3UY6A

Blar1 sensor domain from staphylococcus aureus with n439v mutation
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
252
structure length
252
Chain Sequence
QSITDYNYKKPLHNDYQILDKSKIFGSNSGSFVMYSMAADAYYIYNEKESRKRYSPNSTYKIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVVWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Penicillin-binding protein
molecule keywords Regulatory protein BlaR1
publication title An amino acid position at crossroads of evolution of protein function: antibiotic sensor domain of BlaR1 protein from Staphylococcus aureus versus clasS D beta-lactamases
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 85
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3uy6A00
3HVFA 5CTNA 5GL9A 4DE1A 4X55A 4R4RA 1XXMA 1Q2PA 3SS4A 4P85A 1ONHA 4C6YA 5KSHA 5CRFA 2EFUA 4M3KA 4JKTA 2WZXA 3GVBA 3FKWA 3D4FA 2ZJ9A 4S2PA 3NI9A 3PBSA 1W8QA 4WZ5C 2JCHA 2UWXA 1ES5A 2WK0A 4YFMA 4Y7PA 1N4OA 2Y2JA 5CTMA 3IQAA 5A92A 3O86A 4PM7A 5G18A 4KZ9A 1ES2A 1XKZA 3MZEA 2IWCA 1SKFA 2ZC6B 5CGXA 5CEBA 1PWCA 5DF8A 3UPOA 1FCNA 3LY4A 4WZ5A 4S2KA 4KENB 5AQAA 3HBRA 5BOHA 1FR6A 2EFXA 5M1AA 4KQQA 2J8YA 4RVAA 1JWZA 1Y54A 3DTMA 3IWIA 4GDNA 2WKIA 4HBUA 1KGFA 4IVKA 4ZJ1A 3UE3A 5JYOA 2QZ6A 1E25A 3JYIA 2X02A 4LV1A 4U0TA 5FQMA 2JC7A 2Z2MB 3BFDA 5L2FA 1WYBA 1RGZA 3IHBA 5GHXA 3UNWA 5FQJA 1NXYA 3G34A 4MEZA 1GHMA 1YLWA 1KE4A 4UA9A 3SH8A 4PM5A 2ZQAA 4DXCA 1J9MA 2XF3A 1ERMA 5CECA 1FOFA 5DTTA 2WGWA 5KZHA 3HLDA 2ZQCA 3DWKA 4PM9A 4Y0TA 3B3XA 5EVID 2XR0A 2Y2GA 5F82A 4WMCD 1ESIA 3OPHA 4NETA 2DCFA 4U0XA 1PZPA 4RA7A 5EOEA 3V39A 4N92A 1PZOA 4GD6A 1HTZA 3SH9A 4C75A 1YQSA 3G30A 5DF9A 1IYOA 3MBZA 3A3DA 4IEDA 4D2OA 2Y91A 3QNBA 4QHCA 3BRMA 4EBLA 4MBKA 3Q82A 3WS1A 2FFFB 4PM8A 1KDSA 3ZDJA 4OOLA 1O7EA 3QHYA 5GLAA 2XGNA 1XA7A 5EVIA 4DE3A 4DKIA 5EUAA 3ZG9B 1GA9A 3AGFA 1QMFA 4Z9QA 4ZJ3A 1K54A 3O3VA 5CXWA 3UO9A 3UN7A 2FFYA 1O07A 1Q2QA 3OCLA 4EQIA 5J8XA 5FQIA 2G2UA 3PBOA 4B88A 4N1HA 3PBQA 3M2JA 1LI0A 4JXSA 4DDSA 3GV9A 1BLHA 1SCWA 4OPYA 2XDMA 5FASA 1NYYA 3HLBA 4R0QA 4UA7A 2ZC7A 5JYPA 1K56D 2ZM2A 1BLCA 4YINA 5F1GA 3OPPA 1IYPA 2XEPA 1BSGA 2HDRA 3FWLA 1CEGA 1LI9A 3WS5A 3HLGA 3Q07A 4X53A 5HL1A 4WEKA 3W4QA 4ZBEA 4LCLA 1CK3A 4E6WA 2V2FF 2EXBA 4BQMA 4KG6A 1VQQA 2P9VB 3A3JA 4PPRA 4RX2A 4E3JA 5DTSA 4JXWA 2WADA 4Q8IA 4N9LA 3DWZA 1G6AA 4OQHA 5AQ7A 1ONGA 2IWDA 3ZVWA 4F94A 1ERQA 2OSUA 1KGEA 1EWZA 3BLSA 3VOZA 1K55C 3ZG7B 3W8KA 5HW3A 1MY8A 1S6RA 3C4OA 2OLUA 1XX2A 2IWBA 1K56A 4JPMA 4R3BA 5FQ9A 1L0EA 3SS5A 4E3OA 3Q7ZA 2V1ZA 3G31A 4FSFA 4MBFA 3PBRA 5CHUA 5AQBA 4L0LA 4QJGA 1DJCA 3PBNA 4FD8A 3VOYA 3HLCA 3IF6B 5E2GA 5TFQA 4BL2A 1K55A 2ZQ9A 3ZHHA 2H0TA 3IWOA 1YLYA 4OQIA 2CC1A 1H8ZA 2VGJA 4LENA 3P98A 4GDBA 3UPPA 5M18A 3BFCA 1YT4A 4BD0A 3I7JA 1EI5A 4E3MA 4KQOA 1BLSA 2Q9MA 1DY6A 4S2MA 4R3JA 1IELA 5FI6A 1IKGA 2ZC5B 3IF5A 5HFOA 4C3QA 3IXDA 2V20A 2B5RA 1NZUA 1PWDA 3VFFA 1GHIA 4WZ4A 2I72A 4OOMA 4PMAA 5FI7A 1L0DA 3IXBA 3N7WA 5D3OA 5U47A 3W4PA 1YM1A 5A93A 3UE1A 3V50A 2PBYA 3BFFA 4OP8A 1IKIA 5EVLA 3WRZA 2BLSA 4S2LA 3EQVA 4HEFA 2XFSA 1ES4A 1MWRA 5TR7A 1DJBA 3PTEA 3N8SA 2HDUA 4WYYA 5GLBA 2EX6A 3GMWA 1CI8A 1IYSA 3C7UA 3IXHA 5FQKA 1BZAA 1L0FA 1NJ4A 3WRTA 1W5DA 1ESUA 2J7VA 3TOIA 3ZFZA 3V3SA 4BJPA 1RCJA 1DJAA 3HREA 5DTKA 1SDNA 4OVDA 3LEZA 3O87A 2XLNA 2HDSA 2X71A 1PI5A 2Y59A 3NDGA 4ZTKA 1BTLA 2QMIA 1C3BA 1NRFA 4JF6A 2C5WB 3VP2A 3BFGA 3MKFA 1KE0A 2Y4AA 3E2LA 4UAAA 1TDLA 2WYXA 1JWPA 2HP6A 1K57A 3HLEA 4KQRA 3GR2A 4NK3A 3LY3A 1KGGA 2XQZA 3G2YA 1WE4A 4BENA 1W8YA 1ZG6A 5EVIC 1LL9A 4XUZA 3HL9A 1W7FA 4OOYA 5I94A 1K54C 5HAIA 2XFTA 4KG2A 4K0XA 2VGKA 3O88A 4OLDA 2Q9NA 4P6BA 1ZC2A 3FKVA 5HARA 2R9WA 3RXXA 5CEDA 3GRJA 5FI2A 2H10A 1MXOA 1JVJA 1S0WA 5FAQA 4OP5A 3BEBA 3IXGA 4GD8A 4GZBA 1NZOA 5A90A 4WMCA 2HDQA 4DE0A 4KZ6A 3BECA 1QMEA 4JF5A 4EBNA 3IWQA 3PAGA 1YMSA 3NC8A 4X68A 3WS4A 5HAQA 4JBFA 4OQ0A 4ID4A 4QY5A 4EV4A 4KG5A 1FCOA 3CG5A 1HD8A 4HESA 1MWUA 1AXBA 4EUZA 5E2EA 4ZDXA 3GSGA 4QB8A 1HZOA 1MKIA 5HX9A 2EX2A 3SOIA 3BFEA 4DRTA 5CERA 2C6WB 4GN2A 4OONA 5FSRA 1W79A 3VP1A 3M6HA 4OQGA 3TSGA 4MLLA 1GA0A 2OV5A 2P9VA 3N6IA 4X6TA 2WGVA 1E4DA 2WGIA 3ZG0A 1K6SA 2HP5A 2RCXA 3NDEA 2Y2HA 2ZMAA 2ZM8A 4QD4A 4S2NC 2JBFA 4WBGA 4ZJ2A 1XP4A 2X01A 4IVIA 4MBHA 2XD1A 4DXBA 1I2WA 3C7VA 3OC2A 3FV7A 2ZC3B 3MZFA 1E3UD 4QY6A 4GB7A 3IF6C 2HP9A 3Q1FA 4HBTA 4LCMA 3HUNA 2EXAA 3SS3A 1CEFA 5CGSA 5FAPA 1WYCA 4IBRA 2ZM0A 4KZ3A 5AQ9A 3Q7VB 2E8IA 2A49A 1PI4A 3EQUA 5GLDA 2DNSA 3MFDA 4S2NA 3OZHA 3HLFA 4Y0UA 2ZLYA 3MXRA 1XPBA 3Q81A 3HUMA 4DF6A 3IF6A 1MWSA 3NIAA 5E2HA 5FA7A 3ISGA 3RJUA 4XUXA 3DW0A 4OH0A 5E2FA 3M6BA 5GLCA 4E3IA 3CZDA 1EROA 1XGJA 2Y2NA 1GHPA 3LO7A 2XK1A 3VP3A 4K91A 3TG9A 4WEJA 5HAPA 4E3KA 1E3UA 4P87A 1IEMA 1IYQA 1VM1A 4MNRA 5DF7A 1HVBA 3ZNTA 2H5SA 1N9BA 1RP5A 4R1GA 2Y2KA 3ITBA 3P09A 4GNUA 4LV2A 3VP0A 2XD5A 1TVFA 4U3TA 4H8RA 1K4EA 2G2WA 3HLWA 1TEMA 3ZGAB 3OPLA 1RGYA 2GDNA 3ZVTA 4CJNA 3S22A 3OPRA 4EBPA 4A5RA 2BG1A 2R9XA 4LV0A 5F1FA 4E6XA 4FH4A 4KZ7A 1OMEA 5CHJA 3FZCA 1ZG4A 5EECA 5GHYA 3BLMA 1NYMA 1BUEA 4P0MA 3SH7A 4EWFA 3MXSA 2Y2IA 3PAEA 1KDWA 4KZ5A 3NCKA 3CJMA 1BULA 1K57C 3A3FA 4JXGA 4GKUA 4OPQA 4R23A 4B4ZA 3MZDA 1U60A 4OPZA 1YLZA 1ES3A 4CPKA 4E3LA 1L0GA 3VSLA 3M2KA 3VSKA 4JXVA 2WUQA 5TGFA 3G2ZA 3QNCA 4X69A 5EPHA 4QU3A 3WS0A 3WWXA 1LL5A 2JE5A 4JLFA 3IH8A 5KSCA 2Y2MA 2A3UA 2ZQ8A 3MKEA 1NY0A 1JTDA 4BLMA 3IT9A 4ZAMA 3UY6A 4KZ8A 1GCEA 1MWTA 2Y2PA 4S2OA 1SDEA 4DDYA 1ALQA 4R4SA 2WGWB 4WELA 2Y55A 3VMAA 1MBLA 2WAFA 3C5AA 2EX9A 3GTCA 2J9OA 1ZKJA 2WZZA 2ZC4B 1PWGA 3HUOA 4FCFA 5GHZA 3A3EA 4E3NA 4OLGA 3G35A 5FATA 2HPBA 4N1XA 3A3IA 2EX8A 1YLPA 2J9PA 2OLVA 3RXWA 1BLPA 1KE3A 4UHUA 3E2KA 3ZG5A 4Y0OA 4B4XA 5KMWA 4X56A 1CI9A 2XH9A 2RL3A 4OPRA 5EOOA 2WAEA 4KZ4A 3V3RA 1FQGA 4GOGA 1PIOA 1PYYA 1JTGA 1TDGA 2PU4A 3PBTA 1I2SA 1LLBA 4K0WA 1XA1A 4XXRA 3C4PA 5FAOA 1I5QA 4WM9A 5E43A 1KVLA 5FDHA 1M40A 2WKEA 5EVIB 1PW8A 3N8LA 5IHVA 3ZNYA 4BL3A 4O7DA 3BYDA 3N4IA 5EE8A 3BM6A 2Z2LB 4S2IA 2DRWA 4PM6A 3V5MA 5CHMA 2QPNA 1FCMA 3UDFA 1M6KA 2PU2A 3FYZA 3G32A 3UE0A 4BD1A 2H0YA 2ZQDA 3VP4A 1H8YA 5DVAA 5A91A 1FR1A 2Y2QA 3NBLA 2ZD8A 4KZBA 1FSYA 1XGIA 1YLTA 3S1YA 1K25A 2WKHA 1G68A 2Y2LA 5M19A 3UDXA 1H5XA 3IHAA 4OKPA 1LHYA 2Y2OA 4KZAA 3Q7VA 1YLJA 1YMXA 3LCEA 3ITAA 5F83A 1Z6FA 4RX3A 3N8RA 2ZQ7A 4FH2A 5CGWA 3UDIA 4DE2A 3G4PA 1FSWA 4RYEA 3S4XA 1PW1A 1KVMA 4LV3A 4JF4A 1K4FA 1JWVA 3GQZA 3ZCZA 3OCNA 3AGDA 1SHVA 3UPNA 4N9KA 3NY4A 3AGEA 2P74A 4IBXA 1K38A 3IH9A 5FQQA 1L2SA 3WS2A 4UA6A 3CMZA 1K6RA 4S2JA 1BT5A 3ZG8B 1MPLA 3W4OA 3VFHA
chains in the Genus database with same CATH superfamily
