3UY6A

Blar1 sensor domain from staphylococcus aureus with n439v mutation
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
252
structure length
252
Chain Sequence
QSITDYNYKKPLHNDYQILDKSKIFGSNSGSFVMYSMAADAYYIYNEKESRKRYSPNSTYKIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVVWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An amino acid position at crossroads of evolution of protein function: antibiotic sensor domain of BlaR1 protein from Staphylococcus aureus versus clasS D beta-lactamases
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Penicillin-binding protein
molecule keywords Regulatory protein BlaR1
total genus 85
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3uy6A00
4S2NC 5CHJA 4QY6A 3G30A 4E3IA 3G4PA 3PBRA 4P0MA 1TDGA 2JBFA 3IXGA 4JKTA 5GLDA 2XFSA 2V1ZA 4B88A 4OPYA 1IYSA 5DF7A 2J9PA 2P9VB 2ZQ8A 3BYDA 4RVAA 2Y2GA 3OCNA 4R3BA 2OLUA 1BT5A 5AQAA 2Y59A 3WRTA 3IH8A 4KZ9A 2UWXA 4MBKA 5FI7A 3P98A 4KZBA 3Q07A 3FKVA 3W4PA 4BQMA 3ZG5A 2JCHA 4ZJ1A 3GSGA 4KG6A 4ID4A 1L0GA 4O7DA 4MBFA 3NDEA 1K56A 5FQMA 4ZDXA 2JE5A 3OPPA 1FCOA 3IWOA 4R3JA 2EFUA 3PTEA 3V50A 2ZQAA 5IHVA 1PWDA 4Z9QA 1MKIA 1CEGA 2Y2JA 2PU4A 3CJMA 3Q1FA 1ESIA 2EX8A 4N9KA 3MKFA 2PU2A 4BD1A 1K4FA 3NCKA 3M2KA 2HDSA 1ALQA 1K57C 4WYYA 4GD6A 3ISGA 1VQQA 1BZAA 2ZM2A 4KZ7A 3OZHA 3UO9A 4E6WA 2E8IA 1K55A 1JWZA 2RL3A 1FSYA 1ES3A 3VSKA 2EFXA 3VP2A 1K4EA 1L0EA 1MWUA 3ZFZA 4U3TA 2ZQCA 3IWIA 4OQ0A 4JF4A 3VSLA 3LO7A 3BFFA 2WADA 5FAQA 2WKEA 2WKIA 3HBRA 2X01A 3M2JA 4KQRA 3UDIA 4Y0TA 4EBNA 3BRMA 4R1GA 1Q2QA 2Q9MA 1SDEA 3LCEA 2H0TA 3QHYA 4DF6A 3IF6A 4GDBA 3SS4A 2WGWB 1H8ZA 3LEZA 5DF9A 3HLBA 3OPLA 4XUZA 3UPOA 3G34A 3Q7VB 1KE0A 3ZG7B 1JTDA 3BM6A 3VFFA 2ZC4B 1ES4A 1MBLA 4JLFA 5CERA 3C7VA 5E2EA 5J8XA 4OPZA 4K0XA 3ZVTA 1MPLA 1RGZA 4S2JA 4QD4A 5E2GA 1QMEA 4OQIA 4JBFA 2WGVA 4IVIA 2CC1A 1ESUA 4UAAA 1M40A 3BEBA 3WWXA 3C4OA 5FSRA 3ZG9B 4FSFA 1CEFA 3IXHA 3RJUA 3NBLA 3O88A 3GVBA 3ZGAB 3VOYA 2H10A 3IQAA 3VP4A 3WS1A 2IWDA 4GZBA 1NYYA 5GHZA 4OONA 3TSGA 1XP4A 4KG2A 1BTLA 5FQJA 3V39A 3PBOA 5CTNA 1NYMA 1YQSA 1CK3A 1JWPA 3Q7ZA 1XXMA 4QJGA 1IKGA 5BOHA 4EV4A 2G2UA 1YT4A 3WS0A 2ZC3B 3N4IA 3EQUA 4FH2A 2ZJ9A 2HP5A 3IT9A 4FD8A 1PI5A 1W7FA 4KZ5A 4K0WA 1EI5A 4E3MA 1PIOA 1SCWA 3PAGA 2XGNA 1ZC2A 5M18A 2XEPA 3BFDA 3N7WA 4X53A 4OKPA 4BL2A 4XUXA 5FATA 3SH9A 2P9VA 3HLWA 3WS5A 3QNCA 4PM9A 4WELA 3O87A 3IHBA 1IYQA 2BLSA 3ITBA 4LCMA 4WMCA 5HFOA 2HP9A 1QMFA 3MZEA 5FQKA 1GHPA 3PBTA 3HVFA 5EVLA 1PYYA 1YLPA 2J8YA 2XH9A 1FQGA 3D4FA 1ZG4A 2EX9A 3MXRA 2XD1A 2ZD8A 2VGJA 1PWCA 4L0LA 3HLDA 4MEZA 3VMAA 3Q7VA 3MKEA 4GN2A 3Q82A 3QNBA 5CHMA 1ES2A 4N1HA 4E6XA 3WS4A 4DE2A 2ZQ7A 2HDUA 1I5QA 1E25A 1BUEA 2QZ6A 2R9WA 4PPRA 3JYIA 2QPNA 1YLYA 3SH8A 5L2FA 3HLCA 5I94A 1DJBA 5EECA 4GKUA 5AQ7A 4C75A 3OCLA 4PMAA 1FCNA 3LY4A 5F1FA 3CG5A 4DDSA 3TOIA 2G2WA 1LI9A 1RGYA 1ES5A 4GOGA 1FR1A 1C3BA 3CZDA 3VFHA 5G18A 4DE1A 1YLTA 3HUOA 1SDNA 1ZKJA 1K6RA 3G35A 4OOYA 1IKIA 4GDNA 4OLDA 2HDRA 4WZ5C 1E3UD 1W79A 2C6WB 2I72A 2ZC6B 1W5DA 3GV9A 4KENB 1G68A 2Y2NA 4DE0A 4E3NA 1LLBA 4R23A 4OP5A 4WZ4A 2X71A 4X56A 3ZVWA 4HEFA 1IELA 5U47A 1KGFA 4ZBEA 1I2WA 4RX2A 3DWKA 1NJ4A 3C7UA 3NY4A 5F83A 3BFCA 4YINA 3UE1A 1M6KA 4OH0A 4UA6A 4IEDA 4MLLA 1VM1A 4S2KA 2J7VA 3A3FA 5M1AA 5FA7A 5A90A 3UY6A 3DWZA 3ZG0A 5EE8A 5HAIA 4N9LA 3UPPA 1KVLA 4DE3A 3E2KA 1PZOA 4GD8A 4BLMA 3HUNA 1EWZA 5EVIB 1WE4A 5HARA 3IF5A 5CGXA 5DTKA 1U60A 3ZNYA 3CMZA 4ZJ2A 4OQGA 3UDXA 1ZG6A 3G2YA 1RP5A 1NZUA 2A49A 4OQHA 4P85A 2FFYA 1GCEA 1BLSA 3OPRA 3S22A 5DTSA 3N8LA 2Y2OA 1HZOA 4OP8A 2R9XA 1BSGA 4E3JA 4S2MA 4PM6A 4YFMA 5DF8A 1O7EA 1KGEA 4X68A 4F94A 1KDSA 1KE4A 2Y2QA 1PW8A 3BFEA 1L0DA 3NI9A 5KMWA 5EOEA 2WZZA 4B4ZA 4NK3A 2IWBA 3IH9A 3P09A 5GHXA 1E3UA 4S2PA 3EQVA 4ZJ3A 4R4SA 5GLBA 2V20A 2BG1A 2WAFA 4R4RA 3C4PA 2Y2HA 1SKFA 3IXBA 3WS2A 2OLVA 1XA7A 2H5SA 1N9BA 1OMEA 2Y2MA 4U0XA 1WYCA 4UA7A 4DDYA 1K6SA 3ZNTA 2EX6A 4KZ8A 4CJNA 4E3KA 1JVJA 5AQ9A 5E43A 4A5RA 3TG9A 2Y2LA 1XX2A 2XR0A 4JPMA 2Y2PA 4C3QA 4WM9A 1CI8A 1K55C 5E2FA 5HAQA 1HD8A 1GA0A 3HL9A 3HREA 2HDQA 1J9MA 2H0YA 3O86A 3MZFA 4GB7A 1Q2PA 2C5WB 4KG5A 1H8YA 5FQIA 2WAEA 2Z2MB 2DNSA 4RX3A 5AQBA 4DXBA 4WMCD 4LENA 4OLGA 4E3LA 4Y7PA 3IXDA 4KZ4A 3VP0A 1DY6A 5EVIA 3BLMA 2XF3A 4QY5A 3N8SA 4WEKA 2WZXA 4U0TA 5EOOA 5EPHA 2ZM0A 1JWVA 3S4XA 4C6YA 4X6TA 5GLAA 1S0WA 1ONHA 2Y91A 3UE0A 3BECA 1TEMA 3A3JA 5HW3A 4K91A 1TVFA 3FKWA 3GTCA 2EXAA 5GL9A 1KE3A 1YLWA 1NZOA 3I7JA 1G6AA 3G2ZA 3A3EA 1MWRA 2WYXA 5D3OA 1GA9A 2ZQDA 3VOZA 2V2FF 5TR7A 5HX9A 3FV7A 3FZCA 3W8KA 3MZDA 5FI6A 4LV3A 5JYPA 1FCMA 3AGFA 3IF6C 1MWSA 1N4OA 4CPKA 4EQIA 4R0QA 5DTTA 4JF6A 4LV1A 1RCJA 3FWLA 5FQ9A 4E3OA 3W4QA 1DJAA 2WUQA 4OOMA 2FFFB 1W8YA 4IVKA 4IBRA 1BLCA 3O3VA 3HLFA 2QMIA 4B4XA 3G31A 5E2HA 2A3UA 2DRWA 3W4OA 3SH7A 5FAPA 4UHUA 4S2OA 4EUZA 3BLSA 2XQZA 4S2NA 2OSUA 3GQZA 3G32A 5EVID 3V3SA 5JYOA 2ZLYA 3MXSA 4JXSA 2GDNA 2Z2LB 5FDHA 5CEBA 3RXWA 4QB8A 4HESA 2WK0A 2ZC5B 4BENA 4N1XA 1XGIA 3GMWA 4EBLA 5M19A 3ZG8B 1ERQA 3OPHA 3MFDA 5CRFA 2Y2IA 3NC8A 5CEDA 1YM1A 5CTMA 3S1YA 5GLCA 4KZAA 3UDFA 2IWCA 3N8RA 4QHCA 3E2LA 4Y0OA 2XFTA 1LL5A 1YMSA 1SHVA 4KQOA 4DRTA 3M6HA 3MBZA 3Q81A 1BLHA 3HLEA 4PM5A 4LV0A 1GHMA 1GHIA 3LY3A 4JF5A 1MWTA 4EBPA 3ZDJA 3SS3A 2WGIA 1K54C 3ZHHA 3N6IA 4LCLA 3UNWA 1O07A 5F82A 4KQQA 1BLPA 1EROA 1W8QA 3SS5A 2HPBA 1YMXA 2ZQ9A 1Y54A 4JXVA 3SOIA 3GRJA 3VP1A 1KDWA 4WZ5A 1PW1A 1E4DA 5EUAA 4N92A 2VGKA 2WGWA 3NIAA 3GR2A 2Y4AA 1XGJA 4D2OA 4BJPA 5FI2A 5F1GA 1NXYA 4DKIA 2EX2A 1K25A 1XA1A 3UN7A 1ONGA 1K57A 1BULA 4S2LA 4KZ6A 4DXCA 1K56D 4UA9A 5HL1A 5CGWA 3ZCZA 4KZ3A 5CECA 5KSHA 4P6BA 5CHUA 1KGGA 3OC2A 5TFQA 4FCFA 1DJCA 4S2IA 1HVBA 1IEMA 4MBHA 2ZC7A 1NY0A 5GHYA 4BL3A 5KZHA 1LL9A 5HAPA 4OOLA 4Q8IA 2B5RA 3C5AA 4OPQA 1NRFA 1AXBA 2Q9NA 3B3XA 5EVIC 3VP3A 1JTGA 3M6BA 1FOFA 1YLZA 3IWQA 4Y0UA 5A93A 3PBNA 4H8RA 5CXWA 3RXXA 3V5MA 1LI0A 3FYZA 1Z6FA 5DVAA 2PBYA 4ZAMA 3ITAA 4EWFA 2XLNA 2XD5A 1ERMA 3A3DA 1CI9A 4FH4A 3IHAA 4MNRA 4RYEA 2Y55A 1S6RA 4PM8A 3V3RA 4BD0A 1YLJA 2RCXA 2ZM8A 3PBQA 3A3IA 1KVMA 4HBUA 5A91A 2DCFA 4IBXA 4X69A 1K38A 2XK1A 3AGEA 4JXWA 1K54A 5CGSA 3DW0A 1LHYA 2WKHA 2J9OA 3DTMA 4PM7A 4GNUA 1WYBA 2HP6A 3NDGA 5TGFA 1PZPA 4M3KA 1I2SA 2OV5A 1FSWA 1L0FA 2X02A 2Y2KA 3AGDA 3PAEA 3IF6B 5A92A 4QU3A 1IYPA 4JXGA 1PWGA 4LV2A 1XPBA 4RA7A 4ZTKA 4HBTA 4X55A 3WRZA 3PBSA 4WEJA 1H5XA 1MXOA 3BFGA 3UPNA 3UE3A 2P74A 1TDLA 3HUMA 4P87A 2EXBA 4WBGA 5FQQA 1HTZA 1PI4A 2ZMAA 1MY8A 2XDMA 1IYOA 4XXRA 5FASA 4OPRA 4OVDA 3HLGA 4NETA 5KSCA 5FAOA 1XKZA 2JC7A 1L2SA 1FR6A
chains in the Genus database with same CATH superfamily
