONGA 5M19A 4OPQA 5FAQA 3CPTA 3ZG7B 2DMWA 1KGGA 3M2KA 4UA7A 5EVIA 3A3FA 2ZM2A 2Z2MB 5L8MA 4CLCB 3MBZA 3T12B 3HBRA 4ZJ2A 3H82B 3TSGA 4EBLA 4WN5A 5E2HA 2OV5A 3WRTA 3ZVTA 4N9KA 4DE2A 4Y13A 1RGZA 4R3AA 3LEZA 4Y7PA 4B4ZA 4PM6A 1GCEA 1F2KA 1IKGA 2WKRA 5HWTA 3UN7A 2INWA 4S2MA 5G4ZA 3VP4A 2VV6A 2BLSA 2EX9A 3SH7A 4AFIA 1KGEA 1K56A 1HZOA 1YPRA 1VM1A 3UPNA 3D9YA 4QD4A 3NHQA 3BRMA 1KDWA 3IF6B 1D06A 1YLYA 1K38A 4OH0A 3MQOA 3WWXA 3C38A 2OSUA 2HPBA 5KSCA 4WF0A 3A3EA 3IT9A 3C4PA 1E3UA 2ZLYA 4K08A 4E3IA 3UDFA 1YM1A 1CEGA 2J3TD 2PU2A 3CHWP 3WS4A 3IH9A 3VSLA 4UHUA 1MZUA 3DTEA 1CI8A 3GMWA 3EGXC 1HVBA 5FI2A 4Y0OA 3BFGA 4MBKA 1S66L 3IWIA 3UE0A 5DTSA 3ICYA 1F9IA 4QY6A 1NLZA 3N4IA 2M7VA 1L2SA 4I5SA 1S4RA 1OTBA 1S0WA 1FIKA 4XUXA 3ZG9B 5E2GA 4O7DA 1CI9A 2X02A 2XA7S 3CUEC 3BEBA 3V3SA 1IEMA 4HESA 1ZKJA 3KSFA 4MMNA 2HDSA 2ZM8A 5CGWA 5GHZA 1PRQA 2UV0E 2ZC4B 3QP4A 2JE5A 4S2OA 3KSGA 2JKTI 2Y59A 3DWKA 3L7HA 4D60A 1HLUP 3DWZA 1XJ6A 3E98A 5KZHA 3PR6A 3C7VA 2PR6A 4M3KA 3UB8A 4HH3A 1FILA 2ZQ9A 3NULA 4CLCE 4G3KA 4R38A 1K54A 2EA9A 2H5SA 4MN7A 3ULFA 3ZYTA 4CLCA 2XEPA 2ZMAA 4GDBA 4CJNA 3FV7A 5HARA 5HD3A 1ONHA 3GV9A 2EX6A 3BECA 1NWZA 5HDCA 4YWZA 4KG6A 5FQMA 1TS6A 3Q07A 4FSFA 4HNBA 3MJQA 2XRNA 3OCNA 1FCMA 3IS2B 3KSHA 4DE3A 5J7EA 2WADA 2R78A 2OWHA 3MQ0A 1P97A 3ZGAB 2ZMVA 3W8KA 1G68A 2Q9NA 2XH9A 4OKPA 4EESA 3M6HA 4WEJA 3VMAA 4X1MA 4KG2A 3W4OA 2QHKA 4X53A 4R23A 1Q2QA 3SS5A 2XF3A 3HUOA 2P08A 1GHIA 3EQVA 1E4DA 3LIDA 1VB6A 4P6ZS 1D7EA 2EXAA 5DFYA 1OJGA 5GHYA 5HX9A 1JVJA 1DY6A 2QJ7A 2Y79A 3G31A 3CG5A 3JVVA 1I2WA 4C6YA 2V20A 1ES3A 1GA0A 4I3IA 4YFMA 4EUZA 1NRJA 1MY8A 5DTKA 4E6WA 5DVAA 1D1JA 2NUTC 1S4SA 3QP5A 4OPZA 2HDUA 3A0VA 4NETA 4F3LB 1FSYA 5CHJA 4BL2A 3N7WA 4DE1A 2DRWA 1PZPA 3VSKA 2I72A 3CITA 3PYPA 3A3IA 1CJFA 2WUQA 3R4KA 4ARZB 4Q0JA 4FTXA 3HUMA 2UWXA 4QJGA 4DJ2A 1LSXA 4QB8A 5EM0A 3TE8A 1W8YA 3HJIA 2Y2MA 5HZHA 3HLFA 2PU4A 1NRFA 1IOUA 3V5MA 4Q0HA 2V0UA 2H10A 1YT4A 2BASA 5EVIC 3HLGA 4KZAA 5GLAA 4EW7A 4ID4A 2QMIA 3OLOA 3VP1A 3MXQA 3FWLA 3MKFA 2WGWB 1EWZA 4DE0A 3UE6A 3EOIA 1MPLA 3RFBA 1ES5A 4FH2A 4HIAA 4MBHA 3ZNYA 1RP5A 1SKFA 3NOUC 4OP8A 3LY4A 1DP8A 2PD8A 1Z09A 3NDGA 4RVAA 3G4PA 4Y15A 1MWTA 1V9ZA 3LEQA 2G7UA 3OC2A 1XA1A 3O5YA 3ZNTA 1BLCA 1VHMA 5FQQA 5IHVA 1PWDA 2Y2PA 2RCXA 4PM9A 3ZVWA 1PIOA 4GN2A 3HVFA 1L0DA 2Y91A 2EFXA 3C30A 4HP4A 1AWIA 1VQQA 1W7FA 3FKWA 3Q7VA 3V50A 5FDSA 5I5LA 2D01A 3MZEA 3QNCA 2H28A 4O0PA 4FOFA 1M40A
chains in the Genus database with same CATH topology
1P9WA 4RQ9A 2V9AA 3KO6A 4GS9A 1H8MA 2EWWA 4HJ4A 1TS7A 4HY8A 1MC0A 1STZA 2QJ5A 3KYQA 4BBVA 4EU0A 4ME4A 4DMZA 3UMDA 1UWPX 4HI4A 3TJZC 3IBJA 1KOUA 4NKPA 1P9RA 2V1AA 3A0RA 4Z1WA 5LBRA 2VJWA 5IU1A 4XT2B 5AJGA 2A24A 3F1OB 2FH5A 3LIEA 2A2LA 2KOIA 1OTDA 4R70A 1N9NA 1YKDA 4ZRRA 4NXEA 4YOFA 1LT0A 1XJ4A 2DMWA 2OOLA 4LRZE 2W3FA 2HGVA 3BJNA 5L8MA 4CLCB 2VZWA 4UQIS 2PD7A 5HD5A 3UB9A 3H9WA 3H82B 3R7WB 4WN5A 3VE3A 3LR3A 2W1TA 3NOTC 5J4EA 1YSPA 4R3AA 1GSVA 3KYZA 2K2NA 4ARZA 3CWFA 3GECA 1LSWA 4HJ3A 2J80A 2WKRA 5HWTA 3G6OA 3HCYA 3K3DA 3MMHA 1V9YA 5KSHA 2INWA 3UB7A 2K7SA 2YKHA 5G4ZA 2LB9A 4MCWA 2VV6A 4AFIA 2O0YA 4JGRA 2KDKA 3RH8B 2V1BA 3NOPC 3NHQA 3C8CA 3LR4A 1D06A 3F1PB 1W63Q 1G6OA 3LR0A 1T1AA 5A8BA 3MQOA 4I3JA 3C38A 1TS8A 1ZHHB 2ZOIA 3IS2A 2PYRA 4B9OA 5J3WA 4WF0A 4NXFA 3T4KA 2Z6CA 2W3DA 5K5BA 2PYPA 4GJ4A 4LRYC 3JVUA 4JGOA 2Y8HA 1ODVA 5CX7A 4KQDA 1Y28A 5DKKA 1JNUA 3OBFA 4K08A 2PHYA 1T1BA 4GW9A 5FL3A 3BWLA 2J3TD 2J3WA 1F5MA 4H6JB 4L9EA 2VV7A 3LFVA 4NXBA 1MZUA 2B18A 4UQIM 5HPIA 3EGXC 2ZBBA 3MQQA 1OTAA 4I38A 1S66L 4GS9B 5KIZA 3ICYA 2FZ0A 4ETZA 2W3HA 1F9IA 2PT7A 2W1RA 1NLZA 3CUEA 2M7VA 4I5SA 1S4RA 1OTBA 2GNXA 5HWVA 5HWWA 2HJ9C 3E4QA 4JGQA 4CLCD 4HQAA 2W3EA 1UWNX 4WLAA 2A24B 4IUKA 1XJ3A 2PDRA 3DBAA 3LR5A 2XA7S 3CUEC 1OJ5A 1XJ2A 