3UY6A

Blar1 sensor domain from staphylococcus aureus with n439v mutation
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
252
structure length
252
Chain Sequence
QSITDYNYKKPLHNDYQILDKSKIFGSNSGSFVMYSMAADAYYIYNEKESRKRYSPNSTYKIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVVWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein BlaR1
publication title An amino acid position at crossroads of evolution of protein function: antibiotic sensor domain of BlaR1 protein from Staphylococcus aureus versus clasS D beta-lactamases
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Penicillin-binding protein
total genus 85
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3uy6A00
2A3UA 2DCFA 3G4PA 4R23A 4X56A 4WEJA 2R9XA 5HFOA 1E25A 4X55A 2EX9A 3HLDA 4JPMA 5EOEA 5A93A 4FSFA 4LV3A 4DE0A 2ZQ9A 3NCKA 4LCMA 5AQBA 1KDWA 4E6XA 1LHYA 5FA7A 5EOOA 3I7JA 2Y2OA 2Y2QA 1W5DA 1HVBA 4OOLA 5FSRA 3WS0A 1K56A 2ZD8A 2R9WA 1PI5A 1EWZA 1M6KA 3WS5A 4UA6A 2EFXA 3OPHA 1N9BA 2Q9NA 2EFUA 4HBUA 3GQZA 5CECA 3S22A 2Y2KA 3A3EA 3ZCZA 1RGYA 4QY6A 3HREA 2BLSA 1ES2A 1S6RA 3M2KA 4S2NA 1TVFA 1IYOA 3QHYA 5FI6A 4E3MA 2Y2LA 1MWSA 3IF6B 4EQIA 4PM6A 1CEFA 3IF6C 1J9MA 3OC2A 4K0XA 1BLHA 4S2KA 4X69A 2Q9MA 3IT9A 4KENB 4L0LA 1DY6A 1YLYA 2DNSA 2VGKA 2A49A 1W7FA 4E3IA 2IWCA 2WZXA 1MBLA 4OH0A 3UDFA 2E8IA 2Z2MB 1YLTA 4OP5A 4BLMA 5E2FA 2RL3A 3G34A 4S2LA 4ZJ2A 4KQOA 4O7DA 3BM6A 3V39A 1BZAA 4JF5A 3LCEA 3CG5A 4DKIA 3ITBA 4DXBA 4X53A 4N9KA 3ZNYA 1BTLA 1BLCA 5F1GA 4ZBEA 1M40A 2P9VB 2RCXA 2OSUA 4GKUA 4JXGA 3G2ZA 1WYCA 2JC7A 4R4RA 2Y2PA 1FSYA 3GSGA 3MKEA 3NC8A 4PM5A 1KE3A 3CJMA 2Y2MA 2Y55A 5AQ9A 4GDBA 3W4OA 4NK3A 4OLDA 4OPQA 1SDNA 3NDEA 3OPPA 1YMXA 1KGFA 1HTZA 1XGIA 4E3OA 3VOYA 3IXBA 5FI7A 2WZZA 1KE4A 3RJUA 2GDNA 1YLJA 2ZQDA 3C4PA 3OZHA 5EVIB 3VFHA 3VP3A 5EVIC 3DTMA 4EUZA 2XR0A 3FZCA 3UPNA 3Q7VB 4GZBA 4BL3A 3EQUA 5GHZA 3SOIA 2V1ZA 1I2WA 4EBLA 5TR7A 3BECA 4EWFA 5FDHA 4KZAA 3HLBA 4DE1A 2J9PA 1TEMA 3PAGA 4ZJ1A 3A3JA 1W79A 3UY6A 1EI5A 2WGVA 1GA9A 1PWGA 4MBKA 1JVJA 3DWZA 1BULA 1K38A 4KQQA 4KZ5A 2XFTA 1K57A 4BENA 1XGJA 4B88A 3S1YA 4DDYA 2HDRA 1K4EA 2UWXA 2X71A 1ONHA 1FQGA 5A92A 3VSLA 1L0DA 5EUAA 4Z9QA 1FSWA 5CGSA 1I2SA 2Y91A 1IELA 3BFEA 2Y2IA 4F94A 5EPHA 1PW8A 5EVID 1NY0A 2WK0A 4HEFA 5BOHA 3UPOA 5M1AA 5JYPA 2ZQ8A 3UDIA 4QJGA 5CHJA 1L0EA 3D4FA 1IEMA 1NZUA 4PMAA 1ERQA 4OPRA 3N8SA 1K6SA 2FFFB 5GL9A 2HP6A 5CEDA 3PBRA 1VM1A 2EXBA 4E3LA 3IH9A 3VP0A 4JBFA 2Y2GA 4JXSA 4A5RA 2ZQCA 4KZ8A 1ES3A 1ESUA 1JWVA 4PM8A 3VSKA 3ZG9B 3FV7A 4N1XA 4JKTA 5FQJA 1ESIA 3V5MA 4E6WA 5EE8A 4M3KA 4OOMA 5L2FA 5F82A 3UNWA 2ZMAA 4BD0A 1G6AA 4RYEA 3Q7ZA 4QHCA 3TG9A 4N1HA 2J9OA 1NYYA 1XA7A 3ZDJA 4DE2A 5IHVA 5TFQA 3AGDA 4FD8A 4PPRA 1KE0A 2XH9A 2HP9A 2ZC6B 4JXWA 2XD5A 3CZDA 4K91A 2EX8A 3IF6A 4KG2A 2PBYA 1E4DA 4OPZA 3UE0A 5GLBA 1DJCA 3MXRA 5TGFA 1CI9A 4Y0TA 3P98A 4MLLA 3GTCA 1DJBA 3BLMA 5HW3A 3JYIA 5CHMA 1WE4A 5CTNA 4CJNA 5FATA 2ZM2A 1QMEA 5CTMA 5AQ7A 4GB7A 3O87A 1YQSA 3M6HA 3M6BA 4R3BA 3G30A 3UO9A 1IYSA 1PZOA 2WAEA 1PW1A 2JE5A 4KZ3A 1AXBA 5EVLA 3E2LA 1NRFA 4UHUA 4WMCD 3DWKA 4R4SA 3O88A 1IYPA 2ZC4B 1JTDA 2P9VA 1O7EA 2ZC3B 5FQQA 3MZDA 3BFCA 3GV9A 4U3TA 4UA9A 4ID4A 4QY5A 3Q1FA 3VFFA 1FCMA 3AGFA 4UA7A 5GHYA 1RGZA 4K0WA 2WGIA 1K25A 3G31A 1PIOA 1XXMA 1VQQA 3GVBA 3N8RA 5DF8A 2VGJA 4IVKA 3PBSA 4MBFA 3S4XA 4OQ0A 4RVAA 2CC1A 3MZEA 2BG1A 1H8YA 5CHUA 4OLGA 5EVIA 5E2EA 5A90A 3PBQA 2XGNA 3TSGA 3FKWA 2PU2A 5DVAA 3SH9A 1H5XA 4DE3A 2FFYA 1YLZA 3IHAA 1KVLA 3ZVWA 5E2HA 3HUOA 1XPBA 3IWOA 5DTKA 1FCNA 1L0FA 1Y54A 4E3JA 4YFMA 3DW0A 1G68A 3HVFA 4RX2A 2J8YA 3WRTA 2ZM0A 2QPNA 3IH8A 4GN2A 3Q81A 4RA7A 4GOGA 5FQKA 3BRMA 3BFFA 4FH4A 4XUZA 2ZC5B 3ZG7B 1LLBA 4WZ5A 1OMEA 3QNCA 3O86A 2XK1A 3IF5A 4QU3A 3NBLA 1ES5A 3NI9A 3G32A 3ZG5A 3MXSA 3ZNTA 1CEGA 4IBRA 4MBHA 4DF6A 4ZAMA 4JXVA 4Y0UA 1XKZA 1LL9A 3ZFZA 5GLAA 2ZLYA 2Y59A 4WBGA 1JTGA 2XFSA 4C75A 3HLFA 1RP5A 3PAEA 4JF4A 5DF7A 2WUQA 4GNUA 4WEKA 1N4OA 1E3UD 4WZ5C 2JCHA 3GRJA 5DTTA 1KGEA 1IKGA 3CMZA 4QD4A 4WYYA 1K54C 3NIAA 4BJPA 1MPLA 1BLSA 2HDUA 4GD8A 4OQIA 4DXCA 3BEBA 2HPBA 5DF9A 4QB8A 4ZTKA 3SH7A 2XQZA 3ZG0A 4P87A 3VOZA 2Y4AA 4RX3A 3ZGAB 4XXRA 3PBOA 4WMCA 1H8ZA 1Q2QA 4JLFA 2Y2NA 1DJAA 3NY4A 3UE1A 5FAQA 4ZJ3A 1XX2A 1CI8A 1PWDA 3G2YA 4WELA 4S2OA 4X6TA 3WS2A 3IXGA 3SS4A 2WADA 4LENA 4UAAA 5FAPA 5FASA 4E3NA 2WKHA 3IWIA 2EXAA 1ES4A 5D3OA 3MKFA 3C7UA 2X02A 4GD6A 4N9LA 5GLCA 3P09A 3UN7A 1GCEA 1GHIA 3PTEA 5CEBA 4OQGA 5KZHA 1QMFA 5JYOA 1YT4A 3Q82A 3UDXA 4IBXA 3W8KA 5J8XA 3LY3A 4NETA 1MKIA 3G35A 1K6RA 3E2KA 4OONA 1HD8A 2EX2A 5KSHA 1PYYA 4KZ4A 5EECA 1PI4A 2OLVA 2WGWB 3RXWA 4OVDA 3W4QA 3W4PA 1ONGA 2XDMA 4PM9A 5HX9A 3IXDA 2ZJ9A 3GR2A 2C6WB 2PU4A 1KGGA 4KG6A 2WKEA 2XD1A 2OLUA 1NZOA 3HLEA 2B5RA 1MWRA 3LY4A 5HAPA 3GMWA 3IWQA 1SKFA 1TDLA 1C3BA 2C5WB 1YLPA 4LV2A 2ZC7A 4S2IA 4BD1A 1ZKJA 4B4XA 1LI9A 2HP5A 3LO7A 4H8RA 4KG5A 1LI0A 2H5SA 1NYMA 1YMSA 3HL9A 2WAFA 4LV0A 1ZC2A 5E43A 4EV4A 4OQHA 3PBNA 1XA1A 1W8YA 1IKIA 4LV1A 3HUMA 4IVIA 5FI2A 3RXXA 4S2PA 5KSCA 3TOIA 4MEZA 2V20A 3BFDA 5HAIA 1ZG4A 4BQMA 4OP8A 3C4OA 4XUXA 1E3UA 4WZ4A 2V2FF 4X68A 1FCOA 1K4FA 4S2MA 3VMAA 1K55A 1BUEA 3WWXA 3MFDA 1GA0A 3IXHA 5G18A 5FQMA 5KMWA 3NDGA 2WKIA 2G2WA 1BLPA 4R3JA 4R0QA 1O07A 2Y2JA 3OPRA 3Q7VA 