3HVFA 3CUEA 3LICA 3F1OA 3SS4A 2XROA 2WKQA 2EFUA 3FKWA 3A0VA 3BY9A 3PBSA 2V0WA 4HH2A 2UWXA 2M1CA 4Y7PA 3DTEA 5CTMA 3O86A 4NEED 1GSVA 1FCNA 3LY4A 4S2KA 5L8MA 4Y15A 5BOHA 5JYOA 4GDNA 4IVKA 1KGFA 2X02A 2V9AA 2JC7A 2JHEA 3KSIA 3K3CA 1RGZA 4E04A 1EW0A 4MEZA 4KUOA 1YLWA 4UA9A 2W1TB 2XF3A 4I3AA 5CECA 3TE8A 2WGWA 4MN6A 5KZHA 4EEUA 5FEGA 4Y0TA 4UQIM 1VEUB 4HJ4A 2G7UA 1ZHHB 5F82A 3OPHA 2DCFA 4HOIA 4FUWA 4U0XA 4N92A 4GD6A 3UMDA 1YQSA 1IYOA 4ARZA 4D2OA 2Y91A 1ZTUA 1G6OA 3MXQA 4EBLA 3Q82A 4PM8A 1OTDA 2VZWA 4OOLA 4I38A 2XGNA 3LIEA 5EUAA 4ZJ3A 3UO9A 3UN7A 3M2JA 4JXSA 3LI9A 3LR5A 4UA7A 4PAUA 2ZM2A 4YINA 3OPPA 1BSGA 4LPZA 3BJNA 4ZBEA 3IX8A 2EXBA 1VQQA 3A3JA 2Z6DA 2HF6A 4N9LA 3ICYA 4EU0A 1PRQA 2A24B 2IWDA 3S7QA 1ERQA 2OSUA 3VOZA 3ZG7B 5FL3A 5HW3A 3C4OA 1XX2A 1K56A 5FQ9A 3SS5A 3H7WB 5AQBA 4L0LA 3E4QA 4HNBA 1CF0A 3KSFA 4NXBA 2ZQ9A 4ESPA 5F5YA 4OQIA 2V1BA 1H8ZA 2VV7A 4LGWA 5M18A 1YT4A 4ZRRA 1D1JA 3MSHA 2ZBBA 5HDSA 1PWDA 4PMAA 2JKRI 5U47A 3OLOA 4F3LB 3QP2A 4QWOA 3UE1A 3V50A 3BFFA 4OP8A 3C38A 1ES4A 1GSXA 2EX6A 2KDKA 3C7UA 1F2KA 3IXHA 3W2ZA 1L0FA 1W5DA 2J7VA 1W63Q 4BJPA 1DJAA 2XLNA 3NULA 4ZTKA 1PI5A 1BTLA 5EFWA 3E2LA 2HP6A 3HLEA 4NK3A 3H9WA 2XQZA 1WE4A 4Y2FA 4MMNA 1ZG6A 2W3GA 1LL9A 3HL9A 5I94A 1S66L 1K54C 4I5SA 4OLDA 2Q9NA 2QKPA 3FKVA 3RXXA 2R9WA 2AVXA 5FI2A 2E8JA 1JVJA 2VK3A 4WMCA 1X0OA 4DE0A 3IWQA 3HCYA 4ID4A 2V8FA 3CG5A 1MWUA 5EM0A 1HZOA 2EX2A 4G3VA 3SOIA 1N9NA 3UB5P 2C6WB 3TJZC 1W79A 3SZTA 4MLLA 2VV8A 2PAVP 3N6IA 4Y17A 2WGIA 3ZG0A 1K6SA 3NDEA 4S2NC 2JBFA 4DXBA 4GLQA 4ZJ2A 2X01A 4IVIA 2XD1A 1I2WA 3T1QB 3OC2A 4QY6A 1T19A 3HUNA 2PD7A 1NRJA 4NKPA 5FAPA 1WYCA 2VLGA 2ZM0A 1H3QA 5AQ9A 3KX0X 3MFDA 3MXRA 1D7EA 1XPBA 1MZUA 4DJ2A 4O01A 3NIAA 5E2HA 3ISGA 4XUXA 5E2FA 1EROA 2B18A 2VKSA 3T4SA 4K91A 4E3KA 4P87A 4JGQA 2W1RA 1VM1A 5DF7A 1WA9A 2H5SA 3IS2B 4JGRA 2W3EA 3ITBA 4LV2A 1K4EA 1TEMA 3ZGAB 3MF0A 3UB9A 3S22A 1DP9A 4A5RA 2R9XA 4LV0A 4Q0JA 4KZ7A 1OMEA 2Y2IA 5J4EA 4JXGA 4OPQA 3VSLA 3M2KA 3ZYTA 2XA7M 5HDDA 3VSKA 2WUQA 2WKRA 5TGFA 4X69A 5EPHA 4UEYA 4GS9B 5G4ZA 3IH8A 5HD5A 2A3UA 3MKEA 3NHQA 2ZL1A 3EGDC 3TW8A 3UY6A 1GCEA 1MWTA 4DDYA 4HI4A 4WELA 1MBLA 2EX9A 2J9OA 2WZZA 2YKHA 4FCFA 4XT2B 3A3EA 4E3NA 5HZHA 1MC0A 3G35A 2CMNA 2HPBA 5TBMB 2J9PA 2OLVA 4CLCA 2NUPC 3NOPC 1CI9A 3F1PA 4OPRA 1KOUA 2O0YA 3V3RA 5HPFA 1JTGA 3VE4A 1I2SA 3UB8A 3PR6A 2IA2A 3V67A 3EEHA 4WF0A 1M40A 5I5LA 3ZNYA 3DBAA 3E4PA 4O7DA 2QJ7A 3BYDA 4QPRA 4PM6A 3UE0A 4HP9A 3IX3A 2L4RA 5A91A 1FR1A 4DJ3A 2ZD8A 1XGIA 1YLTA 3EEAA 1K25A 1G68A 1H5XA 3IHAA 4OKPA 4KZAA 1TD5A 1YLJA 3C30A 4RX3A 3N8RA 4GJ4A 4DE2A 1FSWA 4EXOA 1PW1A 4LV3A 4M4XA 1JWVA 3OCNA 1LSWA 3IX4A 3NY4A 3IH9A 2P04A 3TRCA 1K6RA 4S2JA 5CTNA 4DE1A 3T1SA 4ME4A 1ONHA 2ZMFA 4JKTA 5F68A 3D4FA 2ZJ9A 4S2PA 5HD3A 1T1BA 4WZ5C 3R4KA 4RQ9A 1VB6A 2WK0A 1FIKA 3IQAA 4MN5A 1ES2A 3MZEA 2HGVA 5DJTA 1PWCA 4BBUA 5M1AA 4KQQA 4RVAA 1Y54A 3UE3A 2VEAA 4U0TA 5FQMA 2Z2MB 3BFDA 1WYBA 5GHXA 1OTIA 1NXYA 5J3WA 3SH8A 2ZQAA 1J9MA 1FOFA 3VV4A 4NXEA 3CITA 4Z1WA 3BW6A 1G28A 3T4QA 2Y2GA 1LT0A 1ESIA 4GW9A 5EOEA 3T4TA 1HTZA 3F1NB 5DF9A 5AVEA 4DMZA 3A3DA 2EA9A 3QNBA 1Z09A 3BRMA 4MBKA 3WS1A 3MMHA 4GCZA 1KDSA 5GLAA 4DKIA 3EWKA 3R7WB 3AGFA 3ZG9B 1QMFA 4Z9QA 1K54A 4R70A 5J8XA 1Q2QA 3PBQA 1LI0A 3GV9A 4OPYA 3HLBA 2GNXA 1BLCA 5F1GA 2HDRA 1LI9A 3WS5A 2VJWA 4WEKA 3GECA 4HIAA 4P6ZM 4LCLA 4B9OA 2V2FF 2P9VB 4PPRA 4RX2A 4E3JA 2WADA 4OQHA 3ZVWA 3W8KA 2FZ0A 2IWBA 1DP8A 1CQAA 3Q7ZA 2ZMVA 4FSFA 3G31A 5CHUA 3PBRA 1DJCA 3VOYA 3HLCA 5E2GA 5TFQA 3T4JA 2WKPA 1K55A 1N9LA 3ZHHA 1YLYA 4HH3A 3UPPA 3S7NA 5EV0A 3H82B 3I7JA 2INWA 1BLSA 2LB5A 4S2MA 1IKGA 2ZC5B 3FG8A 1STZA 3F1OB 1OTBA 3E98A 3K2NA 4OOMA 5FI7A 3N7WA 1YM1A 3U4LP 5A93A 2GX5A 5C5KA 3WRZA 2BLSA 2XFSA 5TR7A 2B95A 3LYXA 4WYYA 2W1TA 2ACGA 3JVUA 1IYSA 4IUHA 3ZFZA 3TOIA 4I39A 2YKFA 1RCJA 1SDNA 4OVDA 4I3IA 1NRFA 4JF6A 1SZVA 3MKFA 1TDLA 2WYXA 2PDRA 4KQRA 3GR2A 1KGGA 4HQAA 3ZQ5A 4KG2A 4K0XA 2VGKA 2MJ6A 2B02A 4LRYC 5HARA 3LIDA 2H10A 4CLCE 4OP5A 3IXGA 3QP8A 3P7NA 2HDQA 3BECA 5TJJA 4JF5A 5EM1A 4EBNA 1YMSA 3NC8A 3WS4A 4ARZB 5HAQA 4QY5A 1F9IA 1FCOA 4HESA 1HD8A 4IHQA 5HX9A 4OONA 3VP1A 4OQGA 1GA0A 4ETXA 1E4DA 5KSHA 4QD4A 2ZM8A 3KSGA 3C7VA 4LRXC 3BWLA 2A24A 3MZFA 3IF6C 4HBTA 1UWNX 1CEFA 2O9BA 4IBRA 4KZ3A 3UE6A 3Q7VB 3EQUA 2DNSA 2ZLYA 3HUMA 4Y3IA 5J7EA 4EERA 3FPVA 5GLCA 3CPTB 4E3IA 2Y2NA 4EW7A 3C8CA 3LUQA 4HJ6A 3QP1A 3T12B 1IEMA 4MNRA 1OTEA 1RP5A 4R1GA 2Y2KA 5KIZA 3P09A 3VP0A 2XD5A 4U3TA 1XFQA 2J80A 4H8RA 3HLWA 3LI8A 3VE3A 3ZVTA 1RGYA 3IBRA 3OPRA 4EBPA 1XJ2A 3LFVA 5L09A 1OT6A 1ZG4A 2V8CA 1Y4OA 3O5YA 4YWZA 4EWFA 3T1RA 5A8BA 2PR5A 1U60A 3B47A 1TS8A 1YLZA 4CPKA 4E3LA 4UQIS 1L0GA 1S1ZA 1XFNA 4JXVA 1Y28A 4I3JA 1YSQA 4QU3A 3WWXA 2JE5A 1T18A 4ZAMA 1VETB 4KZ8A 3RTYA 1ALQA 4R4SA 2Y55A 4WLAA 3VMAA 2WAFA 2EWVA 3GTCA 1ZKJA 2ZC4B 5GHZA 5LBRA 5FATA 3A3IA 1YLPA 3D9YA 1T1CA 3E2KA 4X56A 2XH9A 2RL3A 1ACFA 5EOOA 1PIOA 1FILA 1XA1A 3C4PA 5E43A 1KVLA 1YAXA 5FDHA 4JGPA 2WKEA 5EVIB 1PW8A 4BL3A 3N4IA 4II7A 3BM6A 2Z2LB 4S2IA 3G32A 4BD1A 3RFBA 1OJGA 1H8MA 5EVEA 3VP4A 3LGOA 2Y2QA 4HY8A 1K0KA 3U2AA 2WKHA 2Y2OA 2VV6A 3FPWA 5CGWA 2OAQ1 4RYEA 2D02A 4JF4A 3CUEC 3ULFA 2W0NA 2Y8HA 3UPNA 2P08A 4IBXA 5FDSA 3MQOA 5FQQA 3WS2A 4MN7A 3CMZA 3T50A 1MPLA 3W4OA 1L3LA 5GL9A 4X55A 1VHMA 1XXMA 1Q2PA 2H28A 4P85A 4GHIA 3NI9A 2JCHA 4YFMA 5A92A 4PKYA 4KZ9A 2ZC6B 4LFUA 3UPOA 5AQAA 3HBRA 1P9WA 3DTMA 3IWIA 4HBUA 1E25A 3JYIA 3LEQA 4LV1A 3L9KA 1G5UA 1UGUA 4GS9A 3IHBA 3UNWA 5FQJA 5DFYA 1KE4A 1ERMA 2I9VA 2ZQCA 3DWKA 4PM9A 5G4YA 1GSWA 5EVID 4EETB 4IUKA 2XR0A 4WMCD 4NETA 3V39A 1PZOA 3QP5A 3SH9A 2ZL1B 1XJ6A 3G30A 4C75A 3E0YA 3MBZA 4EESA 2HJ9C 2K7SA 3KYZA 3QHYA 3LR4A 1XA7A 4DE3A 4X1MA 4CLCB 3O3VA 5CXWA 4R38A 5FQIA 4IJGA 4B88A 4N1HA 1TS0A 3MQQA 1SCWA 5FASA 4R0QA 2ZC7A 5JYPA 1IYPA 2XEPA 2Y79A 4NXGA 3Q07A 4X53A 2D01A 1CK3A 2BTFP 1S4SA 4KG6A 2PHYA 2V1AA 3D72A 1HLUP 1YKDA 4JXWA 4MCWA 3LR3A 1G6AA 5AQ7A 5AJGA 1YSPA 3T1XA 1MY8A 1S6RA 1L0EA 2V1ZA 4QJGA 3PBNA 4FD8A 2GJ3A 3IF6B 3LIFA 2H0TA 3MQ0A 2VGJA 3NOTC 3P98A 3FC7A 3QP4A 2VGLM 3BFCA 5IU1A 2Q9MA 1DY6A 4R3JA 3RH8B 5FI6A 5HFOA 3IXDA 3A0SA 2V20A 1NLZA 2L1MA 2XA7S 2FH5A 5HWWA 2EWWA 5HWTA 2PBYA 5EVLA 4S2LA 3EQVA 3UB6A 1MWRA 4WUJA 1S1YA 3N8SA 2HDUA 3KO6A 2PD8A 5GLBA 2DMWA 3GMWA 2J3TD 1CI8A 2JKTM 3KSHA 1BZAA 1NJ4A 3WRTA 3V3SA 3HREA 5DTKA 3LEZA 3O87A 2HDSA 2Y59A 2C5WB 3VP2A 4CLCD 1KE0A 2Y4AA 4UAAA 1JWPA 3MFXA 1LSXA 3G2YA 4BENA 3F1NA 1SKOA 1W8YA 5F6AA 5EVIC 2JN7A 4OOYA 5HAIA 3T4OA 3O88A 4ETZA 4P6BA 3GRJA 2PBDP 2M7VA 3R7WA 4GZBA 1NZOA 5A90A 4KZ6A 4EEPA 1QMEA 5L07A 4X68A 4OQ0A 3S7PA 1F98A 4KG5A 4EUZA 4KQDA 4HHDA 4QB8A 1MKIA 5CERA 2HV1A 4GN2A 5FSRA 2HZ5A 3M6HA 2P9VA 3HJKA 4X6TA 1T1AA 2HP5A 2ZMAA 1XP4A 3T4LA 1E3UD 4GB7A 2HP9A 4LCMA 2EXAA 4H6JA 2E8IA 1PI4A 4BBTA 1ODVA 4S2NA 3HLFA 2OWHA 3D3OA 4DF6A 5FA7A 4FTXA 3DW0A 4OH0A 4X25A 3CZDA 1XGJA 3B42A 4R6LA 1P0ZA 3TG9A 5HAPA 2BASA 2OAP1 3ZNTA 1HVBA 3EOIA 1OT9A 1DRMA 4GNUA 5FEFA 4R3AA 1TVFA 4BBVA 2GDNA 4CJNA 3VOLA 1D06A 2BG1A 4E6XA 5CHJA 2VX8A 3BLMA 4P0MA 3SH7A 3PAEA 1KDWA 4KZ5A 3NCKA 4R23A 1BULA 1K57C 5HPIA 3MZDA 1VEUA 2J3TC 2O9AA 3WS0A 3QNCA 5HSQA 1LL5A 4JLFA 3DTIA 4B93A 2Y2MA 1NY0A 2UV0E 3PHYA 1JTDA 3IT9A 