4O0PA 4P0MA 2V1ZA 2E8JA 4EU0A 2J9PA 1OJ5A 2P9VB 2ZQ8A 3BYDA 3OCNA 3WRTA 2Y59A 4EUVA 5FI7A 3MMHA 2GZAA 3E98A 4IHQA 4ZJ1A 4ID4A 4MBFA 1BYWA 5FQMA 4R3JA 1FCOA 3IWOA 3PTEA 2ZQAA 5IHVA 1PWDA 4Z9QA 3TE8A 1CEGA 1W63Q 2Y2JA 3CPTA 3Q1FA 4NXFA 4NG2A 4N9KA 2PU2A 5CX7A 1ALQA 1S67L 1K57C 3KX0X 3ISGA 1VQQA 4E6WA 3VP2A 1L0EA 3L7HA 3VSLA 4OQ0A 3V67A 3LO7A 5IU1A 3HBRA 4KQRA 3BRMA 3LCEA 3S7OA 3LEZA 4NKPA 4UQIS 4GS9B 1JTDA 2ZC4B 1MBLA 5F5YA 2VGLM 5E2GA 1DRMA 3O5YA 2CC1A 3MS6A 4UAAA 3IX8A 4FSFA 1MC0A 3RJUA 3NBLA 3ZGAB 5HWVA 4GZBA 4OONA 3RFBA 4EETB 1XXMA 4QJGA 5BOHA 2G2UA 3VE3A 3N4IA 1VHMA 3EQUA 4F3LB 4LFUA 1W7FA 1EI5A 5DKKA 1GSWA 3BQAA 5M18A 1ZC2A 3BFDA 4BL2A 3SH9A 4L9EA 3IHBA 4WMCA 3FC7A 3HVFA 5EVLA 1PYYA 2XH9A 4M4XA 3MXRA 3HLDA 1LSXA 3Q82A 5CHMA 1ES2A 1I5QA 1YLYA 3W2ZA 3HLCA 4R38A 5I94A 3T1RA 5AQ7A 2PD8A 3H9WA 5F1FA 4DDSA 2K2NA 1C3BA 4DE1A 4OOYA 4GDNA 2HDRA 1E3UD 3GV9A 1W5DA 4KENB 3D3OA 3B42A 4GLQA 4HEFA 3DTIA 3UE1A 3NY4A 3BFCA 3LYXA 2JKGA 3A0VA 1IFQA 3ZQ5A 5A90A 3UY6A 5EE8A 3T12B 4N9LA 3E2KA 1PZOA 1EWZA 1WE4A 4RQ9A 3A0SA 2ZOIA 4KUKA 4OQGA 3UDXA 4CQHA 4P85A 5AVFA 1VEUA 2J3TC 1KE4A 2JKFA 5DJUA 1PW8A 3BFEA 3PXPA 3F1OB 5EOEA 2WZZA 1D06A 5GHXA 3EQVA 4ZJ3A 3MXQA 1VB6A 4R4RA 5HDCA 2Y2MA 1WYCA 4DDYA 2YKFA 3TW8A 2JN7A 2EX6A 2K7SA 4XT2A 1JVJA 5AQ9A 4A5RA 4C3QA 2Y2PA 2NUPC 5E2FA 2VEAA 2HDQA 4X1LA 4GB7A 2PHYA 4KG5A 1H8YA 2Z2MB 4OLGA 5DFYA 1F9IA 1DY6A 5EVIA 4EESA 3OOVA 4U0TA 5DFXA 5EOOA 2ZM0A 4I39A 2XSSA 4MMNA 3FKWA 5GL9A 2IA2A 5HD5A 1YLWA 5HPFA 3VOZA 5HX9A 3FV7A 1IOUA 1FCMA 3R4KA 3B47A 3F1NA 4ETXA 4LV1A 1G6OA 1DJAA 2WUQA 5EVEA 4IBRA 2QMIA 4B4XA 5E2HA 4JGPA 4UHUA 2OSUA 3ULFA 2ZLYA 3MXSA 4HESA 2ZC5B 4I3IA 3T4QA 1FILA 3OPHA 3T4KA 4EXOA 4FUWA 4LGWA 3E2LA 1DP6A 3HCYA 1GHMA 1GHIA 2O0YA 4JF5A 2WGIA 1K54C 3ZHHA 4LCLA 3UNWA 2H28A 4CLCD 4G3KA 1TS6A 1EROA 2INWA 3SS5A 1YMXA 4JXVA 1YPRA 3SOIA 3VP1A 3VE4A 2QHKA 5FI2A 3CHWP 1BULA 2ZMFA 4S2LA 5CGWA 1V9ZA 5CECA 4P6BA 5TFQA 4CLCB 4Y15A 3C5AA 2Q9NA 3B3XA 1JTGA 3KYZA 4H8RA 5CXWA 3RXXA 3S7QA 3V5MA 5AVEA 2OOLA 5DVAA 5HDSA 1P9RA 2P7JA 2JKRI 1ERMA 2A2LA 4FH4A 4MNRA 4RYEA 4PM8A 4WUJA 1YLJA 4NXBA 4HBUA 2DCFA 1K38A 4II7A 4JXWA 5MC7A 1LHYA 2HF6A 5I5LA 4PM7A 3H7WB 2HP6A 2QJ7A 5J7EA 2OV5A 1FSWA 3PAEA 3AGDA 4LPZA 4BBTA 1PWGA 2DMWA 4RA7A 4X55A 3BFGA 5HL6A 5HDDA 3LFVA 3C30A 2R78A 1PI4A 2ZMAA 3U4LP 4DN0A 4OPRA 3HLGA 4NETA 2LB5A 5FAOA 2JC7A 4JF6A 5CHJA 3L9KA 4QY6A 4E3IA 3PBRA 1TDGA 4JKTA 5GLDA 2I9VA 1IYSA 5DF7A 2B02A 2Y2GA 5AQAA 1BT5A 5K5BA 4YWZA 1YKDA 3ZG5A 2JCHA 1S1YA 3NDEA 1X0OA 1G5UA 3TRCA 2PU4A 4Y13A 3MKFA 3DBAA 3NCKA 2HDSA 4GHIA 3UO9A 4G3VA 4AFIA 1LL8A 2E8IA 1JWZA 3LR4A 4L9FA 3VSKA 2ZQCA 3IWIA 1LT0A 2WADA 2WKEA 1CJFA 4YNRA 3UDIA 2XA7S 4NXEA 4R1GA 3ICYA 4GDBA 3OPLA 4I3AA 1XJ6A 3VFFA 1TF1A 1XJ3A 5J8XA 4OPZA 1ODVA 1MPLA 4S2JA 1QMEA 3NHQA 5FDSA 2QKPA 3WWXA 5FSRA 1CEFA 3O88A 3GVBA 3MR0A 1T1AA 2A24A 2H10A 3VOYA 3WS1A 1NYYA 5FQJA 1YQSA 2M7UA 1CK3A 1JWPA 3LIBA 3Q7ZA 4UQIM 5HD3A 4BMWA 2P04A 2ZJ9A 4KZ5A 1SCWA 2QJ5A 3GDIA 3NULA 3CI6A 3N7WA 2P08A 4XUXA 3P01A 3WS5A 4Q0HA 4WELA 4PHTA 1IYQA 3RTYA 3BJNA 4LCMA 2HP9A 1QMFA 1NLZA 2KOIA 5HWTA 1OTEA 1YLPA 2J8YA 3LUQA 2M1CA 4L0LA 3D4FA 1ZG4A 2EX9A 2W3DA 3MQQA 3VMAA 4MEZA 4GN2A 4DE2A 4IUHA 1E25A 1BUEA 2R9WA 5J4EA 1DJBA 2W27A 4C75A 3CG5A 2G2WA 1ES5A 4GOGA 3LR0A 3CZDA 1PRQA 1YLTA 1SDNA 1ZKJA 4HQAA 1ZTUA 1IKIA 3D9YA 2ZC6B 1G68A 1LLBA 4WZ4A 4X56A 3ZVWA 1IELA 3NOUC 4RX2A 1NJ4A 5F83A 4YINA 4ARZA 2VX8A 4OH0A 1ACFA 2W3EA 1VM1A 2J7VA 3A3FA 3DTEA 5M1AA 5HZHA 3ZG0A 1WA9A 2KLIA 3ZYTA 5CGXA 1U60A 4HI4A 1S1ZA 1RP5A 2A49A 4OQHA 5F69A 3F1OA 3S22A 4X25A 3OPRA 4ARZB 2R9XA 4X68A 3NI9A 5A8BA 5HWWA 4NK3A 2IWBA 3QP4A 1E3UA 4S2PA 5GLBA 2V20A 2BG1A 3IXBA 3WS2A 5F6AA 2OLVA 1N9BA 1K6SA 5E43A 3TG9A 1XX2A 5DJTA 1F5MA 1K55C 5HAQA 1HD8A 2ZOHA 1GA0A 3HL9A 3PR6A 2HJ9C 3MZFA 2NUTC 2C5WB 2VV7A 2DNSA 4RX3A 5AQBA 3TJZC 4DXBA 4WMCD 5L09A 4E3LA 4KUOA 4KZ4A 5TJJA 3LI8A 4I5SA 3N8SA 2L4RA 2WZXA 3QP1A 3S4XA 5GLAA 2Y91A 3BECA 3A3JA 5HW3A 4K91A 4EW7A 4E04A 1G6AA 3G2ZA 1MWRA 2WYXA 2V2FF 5JYPA 2J80A 3AGFA 1MWSA 1Y28A 4LLOB 5FQ9A 1W8YA 4IVKA 4Q0JA 3HLFA 2V1AA 2A3UA 2DRWA 4QWOA 2K31A 3SH7A 4S2OA 4S2NA 5EVID 4JXSA 5CEBA 4QB8A 3QP8A 3MFDA 3NOPC 3NC8A 5CEDA 1Z09A 5GLCA 2IWCA 4QHCA 3IBJA 1SHVA 4KQOA 4DRTA 3MBZA 3Q81A 1VETA 3HLEA 4LV0A 1MWTA 3ZDJA 2YKHA 2HPBA 4XT2B 2PBDP 2VGKA 2V0UA 3GR2A 3KSHA 5F1GA 3E0YA 2V8FA 2W1TA 2LB9A 4KZ6A 4DXCA 4UA9A 3ZCZA 4KZ3A 3OC2A 4ETZA 5KZHA 2ZC7A 5GHYA 4OOLA 3UB5P 5EVIC 2UV0E 2Z6CA 2J3WA 3PBNA 4HJ4A 3CPTB 4HP4A 3T4OA 1YSPA 3FG8A 3ITAA 4EWFA 3FPVA 2XLNA 5HSQA 1OTBA 3A3DA 1CI9A 1LSWA 3A0RA 2Y55A 2FH5A 2RCXA 2ZM8A 3PBQA 2VA0A 3RH8B 3A3IA 5EM1A 3BQ8A 3CUEA 4X69A 5IT5A 3AGEA 5CGSA 3KSIA 2WKHA 2VZWA 2J9OA 2PYPA 1MZUA 1F98A 5TGFA 4M3KA 3PYPA 1H8MA 4HOIA 1L0FA 4QU3A 1IYPA 4ME4A 4WEJA 4MDZA 3T1SA 2P74A 2PDRA 1MY8A 3KYEA 3LIEA 4JGOA 5FASA 4XXRA 5L8MA 1JNUA 1XKZA 3HJIA 4JGRA 1DP9A 3UMEA 1FR6A 2W3FA 3G30A 3G4PA 3IXGA 3K3DA 3KSFA 3UE6A 4MCWA 3CWFA 2WKQA 4R3BA 4X1MA 4P6ZM 3IH8A 4KZ9A 2UWXA 4MBKA 3P98A 3W4PA 1PNEA 3GSGA 4KG6A 4Y5FA 1HLUP 4ZDXA 2BASA 1SKOB 2QYBA 2JE5A 3OPPA 3V50A 1PFLA 1P97A 3CJMA 1ESIA 3LI9A 1DP8A 2PYRA 4IUKA 4BD1A 3MF0A 4WYYA 4R70A 4GD6A 2ZM2A 4KZ7A 3OZHA 5G4ZA 1K55A 2RL3A 1OTIA 3ZFZA 5EFWA 4HJ3A 4JF4A 1A0KA 1FIKA 4I3JA 5FAQA 3SW1A 2JKTI 2X01A 4EBNA 3QP5A 2Q9MA 1SDEA 4KQDA 4GHIB 2WGWB 1H8ZA 5DF9A 4XUZA 2XRNA 3KO6A 3ZG7B 3BM6A 4HP9A 1ES4A 5CERA 3C7VA 5E2EA 2L0WA 3ZVTA 1RGZA 2D02A 4BWIA 2WGVA 1ESUA 1N9LA 1M40A 3C4OA 2VLGA 1OT9A 3ZG9B 4O8GA 4P6ZS 3GECA 3IQAA 5GHZA 3TSGA 3UB8A 4KG2A 1BTLA 3PBOA 4F3LA 3DTKA 3EWKA 2PR6A 2EA9A 2A24B 1YT4A 5DKLA 3WS0A 2ZC3B 3MSHA 4FH2A 1G28A 3IT9A 4FD8A 4CLCA 3K2NA 5EM0A 5J3WA 2P9VA 3HLWA 2G7UA 3O87A 4LRXC 2BLSA 3MZEA 3PBTA 3C38A 1FQGA 2V0WA 2XD1A 2VGJA 2ZD8A 3S7PA 3QP2A 3UB9A 3Q7VA 3MKEA 4G3WA 4E6XA 1XFQA 4L9GA 2PRFA 2HDUA 3E4OA 4PPRA 1P9WA 2QPNA 3VV4A 5L2FA 4GKUA 3OCLA 4PMAA 1FCNA 3LGOA 3LY4A 5FEGA 1RGYA 1J3WA 5G18A 1K6RA 1T19A 3BY9A 3F1NB 2C6WB 1W79A 1TS8A 2W1RA 4DE0A 4E3NA 2HZ5A 3K3CA 4LRYC 4OP5A 2X71A 4HJ6A 1KGFA 4ZBEA 1I2WA 3C7UA 2KDKA 4UA6A 2J3TD 2W0NA 2Z6DA 5FA7A 4HNBA 1KVLA 4DE3A 4BLMA 3IF5A 5DTKA 3CMZA 2XA7M 3LR5A 1TS0A 2FFYA 3CAXA 3N8LA 2Y2OA 1HZOA 2O9BA 4E3JA 4S2MA 4PM6A 1KGEA 1KDSA 3T4SA 3LICA 3R7WB 4GJ4A 1L0DA 5KMWA 3B33A 3IH9A 1GSXA 1AWIA 2PAVP 2Y2HA 4IJGA 4FOFA 1XA7A 2GJ3A 1OMEA 4U0XA 4WF0A 4KZ8A 4CJNA 4E3KA 3T1QB 3DAVA 4WLAA 2XR0A 3HREA 3H7WA 1VEUB 1Q2PA 2WAEA 4LENA 4B93A 3IS2A 1TD5A 1VETB 3BLMA 2HJEA 2Y8HA 5EPHA 4PAUA 1TS7A 1ONHA 3UE0A 1TVFA 3GTCA 2EXAA 1KE3A 3I7JA 5D3OA 1GA9A 2ZQDA 5TR7A 3LIAA 3FZCA 3W8KA 5FI6A 1UGUA 3UB7A 4CPKA 4EQIA 1N4OA 5DTTA 2PR5A 1RCJA 3FWLA 3W4QA 4OOMA 4PKYG 3G6OA 3G31A 1LSVA 4I38A 3W4OA 3T4LA 4EUZA 3BLSA 1K0KA 3G32A 5FEFA 3QP6A 2GDNA 2JKTM 5FDHA 3EEHA 3BY8A 3P7NA 4BENA 4N1XA 1XGIA 3GMWA 2EWVA 2PT7A 3PHYA 3E4QA 3MJQA 2HGVA 2Y2IA 2VGLS 5G4YA 4DMZA 3MFXA 3UDFA 2QWSA 1EW0A 1LL5A 2ZBBA 3M6HA 4PM5A 1BLHA 4MN7A 4HH2A 2KX6A 3N6IA 3UMDA 2O9AA 1O07A 3UB6A 4CLCC 4KQQA 3IBRA 1YAXA 5L07A 2ZQ9A 3GRJA 1PW1A 5EUAA 4N92A 5TBMB 2Y4AA 1XGJA 4D2OA 4DKIA 2EX2A 1XA1A 1ONGA 4Y17A 1K56D 5CHUA 1KGGA 2VV8A 3C8CA 2GNXA 1HVBA 