2EX6A 3PBTA 4LCLA 5U47A 1SCWA 3OPLA 3SS3A 3WS4A 1Z6FA 2ZM8A 1GHMA 1MY8A 3BYDA 3M2JA 3WRZA 3FYZA 3IHBA 2G2UA 5E2GA 2ZQAA 4S2NC 4HBTA 3N7WA 1SHVA 1ERMA 1JWZA 3N6IA 3HLWA 2Y2HA 1YM1A 5HAQA 5M19A 3HLGA 1K55C 4S2JA 2QZ6A 1L2SA 1PZPA 3VP1A 4U0XA 5GLDA 4KZBA 4DDSA 1HZOA 1NXYA 2X01A 5F83A 3FWLA 2Z2LB 4P85A 1K54A 4HESA 1YLWA 2I72A 5FQIA 4KZ9A 2H0YA 4P0MA 4U0TA 2DRWA 4YINA 3QNBA 1K56D 2WYXA 4R1GA 2OV5A 4C3QA 3LEZA 3SS5A 4C6YA 3AGEA 1ZG6A 4PM7A 5CXWA 5FAOA 1L0GA 4FCFA 4B4ZA 4GDNA 1BSGA 1FOFA 4IEDA 1KDSA 3ZHHA 3V50A 3OCNA 1FR6A 2JBFA 3C5AA 1FR1A 5M18A 2XLNA 5F1FA 3VP4A 5CRFA 5HARA 3FKVA 4MNRA 4KZ7A 3A3DA 2J7VA 3N8LA 1NJ4A 4D2OA 3HBRA 4P6BA 3ZVTA 4E3KA 4Q8IA 1MWTA 1SDEA 4KQRA 3B3XA 4Y0OA 4OPYA 4WM9A 1JWPA 3V3SA 2IWDA 1PWCA 1GHPA 1TDGA 2HDQA 3C7VA 3O3VA 5DTSA 3IQAA 1S0WA 2XEPA 3UPPA 1Q2PA 1EROA 4JF6A 1CK3A 2H0TA 5FQ9A 4N92A 5CERA 3MBZA 1BT5A 1I5QA 2WGWA 5CGXA 1U60A 2XF3A 2ZQ7A 2QMIA 2P74A 5GHXA 4ZDXA 2HDSA 1ALQA 4EBNA 5HL1A 3A3FA 1KVMA 3HUNA 3VP2A 3A3IA 4DRTA 4OOYA 4CPKA 1RCJA 3ITAA 3BFGA 3WS1A 3HLCA 4FH2A 5AQAA 2H10A 5CGWA 1K57C 4Y7PA 5A91A 3MZFA 4BL2A 1WYBA 1IYQA 4KZ6A 3V3RA 1XP4A 3N4IA 1MXOA 3BLSA 1MWUA 3Q07A 5I94A 3EQVA 4OKPA 3OCLA 1LL5A 3ISGA 3UE3A 3SH8A 4EBPA 2IWBA 1W8QA 3ZG8B
chains in the Genus database with same CATH superfamily
2V9AA 4R23A 3LR4A 5HFOA 2R9XA 3MQ0A 3KO6A 4DE0A 5AQBA 1LHYA 5G4ZA 2W1TB 3I7JA 2Y2OA 1W5DA 4HH3A 2ZD8A 4F3LB 3UB9A 2Q9NA 2EFUA 4HBUA 4EEPA 5CECA 2Y2KA 1RGYA 2V0UA 4QY6A 5AJGA 1S6RA 4S2NA 1TVFA 3S7NA 3OLOA 2GNXA 4EQIA 1CEFA 3IF6C 3LYXA 3UPNA 4BD0A 1YLYA 2DNSA 2VGKA 2A49A 2IWCA 1H3QA 5L8MA 1MBLA 5DKLA 4IHQA 2E8IA 4YNRA 4ETZA 1YLTA 3S7PA 2E8JA 4FTXA 4O0PA 4KQOA 1BZAA 4N9KA 3ZNYA 1BLCA 5F1GA 1M40A 2P9VB 2RCXA 3G2ZA 2W3FA 2JC7A 2BASA 2Y2PA 5L07A 1XJ6A 3T4JA 3PHYA 4PM5A 5AQ9A 4OPQA 1HTZA 3VOYA 4NXFA 5FI7A 3RJUA 3MQQA 1YLJA 3C4PA 1OJGA 4M4XA 5EVIB 4PAUA 1OTDA 3HLBA 3QP1A 4DE1A 2J9PA 3A3JA 1W79A 1JVJA 4KQQA 4BENA 3T12B 4B88A 3BQAA 1ONHA 5TBMA 5A92A 2QKPA 4BBTA 3UMEA 1FSWA 3UB8A 1IELA 4F94A 1TF1A 3UPOA 5BOHA 5M1AA 5JYPA 2ZQ8A 1L0EA 2M7UA 4PMAA 4UEYA 3QP5A 3N8SA 4OPRA 4GS9B 3EGDC 2VV7A 4MN6A 3H82B 5J4EA 4JXSA 5G4YA 3UB5P 3KSGA 2ZQCA 2AVXA 4M3KA 4OOMA 1D7EA 5F82A 4QHCA 3TG9A 4XT2B 4MMNA 4B9OA 3LEQA 2HP9A 3PR6A 3CZDA 4KG2A 3UE0A 1OT9A 5TGFA 5HPFA 2K7SA 3JYIA 4HH2A 5CHMA 5FATA 2ZM2A 5AQ7A 5CTMA 4GB7A 3O87A 1YQSA 3UO9A 1IYSA 1PZOA 1PW1A 3P7NA 3F1NB 1NRFA 4UHUA 2ZC4B 3MZDA 3GV9A 4QY5A 1FCMA 3AGFA 4I39A 4Z1WA 4CLCB 2HJEA 4MBFA 3LIAA 2CC1A 4OLGA 1TD5A 5A90A 5DVAA 1H5XA 2VA0A 5HD5A 2QJ5A 1W8QA 2W3EA 1XJ4A 4L9GA 5HPIA 5FDSA 2J8YA 3Q81A 3BRMA 3ZG7B 5FEFA 2VGLS 4WZ5A 2FZ0A 4GW9A 2O9AA 1OJ5A 1CEGA 3CPTB 2HV1A 1XKZA 1LL9A 2VJWA 2VK3A 3IBJA 1JTGA 1LL8A 2XFSA 2WKRA 1YAXA 3GRJA 1KGEA 2PRFA 4G3KA 4QD4A 4HJ3A 3GDIA 4GD8A 2LB9A 2VV8A 2XQZA 3UB6A 3T4OA 3UE1A 1XX2A 2QWSA 4Y5FA 2WADA 4UAAA 2A24A 4E3NA 2WKHA 2R78A 2QHKA 3UN7A 1GCEA 3LI8A 5CEBA 4OQGA 2QYBA 1L3LA 1MKMA 3W8KA 3G35A 4OONA 4KZ4A 1PI4A 3LGOA 3LR0A 2XD1A 3LY4A 3F1PA 3MS6A 1ZKJA 5K5BA 1S1ZA 3ULFA 1LI0A 2PYPA 5L10A 3HL9A 3CUEC 4OQHA 3CAXA 1XA1A 4O8GA 5FI2A 3TOIA 4MEZA 3BFDA 4H6JB 3R7WB 1DP8A 4WZ4A 2V2FF 4X68A 4S2MA 1K55A 3WWXA 1T19A 4R0QA 2Y2JA 2EX6A 1CJFA 1Z09A 4X1LA 5U47A 3WS4A 3UB7A 1GHMA 5DFXA 3MQOA 2ZQAA 4S2NC 4HBTA 3N7WA 2KDKA 3N6IA 2QZ6A 1ZHHB 5GLDA 1EW0A 5F83A 4HESA 2I72A 4KZ9A 5EM0A 2DRWA 4YINA 2OV5A 4C3QA 3SS5A 1ZG6A 4PM7A 4B4ZA 4FCFA 4HY8A 3E0YA 4GDNA 2FH5A 4UQIS 2P7JA 5HSQA 5F1FA 5F68A 4KZ7A 1NJ4A 3ZVTA 1GSVA 4KQRA 4Y0OA 1PRQA 1KOUA 1PWCA 2EA9A 3UPPA 2W1RA 2KLIA 4HI4A 4D60A 3LI9A 5HDSA 2H0TA 4GHIB 2B02A 5CERA 1BT5A 2WGWA 5CGXA 2PR6A 4EBNA 5HL1A 5EV0A 3VP2A 4OOYA 1RCJA 5A91A 4B93A 3DTEA 4KZ6A 3A0SA 2D02A 1Y28A 1MXOA 3N4IA 5I94A 5I5LA 3UE3A 3FPVA 2JKTM 3G4PA 4II7A 4X56A 4WEJA 3MF0A 1E25A 2EX9A 4EETB 3ZQ5A 5A93A 4LV3A 2IA2A 2CMNA 4LCMA 2ZL1B 5FA7A 5EOOA 1CQAA 2A24B 3UE6A 2R9WA 1PI5A 1M6KA 2EFXA 3OPHA 3EOIA 1N9BA 1UWPX 3GQZA 3S22A 3ZCZA 3A3EA 3EEAA 1SKOB 3GECA 1P9RA 3QHYA 3FPWA 3IF6B 4NEED 4PM6A 4S2KA 1DY6A 1W7FA 4I3IA 3L7HA 4OP5A 2RL3A 3V39A 3BQ8A 3LCEA 2HJ9C 3CG5A 4G3VA 4DKIA 1BTLA 4ZBEA 4GKUA 1WYCA 2ZOHA 5F69A 1SZVA 1F2KA 1SDNA 2JN7A 3FG8A 1XGIA 3DTKA 4HP4A 3U4LP 4BMWA 2GDNA 1VEUB 3VFHA 3CITA 4GZBA 4MDZA 5GHZA 2V1ZA 3BECA 4P6ZM 3PAGA 5IS1A 4NG2A 4KQDA 4KZ5A 4Y2FA 1K57A 2HDRA 1K4EA 2UWXA 2X71A 3VSLA 4Z9QA 3BFEA 5EVID 2WK0A 3D4FA 1XJ3A 1NZUA 3FC7A 1K6SA 5GL9A 1TS8A 2G7UA 2DMWA 4A5RA 1S66L 1ESUA 1JWVA 4YWZA 3VSKA 4N1XA 4WUJA 4ARZA 1ESIA 5HWVA 3UNWA 2ZMAA 4N1HA 2J9OA 1XA7A 5IHVA 4PPRA 2B18A 3TW8A 2XD5A 2VEAA 4K91A 4Y15A 3LR5A 4Y0TA 4WLAA 1QMEA 2W0NA 4LRXC 4MCWA 4KZ3A 5EVLA 3E2LA 3O88A 1J3WA 3NOPC 3VFFA 3BFCA 3PYPA 3Q1FA 3SW1A 2QJ7A 2WGIA 1K25A 1XXMA 2O9CA 3N8RA 5DFYA 2V8FA 2JKGA 3S4XA 2MJ6A 4OQ0A 4RVAA 3ZYTA 2BG1A 1WA9A 1GSXA 2GX5A 3MR0A 5E2EA 3PBQA 2PU2A 4DE3A 3H7WB 3TE8A 2OOLA 3LIDA 1XPBA 3IWOA 5DTKA 1FCNA 4EUVA 4DJ2A 4CLCD 3IH8A 2ZC5B 1LLBA 1OMEA 1W63M 1OTAA 4QU3A 3NBLA 2NUPC 3K3DA 1P0ZA 2VX8A 3KX0X 3MXSA 3ZNTA 4HNBA 2ZOIA 4DF6A 5HDDA 4Y0UA 1VETA 2JKRM 1MZUA 4GLQA 5DF7A 4GNUA 1E3UD 3TRCA 1MPLA 4OQIA 2HPBA 5DF9A 5F6AA 2V1AA 3ZG0A 2GJ3A 1Q2QA 4JLFA 1DJAA 1CI8A 1PWDA 3SS4A 4LENA 2XROA 2W3DA 3C38A 3NECA 4I3JA 2EXAA 1ES4A 