3QP6A 4CLCC 2Y2PA 1SDEA 4WN5A 2J3WA 2WGWB 2ZOIA 5IS1A 3C5AA 3HUOA 1PWGA 1F5MA 4OLGA 4N1XA 1BLPA 1KE3A 4Y0OA 3IBJA 3L7HA 2Z6CA 1OJ5A 4KUKA 5CX7A 2WAEA 4KZ4A 3BQAA 1FQGA 4GOGA 1PYYA 1UWPX 1TDGA 2PU4A 3PBTA 1LLBA 4YOFA 2QHKA 4WM9A 4P6ZS 3N8LA 1J3WA 2Q0OA 3BQ8A 2DRWA 3V5MA 2QPNA 1FCMA 2PU2A 2H0YA 5IT5A 1H8YA 5DVAA 3NBLA 4KZBA 3S1YA 2W3FA 5M19A 1LHYA 5DKLA 3Q7VA 3ITAA 5F83A 3H7WA 2ZQ7A 2NUTC 4FH2A 3UDIA 3G4PA 4HP4A 4Q0IA 1KVMA 1N9OA 3CPTA 3GQZA 3AGDA 1XJ4A 4N9KA 3AGEA 3CLOA 1BT5A 4D60A 2PR6A 1S4RA 3VFHA 4R4RA 4C6YA 5CRFA 4M3KA 2WZXA 3GVBA 2O99A 4F3LA 1W8QA 1ES5A 1N4OA 1V9YA 2Y2JA 4PM7A 5G18A 1XKZA 2IWCA 1SKFA 5CGXA 5CEBA 5DF8A 4WZ5A 4KENB 1FR6A 2EFXA 4O0PA 2J8YA 1JWZA 4PHTA 2WKIA 4ZJ1A 2QZ6A 3GDIA 3C2WA 2KOIA 4O8GA 1BYWA 3PYPA 5L2FA 5HDCA 2P7JA 3G34A 1GHMA 3K3DA 4PM5A 4DXCA 1VETA 5DTTA 1TF1A 1YPRA 3HLDA 2OWJA 3A0RA 4AFIA 4MDZA 3B3XA 2W3HA 2KX6A 3PXPA 2A2LA 1PZPA 4RA7A 2JKTI 5DKKA 5MC7A 2W3DA 4YNRA 3T4KA 4IEDA 2XSSA 4QHCA 4G3WA 2FFFB 1W63M 3ZDJA 1O7EA 5DFXA 5EVIA 3MS6A 1GA9A 2K31A 4CQHA 1IFQA 2FFYA 1O07A 3OCLA 5L10A 4EQIA 4Y13A 2G2UA 3PBOA 1P9RA 4DDSA 1BLHA 1XJ3A 2XDMA 1NYYA 1K56D 3EGXC 3FWLA 1CEGA 3HLGA 5HL1A 3G6OA 3W4QA 4E6WA 1V9ZA 3NJAA 1LL8A 4BQMA 1NLYA 5DTSA 5HWVA 4EUVA 4Q8IA 3DWZA 4F94A 1ONGA 1KGEA 1EWZA 3BLSA 1K55C 2OLUA 4JPMA 4HJ3A 4R3BA 4E3OA 2O9CA 4EQ1A 3LIAA 3IS2A 4MBFA 3OBFA 3NECA 4BL2A 3S7OA 3IWOA 4X1LA 2CC1A 4LENA 4GDBA 1MKMA 5DJUA 1TS7A 4BD0A 1EI5A 4E3MA 4KQOA 4NXFA 1IELA 1JNUA 3KYQA 3IF5A 4C3QA 2B5RA 1NZUA 3VFFA 1GHIA 3UB7A 4WZ4A 2I72A 1L0DA 4GHIB 3IXBA 5D3OA 2V0UA 2KLIA 3W4PA 3LR0A 1IKIA 4HEFA 4LLOB 3DAVA 3JPUA 3JVVA 1DJBA 1A0KA 3PTEA 3OOVA 1OPXA 5FQKA 4Y5FA 1ESUA 2OOLA 5F69A 4XT2A 2X71A 1H0MA 3NDGA 2QMIA 1C3BA 4L9FA 2JKGA 3BFGA 5TBMA 3MR0A 1K57A 3LY3A 3NOUC 4XUZA 3E4OA 1W7FA 2XFTA 1ZC2A 5HL6A 5CEDA 2VA0A 4BMWA 3CWFA 1MXOA 5FAQA 1S0WA 3BEBA 2QWSA 4GD8A 2QJ5A 2LB9A 1PNEA 1IOUA 3F1PB 3PAGA 2JKFA 4JBFA 4EV4A 3CI6A 2R78A 3LIBA 4BWIA 1AXBA 5E2EA 4ZDXA 3GSGA 1LSVA 3CAXA 3BFEA 4DRTA 4DN0A 3TSGA 2OV5A 4PKYG 2WGVA 2PRFA 3P01A 2RCXA 4WBGA 2Y2HA 4MBHA 3MJQA 3FV7A 2ZC3B 3Q1FA 3SS3A 5CGSA 3HJIA 3KYEA 2A49A 1P97A 5GLDA 3OZHA 4Y0UA 2L0WA 3Q81A 2PYPA 1MWSA 3IF6A 3RJUA 4L9GA 3M6BA 1NWZA 1GHPA 2JKRM 3LO7A 2XK1A 2PYRA 3VP3A 1S67L 3BY8A 3DTKA 4WEJA 1E3UA 4Q0HA 1IYQA 4LRZE 1N9BA 2W27A 2G2WA 3OPLA 3B33A 4G3KA 5F1FA 4K08A 3UMEA 4FH4A 3FZCA 5EECA 5GHYA 1NYMA 2HJEA 1BUEA 1AWIA 3MXSA 3CJMA 3A3FA 4GKUA 4B4ZA 4OPZA 4FOFA 1ES3A 2QYBA 3G2ZA 5KSCA 2PT7A 2ZQ8A 4BLMA 4S2OA 4NG2A 4L9EA 2EX8A 3RXWA 4UHUA 3ZG5A 4B4XA 5KMWA 1SKOB 4WL9A 1DP6A 4K0WA 4XXRA 5FAOA 1I5QA 1OTAA 5IHVA 5EE8A 5CHMA 1TS6A 3UDFA 1M6KA 3FYZA 2ZQDA 3CHWP 1FSYA 5AVFA 3SW1A 2K2NA 2Y2LA 4JGOA 3UDXA 1CJFA 1YMXA 3LCEA 1Z6FA 3S4XA 2GZAA 2M7UA 1K4FA 3ZCZA 2VGLS 1SHVA 1PFLA 2P74A 2XRNA 1K38A 3H82A 4H6JB 1L2SA 4UA6A 5K5BA 2ZOHA 3ZG8B
chains in the Genus database with same CATH topology
3HVFA 5CTNA 5GL9A 4DE1A 4X55A 4R4RA 1XXMA 1Q2PA 3SS4A 4P85A 1ONHA 4C6YA 5KSHA 5CRFA 2EFUA 4M3KA 4JKTA 2WZXA 3GVBA 3FKWA 3D4FA 2ZJ9A 4S2PA 3NI9A 3PBSA 1W8QA 4WZ5C 2JCHA 2UWXA 1ES5A 2WK0A 4YFMA 4Y7PA 1N4OA 2Y2JA 5CTMA 3IQAA 5A92A 3O86A 4PM7A 5G18A 4KZ9A 1ES2A 1XKZA 3MZEA 2IWCA 1SKFA 2ZC6B 5CGXA 5CEBA 1PWCA 5DF8A 3UPOA 1FCNA 3LY4A 4WZ5A 4S2KA 4KENB 5AQAA 3HBRA 5BOHA 1FR6A 2EFXA 5M1AA 4KQQA 2J8YA 4RVAA 1JWZA 1Y54A 3DTMA 3IWIA 4GDNA 2WKIA 4HBUA 1KGFA 4IVKA 4ZJ1A 3UE3A 5JYOA 2QZ6A 1E25A 3JYIA 2X02A 4LV1A 4U0TA 5FQMA 2JC7A 2Z2MB 3BFDA 5L2FA 1WYBA 1RGZA 3IHBA 5GHXA 3UNWA 5FQJA 1NXYA 3G34A 4MEZA 1GHMA 1YLWA 1KE4A 4UA9A 3SH8A 4PM5A 2ZQAA 4DXCA 1J9MA 2XF3A 1ERMA 5CECA 1FOFA 5DTTA 2WGWA 5KZHA 3HLDA 2ZQCA 3DWKA 4PM9A 4Y0TA 3B3XA 5EVID 2XR0A 2Y2GA 5F82A 4WMCD 1ESIA 3OPHA 4NETA 2DCFA 4U0XA 1PZPA 4RA7A 5EOEA 3V39A 4N92A 1PZOA 4GD6A 1HTZA 3SH9A 4C75A 1YQSA 3G30A 5DF9A 1IYOA 3MBZA 3A3DA 4IEDA 4D2OA 2Y91A 3QNBA 4QHCA 3BRMA 4EBLA 4MBKA 3Q82A 3WS1A 2FFFB 4PM8A 1KDSA 3ZDJA 4OOLA 1O7EA 3QHYA 5GLAA 2XGNA 1XA7A 5EVIA 4DE3A 4DKIA 5EUAA 3ZG9B 1GA9A 3AGFA 1QMFA 4Z9QA 4ZJ3A 1K54A 3O3VA 5CXWA 3UO9A 3UN7A 2FFYA 1O07A 1Q2QA 3OCLA 4EQIA 5J8XA 5FQIA 2G2UA 3PBOA 4B88A 4N1HA 3PBQA 3M2JA 1LI0A 4JXSA 4DDSA 3GV9A 1BLHA 1SCWA 4OPYA 2XDMA 5FASA 1NYYA 3HLBA 4R0QA 4UA7A 2ZC7A 5JYPA 1K56D 2ZM2A 1BLCA 4YINA 5F1GA 3OPPA 1IYPA 2XEPA 1BSGA 2HDRA 3FWLA 1CEGA 1LI9A 3WS5A 3HLGA 3Q07A 4X53A 5HL1A 4WEKA 3W4QA 4ZBEA 4LCLA 1CK3A 4E6WA 2V2FF 2EXBA 4BQMA 4KG6A 1VQQA 2P9VB 3A3JA 4PPRA 4RX2A 4E3JA 5DTSA 4JXWA 2WADA 4Q8IA 4N9LA 3DWZA 1G6AA 4OQHA 5AQ7A 1ONGA 2IWDA 3ZVWA 4F94A 1ERQA 2OSUA 1KGEA 1EWZA 3BLSA 3VOZA 1K55C 3ZG7B 3W8KA 5HW3A 1MY8A 1S6RA 3C4OA 2OLUA 1XX2A 2IWBA 1K56A 4JPMA 4R3BA 5FQ9A 1L0EA 3SS5A 4E3OA 3Q7ZA 2V1ZA 3G31A 4FSFA 4MBFA 3PBRA 5CHUA 5AQBA 4L0LA 4QJGA 1DJCA 3PBNA 4FD8A 3VOYA 3HLCA 3IF6B 5E2GA 5TFQA 4BL2A 1K55A 2ZQ9A 3ZHHA 2H0TA 3IWOA 1YLYA 4OQIA 2CC1A 1H8ZA 2VGJA 4LENA 3P98A 4GDBA 3UPPA 5M18A 3BFCA 1YT4A 4BD0A 3I7JA 1EI5A 4E3MA 4KQOA 1BLSA 2Q9MA 1DY6A 4S2MA 4R3JA 1IELA 5FI6A 1IKGA 2ZC5B 3IF5A 5HFOA 4C3QA 3IXDA 2V20A 2B5RA 1NZUA 1PWDA 3VFFA 1GHIA 4WZ4A 2I72A 4OOMA 4PMAA 5FI7A 1L0DA 3IXBA 3N7WA 5D3OA 5U47A 3W4PA 1YM1A 5A93A 3UE1A 3V50A 2PBYA 3BFFA 4OP8A 1IKIA 5EVLA 3WRZA 2BLSA 4S2LA 3EQVA 4HEFA 2XFSA 1ES4A 1MWRA 5TR7A 1DJBA 3PTEA 3N8SA 2HDUA 4WYYA 5GLBA 2EX6A 3GMWA 1CI8A 1IYSA 3C7UA 3IXHA 5FQKA 1BZAA 1L0FA 1NJ4A 3WRTA 1W5DA 1ESUA 2J7VA 3TOIA 3ZFZA 3V3SA 4BJPA 1RCJA 1DJAA 3HREA 5DTKA 1SDNA 4OVDA 3LEZA 3O87A 2XLNA 2HDSA 2X71A 1PI5A 2Y59A 3NDGA 4ZTKA 1BTLA 2QMIA 1C3BA 1NRFA 4JF6A 2C5WB 3VP2A 3BFGA 3MKFA 1KE0A 2Y4AA 3E2LA 4UAAA 1TDLA 2WYXA 1JWPA 2HP6A 1K57A 3HLEA 4KQRA 3GR2A 4NK3A 3LY3A 1KGGA 2XQZA 3G2YA 1WE4A 4BENA 1W8YA 1ZG6A 5EVIC 1LL9A 4XUZA 3HL9A 1W7FA 4OOYA 5I94A 1K54C 5HAIA 2XFTA 4KG2A 4K0XA 2VGKA 3O88A 4OLDA 2Q9NA 4P6BA 1ZC2A 3FKVA 5HARA 2R9WA 3RXXA 5CEDA 3GRJA 5FI2A 2H10A 1MXOA 1JVJA 1S0WA 5FAQA 4OP5A 3BEBA 3IXGA 4GD8A 4GZBA 1NZOA 5A90A 4WMCA 2HDQA 4DE0A 4KZ6A 3BECA 1QMEA 4JF5A 4EBNA 3IWQA 3PAGA 1YMSA 3NC8A 4X68A 3WS4A 5HAQA 4JBFA 4OQ0A 4ID4A 4QY5A 4EV4A 4KG5A 1FCOA 3CG5A 1HD8A 4HESA 1MWUA 1AXBA 4EUZA 5E2EA 4ZDXA 3GSGA 4QB8A 1HZOA 1MKIA 5HX9A 2EX2A 3SOIA 3BFEA 4DRTA 5CERA 2C6WB 4GN2A 4OONA 5FSRA 1W79A 3VP1A 3M6HA 4OQGA 3TSGA 4MLLA 1GA0A 2OV5A 2P9VA 3N6IA 4X6TA 2WGVA 1E4DA 2WGIA 3ZG0A 1K6SA 2HP5A 2RCXA 3NDEA 2Y2HA 2ZMAA 2ZM8A 4QD4A 4S2NC 2JBFA 4WBGA 4ZJ2A 1XP4A 2X01A 4IVIA 4MBHA 2XD1A 4DXBA 1I2WA 3C7VA 3OC2A 3FV7A 2ZC3B 3MZFA 1E3UD 4QY6A 4GB7A 3IF6C 2HP9A 3Q1FA 4HBTA 4LCMA 3HUNA 2EXAA 3SS3A 1CEFA 5CGSA 5FAPA 1WYCA 4IBRA 2ZM0A 4KZ3A 5AQ9A 3Q7VB 2E8IA 2A49A 1PI4A 3EQUA 5GLDA 2DNSA 3MFDA 4S2NA 3OZHA 3HLFA 4Y0UA 2ZLYA 3MXRA 1XPBA 3Q81A 3HUMA 4DF6A 3IF6A 1MWSA 3NIAA 5E2HA 5FA7A 3ISGA 3RJUA 4XUXA 3DW0A 4OH0A 5E2FA 3M6BA 5GLCA 4E3IA 3CZDA 1EROA 1XGJA 2Y2NA 1GHPA 3LO7A 2XK1A 3VP3A 4K91A 3TG9A 4WEJA 5HAPA 4E3KA 1E3UA 