3E4PA 1NY0A 4BL3A 5HAPA 1T1CA 1T1BA 1AXBA 3VP3A 4Y0UA 5A93A 4EEPA 4EEUA 1Z6FA 2VJWA 2PBYA 4ZAMA 3U2AA 4ZRRA 4YOFA 2XD5A 3V3RA 1KVMA 4IBXA 2XK1A 1K54A 3T4TA 5FL3A 3DW0A 4HIAA 3IX4A 4LRZE 2V1BA 2W3GA 4GNUA 1WYBA 2EWWA 5A92A 3IF6B 4LV2A 1XPBA 4ZTKA 3WRZA 3PBSA 1H5XA 2OWHA 3UE3A 1TDLA 3HUMA 4P87A 4WBGA 5FQQA 1IYOA 3EOIA 4NEED 2O99A 5M19A 4S2NC 2JBFA 2XFSA 4MN6A 3NECA 3NJAA 4OPYA 4B88A 1Y4OA 4RVAA 2OLUA 2GX5A 3MQ0A 4FTXA 4KZBA 3Q07A 3FKVA 2VV6A 4BQMA 1L0GA 3JVUA 4O7DA 1K56A 2EFUA 1MKIA 1L3LA 5C5KA 2EX8A 1K4FA 3M2KA 3CITA 1BZAA 3EGDC 1FSYA 1D7EA 1ES3A 2EFXA 1K4EA 1MWUA 2OAP1 4U3TA 3BFFA 1S66L 2WKIA 1OJGA 3M2JA 1CQAA 3LIFA 4Y0TA 1OT6A 1Q2QA 3F1PB 1NWZA 2H0TA 3OBFA 3QHYA 4DF6A 3IF6A 3SS4A 3HLBA 3UPOA 3CUEC 3G34A 3Q7VB 1KE0A 1ZHHB 4GW9A 4JLFA 4K0XA 4QD4A 4OQIA 4JBFA 3VOLA 4IVIA 2V9AA 2VK3A 3BEBA 1NRJA 3IXHA 2OWJA 3LEQA 2WKPA 3VP4A 2IWDA 3KYQA 1XP4A 3V39A 3D72A 1NYMA 5CTNA 4Y2FA 2ZL1A 1IKGA 1SZVA 1SKOA 4QPRA 2HP5A 1YSQA 1PI5A 4K0WA 3SZTA 4E3MA 1PIOA 3PAGA 2XGNA 2XEPA 4X53A 4OKPA 5FATA 3QNCA 4PM9A 3ITBA 5HFOA 5FQKA 1GHPA 4O01A 2VKSA 3T50A 5TBMA 1STZA 1PWCA 5LBRA 3QNBA 4N1HA 1CF0A 3WS4A 2ZQ7A 1KOUA 2QZ6A 3JYIA 1XJ4A 3SH8A 4GCZA 3F1PA 2HV1A 5EECA 4EERA 3TOIA 1LI9A 1F2KA 1FR1A 3VFHA 3HUOA 3G35A 1S4SA 4OLDA 4WZ5C 2CMNA 2I72A 2Y2NA 4BBUA 1OPXA 4R23A 4MN5A 5U47A 3DWKA 1M6KA 1XJ2A 4IEDA 4MLLA 5IS1A 4S2KA 2XROA 3DWZA 2B95A 5HAIA 3UPPA 5AJGA 4GD8A 3HUNA 5EVIB 5HARA 1MKMA 3ZNYA 4ZJ2A 1ZG6A 3G2YA 4WN5A 1NZUA 3EGXC 1GCEA 1BLSA 1V9YA 5DTSA 4UEYA 2V8CA 4OP8A 1BSGA 4YFMA 5DF8A 1O7EA 5L10A 5F68A 4F94A 4GS9A 4K08A 2Y2QA 3FPWA 3IX3A 4B4ZA 5KIZA 3P09A 4R4SA 2L1MA 2WAFA 3C4PA 1SKFA 2H5SA 2W1TB 1UWPX 4UA7A 3ZNTA 3H82B 2W3HA 1W63M 1OTAA 2Y2LA 4JPMA 2OAQ1 4Q0IA 4WM9A 1CI8A 1N9NA 3O86A 1J9MA 2H0YA 3H82A 4ESPA 3BWLA 5FQIA 1D1JA 4Y7PA 3IXDA 3VP0A 1P0ZA 2XF3A 4QY5A 4WEKA 1JWVA 4C6YA 4X6TA 1S0WA 3R7WA 4R6LA 1TEMA 3JPUA 1NZOA 2ZL1B 3A3EA 4R3AA 3MZDA 4PKYA 3BW6A 4LV3A 3IF6C 4R0QA 4Y3IA 4E3OA 2FFFB 1BLCA 4H6JB 3O3VA 3KSGA 1UWNX 3LR3A 5FAPA 3S7NA 2XQZA 3C2WA 1N9OA 3GQZA 3V3SA 5JYOA 2Z2LB 3EEAA 3RXWA 2WK0A 2B18A 1XFNA 3OLOA 4CLCE 3JVVA 4Z1WA 4EBLA 3ZG8B 1ERQA 2PD7A 3MQOA 3LIDA 5CRFA 1YM1A 5CTMA 1GSVA 3S1YA 4KZAA 3N8RA 4H6JA 4Y0OA 2D01A 2XFTA 3IS2B 1YMSA 2O9CA 2BTFP 3LY3A 4EBPA 1H0MA 3SS3A 1T18A 2MJ6A 5F82A 1BLPA 4NXGA 1W8QA 1Y54A 1KDWA 4DJ3A 4WZ5A 1E4DA 2WGWA 3NIAA 1S4RA 3HJKA 2M7VA 4BJPA 2WKRA 1NXYA 1H3QA 1K25A 3UN7A 4HY8A 1K57A 5HL1A 3NOTC 4JGQA 5EV0A 5KSHA 4HH3A 4FCFA 2ACGA 1DJCA 4S2IA 5HPIA 4MBHA 1IEMA 1LL9A 3CLOA 4Q8IA 2B5RA 4OPQA 1NRFA 3M6BA 1FOFA 1YLZA 3IWQA 4DJ2A 1LI0A 3FYZA 2JKRM 2AVXA 2JHEA 3IHAA 1S6RA 4BD0A 3T1XA 4WL9A 5A91A 2Q0OA 4BBVA 4EQ1A 3DTMA 2ZMVA 3NDGA 1PZPA 1I2SA 2Y2KA 2X02A 4B9OA 4JXGA 4HBTA 1MXOA 2FZ0A 3UPNA 4D60A 3T4JA 2EXBA 1HTZA 2XDMA 1OTDA 4OVDA 5KSCA 2Y79A 4HHDA 1NLYA 1L2SA 4EV4A
chains in the Genus database with same CATH topology
4S2NC 5CHJA 4QY6A 3G30A 4E3IA 3G4PA 3PBRA 4P0MA 1TDGA 2JBFA 3IXGA 4JKTA 5GLDA 2XFSA 2V1ZA 4B88A 4OPYA 1IYSA 5DF7A 2J9PA 2P9VB 2ZQ8A 3BYDA 4RVAA 2Y2GA 3OCNA 4R3BA 2OLUA 1BT5A 5AQAA 2Y59A 3WRTA 3IH8A 4KZ9A 2UWXA 4MBKA 5FI7A 3P98A 4KZBA 3Q07A 3FKVA 3W4PA 4BQMA 3ZG5A 2JCHA 4ZJ1A 3GSGA 4KG6A 4ID4A 1L0GA 4O7DA 4MBFA 3NDEA 1K56A 5FQMA 4ZDXA 2JE5A 3OPPA 1FCOA 3IWOA 4R3JA 2EFUA 3PTEA 3V50A 2ZQAA 5IHVA 1PWDA 4Z9QA 1MKIA 1CEGA 2Y2JA 2PU4A 3CJMA 3Q1FA 1ESIA 2EX8A 4N9KA 3MKFA 2PU2A 4BD1A 1K4FA 3NCKA 3M2KA 2HDSA 1ALQA 1K57C 4WYYA 4GD6A 3ISGA 1VQQA 1BZAA 2ZM2A 4KZ7A 3OZHA 3UO9A 4E6WA 2E8IA 1K55A 1JWZA 2RL3A 1FSYA 1ES3A 3VSKA 2EFXA 3VP2A 1K4EA 1L0EA 1MWUA 3ZFZA 4U3TA 2ZQCA 3IWIA 4OQ0A 4JF4A 3VSLA 3LO7A 3BFFA 2WADA 5FAQA 2WKEA 2WKIA 3HBRA 2X01A 3M2JA 4KQRA 3UDIA 4Y0TA 4EBNA 3BRMA 4R1GA 1Q2QA 2Q9MA 1SDEA 3LCEA 2H0TA 3QHYA 4DF6A 3IF6A 4GDBA 3SS4A 2WGWB 1H8ZA 3LEZA 5DF9A 3HLBA 3OPLA 4XUZA 3UPOA 3G34A 3Q7VB 1KE0A 3ZG7B 1JTDA 3BM6A 3VFFA 2ZC4B 1ES4A 1MBLA 4JLFA 5CERA 3C7VA 5E2EA 5J8XA 4OPZA 4K0XA 3ZVTA 1MPLA 1RGZA 4S2JA 4QD4A 5E2GA 1QMEA 4OQIA 4JBFA 2WGVA 4IVIA 2CC1A 1ESUA 4UAAA 1M40A 3BEBA 3WWXA 3C4OA 5FSRA 3ZG9B 4FSFA 1CEFA 3IXHA 3RJUA 3NBLA 3O88A 3GVBA 3ZGAB 3VOYA 2H10A 3IQAA 3VP4A 3WS1A 2IWDA 4GZBA 1NYYA 5GHZA 4OONA 3TSGA 1XP4A 4KG2A 1BTLA 5FQJA 3V39A 3PBOA 5CTNA 1NYMA 1YQSA 1CK3A 1JWPA 3Q7ZA 1XXMA 4QJGA 1IKGA 5BOHA 4EV4A 2G2UA 1YT4A 3WS0A 2ZC3B 3N4IA 3EQUA 4FH2A 2ZJ9A 2HP5A 3IT9A 4FD8A 1PI5A 1W7FA 4KZ5A 4K0WA 1EI5A 4E3MA 1PIOA 1SCWA 3PAGA 2XGNA 1ZC2A 5M18A 2XEPA 3BFDA 3N7WA 4X53A 4OKPA 4BL2A 4XUXA 5FATA 3SH9A 2P9VA 3HLWA 3WS5A 3QNCA 4PM9A 4WELA 3O87A 3IHBA 1IYQA 2BLSA 3ITBA 4LCMA 4WMCA 5HFOA 2HP9A 1QMFA 3MZEA 5FQKA 1GHPA 3PBTA 3HVFA 5EVLA 1PYYA 1YLPA 2J8YA 2XH9A 1FQGA 3D4FA 1ZG4A 2EX9A 3MXRA 2XD1A 2ZD8A 2VGJA 1PWCA 4L0LA 3HLDA 4MEZA 3VMAA 3Q7VA 3MKEA 4GN2A 3Q82A 3QNBA 5CHMA 1ES2A 4N1HA 4E6XA 3WS4A 4DE2A 2ZQ7A 2HDUA 1I5QA 1E25A 1BUEA 2QZ6A 2R9WA 4PPRA 3JYIA 2QPNA 1YLYA 3SH8A 5L2FA 3HLCA 5I94A 1DJBA 5EECA 4GKUA 5AQ7A 4C75A 3OCLA 4PMAA 1FCNA 3LY4A 5F1FA 3CG5A 4DDSA 3TOIA 2G2WA 1LI9A 1RGYA 1ES5A 4GOGA 1FR1A 1C3BA 3CZDA 3VFHA 5G18A 4DE1A 1YLTA 3HUOA 1SDNA 1ZKJA 1K6RA 3G35A 4OOYA 1IKIA 4GDNA 4OLDA 2HDRA 4WZ5C 1E3UD 1W79A 2C6WB 2I72A 2ZC6B 1W5DA 3GV9A 4KENB 1G68A 2Y2NA 4DE0A 4E3NA 1LLBA 4R23A 4OP5A 4WZ4A 2X71A 4X56A 3ZVWA 4HEFA 1IELA 5U47A 1KGFA 4ZBEA 1I2WA 4RX2A 3DWKA 1NJ4A 3C7UA 3NY4A 5F83A 3BFCA 4YINA 3UE1A 1M6KA 4OH0A 4UA6A 4IEDA 4MLLA 1VM1A 4S2KA 2J7VA 3A3FA 5M1AA 5FA7A 5A90A 3UY6A 3DWZA 3ZG0A 5EE8A 5HAIA 4N9LA 3UPPA 1KVLA 4DE3A 3E2KA 1PZOA 4GD8A 4BLMA 3HUNA 1EWZA 5EVIB 1WE4A 5HARA 3IF5A 5CGXA 5DTKA 1U60A 3ZNYA 3CMZA 4ZJ2A 4OQGA 3UDXA 1ZG6A 3G2YA 1RP5A 1NZUA 2A49A 4OQHA 4P85A 2FFYA 1GCEA 1BLSA 3OPRA 3S22A 5DTSA 3N8LA 2Y2OA 1HZOA 4OP8A 2R9XA 1BSGA 4E3JA 4S2MA 4PM6A 4YFMA 5DF8A 1O7EA 1KGEA 4X68A 4F94A 1KDSA 1KE4A 2Y2QA 1PW8A 3BFEA 1L0DA 3NI9A 5KMWA 5EOEA 2WZZA 4B4ZA 4NK3A 2IWBA 3IH9A 3P09A 5GHXA 1E3UA 4S2PA 3EQVA 4ZJ3A 4R4SA 5GLBA 2V20A 2BG1A 2WAFA 4R4RA 3C4PA 2Y2HA 1SKFA 3IXBA 3WS2A 2OLVA 1XA7A 2H5SA 1N9BA 1OMEA 2Y2MA 4U0XA 1WYCA 4UA7A 4DDYA 1K6SA 3ZNTA 2EX6A 4KZ8A 4CJNA 4E3KA 1JVJA 5AQ9A 5E43A 4A5RA 3TG9A 2Y2LA 1XX2A 2XR0A 4JPMA 2Y2PA 4C3QA 4WM9A 1CI8A 1K55C 5E2FA 5HAQA 1HD8A 1GA0A 3HL9A 3HREA 2HDQA 1J9MA 2H0YA 3O86A 3MZFA 4GB7A 1Q2PA 2C5WB 4KG5A 1H8YA 5FQIA 2WAEA 2Z2MB 2DNSA 4RX3A 5AQBA 4DXBA 4WMCD 4LENA 4OLGA 4E3LA 4Y7PA 3IXDA 4KZ4A 3VP0A 1DY6A 5EVIA 3BLMA 2XF3A 4QY5A 3N8SA 4WEKA 2WZXA 4U0TA 5EOOA 5EPHA 2ZM0A 1JWVA 3S4XA 4C6YA 4X6TA 5GLAA 1S0WA 1ONHA 2Y91A 3UE0A 3BECA 1TEMA 3A3JA 5HW3A 4K91A 1TVFA 3FKWA 3GTCA 2EXAA 5GL9A 1KE3A 1YLWA 1NZOA 3I7JA 1G6AA 3G2ZA 3A3EA 1MWRA 2WYXA 5D3OA 1GA9A 2ZQDA 3VOZA 2V2FF 5TR7A 5HX9A 3FV7A 3FZCA 3W8KA 3MZDA 5FI6A 4LV3A 5JYPA 1FCMA 3AGFA 3IF6C 1MWSA 1N4OA 4CPKA 4EQIA 4R0QA 5DTTA 4JF6A 4LV1A 1RCJA 3FWLA 5FQ9A 4E3OA 3W4QA 1DJAA 2WUQA 4OOMA 2FFFB 1W8YA 4IVKA 4IBRA 