1NRJA 5HDCA 3C2WA 3PTEA 1STZA 5KZHA 1QMFA 1YT4A 3Q82A 5TJJA 1K6RA 4ZRRA 3E2KA 5KSHA 1PYYA 3W4PA 4PM9A 3IXDA 2ZJ9A 2PU4A 2WKEA 1NZOA 3HLEA 5HAPA 1SKFA 4BD1A 1S67L 1CF0A 3IX3A 2HP5A 3LO7A 2WAFA 1ZC2A 4LV1A 4IVIA 1S1YA 5KSCA 4XUXA 3LUQA 3MSHA 3KSHA 1GA0A 3IXHA 3BY9A 5HZHA 1O07A 4LCLA 3SS3A 4LRZE 1DP9A 1MY8A 1P9WA 3M2JA 3W2ZA 3VE3A 3E4OA 1N9NA 1SHVA 2Y2HA 1YM1A 5HAQA 1X0OA 4P85A 1F9IA 4R6LA 3KYEA 2L0WA 4P0MA 2K31A 4LPZA 1K56D 3DBAA 3AGEA 5CXWA 1L0GA 3A0VA 3QP2A 1FR6A 3C5AA 4MN7A 2XLNA 4MNRA 3HCYA 3A3DA 3B42A 4WN5A 4P6BA 1MWTA 4OPYA 5HWTA 4WM9A 3HJKA 5EFWA 2IWDA 2HDQA 3O3VA 5DTSA 1OPXA 1S0WA 2XEPA 3E4PA 1N9LA 2ACGA 1CK3A 5DJTA 4HJ4A 3EWKA 4IJGA 1I5QA 2XF3A 1T1CA 2QMIA 3IBRA 5EM1A 2HDSA 3K3CA 1DP6A 3A3IA 2KX6A 2H10A 5CGWA 1K57C 3VV4A 2UV0E 2J3TD 4Q0IA 1G5UA 1WYBA 3T1RA 5TBMB 4I38A 3Q07A 3OCLA 1LL5A 4EBPA 3SH8A 4Y13A 3C30A 5EOEA 4HP9A 4FSFA 3NCKA 2JKFA 4KUKA 4E6XA 2Y2QA 4OOLA 3C8CA 2V8CA 4O01A 4UA6A 4DN0A 2XA7S 2OWJA 3HREA 3M2KA 1XJ2A 3OBFA 4E3MA 2Y2LA 1MWSA 2PBDP 3OC2A 4NXEA 2L4RA 4X69A 3IT9A 1JNUA 4HIAA 3UDFA 1T1AA 4I3AA 5E2FA 3E98A 4GJ4A 4NKPA 3F1OA 4O7DA 4JF5A 2EWWA 3ITBA 2VGLM 3LFVA 3T4QA 2OSUA 1ACFA 4LFUA 4PKYA 1T18A 3NC8A 1K0KA 2Y2MA 4JGRA 1G28A 2Y55A 4GDBA 3W4OA 4NK3A 3NDEA 4IUHA 4E3OA 3P01A 5FEGA 1KE4A 1GSWA 1TS6A 3DTMA 4EUZA 3FZCA 3EQUA 4EBLA 5FDHA 4KZAA 1TEMA 4ZJ1A 1UWNX 2Z6CA 2WGVA 3LIFA 1PWGA 2M1CA 4MBKA 3DWZA 1K38A 2XFTA 3T4TA 5F5YA 1BYWA 1FQGA 3CHWP 1L0DA 3HJIA 1FIKA 2Y91A 2Y2IA 4HEFA 3UDIA 4QJGA 5CHJA 1IEMA 2FFFB 2HP6A 3PBRA 1VM1A 2EXBA 5IT5A 2W1TA 5L09A 4KZ8A 4PM8A 3ZG9B 4QPRA 4F3LA 3V5MA 4E6WA 5L2FA 1P97A 5IU1A 4RYEA 1NYYA 4X25A 4DE2A 3KSIA 3AGDA 4EXOA 3H9WA 4JXWA 2EX8A 4JGPA 4DMZA 1E4DA 4OPZA 3P98A 4MLLA 3GTCA 2Q0OA 1DJBA 1WE4A 5CTNA 4CJNA 4R3BA 2WAEA 3T50A 2O0YA 4WMCD 1LSWA 3DWKA 1IYPA 2P9VA 5FQQA 2PDRA 3IS2A 5DJUA 4ID4A 2PAVP 5AVFA 3G31A 1VQQA 3F1PB 2VGJA 4IVKA 3PBSA 2JKTI 1H8YA 3MXQA 4BBUA 1IOUA 5EVIA 3JVVA 3TSGA 3FKWA 3SH9A 2FFYA 3U2AA 3IHAA 1KVLA 3HUOA 2OWHA 4UQIM 3PXPA 3RTYA 4EU0A 1L0FA 1Y54A 4E3JA 3DW0A 1G68A 4RX2A 2QPNA 4GN2A 5FQKA 4GOGA 4XUZA 3BFFA 2WKQA 3O86A 5DKKA 2XK1A 3NOUC 3IF5A 3G6OA 3NI9A 3D3OA 4MBHA 4R70A 2ZBBA 3EEHA 4JXVA 3ZFZA 4WBGA 2VLGA 4GS9A 4C75A 3TJZC 1RP5A 3PAEA 4JF4A 2WUQA 4WZ5C 3H82A 3MMHA 2YKHA 1IKGA 4WYYA 4G3WA 4BJPA 2HDUA 3BEBA 2VKSA 4QB8A 4P87A 3VOZA 4XXRA 3PBOA 3VOLA 1VHMA 4XT2A 2Y2NA 3QP6A 5FAQA 4ZJ3A 3G2YA 4WELA 4S2OA 3IXGA 5FAPA 5FASA 5J3WA 3IWIA 3O5YA 4BBVA 3CI6A 2X02A 4GD6A 4N9LA 1H0MA 2O9BA 4HOIA 5JYOA 3UDXA 4IBXA 3F1NA 5J8XA 1OTIA 1MKIA 2EX2A 2VZWA 2WGWB 2GZAA 3W4QA 1ONGA 2C6WB 1KGGA 4KG6A 2B5RA 3T1SA 4CLCA 1OTBA 1C3BA 2ZC7A 4S2IA 1OT6A 4B4XA 4KG5A 3IX8A 3LR3A 1HLUP 2H5SA 2A2LA 4WF0A 4LV0A 5MC7A 4IUKA 5E43A 1V9ZA 3PBNA 1F98A 3T1QB 3HUMA 3RXXA 4PKYG 4BQMA 4OP8A 3A0RA 3C4OA 2P08A 2LB5A 1E3UA 1K4FA 5J7EA 1UGUA 1BUEA 5G18A 3NDGA 2G2WA 4R3JA 1NLZA 3OPRA 3Q7VA 3E4QA 5HD3A 1SCWA 3OPLA 1Z6FA 4RQ9A 4NXBA 2ZM8A 4EERA 2WKPA 3BYDA 3CPTA 3WRZA 3IX4A 3HLWA 1K55C 1HZOA 1NXYA 3IS2B 3NOTC 2X01A 3FWLA 2Z2LB 1K54A 2H0YA 4U0TA 3JVUA 1TS0A 4R1GA 1ZTUA 2B95A 1NLYA 3LEZA 2ZMVA 1BSGA 1FOFA 1KDSA 2I9VA 2V0WA 2JBFA 3MJQA 2PD7A 5CRFA 2J7VA 4MN5A 4E3KA 4Q8IA 1SDEA 2V1BA 3V3SA 3C7VA 4ME4A 3B47A 3IQAA 1Q2PA 1MC0A 4JF6A 2W27A 5FQ9A 3L9KA 1YSQA 1U60A 2ZQ7A 2P74A 4WL9A 3A3FA 3OOVA 4DRTA 4LLOB 3ITAA 2NUTC 3QP4A 5AQAA 1S4RA 2HGVA 2JKRI 3V3RA 4X1MA 1XP4A 1YPRA 3BLSA 3EQVA 2Y8HA 3ISGA 5FL3A 3EGXC 2M7VA 3RFBA 1TS7A 2A3UA 2DCFA 4HHDA 4X55A 3HLDA 4H6JA 4JPMA 4E04A 3R7WA 2ZQ9A 3JPUA 1KDWA 4FOFA 1XFQA 4K08A 3T4SA 1W63Q 1HVBA 5FSRA 3WS0A 1K56A 3K2NA 3WS5A 1EWZA 4ARZB 3BW6A 4HQAA 2BLSA 1ES2A 4CQHA 1IYOA 5FI6A 2EWVA 5HL6A 5C5KA 1J9MA 1XFNA 4K0XA 1BLHA 2Q9MA 4L0LA 4KENB 1OTEA 4E3IA 2ZMFA 2WZXA 4OH0A 4BLMA 3G34A 4S2LA 4ZJ2A 2BTFP 3BM6A 4PHTA 1N9OA 4DXBA 4X53A 2J80A 4L9EA 4JXGA 3KSFA 4R4RA 1FSYA 3GSGA 3MKEA 4Y17A 4I5SA 1KE3A 3CJMA 4OLDA 3OPPA 1YMXA 1KGFA 3IXBA 2PHYA 2WZZA 1Y4OA 2P04A 2L1MA 2ZQDA 3OZHA 3VP3A 1D06A 5EVIC 2XR0A 4BL3A 3Q7VB 1LT0A 4GHIA 3SOIA 4JGQA 1I2WA 5TR7A 4EWFA 3LIBA 2HZ5A 3UY6A 1EI5A 1GA9A 3RH8B 1BULA 1XGJA 4DDYA 3S1YA 3QP8A 5EUAA 5CGSA 1I2SA 4EW7A 2Y79A 5EPHA 1PW8A 2H28A 1NY0A 2D01A 3R4KA 1VETB 3KYQA 1ERQA 2OAP1 4DJ3A 5CEDA 2ZL1A 2K2NA 4Y3IA 4E3LA 3IH9A 4NXGA 4JBFA 3VP0A 2Y2GA 1YSPA 2PT7A 1ES3A 2INWA 4JGOA 1YKDA 3FV7A 4JKTA 5FQJA 3DAVA 5EE8A 3T1XA 4ESPA 1G6AA 3BY8A 3Q7ZA 1SKOA 3ZDJA 5TFQA 4FD8A 4LRYC 1KE0A 2XH9A 2ZC6B 1PFLA 3IF6A 2PBYA 5GLBA 1DJCA 3MXRA 1CI9A 4HJ6A 4ETXA 4AFIA 5HW3A 3BLMA 3T4KA 4L9FA 3M6HA 3M6BA 3G30A 2JE5A 1AXBA 1FILA 4R4SA 2J3WA 1JTDA 4EESA 1O7EA 2ZC3B 4U3TA 4UA9A 4UA7A 5GHYA 1RGZA 4K0WA 1PIOA 3GVBA 4CLCC 5DF8A 1A0KA 3MZEA 1LSVA 3DTIA 5CHUA 1VEUA 2XGNA 1YLZA 2Z6DA 5E2HA 3S7QA 3ZVWA 2OAQ1 1DRMA 3ICYA 4YFMA 3HVFA 3VE4A 3WRTA 1PNEA 2ZM0A 4RA7A 4FH4A 1NWZA 3QNCA 5A8BA 3D72A 1ES5A 1H8MA 2PD8A 3G32A 3ZG5A 4IBRA 3MFXA 4ZAMA 3V67A 1IFQA 5GLAA 2ZLYA 2Y59A 5EVEA 3UMDA 3HLFA 3CWFA 4LGWA 4WEKA 1N4OA 2JCHA 5DTTA 3CMZA 1K54C 3NIAA 1BLSA 4DXCA 4P6ZS 2HF6A 4ZTKA 3SH7A 2Y4AA 4RX3A 3ZGAB 4WMCA 1H8ZA 2O99A 3NHQA 3NY4A 1V9YA 4X6TA 3WS2A 1ODVA 5D3OA 3MKFA 3S7OA 3C7UA 5GLCA 3P09A 4GCZA 1GHIA 4KUOA 2XRNA 3LY3A 4NETA 1HD8A 3B33A 5EECA 2OLVA 3RXWA 4OVDA 