4P87A 1IEMA 1IYQA 1VM1A 4MNRA 5DF7A 1HVBA 3ZNTA 2H5SA 1N9BA 1RP5A 4R1GA 2Y2KA 3ITBA 3P09A 4GNUA 4LV2A 3VP0A 2XD5A 1TVFA 4U3TA 4H8RA 1K4EA 2G2WA 3HLWA 1TEMA 3ZGAB 3OPLA 1RGYA 2GDNA 3ZVTA 4CJNA 3S22A 3OPRA 4EBPA 4A5RA 2BG1A 2R9XA 4LV0A 5F1FA 4E6XA 4FH4A 4KZ7A 1OMEA 5CHJA 3FZCA 1ZG4A 5EECA 5GHYA 3BLMA 1NYMA 1BUEA 4P0MA 3SH7A 4EWFA 3MXSA 2Y2IA 3PAEA 1KDWA 4KZ5A 3NCKA 3CJMA 1BULA 1K57C 3A3FA 4JXGA 4GKUA 4OPQA 4R23A 4B4ZA 3MZDA 1U60A 4OPZA 1YLZA 1ES3A 4CPKA 4E3LA 1L0GA 3VSLA 3M2KA 3VSKA 4JXVA 2WUQA 5TGFA 3G2ZA 3QNCA 4X69A 5EPHA 4QU3A 3WS0A 3WWXA 1LL5A 2JE5A 4JLFA 3IH8A 5KSCA 2Y2MA 2A3UA 2ZQ8A 3MKEA 1NY0A 1JTDA 4BLMA 3IT9A 4ZAMA 3UY6A 4KZ8A 1GCEA 1MWTA 2Y2PA 4S2OA 1SDEA 4DDYA 1ALQA 4R4SA 2WGWB 4WELA 2Y55A 3VMAA 1MBLA 2WAFA 3C5AA 2EX9A 3GTCA 2J9OA 1ZKJA 2WZZA 2ZC4B 1PWGA 3HUOA 4FCFA 5GHZA 3A3EA 4E3NA 4OLGA 3G35A 5FATA 2HPBA 4N1XA 3A3IA 2EX8A 1YLPA 2J9PA 2OLVA 3RXWA 1BLPA 1KE3A 4UHUA 3E2KA 3ZG5A 4Y0OA 4B4XA 5KMWA 4X56A 1CI9A 2XH9A 2RL3A 4OPRA 5EOOA 2WAEA 4KZ4A 3V3RA 1FQGA 4GOGA 1PIOA 1PYYA 1JTGA 1TDGA 2PU4A 3PBTA 1I2SA 1LLBA 4K0WA 1XA1A 4XXRA 3C4PA 5FAOA 1I5QA 4WM9A 5E43A 1KVLA 5FDHA 1M40A 2WKEA 5EVIB 1PW8A 3N8LA 5IHVA 3ZNYA 4BL3A 4O7DA 3BYDA 3N4IA 5EE8A 3BM6A 2Z2LB 4S2IA 2DRWA 4PM6A 3V5MA 5CHMA 2QPNA 1FCMA 3UDFA 1M6KA 2PU2A 3FYZA 3G32A 3UE0A 4BD1A 2H0YA 2ZQDA 3VP4A 1H8YA 5DVAA 5A91A 1FR1A 2Y2QA 3NBLA 2ZD8A 4KZBA 1FSYA 1XGIA 1YLTA 3S1YA 1K25A 2WKHA 1G68A 2Y2LA 5M19A 3UDXA 1H5XA 3IHAA 4OKPA 1LHYA 2Y2OA 4KZAA 3Q7VA 1YLJA 1YMXA 3LCEA 3ITAA 5F83A 1Z6FA 4RX3A 3N8RA 2ZQ7A 4FH2A 5CGWA 3UDIA 4DE2A 3G4PA 1FSWA 4RYEA 3S4XA 1PW1A 1KVMA 4LV3A 4JF4A 1K4FA 1JWVA 3GQZA 3ZCZA 3OCNA 3AGDA 1SHVA 3UPNA 4N9KA 3NY4A 3AGEA 2P74A 4IBXA 1K38A 3IH9A 5FQQA 1L2SA 3WS2A 4UA6A 3CMZA 1K6RA 4S2JA 1BT5A 3ZG8B 1MPLA 3W4OA 3VFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HVF A;  5CTN A;  5GL9 A;  4DE1 A;  4X55 A;  4R4R A;  1XXM A;  1Q2P A;  3SS4 A;  4P85 A;  1ONH A;  4C6Y A;  5KSH A;  5CRF A;  2EFU A;  4M3K A;  4JKT A;  2WZX A;  3GVB A;  3FKW A;  3D4F A;  2ZJ9 A;  4S2P A;  3NI9 A;  3PBS A;  1W8Q A;  4WZ5 C;  2JCH A;  2UWX A;  1ES5 A;  2WK0 A;  4YFM A;  4Y7P A;  1N4O A;  2Y2J A;  5CTM A;  3IQA A;  5A92 A;  3O86 A;  4PM7 A;  5G18 A;  4KZ9 A;  1ES2 A;  1XKZ A;  3MZE A;  2IWC A;  1SKF A;  2ZC6 B;  5CGX A;  5CEB A;  1PWC A;  5DF8 A;  3UPO A;  1FCN A;  3LY4 A;  4WZ5 A;  4S2K A;  4KEN B;  5AQA A;  3HBR A;  5BOH A;  1FR6 A;  2EFX A;  5M1A A;  4KQQ A;  2J8Y A;  4RVA A;  1JWZ A;  1Y54 A;  3DTM A;  3IWI A;  4GDN A;  2WKI A;  4HBU A;  1KGF A;  4IVK A;  4ZJ1 A;  3UE3 A;  5JYO A;  2QZ6 A;  1E25 A;  3JYI A;  2X02 A;  4LV1 A;  4U0T A;  5FQM A;  2JC7 A;  2Z2M B;  3BFD A;  5L2F A;  1WYB A;  1RGZ A;  3IHB A;  5GHX A;  3UNW A;  5FQJ A;  1NXY A;  3G34 A;  4MEZ A;  1GHM A;  1YLW A;  1KE4 A;  4UA9 A;  3SH8 A;  4PM5 A;  2ZQA A;  4DXC A;  1J9M A;  2XF3 A;  1ERM A;  5CEC A;  1FOF A;  5DTT A;  2WGW A;  5KZH A;  3HLD A;  2ZQC A;  3DWK A;  4PM9 A;  4Y0T A;  3B3X A;  5EVI D;  2XR0 A;  2Y2G A;  5F82 A;  4WMC D;  1ESI A;  3OPH A;  4NET A;  2DCF A;  4U0X A;  1PZP A;  4RA7 A;  5EOE A;  3V39 A;  4N92 A;  1PZO A;  4GD6 A;  1HTZ A;  3SH9 A;  4C75 A;  1YQS A;  3G30 A;  5DF9 A;  1IYO A;  3MBZ A;  3A3D A;  4IED A;  4D2O A;  2Y91 A;  3QNB A;  4QHC A;  3BRM A;  4EBL A;  4MBK A;  3Q82 A;  3WS1 A;  2FFF B;  4PM8 A;  1KDS A;  3ZDJ A;  4OOL A;  1O7E A;  3QHY A;  5GLA A;  2XGN A;  1XA7 A;  5EVI A;  4DE3 A;  4DKI A;  5EUA A;  3ZG9 B;  1GA9 A;  3AGF A;  1QMF A;  4Z9Q A;  4ZJ3 A;  1K54 A;  3O3V A;  5CXW A;  3UO9 A;  3UN7 A;  2FFY A;  1O07 A;  1Q2Q A;  3OCL A;  4EQI A;  5J8X A;  5FQI A;  2G2U A;  3PBO A;  4B88 A;  4N1H A;  3PBQ A;  3M2J A;  1LI0 A;  4JXS A;  4DDS A;  3GV9 A;  1BLH A;  1SCW A;  4OPY A;  2XDM A;  5FAS A;  1NYY A;  3HLB A;  4R0Q A;  4UA7 A;  2ZC7 A;  5JYP A;  1K56 D;  2ZM2 A;  1BLC A;  4YIN A;  5F1G A;  3OPP A;  1IYP A;  2XEP A;  1BSG A;  2HDR A;  3FWL A;  1CEG A;  1LI9 A;  3WS5 A;  3HLG A;  3Q07 A;  4X53 A;  5HL1 A;  4WEK A;  3W4Q A;  4ZBE A;  4LCL A;  1CK3 A;  4E6W A;  2V2F F;  2EXB A;  4BQM A;  4KG6 A;  1VQQ A;  2P9V B;  3A3J A;  4PPR A;  4RX2 A;  4E3J A;  5DTS A;  4JXW A;  2WAD A;  4Q8I A;  4N9L A;  3DWZ A;  1G6A A;  4OQH A;  5AQ7 A;  1ONG A;  2IWD A;  3ZVW A;  4F94 A;  1ERQ A;  2OSU A;  1KGE A;  1EWZ A;  3BLS A;  3VOZ A;  1K55 C;  3ZG7 B;  3W8K A;  5HW3 A;  1MY8 A;  1S6R A;  3C4O A;  2OLU A;  1XX2 A;  2IWB A;  1K56 A;  4JPM A;  4R3B A;  5FQ9 A;  1L0E A;  3SS5 A;  4E3O A;  3Q7Z A;  2V1Z A;  3G31 A;  4FSF A;  4MBF A;  3PBR A;  5CHU A;  5AQB A;  4L0L A;  4QJG A;  1DJC A;  3PBN A;  4FD8 A;  3VOY A;  3HLC A;  3IF6 B;  5E2G A;  5TFQ A;  4BL2 A;  1K55 A;  2ZQ9 A;  3ZHH A;  2H0T A;  3IWO A;  1YLY A;  4OQI A;  2CC1 A;  1H8Z A;  2VGJ A;  4LEN A;  3P98 A;  4GDB A;  3UPP A;  5M18 A;  3BFC A;  1YT4 A;  4BD0 A;  3I7J A;  1EI5 A;  4E3M A;  4KQO A;  1BLS A;  2Q9M A;  1DY6 A;  4S2M A;  4R3J A;  1IEL A;  5FI6 A;  1IKG A;  2ZC5 B;  3IF5 A;  5HFO A;  4C3Q A;  3IXD A;  2V20 A;  2B5R A;  1NZU A;  1PWD A;  3VFF A;  1GHI A;  4WZ4 A;  2I72 A;  4OOM A;  4PMA A;  5FI7 A;  1L0D A;  3IXB A;  3N7W A;  5D3O A;  5U47 A;  3W4P A;  1YM1 A;  5A93 A;  3UE1 A;  3V50 A;  2PBY A;  3BFF A;  4OP8 A;  1IKI A;  5EVL A;  3WRZ A;  2BLS A;  4S2L A;  3EQV A;  4HEF A;  2XFS A;  1ES4 A;  1MWR A;  5TR7 A;  1DJB A;  3PTE A;  3N8S A;  2HDU A;  4WYY A;  5GLB A;  2EX6 A;  3GMW A;  1CI8 A;  1IYS A;  3C7U A;  3IXH A;  5FQK A;  1BZA A;  1L0F A;  1NJ4 A;  3WRT A;  1W5D A;  1ESU A;  2J7V A;  3TOI A;  3ZFZ A;  3V3S A;  4BJP A;  1RCJ A;  1DJA A;  3HRE A;  5DTK A;  1SDN A;  4OVD A;  3LEZ A;  3O87 A;  2XLN A;  2HDS A;  2X71 A;  1PI5 A;  2Y59 A;  3NDG A;  4ZTK A;  1BTL A;  2QMI A;  1C3B A;  1NRF A;  4JF6 A;  2C5W B;  3VP2 A;  3BFG A;  3MKF A;  1KE0 A;  2Y4A A;  3E2L A;  4UAA A;  1TDL A;  2WYX A;  1JWP A;  2HP6 A;  1K57 A;  3HLE A;  4KQR A;  3GR2 A;  4NK3 A;  3LY3 A;  1KGG A;  2XQZ A;  3G2Y A;  1WE4 A;  4BEN A;  1W8Y A;  1ZG6 A;  5EVI C;  1LL9 A;  4XUZ A;  3HL9 A;  1W7F A;  4OOY A;  5I94 A;  1K54 C;  5HAI A;  2XFT A;  4KG2 A;  4K0X A;  2VGK A;  3O88 A;  4OLD A;  2Q9N A;  4P6B A;  1ZC2 A;  3FKV A;  5HAR A;  2R9W A;  3RXX A;  5CED A;  3GRJ A;  5FI2 A;  2H10 A;  1MXO A;  1JVJ A;  1S0W A;  5FAQ A;  4OP5 A;  3BEB A;  3IXG A;  4GD8 A;  4GZB A;  1NZO A;  5A90 A;  4WMC A;  2HDQ A;  4DE0 A;  4KZ6 A;  3BEC A;  1QME A;  4JF5 A;  4EBN A;  3IWQ A;  3PAG A;  1YMS A;  3NC8 A;  4X68 A;  3WS4 A;  5HAQ A;  4JBF A;  4OQ0 A;  4ID4 A;  4QY5 A;  4EV4 A;  4KG5 A;  1FCO A;  3CG5 A;  1HD8 A;  4HES A;  1MWU A;  1AXB A;  4EUZ A;  5E2E A;  4ZDX A;  3GSG A;  4QB8 A;  1HZO A;  1MKI A;  5HX9 A;  2EX2 A;  3SOI A;  3BFE A;  4DRT A;  5CER A;  2C6W B;  4GN2 A;  4OON A;  5FSR A;  1W79 A;  3VP1 A;  3M6H A;  4OQG A;  3TSG A;  4MLL A;  1GA0 A;  2OV5 A;  2P9V