1BLCA 3O3VA 3HLFA 2QMIA 4B4XA 3G31A 5E2HA 2A3UA 2DRWA 3W4OA 3SH7A 5FAPA 4UHUA 4S2OA 4EUZA 3BLSA 2XQZA 4S2NA 2OSUA 3GQZA 3G32A 5EVID 3V3SA 5JYOA 2ZLYA 3MXSA 4JXSA 2GDNA 2Z2LB 5FDHA 5CEBA 3RXWA 4QB8A 4HESA 2WK0A 2ZC5B 4BENA 4N1XA 1XGIA 3GMWA 4EBLA 5M19A 3ZG8B 1ERQA 3OPHA 3MFDA 5CRFA 2Y2IA 3NC8A 5CEDA 1YM1A 5CTMA 3S1YA 5GLCA 4KZAA 3UDFA 2IWCA 3N8RA 4QHCA 3E2LA 4Y0OA 2XFTA 1LL5A 1YMSA 1SHVA 4KQOA 4DRTA 3M6HA 3MBZA 3Q81A 1BLHA 3HLEA 4PM5A 4LV0A 1GHMA 1GHIA 3LY3A 4JF5A 1MWTA 4EBPA 3ZDJA 3SS3A 2WGIA 1K54C 3ZHHA 3N6IA 4LCLA 3UNWA 1O07A 5F82A 4KQQA 1BLPA 1EROA 1W8QA 3SS5A 2HPBA 1YMXA 2ZQ9A 1Y54A 4JXVA 3SOIA 3GRJA 3VP1A 1KDWA 4WZ5A 1PW1A 1E4DA 5EUAA 4N92A 2VGKA 2WGWA 3NIAA 3GR2A 2Y4AA 1XGJA 4D2OA 4BJPA 5FI2A 5F1GA 1NXYA 4DKIA 2EX2A 1K25A 1XA1A 3UN7A 1ONGA 1K57A 1BULA 4S2LA 4KZ6A 4DXCA 1K56D 4UA9A 5HL1A 5CGWA 3ZCZA 4KZ3A 5CECA 5KSHA 4P6BA 5CHUA 1KGGA 3OC2A 5TFQA 4FCFA 1DJCA 4S2IA 1HVBA 1IEMA 4MBHA 2ZC7A 1NY0A 5GHYA 4BL3A 5KZHA 1LL9A 5HAPA 4OOLA 4Q8IA 2B5RA 3C5AA 4OPQA 1NRFA 1AXBA 2Q9NA 3B3XA 5EVIC 3VP3A 1JTGA 3M6BA 1FOFA 1YLZA 3IWQA 4Y0UA 5A93A 3PBNA 4H8RA 5CXWA 3RXXA 3V5MA 1LI0A 3FYZA 1Z6FA 5DVAA 2PBYA 4ZAMA 3ITAA 4EWFA 2XLNA 2XD5A 1ERMA 3A3DA 1CI9A 4FH4A 3IHAA 4MNRA 4RYEA 2Y55A 1S6RA 4PM8A 3V3RA 4BD0A 1YLJA 2RCXA 2ZM8A 3PBQA 3A3IA 1KVMA 4HBUA 5A91A 2DCFA 4IBXA 4X69A 1K38A 2XK1A 3AGEA 4JXWA 1K54A 5CGSA 3DW0A 1LHYA 2WKHA 2J9OA 3DTMA 4PM7A 4GNUA 1WYBA 2HP6A 3NDGA 5TGFA 1PZPA 4M3KA 1I2SA 2OV5A 1FSWA 1L0FA 2X02A 2Y2KA 3AGDA 3PAEA 3IF6B 5A92A 4QU3A 1IYPA 4JXGA 1PWGA 4LV2A 1XPBA 4RA7A 4ZTKA 4HBTA 4X55A 3WRZA 3PBSA 4WEJA 1H5XA 1MXOA 3BFGA 3UPNA 3UE3A 2P74A 1TDLA 3HUMA 4P87A 2EXBA 4WBGA 5FQQA 1HTZA 1PI4A 2ZMAA 1MY8A 2XDMA 1IYOA 4XXRA 5FASA 4OPRA 4OVDA 3HLGA 4NETA 5KSCA 5FAOA 1XKZA 2JC7A 1L2SA 1FR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S2N C;  5CHJ A;  4QY6 A;  3G30 A;  4E3I A;  3G4P A;  3PBR A;  4P0M A;  1TDG A;  2JBF A;  3IXG A;  4JKT A;  5GLD A;  2XFS A;  2V1Z A;  4B88 A;  4OPY A;  1IYS A;  5DF7 A;  2J9P A;  2P9V B;  2ZQ8 A;  3BYD A;  4RVA A;  2Y2G A;  3OCN A;  4R3B A;  2OLU A;  1BT5 A;  5AQA A;  2Y59 A;  3WRT A;  3IH8 A;  4KZ9 A;  2UWX A;  4MBK A;  5FI7 A;  3P98 A;  4KZB A;  3Q07 A;  3FKV A;  3W4P A;  4BQM A;  3ZG5 A;  2JCH A;  4ZJ1 A;  3GSG A;  4KG6 A;  4ID4 A;  1L0G A;  4O7D A;  4MBF A;  3NDE A;  1K56 A;  5FQM A;  4ZDX A;  2JE5 A;  3OPP A;  1FCO A;  3IWO A;  4R3J A;  2EFU A;  3PTE A;  3V50 A;  2ZQA A;  5IHV A;  1PWD A;  4Z9Q A;  1MKI A;  1CEG A;  2Y2J A;  2PU4 A;  3CJM A;  3Q1F A;  1ESI A;  2EX8 A;  4N9K A;  3MKF A;  2PU2 A;  4BD1 A;  1K4F A;  3NCK A;  3M2K A;  2HDS A;  1ALQ A;  1K57 C;  4WYY A;  4GD6 A;  3ISG A;  1VQQ A;  1BZA A;  2ZM2 A;  4KZ7 A;  3OZH A;  3UO9 A;  4E6W A;  2E8I A;  1K55 A;  1JWZ A;  2RL3 A;  1FSY A;  1ES3 A;  3VSK A;  2EFX A;  3VP2 A;  1K4E A;  1L0E A;  1MWU A;  3ZFZ A;  4U3T A;  2ZQC A;  3IWI A;  4OQ0 A;  4JF4 A;  3VSL A;  3LO7 A;  3BFF A;  2WAD A;  5FAQ A;  2WKE A;  2WKI A;  3HBR A;  2X01 A;  3M2J A;  4KQR A;  3UDI A;  4Y0T A;  4EBN A;  3BRM A;  4R1G A;  1Q2Q A;  2Q9M A;  1SDE A;  3LCE A;  2H0T A;  3QHY A;  4DF6 A;  3IF6 A;  4GDB A;  3SS4 A;  2WGW B;  1H8Z A;  3LEZ A;  5DF9 A;  3HLB A;  3OPL A;  4XUZ A;  3UPO A;  3G34 A;  3Q7V B;  1KE0 A;  3ZG7 B;  1JTD A;  3BM6 A;  3VFF A;  2ZC4 B;  1ES4 A;  1MBL A;  4JLF A;  5CER A;  3C7V A;  5E2E A;  5J8X A;  4OPZ A;  4K0X A;  3ZVT A;  1MPL A;  1RGZ A;  4S2J A;  4QD4 A;  5E2G A;  1QME A;  4OQI A;  4JBF A;  2WGV A;  4IVI A;  2CC1 A;  1ESU A;  4UAA A;  1M40 A;  3BEB A;  3WWX A;  3C4O A;  5FSR A;  3ZG9 B;  4FSF A;  1CEF A;  3IXH A;  3RJU A;  3NBL A;  3O88 A;  3GVB A;  3ZGA B;  3VOY A;  2H10 A;  3IQA A;  3VP4 A;  3WS1 A;  2IWD A;  4GZB A;  1NYY A;  5GHZ A;  4OON A;  3TSG A;  1XP4 A;  4KG2 A;  1BTL A;  5FQJ A;  3V39 A;  3PBO A;  5CTN A;  1NYM A;  1YQS A;  1CK3 A;  1JWP A;  3Q7Z A;  1XXM A;  4QJG A;  1IKG A;  5BOH A;  4EV4 A;  2G2U A;  1YT4 A;  3WS0 A;  2ZC3 B;  3N4I A;  3EQU A;  4FH2 A;  2ZJ9 A;  2HP5 A;  3IT9 A;  4FD8 A;  1PI5 A;  1W7F A;  4KZ5 A;  4K0W A;  1EI5 A;  4E3M A;  1PIO A;  1SCW A;  3PAG A;  2XGN A;  1ZC2 A;  5M18 A;  2XEP A;  3BFD A;  3N7W A;  4X53 A;  4OKP A;  4BL2 A;  4XUX A;  5FAT A;  3SH9 A;  2P9V A;  3HLW A;  3WS5 A;  3QNC A;  4PM9 A;  4WEL A;  3O87 A;  3IHB A;  1IYQ A;  2BLS A;  3ITB A;  4LCM A;  4WMC A;  5HFO A;  2HP9 A;  1QMF A;  3MZE A;  5FQK A;  1GHP A;  3PBT A;  3HVF A;  5EVL A;  1PYY A;  1YLP A;  2J8Y A;  2XH9 A;  1FQG A;  3D4F A;  1ZG4 A;  2EX9 A;  3MXR A;  2XD1 A;  2ZD8 A;  2VGJ A;  1PWC A;  4L0L A;  3HLD A;  4MEZ A;  3VMA A;  3Q7V A;  3MKE A;  4GN2 A;  3Q82 A;  3QNB A;  5CHM A;  1ES2 A;  4N1H A;  4E6X A;  3WS4 A;  4DE2 A;  2ZQ7 A;  2HDU A;  1I5Q A;  1E25 A;  1BUE A;  2QZ6 A;  2R9W A;  4PPR A;  3JYI A;  2QPN A;  1YLY A;  3SH8 A;  5L2F A;  3HLC A;  5I94 A;  1DJB A;  5EEC A;  4GKU A;  5AQ7 A;  4C75 A;  3OCL A;  4PMA A;  1FCN A;  3LY4 A;  5F1F A;  3CG5 A;  4DDS A;  3TOI A;  2G2W A;  1LI9 A;  1RGY A;  1ES5 A;  4GOG A;  1FR1 A;  1C3B A;  3CZD A;  3VFH A;  5G18 A;  4DE1 A;  1YLT A;  3HUO A;  1SDN A;  1ZKJ A;  1K6R A;  3G35 A;  4OOY A;  1IKI A;  4GDN A;  4OLD A;  2HDR A;  4WZ5 C;  1E3U D;  1W79 A;  2C6W B;  2I72 A;  2ZC6 B;  1W5D A;  3GV9 A;  4KEN B;  1G68 A;  2Y2N A;  4DE0 A;  4E3N A;  1LLB A;  4R23 A;  4OP5 A;  4WZ4 A;  2X71 A;  4X56 A;  3ZVW A;  4HEF A;  1IEL A;  5U47 A;  1KGF A;  4ZBE A;  1I2W A;  4RX2 A;  3DWK A;  1NJ4 A;  3C7U A;  3NY4 A;  5F83 A;  3BFC A;  4YIN A;  3UE1 A;  1M6K A;  4OH0 A;  4UA6 A;  4IED A;  4MLL A;  1VM1 A;  4S2K A;  2J7V A;  3A3F A;  5M1A A;  5FA7 A;  5A90 A;  3UY6 A;  3DWZ A;  3ZG0 A;  5EE8 A;  5HAI A;  4N9L A;  3UPP A;  1KVL A;  4DE3 A;  3E2K A;  1PZO A;  4GD8 A;  4BLM A;  3HUN A;  1EWZ A;  5EVI B;  1WE4 A;  5HAR A;  3IF5 A;  5CGX A;  5DTK A;  1U60 A;  3ZNY A;  3CMZ A;  4ZJ2 A;  4OQG A;  3UDX A;  1ZG6 A;  3G2Y A;  1RP5 A;  1NZU A;  2A49 A;  4OQH A;  4P85 A;  2FFY A;  1GCE A;  1BLS A;  3OPR A;  3S22 A;  5DTS A;  3N8L A;  2Y2O A;  1HZO A;  4OP8 A;  2R9X A;  1BSG A;  4E3J A;  4S2M A;  4PM6 A;  4YFM A;  5DF8 A;  1O7E A;  1KGE A;  4X68 A;  4F94 A;  1KDS A;  1KE4 A;  2Y2Q A;  1PW8 A;  3BFE A;  1L0D A;  3NI9 A;  5KMW A;  5EOE A;  2WZZ A;  4B4Z A;  4NK3 A;  2IWB A;  3IH9 A;  3P09 A;  5GHX A;  1E3U A;  4S2P A;  3EQV A;  4ZJ3 A;  4R4S A;  5GLB A;  2V20 A;  2BG1 A;  2WAF A;  4R4R A;  3C4P A;  2Y2H A;  1SKF A;  3IXB A;  3WS2 A;  2OLV A;  1XA7 A;  2H5S A;  1N9B A;  1OME A;  2Y2M A;  4U0X A;  1WYC A;  4UA7 A;  4DDY A;  1K6S A;  3ZNT A;  2EX6 A;  4KZ8 A;  4CJN A;  4E3K A;  1JVJ A;  5AQ9 A;  5E43 A;  4A5R A;  3TG9 A;  2Y2L A;  1XX2 A;  2XR0 A;  4JPM A;  2Y2P A;  4C3Q A;  4WM9 A;  1CI8 A;  1K55 C;  5E2F A;  5HAQ A;  1HD8 A;  1GA0 A;  3HL9 A;  3HRE A;  2HDQ A;  1J9M A;  2H0Y A;  3O86 A;  3MZF A;  4GB7 A;  