2XDMA 5HX9A 3GR2A 2XA7M 2OLUA 3NULA 1T1BA 1MWRA 3GMWA 3IWQA 3KYZA 1TDLA 2C5WB 1YLPA 4LV2A 4R3AA 1LI9A 4H8RA 1NYMA 1YMSA 2W3GA 3NJAA 4EV4A 1S4SA 4BWIA 3D9YA 1W8YA 1IKIA 4S2PA 3H7WA 3BWLA 2V20A 5HAIA 1ZG4A 3VMAA 1FCOA 3T4LA 3MFDA 5KMWA 5FQMA 2WKIA 1BLPA 4FUWA 3PBTA 2PR5A 2VV6A 2PYRA 4CLCE 3FYZA 3IHBA 2G2UA 5LBRA 5E2GA 1ERMA 1JWZA 2XSSA 4R38A 5M19A 3HLGA 4S2JA 1L2SA 1PZPA 3LIEA 3VP1A 4U0XA 4KZBA 4DDSA 5KIZA 5FQIA 1YLWA 4EEUA 1AWIA 3BJNA 3QNBA 4C6YA 2WYXA 3F1OB 5FAOA 5CX7A 4IEDA 3ZHHA 3V50A 3OCNA 1FR1A 4Q0HA 5M18A 3VP4A 5HARA 3FKVA 3N8LA 4D2OA 3HBRA 1LSXA 2W3HA 3B3XA 4YOFA 2J3TC 1JWPA 1GHPA 1TDGA 3LICA 2KOIA 2YKFA 5HWWA 1EROA 4N92A 3MBZA 1F5MA 5AVEA 5GHXA 4ZDXA 4QWOA 1ALQA 1KVMA 3HUNA 4EQ1A 4Q0JA 4CPKA 2JHEA 3BFGA 3WS1A 3HLCA 4FH2A 1VB6A 4Y7PA 3MZFA 4BL2A 1IYQA 3SZTA 3CLOA 1G6OA 1MWUA 4OKPA 3CUEA 1D1JA 2IWBA 2Z2MB 3ZG8B
chains in the Genus database with same CATH topology
2A3UA 2DCFA 3G4PA 4R23A 4X56A 4WEJA 2R9XA 5HFOA 1E25A 4X55A 2EX9A 3HLDA 4JPMA 5EOEA 5A93A 4FSFA 4LV3A 4DE0A 2ZQ9A 3NCKA 4LCMA 5AQBA 1KDWA 4E6XA 1LHYA 5FA7A 5EOOA 3I7JA 2Y2OA 2Y2QA 1W5DA 1HVBA 4OOLA 5FSRA 3WS0A 1K56A 2ZD8A 2R9WA 1PI5A 1EWZA 1M6KA 3WS5A 4UA6A 2EFXA 3OPHA 1N9BA 2Q9NA 2EFUA 4HBUA 3GQZA 5CECA 3S22A 2Y2KA 3A3EA 3ZCZA 1RGYA 4QY6A 3HREA 2BLSA 1ES2A 1S6RA 3M2KA 4S2NA 1TVFA 1IYOA 3QHYA 5FI6A 4E3MA 2Y2LA 1MWSA 3IF6B 4EQIA 4PM6A 1CEFA 3IF6C 1J9MA 3OC2A 4K0XA 1BLHA 4S2KA 4X69A 2Q9MA 3IT9A 4KENB 4L0LA 1DY6A 1YLYA 2DNSA 2VGKA 2A49A 1W7FA 4E3IA 2IWCA 2WZXA 1MBLA 4OH0A 3UDFA 2E8IA 2Z2MB 1YLTA 4OP5A 4BLMA 5E2FA 2RL3A 3G34A 4S2LA 4ZJ2A 4KQOA 4O7DA 3BM6A 3V39A 1BZAA 4JF5A 3LCEA 3CG5A 4DKIA 3ITBA 4DXBA 4X53A 4N9KA 3ZNYA 1BTLA 1BLCA 5F1GA 4ZBEA 1M40A 2P9VB 2RCXA 2OSUA 4GKUA 4JXGA 3G2ZA 1WYCA 2JC7A 4R4RA 2Y2PA 1FSYA 3GSGA 3MKEA 3NC8A 4PM5A 1KE3A 3CJMA 2Y2MA 2Y55A 5AQ9A 4GDBA 3W4OA 4NK3A 4OLDA 4OPQA 1SDNA 3NDEA 3OPPA 1YMXA 1KGFA 1HTZA 1XGIA 4E3OA 3VOYA 3IXBA 5FI7A 2WZZA 1KE4A 3RJUA 2GDNA 1YLJA 2ZQDA 3C4PA 3OZHA 5EVIB 3VFHA 3VP3A 5EVIC 3DTMA 4EUZA 2XR0A 3FZCA 3UPNA 3Q7VB 4GZBA 4BL3A 3EQUA 5GHZA 3SOIA 2V1ZA 1I2WA 4EBLA 5TR7A 3BECA 4EWFA 5FDHA 4KZAA 3HLBA 4DE1A 2J9PA 1TEMA 3PAGA 4ZJ1A 3A3JA 1W79A 3UY6A 1EI5A 2WGVA 1GA9A 1PWGA 4MBKA 1JVJA 3DWZA 1BULA 1K38A 4KQQA 4KZ5A 2XFTA 1K57A 4BENA 1XGJA 4B88A 3S1YA 4DDYA 2HDRA 1K4EA 2UWXA 2X71A 1ONHA 1FQGA 5A92A 3VSLA 1L0DA 5EUAA 4Z9QA 1FSWA 5CGSA 1I2SA 2Y91A 1IELA 3BFEA 2Y2IA 4F94A 5EPHA 1PW8A 5EVID 1NY0A 2WK0A 4HEFA 5BOHA 3UPOA 5M1AA 5JYPA 2ZQ8A 3UDIA 4QJGA 5CHJA 1L0EA 3D4FA 1IEMA 1NZUA 4PMAA 1ERQA 4OPRA 3N8SA 1K6SA 2FFFB 5GL9A 2HP6A 5CEDA 3PBRA 1VM1A 2EXBA 4E3LA 3IH9A 3VP0A 4JBFA 2Y2GA 4JXSA 4A5RA 2ZQCA 4KZ8A 1ES3A 1ESUA 1JWVA 4PM8A 3VSKA 3ZG9B 3FV7A 4N1XA 4JKTA 5FQJA 1ESIA 3V5MA 4E6WA 5EE8A 4M3KA 4OOMA 5L2FA 5F82A 3UNWA 2ZMAA 4BD0A 1G6AA 4RYEA 3Q7ZA 4QHCA 3TG9A 4N1HA 2J9OA 1NYYA 1XA7A 3ZDJA 4DE2A 5IHVA 5TFQA 3AGDA 4FD8A 4PPRA 1KE0A 2XH9A 2HP9A 2ZC6B 4JXWA 2XD5A 3CZDA 4K91A 2EX8A 3IF6A 4KG2A 2PBYA 1E4DA 4OPZA 3UE0A 5GLBA 1DJCA 3MXRA 5TGFA 1CI9A 4Y0TA 3P98A 4MLLA 3GTCA 1DJBA 3BLMA 5HW3A 3JYIA 5CHMA 1WE4A 5CTNA 4CJNA 5FATA 2ZM2A 1QMEA 5CTMA 5AQ7A 4GB7A 3O87A 1YQSA 3M6HA 3M6BA 4R3BA 3G30A 3UO9A 1IYSA 1PZOA 2WAEA 1PW1A 2JE5A 4KZ3A 1AXBA 5EVLA 3E2LA 1NRFA 4UHUA 4WMCD 3DWKA 4R4SA 3O88A 1IYPA 2ZC4B 1JTDA 2P9VA 1O7EA 2ZC3B 5FQQA 3MZDA 3BFCA 3GV9A 4U3TA 4UA9A 4ID4A 4QY5A 3Q1FA 3VFFA 1FCMA 3AGFA 4UA7A 5GHYA 1RGZA 4K0WA 2WGIA 1K25A 3G31A 1PIOA 1XXMA 1VQQA 3GVBA 3N8RA 5DF8A 2VGJA 4IVKA 3PBSA 4MBFA 3S4XA 4OQ0A 4RVAA 2CC1A 3MZEA 2BG1A 1H8YA 5CHUA 4OLGA 5EVIA 5E2EA 5A90A 3PBQA 2XGNA 3TSGA 3FKWA 2PU2A 5DVAA 3SH9A 1H5XA 4DE3A 2FFYA 1YLZA 3IHAA 1KVLA 3ZVWA 5E2HA 3HUOA 1XPBA 3IWOA 5DTKA 1FCNA 1L0FA 1Y54A 4E3JA 4YFMA 3DW0A 1G68A 3HVFA 4RX2A 2J8YA 3WRTA 2ZM0A 2QPNA 3IH8A 4GN2A 3Q81A 4RA7A 4GOGA 5FQKA 3BRMA 3BFFA 4FH4A 4XUZA 2ZC5B 3ZG7B 1LLBA 4WZ5A 1OMEA 3QNCA 3O86A 2XK1A 3IF5A 4QU3A 3NBLA 1ES5A 3NI9A 3G32A 3ZG5A 3MXSA 3ZNTA 1CEGA 4IBRA 4MBHA 4DF6A 4ZAMA 4JXVA 4Y0UA 1XKZA 1LL9A 3ZFZA 5GLAA 2ZLYA 2Y59A 4WBGA 1JTGA 2XFSA 4C75A 3HLFA 1RP5A 3PAEA 4JF4A 5DF7A 2WUQA 4GNUA 4WEKA 1N4OA 1E3UD 4WZ5C 2JCHA 3GRJA 5DTTA 1KGEA 1IKGA 3CMZA 4QD4A 4WYYA 1K54C 3NIAA 4BJPA 1MPLA 1BLSA 2HDUA 4GD8A 4OQIA 4DXCA 3BEBA 2HPBA 5DF9A 4QB8A 4ZTKA 3SH7A 2XQZA 3ZG0A 4P87A 3VOZA 2Y4AA 4RX3A 3ZGAB 4XXRA 3PBOA 4WMCA 1H8ZA 1Q2QA 4JLFA 2Y2NA 1DJAA 3NY4A 3UE1A 5FAQA 4ZJ3A 1XX2A 1CI8A 1PWDA 3G2YA 4WELA 4S2OA 4X6TA 3WS2A 3IXGA 3SS4A 2WADA 4LENA 4UAAA 5FAPA 5FASA 4E3NA 2WKHA 3IWIA 2EXAA 1ES4A 5D3OA 3MKFA 3C7UA 2X02A 4GD6A 4N9LA 5GLCA 3P09A 3UN7A 1GCEA 1GHIA 3PTEA 5CEBA 4OQGA 5KZHA 1QMFA 5JYOA 1YT4A 3Q82A 3UDXA 4IBXA 3W8KA 5J8XA 3LY3A 4NETA 1MKIA 3G35A 1K6RA 3E2KA 4OONA 1HD8A 2EX2A 5KSHA 1PYYA 4KZ4A 5EECA 1PI4A 2OLVA 2WGWB 3RXWA 4OVDA 3W4QA 3W4PA 1ONGA 2XDMA 4PM9A 5HX9A 3IXDA 2ZJ9A 3GR2A 2C6WB 2PU4A 1KGGA 4KG6A 2WKEA 2XD1A 2OLUA 1NZOA 3HLEA 2B5RA 1MWRA 3LY4A 5HAPA 3GMWA 3IWQA 1SKFA 1TDLA 1C3BA 2C5WB 1YLPA 4LV2A 2ZC7A 4S2IA 4BD1A 1ZKJA 4B4XA 1LI9A 2HP5A 3LO7A 4H8RA 4KG5A 1LI0A 2H5SA 1NYMA 1YMSA 3HL9A 2WAFA 4LV0A 1ZC2A 5E43A 4EV4A 4OQHA 3PBNA 1XA1A 1W8YA 1IKIA 4LV1A 3HUMA 4IVIA 5FI2A 3RXXA 4S2PA 5KSCA 3TOIA 4MEZA 2V20A 3BFDA 5HAIA 1ZG4A 