2W3GA 5DFXA 3VOLA 1YAXA 3RTYA 3KSFA 4MMNA 2WKQA 5DJTA 4I39A 4EETB 1G28A 2JKTM 2M1CA 2V0WA 4G3VA 1F98A 2OAP1 3KSGA 2W1TB 2JKTI 4NEED 4GCZA 2EWVA 4Y3IA 2VLGA 3BY9A 4F3LA 1XJ6A 3E98A 3EGDC 5TJJA 3KX0X 3PR6A 2O9AA 4XT2A 5TBMB 1UGUA 2PR6A 2O99A 3EWKA 2J3TC 3UB8A 4HH3A 3K2NA 2JN7A 4R6LA 2OWJA 4CLCE 2K31A 4G3WA 3NJAA 1OT6A 4G3KA 3LIFA 4R38A 5HL6A 2ZOHA 2EA9A 1T19A 2I9VA 4MN7A 3ULFA 4IUHA 4Y2FA 4KQOA 3ZYTA 4CLCA 4EERA 4O01A 2Z6DA 2L0WA 3H7WB 2GX5A 4WUJA 3PBNA 3ZQ5A 3UB6A 4BBUA 4CQHA 1ZTUA 3LI9A 4DN0A 1XFNA 1X0OA 5HD3A 1TF1A 3B47A 4PKYA 3W2ZA 4CLCC 4QPRA 1NWZA 4L9GA 5HDCA 4YWZA 1S67L 4HJ6A 3PBSA 1TS6A 1GSXA 4FSFA 3F1NB 3MJQA 4HNBA 2XRNA 3OCNA 3IS2B 3KSHA 4JGPA 2CMNA 3EEAA 2QKPA 1DP6A 2W27A 4M4XA 5J7EA 2R78A 4HOIA 2OWHA 3MQ0A 3C2WA 1P97A 4BMWA 5DJUA 4NXGA 2ZMVA 2LB5A 2VKSA 4GHIA 4OOMA 1TD5A 3VV4A 4EESA 4WEJA 3LYXA 2XA7M 3K3CA 2QHKA 3PXPA 1MKMA 2QYBA 1T18A 2KX6A 2P08A 1GSWA 2L1MA 3F1PA 3PBOA 4GLQA 2KLIA 4Q0IA 3EQVA 2NUPC 3LIDA 1VB6A 4P6ZS 4PHTA 1D7EA 5DFYA 1IFQA 1EW0A 2PR5A 1OJGA 1OT9A 2D02A 3MR0A 3T4SA 3S7QA 4E04A 4HH2A 3UE3A 1WA9A 2QJ7A 5AVFA 3PBRA 5EFWA 3D72A 2VEAA 2Y79A 3PBQA 3S7NA 3B42A 3B33A 2B02A 3JVVA 4OOLA 5F5YA 4YNRA 2L4RA 5DF9A 3T4TA 5F68A 3U2AA 3T4OA 2HF6A 3E4OA 4I3IA 1H3QA 4EQ1A 1NRJA 4EXOA 4UEYA 5HDDA 2XSSA 3BW6A 4WELA 2NUTC 5AVEA 1S4SA 4B93A 4MN5A 5HDSA 3EQUA 2IA2A 4EEUA 1XFQA 4KUKA 2VGLS 2GZAA 3A0VA 4F3LB 4LRXC 5F6AA 3TRCA 3CITA 3PYPA 2QWSA 3T50A 2O9CA 1P0ZA 1OTEA 3P7NA 3R4KA 4ARZB 1W63M 4Q0JA 3VE4A 3F1OA 4L9FA 4DJ2A 1LSXA 3UMEA 3TE8A 1OPXA 3LI8A 3HJIA 5HZHA 3D3OA 3SW1A 2P04A 2VV8A 1DRMA 2HV1A 1IOUA 2XROA 4PKYG 1DP9A 2M7UA 4Q0HA 4EUVA 2V0UA 2HJEA 3H82A 3R7WA 2BASA 2O9BA 5G4YA 5F69A 3S7OA 3E4PA 1BYWA 4LLOB 4P6ZM 4BBTA 1T1CA 3T4JA 4EW7A 2VX8A 5TBMA 1NLYA 4Y5FA 3T4QA 3LUQA 3MF0A 3GDIA 3OLOA 3TW8A 3MXQA 3S7PA 3FPVA 4EEPA 5C5KA 3PBTA 3UE6A 1YSQA 4IJGA 3EOIA 3H7WA 4GHIB 3RFBA 3CLOA 4HIAA 2GJ3A 1N9OA 4LPZA 3BY8A 2VA0A 2P7JA 4HHDA 3BQ8A 3NOUC 4BWIA 1N9LA 1DP8A 2PD8A 5MC7A 3E0YA 2JKRM 4ETXA 3LIBA 3CAXA 1S1YA 3OCLA 2JKRI 1V9ZA 3FG8A 2G7UA 3F1NA 3OC2A 3LIAA 2W0NA 3O5YA 4IHQA 3EEHA 2JHEA 1VHMA 4WEKA 3T4LA 5HPFA 4HP9A 4PAUA 1OTIA 2VGLM 3FC7A 5HSQA 5IT5A 3V67A 1LSVA 4MDZA 2ZMFA 4BJPA 3OOVA 3MFXA 3IBRA 3FPWA 4MN6A 3HJKA 5IS1A 4II7A 4KUOA 1S1ZA 3C30A 3BQAA 4HP4A 4L0LA 4O8GA 3A0SA 2MJ6A 2OAQ1 4WL9A 4DJ3A 3KSIA 5I5LA 2D01A 2WKPA 4H6JA 1LL8A 3PHYA 2YKFA 3CI6A 3LICA 4I3AA 5DKLA 1TS0A 2H28A 3P01A 4O0PA 4FOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RQ9 A;  2V9A A;  4GS9 A;  4HJ4 A;  1TS7 A;  4HY8 A;  2QJ5 A;  4BBV A;  3UMD A;  1UWP X;  4HI4 A;  1KOU A;  2V1A A;  3A0R A;  5IU1 A;  4XT2 B;  2A24 A;  3F1O B;  3LIE A;  1OTD A;  4R70 A;  1N9N A;  4NXE A;  1LT0 A;  1XJ4 A;  2OOL A;  4LRZ E;  2PD7 A;  5HD5 A;  3UB9 A;  3H9W A;  3H82 B;  4WN5 A;  3VE3 A;  3NOT C;  5J4E A;  4R3A A;  1GSV A;  3CWF A;  3GEC A;  1LSW A;  4HJ3 A;  2J80 A;  2WKR A;  5HWT A;  3G6O A;  3K3D A;  1V9Y A;  2INW A;  3UB7 A;  2K7S A;  2YKH A;  5G4Z A;  2VV6 A;  4JGR A;  2KDK A;  3RH8 B;  2V1B A;  3NOP C;  3NHQ A;  3C8C A;  1D06 A;  3F1P B;  1T1A A;  5A8B A;  3MQO A;  4I3J A;  1TS8 A;  2ZOI A;  3IS2 A;  2PYR A;  4B9O A;  5J3W A;  4WF0 A;  4NXF A;  2Z6C A;  2PYP A;  4LRY C;  4JGO A;  1ODV A;  4KQD A;  1Y28 A;  5DKK A;  1JNU A;  4K08 A;  2PHY A;  1T1B A;  4GW9 A;  3BWL A;  4H6J B;  4NXB A;  4L9E A;  2VV7 A;  1MZU A;  2ZBB A;  3MQQ A;  1OTA A;  4I38 A;  1S66 L;  4GS9 B;  5KIZ A;  3ICY A;  1F9I A;  4I5S A;  1S4R A;  1OTB A;  5HWV A;  5HWW A;  3E4Q A;  4JGQ A;  4HQA A;  1UWN X;  4WLA A;  2A24 B;  1XJ3 A;  2PDR A;  1OJ5 A;  1XJ2 A;  3VOL A;  3RTY A;  2WKQ A;  5DJT A;  4I39 A;  4EET B;  1G28 A;  2M1C A;  2V0W A;  1F98 A;  4GCZ A;  2VLG A;  3BY9 A;  4F3L A;  1XJ6 A;  3KX0 X;  