A;  3N6I A;  4X6T A;  2WGV A;  1E4D A;  2WGI A;  3ZG0 A;  1K6S A;  2HP5 A;  2RCX A;  3NDE A;  2Y2H A;  2ZMA A;  2ZM8 A;  4QD4 A;  4S2N C;  2JBF A;  4WBG A;  4ZJ2 A;  1XP4 A;  2X01 A;  4IVI A;  4MBH A;  2XD1 A;  4DXB A;  1I2W A;  3C7V A;  3OC2 A;  3FV7 A;  2ZC3 B;  3MZF A;  1E3U D;  4QY6 A;  4GB7 A;  3IF6 C;  2HP9 A;  3Q1F A;  4HBT A;  4LCM A;  3HUN A;  2EXA A;  3SS3 A;  1CEF A;  5CGS A;  5FAP A;  1WYC A;  4IBR A;  2ZM0 A;  4KZ3 A;  5AQ9 A;  3Q7V B;  2E8I A;  2A49 A;  1PI4 A;  3EQU A;  5GLD A;  2DNS A;  3MFD A;  4S2N A;  3OZH A;  3HLF A;  4Y0U A;  2ZLY A;  3MXR A;  1XPB A;  3Q81 A;  3HUM A;  4DF6 A;  3IF6 A;  1MWS A;  3NIA A;  5E2H A;  5FA7 A;  3ISG A;  3RJU A;  4XUX A;  3DW0 A;  4OH0 A;  5E2F A;  3M6B A;  5GLC A;  4E3I A;  3CZD A;  1ERO A;  1XGJ A;  2Y2N A;  1GHP A;  3LO7 A;  2XK1 A;  3VP3 A;  4K91 A;  3TG9 A;  4WEJ A;  5HAP A;  4E3K A;  1E3U A;  4P87 A;  1IEM A;  1IYQ A;  1VM1 A;  4MNR A;  5DF7 A;  1HVB A;  3ZNT A;  2H5S A;  1N9B A;  1RP5 A;  4R1G A;  2Y2K A;  3ITB A;  3P09 A;  4GNU A;  4LV2 A;  3VP0 A;  2XD5 A;  1TVF A;  4U3T A;  4H8R A;  1K4E A;  2G2W A;  3HLW A;  1TEM A;  3ZGA B;  3OPL A;  1RGY A;  2GDN A;  3ZVT A;  4CJN A;  3S22 A;  3OPR A;  4EBP A;  4A5R A;  2BG1 A;  2R9X A;  4LV0 A;  5F1F A;  4E6X A;  4FH4 A;  4KZ7 A;  1OME A;  5CHJ A;  3FZC A;  1ZG4 A;  5EEC A;  5GHY A;  3BLM A;  1NYM A;  1BUE A;  4P0M A;  3SH7 A;  4EWF A;  3MXS A;  2Y2I A;  3PAE A;  1KDW A;  4KZ5 A;  3NCK A;  3CJM A;  1BUL A;  1K57 C;  3A3F A;  4JXG A;  4GKU A;  4OPQ A;  4R23 A;  4B4Z A;  3MZD A;  1U60 A;  4OPZ A;  1YLZ A;  1ES3 A;  4CPK A;  4E3L A;  1L0G A;  3VSL A;  3M2K A;  3VSK A;  4JXV A;  2WUQ A;  5TGF A;  3G2Z A;  3QNC A;  4X69 A;  5EPH A;  4QU3 A;  3WS0 A;  3WWX A;  1LL5 A;  2JE5 A;  4JLF A;  3IH8 A;  5KSC A;  2Y2M A;  2A3U A;  2ZQ8 A;  3MKE A;  1NY0 A;  1JTD A;  4BLM A;  3IT9 A;  4ZAM A;  3UY6 A;  4KZ8 A;  1GCE A;  1MWT A;  2Y2P A;  4S2O A;  1SDE A;  4DDY A;  1ALQ A;  4R4S A;  2WGW B;  4WEL A;  2Y55 A;  3VMA A;  1MBL A;  2WAF A;  3C5A A;  2EX9 A;  3GTC A;  2J9O A;  1ZKJ A;  2WZZ A;  2ZC4 B;  1PWG A;  3HUO A;  4FCF A;  5GHZ A;  3A3E A;  4E3N A;  4OLG A;  3G35 A;  5FAT A;  2HPB A;  4N1X A;  3A3I A;  2EX8 A;  1YLP A;  2J9P A;  2OLV A;  3RXW A;  1BLP A;  1KE3 A;  4UHU A;  3E2K A;  3ZG5 A;  4Y0O A;  4B4X A;  5KMW A;  4X56 A;  1CI9 A;  2XH9 A;  2RL3 A;  4OPR A;  5EOO A;  2WAE A;  4KZ4 A;  3V3R A;  1FQG A;  4GOG A;  1PIO A;  1PYY A;  1JTG A;  1TDG A;  2PU4 A;  3PBT A;  1I2S A;  1LLB A;  4K0W A;  1XA1 A;  4XXR A;  3C4P A;  5FAO A;  1I5Q A;  4WM9 A;  5E43 A;  1KVL A;  5FDH A;  1M40 A;  2WKE A;  5EVI B;  1PW8 A;  3N8L A;  5IHV A;  3ZNY A;  4BL3 A;  4O7D A;  3BYD A;  3N4I A;  5EE8 A;  3BM6 A;  2Z2L B;  4S2I A;  2DRW A;  4PM6 A;  3V5M A;  5CHM A;  2QPN A;  1FCM A;  3UDF A;  1M6K A;  2PU2 A;  3FYZ A;  3G32 A;  3UE0 A;  4BD1 A;  2H0Y A;  2ZQD A;  3VP4 A;  1H8Y A;  5DVA A;  5A91 A;  1FR1 A;  2Y2Q A;  3NBL A;  2ZD8 A;  4KZB A;  1FSY A;  1XGI A;  1YLT A;  3S1Y A;  1K25 A;  2WKH A;  1G68 A;  2Y2L A;  5M19 A;  3UDX A;  1H5X A;  3IHA A;  4OKP A;  1LHY A;  2Y2O A;  4KZA A;  3Q7V A;  1YLJ A;  1YMX A;  3LCE A;  3ITA A;  5F83 A;  1Z6F A;  4RX3 A;  3N8R A;  2ZQ7 A;  4FH2 A;  5CGW A;  3UDI A;  4DE2 A;  3G4P A;  1FSW A;  4RYE A;  3S4X A;  1PW1 A;  1KVM A;  4LV3 A;  4JF4 A;  1K4F A;  1JWV A;  3GQZ A;  3ZCZ A;  3OCN A;  3AGD A;  1SHV A;  3UPN A;  4N9K A;  3NY4 A;  3AGE A;  2P74 A;  4IBX A;  1K38 A;  3IH9 A;  5FQQ A;  1L2S A;  3WS2 A;  4UA6 A;  3CMZ A;  1K6R A;  4S2J A;  1BT5 A;  3ZG8 B;  1MPL A;  3W4O A;  3VFH A; 
#chains in the Genus database with same CATH topology
 3HVF A;  3CUE A;  3LIC A;  3F1O A;  3SS4 A;  2XRO A;  2WKQ A;  2EFU A;  3FKW A;  3A0V A;  3BY9 A;  3PBS A;  2V0W A;  4HH2 A;  2UWX A;  2M1C A;  4Y7P A;  3DTE A;  5CTM A;  3O86 A;  4NEE D;  1GSV A;  1FCN A;  3LY4 A;  4S2K A;  5L8M A;  4Y15 A;  5BOH A;  5JYO A;  4GDN A;  4IVK A;  1KGF A;  2X02 A;  2V9A A;  2JC7 A;  2JHE A;  3KSI A;  3K3C A;  1RGZ A;  4E04 A;  1EW0 A;  4MEZ A;  4KUO A;  1YLW A;  4UA9 A;  2W1T B;  2XF3 A;  4I3A A;  5CEC A;  3TE8 A;  2WGW A;  4MN6 A;  5KZH A;  4EEU A;  5FEG A;  4Y0T A;  4UQI M;  1VEU B;  4HJ4 A;  2G7U A;  1ZHH B;  5F82 A;  3OPH A;  2DCF A;  4HOI A;  4FUW A;  4U0X A;  4N92 A;  4GD6 A;  3UMD A;  1YQS A;  1IYO A;  4ARZ A;  4D2O A;  2Y91 A;  1ZTU A;  1G6O A;  3MXQ A;  4EBL A;  3Q82 A;  4PM8 A;  1OTD A;  2VZW A;  4OOL A;  4I38 A;  2XGN A;  3LIE A;  5EUA A;  4ZJ3 A;  3UO9 A;  3UN7 A;  3M2J A;  4JXS A;  3LI9 A;  3LR5 A;  4UA7 A;  4PAU A;  2ZM2 A;  4YIN A;  3OPP A;  1BSG A;  4LPZ A;  3BJN A;  4ZBE A;  3IX8 A;  2EXB A;  1VQQ A;  3A3J A;  2Z6D A;  2HF6 A;  4N9L A;  3ICY A;  4EU0 A;  1PRQ A;  2A24 B;  2IWD A;  3S7Q A;  1ERQ A;  2OSU A;  3VOZ A;  3ZG7 B;  5FL3 A;  5HW3 A;  3C4O A;  1XX2 A;  1K56 A;  5FQ9 A;  3SS5 A;  3H7W B;  5AQB A;  4L0L A;  3E4Q A;  4HNB A;  1CF0 A;  3KSF A;  4NXB A;  2ZQ9 A;  4ESP A;  5F5Y A;  4OQI A;  2V1B A;  1H8Z A;  2VV7 A;  4LGW A;  5M18 A;  1YT4 A;  4ZRR A;  1D1J A;  3MSH A;  2ZBB A;  5HDS A;  1PWD A;  4PMA A;  2JKR I;  5U47 A;  3OLO A;  4F3L B;  3QP2 A;  4QWO A;  3UE1 A;  3V50 A;  3BFF A;  4OP8 A;  3C38 A;  1ES4 A;  1GSX A;  2EX6 A;  2KDK A;  3C7U A;  1F2K A;  3IXH A;  3W2Z A;  1L0F A;  1W5D A;  2J7V A;  1W63 Q;  4BJP A;  1DJA A;  2XLN A;  3NUL A;  4ZTK A;  1PI5 A;  1BTL A;  5EFW A;  3E2L A;  2HP6 A;  3HLE A;  4NK3 A;  3H9W A;  2XQZ A;  1WE4 A;  4Y2F A;  4MMN A;  1ZG6 A;  2W3G A;  1LL9 A;  3HL9 A;  5I94 A;  1S66 L;  1K54 C;  4I5S A;  4OLD A;  2Q9N A;  2QKP A;  3FKV A;  3RXX A;  2R9W A;  2AVX A;  5FI2 A;  2E8J A;  1JVJ A;  2VK3 A;  4WMC A;  1X0O A;  4DE0 A;  3IWQ A;  3HCY A;  4ID4 A;  2V8F A;  3CG5 A;  1MWU A;  5EM0 A;  1HZO A;  2EX2 A;  4G3V A;  3SOI A;  1N9N A;  3UB5 P;  2C6W B;  3TJZ C;  1W79 A;  3SZT A;  4MLL A;  2VV8 A;  2PAV P;  3N6I A;  4Y17 A;  2WGI A;  3ZG0 A;  1K6S A;  3NDE A;  4S2N C;  2JBF A;  4DXB A;  4GLQ A;  4ZJ2 A;  2X01 A;  4IVI A;  2XD1 A;  1I2W A;  3T1Q B;  3OC2 A;  4QY6 A;  1T19 A;  3HUN A;  2PD7 A;  1NRJ A;  4NKP A;  5FAP A;  1WYC A;  2VLG A;  2ZM0 A;  1H3Q A;  5AQ9 A;  3KX0 X;  3MFD A;  3MXR A;  1D7E A;  1XPB A;  1MZU A;  4DJ2 A;  4O01 A;  3NIA A;  5E2H A;  3ISG A;  4XUX A;  5E2F A;  1ERO A;  2B18 A;  2VKS A;  3T4S A;  4K91 A;  4E3K A;  4P87 A;  4JGQ A;  2W1R A;  1VM1 A;  5DF7 A;  1WA9 A;  2H5S A;  3IS2 B;  4JGR A;  2W3E A;  3ITB A;  4LV2 A;  1K4E A;  1TEM A;  3ZGA B;  3MF0 A;  3UB9 A;  3S22 A;  1DP9 A;  4A5R A;  2R9X A;  4LV0 A;  4Q0J A;  4KZ7 A;  1OME A;  2Y2I A;  5J4E A;  4JXG A;  4OPQ A;  3VSL A;  3M2K A;  3ZYT A;  2XA7 M;  5HDD A;  3VSK A;  2WUQ A;  2WKR A;  5TGF A;  4X69 A;  5EPH A;  4UEY A;  4GS9 B;  5G4Z A;  3IH8 A;  5HD5 A;  2A3U A;  3MKE A;  3NHQ A;  2ZL1 A;  3EGD C;  3TW8 A;  3UY6 A;  1GCE