2ZOHA

X-ray crystal structure of photoactive yellow protein, wild type, at 295k
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Low-barrier hydrogen bond in photoactive yellow protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2zohA00
4LRYC 4NXGA 2YKHA 4EW7A 5F68A 4R6LA 3LIAA 2L1MA 3LUQA 5AVEA 3UE6A 3EEHA 1S4RA 4WL9A 3UMDA 3PHYA 4LLOB 1P97A 4WUJA 2VV7A 3MQQA 1OTBA 2PHYA 4GHIB 1ODVA 4K08A 1G28A 1X0OA 2L0WA 3UB6A 4BBVA 4EQ1A 1EW0A 4HH2A 4HHDA 3HJIA 4HQAA 4HJ6A 5F69A 1OT9A 4R38A 5HDDA 3RTYA 4EERA 1T18A 3MQOA 2HV1A 1UWPX 2QKPA 2V0UA 3IS2B 4KUOA 3FC7A 2QJ5A 3F1OB 2QHKA 2OWJA 3BWLA 3F1PB 3NJAA 4JGRA 4NXBA 3MR0A 4HNBA 4JGPA 2QWSA 5F5YA 3EWKA 1NWZA 4DJ3A 2ZBBA 4PKYA 1XJ2A 4WLAA 4EXOA 3CLOA 4GS9B 1D7EA 2PD7A 4F3LB 5G4ZA 5KIZA 5HD5A 1OT6A 4LPZA 3MXQA 1TS7A 1KOUA 1VB6A 1GSWA 3B33A 2PDRA 3LYXA 4HJ3A 3OLOA 4NXFA 4RQ9A 5J4EA 1S4SA 4GCZA 4B9OA 4I5SA 2W27A 4L9FA 1N9LA 1OTAA 2VEAA 1P0ZA 2B02A 3BY9A 3NOUC 1OJ5A 3ZQ5A 1DRMA 2Z6DA 3F1PA 3GECA 1OTEA 2OWHA 4KQDA 4PKYG 1LSWA 2R78A 4LRXC 3CAXA 3LICA 1S67L 3D72A 4JGOA 1LSVA 4XT2B 1XJ6A 3E4PA 5DJUA 2KDKA 2A24B 1OTDA 1XJ3A 1XFNA 3NOTC 2L4RA 4HJ4A 3VOLA 2CMNA 2H28A 3UB8A 2PD8A 3ICYA 3HJKA 1N9NA 3LIBA 2WKPA 4R70A 4DJ2A 4GW9A 2PYPA 3LIFA 5HD3A 4YWZA 4M4XA 1F9IA 3FG8A 3LI8A 2PR6A 2K7SA 2P7JA 1T1AA 5HWTA 4EESA 4HI4A 1N9OA 3G6OA 3IS2A 5DJTA 5DKLA 5TBMB 4BBTA 4E04A 1OJGA 1V9ZA 3A0SA 5DKKA 1D06A 3NOPC 4HH3A 4I3IA 2VV8A 1TS6A 1S66L 2PYRA 1GSVA 2QJ7A 4HOIA 2WKQA 1T1BA 5HZHA 2ZOIA 5EFWA 5HWWA 3MJQA 4GS9A 3K3CA 1LSXA 4KUKA 3RH8B 1OTIA 1BYWA 1LT0A 1WA9A 4I39A 1DP9A 4LRZE 2W0NA 3UB7A 3UMEA 4MN6A 1XFQA 5J3WA 3UB9A 2D02A 2JHEA 2M1CA 5HSQA 1XJ4A 1MZUA 2V9AA 4WN5A 4EEPA 4H6JB 3H7WB 3LIDA 3SW1A 2A24A 4EETB 2PR5A 3IBRA 3F1NB 1V9YA 1Y28A 1DP6A 5G4YA 2GJ3A 2ZOHA 1TS0A 2EA9A 3T50A 3H82B 3ULFA 3F1OA 2OOLA 2INWA 3GDIA 3H7WA 4L9GA 3A0RA 3E4OA 4R3AA 4H6JA 3PYPA 4HIAA 5IS1A 4XT2A 3H9WA 5I5LA 3P7NA 4GHIA 2YKFA 4HP4A 4HY8A 3LIEA 4EEUA 4F3LA 5HWVA 3H82A 2VLGA 4I3JA 2I9VA 1GSXA 2KX6A 2V0WA 3F1NA 5AVFA 1UGUA 1DP8A 5J7EA 1T19A 5HDCA 2Z6CA 4I38A 2V1BA 3A0VA 2JN7A 3C2WA 3CWFA 3VE4A 1S1YA 1T1CA 2BASA 4BBUA 3MFXA 1JNUA 3NHQA 3K3DA 2J80A 1S1ZA 4L9EA 2VV6A 5TBMA 3LI9A 3KX0X 1F98A 2WKRA 4HP9A 5HDSA 3C8CA 3VE3A 5IU1A 3BY8A 4MN5A 5A8BA 4JGQA 4NXEA 1TS8A 1LL8A 3E4QA 4WF0A 4I3AA 5F6AA 2D01A 2V1AA 1UWNX
chains in the Genus database with same CATH superfamily
4YOFA 4R6LA 3MKFA 5GLCA 3PAGA 3PAEA 3HJIA 1OT9A 3RTYA 4MCWA 3V67A 1PW1A 4G3WA 2QHKA 5JYPA 3BM6A 4LCLA 4OQHA 4EXOA 5GHYA 4K91A 2Y91A 3GQZA 3LYXA 4Y0UA 4NXFA 3HLWA 2KLIA 1OTAA 3BY9A 4LFUA 3Q07A 2Z6DA 2XA7M 3TW8A 3S22A 3UB5P 3VOLA 1XFNA 4DJ2A 3GV9A 4X53A 4HBTA 3BQAA 4CJNA 4QY6A 1H3QA 1MWRA 3ISGA 1HZOA 4CLCA 3D9YA 2W0NA 1FSWA 1XFQA 3T4OA 4JF6A 3PBRA 1K57A 2XEPA 4AFIA 3NBLA 4KZ6A 4QWOA 5G4YA 1TS0A 1EI5A 5FQ9A 4IHQA 1KDSA 3HUMA 5FI6A 5HL6A 2GZAA 2Y8HA 5HDCA 1FR6A 4OOLA 4L0LA 1S1ZA 4ZJ3A 1FCMA 3A3JA 3BFGA 1YLZA 3QP6A 4WF0A 4I3AA 4ZBEA 2D01A 3VP2A 4E3MA 1SCWA 1JVJA 4EW7A 4MMNA 3UE6A 5CXWA 1P97A 3ZCZA 3PBOA 2L0WA 3UB6A 2Y2QA 3C38A 4P0MA 5EVIB 4EERA 1T18A 4X55A 3F1OB 3FPVA 3JVVA 1QMFA 4BQMA 4GS9B 3IBJA 1MC0A 5FAPA 1W8QA 4N1XA 1PIOA 1S4SA 1SDEA 4K0XA 2E8JA 3LFVA 1OJ5A 1I2SA 4D2OA 1K6RA 1LSWA 1YT4A 3LR5A 3D72A 2KDKA 2EFXA 3UB8A 4Z1WA 3WS5A 3LIBA 2PYPA 2PAVP 3FG8A 3Q81A 5F1FA 4KZ3A 4PMAA 2WYXA 3IXHA 1V9ZA 4BBTA 2XROA 2OSUA 2QPNA 3R7WB 3UE1A 4G3KA 3ITAA 4PM5A 4Y0TA 1GA9A 4KQRA 5HSQA 4KG5A 3P98A 4UA7A 2PU2A 2VKSA 2OOLA 3GDIA 1L0EA 2DNSA 2ZC5B 4H6JA 3PYPA 4JBFA 5KMWA 5IS1A 2FZ0A 1ACFA 4GHIA 2YKFA 4OPRA 2ZQ9A 3H82A 1TF1A 4RYEA 3SOIA 2HP5A 2P74A 4BBUA 3GMWA 1TDGA 3G30A 4KZ5A 4YFMA 3K3DA 5KZHA 4QD4A 4Y5FA 3FZCA 1YLYA 2C5WB 5HAPA 3LY4A 4O0PA 3LGOA 1W8YA 3VSLA 4X6TA 4IUHA 4BMWA 3WS4A 4OQ0A 3UMDA 1OTBA 3UPNA 1L0FA 2EX9A 4DE2A 1CJFA 4FUWA 4QB8A 1DY6A 2M7UA 3G31A 1IYSA 2ZL1B 2ZBBA 1IKIA 1ZC2A 4IVKA 1GCEA 2HP6A 3ZGAB 2B02A 4Y17A 3F1PA 3NDGA 2Y2IA 2EXAA 4JGOA 5FAOA 1PZOA 1KE4A 3KYQA 3T1RA 2K7SA 1BZAA 4GOGA 1N9OA 4S2JA 1OJGA 5TJJA 1JWPA 1PYYA 4Y3IA 1S66L 3JVUA 2A49A 2Y2OA 5CGXA 3C5AA 3NULA 3U2AA 4DF6A 2ZQ8A 2ZQDA 3DWKA 2H5SA 2W1TA 3C30A 2M1CA 3NY4A 1XJ4A 2V9AA 4JF4A 4EBLA 5HARA 1DP6A 3C4OA 4XUZA 4IBRA 2JE5A 2R9XA 3HUOA 3MXSA 3UPPA 1GSXA 3F1NA 3FPWA 2BLSA 1FIKA 5DFYA 4BWIA 2P04A 4QJGA 2ZMFA 3IH9A 1XPBA 2WUQA 4FTXA 2JC7A 2O9BA 4HP9A 5CHUA 2WK0A 1YSQA 4X1LA 3SH8A 2LB9A 5GLBA 4QU3A 1MKIA 5KSCA 1K25A 3BYDA 1ZHHB 1QMEA 1NLYA 2VV7A 1KGFA 1XP4A 4OOMA 2B95A 3N8RA 2W3HA 4OOYA 3T4KA 3F1PB 2X02A 2JKGA 1W7FA 1MPLA 1OT6A 4P6ZS 1KOUA 3B42A 2PDRA 3DW0A 3WRZA 2ZM8A 1P0ZA 3CAXA 5K5BA 1LSVA 1XJ6A 3ZDJA 3SS5A 2XA7S 2O99A 3WWXA 4CLCB 3MSHA 1ESIA 2DMWA 4E04A 4WEJA 4B93A 1TD5A 2XFTA 2HGVA 2Q9MA 2ZOIA 1J3WA 1K4FA 4EWFA 1ERMA 3CHWP 3RH8B 1OTIA 2VGJA 5HPIA 2PRFA 3IHAA 5CGWA 4EETB 3F1NB 1Z09A 3G4PA 2ZOHA 3ULFA 2ZC6B 5CHJA 3M6BA 2KOIA 3IWOA 4EV4A 2XLNA 4BD1A 5FQIA 4RX3A 4E3JA 4Q0JA 5A8BA 2H0TA 3VV4A 5DVAA 1FOFA 1ERQA 3WS0A 2G7UA 3T1XA 1L0GA 3ZG9B 1CK3A 4II7A 4LLOB 3ZVWA 3MQQA 4K08A 1KVMA 2X71A 