4XT2 A;  5TBM B;  1UGU A;  2PR6 A;  3EWK A;  3UB8 A;  4HH3 A;  2JN7 A;  4R6L A;  2OWJ A;  3NJA A;  1OT6 A;  4R38 A;  3LIF A;  2ZOH A;  2EA9 A;  1T19 A;  2I9V A;  3ULF A;  4EER A;  2Z6D A;  2L0W A;  3H7W B;  4WUJ A;  3ZQ5 A;  3UB6 A;  4BBU A;  3LI9 A;  1XFN A;  1X0O A;  5HD3 A;  4PKY A;  1NWZ A;  4L9G A;  5HDC A;  4YWZ A;  1S67 L;  4HJ6 A;  1TS6 A;  1GSX A;  3F1N B;  3MJQ A;  4HNB A;  4JGP A;  3IS2 B;  2CMN A;  2QKP A;  1DP6 A;  2W27 A;  4M4X A;  5J7E A;  2R78 A;  4HOI A;  2OWH A;  3C2W A;  1P97 A;  5DJU A;  4NXG A;  4GHI A;  4EES A;  3LYX A;  3K3C A;  2QHK A;  1T18 A;  2KX6 A;  1GSW A;  2L1M A;  3F1P A;  3LID A;  1VB6 A;  1D7E A;  1EW0 A;  2PR5 A;  1OJG A;  1OT9 A;  2D02 A;  3MR0 A;  4E04 A;  4HH2 A;  1WA9 A;  2QJ7 A;  5AVF A;  5EFW A;  3D72 A;  2VEA A;  3B33 A;  2B02 A;  5F5Y A;  2L4R A;  5F68 A;  3E4O A;  4I3I A;  4EQ1 A;  4EXO A;  5HDD A;  5AVE A;  1S4S A;  4MN5 A;  5HDS A;  4EEU A;  1XFQ A;  4KUK A;  3A0V A;  4F3L B;  4LRX C;  5F6A A;  3PYP A;  2QWS A;  3T50 A;  1P0Z A;  1OTE A;  3P7N A;  3VE4 A;  3F1O A;  4L9F A;  4DJ2 A;  1LSX A;  3UME A;  3LI8 A;  3HJI A;  5HZH A;  3SW1 A;  2VV8 A;  1DRM A;  2HV1 A;  4PKY G;  1DP9 A;  2V0U A;  3H82 A;  2BAS A;  5G4Y A;  5F69 A;  3E4P A;  1BYW A;  4LLO B;  4BBT A;  1T1C A;  4EW7 A;  5TBM A;  3LUQ A;  3GDI A;  3OLO A;  3MXQ A;  4EEP A;  3UE6 A;  3H7W A;  4GHI B;  3CLO A;  4HIA A;  2GJ3 A;  1N9O A;  4LPZ A;  3BY8 A;  2P7J A;  4HHD A;  3NOU C;  1N9L A;  1DP8 A;  2PD8 A;  3LIB A;  3CAX A;  1S1Y A;  1V9Z A;  3FG8 A;  3F1N A;  3LIA A;  2W0N A;  3EEH A;  2JHE A;  4HP9 A;  1OTI A;  3FC7 A;  5HSQ A;  1LSV A;  3MFX A;  3IBR A;  4MN6 A;  3HJK A;  5IS1 A;  4KUO A;  1S1Z A;  4HP4 A;  3A0S A;  4DJ3 A;  4WL9 A;  5I5L A;  2D01 A;  2WKP A;  4H6J A;  1LL8 A;  3PHY A;  2YKF A;  4I3A A;  3LIC A;  5DKL A;  1TS0 A;  2H28 A; 
#chains in the Genus database with same CATH topology
 1P9W A;  1XPB A;  2V9A A;  3KO6 A;  4GS9 A;  1H8M A;  4U0T A;  1TS7 A;  4HY8 A;  4LCM A;  3NEC A;  3KYQ A;  4EU0 A;  5L09 A;  4X25 A;  5GHX A;  4BD0 A;  3IBJ A;  3RXW A;  1KOU A;  1BZA A;  4NKP A;  4HBU A;  3M6B A;  4OQG A;  4Z1W A;  5LBR A;  3QNB A;  2FH5 A;  2A2L A;  4NK3 A;  1YKD A;  2W3F A;  5HFO A;  4QU3 A;  2HGV A;  4OPY A;  4UQI S;  4WZ5 A;  2PD7 A;  3BYD A;  5HD5 A;  3E2K A;  3ZDJ A;  1CF0 A;  3Q81 A;  3Q1F A;  2Y2J A;  1TDG A;  2K2N A;  4ARZ A;  2WZZ A;  5EOO A;  2XLN A;  4HJ3 A;  2WKI A;  3CZD A;  2J80 A;  3LO7 A;  5E2E A;  3HUN A;  4UA6 A;  3K3D A;  5KSH A;  2YKH A;  4ZBE A;  4JF6 A;  4OPR A;  3T1X A;  2A49 A;  2KDK A;  2P9V B;  3T1S A;  1O07 A;  4KZB A;  4WMC D;  4X68 A;  5FI6 A;  1ZG4 A;  4WBG A;  5FDH A;  3BLM A;  1VEU B;  2X71 A;  1W63 Q;  1G6O A;  1TS8 A;  4RX3 A;  3WS1 A;  2PYR A;  4B9O A;  2WGW A;  2HP9 A;  3T4K A;  2ZL1 B;  2Z6C A;  2W3D A;  4RX2 A;  3IF5 A;  2Y8H A;  1Y28 A;  5AQ9 A;  2IWC A;  2BG1 A;  2Y2H A;  3T1Q B;  5EUA A;  5M1A A;  2QPN A;  4GW9 A;  2J8Y A;  4H6J B;  4NXB A;  2VV7 A;  3LFV A;  4GNU A;  1PNE A;  1OTA A;  1VET B;  4I38 A;  4Q8I A;  1RCJ A;  1BUE A;  5KIZ A;  1QMF A;  2PT7 A;  3IXH A;  2WYX A;  5I94 A;  3E4Q A;  3LGO A;  2W3E A;  3MSH A;  2A24 B;  4IUK A;  1XJ3 A;  5FAO A;  3M2J A;  2PDR A;  3DBA A;  3LR5 A;  2JCH A;  1OJ5 A;  4DDY A;  5DFX A;  3JPU A;  1YAX A;  5DJT A;  3O87 A;  4I39 A;  4EET B;  2JKT M;  2V0W A;  1SDN A;  4DXC A;  2OAP 1;  2ZQD A;  1PFL A;  2W1T B;  3GVB A;  4Y3I A;  4KZ4 A;  2Y2L A;  3BY9 A;  2XFT A;  2Y4A A;  2ACG A;  2O9A A;  2O99 A;  1L3L A;  3ZG5 A;  3OPR A;  4EWF A;  4XXR A;  1FR6 A;  3RXX A;  1WE4 A;  2EXB A;  3BFF A;  2I9V A;  2XD1 A;  4KQO A;  4EER A;  2L0W A;  3H7W B;  1MKI A;  1SDE A;  1TF1 A;  2XFS A;  1CQA A;  1LHY A;  5U47 A;  5L10 A;  1S67 L;  4ZJ1 A;  5EPH A;  