A;  1MWT A;  4DDY A;  4HI4 A;  4WEL A;  1MBL A;  2EX9 A;  2J9O A;  2WZZ A;  2YKH A;  4FCF A;  4XT2 B;  3A3E A;  4E3N A;  5HZH A;  1MC0 A;  3G35 A;  2CMN A;  2HPB A;  5TBM B;  2J9P A;  2OLV A;  4CLC A;  2NUP C;  3NOP C;  1CI9 A;  3F1P A;  4OPR A;  1KOU A;  2O0Y A;  3V3R A;  5HPF A;  1JTG A;  3VE4 A;  1I2S A;  3UB8 A;  3PR6 A;  2IA2 A;  3V67 A;  3EEH A;  4WF0 A;  1M40 A;  5I5L A;  3ZNY A;  3DBA A;  3E4P A;  4O7D A;  2QJ7 A;  3BYD A;  4QPR A;  4PM6 A;  3UE0 A;  4HP9 A;  3IX3 A;  2L4R A;  5A91 A;  1FR1 A;  4DJ3 A;  2ZD8 A;  1XGI A;  1YLT A;  3EEA A;  1K25 A;  1G68 A;  1H5X A;  3IHA A;  4OKP A;  4KZA A;  1TD5 A;  1YLJ A;  3C30 A;  4RX3 A;  3N8R A;  4GJ4 A;  4DE2 A;  1FSW A;  4EXO A;  1PW1 A;  4LV3 A;  4M4X A;  1JWV A;  3OCN A;  1LSW A;  3IX4 A;  3NY4 A;  3IH9 A;  2P04 A;  3TRC A;  1K6R A;  4S2J A;  5CTN A;  4DE1 A;  3T1S A;  4ME4 A;  1ONH A;  2ZMF A;  4JKT A;  5F68 A;  3D4F A;  2ZJ9 A;  4S2P A;  5HD3 A;  1T1B A;  4WZ5 C;  3R4K A;  4RQ9 A;  1VB6 A;  2WK0 A;  1FIK A;  3IQA A;  4MN5 A;  1ES2 A;  3MZE A;  2HGV A;  5DJT A;  1PWC A;  4BBU A;  5M1A A;  4KQQ A;  4RVA A;  1Y54 A;  3UE3 A;  2VEA A;  4U0T A;  5FQM A;  2Z2M B;  3BFD A;  1WYB A;  5GHX A;  1OTI A;  1NXY A;  5J3W A;  3SH8 A;  2ZQA A;  1J9M A;  1FOF A;  3VV4 A;  4NXE A;  3CIT A;  4Z1W A;  3BW6 A;  1G28 A;  3T4Q A;  2Y2G A;  1LT0 A;  1ESI A;  4GW9 A;  5EOE A;  3T4T A;  1HTZ A;  3F1N B;  5DF9 A;  5AVE A;  4DMZ A;  3A3D A;  2EA9 A;  3QNB A;  1Z09 A;  3BRM A;  4MBK A;  3WS1 A;  3MMH A;  4GCZ A;  1KDS A;  5GLA A;  4DKI A;  3EWK A;  3R7W B;  3AGF A;  3ZG9 B;  1QMF A;  4Z9Q A;  1K54 A;  4R70 A;  5J8X A;  1Q2Q A;  3PBQ A;  1LI0 A;  3GV9 A;  4OPY A;  3HLB A;  2GNX A;  1BLC A;  5F1G A;  2HDR A;  1LI9 A;  3WS5 A;  2VJW A;  4WEK A;  3GEC A;  4HIA A;  4P6Z M;  4LCL A;  4B9O A;  2V2F F;  2P9V B;  4PPR A;  4RX2 A;  4E3J A;  2WAD A;  4OQH A;  3ZVW A;  3W8K A;  2FZ0 A;  2IWB A;  1DP8 A;  1CQA A;  3Q7Z A;  2ZMV A;  4FSF A;  3G31 A;  5CHU A;  3PBR A;  1DJC A;  3VOY A;  3HLC A;  5E2G A;  5TFQ A;  3T4J A;  2WKP A;  1K55 A;  1N9L A;  3ZHH A;  1YLY A;  4HH3 A;  3UPP A;  3S7N A;  5EV0 A;  3H82 B;  3I7J A;  2INW A;  1BLS A;  2LB5 A;  4S2M A;  1IKG A;  2ZC5 B;  3FG8 A;  1STZ A;  3F1O B;  1OTB A;  3E98 A;  3K2N A;  4OOM A;  5FI7 A;  3N7W A;  1YM1 A;  3U4L P;  5A93 A;  2GX5 A;  5C5K A;  3WRZ A;  2BLS A;  2XFS A;  5TR7 A;  2B95 A;  3LYX A;  4WYY A;  2W1T A;  2ACG A;  3JVU A;  1IYS A;  4IUH A;  3ZFZ A;  3TOI A;  4I39 A;  2YKF A;  1RCJ A;  1SDN A;  4OVD A;  4I3I A;  1NRF A;  4JF6 A;  1SZV A;  3MKF A;  1TDL A;  2WYX A;  2PDR A;  4KQR A;  3GR2 A;  1KGG A;  4HQA A;  3ZQ5 A;  4KG2 A;  4K0X A;  2VGK A;  2MJ6 A;  2B02 A;  4LRY C;  5HAR A;  3LID A;  2H10 A;  4CLC E;  4OP5 A;  3IXG A;  3QP8 A;  3P7N A;  2HDQ A;  3BEC A;  5TJJ A;  4JF5 A;  5EM1 A;  4EBN A;  1YMS A;  3NC8 A;  3WS4 A;  4ARZ B;  5HAQ A;  4QY5 A;  1F9I A;  1FCO A;  4HES A;  1HD8 A;  4IHQ A;  5HX9 A;  4OON A;  3VP1 A;  4OQG A;  1GA0 A;  4ETX A;  1E4D A;  5KSH A;  4QD4 A;  2ZM8 A;  3KSG A;  3C7V A;  4LRX C;  3BWL A;  2A24 A;  3MZF A;  3IF6 C;  4HBT A;  1UWN X;  1CEF A;  2O9B A;  4IBR A;  4KZ3 A;  3UE6 A;  3Q7V B;  3EQU A;  2DNS A;  2ZLY A;  3HUM A;  4Y3I A;  5J7E A;  4EER A;  3FPV A;  5GLC A;  3CPT B;  4E3I A;  2Y2N A;  4EW7 A;  3C8C A;  3LUQ A;  4HJ6 A;  3QP1 A;  3T12 B;  1IEM A;  4MNR A;  1OTE A;  1RP5 A;  4R1G A;  2Y2K A;  5KIZ A;  3P09 A;  3VP0 A;  2XD5 A;  4U3T A;  1XFQ A;  2J80 A;  4H8R A;  3HLW A;  3LI8 A;  3VE3 A;  3ZVT A;  1RGY A;  3IBR A;  3OPR A;  4EBP A;  1XJ2 A;  3LFV A;  5L09 A;  1OT6 A;  1ZG4 A;  2V8C A;  1Y4O A;  3O5Y A;  4YWZ A;  4EWF A;  3T1R A;  5A8B A;  2PR5 A;  1U60 A;  3B47 A;  1TS8 A;  1YLZ A;  4CPK A;  4E3L A;  4UQI S;  1L0G A;  1S1Z A;  1XFN A;  4JXV A;  1Y28 A;  4I3J A;  1YSQ A;  4QU3 A;  3WWX A;  2JE5 A;  1T18 A;  4ZAM A;  1VET B;  4KZ8 A;  3RTY A;  1ALQ A;  4R4S A;  2Y55 A;  4WLA A;  3VMA A;  2WAF A;  2EWV A;  3GTC A;  1ZKJ A;  2ZC4 B;  5GHZ A;  5LBR A;  5FAT A;  3A3I A;  1YLP A;  3D9Y A;  1T1C A;  3E2K A;  4X56 A;  2XH9 A;  2RL3 A;  1ACF A;  5EOO A;  1PIO A;  1FIL A;  1XA1 A;  3C4P A;  5E43 A;  1KVL A;  1YAX A;  5FDH A;  4JGP A;  2WKE A;  5EVI B;  1PW8 A;  4BL3 A;  3N4I A;  4II7 A;  3BM6 A;  2Z2L B;  4S2I A;  3G32 A;  4BD1 A;  3RFB A;  1OJG A;  1H8M A;  5EVE A;  3VP4 A;  3LGO A;  2Y2Q A;  4HY8 A;  1K0K A;  3U2A A;  2WKH A;  2Y2O A;  2VV6 A;  3FPW A;  5CGW A;  2OAQ 1;  4RYE A;  2D02 A;  4JF4 A;  3CUE C;  3ULF A;  2W0N A;  2Y8H A;  3UPN A;  2P08 A;  4IBX A;  5FDS A;  3MQO A;  5FQQ A;  3WS2 A;  4MN7 A;  3CMZ A;  3T50 A;  1MPL A;  3W4O A;  1L3L A;  5GL9 A;  4X55 A;  1VHM A;  1XXM A;  1Q2P A;  2H28 A;  4P85 A;  4GHI A;  3NI9 A;  2JCH A;  4YFM A;  5A92 A;  4PKY A;  4KZ9 A;  2ZC6 B;  4LFU A;  3UPO A;  5AQA A;  3HBR A;  1P9W A;  3DTM A;  3IWI A;  4HBU A;  1E25 A;  3JYI A;  3LEQ A;  4LV1 A;  3L9K A;  1G5U A;  1UGU A;  4GS9 A;  3IHB A;  3UNW A;  5FQJ A;  5DFY A;  1KE4 A;  1ERM A;  2I9V A;  2ZQC A;  3DWK A;  4PM9 A;  5G4Y A;  1GSW A;  5EVI D;  4EET B;  4IUK A;  2XR0 A;  4WMC D;  4NET A;  3V39 A;  1PZO A;  3QP5 A;  3SH9 A;  2ZL1 B;  1XJ6 A;  3G30 A;  4C75 A;  3E0Y A;  3MBZ A;  4EES A;  2HJ9 C;  2K7S A;  3KYZ A;  3QHY A;  3LR4 A;  1XA7 A;  4DE3 A;  4X1M A;  4CLC B;  3O3V A;  5CXW A;  4R38 A;  5FQI A;  4IJG A;  4B88 A;  4N1H A;  1TS0 A;  3MQQ A;  1SCW A;  5FAS A;  4R0Q A;  2ZC7 A;  5JYP A;  1IYP A;  2XEP A;  2Y79 A;  4NXG A;  3Q07 A;  4X53 A;  2D01 A;  1CK3 A;  2BTF P;  1S4S A;  4KG6 A;  2PHY A;  2V1A A;  3D72 A;  1HLU P;  1YKD A;  4JXW A;  4MCW A;  3LR3 A;  1G6A A;  5AQ7 A;  5AJG A;  1YSP A;  3T1X A;  1MY8 A;  1S6R A;  1L0E A;  2V1Z A;  4QJG A;  3PBN A;  4FD8 A;  2GJ3 A;  3IF6 B;  3LIF A;  2H0T A;  3MQ0 A;  2VGJ A;  3NOT C;  3P98 A;  3FC7 A;  3QP4 A;  2VGL M;  3BFC A;  5IU1 A;  2Q9M A;  1DY6 A;  4R3J A;  3RH8 B;  5FI6 A;  5HFO A;  3IXD A;  3A0S A;  2V20 A;  1NLZ A;  2L1M A;  2XA7 S;  2FH5 A;  5HWW A;  2EWW A;  5HWT A;  2PBY A;  5EVL A;  4S2L A;  3EQV A;  3UB6 A;  1MWR A;  4WUJ A;  1S1Y A;  3N8S A;  2HDU A;  3KO6 A;  2PD8 A;  5GLB A;  2DMW A;  3GMW A;  2J3T D;  1CI8 A;  2JKT M;  3KSH A;  1BZA A;  1NJ4 A;  3WRT A;  3V3S A;  3HRE A;  5DTK A;  3LEZ A;  3O87 A;  2HDS A;  2Y59 A;  2C5W B;  3VP2 A;  4CLC D;  1KE0 A;  2Y4A A;  4UAA A;  1JWP A;  3MFX A;  1LSX A;  3G2Y A;  4BEN A;  3F1N A;  1SKO A;  1W8Y A;  5F6A A;  5EVI C;  2JN7 A;  4OOY A;  5HAI A;  3T4O A;  3O88 A;  4ETZ A;  4P6B A;  3GRJ A;  2PBD P;  2M7V A;  3R7W A;  4GZB A;  1NZO A;  5A90 A;  4KZ6 A;  4EEP A;  1QME A;  5L07 A;  4X68 A;  4OQ0 A;  3S7P A;  1F98 A;  4KG5 A;  4EUZ A;  4KQD A;  4HHD A;  4QB8 A;  1MKI A;  5CER A;  2HV1 A;  4GN2 A;  5FSR A;  2HZ5 A;  3M6H A;  2P9V A;  3HJK A;  4X6T A;  1T1A A;  2HP5 A;  2ZMA A;  1XP4 A;  3T4L A;  1E3U D;  4GB7 A;  