4LGWA 5FI7A 1BUEA 3UE3A 3GRJA 3O3VA 3UNWA 3B3XA 2Y2HA 4XXRA 3QP8A 1GSWA 2WGIA 5FQKA 3GVBA 4L9FA 4O8GA 3Q7VB 2VK3A 3E4PA 1E3UA 2CMNA 3BW6A 4JXSA 5CX7A 4S2IA 2Y2KA 5HWTA 4X1MA 1YSPA 4HI4A 1KGEA 1W5DA 1STZA 2VGKA 4HOIA 2WKQA 1K6SA 4KQOA 3V3SA 3D4FA 3UE0A 3CUEC 3T4SA 3QNCA 2OV5A 4H6JB 3FKVA 4P6BA 4D60A 1P9WA 3BFEA 1VEUB 5HL1A 4UHUA 3A0RA 2Y2GA 4DRTA 3LIEA 3MFDA 1FQGA 2V0WA 2ZQCA 4PM8A 3SH7A 5LBRA 4I38A 2QZ6A 3HVFA 1WYCA 4S2MA 3NHQA 2V20A 4BL2A 3NC8A 2AVXA 3JYIA 4LENA 4Q0HA 1MWUA 2P08A 5HDSA 3Q1FA 1VETB 3CUEA 4MN7A 4ID4A 2Q0OA 1D1JA 4O7DA 5TR7A 1DJAA 2NUTC 3EEHA 2HJEA 4WL9A 2ZL1A 3HCYA 1FCNA 3OOVA 3W8KA 4U3TA 3BFFA 4FD8A 3WS1A 3CITA 3C7UA 5E2HA 1SKOA 1XA1A 5AQ9A 3VP4A 1L2SA 1S6RA 3Q7VA 1NZOA 4JGPA 2QWSA 3EWKA 2EWWA 2J3TD 1PZPA 4ZTKA 5GHZA 4E3IA 4ZJ1A 4ZJ2A 1TS7A 3IX8A 3IWIA 2XDMA 1IYPA 3IWQA 4YINA 4PKYG 4XT2B 1G6AA 4HJ4A 2PD8A 2QMIA 4MBKA 3MS6A 2O0YA 1F9IA 1PRQA 2P7JA 4C6YA 4DXBA 1K54C 1ONHA 1GSVA 1C3BA 3PTEA 1T1BA 2BG1A 4MNRA 5FI2A 1MY8A 4MLLA 3UB7A 1LT0A 1U60A 2D02A 1OPXA 1LLBA 3LIDA 2ACGA 5M18A 2Y2MA 1I2WA 5FQQA 3ZG0A 3FKWA 4F3LA 4KZ4A 2VLGA 4I3JA 4C75A 2P9VA 3CWFA 3VE4A 4ETZA 4GJ4A 1XKZA 3VE3A 5L07A 3IF6B 2PT7A 4IEDA 5F82A 2OAQ1 2EX8A 4UA6A 3ZNTA 3ZYTA 2W3DA 5F69A 1PFLA 3G2ZA 5HPFA 4KUOA 5CTNA 2B5RA 3P01A 4UA9A 2FH5A 5HD5A 3OPPA 1VM1A 5M1AA 3OLOA 4GCZA 2WKHA 2ZC7A 2X01A 2OWHA 1SKFA 2IA2A 3KSFA 2L4RA 3SZTA 1I5QA 4S2NC 1PI4A 4X68A 2V8FA 3IS2A 5DJTA 3TOIA 4PPRA 5IT5A 1D06A 4I3IA 3CJMA 2PYRA 5EVID 4DE3A 5FEGA 3VP3A 4WZ5C 5HZHA 5HWWA 4GS9A 3ZVTA 3NECA 3OC2A 4MDZA 3M2JA 4CLCC 4WELA 4B88A 4GD6A 5FDHA 4Y2FA 1MZUA 2IWDA 4EEPA 5E43A 2A24A 5TGFA 3L9KA 3HLBA 1FR1A 4JXGA 5A91A 3T50A 5L09A 3HREA 1XXMA 4XT2A 1VHMA 4Y13A 2ZC3B 3VP0A 4LCMA 3C2WA 1KGGA 2J8YA 3MFXA 3MMHA 5EUAA 1ES4A 5HAQA 2E8IA 3LI9A 5G18A 1F2KA 4WZ4A 4S2PA 3IXBA 4GLQA 2QKPA 2WAEA 3TSGA 2VX8A 5HFOA 5EECA 3S7PA 3OPHA 1GHIA 3G2YA 1K56D 3BJNA 5C5KA 2OWJA 1EWZA 3MZDA 3LR4A 1VB6A 5DTKA 1F5MA 2HJ9C 1DJCA 1YQSA 3OCLA 4M3KA 1YLJA 2EXBA 4R70A 1BULA 1YLWA 3C7VA 4Y7PA 3IF6A 3RXWA 3LI8A 1YLTA 1T1AA 3PBSA 5DF9A 1BTLA 4A5RA 4MBFA 1IFQA 3AGFA 4KUKA 1LI0A 1OMEA 1Q2PA 1LI9A 2WADA 2XFSA 4EUZA 3DTKA 3SS4A 4NETA 2GJ3A 5CGSA 3H82B 4R3BA 1L3LA 2CC1A 2G2WA 4EEUA 2EWVA 1DP8A 4O01A 2Z6CA 2V1BA 4PM7A 4BENA 1S1YA 2BASA 5CEDA 3RXXA 3T1SA 1O7EA 3HBRA 2VV6A 4BD0A 1RCJA 4UQIS 2XF3A 3Q82A 3S1YA 3M6HA 2J9OA 1YPRA 1TS8A 1MWTA 3ZG8B 1UWNX 4R4SA 1BLSA 1NY0A 3G32A 1H8MA 3EEAA 4P87A 3CZDA 1JWVA 1IKGA 1H8ZA 4DXCA 1SDNA 4S2OA 2H10A 2V0UA 5FA7A 4WYYA 3HLCA 4G3VA 4HNBA 3LY3A 1TEMA 5EM0A 1FSYA 1XJ2A 3C4PA 2PD7A 2WKEA 1ZTUA 3Q7ZA 5MC7A 1IOUA 4GKUA 3LICA 2K31A 5DJUA 3N8LA 2WZXA 3LIFA 4WBGA 3NDEA 5EPHA 2PR6A 2HZ5A 3MQ0A 5EV0A 1LHYA 5DKLA 5DKKA 1JTGA 4JF5A 1RP5A 4NG2A 1NYMA 3K3CA 5CHMA 1BYWA 5J8XA 1ES5A 4X25A 5GLAA 3SW1A 2V8CA 3N8SA 3GTCA 1W63M 4E6XA 3HLDA 1PWDA 4R3AA 1YKDA 4R4RA 3H9WA 2GX5A 4HP4A 4HY8A 4OVDA 2R9WA 1NLZA 4WMCD 3AGEA 1CI8A 4DE0A 4YNRA 4CPKA 3T4LA 3N7WA 3UN7A 4OQGA 2ZMVA 5F6AA 2IWCA 4FH2A 4PHTA 4RX2A 1PW8A 4R1GA 5AVEA 5BOHA 4B4XA 3PHYA 3VMAA 4GHIB 4OP8A 4Z9QA 4DDSA 5DF7A 4GDBA 1G68A 3BWLA 4EUVA 3KYEA 4HESA 2XQZA 3SS3A 4EBNA 3D3OA 3PR6A 4P6ZM 5CERA 1O07A 5G4ZA 3ZNYA 5I94A 1CEGA 5A92A 3B33A 4HJ3A 2Z2LB 2Y2JA 1DJBA 3VP1A 2PBYA 3GECA 4KQDA 5KSHA 1AXBA 2ZMAA 3NOTC 4RVAA 1N4OA 3HLFA 3R7WA 4YWZA 3CG5A 4M4XA 4NEED 4OPQA 4XUXA 2ZLYA 4CLCE 2JCHA 3A0SA 3DTMA 2VV8A 1TS6A 1G5UA 5EFWA 1JTDA 3MBZA 5EOEA 4IJGA 3BQ8A 1XGJA 2W3GA 1FCOA 1A0KA 4WN5A 5AQBA 5E2FA 3V3RA 2EX6A 3HUNA 4GN2A 3KSGA 2INWA 3H7WA 3ITBA 3O88A 3A3FA 3P7NA 1L0DA 4K0WA 5AVFA 5J7EA 3DTIA 1N9BA 2JN7A 3NIAA 5GHXA 4KZ9A 3T12B 2HPBA 3HLGA 2J3WA 4QPRA 3RJUA 4ZRRA 1KE0A 3V5MA 2Y2NA 5FATA 1CF0A 4R38A 5HDDA 3IXDA 3MQOA 3ZHHA 2HV1A 4JGRA 2EFUA 1SHVA 5GL9A 4PKYA 5KIZA 1E3UD 1FILA 3MXQA 5J4EA 1K54A 4FSFA 3VFHA 2JKTM 3V39A 2DCFA 3BLMA 1W79A 1ES2A 2Q9NA 4IVIA 3UDXA 1N9NA 3DBAA 5AJGA 4F94A 1VETA 3N4IA 3ZG5A 1XA7A 3SH9A 2V2FF 3OPRA 4WEKA 3NOPC 2ZD8A 4HH3A 2HDRA 5EE8A 4R3JA 1GHPA 3PBQA 1K38A 4LRZE 1WA9A 4EU0A 4E3LA 1PWGA 4MN6A 4ETXA 1NRFA 1LL5A 3LO7A 1MKMA 5HW3A 1NYYA 5EVLA 3A3EA 1V9YA 1Y28A 3IX4A 4OP5A 4UQIM 3UY6A 4HIAA 4P85A 2A2LA 2XRNA 3MKEA 4NK3A 3T4QA 4ESPA 4LV0A 4OPZA 5JYOA 3O5YA 4OLDA 2ZM0A 3EGDC 4PM6A 1YAXA 1LL8A 1IYOA 2PBDP 4MBHA 3LIAA 1K4EA 3VOZA 2PHYA 3I7JA 2Y2PA 4EQ1A 1XGIA 4HH2A 4HQAA 4HJ6A 3MZFA 3FC7A 1H5XA 2QJ5A 5DFXA 3FYZA 5A93A 1NRJA 3KO6A 4R23A 3IQAA 5AQAA 5F83A 4F3LB 5GLDA 1GHMA 2DRWA 3QNBA 4GB7A 5EVEA 1PI5A 2W27A 3MXRA 4GZBA 3BEBA 4C3QA 3B47A 1S67L 4OONA 4NKPA 2I72A 4N9LA 4S2LA 3ICYA 2WKPA 4BL3A 5AQ7A 3CMZA 2JKFA 1K55C 3HLEA 4E3OA 3BFDA 1XX2A 4X56A 4KZ7A 1P9RA 5CECA 1KDWA 1M6KA 2OAP1 3WRTA 4UAAA 3P09A 4I39A 1PNEA 4LV3A 1NXYA 2JHEA 2ZC4B 4OKPA 3G34A 3H7WB 4LV2A 2ZQAA 5L10A 1KE3A 4S2KA 4DN0A 2EA9A 3CPTA 1YMXA 3W2ZA 3W4OA 5E2GA 4L9GA 4Q0IA 3TRCA 4Q8IA 5HWVA 4HBUA 5F1GA 1S0WA 4S2NA 2W3EA 3E2LA 2RL3A 2VGLS 1EROA 3S7QA 2WGVA 1F98A 2WKRA 3C8CA 3KSIA 4MN5A 3IH8A 1YLPA 4NXEA 3PBNA 1RGYA 4DKIA 3BLSA 4QY5A 2GDNA 1BT5A 2W1RA 3S7NA 