1Q2P A;  2C5W B;  4KG5 A;  1H8Y A;  5FQI A;  2WAE A;  2Z2M B;  2DNS A;  4RX3 A;  5AQB A;  4DXB A;  4WMC D;  4LEN A;  4OLG A;  4E3L A;  4Y7P A;  3IXD A;  4KZ4 A;  3VP0 A;  1DY6 A;  5EVI A;  3BLM A;  2XF3 A;  4QY5 A;  3N8S A;  4WEK A;  2WZX A;  4U0T A;  5EOO A;  5EPH A;  2ZM0 A;  1JWV A;  3S4X A;  4C6Y A;  4X6T A;  5GLA A;  1S0W A;  1ONH A;  2Y91 A;  3UE0 A;  3BEC A;  1TEM A;  3A3J A;  5HW3 A;  4K91 A;  1TVF A;  3FKW A;  3GTC A;  2EXA A;  5GL9 A;  1KE3 A;  1YLW A;  1NZO A;  3I7J A;  1G6A A;  3G2Z A;  3A3E A;  1MWR A;  2WYX A;  5D3O A;  1GA9 A;  2ZQD A;  3VOZ A;  2V2F F;  5TR7 A;  5HX9 A;  3FV7 A;  3FZC A;  3W8K A;  3MZD A;  5FI6 A;  4LV3 A;  5JYP A;  1FCM A;  3AGF A;  3IF6 C;  1MWS A;  1N4O A;  4CPK A;  4EQI A;  4R0Q A;  5DTT A;  4JF6 A;  4LV1 A;  1RCJ A;  3FWL A;  5FQ9 A;  4E3O A;  3W4Q A;  1DJA A;  2WUQ A;  4OOM A;  2FFF B;  1W8Y A;  4IVK A;  4IBR A;  1BLC A;  3O3V A;  3HLF A;  2QMI A;  4B4X A;  3G31 A;  5E2H A;  2A3U A;  2DRW A;  3W4O A;  3SH7 A;  5FAP A;  4UHU A;  4S2O A;  4EUZ A;  3BLS A;  2XQZ A;  4S2N A;  2OSU A;  3GQZ A;  3G32 A;  5EVI D;  3V3S A;  5JYO A;  2ZLY A;  3MXS A;  4JXS A;  2GDN A;  2Z2L B;  5FDH A;  5CEB A;  3RXW A;  4QB8 A;  4HES A;  2WK0 A;  2ZC5 B;  4BEN A;  4N1X A;  1XGI A;  3GMW A;  4EBL A;  5M19 A;  3ZG8 B;  1ERQ A;  3OPH A;  3MFD A;  5CRF A;  2Y2I A;  3NC8 A;  5CED A;  1YM1 A;  5CTM A;  3S1Y A;  5GLC A;  4KZA A;  3UDF A;  2IWC A;  3N8R A;  4QHC A;  3E2L A;  4Y0O A;  2XFT A;  1LL5 A;  1YMS A;  1SHV A;  4KQO A;  4DRT A;  3M6H A;  3MBZ A;  3Q81 A;  1BLH A;  3HLE A;  4PM5 A;  4LV0 A;  1GHM A;  1GHI A;  3LY3 A;  4JF5 A;  1MWT A;  4EBP A;  3ZDJ A;  3SS3 A;  2WGI A;  1K54 C;  3ZHH A;  3N6I A;  4LCL A;  3UNW A;  1O07 A;  5F82 A;  4KQQ A;  1BLP A;  1ERO A;  1W8Q A;  3SS5 A;  2HPB A;  1YMX A;  2ZQ9 A;  1Y54 A;  4JXV A;  3SOI A;  3GRJ A;  3VP1 A;  1KDW A;  4WZ5 A;  1PW1 A;  1E4D A;  5EUA A;  4N92 A;  2VGK A;  2WGW A;  3NIA A;  3GR2 A;  2Y4A A;  1XGJ A;  4D2O A;  4BJP A;  5FI2 A;  5F1G A;  1NXY A;  4DKI A;  2EX2 A;  1K25 A;  1XA1 A;  3UN7 A;  1ONG A;  1K57 A;  1BUL A;  4S2L A;  4KZ6 A;  4DXC A;  1K56 D;  4UA9 A;  5HL1 A;  5CGW A;  3ZCZ A;  4KZ3 A;  5CEC A;  5KSH A;  4P6B A;  5CHU A;  1KGG A;  3OC2 A;  5TFQ A;  4FCF A;  1DJC A;  4S2I A;  1HVB A;  1IEM A;  4MBH A;  2ZC7 A;  1NY0 A;  5GHY A;  4BL3 A;  5KZH A;  1LL9 A;  5HAP A;  4OOL A;  4Q8I A;  2B5R A;  3C5A A;  4OPQ A;  1NRF A;  1AXB A;  2Q9N A;  3B3X A;  5EVI C;  3VP3 A;  1JTG A;  3M6B A;  1FOF A;  1YLZ A;  3IWQ A;  4Y0U A;  5A93 A;  3PBN A;  4H8R A;  5CXW A;  3RXX A;  3V5M A;  1LI0 A;  3FYZ A;  1Z6F A;  5DVA A;  2PBY A;  4ZAM A;  3ITA A;  4EWF A;  2XLN A;  2XD5 A;  1ERM A;  3A3D A;  1CI9 A;  4FH4 A;  3IHA A;  4MNR A;  4RYE A;  2Y55 A;  1S6R A;  4PM8 A;  3V3R A;  4BD0 A;  1YLJ A;  2RCX A;  2ZM8 A;  3PBQ A;  3A3I A;  1KVM A;  4HBU A;  5A91 A;  2DCF A;  4IBX A;  4X69 A;  1K38 A;  2XK1 A;  3AGE A;  4JXW A;  1K54 A;  5CGS A;  3DW0 A;  1LHY A;  2WKH A;  2J9O A;  3DTM A;  4PM7 A;  4GNU A;  1WYB A;  2HP6 A;  3NDG A;  5TGF A;  1PZP A;  4M3K A;  1I2S A;  2OV5 A;  1FSW A;  1L0F A;  2X02 A;  2Y2K A;  3AGD A;  3PAE A;  3IF6 B;  5A92 A;  4QU3 A;  1IYP A;  4JXG A;  1PWG A;  4LV2 A;  1XPB A;  4RA7 A;  4ZTK A;  4HBT A;  4X55 A;  3WRZ A;  3PBS A;  4WEJ A;  1H5X A;  1MXO A;  3BFG A;  3UPN A;  3UE3 A;  2P74 A;  1TDL A;  3HUM A;  4P87 A;  2EXB A;  4WBG A;  5FQQ A;  1HTZ A;  1PI4 A;  2ZMA A;  1MY8 A;  2XDM A;  1IYO A;  4XXR A;  5FAS A;  4OPR A;  4OVD A;  3HLG A;  4NET A;  5KSC A;  5FAO A;  1XKZ A;  2JC7 A;  1L2S A;  1FR6 A; 
#chains in the Genus database with same CATH topology
 4O0P A;  4P0M A;  2V1Z A;  2E8J A;  4EU0 A;  2J9P A;  1OJ5 A;  2P9V B;  2ZQ8 A;  3BYD A;  3OCN A;  3WRT A;  2Y59 A;  4EUV A;  5FI7 A;  3MMH A;  2GZA A;  3E98 A;  4IHQ A;  4ZJ1 A;  4ID4 A;  4MBF A;  1BYW A;  5FQM A;  4R3J A;  1FCO A;  3IWO A;  3PTE A;  2ZQA A;  5IHV A;  1PWD A;  4Z9Q A;  3TE8 A;  1CEG A;  1W63 Q;  2Y2J A;  3CPT A;  3Q1F A;  4NXF A;  4NG2 A;  4N9K A;  2PU2 A;  5CX7 A;  1ALQ A;  1S67 L;  1K57 C;  3KX0 X;  3ISG A;  1VQQ A;  4E6W A;  3VP2 A;  1L0E A;  3L7H A;  3VSL A;  4OQ0 A;  3V67 A;  3LO7 A;  5IU1 A;  3HBR A;  4KQR A;  3BRM A;  3LCE A;  3S7O A;  3LEZ A;  4NKP A;  4UQI S;  4GS9 B;  1JTD A;  2ZC4 B;  1MBL A;  5F5Y A;  2VGL M;  5E2G A;  1DRM A;  3O5Y A;  2CC1 A;  3MS6 A;  4UAA A;  3IX8 A;  4FSF A;  1MC0 A;  3RJU A;  3NBL A;  3ZGA B;  5HWV A;  4GZB A;  4OON A;  3RFB A;  4EET B;  1XXM A;  4QJG A;  5BOH A;  2G2U A;  3VE3 A;  3N4I A;  1VHM A;  3EQU A;  4F3L B;  4LFU A;  1W7F A;  1EI5 A;  5DKK A;  1GSW A;  3BQA A;  5M18 A;  1ZC2 A;  3BFD A;  4BL2 A;  3SH9 A;  4L9E A;  3IHB A;  4WMC A;  3FC7 A;  3HVF A;  5EVL A;  1PYY A;  2XH9 A;  4M4X A;  3MXR A;  3HLD A;  1LSX A;  3Q82 A;  5CHM A;  1ES2 A;  1I5Q A;  1YLY A;  3W2Z A;  3HLC A;  4R38 A;  5I94 A;  3T1R A;  5AQ7 A;  2PD8 A;  3H9W A;  5F1F A;  4DDS A;  2K2N A;  1C3B A;  4DE1 A;  4OOY A;  4GDN A;  2HDR A;  1E3U D;  3GV9 A;  1W5D A;  4KEN B;  3D3O A;  3B42 A;  4GLQ A;  4HEF A;  3DTI A;  3UE1 A;  3NY4 A;  3BFC A;  3LYX A;  2JKG A;  3A0V A;  1IFQ A;  3ZQ5 A;  5A90 A;  3UY6 A;  5EE8 A;  3T12 B;  4N9L A;  3E2K A;  1PZO A;  1EWZ A;  1WE4 A;  4RQ9 A;  3A0S A;  2ZOI A;  4KUK A;  4OQG A;  3UDX A;  4CQH A;  4P85 A;  5AVF A;  1VEU A;  2J3T C;  1KE4 A;  2JKF A;  5DJU A;  1PW8 A;  3BFE A;  3PXP A;  3F1O B;  5EOE A;  2WZZ A;  1D06 A;  5GHX A;  3EQV A;  4ZJ3 A;  3MXQ A;  1VB6 A;  4R4R A;  5HDC A;  2Y2M A;  1WYC A;  4DDY A;  2YKF A;  3TW8 A;  2JN7 A;  2EX6 A;  2K7S A;  4XT2 A;  1JVJ A;  5AQ9 A;  4A5R A;  4C3Q A;  2Y2P A;  2NUP C;  5E2F A;  2VEA A;  2HDQ A;  4X1L A;  4GB7 A;  2PHY A;  4KG5 A;  1H8Y A;  2Z2M B;  4OLG A;  5DFY A;  1F9I A;  1DY6 A;  5EVI A;  4EES A;  3OOV A;  4U0T A;  5DFX A;  5EOO A;  2ZM0 A;  4I39 A;  2XSS A;  4MMN A;  3FKW A;  5GL9 A;  2IA2 A;  5HD5 A;  1YLW A;  5HPF A;  3VOZ A;  5HX9 A;  3FV7 A;  1IOU A;  1FCM A;  3R4K A;  3B47 A;  3F1N A;  4ETX A;  4LV1 A;  1G6O A;  1DJA A;  2WUQ A;  5EVE A;  4IBR A;  2QMI A;  4B4X A;  5E2H A;  4JGP A;  4UHU A;  2OSU A;  3ULF A;  2ZLY A;  3MXS A;  4HES A;  2ZC5 B;  4I3I A;  3T4Q A;  1FIL A;  3OPH A;  3T4K A;  4EXO A;  4FUW A;  4LGW A;  3E2L A;  1DP6 A;  3HCY A;  1GHM A;  1GHI A;  2O0Y A;  4JF5 A;  2WGI A;  1K54 C;  3ZHH A;  4LCL A;  3UNW A;  2H28 A;  4CLC D;  4G3K A;  1TS6 A;  1ERO A;  2INW A;  3SS5 A;  1YMX A;  4JXV A;  1YPR A;  3SOI A;  3VP1 A;  3VE4 A;  2QHK A;  5FI2 A;  3CHW P;  1BUL A;  2ZMF A;  4S2L A;  5CGW A;  1V9Z A;  5CEC A;  4P6B A;  5TFQ A;  4CLC B;  4Y15 A;  3C5A A;  2Q9N A;  3B3X A;  1JTG A;  3KYZ A;  4H8R A;  5CXW A;  3RXX A;  3S7Q A;  3V5M A;  5AVE A;  2OOL A;  5DVA A;  5HDS A;  1P9R A;  2P7J A;  2JKR I;  1ERM A;  2A2L A;  4FH4 A;  4MNR A;  4RYE A;  4PM8 A;  4WUJ A;  