2HP9 A;  4LCM A;  2EXA A;  4H6J A;  2E8I A;  1PI4 A;  4BBT A;  1ODV A;  4S2N A;  3HLF A;  2OWH A;  3D3O A;  4DF6 A;  5FA7 A;  4FTX A;  3DW0 A;  4OH0 A;  4X25 A;  3CZD A;  1XGJ A;  3B42 A;  4R6L A;  1P0Z A;  3TG9 A;  5HAP A;  2BAS A;  2OAP 1;  3ZNT A;  1HVB A;  3EOI A;  1OT9 A;  1DRM A;  4GNU A;  5FEF A;  4R3A A;  1TVF A;  4BBV A;  2GDN A;  4CJN A;  3VOL A;  1D06 A;  2BG1 A;  4E6X A;  5CHJ A;  2VX8 A;  3BLM A;  4P0M A;  3SH7 A;  3PAE A;  1KDW A;  4KZ5 A;  3NCK A;  4R23 A;  1BUL A;  1K57 C;  5HPI A;  3MZD A;  1VEU A;  2J3T C;  2O9A A;  3WS0 A;  3QNC A;  5HSQ A;  1LL5 A;  4JLF A;  3DTI A;  4B93 A;  2Y2M A;  1NY0 A;  2UV0 E;  3PHY A;  1JTD A;  3IT9 A;  3QP6 A;  4CLC C;  2Y2P A;  1SDE A;  4WN5 A;  2J3W A;  2WGW B;  2ZOI A;  5IS1 A;  3C5A A;  3HUO A;  1PWG A;  1F5M A;  4OLG A;  4N1X A;  1BLP A;  1KE3 A;  4Y0O A;  3IBJ A;  3L7H A;  2Z6C A;  1OJ5 A;  4KUK A;  5CX7 A;  2WAE A;  4KZ4 A;  3BQA A;  1FQG A;  4GOG A;  1PYY A;  1UWP X;  1TDG A;  2PU4 A;  3PBT A;  1LLB A;  4YOF A;  2QHK A;  4WM9 A;  4P6Z S;  3N8L A;  1J3W A;  2Q0O A;  3BQ8 A;  2DRW A;  3V5M A;  2QPN A;  1FCM A;  2PU2 A;  2H0Y A;  5IT5 A;  1H8Y A;  5DVA A;  3NBL A;  4KZB A;  3S1Y A;  2W3F A;  5M19 A;  1LHY A;  5DKL A;  3Q7V A;  3ITA A;  5F83 A;  3H7W A;  2ZQ7 A;  2NUT C;  4FH2 A;  3UDI A;  3G4P A;  4HP4 A;  4Q0I A;  1KVM A;  1N9O A;  3CPT A;  3GQZ A;  3AGD A;  1XJ4 A;  4N9K A;  3AGE A;  3CLO A;  1BT5 A;  4D60 A;  2PR6 A;  1S4R A;  3VFH A;  4R4R A;  4C6Y A;  5CRF A;  4M3K A;  2WZX A;  3GVB A;  2O99 A;  4F3L A;  1W8Q A;  1ES5 A;  1N4O A;  1V9Y A;  2Y2J A;  4PM7 A;  5G18 A;  1XKZ A;  2IWC A;  1SKF A;  5CGX A;  5CEB A;  5DF8 A;  4WZ5 A;  4KEN B;  1FR6 A;  2EFX A;  4O0P A;  2J8Y A;  1JWZ A;  4PHT A;  2WKI A;  4ZJ1 A;  2QZ6 A;  3GDI A;  3C2W A;  2KOI A;  4O8G A;  1BYW A;  3PYP A;  5L2F A;  5HDC A;  2P7J A;  3G34 A;  1GHM A;  3K3D A;  4PM5 A;  4DXC A;  1VET A;  5DTT A;  1TF1 A;  1YPR A;  3HLD A;  2OWJ A;  3A0R A;  4AFI A;  4MDZ A;  3B3X A;  2W3H A;  2KX6 A;  3PXP A;  2A2L A;  1PZP A;  4RA7 A;  2JKT I;  5DKK A;  5MC7 A;  2W3D A;  4YNR A;  3T4K A;  4IED A;  2XSS A;  4QHC A;  4G3W A;  2FFF B;  1W63 M;  3ZDJ A;  1O7E A;  5DFX A;  5EVI A;  3MS6 A;  1GA9 A;  2K31 A;  4CQH A;  1IFQ A;  2FFY A;  1O07 A;  3OCL A;  5L10 A;  4EQI A;  4Y13 A;  2G2U A;  3PBO A;  1P9R A;  4DDS A;  1BLH A;  1XJ3 A;  2XDM A;  1NYY A;  1K56 D;  3EGX C;  3FWL A;  1CEG A;  3HLG A;  5HL1 A;  3G6O A;  3W4Q A;  4E6W A;  1V9Z A;  3NJA A;  1LL8 A;  4BQM A;  1NLY A;  5DTS A;  5HWV A;  4EUV A;  4Q8I A;  3DWZ A;  4F94 A;  1ONG A;  1KGE A;  1EWZ A;  3BLS A;  1K55 C;  2OLU A;  4JPM A;  4HJ3 A;  4R3B A;  4E3O A;  2O9C A;  4EQ1 A;  3LIA A;  3IS2 A;  4MBF A;  3OBF A;  3NEC A;  4BL2 A;  3S7O A;  3IWO A;  4X1L A;  2CC1 A;  4LEN A;  4GDB A;  1MKM A;  5DJU A;  1TS7 A;  4BD0 A;  1EI5 A;  4E3M A;  4KQO A;  4NXF A;  1IEL A;  1JNU A;  3KYQ A;  3IF5 A;  4C3Q A;  2B5R A;  1NZU A;  3VFF A;  1GHI A;  3UB7 A;  4WZ4 A;  2I72 A;  1L0D A;  4GHI B;  3IXB A;  5D3O A;  2V0U A;  2KLI A;  3W4P A;  3LR0 A;  1IKI A;  4HEF A;  4LLO B;  3DAV A;  3JPU A;  3JVV A;  1DJB A;  1A0K A;  3PTE A;  3OOV A;  1OPX A;  5FQK A;  4Y5F A;  1ESU A;  2OOL A;  5F69 A;  4XT2 A;  2X71 A;  1H0M A;  3NDG A;  2QMI A;  1C3B A;  4L9F A;  2JKG A;  3BFG A;  5TBM A;  3MR0 A;  1K57 A;  3LY3 A;  3NOU C;  4XUZ A;  3E4O A;  1W7F A;  2XFT A;  1ZC2 A;  5HL6 A;  5CED A;  2VA0 A;  4BMW A;  3CWF A;  1MXO A;  5FAQ A;  1S0W A;  3BEB A;  2QWS A;  4GD8 A;  2QJ5 A;  2LB9 A;  1PNE A;  1IOU A;  3F1P B;  3PAG A;  2JKF A;  4JBF A;  4EV4 A;  3CI6 A;  2R78 A;  3LIB A;  4BWI A;  1AXB A;  5E2E A;  4ZDX A;  3GSG A;  1LSV A;  3CAX A;  3BFE A;  4DRT A;  4DN0 A;  3TSG A;  2OV5 A;  4PKY G;  2WGV A;  2PRF A;  3P01 A;  2RCX A;  4WBG A;  2Y2H A;  4MBH A;  3MJQ A;  3FV7 A;  2ZC3 B;  3Q1F A;  3SS3 A;  5CGS A;  3HJI A;  3KYE A;  2A49 A;  1P97 A;  5GLD A;  3OZH A;  4Y0U A;  2L0W A;  3Q81 A;  2PYP A;  1MWS A;  3IF6 A;  3RJU A;  4L9G A;  3M6B A;  1NWZ A;  1GHP A;  2JKR M;  3LO7 A;  2XK1 A;  2PYR A;  3VP3 A;  1S67 L;  3BY8 A;  3DTK A;  4WEJ A;  1E3U A;  4Q0H A;  1IYQ A;  4LRZ E;  1N9B A;  2W27 A;  2G2W A;  3OPL A;  3B33 A;  4G3K A;  5F1F A;  4K08 A;  3UME A;  4FH4 A;  3FZC A;  5EEC A;  5GHY A;  1NYM A;  2HJE A;  1BUE A;  1AWI A;  3MXS A;  3CJM A;  3A3F A;  4GKU A;  4B4Z A;  4OPZ A;  4FOF A;  1ES3 A;  2QYB A;  3G2Z A;  5KSC A;  2PT7 A;  2ZQ8 A;  4BLM A;  4S2O A;  4NG2 A;  4L9E A;  2EX8 A;  3RXW A;  4UHU A;  3ZG5 A;  4B4X A;  5KMW A;  1SKO B;  4WL9 A;  1DP6 A;  4K0W A;  4XXR A;  5FAO A;  1I5Q A;  1OTA A;  5IHV A;  5EE8 A;  5CHM A;  1TS6 A;  3UDF A;  1M6K A;  3FYZ A;  2ZQD A;  3CHW P;  1FSY A;  5AVF A;  3SW1 A;  2K2N A;  2Y2L A;  4JGO A;  3UDX A;  1CJF A;  1YMX A;  3LCE A;  1Z6F A;  3S4X A;  2GZA A;  2M7U A;  1K4F A;  3ZCZ A;  2VGL S;  1SHV A;  1PFL A;  2P74 A;  2XRN A;  1K38 A;  3H82 A;  4H6J B;  1L2S A;  4UA6 A;  5K5B A;  2ZOH A;  3ZG8 B; 
#chains in the Genus database with same CATH homology
 3HVF A;  5CTN A;  5GL9 A;  4DE1 A;  4X55 A;  4R4R A;  1XXM A;  1Q2P A;  3SS4 A;  4P85 A;  1ONH A;  4C6Y A;  5KSH A;  5CRF A;  2EFU A;  4M3K A;  4JKT A;  2WZX A;  3GVB A;  3FKW A;  3D4F A;  2ZJ9 A;  4S2P A;  3NI9 A;  3PBS A;  1W8Q A;  4WZ5 C;  2JCH A;  2UWX A;  1ES5 A;  2WK0 A;  4YFM A;  4Y7P A;  1N4O A;  2Y2J A;  5CTM A;  3IQA A;  5A92 A;  3O86 A;  4PM7 A;  5G18 A;  4KZ9 A;  1ES2 A;  1XKZ A;  3MZE A;  2IWC A;  1SKF A;  2ZC6 B;  5CGX A;  5CEB A;  1PWC A;  5DF8 A;  3UPO A;  1FCN A;  3LY4 A;  4WZ5 A;  4S2K A;  4KEN B;  5AQA A;  3HBR A;  5BOH A;  1FR6 A;  2EFX A;  5M1A A;  4KQQ A;  2J8Y A;  4RVA A;  1JWZ A;  1Y54 A;  3DTM A;  3IWI A;  4GDN A;  2WKI A;  4HBU A;  1KGF A;  4IVK A;  4ZJ1 A;  3UE3 A;  5JYO A;  2QZ6 A;  1E25 A;  3JYI A;  2X02 A;  4LV1 A;  4U0T A;  5FQM A;  2JC7 A;  2Z2M B;  3BFD A;  5L2F A;  1WYB A;  1RGZ A;  3IHB A;  5GHX A;  3UNW A;  5FQJ A;  1NXY A;  3G34 A;  4MEZ A;  1GHM A;  1YLW A;  1KE4 A;  4UA9 A;  3SH8 A;  4PM5 A;  2ZQA A;  4DXC A;  1J9M A;  2XF3 A;  1ERM A;  5CEC A;  1FOF A;  5DTT A;  2WGW A;  5KZH A;  3HLD A;  2ZQC A;  3DWK A;  4PM9 A;  4Y0T A;  3B3X A;  5EVI D;  2XR0 A;  2Y2G A;  5F82 A;  4WMC D;  1ESI A;  3OPH A;  4NET A;  2DCF A;  4U0X A;  1PZP A;  4RA7 A;  5EOE A;  3V39 A;  4N92 A;  1PZO A;  4GD6 A;  1HTZ A;  3SH9 A;  4C75 A;  1YQS A;  3G30 A;  5DF9 A;  1IYO A;  3MBZ A;  3A3D A;  4IED A;  4D2O A;  2Y91 A;  3QNB A;  4QHC A;  3BRM A;  4EBL A;  4MBK A;  3Q82 A;  3WS1 A;  2FFF B;  4PM8 A;  1KDS A;  3ZDJ A;  4OOL A;  1O7E A;  3QHY A;  5GLA A;  2XGN A;  1XA7 A;  5EVI A;  4DE3 A;  4DKI A;  5EUA A;  3ZG9 B;  1GA9 A;  3AGF A;  1QMF A;  4Z9Q A;  4ZJ3 A;  1K54 A;  3O3V A;  5CXW A;  3UO9 A;  3UN7 A;  2FFY A;  1O07 A;  1Q2Q A;  3OCL A;  4EQI A;  5J8X A;  5FQI A;  2G2U A;  3PBO A;  