1CEFA 1HVBA 3MF0A 4ZDXA 4JXWA 1BLCA 4DE1A 2OLVA 5DF8A 4JXVA 5CTMA 5L8MA 4WLAA 3LCEA 5TFQA 2UWXA 1NJ4A 3EQVA 5EVIA 4R0QA 4I5SA 2K2NA 1CQAA 3EGXC 3ZQ5A 1DRMA 4EQIA 5CEBA 3BRMA 1TDLA 2H28A 4KZAA 5HD3A 2XR0A 1MXOA 3TE8A 4WM9A 2Y2LA 3GR2A 3S7OA 5DTSA 1TVFA 4E3KA 5TBMB 3UDIA 3IF5A 3QP4A 4E6WA 3A3DA 1WE4A 5FSRA 3DAVA 4KZ8A 4N1HA 3UMEA 4FOFA 2ZJ9A 2Z2MB 1K57C 1ONGA 3E98A 4KG2A 4Y15A 2W1TB 3LR0A 1VQQA 3FV7A 3QP5A 2UV0E 4IUKA 4LV1A 1AWIA 3IXGA 1ALQA 3AGDA 5I5LA 2VA0A 2O9CA 2I9VA 1T19A 5FAQA 3A0VA 1T1CA 1WYBA 1JNUA 2J80A 4OPYA 4HEFA 4PM9A 4KG6A 2J3TC 2ZM2A 3A3IA 2FFYA 3M2KA 3IT9A 2JKRM 2W3FA 3N6IA 3ZFZA 2L1MA 3CPTB 4GD8A 1CI9A 5F68A 3R4KA 3EQUA 1X0OA 3VSKA 3E0YA 4DDYA 4FCFA 3ZG7B 3O87A 2OLUA 3NJAA 3G35A 1IYQA 1KVLA 1LL9A 1NWZA 1IEMA 4DJ3A 1D7EA 1HD8A 4LPZA 4ME4A 3IF6C 3E2KA 2WGWB 3PBTA 3EOIA 3NOUC 1OTEA 4CLCD 1BLPA 2R78A 2WAFA 2IWBA 4PAUA 1XJ3A 3DTEA 5L2FA 1BSGA 3NCKA 2C6WB 3TJZC 3OBFA 2B18A 4ARZB 2A3UA 1Y4OA 2QJ7A 3OPLA 4QHCA 1HLUP 4JKTA 4KENB 3DWZA 5FDSA 4GDNA 5D3OA 2PR5A 3VOYA 1E4DA 1YMSA 3E4OA 3UDFA 1E25A 1UGUA 1Z6FA 3JPUA 2WKIA 1M40A 4L9EA 5TBMA 5IU1A 4WMCA 5FEFA 2HDSA 2ZQ7A 4CQHA 3WS2A 3E4QA 4JPMA 2V1AA 2Y79A 2VGLM 3CI6A 3LUQA 1S4RA 1Q2QA 1ODVA 5M19A 4IBXA 4WZ5A 1UWPX 5IHVA 2M7VA 3IX3A 1K0KA 2H0YA 1G6OA 3CLOA 3OZHA 3OCNA 4RA7A 5EVIC 5FL3A 2O9AA 4FH4A 5E2EA 4B9OA 1MBLA 5FQJA 1N9LA 3RFBA 4X69A 4GNUA 1JWZA 4OLGA 3HJKA 1GA0A 1ZKJA 5CRFA 4JLFA 2JBFA 5U47A 2BTFP 4UEYA 2HDUA 3UO9A 3T4JA 3LR3A 1H8YA 1LSXA 2VZWA 1W63Q 1DP9A 4N92A 5J3WA 3UB9A 2WGWA 4ARZA 3IHBA 2NUPC 2XD1A 3W4QA 4ZAMA 3W4PA 1IELA 4KZBA 1Y54A 3QP1A 4U0XA 4OQIA 3O86A 2WZZA 2HP9A 3KYZA 5HAIA 5EM1A 2VJWA 3L7HA 4DMZA 3GSGA 4JGQA 4LRYC 4NXGA 5FASA 2YKHA 1ESUA 2XH9A 1BLHA 2LB5A 2Y4AA 4WUJA 4MEZA 1G28A 4B4ZA 4BBVA 1EW0A 4HHDA 3BFCA 3BECA 3IS2B 3K2NA 4NXBA 3MR0A 5F5YA 3S4XA 5FQMA 1SKOB 3QP2A 2GNXA 1YM1A 2XSSA 1ZG6A 2J7VA 4RQ9A 3VFFA 4BJPA 2VEAA 4Y0OA 1ES3A 3QHYA 1H0MA 3LEZA 4LRXC 2EX2A 2A24B 1OTDA 1J9MA 1K56A 3NI9A 1VEUA 4GW9A 4U0TA 1K55A 2G2UA 4EESA 4E3NA 3G6OA 2HDQA 5DTTA 2V1ZA 2FFFB 3PXPA 4H8RA 3MJQA 2JKTI 4N9KA 2RCXA 3T4TA 2HF6A 3V50A 1SZVA 3HL9A 2PU4A 3IBRA 5EOOA 4BLMA 2XD5A 2J9PA 1ZG4A 3MZEA 3F1OA 2XGNA 3T1QB 2Y59A 2JKRI 1MWSA 2XK1A 3UPOA 2MJ6A 2KX6A 3KSHA 3U4LP 2QYBA 5HX9A 3FWLA 3TG9A 1NZUA 1HTZA 4OH0A 1PWCA 3KX0X 2P9VB 4EBPA 2Y55A 3LEQA 3BY8A 4KQQA 1RGZA 5A90A
chains in the Genus database with same CATH topology
4YOFA 2G7UA 1H8MA 4R6LA 3EEAA 2W1RA 3S7NA 4II7A 4LLOB 3MQQA 4K08A 3MF0A 3HJIA 1OT9A 3RTYA 3UE3A 4MCWA 3V67A 2V0UA 4G3WA 2QHKA 4G3VA 4HNBA 5L8MA 1XJ2A 4WLAA 4EXOA 2PD7A 3LYXA 3EQVA 1GSWA 4NXFA 1ZTUA 4I5SA 4L9FA 2K2NA 2KLIA 1OTAA 3EGXC 5MC7A 3BY9A 4O8GA 1IOUA 3ZQ5A 1DRMA 2Z6DA 2XA7M 3TW8A 3LICA 2K31A 5DJUA 3E4PA 3VOLA 1XFNA 2CMNA 2H28A 3BW6A 4DJ2A 5CX7A 5HD3A 3LIFA 2PR6A 3TE8A 3MQ0A 5HWTA 3S7OA 1YSPA 4HI4A 3BQAA 5DKLA 5TBMB 5DKKA 1STZA 1H3QA 4HOIA 2WKQA 4KQOA 4CLCA 3K3CA 1BYWA 3UMEA 2W0NA 4FOFA 1XFQA 3CUEC 3T4SA 3T4OA 4H6JB 3PBRA 3SW1A 3E98A 4AFIA 2W1TB 1P9WA 3LR0A 1W63M 5G4YA 1TS0A 4IHQA 4IUKA 3A0RA 4R3AA 1YKDA 5I5LA 3H9WA 2GX5A 4HP4A 4HY8A 3LIEA 2VA0A 5HL6A 2O9CA 2GZAA 2I9VA 2V0WA 1NLZA 2Y8HA 1T19A 5HDCA 5LBRA 4I38A 3A0VA 4OOLA 1T1CA 4L0LA 1JNUA 3NHQA 4YNRA 2J80A 1S1ZA 4Q0HA 2P08A 3T4LA 5HDSA 2J3TC 2ZMVA 3CUEA 4WF0A 5F6AA 4I3AA 4MN7A 2D01A 4PHTA 2JKRM 2W3FA 4EW7A 2L1MA 2NUTC 5AVEA 4MMNA 3EEHA 2HJEA 4WL9A 3UE6A 3PHYA 5F68A 1P97A 3HCYA 3R4KA 3OOVA 3EQUA 4GHIB 3PBOA 1X0OA 2L0WA 3UB6A 3C38A 3E0YA 3CITA 4EERA 1T18A 3NJAA 3F1OB 3BWLA 4EUVA 3FPVA 3JVVA 4JGPA 2QWSA 3EWKA 1NWZA 2EWWA 4DJ3A 3D3OA 3PR6A 4P6ZM 2J3TD 4GS9B 1D7EA 3IBJA 1MC0A 5G4ZA 4LPZA 1TS7A 3B33A 4ME4A 4HJ3A 1S4SA 3PBTA 3EOIA 3LFVA 3NOUC 1OJ5A 3GECA 4PKYG 1OTEA 4KQDA 4CLCD 5KSHA 1LSWA 2R78A 3LR5A 4XT2B 3D72A 2KDKA 4PAUA 3NOTC 1XJ3A 4HJ4A 3UB8A 4Z1WA 2PD8A 3LIBA 2O0YA 2PYPA 3R7WA 4YWZA 4M4XA 1F9IA 3FG8A 4NEED 2P7JA 3TJZC 4CLCE 3OBFA 2B18A 1V9ZA 3A0SA 4BBTA 2XROA 4ARZB 2VV8A 1TS6A 3R7WB 1GSVA 4G3KA 2QJ7A 1T1BA 5EFWA 3UB7A 1LT0A 4IJGA 2D02A 1OPXA 3BQ8A 2W3GA 5HSQA 4WN5A 3LIDA 2PR5A 2VKSA 3KSGA 2OOLA 2INWA 3GDIA 3H7WA 3E4OA 4H6JA 3PYPA 5IS1A 2FZ0A 4F3LA 3P7NA 4GHIA 2YKFA 3H82A 1TF1A 2VLGA 4I3JA 5AVFA 5J7EA 1UGUA 3CWFA 2JN7A 3VE4A 4BBUA 4ETZA 3K3DA 4Y5FA 4L9EA 5TBMA 4GJ4A 3VE3A 5IU1A 4CQHA 4O0PA 2PT7A 3E4QA 2V1AA 2J3WA 4IUHA 4BMWA 2Y79A 2VGLM 4QPRA 4ZRRA 3CI6A 3LUQA 2OAQ1 1S4RA 3UMDA 1OTBA 1ODVA 3ZYTA 2W3DA 5F69A 4R38A 5HDDA 5HPFA 3MQOA 2HV1A 1UWPX 4KUOA 4JGRA 2M7VA 2M7UA 3P01A 2FH5A 2ZBBA 1G6OA 4PKYA 3CLOA 5KIZA 5HD5A 3OCNA 3MXQA 5J4EA 5FL3A 2O9AA 3OLOA 4FSFA 2JKTM 4GCZA 4B9OA 1N9LA 3RFBA 2B02A 3F1PA 2OWHA 4JGOA 2IA2A 3KSFA 2L4RA 3KYQA 3HJKA 1N9NA 3DBAA 5AJGA 2K7SA 1N9OA 3IS2A 4WEKA 5DJTA 1OJGA 5TJJA 5IT5A 1D06A 3NOPC 4HH3A 4I3IA 4UEYA 4Y3IA 2PYRA 1S66L 3T4JA 3JVUA 5HZHA 3LR3A 3PBQA 5HWWA 4GS9A 1LSXA 2VZWA 1W63Q 3U2AA 4LRZE 3OC2A 1WA9A 4MDZA 4CLCC 1DP9A 4WELA 4EU0A 4MN6A 5J3WA 2W1TA 3UB9A 4ETXA 3C30A 2M1CA 4ARZA 1XJ4A 4Y2FA 1MZUA 2V9AA 1MKMA 4EEPA 2A24A 1V9YA 2NUPC 1Y28A 1DP6A 