1YLJ A;  4NXB A;  4HBU A;  2DCF A;  1K38 A;  4II7 A;  4JXW A;  5MC7 A;  1LHY A;  2HF6 A;  5I5L A;  4PM7 A;  3H7W B;  2HP6 A;  2QJ7 A;  5J7E A;  2OV5 A;  1FSW A;  3PAE A;  3AGD A;  4LPZ A;  4BBT A;  1PWG A;  2DMW A;  4RA7 A;  4X55 A;  3BFG A;  5HL6 A;  5HDD A;  3LFV A;  3C30 A;  2R78 A;  1PI4 A;  2ZMA A;  3U4L P;  4DN0 A;  4OPR A;  3HLG A;  4NET A;  2LB5 A;  5FAO A;  2JC7 A;  4JF6 A;  5CHJ A;  3L9K A;  4QY6 A;  4E3I A;  3PBR A;  1TDG A;  4JKT A;  5GLD A;  2I9V A;  1IYS A;  5DF7 A;  2B02 A;  2Y2G A;  5AQA A;  1BT5 A;  5K5B A;  4YWZ A;  1YKD A;  3ZG5 A;  2JCH A;  1S1Y A;  3NDE A;  1X0O A;  1G5U A;  3TRC A;  2PU4 A;  4Y13 A;  3MKF A;  3DBA A;  3NCK A;  2HDS A;  4GHI A;  3UO9 A;  4G3V A;  4AFI A;  1LL8 A;  2E8I A;  1JWZ A;  3LR4 A;  4L9F A;  3VSK A;  2ZQC A;  3IWI A;  1LT0 A;  2WAD A;  2WKE A;  1CJF A;  4YNR A;  3UDI A;  2XA7 S;  4NXE A;  4R1G A;  3ICY A;  4GDB A;  3OPL A;  4I3A A;  1XJ6 A;  3VFF A;  1TF1 A;  1XJ3 A;  5J8X A;  4OPZ A;  1ODV A;  1MPL A;  4S2J A;  1QME A;  3NHQ A;  5FDS A;  2QKP A;  3WWX A;  5FSR A;  1CEF A;  3O88 A;  3GVB A;  3MR0 A;  1T1A A;  2A24 A;  2H10 A;  3VOY A;  3WS1 A;  1NYY A;  5FQJ A;  1YQS A;  2M7U A;  1CK3 A;  1JWP A;  3LIB A;  3Q7Z A;  4UQI M;  5HD3 A;  4BMW A;  2P04 A;  2ZJ9 A;  4KZ5 A;  1SCW A;  2QJ5 A;  3GDI A;  3NUL A;  3CI6 A;  3N7W A;  2P08 A;  4XUX A;  3P01 A;  3WS5 A;  4Q0H A;  4WEL A;  4PHT A;  1IYQ A;  3RTY A;  3BJN A;  4LCM A;  2HP9 A;  1QMF A;  1NLZ A;  2KOI A;  5HWT A;  1OTE A;  1YLP A;  2J8Y A;  3LUQ A;  2M1C A;  4L0L A;  3D4F A;  1ZG4 A;  2EX9 A;  2W3D A;  3MQQ A;  3VMA A;  4MEZ A;  4GN2 A;  4DE2 A;  4IUH A;  1E25 A;  1BUE A;  2R9W A;  5J4E A;  1DJB A;  2W27 A;  4C75 A;  3CG5 A;  2G2W A;  1ES5 A;  4GOG A;  3LR0 A;  3CZD A;  1PRQ A;  1YLT A;  1SDN A;  1ZKJ A;  4HQA A;  1ZTU A;  1IKI A;  3D9Y A;  2ZC6 B;  1G68 A;  1LLB A;  4WZ4 A;  4X56 A;  3ZVW A;  1IEL A;  3NOU C;  4RX2 A;  1NJ4 A;  5F83 A;  4YIN A;  4ARZ A;  2VX8 A;  4OH0 A;  1ACF A;  2W3E A;  1VM1 A;  2J7V A;  3A3F A;  3DTE A;  5M1A A;  5HZH A;  3ZG0 A;  1WA9 A;  2KLI A;  3ZYT A;  5CGX A;  1U60 A;  4HI4 A;  1S1Z A;  1RP5 A;  2A49 A;  4OQH A;  5F69 A;  3F1O A;  3S22 A;  4X25 A;  3OPR A;  4ARZ B;  2R9X A;  4X68 A;  3NI9 A;  5A8B A;  5HWW A;  4NK3 A;  2IWB A;  3QP4 A;  1E3U A;  4S2P A;  5GLB A;  2V20 A;  2BG1 A;  3IXB A;  3WS2 A;  5F6A A;  2OLV A;  1N9B A;  1K6S A;  5E43 A;  3TG9 A;  1XX2 A;  5DJT A;  1F5M A;  1K55 C;  5HAQ A;  1HD8 A;  2ZOH A;  1GA0 A;  3HL9 A;  3PR6 A;  2HJ9 C;  3MZF A;  2NUT C;  2C5W B;  2VV7 A;  2DNS A;  4RX3 A;  5AQB A;  3TJZ C;  4DXB A;  4WMC D;  5L09 A;  4E3L A;  4KUO A;  4KZ4 A;  5TJJ A;  3LI8 A;  4I5S A;  3N8S A;  2L4R A;  2WZX A;  3QP1 A;  3S4X A;  5GLA A;  2Y91 A;  3BEC A;  3A3J A;  5HW3 A;  4K91 A;  4EW7 A;  4E04 A;  1G6A A;  3G2Z A;  1MWR A;  2WYX A;  2V2F F;  5JYP A;  2J80 A;  3AGF A;  1MWS A;  1Y28 A;  4LLO B;  5FQ9 A;  1W8Y A;  4IVK A;  4Q0J A;  3HLF A;  2V1A A;  2A3U A;  2DRW A;  4QWO A;  2K31 A;  3SH7 A;  4S2O A;  4S2N A;  5EVI D;  4JXS A;  5CEB A;  4QB8 A;  3QP8 A;  3MFD A;  3NOP C;  3NC8 A;  5CED A;  1Z09 A;  5GLC A;  2IWC A;  4QHC A;  3IBJ A;  1SHV A;  4KQO A;  4DRT A;  3MBZ A;  3Q81 A;  1VET A;  3HLE A;  4LV0 A;  1MWT A;  3ZDJ A;  2YKH A;  2HPB A;  4XT2 B;  2PBD P;  2VGK A;  2V0U A;  3GR2 A;  3KSH A;  5F1G A;  3E0Y A;  2V8F A;  2W1T A;  2LB9 A;  4KZ6 A;  4DXC A;  4UA9 A;  3ZCZ A;  4KZ3 A;  3OC2 A;  4ETZ A;  5KZH A;  2ZC7 A;  5GHY A;  4OOL A;  3UB5 P;  5EVI C;  2UV0 E;  2Z6C A;  2J3W A;  3PBN A;  4HJ4 A;  3CPT B;  4HP4 A;  3T4O A;  1YSP A;  3FG8 A;  3ITA A;  4EWF A;  3FPV A;  2XLN A;  5HSQ A;  1OTB A;  3A3D A;  1CI9 A;  1LSW A;  3A0R A;  2Y55 A;  2FH5 A;  2RCX A;  2ZM8 A;  3PBQ A;  2VA0 A;  3RH8 B;  3A3I A;  5EM1 A;  3BQ8 A;  3CUE A;  4X69 A;  5IT5 A;  3AGE A;  5CGS A;  3KSI A;  2WKH A;  2VZW A;  2J9O A;  2PYP A;  1MZU A;  1F98 A;  5TGF A;  4M3K A;  3PYP A;  1H8M A;  4HOI A;  1L0F A;  4QU3 A;  1IYP A;  4ME4 A;  4WEJ A;  4MDZ A;  3T1S A;  2P74 A;  2PDR A;  1MY8 A;  3KYE A;  3LIE A;  4JGO A;  5FAS A;  4XXR A;  5L8M A;  1JNU A;  1XKZ A;  3HJI A;  4JGR A;  1DP9 A;  3UME A;  1FR6 A;  2W3F A;  3G30 A;  3G4P A;  3IXG A;  3K3D A;  3KSF A;  3UE6 A;  4MCW A;  3CWF A;  2WKQ A;  4R3B A;  4X1M A;  4P6Z M;  3IH8 A;  4KZ9 A;  2UWX A;  4MBK A;  3P98 A;  3W4P A;  1PNE A;  3GSG A;  4KG6 A;  4Y5F A;  1HLU P;  4ZDX A;  2BAS A;  1SKO B;  2QYB A;  2JE5 A;  3OPP A;  3V50 A;  1PFL A;  1P97 A;  3CJM A;  1ESI A;  3LI9 A;  1DP8 A;  2PYR A;  4IUK A;  4BD1 A;  3MF0 A;  4WYY A;  4R70 A;  4GD6 A;  2ZM2 A;  4KZ7 A;  3OZH A;  5G4Z A;  1K55 A;  2RL3 A;  1OTI A;  3ZFZ A;  5EFW A;  4HJ3 A;  4JF4 A;  1A0K A;  1FIK A;  4I3J A;  5FAQ A;  3SW1 A;  2JKT I;  2X01 A;  4EBN A;  3QP5 A;  2Q9M A;  1SDE A;  4KQD A;  4GHI B;  2WGW B;  1H8Z A;  5DF9 A;  4XUZ A;  2XRN A;  3KO6 A;  3ZG7 B;  3BM6 A;  4HP9 A;  1ES4 A;  5CER A;  3C7V A;  5E2E A;  2L0W A;  3ZVT A;  1RGZ A;  2D02 A;  4BWI A;  2WGV A;  1ESU A;  1N9L A;  1M40 A;  3C4O A;  2VLG A;  1OT9 A;  3ZG9 B;  4O8G A;  4P6Z S;  3GEC A;  3IQA A;  5GHZ A;  3TSG A;  3UB8 A;  4KG2 A;  1BTL A;  3PBO A;  4F3L A;  3DTK A;  3EWK A;  2PR6 A;  2EA9 A;  2A24 B;  1YT4 A;  5DKL A;  3WS0 A;  2ZC3 B;  3MSH A;  4FH2 A;  1G28 A;  3IT9 A;  4FD8 A;  4CLC A;  3K2N A;  5EM0 A;  5J3W A;  2P9V A;  3HLW A;  2G7U A;  3O87 A;  4LRX C;  2BLS A;  3MZE A;  3PBT A;  3C38 A;  1FQG A;  2V0W A;  2XD1 A;  2VGJ A;  2ZD8 A;  3S7P A;  3QP2 A;  3UB9 A;  3Q7V A;  3MKE A;  4G3W A;  4E6X A;  1XFQ A;  4L9G A;  2PRF A;  2HDU A;  3E4O A;  4PPR A;  1P9W A;  2QPN A;  3VV4 A;  5L2F A;  4GKU A;  3OCL A;  4PMA A;  1FCN A;  3LGO A;  3LY4 A;  5FEG A;  1RGY A;  1J3W A;  5G18 A;  1K6R A;  1T19 A;  3BY9 A;  3F1N B;  2C6W B;  1W79 A;  1TS8 A;  2W1R A;  4DE0 A;  4E3N A;  2HZ5 A;  3K3C A;  4LRY C;  4OP5 A;  2X71 A;  4HJ6 A;  1KGF A;  4ZBE A;  1I2W A;  3C7U A;  2KDK A;  4UA6 A;  2J3T D;  2W0N A;  2Z6D A;  5FA7 A;  4HNB A;  1KVL A;  4DE3 A;  4BLM A;  3IF5 A;  5DTK A;  3CMZ A;  2XA7 M;  3LR5 A;  1TS0 A;  2FFY A;  3CAX A;  3N8L A;  2Y2O A;  1HZO A;  2O9B A;  4E3J A;  4S2M A;  4PM6 A;  1KGE A;  1KDS A;  3T4S A;  3LIC A;  3R7W B;  4GJ4 A;  1L0D A;  5KMW A;  3B33 A;  3IH9 A;  1GSX A;  1AWI A;  2PAV P;  2Y2H A;  4IJG A;  4FOF A;  1XA7 A;  2GJ3 A;  1OME A;  4U0X A;  4WF0 A;  4KZ8 A;  4CJN A;  4E3K A;  3T1Q B;  3DAV A;  4WLA A;  2XR0 A;  3HRE A;  3H7W A;  1VEU B;  1Q2P A;  2WAE A;  4LEN A;  4B93 A;  3IS2 A;  1TD5 A;  1VET B;  3BLM A;  2HJE A;  2Y8H A;  5EPH A;  4PAU A;  1TS7 A;  1ONH A;  3UE0 A;  1TVF A;  3GTC A;  2EXA A;  1KE3 A;  3I7J A;  5D3O A;  1GA9 A;  2ZQD A;  5TR7 A;  3LIA A;  3FZC A;  3W8K A;  5FI6 A;  1UGU A;  3UB7 A;  4CPK A;  4EQI A;  1N4O A;  5DTT A;  2PR5 A;  1RCJ A;  3FWL A;  3W4Q A;  4OOM A;  4PKY G;  3G6O A;  