4BQMA 4OP8A 3C4OA 4XUXA 1E3UA 4WZ4A 2V2FF 4X68A 1FCOA 1K4FA 4S2MA 3VMAA 1K55A 1BUEA 3WWXA 3MFDA 1GA0A 3IXHA 5G18A 5FQMA 5KMWA 3NDGA 2WKIA 2G2WA 1BLPA 4R3JA 4R0QA 1O07A 2Y2JA 3OPRA 3Q7VA 2EX6A 3PBTA 4LCLA 5U47A 1SCWA 3OPLA 3SS3A 3WS4A 1Z6FA 2ZM8A 1GHMA 1MY8A 3BYDA 3M2JA 3WRZA 3FYZA 3IHBA 2G2UA 5E2GA 2ZQAA 4S2NC 4HBTA 3N7WA 1SHVA 1ERMA 1JWZA 3N6IA 3HLWA 2Y2HA 1YM1A 5HAQA 5M19A 3HLGA 1K55C 4S2JA 2QZ6A 1L2SA 1PZPA 3VP1A 4U0XA 5GLDA 4KZBA 4DDSA 1HZOA 1NXYA 2X01A 5F83A 3FWLA 2Z2LB 4P85A 1K54A 4HESA 1YLWA 2I72A 5FQIA 4KZ9A 2H0YA 4P0MA 4U0TA 2DRWA 4YINA 3QNBA 1K56D 2WYXA 4R1GA 2OV5A 4C3QA 3LEZA 3SS5A 4C6YA 3AGEA 1ZG6A 4PM7A 5CXWA 5FAOA 1L0GA 4FCFA 4B4ZA 4GDNA 1BSGA 1FOFA 4IEDA 1KDSA 3ZHHA 3V50A 3OCNA 1FR6A 2JBFA 3C5AA 1FR1A 5M18A 2XLNA 5F1FA 3VP4A 5CRFA 5HARA 3FKVA 4MNRA 4KZ7A 3A3DA 2J7VA 3N8LA 1NJ4A 4D2OA 3HBRA 4P6BA 3ZVTA 4E3KA 4Q8IA 1MWTA 1SDEA 4KQRA 3B3XA 4Y0OA 4OPYA 4WM9A 1JWPA 3V3SA 2IWDA 1PWCA 1GHPA 1TDGA 2HDQA 3C7VA 3O3VA 5DTSA 3IQAA 1S0WA 2XEPA 3UPPA 1Q2PA 1EROA 4JF6A 1CK3A 2H0TA 5FQ9A 4N92A 5CERA 3MBZA 1BT5A 1I5QA 2WGWA 5CGXA 1U60A 2XF3A 2ZQ7A 2QMIA 2P74A 5GHXA 4ZDXA 2HDSA 1ALQA 4EBNA 5HL1A 3A3FA 1KVMA 3HUNA 3VP2A 3A3IA 4DRTA 4OOYA 4CPKA 1RCJA 3ITAA 3BFGA 3WS1A 3HLCA 4FH2A 5AQAA 2H10A 5CGWA 1K57C 4Y7PA 5A91A 3MZFA 4BL2A 1WYBA 1IYQA 4KZ6A 3V3RA 1XP4A 3N4IA 1MXOA 3BLSA 1MWUA 3Q07A 5I94A 3EQVA 4OKPA 3OCLA 1LL5A 3ISGA 3UE3A 3SH8A 4EBPA 2IWBA 1W8QA 3ZG8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A3U A;  2DCF A;  3G4P A;  4R23 A;  4X56 A;  4WEJ A;  2R9X A;  5HFO A;  1E25 A;  4X55 A;  2EX9 A;  3HLD A;  4JPM A;  5EOE A;  5A93 A;  4FSF A;  4LV3 A;  4DE0 A;  2ZQ9 A;  3NCK A;  4LCM A;  5AQB A;  1KDW A;  4E6X A;  1LHY A;  5FA7 A;  5EOO A;  3I7J A;  2Y2O A;  2Y2Q A;  1W5D A;  1HVB A;  4OOL A;  5FSR A;  3WS0 A;  1K56 A;  2ZD8 A;  2R9W A;  1PI5 A;  1EWZ A;  1M6K A;  3WS5 A;  4UA6 A;  2EFX A;  3OPH A;  1N9B A;  2Q9N A;  2EFU A;  4HBU A;  3GQZ A;  5CEC A;  3S22 A;  2Y2K A;  3A3E A;  3ZCZ A;  1RGY A;  4QY6 A;  3HRE A;  2BLS A;  1ES2 A;  1S6R A;  3M2K A;  4S2N A;  1TVF A;  1IYO A;  3QHY A;  5FI6 A;  4E3M A;  2Y2L A;  1MWS A;  3IF6 B;  4EQI A;  4PM6 A;  1CEF A;  3IF6 C;  1J9M A;  3OC2 A;  4K0X A;  1BLH A;  4S2K A;  4X69 A;  2Q9M A;  3IT9 A;  4KEN B;  4L0L A;  1DY6 A;  1YLY A;  2DNS A;  2VGK A;  2A49 A;  1W7F A;  4E3I A;  2IWC A;  2WZX A;  1MBL A;  4OH0 A;  3UDF A;  2E8I A;  2Z2M B;  1YLT A;  4OP5 A;  4BLM A;  5E2F A;  2RL3 A;  3G34 A;  4S2L A;  4ZJ2 A;  4KQO A;  4O7D A;  3BM6 A;  3V39 A;  1BZA A;  4JF5 A;  3LCE A;  3CG5 A;  4DKI A;  3ITB A;  4DXB A;  4X53 A;  4N9K A;  3ZNY A;  1BTL A;  1BLC A;  5F1G A;  4ZBE A;  1M40 A;  2P9V B;  2RCX A;  2OSU A;  4GKU A;  4JXG A;  3G2Z A;  1WYC A;  2JC7 A;  4R4R A;  2Y2P A;  1FSY A;  3GSG A;  3MKE A;  3NC8 A;  4PM5 A;  1KE3 A;  3CJM A;  2Y2M A;  2Y55 A;  5AQ9 A;  4GDB A;  3W4O A;  4NK3 A;  4OLD A;  4OPQ A;  1SDN A;  3NDE A;  3OPP A;  1YMX A;  1KGF A;  1HTZ A;  1XGI A;  4E3O A;  3VOY A;  3IXB A;  5FI7 A;  2WZZ A;  1KE4 A;  3RJU A;  2GDN A;  1YLJ A;  2ZQD A;  3C4P A;  3OZH A;  5EVI B;  3VFH A;  3VP3 A;  5EVI C;  3DTM A;  4EUZ A;  2XR0 A;  3FZC A;  3UPN A;  3Q7V B;  4GZB A;  4BL3 A;  3EQU A;  5GHZ A;  3SOI A;  2V1Z A;  1I2W A;  4EBL A;  5TR7 A;  3BEC A;  4EWF A;  5FDH A;  4KZA A;  3HLB A;  4DE1 A;  2J9P A;  1TEM A;  3PAG A;  4ZJ1 A;  3A3J A;  1W79 A;  3UY6 A;  1EI5 A;  2WGV A;  1GA9 A;  1PWG A;  4MBK A;  1JVJ A;  3DWZ A;  1BUL A;  1K38 A;  4KQQ A;  4KZ5 A;  2XFT A;  1K57 A;  4BEN A;  1XGJ A;  4B88 A;  3S1Y A;  4DDY A;  2HDR A;  1K4E A;  2UWX A;  2X71 A;  1ONH A;  1FQG A;  5A92 A;  3VSL A;  1L0D A;  5EUA A;  4Z9Q A;  1FSW A;  5CGS A;  1I2S A;  2Y91 A;  1IEL A;  3BFE A;  2Y2I A;  4F94 A;  5EPH A;  1PW8 A;  5EVI D;  1NY0 A;  2WK0 A;  4HEF A;  5BOH A;  3UPO A;  5M1A A;  5JYP A;  2ZQ8 A;  3UDI A;  4QJG A;  5CHJ A;  1L0E A;  3D4F A;  1IEM A;  1NZU A;  4PMA A;  1ERQ A;  4OPR A;  3N8S A;  1K6S A;  2FFF B;  5GL9 A;  2HP6 A;  5CED A;  3PBR A;  1VM1 A;  2EXB A;  4E3L A;  3IH9 A;  3VP0 A;  4JBF A;  2Y2G A;  4JXS A;  4A5R A;  2ZQC A;  4KZ8 A;  1ES3 A;  1ESU A;  1JWV A;  4PM8 A;  3VSK A;  3ZG9 B;  3FV7 A;  4N1X A;  4JKT A;  5FQJ A;  1ESI A;  3V5M A;  4E6W A;  5EE8 A;  4M3K A;  4OOM A;  5L2F A;  5F82 A;  3UNW A;  2ZMA A;  4BD0 A;  1G6A A;  4RYE A;  3Q7Z A;  4QHC A;  3TG9 A;  4N1H A;  2J9O A;  1NYY A;  1XA7 A;  3ZDJ A;  4DE2 A;  5IHV A;  5TFQ A;  3AGD A;  4FD8 A;  4PPR A;  1KE0 A;  2XH9 A;  2HP9 A;  2ZC6 B;  4JXW A;  2XD5 A;  3CZD A;  4K91 A;  2EX8 A;  3IF6 A;  4KG2 A;  2PBY A;  1E4D A;  4OPZ A;  3UE0 A;  5GLB A;  1DJC A;  3MXR A;  5TGF A;  1CI9 A;  4Y0T A;  3P98 A;  4MLL A;  3GTC A;  1DJB A;  3BLM A;  5HW3 A;  3JYI A;  5CHM A;  1WE4 A;  5CTN A;  4CJN A;  5FAT A;  2ZM2 A;  1QME A;  5CTM A;  5AQ7 A;  4GB7 A;  3O87 A;  1YQS A;  3M6H A;  3M6B A;  4R3B A;  3G30 A;  3UO9 A;  1IYS A;  1PZO A;  2WAE A;  1PW1 A;  2JE5 A;  4KZ3 A;  1AXB A;  5EVL A;  3E2L A;  1NRF A;  4UHU A;  4WMC D;  3DWK A;  4R4S A;  3O88 A;  1IYP A;  2ZC4 B;  1JTD A;  2P9V A;  1O7E A;  2ZC3 B;  5FQQ A;  3MZD A;  3BFC A;  3GV9 A;  4U3T A;  4UA9 A;  4ID4 A;  4QY5 A;  3Q1F A;  3VFF A;  1FCM A;  3AGF A;  4UA7 