3T50A 4UQIM 4HIAA 4XT2A 1VHMA 2A2LA 2XRNA 1GSXA 3F1NA 3FPWA 5DFYA 3T4QA 3C2WA 4BWIA 2P04A 3MFXA 3MMHA 2ZMFA 3LI9A 3O5YA 2O9BA 4HP9A 1YSQA 3KYZA 3EGDC 4GLQA 1YAXA 2LB9A 1LL8A 2VJWA 2QKPA 4DMZA 4JGQA 4LRYC 4NXGA 2YKHA 1ZHHB 2VX8A 3LIAA 2LB5A 1NLYA 4WUJA 2VV7A 2PHYA 3S7PA 1G28A 4BBVA 4EQ1A 1EW0A 4HH2A 4HHDA 4HQAA 4HJ6A 4OOMA 3BJNA 2W3HA 3IS2B 3K2NA 5C5KA 3FC7A 2QJ5A 3T4KA 2OWJA 3F1PB 5DFXA 4NXBA 1NRJA 3MR0A 3KO6A 5F5YA 4F3LB 1OT6A 2GNXA 3LR4A 1KOUA 1VB6A 2XSSA 3B42A 2PDRA 4P6ZS 4RQ9A 2W27A 4BJPA 1F5MA 2VEAA 1P0ZA 2HJ9C 3B47A 4LRXC 3CAXA 1S67L 5K5BA 1LSVA 4NKPA 1XJ6A 2A24B 1OTDA 3OCLA 3ICYA 4R70A 2WKPA 4GW9A 2XA7S 2O99A 3LI8A 4CLCB 1T1AA 4EESA 3PBSA 5DF9A 2DMWA 3G6OA 4E04A 4WEJA 4B93A 1TD5A 2HGVA 1P9RA 3PXPA 2ZOIA 1IFQA 2OAP1 3MJQA 3RH8B 4KUKA 2JKTI 1OTIA 4I39A 2JHEA 3T4TA 5HPIA 2HF6A 3H7WB 4EETB 3IBRA 3F1NB 4DN0A 2GJ3A 2ZOHA 2EA9A 3H82B 3ULFA 3F1OA 3W2ZA 4L9GA 2JKRI 4Q0IA 3TRCA 2KOIA 4EEUA 5HWVA 2MJ6A 2EWVA 2W3EA 2KX6A 3KSHA 1DP8A 4O01A 2Z6CA 2QYBA 2V1BA 1S1YA 2BASA 2VGLS 2VV6A 3S7QA 3KX0X 1F98A 4UQIS 2WKRA 4Q0JA 3C8CA 3KSIA 3BY8A 4MN5A 5A8BA 4NXEA 3PBNA 3VV4A 1TS8A 1UWNX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LRY C;  4NXG A;  2YKH A;  4EW7 A;  5F68 A;  4R6L A;  3LIA A;  2L1M A;  3LUQ A;  5AVE A;  3UE6 A;  3EEH A;  1S4R A;  4WL9 A;  3UMD A;  3PHY A;  4LLO B;  1P97 A;  4WUJ A;  2VV7 A;  3MQQ A;  1OTB A;  2PHY A;  4GHI B;  1ODV A;  4K08 A;  1G28 A;  1X0O A;  2L0W A;  3UB6 A;  4BBV A;  4EQ1 A;  1EW0 A;  4HH2 A;  4HHD A;  3HJI A;  4HQA A;  4HJ6 A;  5F69 A;  1OT9 A;  4R38 A;  5HDD A;  3RTY A;  4EER A;  1T18 A;  3MQO A;  2HV1 A;  1UWP X;  2QKP A;  2V0U A;  3IS2 B;  4KUO A;  3FC7 A;  2QJ5 A;  3F1O B;  2QHK A;  2OWJ A;  3BWL A;  3F1P B;  3NJA A;  4JGR A;  4NXB A;  3MR0 A;  4HNB A;  4JGP A;  2QWS A;  5F5Y A;  3EWK A;  1NWZ A;  4DJ3 A;  2ZBB A;  4PKY A;  1XJ2 A;  4WLA A;  4EXO A;  3CLO A;  4GS9 B;  1D7E A;  2PD7 A;  4F3L B;  5G4Z A;  5KIZ A;  5HD5 A;  1OT6 A;  4LPZ A;  3MXQ A;  1TS7 A;  1KOU A;  1VB6 A;  1GSW A;  3B33 A;  2PDR A;  3LYX A;  4HJ3 A;  3OLO A;  4NXF A;  4RQ9 A;  5J4E A;  1S4S A;  4GCZ A;  4B9O A;  4I5S A;  2W27 A;  4L9F A;  1N9L A;  1OTA A;  2VEA A;  1P0Z A;  2B02 A;  3BY9 A;  3NOU C;  1OJ5 A;  3ZQ5 A;  1DRM A;  2Z6D A;  3F1P A;  3GEC A;  1OTE A;  2OWH A;  4KQD A;  4PKY G;  1LSW A;  2R78 A;  4LRX C;  3CAX A;  3LIC A;  1S67 L;  3D72 A;  4JGO A;  1LSV A;  4XT2 B;  1XJ6 A;  3E4P A;  5DJU A;  2KDK A;  2A24 B;  1OTD A;  1XJ3 A;  1XFN A;  3NOT C;  2L4R A;  4HJ4 A;  3VOL A;  2CMN A;  2H28 A;  3UB8 A;  2PD8 A;  3ICY A;  3HJK A;  1N9N A;  3LIB A;  2WKP A;  4R70 A;  4DJ2 A;  4GW9 A;  2PYP A;  3LIF A;  5HD3 A;  4YWZ A;  4M4X A;  1F9I A;  3FG8 A;  3LI8 A;  2PR6 A;  2K7S A;  2P7J A;  1T1A A;  5HWT A;  4EES A;  4HI4 A;  1N9O A;  3G6O A;  3IS2 A;  5DJT A;  5DKL A;  5TBM B;  4BBT A;  4E04 A;  1OJG A;  1V9Z A;  3A0S A;  5DKK A;  1D06 A;  3NOP C;  4HH3 A;  4I3I A;  2VV8 A;  1TS6 A;  1S66 L;  2PYR A;  1GSV A;  2QJ7 A;  4HOI A;  2WKQ A;  1T1B A;  5HZH A;  2ZOI A;  5EFW A;  5HWW A;  3MJQ A;  4GS9 A;  3K3C A;  1LSX A;  4KUK A;  3RH8 B;  1OTI A;  1BYW A;  1LT0 A;  1WA9 A;  4I39 A;  1DP9 A;  4LRZ E;  2W0N A;  3UB7 A;  3UME A;  4MN6 A;  1XFQ A;  5J3W A;  3UB9 A;  2D02 A;  2JHE A;  2M1C A;  5HSQ A;  1XJ4 A;  1MZU A;  2V9A A;  4WN5 A;  4EEP A;  4H6J B;  3H7W B;  3LID A;  3SW1 A;  2A24 A;  4EET B;  2PR5 A;  3IBR A;  3F1N B;  1V9Y A;  1Y28 A;  1DP6 A;  5G4Y A;  2GJ3 A;  2ZOH A;  1TS0 A;  2EA9 A;  3T50 A;  3H82 B;  3ULF A;  3F1O A;  2OOL A;  2INW A;  3GDI A;  3H7W A;  4L9G A;  3A0R A;  3E4O A;  4R3A A;  4H6J A;  3PYP A;  4HIA A;  5IS1 A;  4XT2 A;  3H9W A;  5I5L A;  3P7N A;  4GHI A;  2YKF A;  4HP4 A;  4HY8 A;  3LIE A;  4EEU A;  4F3L A;  5HWV A;  3H82 A;  2VLG A;  4I3J A;  2I9V A;  1GSX A;  2KX6 A;  2V0W A;  3F1N A;  5AVF A;  1UGU A;  1DP8 A;  5J7E A;  1T19 A;  5HDC A;  2Z6C A;  4I38 A;  2V1B A;  3A0V A;  2JN7 A;  3C2W A;  3CWF A;  3VE4 A;  1S1Y A;  1T1C A;  2BAS A;  4BBU A;  3MFX A;  1JNU A;  3NHQ A;  3K3D A;  2J80 A;  1S1Z A;  4L9E A;  2VV6 A;  5TBM A;  3LI9 A;  3KX0 X;  1F98 A;  2WKR A;  4HP9 A;  5HDS A;  3C8C A;  3VE3 A;  5IU1 A;  3BY8 A;  4MN5 A;  5A8B A;  4JGQ A;  4NXE A;  1TS8 A;  1LL8 A;  3E4Q A;  4WF0 A;  4I3A A;  5F6A A;  2D01 A;  2V1A A;  1UWN X; 
#chains in the Genus database with same CATH topology