3G31 A;  1LSV A;  4I38 A;  3W4O A;  3T4L A;  4EUZ A;  3BLS A;  1K0K A;  3G32 A;  5FEF A;  3QP6 A;  2GDN A;  2JKT M;  5FDH A;  3EEH A;  3BY8 A;  3P7N A;  4BEN A;  4N1X A;  1XGI A;  3GMW A;  2EWV A;  2PT7 A;  3PHY A;  3E4Q A;  3MJQ A;  2HGV A;  2Y2I A;  2VGL S;  5G4Y A;  4DMZ A;  3MFX A;  3UDF A;  2QWS A;  1EW0 A;  1LL5 A;  2ZBB A;  3M6H A;  4PM5 A;  1BLH A;  4MN7 A;  4HH2 A;  2KX6 A;  3N6I A;  3UMD A;  2O9A A;  1O07 A;  3UB6 A;  4CLC C;  4KQQ A;  3IBR A;  1YAX A;  5L07 A;  2ZQ9 A;  3GRJ A;  1PW1 A;  5EUA A;  4N92 A;  5TBM B;  2Y4A A;  1XGJ A;  4D2O A;  4DKI A;  2EX2 A;  1XA1 A;  1ONG A;  4Y17 A;  1K56 D;  5CHU A;  1KGG A;  2VV8 A;  3C8C A;  2GNX A;  1HVB A;  3E4P A;  1NY0 A;  4BL3 A;  5HAP A;  1T1C A;  1T1B A;  1AXB A;  3VP3 A;  4Y0U A;  5A93 A;  4EEP A;  4EEU A;  1Z6F A;  2VJW A;  2PBY A;  4ZAM A;  3U2A A;  4ZRR A;  4YOF A;  2XD5 A;  3V3R A;  1KVM A;  4IBX A;  2XK1 A;  1K54 A;  3T4T A;  5FL3 A;  3DW0 A;  4HIA A;  3IX4 A;  4LRZ E;  2V1B A;  2W3G A;  4GNU A;  1WYB A;  2EWW A;  5A92 A;  3IF6 B;  4LV2 A;  1XPB A;  4ZTK A;  3WRZ A;  3PBS A;  1H5X A;  2OWH A;  3UE3 A;  1TDL A;  3HUM A;  4P87 A;  4WBG A;  5FQQ A;  1IYO A;  3EOI A;  4NEE D;  2O99 A;  5M19 A;  4S2N C;  2JBF A;  2XFS A;  4MN6 A;  3NEC A;  3NJA A;  4OPY A;  4B88 A;  1Y4O A;  4RVA A;  2OLU A;  2GX5 A;  3MQ0 A;  4FTX A;  4KZB A;  3Q07 A;  3FKV A;  2VV6 A;  4BQM A;  1L0G A;  3JVU A;  4O7D A;  1K56 A;  2EFU A;  1MKI A;  1L3L A;  5C5K A;  2EX8 A;  1K4F A;  3M2K A;  3CIT A;  1BZA A;  3EGD C;  1FSY A;  1D7E A;  1ES3 A;  2EFX A;  1K4E A;  1MWU A;  2OAP 1;  4U3T A;  3BFF A;  1S66 L;  2WKI A;  1OJG A;  3M2J A;  1CQA A;  3LIF A;  4Y0T A;  1OT6 A;  1Q2Q A;  3F1P B;  1NWZ A;  2H0T A;  3OBF A;  3QHY A;  4DF6 A;  3IF6 A;  3SS4 A;  3HLB A;  3UPO A;  3CUE C;  3G34 A;  3Q7V B;  1KE0 A;  1ZHH B;  4GW9 A;  4JLF A;  4K0X A;  4QD4 A;  4OQI A;  4JBF A;  3VOL A;  4IVI A;  2V9A A;  2VK3 A;  3BEB A;  1NRJ A;  3IXH A;  2OWJ A;  3LEQ A;  2WKP A;  3VP4 A;  2IWD A;  3KYQ A;  1XP4 A;  3V39 A;  3D72 A;  1NYM A;  5CTN A;  4Y2F A;  2ZL1 A;  1IKG A;  1SZV A;  1SKO A;  4QPR A;  2HP5 A;  1YSQ A;  1PI5 A;  4K0W A;  3SZT A;  4E3M A;  1PIO A;  3PAG A;  2XGN A;  2XEP A;  4X53 A;  4OKP A;  5FAT A;  3QNC A;  4PM9 A;  3ITB A;  5HFO A;  5FQK A;  1GHP A;  4O01 A;  2VKS A;  3T50 A;  5TBM A;  1STZ A;  1PWC A;  5LBR A;  3QNB A;  4N1H A;  1CF0 A;  3WS4 A;  2ZQ7 A;  1KOU A;  2QZ6 A;  3JYI A;  1XJ4 A;  3SH8 A;  4GCZ A;  3F1P A;  2HV1 A;  5EEC A;  4EER A;  3TOI A;  1LI9 A;  1F2K A;  1FR1 A;  3VFH A;  3HUO A;  3G35 A;  1S4S A;  4OLD A;  4WZ5 C;  2CMN A;  2I72 A;  2Y2N A;  4BBU A;  1OPX A;  4R23 A;  4MN5 A;  5U47 A;  3DWK A;  1M6K A;  1XJ2 A;  4IED A;  4MLL A;  5IS1 A;  4S2K A;  2XRO A;  3DWZ A;  2B95 A;  5HAI A;  3UPP A;  5AJG A;  4GD8 A;  3HUN A;  5EVI B;  5HAR A;  1MKM A;  3ZNY A;  4ZJ2 A;  1ZG6 A;  3G2Y A;  4WN5 A;  1NZU A;  3EGX C;  1GCE A;  1BLS A;  1V9Y A;  5DTS A;  4UEY A;  2V8C A;  4OP8 A;  1BSG A;  4YFM A;  5DF8 A;  1O7E A;  5L10 A;  5F68 A;  4F94 A;  4GS9 A;  4K08 A;  2Y2Q A;  3FPW A;  3IX3 A;  4B4Z A;  5KIZ A;  3P09 A;  4R4S A;  2L1M A;  2WAF A;  3C4P A;  1SKF A;  2H5S A;  2W1T B;  1UWP X;  4UA7 A;  3ZNT A;  3H82 B;  2W3H A;  1W63 M;  1OTA A;  2Y2L A;  4JPM A;  2OAQ 1;  4Q0I A;  4WM9 A;  1CI8 A;  1N9N A;  3O86 A;  1J9M A;  2H0Y A;  3H82 A;  4ESP A;  3BWL A;  5FQI A;  1D1J A;  4Y7P A;  3IXD A;  3VP0 A;  1P0Z A;  2XF3 A;  4QY5 A;  4WEK A;  1JWV A;  4C6Y A;  4X6T A;  1S0W A;  3R7W A;  4R6L A;  1TEM A;  3JPU A;  1NZO A;  2ZL1 B;  3A3E A;  4R3A A;  3MZD A;  4PKY A;  3BW6 A;  4LV3 A;  3IF6 C;  4R0Q A;  4Y3I A;  4E3O A;  2FFF B;  1BLC A;  4H6J B;  3O3V A;  3KSG A;  1UWN X;  3LR3 A;  5FAP A;  3S7N A;  2XQZ A;  3C2W A;  1N9O A;  3GQZ A;  3V3S A;  5JYO A;  2Z2L B;  3EEA A;  3RXW A;  2WK0 A;  2B18 A;  1XFN A;  3OLO A;  4CLC E;  3JVV A;  4Z1W A;  4EBL A;  3ZG8 B;  1ERQ A;  2PD7 A;  3MQO A;  3LID A;  5CRF A;  1YM1 A;  5CTM A;  1GSV A;  3S1Y A;  4KZA A;  3N8R A;  4H6J A;  4Y0O A;  2D01 A;  2XFT A;  3IS2 B;  1YMS A;  2O9C A;  2BTF P;  3LY3 A;  4EBP A;  1H0M A;  3SS3 A;  1T18 A;  2MJ6 A;  5F82 A;  1BLP A;  4NXG A;  1W8Q A;  1Y54 A;  1KDW A;  4DJ3 A;  4WZ5 A;  1E4D A;  2WGW A;  3NIA A;  1S4R A;  3HJK A;  2M7V A;  4BJP A;  2WKR A;  1NXY A;  1H3Q A;  1K25 A;  3UN7 A;  4HY8 A;  1K57 A;  5HL1 A;  3NOT C;  4JGQ A;  5EV0 A;  5KSH A;  4HH3 A;  4FCF A;  2ACG A;  1DJC A;  4S2I A;  5HPI A;  4MBH A;  1IEM A;  1LL9 A;  3CLO A;  4Q8I A;  2B5R A;  4OPQ A;  1NRF A;  3M6B A;  1FOF A;  1YLZ A;  3IWQ A;  4DJ2 A;  1LI0 A;  3FYZ A;  2JKR M;  2AVX A;  2JHE A;  3IHA A;  1S6R A;  4BD0 A;  3T1X A;  4WL9 A;  5A91 A;  2Q0O A;  4BBV A;  4EQ1 A;  3DTM A;  2ZMV A;  3NDG A;  1PZP A;  1I2S A;  2Y2K A;  2X02 A;  4B9O A;  4JXG A;  4HBT A;  1MXO A;  2FZ0 A;  3UPN A;  4D60 A;  3T4J A;  2EXB A;  1HTZ A;  2XDM A;  1OTD A;  4OVD A;  5KSC A;  2Y79 A;  4HHD A;  1NLY A;  1L2S A;  4EV4 A; 
#chains in the Genus database with same CATH homology
 4S2N C;  5CHJ A;  4QY6 A;  3G30 A;  4E3I A;  3G4P A;  3PBR A;  4P0M A;  1TDG A;  2JBF A;  3IXG A;  4JKT A;  5GLD A;  2XFS A;  2V1Z A;  4B88 A;  4OPY A;  1IYS A;  5DF7 A;  2J9P A;  2P9V B;  2ZQ8 A;  3BYD A;  4RVA A;  2Y2G A;  3OCN A;  4R3B A;  2OLU A;  1BT5 A;  5AQA A;  2Y59 A;  3WRT A;  3IH8 A;  4KZ9 A;  2UWX A;  4MBK A;  5FI7 A;  3P98 A;  4KZB A;  3Q07 A;  3FKV A;  3W4P A;  4BQM A;  3ZG5 A;  2JCH A;  4ZJ1 A;  3GSG A;  4KG6 A;  4ID4 A;  1L0G A;  4O7D A;  4MBF A;  3NDE A;  1K56 A;  5FQM A;  4ZDX A;  2JE5 A;  3OPP A;  1FCO A;  3IWO A;  4R3J A;  2EFU A;  3PTE A;  3V50 A;  2ZQA A;  5IHV A;  1PWD A;  4Z9Q A;  1MKI A;  1CEG A;  2Y2J A;  2PU4 A;  3CJM A;  3Q1F A;  1ESI A;  2EX8 A;  4N9K A;  3MKF A;  2PU2 A;  4BD1 A;  1K4F A;  3NCK A;  3M2K A;  2HDS A;  1ALQ A;  1K57 C;  4WYY A;  4GD6 A;  3ISG A;  1VQQ A;  1BZA A;  2ZM2 A;  4KZ7 A;  3OZH A;  3UO9 A;  4E6W A;  2E8I A;  1K55 A;  1JWZ A;  2RL3 A;  1FSY A;  1ES3 A;  3VSK A;  2EFX A;  3VP2 A;  1K4E A;  1L0E A;  1MWU A;  3ZFZ A;  4U3T A;  2ZQC A;  3IWI A;  4OQ0 A;  4JF4 A;  3VSL A;  3LO7 A;  3BFF A;  2WAD A;  5FAQ A;  2WKE A;  2WKI A;  3HBR A;  2X01 A;  3M2J A;  4KQR A;  3UDI A;  4Y0T A;  4EBN A;  3BRM A;  4R1G A;  1Q2Q A;  2Q9M A;  1SDE A;  3LCE A;  2H0T A;  3QHY A;  4DF6 A;  3IF6 A;  4GDB A;  3SS4 A;  2WGW B;  1H8Z A;  3LEZ A;  5DF9 A;  3HLB A;  3OPL A;  4XUZ A;  3UPO A;  3G34 A;  3Q7V B;  1KE0 A;  3ZG7 B;  1JTD A;  3BM6 A;  3VFF A;  2ZC4 B;  1ES4 A;  1MBL A;  4JLF A;  5CER A;  3C7V A;  5E2E A;  5J8X A;  4OPZ A;  4K0X A;  3ZVT A;  1MPL A;  1RGZ A;  4S2J A;  4QD4 A;  5E2G A;  1QME A;  4OQI A;  4JBF A;  2WGV A;  4IVI A;  2CC1 A;  1ESU A;  4UAA A;  1M40 A;  3BEB A;  3WWX A;  3C4O A;  5FSR A;  3ZG9 B;  4FSF A;  1CEF A;  3IXH A;  3RJU A;  3NBL A;  3O88 A;  3GVB