A;  5GHY A;  1RGZ A;  4K0W A;  2WGI A;  1K25 A;  3G31 A;  1PIO A;  1XXM A;  1VQQ A;  3GVB A;  3N8R A;  5DF8 A;  2VGJ A;  4IVK A;  3PBS A;  4MBF A;  3S4X A;  4OQ0 A;  4RVA A;  2CC1 A;  3MZE A;  2BG1 A;  1H8Y A;  5CHU A;  4OLG A;  5EVI A;  5E2E A;  5A90 A;  3PBQ A;  2XGN A;  3TSG A;  3FKW A;  2PU2 A;  5DVA A;  3SH9 A;  1H5X A;  4DE3 A;  2FFY A;  1YLZ A;  3IHA A;  1KVL A;  3ZVW A;  5E2H A;  3HUO A;  1XPB A;  3IWO A;  5DTK A;  1FCN A;  1L0F A;  1Y54 A;  4E3J A;  4YFM A;  3DW0 A;  1G68 A;  3HVF A;  4RX2 A;  2J8Y A;  3WRT A;  2ZM0 A;  2QPN A;  3IH8 A;  4GN2 A;  3Q81 A;  4RA7 A;  4GOG A;  5FQK A;  3BRM A;  3BFF A;  4FH4 A;  4XUZ A;  2ZC5 B;  3ZG7 B;  1LLB A;  4WZ5 A;  1OME A;  3QNC A;  3O86 A;  2XK1 A;  3IF5 A;  4QU3 A;  3NBL A;  1ES5 A;  3NI9 A;  3G32 A;  3ZG5 A;  3MXS A;  3ZNT A;  1CEG A;  4IBR A;  4MBH A;  4DF6 A;  4ZAM A;  4JXV A;  4Y0U A;  1XKZ A;  1LL9 A;  3ZFZ A;  5GLA A;  2ZLY A;  2Y59 A;  4WBG A;  1JTG A;  2XFS A;  4C75 A;  3HLF A;  1RP5 A;  3PAE A;  4JF4 A;  5DF7 A;  2WUQ A;  4GNU A;  4WEK A;  1N4O A;  1E3U D;  4WZ5 C;  2JCH A;  3GRJ A;  5DTT A;  1KGE A;  1IKG A;  3CMZ A;  4QD4 A;  4WYY A;  1K54 C;  3NIA A;  4BJP A;  1MPL A;  1BLS A;  2HDU A;  4GD8 A;  4OQI A;  4DXC A;  3BEB A;  2HPB A;  5DF9 A;  4QB8 A;  4ZTK A;  3SH7 A;  2XQZ A;  3ZG0 A;  4P87 A;  3VOZ A;  2Y4A A;  4RX3 A;  3ZGA B;  4XXR A;  3PBO A;  4WMC A;  1H8Z A;  1Q2Q A;  4JLF A;  2Y2N A;  1DJA A;  3NY4 A;  3UE1 A;  5FAQ A;  4ZJ3 A;  1XX2 A;  1CI8 A;  1PWD A;  3G2Y A;  4WEL A;  4S2O A;  4X6T A;  3WS2 A;  3IXG A;  3SS4 A;  2WAD A;  4LEN A;  4UAA A;  5FAP A;  5FAS A;  4E3N A;  2WKH A;  3IWI A;  2EXA A;  1ES4 A;  5D3O A;  3MKF A;  3C7U A;  2X02 A;  4GD6 A;  4N9L A;  5GLC A;  3P09 A;  3UN7 A;  1GCE A;  1GHI A;  3PTE A;  5CEB A;  4OQG A;  5KZH A;  1QMF A;  5JYO A;  1YT4 A;  3Q82 A;  3UDX A;  4IBX A;  3W8K A;  5J8X A;  3LY3 A;  4NET A;  1MKI A;  3G35 A;  1K6R A;  3E2K A;  4OON A;  1HD8 A;  2EX2 A;  5KSH A;  1PYY A;  4KZ4 A;  5EEC A;  1PI4 A;  2OLV A;  2WGW B;  3RXW A;  4OVD A;  3W4Q A;  3W4P A;  1ONG A;  2XDM A;  4PM9 A;  5HX9 A;  3IXD A;  2ZJ9 A;  3GR2 A;  2C6W B;  2PU4 A;  1KGG A;  4KG6 A;  2WKE A;  2XD1 A;  2OLU A;  1NZO A;  3HLE A;  2B5R A;  1MWR A;  3LY4 A;  5HAP A;  3GMW A;  3IWQ A;  1SKF A;  1TDL A;  1C3B A;  2C5W B;  1YLP A;  4LV2 A;  2ZC7 A;  4S2I A;  4BD1 A;  1ZKJ A;  4B4X A;  1LI9 A;  2HP5 A;  3LO7 A;  4H8R A;  4KG5 A;  1LI0 A;  2H5S A;  1NYM A;  1YMS A;  3HL9 A;  2WAF A;  4LV0 A;  1ZC2 A;  5E43 A;  4EV4 A;  4OQH A;  3PBN A;  1XA1 A;  1W8Y A;  1IKI A;  4LV1 A;  3HUM A;  4IVI A;  5FI2 A;  3RXX A;  4S2P A;  5KSC A;  3TOI A;  4MEZ A;  2V20 A;  3BFD A;  5HAI A;  1ZG4 A;  4BQM A;  4OP8 A;  3C4O A;  4XUX A;  1E3U A;  4WZ4 A;  2V2F F;  4X68 A;  1FCO A;  1K4F A;  4S2M A;  3VMA A;  1K55 A;  1BUE A;  3WWX A;  3MFD A;  1GA0 A;  3IXH A;  5G18 A;  5FQM A;  5KMW A;  3NDG A;  2WKI A;  2G2W A;  1BLP A;  4R3J A;  4R0Q A;  1O07 A;  2Y2J A;  3OPR A;  3Q7V A;  2EX6 A;  3PBT A;  4LCL A;  5U47 A;  1SCW A;  3OPL A;  3SS3 A;  3WS4 A;  1Z6F A;  2ZM8 A;  1GHM A;  1MY8 A;  3BYD A;  3M2J A;  3WRZ A;  3FYZ A;  3IHB A;  2G2U A;  5E2G A;  2ZQA A;  4S2N C;  4HBT A;  3N7W A;  1SHV A;  1ERM A;  1JWZ A;  3N6I A;  3HLW A;  2Y2H A;  1YM1 A;  5HAQ A;  5M19 A;  3HLG A;  1K55 C;  4S2J A;  2QZ6 A;  1L2S A;  1PZP A;  3VP1 A;  4U0X A;  5GLD A;  4KZB A;  4DDS A;  1HZO A;  1NXY A;  2X01 A;  5F83 A;  3FWL A;  2Z2L B;  4P85 A;  1K54 A;  4HES A;  1YLW A;  2I72 A;  5FQI A;  4KZ9 A;  2H0Y A;  4P0M A;  4U0T A;  2DRW A;  4YIN A;  3QNB A;  1K56 D;  2WYX A;  4R1G A;  2OV5 A;  4C3Q A;  3LEZ A;  3SS5 A;  4C6Y A;  3AGE A;  1ZG6 A;  4PM7 A;  5CXW A;  5FAO A;  1L0G A;  4FCF A;  4B4Z A;  4GDN A;  1BSG A;  1FOF A;  4IED A;  1KDS A;  3ZHH A;  3V50 A;  3OCN A;  1FR6 A;  2JBF A;  3C5A A;  1FR1 A;  5M18 A;  2XLN A;  5F1F A;  3VP4 A;  5CRF A;  5HAR A;  3FKV A;  4MNR A;  4KZ7 A;  3A3D A;  2J7V A;  3N8L A;  1NJ4 A;  4D2O A;  3HBR A;  4P6B A;  3ZVT A;  4E3K A;  4Q8I A;  1MWT A;  1SDE A;  4KQR A;  3B3X A;  4Y0O A;  4OPY A;  4WM9 A;  1JWP A;  3V3S A;  2IWD A;  1PWC A;  1GHP A;  1TDG A;  2HDQ A;  3C7V A;  3O3V A;  5DTS A;  3IQA A;  1S0W A;  2XEP A;  3UPP A;  1Q2P A;  1ERO A;  4JF6 A;  1CK3 A;  2H0T A;  5FQ9 A;  4N92 A;  5CER A;  3MBZ A;  1BT5 A;  1I5Q A;  2WGW A;  5CGX A;  1U60 A;  2XF3 A;  2ZQ7 A;  2QMI A;  2P74 A;  5GHX A;  4ZDX A;  2HDS A;  1ALQ A;  4EBN A;  5HL1 A;  3A3F A;  1KVM A;  3HUN A;  3VP2 A;  3A3I A;  4DRT A;  4OOY A;  4CPK A;  1RCJ A;  3ITA A;  3BFG A;  3WS1 A;  3HLC A;  4FH2 A;  5AQA A;  2H10 A;  5CGW A;  1K57 C;  4Y7P A;  5A91 A;  3MZF A;  4BL2 A;  1WYB A;  1IYQ A;  4KZ6 A;  3V3R A;  1XP4 A;  3N4I A;  1MXO A;  3BLS A;  1MWU A;  3Q07 A;  5I94 A;  3EQV A;  4OKP A;  3OCL A;  1LL5 A;  3ISG A;  3UE3 A;  3SH8 A;  4EBP A;  2IWB A;  1W8Q A;  3ZG8 B; 
#chains in the Genus database with same CATH topology