2PAV P;  2H0T A;  4JGP A;  3ZG8 B;  2CMN A;  3EEA A;  1IYO A;  1IEL A;  1GHP A;  1J9M A;  3UO9 A;  4GOG A;  3O3V A;  4B4X A;  5FI7 A;  1DJA A;  4NXG A;  4GHI A;  5TR7 A;  1KVL A;  1J3W A;  1FOF A;  2JBF A;  3HLC A;  1PW1 A;  2XA7 M;  4OQI A;  4OON A;  2Z2L B;  3QP2 A;  1T18 A;  1YLW A;  2KLI A;  1L0E A;  4PM7 A;  3NY4 A;  1G5U A;  2Y2O A;  1EW0 A;  2PR5 A;  1OT9 A;  3TOI A;  4MBF A;  3MR0 A;  4Y0U A;  4E04 A;  4HH2 A;  1WA9 A;  5AQA A;  3NDE A;  2VEA A;  5EVI D;  3B33 A;  4OOL A;  4F94 A;  5F5Y A;  2L4R A;  3G35 A;  3NCK A;  2J9P A;  1YLJ A;  3FZC A;  3NBL A;  1SHV A;  5EOE A;  4BQM A;  3ZHH A;  4PM5 A;  2WZX A;  1CK3 A;  3C5A A;  1YMS A;  4FUW A;  4UEY A;  3G32 A;  1ACF A;  4IVK A;  4WEL A;  3IHB A;  3OPL A;  5GL9 A;  3EQU A;  1H5X A;  4UA9 A;  5L07 A;  1XX2 A;  1XFQ A;  3SS3 A;  3N8S A;  2VGL S;  3VP3 A;  5KMW A;  4X1L A;  1LLB A;  3B3X A;  2XDM A;  3T50 A;  4S2K A;  5HW3 A;  1K57 C;  3SZT A;  3VE4 A;  1ERM A;  3N8L A;  2V2F F;  1OPX A;  3LI8 A;  3QP6 A;  2E8J A;  1ERQ A;  2P04 A;  1G6A A;  1DJC A;  2VV8 A;  4OLD A;  2XRO A;  1DP9 A;  4EUV A;  2CC1 A;  3AGE A;  3H82 A;  3NI9 A;  2O9B A;  1SCW A;  1IYS A;  1K55 C;  4RA7 A;  3E4P A;  4P6Z M;  2Y2G A;  1BLH A;  3LUQ A;  3GDI A;  3TW8 A;  4E3M A;  4ZAM A;  2VGJ A;  3MS6 A;  3FKV A;  4EEP A;  5C5K A;  2ZD8 A;  4JBF A;  1YSQ A;  1PI4 A;  4Z9Q A;  3H7W A;  2GJ3 A;  1N9O A;  4LFU A;  4EBP A;  1HD8 A;  5MC7 A;  1JTG A;  4K0W A;  2R9W A;  3CAX A;  3U4L P;  3IF6 A;  3P98 A;  3FG8 A;  3LIA A;  4IHQ A;  3EEH A;  3T4L A;  2J9O A;  4DXB A;  3OOV A;  1ZC2 A;  4N92 A;  1H8Z A;  5CXW A;  5E43 A;  2R9X A;  3UE1 A;  4KUO A;  4E3K A;  5EVL A;  3GQZ A;  3BQA A;  4KZ3 A;  4O8G A;  2OLV A;  3A0S A;  5GLC A;  3G2Y A;  4WL9 A;  4XUZ A;  2WAF A;  4KZ5 A;  2WKP A;  4IBX A;  3PHY A;  3BFE A;  4I3A A;  2WKE A;  3P01 A;  4S2L A;  4BD1 A;  1BT5 A;  2EWW A;  1CEF A;  4HJ4 A;  1BLP A;  5FQJ A;  1K4F A;  1YLT A;  1NZU A;  1SKO B;  3WS2 A;  3S22 A;  1UWP X;  3RJU A;  1PI5 A;  4IBR A;  4KZ9 A;  4X69 A;  5FAP A;  1MBL A;  5AJG A;  1NYY A;  4R3B A;  3F1O B;  3LIE A;  3ZG0 A;  4R70 A;  5HAP A;  4ZRR A;  4NXE A;  4YOF A;  2OOL A;  5A91 A;  4OQH A;  3QP8 A;  1FCO A;  3R7W B;  4DF6 A;  1XGI A;  3NOT C;  1JTD A;  5TFQ A;  1YSP A;  5TGF A;  1GSV A;  3KYZ A;  3GEC A;  1WYC A;  1LSW A;  3W4Q A;  2HDR A;  5CHU A;  3BFC A;  5HAI A;  3IHA A;  5FSR A;  1LL5 A;  4OLG A;  1ZG6 A;  4UAA A;  1V9Y A;  3UB7 A;  3IH8 A;  2LB9 A;  4MCW A;  4JGR A;  3V3R A;  3RH8 B;  4P0M A;  1Z6F A;  4NG2 A;  3PAE A;  1YMX A;  2V1B A;  3O86 A;  4GD6 A;  4GD8 A;  3QHY A;  3C8C A;  2EX2 A;  5EV0 A;  5CGS A;  3LR0 A;  5DF8 A;  5A8B A;  3DW0 A;  4I3J A;  1K0K A;  5A92 A;  4YIN A;  1ZHH B;  1K6R A;  3IS2 A;  1I5Q A;  4NXF A;  5K5B A;  4LCL A;  4GJ4 A;  3V39 A;  1QME A;  3JVU A;  4JGO A;  3DAV A;  1KE4 A;  1T1B A;  5FAT A;  4KQQ A;  4LEN A;  2P74 A;  2WKH A;  3BWL A;  1F5M A;  4L9E A;  2B18 A;  4UQI M;  5HPI A;  2HP5 A;  4KZ7 A;  1XA7 A;  2ZBB A;  3MQQ A;  3UDX A;  4JF5 A;  2V8F A;  4WMC A;  3IQA A;  4HEF A;  2FZ0 A;  4OOY A;  2W1R A;  4LV0 A;  3CUE A;  2HP6 A;  5HWW A;  2HJ9 C;  4JGQ A;  4HQA A;  2DCF A;  4S2N A;  1UWN X;  3D4F A;  4WLA A;  2A3U A;  1PW8 A;  4U0X A;  5DF7 A;  4C75 A;  3VOL A;  5EVI B;  5CEB A;  3MXR A;  4E3O A;  3UNW A;  3VFF A;  1G28 A;  4G3V A;  4EQI A;  2BTF P;  4DRT A;  4NEE D;  4S2I A;  5BOH A;  4F3L A;  4JF4 A;  4LV1 A;  2ZQA A;  3ITB A;  5TBM B;  1UGU A;  1K25 A;  3EWK A;  5CGX A;  5F83 A;  2B95 A;  3K2N A;  2K31 A;  3NIA A;  3NJA A;  1OT6 A;  5HL6 A;  4R0Q A;  5F1F A;  2ZOH A;  4IUH A;  4O01 A;  4CPK A;  4LV2 A;  3UB6 A;  4CQH A;  3LY3 A;  4DN0 A;  1LI0 A;  5FAS A;  4E3L A;  1K54 C;  4WZ4 A;  3B47 A;  4MNR A;  1W5D A;  3L9K