4B88 A;  4N1H A;  3PBQ A;  3M2J A;  1LI0 A;  4JXS A;  4DDS A;  3GV9 A;  1BLH A;  1SCW A;  4OPY A;  2XDM A;  5FAS A;  1NYY A;  3HLB A;  4R0Q A;  4UA7 A;  2ZC7 A;  5JYP A;  1K56 D;  2ZM2 A;  1BLC A;  4YIN A;  5F1G A;  3OPP A;  1IYP A;  2XEP A;  1BSG A;  2HDR A;  3FWL A;  1CEG A;  1LI9 A;  3WS5 A;  3HLG A;  3Q07 A;  4X53 A;  5HL1 A;  4WEK A;  3W4Q A;  4ZBE A;  4LCL A;  1CK3 A;  4E6W A;  2V2F F;  2EXB A;  4BQM A;  4KG6 A;  1VQQ A;  2P9V B;  3A3J A;  4PPR A;  4RX2 A;  4E3J A;  5DTS A;  4JXW A;  2WAD A;  4Q8I A;  4N9L A;  3DWZ A;  1G6A A;  4OQH A;  5AQ7 A;  1ONG A;  2IWD A;  3ZVW A;  4F94 A;  1ERQ A;  2OSU A;  1KGE A;  1EWZ A;  3BLS A;  3VOZ A;  1K55 C;  3ZG7 B;  3W8K A;  5HW3 A;  1MY8 A;  1S6R A;  3C4O A;  2OLU A;  1XX2 A;  2IWB A;  1K56 A;  4JPM A;  4R3B A;  5FQ9 A;  1L0E A;  3SS5 A;  4E3O A;  3Q7Z A;  2V1Z A;  3G31 A;  4FSF A;  4MBF A;  3PBR A;  5CHU A;  5AQB A;  4L0L A;  4QJG A;  1DJC A;  3PBN A;  4FD8 A;  3VOY A;  3HLC A;  3IF6 B;  5E2G A;  5TFQ A;  4BL2 A;  1K55 A;  2ZQ9 A;  3ZHH A;  2H0T A;  3IWO A;  1YLY A;  4OQI A;  2CC1 A;  1H8Z A;  2VGJ A;  4LEN A;  3P98 A;  4GDB A;  3UPP A;  5M18 A;  3BFC A;  1YT4 A;  4BD0 A;  3I7J A;  1EI5 A;  4E3M A;  4KQO A;  1BLS A;  2Q9M A;  1DY6 A;  4S2M A;  4R3J A;  1IEL A;  5FI6 A;  1IKG A;  2ZC5 B;  3IF5 A;  5HFO A;  4C3Q A;  3IXD A;  2V20 A;  2B5R A;  1NZU A;  1PWD A;  3VFF A;  1GHI A;  4WZ4 A;  2I72 A;  4OOM A;  4PMA A;  5FI7 A;  1L0D A;  3IXB A;  3N7W A;  5D3O A;  5U47 A;  3W4P A;  1YM1 A;  5A93 A;  3UE1 A;  3V50 A;  2PBY A;  3BFF A;  4OP8 A;  1IKI A;  5EVL A;  3WRZ A;  2BLS A;  4S2L A;  3EQV A;  4HEF A;  2XFS A;  1ES4 A;  1MWR A;  5TR7 A;  1DJB A;  3PTE A;  3N8S A;  2HDU A;  4WYY A;  5GLB A;  2EX6 A;  3GMW A;  1CI8 A;  1IYS A;  3C7U A;  3IXH A;  5FQK A;  1BZA A;  1L0F A;  1NJ4 A;  3WRT A;  1W5D A;  1ESU A;  2J7V A;  3TOI A;  3ZFZ A;  3V3S A;  4BJP A;  1RCJ A;  1DJA A;  3HRE A;  5DTK A;  1SDN A;  4OVD A;  3LEZ A;  3O87 A;  2XLN A;  2HDS A;  2X71 A;  1PI5 A;  2Y59 A;  3NDG A;  4ZTK A;  1BTL A;  2QMI A;  1C3B A;  1NRF A;  4JF6 A;  2C5W B;  3VP2 A;  3BFG A;  3MKF A;  1KE0 A;  2Y4A A;  3E2L A;  4UAA A;  1TDL A;  2WYX A;  1JWP A;  2HP6 A;  1K57 A;  3HLE A;  4KQR A;  3GR2 A;  4NK3 A;  3LY3 A;  1KGG A;  2XQZ A;  3G2Y A;  1WE4 A;  4BEN A;  1W8Y A;  1ZG6 A;  5EVI C;  1LL9 A;  4XUZ A;  3HL9 A;  1W7F A;  4OOY A;  5I94 A;  1K54 C;  5HAI A;  2XFT A;  4KG2 A;  4K0X A;  2VGK A;  3O88 A;  4OLD A;  2Q9N A;  4P6B A;  1ZC2 A;  3FKV A;  5HAR A;  2R9W A;  3RXX A;  5CED A;  3GRJ A;  5FI2 A;  2H10 A;  1MXO A;  1JVJ A;  1S0W A;  5FAQ A;  4OP5 A;  3BEB A;  3IXG A;  4GD8 A;  4GZB A;  1NZO A;  5A90 A;  4WMC A;  2HDQ A;  4DE0 A;  4KZ6 A;  3BEC A;  1QME A;  4JF5 A;  4EBN A;  3IWQ A;  3PAG A;  1YMS A;  3NC8 A;  4X68 A;  3WS4 A;  5HAQ A;  4JBF A;  4OQ0 A;  4ID4 A;  4QY5 A;  4EV4 A;  4KG5 A;  1FCO A;  3CG5 A;  1HD8 A;  4HES A;  1MWU A;  1AXB A;  4EUZ A;  5E2E A;  4ZDX A;  3GSG A;  4QB8 A;  1HZO A;  1MKI A;  5HX9 A;  2EX2 A;  3SOI A;  3BFE A;  4DRT A;  5CER A;  2C6W B;  4GN2 A;  4OON A;  5FSR A;  1W79 A;  3VP1 A;  3M6H A;  4OQG A;  3TSG A;  4MLL A;  1GA0 A;  2OV5 A;  2P9V A;  3N6I A;  4X6T A;  2WGV A;  1E4D A;  2WGI A;  3ZG0 A;  1K6S A;  2HP5 A;  2RCX A;  3NDE A;  2Y2H A;  2ZMA A;  2ZM8 A;  4QD4 A;  4S2N C;  2JBF A;  4WBG A;  4ZJ2 A;  1XP4 A;  2X01 A;  4IVI A;  4MBH A;  2XD1 A;  4DXB A;  1I2W A;  3C7V A;  3OC2 A;  3FV7 A;  2ZC3 B;  3MZF A;  1E3U D;  4QY6 A;  4GB7 A;  3IF6 C;  2HP9 A;  3Q1F A;  4HBT A;  4LCM A;  3HUN A;  2EXA A;  3SS3 A;  1CEF A;  5CGS A;  5FAP A;  1WYC A;  4IBR A;  2ZM0 A;  4KZ3 A;  5AQ9 A;  3Q7V B;  2E8I A;  2A49 A;  1PI4 A;  3EQU A;  5GLD A;  2DNS A;  3MFD A;  4S2N A;  3OZH A;  3HLF A;  4Y0U A;  2ZLY A;  3MXR A;  1XPB A;  3Q81 A;  3HUM A;  4DF6 A;  3IF6 A;  1MWS A;  3NIA A;  5E2H A;  5FA7 A;  3ISG A;  3RJU A;  4XUX A;  3DW0 A;  4OH0 A;  5E2F A;  3M6B A;  5GLC A;  4E3I A;  3CZD A;  1ERO A;  1XGJ A;  2Y2N A;  1GHP A;  3LO7 A;  2XK1 A;  3VP3 A;  4K91 A;  3TG9 A;  4WEJ A;  5HAP A;  4E3K A;  1E3U A;  4P87 A;  1IEM A;  1IYQ A;  1VM1 A;  4MNR A;  5DF7 A;  1HVB A;  3ZNT A;  2H5S A;  1N9B A;  1RP5 A;  4R1G A;  2Y2K A;  3ITB A;  3P09 A;  4GNU A;  4LV2 A;  3VP0 A;  2XD5 A;  1TVF A;  4U3T A;  4H8R A;  1K4E A;  2G2W A;  3HLW A;  1TEM A;  3ZGA B;  3OPL A;  1RGY A;  2GDN A;  3ZVT A;  4CJN A;  3S22 A;  3OPR A;  4EBP A;  4A5R A;  2BG1 A;  2R9X A;  4LV0 A;  5F1F A;  4E6X A;  4FH4 A;  4KZ7 A;  1OME A;  5CHJ A;  3FZC A;  1ZG4 A;  5EEC A;  5GHY A;  3BLM A;  1NYM A;  1BUE A;  4P0M A;  3SH7 A;  4EWF A;  3MXS A;  2Y2I A;  3PAE A;  1KDW A;  4KZ5 A;  3NCK A;  3CJM A;  1BUL A;  1K57 C;  3A3F A;  4JXG A;  4GKU A;  4OPQ A;  4R23 A;  4B4Z A;  3MZD A;  1U60 A;  4OPZ A;  1YLZ A;  1ES3 A;  4CPK A;  4E3L A;  1L0G A;  3VSL A;  3M2K A;  3VSK A;  4JXV A;  2WUQ A;  5TGF A;  3G2Z A;  3QNC A;  4X69 A;  5EPH A;  4QU3 A;  3WS0 A;  3WWX A;  1LL5 A;  2JE5 A;  4JLF A;  3IH8 A;  5KSC A;  2Y2M A;  2A3U A;  2ZQ8 A;  3MKE A;  1NY0 A;  1JTD A;  4BLM A;  3IT9 A;  4ZAM A;  3UY6 A;  4KZ8 A;  1GCE A;  1MWT A;  2Y2P A;  4S2O A;  1SDE A;  4DDY A;  1ALQ A;  4R4S A;  2WGW B;  4WEL A;  2Y55 A;  3VMA A;  1MBL A;  2WAF A;  3C5A A;  2EX9 A;  3GTC A;  2J9O A;  1ZKJ A;  2WZZ A;  2ZC4 B;  1PWG A;  3HUO A;  4FCF A;  5GHZ A;  3A3E A;  4E3N A;  4OLG A;  3G35 A;  5FAT A;  2HPB A;  4N1X A;  3A3I A;  2EX8 A;  1YLP A;  2J9P A;  2OLV A;  3RXW A;  1BLP A;  1KE3 A;  4UHU A;  3E2K A;  3ZG5 A;  4Y0O A;  4B4X A;  5KMW A;  4X56 A;  1CI9 A;  2XH9 A;  2RL3 A;  4OPR A;  5EOO A;  2WAE A;  4KZ4 A;  3V3R A;  1FQG A;  4GOG A;  1PIO A;  1PYY A;  1JTG A;  1TDG A;  2PU4 A;  3PBT A;  1I2S A;  1LLB A;  4K0W A;  1XA1 A;  4XXR A;  3C4P A;  5FAO A;  1I5Q A;  4WM9 A;  5E43 A;  1KVL A;  5FDH A;  1M40 A;  2WKE A;  5EVI B;  1PW8 A;  3N8L A;  5IHV A;  3ZNY A;  4BL3 A;  4O7D A;  3BYD A;  3N4I A;  5EE8 A;  3BM6 A;  2Z2L B;  4S2I A;  2DRW A;  4PM6 A;  3V5M A;  5CHM A;  2QPN A;  1FCM A;  3UDF A;  1M6K A;  2PU2 A;  3FYZ A;  3G32 A;  3UE0 A;  4BD1 A;  2H0Y A;  2ZQD A;  3VP4 A;  1H8Y A;  5DVA A;  5A91 A;  1FR1 A;  2Y2Q A;  3NBL A;  2ZD8 A;  4KZB A;  1FSY A;  1XGI A;  1YLT A;  3S1Y A;  1K25 A;  2WKH A;  1G68 A;  2Y2L A;  5M19 A;  3UDX A;  1H5X A;  3IHA A;  4OKP A;  1LHY A;  2Y2O A;  4KZA A;  3Q7V A;  1YLJ A;  1YMX A;  3LCE A;  3ITA A;  5F83 A;  1Z6F A;  4RX3 A;  3N8R A;  2ZQ7 A;  4FH2 A;  5CGW A;  3UDI A;  4DE2 A;  3G4P A;  1FSW A;  4RYE A;  3S4X A;  1PW1 A;  1KVM A;  4LV3 A;  4JF4 A;  1K4F A;  1JWV A;  3GQZ A;  3ZCZ A;  3OCN A;  3AGD A;  1SHV A;  3UPN A;  4N9K A;  3NY4 A;  3AGE A;  2P74 A;  4IBX A;  1K38 A;  3IH9 A;  5FQQ A;  1L2S A;  3WS2 A;  4UA6 A;  3CMZ A;  1K6R A;  4S2J A;  1BT5 A;  3ZG8 B;  1MPL A;  3W4O A;  3VFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...