A;  3ZGA B;  3VOY A;  2H10 A;  3IQA A;  3VP4 A;  3WS1 A;  2IWD A;  4GZB A;  1NYY A;  5GHZ A;  4OON A;  3TSG A;  1XP4 A;  4KG2 A;  1BTL A;  5FQJ A;  3V39 A;  3PBO A;  5CTN A;  1NYM A;  1YQS A;  1CK3 A;  1JWP A;  3Q7Z A;  1XXM A;  4QJG A;  1IKG A;  5BOH A;  4EV4 A;  2G2U A;  1YT4 A;  3WS0 A;  2ZC3 B;  3N4I A;  3EQU A;  4FH2 A;  2ZJ9 A;  2HP5 A;  3IT9 A;  4FD8 A;  1PI5 A;  1W7F A;  4KZ5 A;  4K0W A;  1EI5 A;  4E3M A;  1PIO A;  1SCW A;  3PAG A;  2XGN A;  1ZC2 A;  5M18 A;  2XEP A;  3BFD A;  3N7W A;  4X53 A;  4OKP A;  4BL2 A;  4XUX A;  5FAT A;  3SH9 A;  2P9V A;  3HLW A;  3WS5 A;  3QNC A;  4PM9 A;  4WEL A;  3O87 A;  3IHB A;  1IYQ A;  2BLS A;  3ITB A;  4LCM A;  4WMC A;  5HFO A;  2HP9 A;  1QMF A;  3MZE A;  5FQK A;  1GHP A;  3PBT A;  3HVF A;  5EVL A;  1PYY A;  1YLP A;  2J8Y A;  2XH9 A;  1FQG A;  3D4F A;  1ZG4 A;  2EX9 A;  3MXR A;  2XD1 A;  2ZD8 A;  2VGJ A;  1PWC A;  4L0L A;  3HLD A;  4MEZ A;  3VMA A;  3Q7V A;  3MKE A;  4GN2 A;  3Q82 A;  3QNB A;  5CHM A;  1ES2 A;  4N1H A;  4E6X A;  3WS4 A;  4DE2 A;  2ZQ7 A;  2HDU A;  1I5Q A;  1E25 A;  1BUE A;  2QZ6 A;  2R9W A;  4PPR A;  3JYI A;  2QPN A;  1YLY A;  3SH8 A;  5L2F A;  3HLC A;  5I94 A;  1DJB A;  5EEC A;  4GKU A;  5AQ7 A;  4C75 A;  3OCL A;  4PMA A;  1FCN A;  3LY4 A;  5F1F A;  3CG5 A;  4DDS A;  3TOI A;  2G2W A;  1LI9 A;  1RGY A;  1ES5 A;  4GOG A;  1FR1 A;  1C3B A;  3CZD A;  3VFH A;  5G18 A;  4DE1 A;  1YLT A;  3HUO A;  1SDN A;  1ZKJ A;  1K6R A;  3G35 A;  4OOY A;  1IKI A;  4GDN A;  4OLD A;  2HDR A;  4WZ5 C;  1E3U D;  1W79 A;  2C6W B;  2I72 A;  2ZC6 B;  1W5D A;  3GV9 A;  4KEN B;  1G68 A;  2Y2N A;  4DE0 A;  4E3N A;  1LLB A;  4R23 A;  4OP5 A;  4WZ4 A;  2X71 A;  4X56 A;  3ZVW A;  4HEF A;  1IEL A;  5U47 A;  1KGF A;  4ZBE A;  1I2W A;  4RX2 A;  3DWK A;  1NJ4 A;  3C7U A;  3NY4 A;  5F83 A;  3BFC A;  4YIN A;  3UE1 A;  1M6K A;  4OH0 A;  4UA6 A;  4IED A;  4MLL A;  1VM1 A;  4S2K A;  2J7V A;  3A3F A;  5M1A A;  5FA7 A;  5A90 A;  3UY6 A;  3DWZ A;  3ZG0 A;  5EE8 A;  5HAI A;  4N9L A;  3UPP A;  1KVL A;  4DE3 A;  3E2K A;  1PZO A;  4GD8 A;  4BLM A;  3HUN A;  1EWZ A;  5EVI B;  1WE4 A;  5HAR A;  3IF5 A;  5CGX A;  5DTK A;  1U60 A;  3ZNY A;  3CMZ A;  4ZJ2 A;  4OQG A;  3UDX A;  1ZG6 A;  3G2Y A;  1RP5 A;  1NZU A;  2A49 A;  4OQH A;  4P85 A;  2FFY A;  1GCE A;  1BLS A;  3OPR A;  3S22 A;  5DTS A;  3N8L A;  2Y2O A;  1HZO A;  4OP8 A;  2R9X A;  1BSG A;  4E3J A;  4S2M A;  4PM6 A;  4YFM A;  5DF8 A;  1O7E A;  1KGE A;  4X68 A;  4F94 A;  1KDS A;  1KE4 A;  2Y2Q A;  1PW8 A;  3BFE A;  1L0D A;  3NI9 A;  5KMW A;  5EOE A;  2WZZ A;  4B4Z A;  4NK3 A;  2IWB A;  3IH9 A;  3P09 A;  5GHX A;  1E3U A;  4S2P A;  3EQV A;  4ZJ3 A;  4R4S A;  5GLB A;  2V20 A;  2BG1 A;  2WAF A;  4R4R A;  3C4P A;  2Y2H A;  1SKF A;  3IXB A;  3WS2 A;  2OLV A;  1XA7 A;  2H5S A;  1N9B A;  1OME A;  2Y2M A;  4U0X A;  1WYC A;  4UA7 A;  4DDY A;  1K6S A;  3ZNT A;  2EX6 A;  4KZ8 A;  4CJN A;  4E3K A;  1JVJ A;  5AQ9 A;  5E43 A;  4A5R A;  3TG9 A;  2Y2L A;  1XX2 A;  2XR0 A;  4JPM A;  2Y2P A;  4C3Q A;  4WM9 A;  1CI8 A;  1K55 C;  5E2F A;  5HAQ A;  1HD8 A;  1GA0 A;  3HL9 A;  3HRE A;  2HDQ A;  1J9M A;  2H0Y A;  3O86 A;  3MZF A;  4GB7 A;  1Q2P A;  2C5W B;  4KG5 A;  1H8Y A;  5FQI A;  2WAE A;  2Z2M B;  2DNS A;  4RX3 A;  5AQB A;  4DXB A;  4WMC D;  4LEN A;  4OLG A;  4E3L A;  4Y7P A;  3IXD A;  4KZ4 A;  3VP0 A;  1DY6 A;  5EVI A;  3BLM A;  2XF3 A;  4QY5 A;  3N8S A;  4WEK A;  2WZX A;  4U0T A;  5EOO A;  5EPH A;  2ZM0 A;  1JWV A;  3S4X A;  4C6Y A;  4X6T A;  5GLA A;  1S0W A;  1ONH A;  2Y91 A;  3UE0 A;  3BEC A;  1TEM A;  3A3J A;  5HW3 A;  4K91 A;  1TVF A;  3FKW A;  3GTC A;  2EXA A;  5GL9 A;  1KE3 A;  1YLW A;  1NZO A;  3I7J A;  1G6A A;  3G2Z A;  3A3E A;  1MWR A;  2WYX A;  5D3O A;  1GA9 A;  2ZQD A;  3VOZ A;  2V2F F;  5TR7 A;  5HX9 A;  3FV7 A;  3FZC A;  3W8K A;  3MZD A;  5FI6 A;  4LV3 A;  5JYP A;  1FCM A;  3AGF A;  3IF6 C;  1MWS A;  1N4O A;  4CPK A;  4EQI A;  4R0Q A;  5DTT A;  4JF6 A;  4LV1 A;  1RCJ A;  3FWL A;  5FQ9 A;  4E3O A;  3W4Q A;  1DJA A;  2WUQ A;  4OOM A;  2FFF B;  1W8Y A;  4IVK A;  4IBR A;  1BLC A;  3O3V A;  3HLF A;  2QMI A;  4B4X A;  3G31 A;  5E2H A;  2A3U A;  2DRW A;  3W4O A;  3SH7 A;  5FAP A;  4UHU A;  4S2O A;  4EUZ A;  3BLS A;  2XQZ A;  4S2N A;  2OSU A;  3GQZ A;  3G32 A;  5EVI D;  3V3S A;  5JYO A;  2ZLY A;  3MXS A;  4JXS A;  2GDN A;  2Z2L B;  5FDH A;  5CEB A;  3RXW A;  4QB8 A;  4HES A;  2WK0 A;  2ZC5 B;  4BEN A;  4N1X A;  1XGI A;  3GMW A;  4EBL A;  5M19 A;  3ZG8 B;  1ERQ A;  3OPH A;  3MFD A;  5CRF A;  2Y2I A;  3NC8 A;  5CED A;  1YM1 A;  5CTM A;  3S1Y A;  5GLC A;  4KZA A;  3UDF A;  2IWC A;  3N8R A;  4QHC A;  3E2L A;  4Y0O A;  2XFT A;  1LL5 A;  1YMS A;  1SHV A;  4KQO A;  4DRT A;  3M6H A;  3MBZ A;  3Q81 A;  1BLH A;  3HLE A;  4PM5 A;  4LV0 A;  1GHM A;  1GHI A;  3LY3 A;  4JF5 A;  1MWT A;  4EBP A;  3ZDJ A;  3SS3 A;  2WGI A;  1K54 C;  3ZHH A;  3N6I A;  4LCL A;  3UNW A;  1O07 A;  5F82 A;  4KQQ A;  1BLP A;  1ERO A;  1W8Q A;  3SS5 A;  2HPB A;  1YMX A;  2ZQ9 A;  1Y54 A;  4JXV A;  3SOI A;  3GRJ A;  3VP1 A;  1KDW A;  4WZ5 A;  1PW1 A;  1E4D A;  5EUA A;  4N92 A;  2VGK A;  2WGW A;  3NIA A;  3GR2 A;  2Y4A A;  1XGJ A;  4D2O A;  4BJP A;  5FI2 A;  5F1G A;  1NXY A;  4DKI A;  2EX2 A;  1K25 A;  1XA1 A;  3UN7 A;  1ONG A;  1K57 A;  1BUL A;  4S2L A;  4KZ6 A;  4DXC A;  1K56 D;  4UA9 A;  5HL1 A;  5CGW A;  3ZCZ A;  4KZ3 A;  5CEC A;  5KSH A;  4P6B A;  5CHU A;  1KGG A;  3OC2 A;  5TFQ A;  4FCF A;  1DJC A;  4S2I A;  1HVB A;  1IEM A;  4MBH A;  2ZC7 A;  1NY0 A;  5GHY A;  4BL3 A;  5KZH A;  1LL9 A;  5HAP A;  4OOL A;  4Q8I A;  2B5R A;  3C5A A;  4OPQ A;  1NRF A;  1AXB A;  2Q9N A;  3B3X A;  5EVI C;  3VP3 A;  1JTG A;  3M6B A;  1FOF A;  1YLZ A;  3IWQ A;  4Y0U A;  5A93 A;  3PBN A;  4H8R A;  5CXW A;  3RXX A;  3V5M A;  1LI0 A;  3FYZ A;  1Z6F A;  5DVA A;  2PBY A;  4ZAM A;  3ITA A;  4EWF A;  2XLN A;  2XD5 A;  1ERM A;  3A3D A;  1CI9 A;  4FH4 A;  3IHA A;  4MNR A;  4RYE A;  2Y55 A;  1S6R A;  4PM8 A;  3V3R A;  4BD0 A;  1YLJ A;  2RCX A;  2ZM8 A;  3PBQ A;  3A3I A;  1KVM A;  4HBU A;  5A91 A;  2DCF A;  4IBX A;  4X69 A;  1K38 A;  2XK1 A;  3AGE A;  4JXW A;  1K54 A;  5CGS A;  3DW0 A;  1LHY A;  2WKH A;  2J9O A;  3DTM A;  4PM7 A;  4GNU A;  1WYB A;  2HP6 A;  3NDG A;  5TGF A;  1PZP A;  4M3K A;  1I2S A;  2OV5 A;  1FSW A;  1L0F A;  2X02 A;  2Y2K A;  3AGD A;  3PAE A;  3IF6 B;  5A92 A;  4QU3 A;  1IYP A;  4JXG A;  1PWG A;  4LV2 A;  1XPB A;  4RA7 A;  4ZTK A;  4HBT A;  4X55 A;  3WRZ A;  3PBS A;  4WEJ A;  1H5X A;  1MXO A;  3BFG A;  3UPN A;  3UE3 A;  2P74 A;  1TDL A;  3HUM A;  4P87 A;  2EXB A;  4WBG A;  5FQQ A;  1HTZ A;  1PI4 A;  2ZMA A;  1MY8 A;  2XDM A;  1IYO A;  4XXR A;  5FAS A;  4OPR A;  4OVD A;  3HLG A;  4NET A;  5KSC A;  5FAO A;  1XKZ A;  2JC7 A;  1L2S A;  1FR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...