A;  3W2Z A;  1LL9 A;  4CLC C;  4X55 A;  4QPR A;  4L9G A;  2ZC6 B;  4HJ6 A;  4QHC A;  4ZTK A;  3PBS A;  1OME A;  3I7J A;  1GSX A;  3F1N B;  4E3N A;  5FEG A;  3HRE A;  2QKP A;  1DP6 A;  2W27 A;  1KE3 A;  5EEC A;  2ZM0 A;  1IYP A;  4KG5 A;  3C2W A;  4BMW A;  3HL9 A;  2LB5 A;  2VKS A;  1W79 A;  3LYX A;  2G2W A;  3K3C A;  1MKM A;  4H8R A;  1GSW A;  2L1M A;  2C6W B;  4PHT A;  4A5R A;  1IFQ A;  3AGD A;  2D02 A;  3IF6 C;  4DKI A;  3T4S A;  3S7Q A;  2HDQ A;  3UE3 A;  5FQI A;  2ZQC A;  5AVF A;  5EFW A;  3LCE A;  5F1G A;  3PBQ A;  2B5R A;  3KYE A;  4C3Q A;  2B02 A;  5M18 A;  4PMA A;  4YNR A;  4Y17 A;  2VGK A;  3T4T A;  5CTM A;  3U2A A;  2HF6 A;  4OVD A;  4RYE A;  4EXO A;  3HLW A;  1N9B A;  2XSS A;  4JXG A;  3UPP A;  4MN5 A;  1H8Y A;  5HDS A;  2IA2 A;  4MEZ A;  4EEU A;  2GZA A;  3P09 A;  3AGF A;  5F6A A;  3SOI A;  4N9L A;  3WS5 A;  2QWS A;  1XGJ A;  2O9C A;  1P0Z A;  1OTE A;  4N1H A;  3P7N A;  4R1G A;  3OPH A;  3UME A;  1SZV A;  1KGF A;  1ALQ A;  3VP0 A;  2FFF B;  4PKY G;  4E3J A;  2M7U A;  2HJE A;  5G4Y A;  2WGI A;  1EI5 A;  3S7O A;  1BYW A;  4BBT A;  1T1C A;  4P6B A;  3T4J A;  2VX8 A;  4MLL A;  5TBM A;  1NLY A;  4Y5F A;  5CEC A;  2XK1 A;  3S7P A;  3FPV A;  4JKT A;  4EV4 A;  2DNS A;  1GA9 A;  4HBT A;  3IX8 A;  1LI9 A;  3CLO A;  4LPZ A;  4P85 A;  3BY8 A;  5EE8 A;  2P7J A;  4HHD A;  2P9V A;  1N9L A;  3MZD A;  3E0Y A;  4JXS A;  5J8X A;  4PPR A;  4JXW A;  3LIB A;  5EVE A;  2JKR I;  3DTI A;  3G2Z A;  3VOZ A;  1VEU A;  4FD8 A;  1MWR A;  4OP5 A;  3F1N A;  2W0N A;  4R4R A;  3OPP A;  5CHM A;  2VGL M;  3FC7 A;  4K91 A;  5HSQ A;  5IT5 A;  3V67 A;  3BM6 A;  4MDZ A;  2ZMF A;  3MFD A;  4BJP A;  2ZL1 A;  4DDS A;  3MFX A;  5FEF A;  5FQK A;  3FPW A;  4MN6 A;  3HJK A;  4KZ6 A;  3VOY A;  1BLS A;  1KVM A;  1ES2 A;  1S1Z A;  3S4X A;  2Q0O A;  3Q7Z A;  1YQS A;  2ZC7 A;  4OQ0 A;  1N4O A;  1PZO A;  3KSI A;  4H6J A;  2YKF A;  1ESI A;  2IWD A;  1WYB A;  4IED A;  1VET A;  4RQ9 A;  1H0M A;  3SH9 A;  1MC0 A;  1STZ A;  2QJ5 A;  1BUL A;  4ME4 A;  4DMZ A;  2H0Y A;  4HI4 A;  3JYI A;  2V1A A;  5JYP A;  4S2P A;  2JC7 A;  4P87 A;  5IU1 A;  4XT2 B;  1K56 D;  2A24 A;  2WK0 A;  2KOI A;  1OTD A;  3GR2 A;  1N9N A;  1E25 A;  1LT0 A;  1XJ4 A;  3UDI A;  4LRZ E;  1NJ4 A;  1AXB A;  4S2N C;  3BJN A;  5CRF A;  2C5W B;  3IWQ A;  2VZW A;  1W8Q A;  3UB9 A;  1NY0 A;  3H9W A;  3VE3 A;  3LR3 A;  1PWG A;  3Q82 A;  2W1T A;  4ESP A;  5J4E A;  2Y2Q A;  4KEN B;  1E3U D;  4WZ5 C;  3CWF A;  1ES4 A;  4E6X A;  3G6O A;  3HCY A;  4X56 A;  3MMH A;  2K7S A;  3NC8 A;  2O0Y A;  2WGV A;  2JKG A;  5G18 A;  3NOP C;  1JWP A;  5D3O A;  3LR4 A;  1C3B A;  3F1P B;  2PBY A;  2VK3 A;  1T1A A;  2Y55 A;  1TEM A;  1IKI A;  2ZOI A;  5J3W A;  1KE0 A;  2QZ6 A;  2PYP A;  4LRY C;  5CX7 A;  1ODV A;  4KQD A;  2WAE A;  5DKK A;  1JNU A;  1DJB A;  3OBF A;  2PHY A;  1XP4 A;  3Q7V B;  3PTE A;  5FL3 A;  3N6I A;  4S2J A;  2J3W A;  4N1X A;  5GLB A;  1Y54 A;  3IXB A;  1I2S A;  4GS9 B;  4ETZ A;  2W3H A;  5F82 A;  3E2L A;  5A93 A;  3IX3 A;  2J7V A;  4BL3 A;  5EM1 A;  2GNX A;  5HWV A;  4CLC D;  3ITA A;  3GTC A;  1JWV A;  3C4O A;  4JPM A;  3GRJ A;  1Q2P A;  4X6T A;  3T1R A;  1XJ2 A;  2W3G A;  1FQG A;  3IX4 A;  3IWO A;  3RTY A;  2WKQ A;  5A90 A;  2M1C A;  2EFU A;  1F98 A;  3ISG A;  2ZQ7 A;  4GCZ A;  2EWV A;  2VLG A;  4GKU A;  3EGD C;  1YLZ A;  5TJJ A;  3KX0 X;  4XT2 A;  2G2U A;  5JYO A;  1BSG A;  2J3T C;  1U60 A;  2JN7 A;  4R6L A;  2OWJ A;  4G3W A;  4GDN A;  3UPO A;  2GDN A;  3LIF A;  1L0G A;  1O7E A;  1T19 A;  1TDL A;  4Y2F A;  1MWU A;  2Z6D A;  1NXY A;  2GX5 A;  1S6R A;  4WUJ A;  3DTM A;  3PBN A;  3ZQ5 A;  4BBU A;  1XXM A;  1ZTU A;  3LI9 A;  1XFN A;  1X0O A;  3GSG A;  4PKY A;  1K6S A;  4R4S A;  1JWZ A;  2Y2N A;  2ZC5 B;  2E8I A;  3C7U