 4YOF A;  4R6L A;  3MKF A;  5GLC A;  3PAG A;  3PAE A;  3HJI A;  1OT9 A;  3RTY A;  4MCW A;  3V67 A;  1PW1 A;  4G3W A;  2QHK A;  5JYP A;  3BM6 A;  4LCL A;  4OQH A;  4EXO A;  5GHY A;  4K91 A;  2Y91 A;  3GQZ A;  3LYX A;  4Y0U A;  4NXF A;  3HLW A;  2KLI A;  1OTA A;  3BY9 A;  4LFU A;  3Q07 A;  2Z6D A;  2XA7 M;  3TW8 A;  3S22 A;  3UB5 P;  3VOL A;  1XFN A;  4DJ2 A;  3GV9 A;  4X53 A;  4HBT A;  3BQA A;  4CJN A;  4QY6 A;  1H3Q A;  1MWR A;  3ISG A;  1HZO A;  4CLC A;  3D9Y A;  2W0N A;  1FSW A;  1XFQ A;  3T4O A;  4JF6 A;  3PBR A;  1K57 A;  2XEP A;  4AFI A;  3NBL A;  4KZ6 A;  4QWO A;  5G4Y A;  1TS0 A;  1EI5 A;  5FQ9 A;  4IHQ A;  1KDS A;  3HUM A;  5FI6 A;  5HL6 A;  2GZA A;  2Y8H A;  5HDC A;  1FR6 A;  4OOL A;  4L0L A;  1S1Z A;  4ZJ3 A;  1FCM A;  3A3J A;  3BFG A;  1YLZ A;  3QP6 A;  4WF0 A;  4I3A A;  4ZBE A;  2D01 A;  3VP2 A;  4E3M A;  1SCW A;  1JVJ A;  4EW7 A;  4MMN A;  3UE6 A;  5CXW A;  1P97 A;  3ZCZ A;  3PBO A;  2L0W A;  3UB6 A;  2Y2Q A;  3C38 A;  4P0M A;  5EVI B;  4EER A;  1T18 A;  4X55 A;  3F1O B;  3FPV A;  3JVV A;  1QMF A;  4BQM A;  4GS9 B;  3IBJ A;  1MC0 A;  5FAP A;  1W8Q A;  4N1X A;  1PIO A;  1S4S A;  1SDE A;  4K0X A;  2E8J A;  3LFV A;  1OJ5 A;  1I2S A;  4D2O A;  1K6R A;  1LSW A;  1YT4 A;  3LR5 A;  3D72 A;  2KDK A;  2EFX A;  3UB8 A;  4Z1W A;  3WS5 A;  3LIB A;  2PYP A;  2PAV P;  3FG8 A;  3Q81 A;  5F1F A;  4KZ3 A;  4PMA A;  2WYX A;  3IXH A;  1V9Z A;  4BBT A;  2XRO A;  2OSU A;  2QPN A;  3R7W B;  3UE1 A;  4G3K A;  3ITA A;  4PM5 A;  4Y0T A;  1GA9 A;  4KQR A;  5HSQ A;  4KG5 A;  3P98 A;  4UA7 A;  2PU2 A;  2VKS A;  2OOL A;  3GDI A;  1L0E A;  2DNS A;  2ZC5 B;  4H6J A;  3PYP A;  4JBF A;  5KMW A;  5IS1 A;  2FZ0 A;  1ACF A;  4GHI A;  2YKF A;  4OPR A;  2ZQ9 A;  3H82 A;  1TF1 A;  4RYE A;  3SOI A;  2HP5 A;  2P74 A;  4BBU A;  3GMW A;  1TDG A;  3G30 A;  4KZ5 A;  4YFM A;  3K3D A;  5KZH A;  4QD4 A;  4Y5F A;  3FZC A;  1YLY A;  2C5W B;  5HAP A;  3LY4 A;  4O0P A;  3LGO A;  1W8Y A;  3VSL A;  4X6T A;  4IUH A;  4BMW A;  3WS4 A;  4OQ0 A;  3UMD A;  1OTB A;  3UPN A;  1L0F A;  2EX9 A;  4DE2 A;  1CJF A;  4FUW A;  4QB8 A;  1DY6 A;  2M7U A;  3G31 A;  1IYS A;  2ZL1 B;  2ZBB A;  1IKI A;  1ZC2 A;  4IVK A;  1GCE A;  2HP6 A;  3ZGA B;  2B02 A;  4Y17 A;  3F1P A;  3NDG A;  2Y2I A;  2EXA A;  4JGO A;  5FAO A;  1PZO A;  1KE4 A;  3KYQ A;  3T1R A;  2K7S A;  1BZA A;  4GOG A;  1N9O A;  4S2J A;  1OJG A;  5TJJ A;  1JWP A;  1PYY A;  4Y3I A;  1S66 L;  3JVU A;  2A49 A;  2Y2O A;  5CGX A;  3C5A A;  3NUL A;  3U2A A;  4DF6 A;  2ZQ8 A;  2ZQD A;  3DWK A;  2H5S A;  2W1T A;  3C30 A;  2M1C A;  3NY4 A;  1XJ4 A;  2V9A A;  4JF4 A;  4EBL A;  5HAR A;  1DP6 A;  3C4O A;  4XUZ A;  4IBR A;  2JE5 A;  2R9X A;  3HUO A;  3MXS A;  3UPP A;  1GSX A;  3F1N A;  3FPW A;  2BLS A;  1FIK A;  5DFY A;  4BWI A;  2P04 A;  4QJG A;  2ZMF A;  3IH9 A;  1XPB A;  2WUQ A;  4FTX A;  2JC7 A;  2O9B A;  4HP9 A;  5CHU A;  2WK0 A;  1YSQ A;  4X1L A;  3SH8 A;  2LB9 A;  5GLB A;  4QU3 A;  1MKI A;  5KSC A;  1K25 A;  3BYD A;  1ZHH B;  1QME A;  1NLY A;  2VV7 A;  1KGF A;  1XP4 A;  4OOM A;  2B95 A;  3N8R A;  2W3H A;  4OOY A;  3T4K A;  3F1P B;  2X02 A;  2JKG A;  1W7F A;  1MPL A;  1OT6 A;  4P6Z S;  1KOU A;  3B42 A;  2PDR A;  3DW0 A;  3WRZ A;  2ZM8 A;  1P0Z A;  3CAX A;  5K5B A;  1LSV A;  1XJ6 A;  3ZDJ A;  3SS5 A;  2XA7 S;  2O99 A;  3WWX A;  4CLC B;  3MSH A;  1ESI A;  2DMW A;  4E04 A;  4WEJ A;  4B93 A;  1TD5 A;  2XFT A;  2HGV A;  2Q9M A;  2ZOI A;  1J3W A;  1K4F A;  4EWF A;  1ERM A;  3CHW P;  3RH8 B;  1OTI A;  2VGJ A;  5HPI A;  2PRF A;  3IHA A;  5CGW A;  4EET B;  3F1N B;  1Z09 A;  3G4P A;  2ZOH A;  3ULF A;  2ZC6 B;  5CHJ A;  3M6B A;  2KOI A;  3IWO A;  4EV4 A;  2XLN A;  4BD1 A;  5FQI A;  4RX3 A;  4E3J A;  4Q0J A;  5A8B A;  2H0T A;  3VV4 A;  5DVA A;  1FOF A;  1ERQ A;  3WS0 A;  2G7U A;  3T1X A;  1L0G A;  3ZG9 B;  1CK3 A;  4II7 A;  4LLO B;  3ZVW A;  3MQQ A;  4K08 A;  1KVM A;  2X71 A;  4LGW A;  5FI7 A;  1BUE A;  3UE3 A;  3GRJ A;  3O3V A;  3UNW A;  3B3X A;  2Y2H A;  4XXR A;  3QP8 A;  1GSW A;  2WGI A;  5FQK A;  3GVB A;  4L9F A;  4O8G A;  3Q7V B;  2VK3 A;  3E4P A;  1E3U A;  2CMN A;  3BW6 A;  4JXS A;  5CX7 A;  4S2I A;  2Y2K A;  5HWT A;  4X1M A;  1YSP A;  4HI4 A;  1KGE A;  1W5D A;  1STZ A;  2VGK A;  4HOI A;  2WKQ A;  1K6S A;  4KQO A;  3V3S A;  3D4F A;  3UE0 A;  3CUE C;  3T4S A;  3QNC A;  2OV5 A;  4H6J B;  3FKV A;  4P6B A;  4D60 A;  1P9W A;  3BFE A;  1VEU B;  5HL1 A;  4UHU A;  3A0R A;  2Y2G A;  4DRT A;  3LIE A;  3MFD A;  1FQG A;  2V0W A;  2ZQC A;  4PM8 A;  3SH7 A;  5LBR A;  4I38 A;  2QZ6 A;  3HVF A;  1WYC A;  4S2M A;  3NHQ A;  2V20 A;  4BL2 A;  3NC8 A;  2AVX A;  3JYI A;  4LEN A;  4Q0H A;  1MWU A;  2P08 A;  5HDS A;  3Q1F A;  1VET B;  3CUE A;  4MN7 A;  4ID4 A;  2Q0O A;  1D1J A;  4O7D A;  5TR7 A;  1DJA A;  2NUT C;  3EEH A;  2HJE A;  4WL9 A;  2ZL1 A;  3HCY A;  1FCN A;  3OOV A;  3W8K A;  4U3T A;  3BFF A;  4FD8 A;  3WS1 A;  3CIT A;  3C7U A;  5E2H A;  1SKO A;  1XA1 A;  5AQ9 A;  3VP4 A;  1L2S A;  1S6R A;  3Q7V A;  1NZO A;  4JGP A;  2QWS A;  3EWK A;  2EWW A;  2J3T D;  1PZP A;  4ZTK A;  5GHZ A;  4E3I A;  4ZJ1 A;  4ZJ2 A;  1TS7 A;  3IX8 A;  3IWI A;  2XDM A;  1IYP A;  3IWQ A;  4YIN A;  4PKY G;  4XT2 B;  1G6A A;  4HJ4 A;  2PD8 A;  2QMI A;  4MBK A;  3MS6 A;  2O0Y A;  1F9I A;  1PRQ A;  2P7J A;  4C6Y A;  4DXB A;  1K54 C;  1ONH A;  1GSV A;  1C3B A;  3PTE A;  1T1B A;  2BG1 A;  4MNR A;  5FI2 A;  1MY8 A;  4MLL A;  3UB7 A;  1LT0 A;  1U60 A;  2D02 A;  1OPX A;  1LLB A;  3LID A;  2ACG A;  5M18 A;  2Y2M A;  1I2W A;  5FQQ A;  3ZG0 A;  3FKW A;  4F3L A;  4KZ4 A;  2VLG A;  4I3J A;  4C75 A;  2P9V A;  3CWF A;  3VE4 A;  4ETZ A;  4GJ4 A;  1XKZ A;  