 2V9A A;  4R23 A;  3LR4 A;  5HFO A;  2R9X A;  3MQ0 A;  3KO6 A;  4DE0 A;  5AQB A;  1LHY A;  5G4Z A;  2W1T B;  3I7J A;  2Y2O A;  1W5D A;  4HH3 A;  2ZD8 A;  4F3L B;  3UB9 A;  2Q9N A;  2EFU A;  4HBU A;  4EEP A;  5CEC A;  2Y2K A;  1RGY A;  2V0U A;  4QY6 A;  5AJG A;  1S6R A;  4S2N A;  1TVF A;  3S7N A;  3OLO A;  2GNX A;  4EQI A;  1CEF A;  3IF6 C;  3LYX A;  3UPN A;  4BD0 A;  1YLY A;  2DNS A;  2VGK A;  2A49 A;  2IWC A;  1H3Q A;  5L8M A;  1MBL A;  5DKL A;  4IHQ A;  2E8I A;  4YNR A;  4ETZ A;  1YLT A;  3S7P A;  2E8J A;  4FTX A;  4O0P A;  4KQO A;  1BZA A;  4N9K A;  3ZNY A;  1BLC A;  5F1G A;  1M40 A;  2P9V B;  2RCX A;  3G2Z A;  2W3F A;  2JC7 A;  2BAS A;  2Y2P A;  5L07 A;  1XJ6 A;  3T4J A;  3PHY A;  4PM5 A;  5AQ9 A;  4OPQ A;  1HTZ A;  3VOY A;  4NXF A;  5FI7 A;  3RJU A;  3MQQ A;  1YLJ A;  3C4P A;  1OJG A;  4M4X A;  5EVI B;  4PAU A;  1OTD A;  3HLB A;  3QP1 A;  4DE1 A;  2J9P A;  3A3J A;  1W79 A;  1JVJ A;  4KQQ A;  4BEN A;  3T12 B;  4B88 A;  3BQA A;  1ONH A;  5TBM A;  5A92 A;  2QKP A;  4BBT A;  3UME A;  1FSW A;  3UB8 A;  1IEL A;  4F94 A;  1TF1 A;  3UPO A;  5BOH A;  5M1A A;  5JYP A;  2ZQ8 A;  1L0E A;  2M7U A;  4PMA A;  4UEY A;  3QP5 A;  3N8S A;  4OPR A;  4GS9 B;  3EGD C;  2VV7 A;  4MN6 A;  3H82 B;  5J4E A;  4JXS A;  5G4Y A;  3UB5 P;  3KSG A;  2ZQC A;  2AVX A;  4M3K A;  4OOM A;  1D7E A;  5F82 A;  4QHC A;  3TG9 A;  4XT2 B;  4MMN A;  4B9O A;  3LEQ A;  2HP9 A;  3PR6 A;  3CZD A;  4KG2 A;  3UE0 A;  1OT9 A;  5TGF A;  5HPF A;  2K7S A;  3JYI A;  4HH2 A;  5CHM A;  5FAT A;  2ZM2 A;  5AQ7 A;  5CTM A;  4GB7 A;  3O87 A;  1YQS A;  3UO9 A;  1IYS A;  1PZO A;  1PW1 A;  3P7N A;  3F1N B;  1NRF A;  4UHU A;  2ZC4 B;  3MZD A;  3GV9 A;  4QY5 A;  1FCM A;  3AGF A;  4I39 A;  4Z1W A;  4CLC B;  2HJE A;  4MBF A;  3LIA A;  2CC1 A;  4OLG A;  1TD5 A;  5A90 A;  5DVA A;  1H5X A;  2VA0 A;  5HD5 A;  2QJ5 A;  1W8Q A;  2W3E A;  1XJ4 A;  4L9G A;  5HPI A;  5FDS A;  2J8Y A;  3Q81 A;  3BRM A;  3ZG7 B;  5FEF A;  2VGL S;  4WZ5 A;  2FZ0 A;  4GW9 A;  2O9A A;  1OJ5 A;  1CEG A;  3CPT B;  2HV1 A;  1XKZ A;  1LL9 A;  2VJW A;  2VK3 A;  3IBJ A;  1JTG A;  1LL8 A;  2XFS A;  2WKR A;  1YAX A;  3GRJ A;  1KGE A;  2PRF A;  4G3K A;  4QD4 A;  4HJ3 A;  3GDI A;  4GD8 A;  2LB9 A;  2VV8 A;  2XQZ A;  3UB6 A;  3T4O A;  3UE1 A;  1XX2 A;  2QWS A;  4Y5F A;  2WAD A;  4UAA A;  2A24 A;  4E3N A;  2WKH A;  2R78 A;  2QHK A;  3UN7 A;  1GCE A;  3LI8 A;  5CEB A;  4OQG A;  2QYB A;  1L3L A;  1MKM A;  3W8K A;  3G35 A;  4OON A;  4KZ4 A;  1PI4 A;  3LGO A;  3LR0 A;  2XD1 A;  3LY4 A;  3F1P A;  3MS6 A;  1ZKJ A;  5K5B A;  1S1Z A;  3ULF A;  1LI0 A;  2PYP A;  5L10 A;  3HL9 A;  3CUE C;  4OQH A;  3CAX A;  1XA1 A;  4O8G A;  5FI2 A;  3TOI A;  4MEZ A;  3BFD A;  4H6J B;  3R7W B;  1DP8 A;  4WZ4 A;  2V2F F;  4X68 A;  4S2M A;  1K55 A;  3WWX A;  1T19 A;  4R0Q A;  2Y2J A;  2EX6 A;  1CJF A;  1Z09 A;  4X1L A;  5U47 A;  3WS4 A;  3UB7 A;  1GHM A;  5DFX A;  3MQO A;  2ZQA A;  4S2N C;  4HBT A;  3N7W A;  2KDK A;  3N6I A;  2QZ6 A;  1ZHH B;  5GLD A;  1EW0 A;  5F83 A;  4HES A;  2I72 A;  4KZ9 A;  5EM0 A;  2DRW A;  4YIN A;  2OV5 A;  4C3Q A;  3SS5 A;  1ZG6 A;  4PM7 A;  4B4Z A;  4FCF A;  4HY8 A;  3E0Y A;  4GDN A;  2FH5 A;  4UQI S;  2P7J A;  5HSQ A;  5F1F A;  5F68 A;  4KZ7 A;  1NJ4 A;  3ZVT A;  1GSV A;  4KQR A;  4Y0O A;  1PRQ A;  1KOU A;  1PWC A;  2EA9 A;  3UPP A;  2W1R A;  2KLI A;  4HI4 A;  4D60 A;  3LI9 A;  5HDS A;  2H0T A;  4GHI B;  2B02 A;  5CER A;  1BT5 A;  2WGW A;  5CGX A;  2PR6 A;  4EBN A;  5HL1 A;  5EV0 A;  3VP2 A;  4OOY A;  1RCJ A;  5A91 A;  4B93 A;  3DTE A;  4KZ6 A;  3A0S A;  2D02 A;  1Y28 A;  1MXO A;  3N4I A;  5I94 A;  5I5L A;  3UE3 A;  3FPV A;  2JKT M;  3G4P A;  4II7 A;  4X56 A;  4WEJ A;  3MF0 A;  1E25 A;  2EX9 A;  4EET B;  3ZQ5 A;  5A93 A;  4LV3 A;  2IA2 A;  2CMN A;  4LCM A;  2ZL1 B;  5FA7 A;  5EOO A;  1CQA A;  2A24 B;  3UE6 A;  2R9W A;  1PI5 A;  1M6K A;  2EFX A;  3OPH A;  3EOI A;  1N9B A;  1UWP X;  3GQZ A;  3S22 A;  3ZCZ A;  3A3E A;  3EEA A;  1SKO B;  3GEC A;  1P9R A;  3QHY A;  3FPW A;  3IF6 B;  4NEE D;  4PM6 A;  4S2K A;  1DY6 A;  1W7F A;  4I3I A;  3L7H A;  4OP5 A;  2RL3 A;  3V39 A;  3BQ8 A;  3LCE A;  2HJ9 C;  3CG5 A;  4G3V A;  4DKI A;  1BTL A;  4ZBE A;  4GKU A;  1WYC A;  2ZOH A;  5F69 A;  1SZV A;  1F2K A;  1SDN A;  2JN7 A;  3FG8 A;  1XGI A;  3DTK A;  4HP4 A;  3U4L P;  4BMW A;  2GDN A;  1VEU B;  3VFH A;  3CIT A;  4GZB A;  4MDZ A;  5GHZ A;  2V1Z A;  3BEC A;  4P6Z M;  3PAG A;  5IS1 A;  4NG2 A;  4KQD A;  4KZ5 A;  4Y2F A;  1K57 A;  2HDR A;  1K4E A;  2UWX A;  2X71 A;  3VSL A;  4Z9Q A;  3BFE A;  5EVI D;  2WK0 A;  3D4F A;  1XJ3 A;  1NZU A;  3FC7 A;  1K6S A;  5GL9 A;  1TS8 A;  2G7U A;  2DMW A;  4A5R A;  1S66 L;  1ESU A;  1JWV A;  4YWZ A;  3VSK A;  4N1X A;  4WUJ A;  4ARZ A;  1ESI A;  5HWV A;  3UNW A;  2ZMA A;  4N1H A;  2J9O A;  1XA7 A;  5IHV A;  4PPR A;  2B18 A;  3TW8 A;  2XD5 A;  2VEA A;  4K91 A;  4Y15 A;  3LR5 A;  4Y0T A;  4WLA A;  1QME A;  2W0N A;  4LRX C;  4MCW A;  4KZ3 A;  5EVL A;  3E2L A;  3O88 A;  1J3W A;  3NOP C;  3VFF A;  3BFC A;  3PYP A;  3Q1F A;  3SW1 A;  2QJ7 A;  2WGI A;  1K25 A;  1XXM A;  2O9C A;  3N8R A;  5DFY A;  2V8F A;  2JKG A;  3S4X A;  2MJ6 A;  4OQ0 A;  4RVA A;  3ZYT A;  2BG1 A;  1WA9 A;  1GSX A;  2GX5 A;  3MR0 A;  5E2E A;  3PBQ A;  2PU2 A;  4DE3 A;  3H7W B;  3TE8 A;  2OOL A;  3LID A;  1XPB A;  3IWO A;  5DTK A;  1FCN A;  4EUV A;  4DJ2 A;  4CLC D;  3IH8 A;  2ZC5 B;  1LLB A;  1OME A;  1W63 M;  1OTA A;  4QU3 A;  3NBL A;  2NUP C;  3K3D A;  1P0Z A;  