A;  4D2O A;  4M4X A;  3UB5 P;  1KDS A;  3QP1 A;  4HOI A;  4IVI A;  4WYY A;  5DJU A;  3DTK A;  1TVF A;  4GB7 A;  4OOM A;  5HL1 A;  1GHM A;  1TD5 A;  3VV4 A;  4BEN A;  5L2F A;  3O88 A;  4U3T A;  2PRF A;  2PBD P;  3W4P A;  3PXP A;  2QYB A;  2V8C A;  3MKE A;  2KX6 A;  3F1P A;  3PBO A;  4GLQ A;  4Q0I A;  2NUP C;  4EBN A;  2ZQ8 A;  2XGN A;  2FFY A;  2V1Z A;  1MXO A;  3PAG A;  4JXV A;  3VFH A;  4Y0T A;  3PBR A;  1K4E A;  3D72 A;  3S7N A;  3B42 A;  3OZH A;  5HAQ A;  2ZJ9 A;  5CTN A;  2Y2K A;  5DF9 A;  1YLP A;  5F68 A;  5GLD A;  3T4O A;  3E4O A;  2XD5 A;  4WM9 A;  1H3Q A;  4BLM A;  4EQ1 A;  3CPT B;  4K0X A;  3ZCZ A;  3VP2 A;  5HDD A;  2X01 A;  3BW6 A;  5AVE A;  4B93 A;  3N8R A;  4FCF A;  1K57 A;  2IWB A;  4KUK A;  3IXD A;  3HLE A;  2XR0 A;  1SKO A;  4PM8 A;  5E2F A;  4QY5 A;  4LRX C;  2JKF A;  3TRC A;  1M6K A;  3S1Y A;  1W63 M;  3F1O A;  3A3J A;  1HTZ A;  1NZO A;  4L9F A;  4JLF A;  5CER A;  1K55 A;  3D3O A;  3SW1 A;  2EX8 A;  3ZFZ A;  1FCN A;  1DRM A;  2HV1 A;  1XKZ A;  3R7W A;  5F69 A;  4LLO B;  3TG9 A;  3T4Q A;  1IYQ A;  3MF0 A;  1BTL A;  4ZJ3 A;  3FYZ A;  2Q9M A;  2ZC3 B;  5AQB A;  1L0F A;  3PBT A;  4IJG A;  4LV3 A;  4GHI B;  1FSW A;  2VA0 A;  3BLS A;  3G34 A;  3BQ8 A;  4BWI A;  3MZF A;  1Y4O A;  3WRZ A;  2XQZ A;  3MXS A;  2JKR M;  4ZDX A;  4ETX A;  1S1Y A;  4GZB A;  3OCL A;  3WS0 A;  4QWO A;  2RL3 A;  5CED A;  2JHE A;  4WEK A;  5HPF A;  4HP9 A;  1PYY A;  3HLB A;  4PAU A;  1OTI A;  3SS4 A;  4LGW A;  2OLU A;  1LSV A;  3UY6 A;  3IBR A;  3SH8 A;  1NYM A;  1MWS A;  5IS1 A;  4II7 A;  4B88 A;  2Y2I A;  5AQ7 A;  4L0L A;  2HZ5 A;  3BFD A;  2MJ6 A;  2OAQ 1;  4DJ3 A;  1RGY A;  4KQR A;  3CJM A;  1LL8 A;  3CI6 A;  3LIC A;  5DKL A;  1TS0 A;  1ESU A;  2AVX A;  1PWC A;  3IXG A;  4BBV A;  3G30 A;  5FA7 A;  3UMD A;  1FR1 A;  3TJZ C;  3A3D A;  4FH4 A;  3HLD A;  4KZ8 A;  1P9R A;  5FQ9 A;  4R3J A;  3A0R A;  5DTT A;  2VJW A;  1A0K A;  1ERO A;  3CMZ A;  1ONG A;  5M19 A;  4OPQ A;  5FAQ A;  3CPT A;  3ZG7 B;  2DMW A;  1KGG A;  3M2K A;  4UA7 A;  5EVI A;  3A3F A;  2ZM2 A;  2Z2M B;  5L8M A;  4CLC B;  3MBZ A;  3T12 B;  3HBR A;  4ZJ2 A;  3H82 B;  3TSG A;  4EBL A;  4WN5 A;  5E2H A;  2OV5 A;  3WRT A;  3ZVT A;  4N9K A;  4DE2 A;  4Y13 A;  1RGZ A;  4R3A A;  3LEZ A;  4Y7P A;  4B4Z A;  4PM6 A;  1GCE A;  1F2K A;  1IKG A;  2WKR A;  5HWT A;  3UN7 A;  2INW A;  4S2M A;  5G4Z A;  3VP4 A;  2VV6 A;  2BLS A;  2EX9 A;  3SH7 A;  4AFI A;  1KGE A;  1K56 A;  1HZO A;  1YPR A;  1VM1 A;  3UPN A;  3D9Y A;  4QD4 A;  3NHQ A;  3BRM A;  1KDW A;  3IF6 B;  1D06 A;  1YLY A;  1K38 A;  4OH0 A;  3MQO A;  3WWX A;  3C38 A;  2OSU A;  2HPB A;  5KSC A;  4WF0 A;  3A3E A;  3IT9 A;  3C4P A;  1E3U A;  2ZLY A;  4K08 A;  4E3I A;  3UDF A;  1YM1 A;  1CEG A;  2J3T D;  2PU2 A;  3CHW P;  3WS4 A;  3IH9 A;  3VSL A;  4UHU A;  1MZU A;  3DTE A;  1CI8 A;  3GMW A;  3EGX C;  1HVB A;  5FI2 A;  4Y0O A;  3BFG A;  4MBK A;  1S66 L;  3IWI A;  3UE0 A;  5DTS A;  3ICY A;  1F9I A;  4QY6 A;  1NLZ A;  3N4I A;  2M7V A;  1L2S A;  4I5S A;  1S4R A;  1OTB A;  1S0W A;  1FIK A;  4XUX A;  3ZG9 B;  5E2G A;  4O7D A;  1CI9 A;  2X02 A;  2XA7 S;  3CUE C;  3BEB A;  3V3S A;  1IEM A;  4HES A;  1ZKJ A;  3KSF A;  4MMN A;  2HDS A;  2ZM8 A;  5CGW A;  5GHZ A;  1PRQ A;  2UV0 E;  2ZC4 B;  3QP4 A;  2JE5 A;  4S2O A;  3KSG A;  2JKT I;  2Y59 A;  3DWK A;  3L7H A;  4D60 A;  1HLU P;  3DWZ A;  1XJ6 A;  3E98 A;  5KZH A;  3PR6 A;  3C7V A;  2PR6 A;  4M3K A;  3UB8 A;  4HH3 A;  1FIL A;  2ZQ9 A;  3NUL A;  4CLC E;  4G3K A;  4R38 A;  1K54 A;  2EA9 A;  2H5S A;  4MN7 A;  3ULF A;  3ZYT A;  4CLC A;  2XEP A;  2ZMA A;  4GDB A;  4CJN A;  3FV7 A;  5HAR A;  5HD3 A;  1ONH A;  3GV9 A;  2EX6 A;  3BEC A;  1NWZ A;  5HDC A;  4YWZ A;  4KG6 A;  5FQM A;  1TS6 A;  3Q07 A;  4FSF A;  