3VE3 A;  5L07 A;  3IF6 B;  2PT7 A;  4IED A;  5F82 A;  2OAQ 1;  2EX8 A;  4UA6 A;  3ZNT A;  3ZYT A;  2W3D A;  5F69 A;  1PFL A;  3G2Z A;  5HPF A;  4KUO A;  5CTN A;  2B5R A;  3P01 A;  4UA9 A;  2FH5 A;  5HD5 A;  3OPP A;  1VM1 A;  5M1A A;  3OLO A;  4GCZ A;  2WKH A;  2ZC7 A;  2X01 A;  2OWH A;  1SKF A;  2IA2 A;  3KSF A;  2L4R A;  3SZT A;  1I5Q A;  4S2N C;  1PI4 A;  4X68 A;  2V8F A;  3IS2 A;  5DJT A;  3TOI A;  4PPR A;  5IT5 A;  1D06 A;  4I3I A;  3CJM A;  2PYR A;  5EVI D;  4DE3 A;  5FEG A;  3VP3 A;  4WZ5 C;  5HZH A;  5HWW A;  4GS9 A;  3ZVT A;  3NEC A;  3OC2 A;  4MDZ A;  3M2J A;  4CLC C;  4WEL A;  4B88 A;  4GD6 A;  5FDH A;  4Y2F A;  1MZU A;  2IWD A;  4EEP A;  5E43 A;  2A24 A;  5TGF A;  3L9K A;  3HLB A;  1FR1 A;  4JXG A;  5A91 A;  3T50 A;  5L09 A;  3HRE A;  1XXM A;  4XT2 A;  1VHM A;  4Y13 A;  2ZC3 B;  3VP0 A;  4LCM A;  3C2W A;  1KGG A;  2J8Y A;  3MFX A;  3MMH A;  5EUA A;  1ES4 A;  5HAQ A;  2E8I A;  3LI9 A;  5G18 A;  1F2K A;  4WZ4 A;  4S2P A;  3IXB A;  4GLQ A;  2QKP A;  2WAE A;  3TSG A;  2VX8 A;  5HFO A;  5EEC A;  3S7P A;  3OPH A;  1GHI A;  3G2Y A;  1K56 D;  3BJN A;  5C5K A;  2OWJ A;  1EWZ A;  3MZD A;  3LR4 A;  1VB6 A;  5DTK A;  1F5M A;  2HJ9 C;  1DJC A;  1YQS A;  3OCL A;  4M3K A;  1YLJ A;  2EXB A;  4R70 A;  1BUL A;  1YLW A;  3C7V A;  4Y7P A;  3IF6 A;  3RXW A;  3LI8 A;  1YLT A;  1T1A A;  3PBS A;  5DF9 A;  1BTL A;  4A5R A;  4MBF A;  1IFQ A;  3AGF A;  4KUK A;  1LI0 A;  1OME A;  1Q2P A;  1LI9 A;  2WAD A;  2XFS A;  4EUZ A;  3DTK A;  3SS4 A;  4NET A;  2GJ3 A;  5CGS A;  3H82 B;  4R3B A;  1L3L A;  2CC1 A;  2G2W A;  4EEU A;  2EWV A;  1DP8 A;  4O01 A;  2Z6C A;  2V1B A;  4PM7 A;  4BEN A;  1S1Y A;  2BAS A;  5CED A;  3RXX A;  3T1S A;  1O7E A;  3HBR A;  2VV6 A;  4BD0 A;  1RCJ A;  4UQI S;  2XF3 A;  3Q82 A;  3S1Y A;  3M6H A;  2J9O A;  1YPR A;  1TS8 A;  1MWT A;  3ZG8 B;  1UWN X;  4R4S A;  1BLS A;  1NY0 A;  3G32 A;  1H8M A;  3EEA A;  4P87 A;  3CZD A;  1JWV A;  1IKG A;  1H8Z A;  4DXC A;  1SDN A;  4S2O A;  2H10 A;  2V0U A;  5FA7 A;  4WYY A;  3HLC A;  4G3V A;  4HNB A;  3LY3 A;  1TEM A;  5EM0 A;  1FSY A;  1XJ2 A;  3C4P A;  2PD7 A;  2WKE A;  1ZTU A;  3Q7Z A;  5MC7 A;  1IOU A;  4GKU A;  3LIC A;  2K31 A;  5DJU A;  3N8L A;  2WZX A;  3LIF A;  4WBG A;  3NDE A;  5EPH A;  2PR6 A;  2HZ5 A;  3MQ0 A;  5EV0 A;  1LHY A;  5DKL A;  5DKK A;  1JTG A;  4JF5 A;  1RP5 A;  4NG2 A;  1NYM A;  3K3C A;  5CHM A;  1BYW A;  5J8X A;  1ES5 A;  4X25 A;  5GLA A;  3SW1 A;  2V8C A;  3N8S A;  3GTC A;  1W63 M;  4E6X A;  3HLD A;  1PWD A;  4R3A A;  1YKD A;  4R4R A;  3H9W A;  2GX5 A;  4HP4 A;  4HY8 A;  4OVD A;  2R9W A;  1NLZ A;  4WMC D;  3AGE A;  1CI8 A;  4DE0 A;  4YNR A;  4CPK A;  3T4L A;  3N7W A;  3UN7 A;  4OQG A;  2ZMV A;  5F6A A;  2IWC A;  4FH2 A;  4PHT A;  4RX2 A;  1PW8 A;  4R1G A;  5AVE A;  5BOH A;  4B4X A;  3PHY A;  3VMA A;  4GHI B;  4OP8 A;  4Z9Q A;  4DDS A;  5DF7 A;  4GDB A;  1G68 A;  3BWL A;  4EUV A;  3KYE A;  4HES A;  2XQZ A;  3SS3 A;  4EBN A;  3D3O A;  3PR6 A;  4P6Z M;  5CER A;  1O07 A;  5G4Z A;  3ZNY A;  5I94 A;  1CEG A;  5A92 A;  3B33 A;  4HJ3 A;  2Z2L B;  2Y2J A;  1DJB A;  3VP1 A;  2PBY A;  3GEC A;  4KQD A;  5KSH A;  1AXB A;  2ZMA A;  3NOT C;  4RVA A;  1N4O A;  3HLF A;  3R7W A;  4YWZ A;  3CG5 A;  4M4X A;  4NEE D;  4OPQ A;  4XUX A;  2ZLY A;  4CLC E;  2JCH A;  3A0S A;  3DTM A;  2VV8 A;  1TS6 A;  1G5U A;  5EFW A;  1JTD A;  3MBZ A;  5EOE A;  4IJG A;  3BQ8 A;  1XGJ A;  2W3G A;  1FCO A;  1A0K A;  4WN5 A;  5AQB A;  5E2F A;  3V3R A;  2EX6 A;  3HUN A;  4GN2 A;  3KSG A;  2INW A;  3H7W A;  3ITB A;  3O88 A;  3A3F A;  3P7N A;  1L0D A;  4K0W A;  5AVF A;  5J7E A;  3DTI A;  1N9B A;  2JN7 A;  3NIA A;  5GHX A;  4KZ9 A;  3T12 B;  2HPB A;  3HLG A;  2J3W A;  4QPR A;  3RJU A;  4ZRR A;  1KE0 A;  3V5M A;  2Y2N A;  5FAT A;  1CF0 A;  4R38 A;  5HDD A;  3IXD A;  3MQO A;  3ZHH A;  2HV1 A;  4JGR A;  2EFU A;  1SHV A;  5GL9 A;  4PKY A;  5KIZ A;  1E3U D;  1FIL A;  3MXQ A;  5J4E A;  1K54 A;  4FSF A;  3VFH A;  2JKT M;  3V39 A;  2DCF A;  3BLM A;  1W79 A;  1ES2 A;  2Q9N A;  4IVI A;  3UDX A;  1N9N A;  3DBA A;  5AJG A;  4F94 A;  1VET A;  3N4I A;  3ZG5 A;  1XA7 A;  3SH9 A;  2V2F F;  3OPR A;  4WEK A;  3NOP C;  2ZD8 A;  4HH3 A;  2HDR A;  5EE8 A;  4R3J A;  1GHP A;  3PBQ A;  1K38 A;  4LRZ E;  1WA9 A;  4EU0 A;  4E3L A;  1PWG A;  4MN6 A;  4ETX A;  1NRF A;  1LL5 A;  3LO7 A;  1MKM A;  5HW3 A;  1NYY A;  5EVL A;  3A3E A;  1V9Y A;  1Y28 A;  3IX4 A;  4OP5 A;  4UQI M;  3UY6 A;  4HIA A;  4P85 A;  2A2L A;  2XRN A;  3MKE A;  4NK3 A;  3T4Q A;  4ESP A;  4LV0 A;  4OPZ A;  5JYO A;  3O5Y A;  4OLD A;  2ZM0 A;  3EGD C;  4PM6 A;  1YAX A;  1LL8 A;  1IYO A;  2PBD P;  4MBH A;  3LIA A;  1K4E A;  3VOZ A;  2PHY A;  3I7J A;  2Y2P A;  4EQ1 A;  1XGI A;  4HH2 A;  4HQA A;  4HJ6 A;  3MZF A;  3FC7 A;  1H5X A;  2QJ5 A;  5DFX A;  3FYZ A;  5A93 A;  1NRJ A;  3KO6 A;  4R23 A;  3IQA A;  5AQA A;  5F83 A;  4F3L B;  5GLD A;  1GHM A;  2DRW A;  3QNB A;  4GB7 A;  5EVE A;  1PI5 A;  2W27 A;  3MXR A;  4GZB A;  3BEB A;  4C3Q A;  3B47 