4HNB A;  3MJQ A;  2XRN A;  3OCN A;  1FCM A;  3IS2 B;  3KSH A;  4DE3 A;  5J7E A;  2WAD A;  2R78 A;  2OWH A;  3MQ0 A;  1P97 A;  3ZGA B;  2ZMV A;  3W8K A;  1G68 A;  2Q9N A;  2XH9 A;  4OKP A;  4EES A;  3M6H A;  4WEJ A;  3VMA A;  4X1M A;  4KG2 A;  3W4O A;  2QHK A;  4X53 A;  4R23 A;  1Q2Q A;  3SS5 A;  2XF3 A;  3HUO A;  2P08 A;  1GHI A;  3EQV A;  1E4D A;  3LID A;  1VB6 A;  4P6Z S;  1D7E A;  2EXA A;  5DFY A;  1OJG A;  5GHY A;  5HX9 A;  1JVJ A;  1DY6 A;  2QJ7 A;  2Y79 A;  3G31 A;  3CG5 A;  3JVV A;  1I2W A;  4C6Y A;  2V20 A;  1ES3 A;  1GA0 A;  4I3I A;  4YFM A;  4EUZ A;  1NRJ A;  1MY8 A;  5DTK A;  4E6W A;  5DVA A;  1D1J A;  2NUT C;  1S4S A;  3QP5 A;  4OPZ A;  2HDU A;  3A0V A;  4NET A;  4F3L B;  1FSY A;  5CHJ A;  4BL2 A;  3N7W A;  4DE1 A;  2DRW A;  1PZP A;  3VSK A;  2I72 A;  3CIT A;  3PYP A;  3A3I A;  1CJF A;  2WUQ A;  3R4K A;  4ARZ B;  4Q0J A;  4FTX A;  3HUM A;  2UWX A;  4QJG A;  4DJ2 A;  1LSX A;  4QB8 A;  5EM0 A;  3TE8 A;  1W8Y A;  3HJI A;  2Y2M A;  5HZH A;  3HLF A;  2PU4 A;  1NRF A;  1IOU A;  3V5M A;  4Q0H A;  2V0U A;  2H10 A;  1YT4 A;  2BAS A;  5EVI C;  3HLG A;  4KZA A;  5GLA A;  4EW7 A;  4ID4 A;  2QMI A;  3OLO A;  3VP1 A;  3MXQ A;  3FWL A;  3MKF A;  2WGW B;  1EWZ A;  4DE0 A;  3UE6 A;  3EOI A;  1MPL A;  3RFB A;  1ES5 A;  4FH2 A;  4HIA A;  4MBH A;  3ZNY A;  1RP5 A;  1SKF A;  3NOU C;  4OP8 A;  3LY4 A;  1DP8 A;  2PD8 A;  1Z09 A;  3NDG A;  4RVA A;  3G4P A;  4Y15 A;  1MWT A;  1V9Z A;  3LEQ A;  2G7U A;  3OC2 A;  1XA1 A;  3O5Y A;  3ZNT A;  1BLC A;  1VHM A;  5FQQ A;  5IHV A;  1PWD A;  2Y2P A;  2RCX A;  4PM9 A;  3ZVW A;  1PIO A;  4GN2 A;  3HVF A;  1L0D A;  2Y91 A;  2EFX A;  3C30 A;  4HP4 A;  1AWI A;  1VQQ A;  1W7F A;  3FKW A;  3Q7V A;  3V50 A;  5FDS A;  5I5L A;  2D01 A;  3MZE A;  3QNC A;  2H28 A;  4O0P A;  4FOF A;  1M40 A; 
#chains in the Genus database with same CATH homology
 1P9W A;  4RQ9 A;  2V9A A;  3KO6 A;  4GS9 A;  1H8M A;  2EWW A;  4HJ4 A;  1TS7 A;  4HY8 A;  1MC0 A;  1STZ A;  2QJ5 A;  3KYQ A;  4BBV A;  4EU0 A;  4ME4 A;  4DMZ A;  3UMD A;  1UWP X;  4HI4 A;  3TJZ C;  3IBJ A;  1KOU A;  4NKP A;  1P9R A;  2V1A A;  3A0R A;  4Z1W A;  5LBR A;  2VJW A;  5IU1 A;  4XT2 B;  5AJG A;  2A24 A;  3F1O B;  2FH5 A;  3LIE A;  2A2L A;  2KOI A;  1OTD A;  4R70 A;  1N9N A;  1YKD A;  4ZRR A;  4NXE A;  4YOF A;  1LT0 A;  1XJ4 A;  2DMW A;  2OOL A;  4LRZ E;  2W3F A;  2HGV A;  3BJN A;  5L8M A;  4CLC B;  2VZW A;  4UQI S;  2PD7 A;  5HD5 A;  3UB9 A;  3H9W A;  3H82 B;  3R7W B;  4WN5 A;  3VE3 A;  3LR3 A;  2W1T A;  3NOT C;  5J4E A;  1YSP A;  4R3A A;  1GSV A;  3KYZ A;  2K2N A;  4ARZ A;  3CWF A;  3GEC A;  1LSW A;  4HJ3 A;  2J80 A;  2WKR A;  5HWT A;  3G6O A;  3HCY A;  3K3D A;  3MMH A;  1V9Y A;  5KSH A;  2INW A;  3UB7 A;  2K7S A;  2YKH A;  5G4Z A;  2LB9 A;  4MCW A;  2VV6 A;  4AFI A;  2O0Y A;  4JGR A;  2KDK A;  3RH8 B;  2V1B A;  3NOP C;  3NHQ A;  3C8C A;  3LR4 A;  1D06 A;  3F1P B;  1W63 Q;  1G6O A;  3LR0 A;  1T1A A;  5A8B A;  3MQO A;  4I3J A;  3C38 A;  1TS8 A;  1ZHH B;  2ZOI A;  3IS2 A;  2PYR A;  4B9O A;  5J3W A;  4WF0 A;  4NXF A;  3T4K A;  2Z6C A;  2W3D A;  5K5B A;  2PYP A;  4GJ4 A;  4LRY C;  3JVU A;  4JGO A;  2Y8H A;  1ODV A;  5CX7 A;  4KQD A;  1Y28 A;  5DKK A;  1JNU A;  3OBF A;  4K08 A;  2PHY A;  1T1B A;  4GW9 A;  5FL3 A;  3BWL A;  2J3T D;  2J3W A;  1F5M A;  4H6J B;  4L9E A;  2VV7 A;  3LFV A;  4NXB A;  1MZU A;  2B18 A;  4UQI M;  5HPI A;  3EGX C;  2ZBB A;  3MQQ A;  1OTA A;  4I38 A;  1S66 L;  4GS9 B;  5KIZ A;  3ICY A;  2FZ0 A;  4ETZ A;  2W3H A;  1F9I A;  2PT7 A;  2W1R A;  1NLZ A;  3CUE A;  2M7V A;  4I5S A;  1S4R A;  1OTB A;  2GNX A;  5HWV A;  5HWW A;  2HJ9 C;  3E4Q A;  4JGQ A;  4CLC D;  4HQA A;  2W3E A;  1UWN X;  4WLA A;  2A24 B;  4IUK A;  1XJ3 A;  2PDR A;  3DBA A;  3LR5 A;  2XA7 S;  3CUE C;  1OJ5 A;  1XJ2 A;  2W3G A;  5DFX A;  3VOL A;  1YAX A;  3RTY A;  3KSF A;  4MMN A;  2WKQ A;  5DJT A;  4I39 A;  4EET B;  1G28 A;  2JKT M;  2M1C A;  2V0W A;  4G3V A;  1F98 A;  2OAP 1;  3KSG A;  2W1T B;  2JKT I;  4NEE D;  4GCZ A;  2EWV A;  4Y3I A;  2VLG A;  3BY9 A;  4F3L A;  1XJ6 A;  3E98 A;  3EGD C;  5TJJ A;  3KX0 X;  3PR6 A;  2O9A A;  4XT2 A;  5TBM B;  1UGU A;  2PR6 A;  2O99 A;  3EWK A;  2J3T C;  3UB8 A;  4HH3 A;  3K2N A;  2JN7 A;  4R6L A;  2OWJ A;  4CLC E;  2K31 A;  4G3W A;  3NJA A;  1OT6 A;  4G3K A;  3LIF A;  4R38 A;  5HL6 A;  2ZOH A;  2EA9 A;  1T19 A;  2I9V A;  4MN7 A;  3ULF A;  4IUH A;  4Y2F A;  4KQO A;  3ZYT A;  4CLC A;  4EER A;  4O01 A;  2Z6D A;  2L0W A;  3H7W B;  2GX5 A;  4WUJ A;  3PBN A;  3ZQ5 A;  3UB6 A;  4BBU A;  4CQH A;  1ZTU A;  3LI9 A;  4DN0 A;  1XFN A;  1X0O A;  5HD3 A;  1TF1 A;  3B47 A;  4PKY A;  3W2Z A;  4CLC C;  4QPR A;  1NWZ A;  4L9G A;  5HDC A;  4YWZ A;  1S67 L;  4HJ6 A;  3PBS A;  1TS6 A;  1GSX A;  4FSF A;  3F1N B;  3MJQ A;  4HNB A;  2XRN A;  3OCN A;  3IS2 B;  3KSH A;  4JGP A;  2CMN A;  3EEA A;  2QKP A;  1DP6 A;  2W27 A;  4M4X A;  5J7E A;  2R78 A;  4HOI A;  2OWH A;  3MQ0 A;  3C2W A;  1P97 A;  4BMW A;  5DJU A;  4NXG A;  2ZMV A;  2LB5 A;  2VKS A;  4GHI A;  4OOM A;  1TD5 A;  3VV4 A;  4EES A;  4WEJ A;  3LYX A;  2XA7 M;  3K3C A;  2QHK A;  3PXP A;  1MKM A;  2QYB A;  1T18 A;  2KX6 A;  2P08 A;  1GSW A;  2L1M A;  3F1P A;  3PBO A;  4GLQ A;  2KLI A;  4Q0I A;  3EQV A;  2NUP C;  3LID A;  1VB6 A;  4P6Z S;  4PHT A;  1D7E A;  5DFY A;  1IFQ A;  1EW0 A;  2PR5 A;  1OJG A;  1OT9 A;  2D02 A;  3MR0 A;  3T4S A;  3S7Q A;  4E04 A;  4HH2 A;  3UE3 A;  1WA9 A;  2QJ7 A;  5AVF A;  3PBR A;  5EFW A;  3D72 A;  2VEA A;  2Y79 A;  3PBQ A;  3S7N A;  3B42 A;  3B33 A;  2B02 A;  3JVV A;  4OOL A;  5F5Y A;  4YNR A;  2L4R A;  5DF9 A;  3T4T A;  5F68 A;  3U2A A;  3T4O A;  2HF6 A;  3E4O A;  4I3I A;  1H3Q A;  4EQ1 A;  1NRJ A;  4EXO A;  4UEY A;  5HDD A;  2XSS A;  3BW6 A;  4WEL A;  2NUT C;  5AVE A;  1S4S A;  4B93 A;  4MN5 A;  5HDS A;  3EQU A;  2IA2 A;  4EEU A;  1XFQ A;  4KUK A;  2VGL S;  2GZA A;  3A0V A;  4F3L B;  4LRX C;  5F6A A;  3TRC A;  3CIT A;  3PYP A;  2QWS A;  3T50 A;  2O9C A;  1P0Z A;  1OTE A;  3P7N A;  3R4K A;  4ARZ B;  1W63 M;  4Q0J A;  3VE4 A;  3F1O A;  4L9F A;  4DJ2 A;  1LSX A;  3UME A;  3TE8 A;  1OPX A;  3LI8 A;  3HJI A;  5HZH A;  3D3O A;  3SW1 A;  2P04 A;  2VV8 A;  1DRM A;  2HV1 A;  1IOU A;  2XRO A;  4PKY G;  1DP9 A;  2M7U A;  4Q0H A;  4EUV A;  2V0U A;  2HJE A;  3H82 A;  3R7W A;  2BAS A;  2O9B A;  5G4Y A;  5F69 A;  3S7O A;  3E4P A;  1BYW A;  4LLO B;  4P6Z M;  4BBT A;  1T1C A;  3T4J A;  4EW7 A;  2VX8 A;  5TBM A;  1NLY A;  4Y5F A;  3T4Q A;  3LUQ A;  3MF0 A;  3GDI A;  3OLO A;  3TW8 A;  3MXQ A;  3S7P A;  3FPV A;  4EEP A;  5C5K A;  3PBT A;  3UE6 A;  1YSQ A;  4IJG A;  3EOI A;  3H7W A;  4GHI B;  3RFB A;  3CLO A;  4HIA A;  2GJ3 A;  1N9O A;  4LPZ A;  3BY8 A;  2VA0 A;  2P7J A;  4HHD A;  3BQ8 A;  3NOU C;  4BWI A;  1N9L A;  1DP8 A;  2PD8 A;  5MC7 A;  3E0Y A;  2JKR M;  4ETX A;  3LIB A;  3CAX A;  1S1Y A;  3OCL A;  2JKR I;  1V9Z A;  3FG8 A;  2G7U A;  3F1N A;  3OC2 A;  3LIA A;  2W0N A;  3O5Y A;  4IHQ A;  3EEH A;  2JHE A;  1VHM A;  4WEK A;  3T4L A;  5HPF A;  4HP9 A;  4PAU A;  1OTI A;  2VGL M;  3FC7 A;  5HSQ A;  5IT5 A;  3V67 A;  1LSV A;  4MDZ A;  2ZMF A;  4BJP A;  3OOV A;  3MFX A;  3IBR A;  3FPW A;  4MN6 A;  3HJK A;  5IS1 A;  4II7 A;  4KUO A;  1S1Z A;  3C30 A;  3BQA A;  4HP4 A;  4L0L A;  4O8G A;  3A0S A;  2MJ6 A;  2OAQ 1;  4WL9 A;  4DJ3 A;  3KSI A;  5I5L A;  2D01 A;  2WKP A;  4H6J A;  1LL8 A;  3PHY A;  2YKF A;  3CI6 A;  3LIC A;  4I3A A;  5DKL A;  1TS0 A;  2H28 A;  3P01 A;  4O0P A;  4FOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...