A;  1S67 L;  4OON A;  4NKP A;  2I72 A;  4N9L A;  4S2L A;  3ICY A;  2WKP A;  4BL3 A;  5AQ7 A;  3CMZ A;  2JKF A;  1K55 C;  3HLE A;  4E3O A;  3BFD A;  1XX2 A;  4X56 A;  4KZ7 A;  1P9R A;  5CEC A;  1KDW A;  1M6K A;  2OAP 1;  3WRT A;  4UAA A;  3P09 A;  4I39 A;  1PNE A;  4LV3 A;  1NXY A;  2JHE A;  2ZC4 B;  4OKP A;  3G34 A;  3H7W B;  4LV2 A;  2ZQA A;  5L10 A;  1KE3 A;  4S2K A;  4DN0 A;  2EA9 A;  3CPT A;  1YMX A;  3W2Z A;  3W4O A;  5E2G A;  4L9G A;  4Q0I A;  3TRC A;  4Q8I A;  5HWV A;  4HBU A;  5F1G A;  1S0W A;  4S2N A;  2W3E A;  3E2L A;  2RL3 A;  2VGL S;  1ERO A;  3S7Q A;  2WGV A;  1F98 A;  2WKR A;  3C8C A;  3KSI A;  4MN5 A;  3IH8 A;  1YLP A;  4NXE A;  3PBN A;  1RGY A;  4DKI A;  3BLS A;  4QY5 A;  2GDN A;  1BT5 A;  2W1R A;  3S7N A;  1CEF A;  1HVB A;  3MF0 A;  4ZDX A;  4JXW A;  1BLC A;  4DE1 A;  2OLV A;  5DF8 A;  4JXV A;  5CTM A;  5L8M A;  4WLA A;  3LCE A;  5TFQ A;  2UWX A;  1NJ4 A;  3EQV A;  5EVI A;  4R0Q A;  4I5S A;  2K2N A;  1CQA A;  3EGX C;  3ZQ5 A;  1DRM A;  4EQI A;  5CEB A;  3BRM A;  1TDL A;  2H28 A;  4KZA A;  5HD3 A;  2XR0 A;  1MXO A;  3TE8 A;  4WM9 A;  2Y2L A;  3GR2 A;  3S7O A;  5DTS A;  1TVF A;  4E3K A;  5TBM B;  3UDI A;  3IF5 A;  3QP4 A;  4E6W A;  3A3D A;  1WE4 A;  5FSR A;  3DAV A;  4KZ8 A;  4N1H A;  3UME A;  4FOF A;  2ZJ9 A;  2Z2M B;  1K57 C;  1ONG A;  3E98 A;  4KG2 A;  4Y15 A;  2W1T B;  3LR0 A;  1VQQ A;  3FV7 A;  3QP5 A;  2UV0 E;  4IUK A;  4LV1 A;  1AWI A;  3IXG A;  1ALQ A;  3AGD A;  5I5L A;  2VA0 A;  2O9C A;  2I9V A;  1T19 A;  5FAQ A;  3A0V A;  1T1C A;  1WYB A;  1JNU A;  2J80 A;  4OPY A;  4HEF A;  4PM9 A;  4KG6 A;  2J3T C;  2ZM2 A;  3A3I A;  2FFY A;  3M2K A;  3IT9 A;  2JKR M;  2W3F A;  3N6I A;  3ZFZ A;  2L1M A;  3CPT B;  4GD8 A;  1CI9 A;  5F68 A;  3R4K A;  3EQU A;  1X0O A;  3VSK A;  3E0Y A;  4DDY A;  4FCF A;  3ZG7 B;  3O87 A;  2OLU A;  3NJA A;  3G35 A;  1IYQ A;  1KVL A;  1LL9 A;  1NWZ A;  1IEM A;  4DJ3 A;  1D7E A;  1HD8 A;  4LPZ A;  4ME4 A;  3IF6 C;  3E2K A;  2WGW B;  3PBT A;  3EOI A;  3NOU C;  1OTE A;  4CLC D;  1BLP A;  2R78 A;  2WAF A;  2IWB A;  4PAU A;  1XJ3 A;  3DTE A;  5L2F A;  1BSG A;  3NCK A;  2C6W B;  3TJZ C;  3OBF A;  2B18 A;  4ARZ B;  2A3U A;  1Y4O A;  2QJ7 A;  3OPL A;  4QHC A;  1HLU P;  4JKT A;  4KEN B;  3DWZ A;  5FDS A;  4GDN A;  5D3O A;  2PR5 A;  3VOY A;  1E4D A;  1YMS A;  3E4O A;  3UDF A;  1E25 A;  1UGU A;  1Z6F A;  3JPU A;  2WKI A;  1M40 A;  4L9E A;  5TBM A;  5IU1 A;  4WMC A;  5FEF A;  2HDS A;  2ZQ7 A;  4CQH A;  3WS2 A;  3E4Q A;  4JPM A;  2V1A A;  2Y79 A;  2VGL M;  3CI6 A;  3LUQ A;  1S4R A;  1Q2Q A;  1ODV A;  5M19 A;  4IBX A;  4WZ5 A;  1UWP X;  5IHV A;  2M7V A;  3IX3 A;  1K0K A;  2H0Y A;  1G6O A;  3CLO A;  3OZH A;  3OCN A;  4RA7 A;  5EVI C;  5FL3 A;  2O9A A;  4FH4 A;  5E2E A;  4B9O A;  1MBL A;  5FQJ A;  1N9L A;  3RFB A;  4X69 A;  4GNU A;  1JWZ A;  4OLG A;  3HJK A;  1GA0 A;  1ZKJ A;  5CRF A;  4JLF A;  2JBF A;  5U47 A;  2BTF P;  4UEY A;  2HDU A;  3UO9 A;  3T4J A;  3LR3 A;  1H8Y A;  1LSX A;  2VZW A;  1W63 Q;  1DP9 A;  4N92 A;  5J3W A;  3UB9 A;  2WGW A;  4ARZ A;  3IHB A;  2NUP C;  2XD1 A;  3W4Q A;  4ZAM A;  3W4P A;  1IEL A;  4KZB A;  1Y54 A;  3QP1 A;  4U0X A;  4OQI A;  3O86 A;  2WZZ A;  2HP9 A;  3KYZ A;  5HAI A;  5EM1 A;  2VJW A;  3L7H A;  4DMZ A;  3GSG A;  4JGQ A;  4LRY C;  4NXG A;  5FAS A;  2YKH A;  1ESU A;  2XH9 A;  1BLH A;  2LB5 A;  2Y4A A;  4WUJ A;  4MEZ A;  1G28 A;  4B4Z A;  4BBV A;  1EW0 A;  4HHD A;  3BFC A;  3BEC A;  3IS2 B;  3K2N A;  4NXB A;  3MR0 A;  5F5Y A;  3S4X A;  5FQM A;  1SKO B;  3QP2 A;  2GNX A;  1YM1 A;  2XSS A;  1ZG6 A;  2J7V A;  4RQ9 A;  3VFF A;  4BJP A;  2VEA A;  4Y0O A;  1ES3 A;  3QHY A;  1H0M A;  3LEZ A;  4LRX C;  2EX2 A;  2A24 B;  1OTD A;  1J9M A;  1K56 A;  3NI9 A;  1VEU A;  4GW9 A;  4U0T A;  1K55 A;  2G2U A;  4EES A;  4E3N A;  3G6O A;  2HDQ A;  5DTT A;  2V1Z A;  2FFF B;  3PXP A;  4H8R A;  3MJQ A;  2JKT I;  4N9K A;  2RCX A;  3T4T A;  2HF6 A;  3V50 A;  1SZV A;  3HL9 A;  2PU4 A;  3IBR A;  5EOO A;  4BLM A;  2XD5 A;  2J9P A;  1ZG4 A;  3MZE A;  3F1O A;  2XGN A;  3T1Q B;  2Y59 A;  2JKR I;  1MWS A;  2XK1 A;  3UPO A;  2MJ6 A;  2KX6 A;  3KSH A;  3U4L P;  2QYB A;  5HX9 A;  3FWL A;  3TG9 A;  1NZU A;  1HTZ A;  4OH0 A;  1PWC A;  3KX0 X;  2P9V B;  4EBP A;  2Y55 A;  3LEQ A;  3BY8 A;  4KQQ A;  1RGZ A;  5A90 A; 
#chains in the Genus database with same CATH homology
 4YOF A;  2G7U A;  1H8M A;  4R6L A;  3EEA A;  2W1R A;  3S7N A;  4II7 A;  4LLO B;  3MQQ A;  4K08 A;  3MF0 A;  3HJI A;  1OT9 A;  3RTY A;  3UE3 A;  4MCW A;  3V67 A;  2V0U A;  4G3W A;  2QHK A;  4G3V A;  4HNB A;  5L8M A;  1XJ2 A;  4WLA A;  4EXO A;  2PD7 A;  3LYX A;  3EQV A;  1GSW A;  4NXF A;  1ZTU A;  4I5S A;  4L9F A;  2K2N A;  2KLI A;  1OTA A;  3EGX C;  5MC7 A;  3BY9 A;  4O8G A;  1IOU A;  3ZQ5 A;  1DRM A;  2Z6D A;  2XA7 M;  3TW8 A;  3LIC A;  2K31 A;  5DJU A;  3E4P A;  3VOL A;  1XFN A;  2CMN A;  2H28 A;  3BW6 A;  4DJ2 A;  5CX7 A;  5HD3 A;  3LIF A;  2PR6 A;  3TE8 A;  3MQ0 A;  5HWT A;  3S7O A;  1YSP A;  4HI4 A;  3BQA A;  5DKL A;  5TBM B;  5DKK A;  1STZ A;  1H3Q A;  4HOI A;  2WKQ A;  4KQO A;  4CLC A;  3K3C A;  1BYW A;  3UME A;  2W0N A;  4FOF A;  1XFQ A;  3CUE C;  3T4S A;  3T4O A;  4H6J B;  3PBR A;  3SW1 A;  3E98 A;  4AFI A;  2W1T B;  1P9W A;  3LR0 A;  1W63 M;  5G4Y A;  1TS0 A;  4IHQ A;  4IUK A;  3A0R A;  4R3A A;  1YKD A;  5I5L A;  3H9W A;  2GX5 A;  4HP4 A;  4HY8 A;  3LIE A;  2VA0 A;  5HL6 A;  2O9C A;  2GZA A;  2I9V A;  2V0W A;  1NLZ A;  2Y8H A;  1T19 A;  5HDC A;  5LBR A;  4I38 A;  3A0V A;  4OOL A;  1T1C A;  4L0L A;  1JNU A;  3NHQ A;  4YNR A;  2J80 A;  1S1Z A;  4Q0H A;  2P08 A;  3T4L A;  5HDS A;  2J3T C;  2ZMV A;  3CUE A;  4WF0 A;  5F6A A;  4I3A A;  4MN7 A;  2D01 A;  4PHT A;  2JKR M;  2W3F A;  4EW7 A;  2L1M A;  2NUT C;  5AVE A;  4MMN A;  3EEH A;  2HJE A;  4WL9 A;  3UE6 A;  3PHY A;  5F68 A;  1P97 A;  3HCY A;  3R4K A;  3OOV A;  3EQU A;  4GHI B;  3PBO A;  1X0O A;  2L0W A;  3UB6 A;  3C38 A;  3E0Y A;  3CIT A;  4EER A;  1T18 A;  3NJA A;  3F1O B;  3BWL A;  4EUV A;  3FPV A;  3JVV A;  4JGP A;  2QWS A;  3EWK A;  1NWZ A;  2EWW A;  4DJ3 A;  3D3O A;  3PR6 A;  4P6Z M;  2J3T D;  4GS9 B;  1D7E A;  3IBJ A;  1MC0 A;  5G4Z A;  4LPZ A;  1TS7 A;  3B33 A;  4ME4 A;  4HJ3 A;  1S4S A;  3PBT A;  3EOI A;  3LFV A;  3NOU C;  1OJ5 A;  3GEC A;  4PKY G;  1OTE A;  4KQD A;  4CLC D;  5KSH A;  1LSW A;  2R78 A;  3LR5 A;  4XT2 B;  3D72 A;  2KDK A;  4PAU A;  3NOT C;  1XJ3 A;  4HJ4 A;  3UB8 A;  4Z1W A;  2PD8 A;  3LIB A;  2O0Y A;  2PYP A;  3R7W A;  4YWZ A;  4M4X A;  1F9I A;  3FG8 A;  4NEE D;  2P7J A;  3TJZ C;  4CLC E;  3OBF A;  2B18 A;  1V9Z A;  3A0S A;  4BBT A;  2XRO A;  4ARZ B;  2VV8 A;  1TS6 A;  3R7W B;  1GSV A;  4G3K A;  2QJ7 A;  1T1B A;  5EFW A;  3UB7 A;  1LT0 A;  4IJG A;  2D02 A;  1OPX A;  3BQ8 A;  2W3G A;  5HSQ A;  4WN5 A;  3LID A;  2PR5 A;  2VKS A;  3KSG A;  2OOL A;  2INW A;  3GDI A;  3H7W A;  3E4O A;  4H6J A;  3PYP A;  5IS1 A;  2FZ0 A;  4F3L A;  3P7N A;  4GHI A;  2YKF A;  3H82 A;  1TF1 A;  2VLG A;  4I3J A;  5AVF A;  5J7E A;  1UGU A;  3CWF A;  2JN7 A;  3VE4 A;  4BBU A;  4ETZ A;  3K3D A;  4Y5F A;  4L9E A;  5TBM A;  4GJ4 A;  3VE3 A;  5IU1 A;  4CQH A;  4O0P A;  2PT7 A;  3E4Q A;  2V1A A;  2J3W A;  4IUH A;  4BMW A;  2Y79 A;  2VGL M;  4QPR A;  4ZRR A;  3CI6 A;  3LUQ A;  2OAQ 1;  1S4R A;  3UMD A;  1OTB A;  1ODV A;  3ZYT A;  2W3D A;  5F69 A;  4R38 A;  5HDD A;  5HPF A;  3MQO A;  2HV1 A;  1UWP X;  4KUO A;  4JGR A;  2M7V A;  2M7U A;  3P01 A;  2FH5 A;  2ZBB A;  1G6O A;  4PKY A;  3CLO A;  5KIZ A;  5HD5 A;  3OCN A;  3MXQ A;  5J4E A;  5FL3 A;  2O9A A;  3OLO A;  4FSF A;  2JKT M;  4GCZ A;  4B9O A;  1N9L A;  3RFB A;  2B02 A;  3F1P A;  2OWH A;  4JGO A;  2IA2 A;  3KSF A;  2L4R A;  3KYQ A;  3HJK A;  1N9N A;  3DBA A;  5AJG A;  2K7S A;  1N9O A;  3IS2 A;  4WEK A;  5DJT A;  1OJG A;  5TJJ A;  5IT5 A;  1D06 A;  3NOP C;  4HH3 A;  4I3I A;  4UEY A;  4Y3I A;  2PYR A;  1S66 L;  3T4J A;  3JVU A;  5HZH A;  3LR3 A;  3PBQ A;  5HWW A;  4GS9 A;  1LSX A;  2VZW A;  1W63 Q;  3U2A A;  4LRZ E;  3OC2 A;  1WA9 A;  4MDZ A;  4CLC C;  1DP9 A;  4WEL A;  4EU0 A;  4MN6 A;  5J3W A;  2W1T A;  3UB9 A;  4ETX A;  3C30 A;  2M1C A;  4ARZ A;  1XJ4 A;  4Y2F A;  1MZU A;  2V9A A;  1MKM A;  4EEP A;  2A24 A;  1V9Y A;  2NUP C;  1Y28 A;  1DP6 A;  3T50 A;  4UQI M;  4HIA A;  4XT2 A;  1VHM A;  2A2L A;  2XRN A;  1GSX A;  3F1N A;  3FPW A;  5DFY A;  3T4Q A;  3C2W A;  4BWI A;  2P04 A;  3MFX A;  3MMH A;  2ZMF A;  3LI9 A;  3O5Y A;  2O9B A;  4HP9 A;  1YSQ A;  3KYZ A;  3EGD C;  4GLQ A;  1YAX A;  2LB9 A;  1LL8 A;  2VJW A;  2QKP A;  4DMZ A;  4JGQ A;  4LRY C;  4NXG A;  2YKH A;  1ZHH B;  2VX8 A;  3LIA A;  2LB5 A;  1NLY A;  4WUJ A;  2VV7 A;  2PHY A;  3S7P A;  1G28 A;  4BBV A;  4EQ1 A;  1EW0 A;  4HH2 A;  4HHD A;  4HQA A;  4HJ6 A;  4OOM A;  3BJN A;  2W3H A;  3IS2 B;  3K2N A;  5C5K A;  3FC7 A;  2QJ5 A;  3T4K A;  2OWJ A;  3F1P B;  5DFX A;  4NXB A;  1NRJ A;  3MR0 A;  3KO6 A;  5F5Y A;  4F3L B;  1OT6 A;  2GNX A;  3LR4 A;  1KOU A;  1VB6 A;  2XSS A;  3B42 A;  2PDR A;  4P6Z S;  4RQ9 A;  2W27 A;  4BJP A;  1F5M A;  2VEA A;  1P0Z A;  2HJ9 C;  3B47 A;  4LRX C;  3CAX A;  1S67 L;  5K5B A;  1LSV A;  4NKP A;  1XJ6 A;  2A24 B;  1OTD A;  3OCL A;  3ICY A;  4R70 A;  2WKP A;  4GW9 A;  2XA7 S;  2O99 A;  3LI8 A;  4CLC B;  1T1A A;  4EES A;  3PBS A;  5DF9 A;  2DMW A;  3G6O A;  4E04 A;  4WEJ A;  4B93 A;  1TD5 A;  2HGV A;  1P9R A;  3PXP A;  2ZOI A;  1IFQ A;  2OAP 1;  3MJQ A;  3RH8 B;  4KUK A;  2JKT I;  1OTI A;  4I39 A;  2JHE A;  3T4T A;  5HPI A;  2HF6 A;  3H7W B;  4EET B;  3IBR A;  3F1N B;  4DN0 A;  2GJ3 A;  2ZOH A;  2EA9 A;  3H82 B;  3ULF A;  3F1O A;  3W2Z A;  4L9G A;  2JKR I;  4Q0I A;  3TRC A;  2KOI A;  4EEU A;  5HWV A;  2MJ6 A;  2EWV A;  2W3E A;  2KX6 A;  3KSH A;  1DP8 A;  4O01 A;  2Z6C A;  2QYB A;  2V1B A;  1S1Y A;  2BAS A;  2VGL S;  2VV6 A;  3S7Q A;  3KX0 X;  1F98 A;  4UQI S;  2WKR A;  4Q0J A;  3C8C A;  3KSI A;  3BY8 A;  4MN5 A;  5A8B A;  4NXE A;  3PBN A;  3VV4 A;  1TS8 A;  1UWN X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...