2VX8 A;  3KX0 X;  3MXS A;  3ZNT A;  4HNB A;  2ZOI A;  4DF6 A;  5HDD A;  4Y0U A;  1VET A;  2JKR M;  1MZU A;  4GLQ A;  5DF7 A;  4GNU A;  1E3U D;  3TRC A;  1MPL A;  4OQI A;  2HPB A;  5DF9 A;  5F6A A;  2V1A A;  3ZG0 A;  2GJ3 A;  1Q2Q A;  4JLF A;  1DJA A;  1CI8 A;  1PWD A;  3SS4 A;  4LEN A;  2XRO A;  2W3D A;  3C38 A;  3NEC A;  4I3J A;  2EXA A;  1ES4 A;  1NRJ A;  5HDC A;  3C2W A;  3PTE A;  1STZ A;  5KZH A;  1QMF A;  1YT4 A;  3Q82 A;  5TJJ A;  1K6R A;  4ZRR A;  3E2K A;  5KSH A;  1PYY A;  3W4P A;  4PM9 A;  3IXD A;  2ZJ9 A;  2PU4 A;  2WKE A;  1NZO A;  3HLE A;  5HAP A;  1SKF A;  4BD1 A;  1S67 L;  1CF0 A;  3IX3 A;  2HP5 A;  3LO7 A;  2WAF A;  1ZC2 A;  4LV1 A;  4IVI A;  1S1Y A;  5KSC A;  4XUX A;  3LUQ A;  3MSH A;  3KSH A;  1GA0 A;  3IXH A;  3BY9 A;  5HZH A;  1O07 A;  4LCL A;  3SS3 A;  4LRZ E;  1DP9 A;  1MY8 A;  1P9W A;  3M2J A;  3W2Z A;  3VE3 A;  3E4O A;  1N9N A;  1SHV A;  2Y2H A;  1YM1 A;  5HAQ A;  1X0O A;  4P85 A;  1F9I A;  4R6L A;  3KYE A;  2L0W A;  4P0M A;  2K31 A;  4LPZ A;  1K56 D;  3DBA A;  3AGE A;  5CXW A;  1L0G A;  3A0V A;  3QP2 A;  1FR6 A;  3C5A A;  4MN7 A;  2XLN A;  4MNR A;  3HCY A;  3A3D A;  3B42 A;  4WN5 A;  4P6B A;  1MWT A;  4OPY A;  5HWT A;  4WM9 A;  3HJK A;  5EFW A;  2IWD A;  2HDQ A;  3O3V A;  5DTS A;  1OPX A;  1S0W A;  2XEP A;  3E4P A;  1N9L A;  2ACG A;  1CK3 A;  5DJT A;  4HJ4 A;  3EWK A;  4IJG A;  1I5Q A;  2XF3 A;  1T1C A;  2QMI A;  3IBR A;  5EM1 A;  2HDS A;  3K3C A;  1DP6 A;  3A3I A;  2KX6 A;  2H10 A;  5CGW A;  1K57 C;  3VV4 A;  2UV0 E;  2J3T D;  4Q0I A;  1G5U A;  1WYB A;  3T1R A;  5TBM B;  4I38 A;  3Q07 A;  3OCL A;  1LL5 A;  4EBP A;  3SH8 A;  4Y13 A;  3C30 A;  5EOE A;  4HP9 A;  4FSF A;  3NCK A;  2JKF A;  4KUK A;  4E6X A;  2Y2Q A;  4OOL A;  3C8C A;  2V8C A;  4O01 A;  4UA6 A;  4DN0 A;  2XA7 S;  2OWJ A;  3HRE A;  3M2K A;  1XJ2 A;  3OBF A;  4E3M A;  2Y2L A;  1MWS A;  2PBD P;  3OC2 A;  4NXE A;  2L4R A;  4X69 A;  3IT9 A;  1JNU A;  4HIA A;  3UDF A;  1T1A A;  4I3A A;  5E2F A;  3E98 A;  4GJ4 A;  4NKP A;  3F1O A;  4O7D A;  4JF5 A;  2EWW A;  3ITB A;  2VGL M;  3LFV A;  3T4Q A;  2OSU A;  1ACF A;  4LFU A;  4PKY A;  1T18 A;  3NC8 A;  1K0K A;  2Y2M A;  4JGR A;  1G28 A;  2Y55 A;  4GDB A;  3W4O A;  4NK3 A;  3NDE A;  4IUH A;  4E3O A;  3P01 A;  5FEG A;  1KE4 A;  1GSW A;  1TS6 A;  3DTM A;  4EUZ A;  3FZC A;  3EQU A;  4EBL A;  5FDH A;  4KZA A;  1TEM A;  4ZJ1 A;  1UWN X;  2Z6C A;  2WGV A;  3LIF A;  1PWG A;  2M1C A;  4MBK A;  3DWZ A;  1K38 A;  2XFT A;  3T4T A;  5F5Y A;  1BYW A;  1FQG A;  3CHW P;  1L0D A;  3HJI A;  1FIK A;  2Y91 A;  2Y2I A;  4HEF A;  3UDI A;  4QJG A;  5CHJ A;  1IEM A;  2FFF B;  2HP6 A;  3PBR A;  1VM1 A;  2EXB A;  5IT5 A;  2W1T A;  5L09 A;  4KZ8 A;  4PM8 A;  3ZG9 B;  4QPR A;  4F3L A;  3V5M A;  4E6W A;  5L2F A;  1P97 A;  5IU1 A;  4RYE A;  1NYY A;  4X25 A;  4DE2 A;  3KSI A;  3AGD A;  4EXO A;  3H9W A;  4JXW A;  2EX8 A;  4JGP A;  4DMZ A;  1E4D A;  4OPZ A;  3P98 A;  4MLL A;  3GTC A;  2Q0O A;  1DJB A;  1WE4 A;  5CTN A;  4CJN A;  4R3B A;  2WAE A;  3T50 A;  2O0Y A;  4WMC D;  1LSW A;  3DWK A;  1IYP A;  2P9V A;  5FQQ A;  2PDR A;  3IS2 A;  5DJU A;  4ID4 A;  2PAV P;  5AVF A;  3G31 A;  1VQQ A;  3F1P B;  2VGJ A;  4IVK A;  3PBS A;  2JKT I;  1H8Y A;  3MXQ A;  4BBU A;  1IOU A;  5EVI A;  3JVV A;  3TSG A;  3FKW A;  3SH9 A;  2FFY A;  3U2A A;  3IHA A;  1KVL A;  3HUO A;  2OWH A;  4UQI M;  3PXP A;  3RTY A;  4EU0 A;  1L0F A;  1Y54 A;  4E3J A;  3DW0 A;  1G68 A;  4RX2 A;  2QPN A;  4GN2 A;  5FQK A;  4GOG A;  4XUZ A;  3BFF A;  2WKQ A;  3O86 A;  5DKK A;  2XK1 A;  3NOU C;  3IF5 A;  3G6O A;  3NI9 A;  3D3O A;  4MBH A;  4R70 A;  2ZBB A;  3EEH A;  4JXV A;  3ZFZ A;  4WBG A;  2VLG A;  4GS9 A;  4C75 A;  3TJZ C;  1RP5 A;  3PAE A;  4JF4 A;  2WUQ A;  4WZ5 C;  3H82 A;  3MMH A;  2YKH A;  1IKG A;  4WYY A;  4G3W A;  4BJP A;  2HDU A;  3BEB A;  2VKS A;  4QB8 A;  4P87 A;  3VOZ A;  4XXR A;  3PBO A;  3VOL A;  1VHM A;  4XT2 A;  2Y2N A;  3QP6 A;  5FAQ A;  4ZJ3 A;  3G2Y A;  4WEL A;  4S2O A;  3IXG A;  5FAP A;  5FAS A;  5J3W A;  3IWI A;  3O5Y A;  4BBV A;  3CI6 A;  2X02 A;  4GD6 A;  4N9L A;  1H0M A;  2O9B A;  4HOI A;  5JYO A;  3UDX A;  4IBX A;  3F1N A;  5J8X A;  1OTI A;  1MKI A;  2EX2 A;  2VZW A;  2WGW B;  2GZA A;  3W4Q A;  1ONG A;  2C6W B;  1KGG A;  4KG6 A;  2B5R A;  3T1S A;  4CLC A;  1OTB A;  1C3B A;  2ZC7 A;  4S2I A;  1OT6 A;  4B4X A;  4KG5 A;  3IX8 A;  3LR3 A;  1HLU P;  2H5S A;  2A2L A;  4WF0 A;  4LV0 A;  5MC7 A;  4IUK A;  5E43 A;  1V9Z A;  3PBN A;  1F98 A;  3T1Q B;  3HUM A;  3RXX A;  4PKY G;  4BQM A;  4OP8 A;  3A0R A;  3C4O A;  2P08 A;  2LB5 A;  1E3U A;  1K4F A;  5J7E A;  1UGU A;  1BUE A;  5G18 A;  3NDG A;  2G2W A;  4R3J A;  1NLZ A;  3OPR A;  3Q7V A;  3E4Q A;  5HD3 A;  1SCW A;  3OPL A;  1Z6F A;  4RQ9 A;  4NXB A;  2ZM8 A;  4EER A;  2WKP A;  3BYD A;  3CPT A;  3WRZ A;  3IX4 A;  3HLW A;  1K55 C;  1HZO A;  1NXY A;  3IS2 B;  3NOT C;  2X01 A;  3FWL A;  2Z2L B;  1K54 A;  2H0Y A;  4U0T A;  3JVU A;  1TS0 A;  4R1G A;  1ZTU A;  2B95 A;  1NLY A;  3LEZ A;  2ZMV A;  1BSG A;  1FOF A;  1KDS A;  2I9V A;  2V0W A;  2JBF A;  3MJQ A;  2PD7 A;  5CRF A;  2J7V A;  4MN5 A;  4E3K A;  4Q8I A;  1SDE A;  2V1B A;  3V3S A;  3C7V A;  4ME4 A;  3B47 A;  3IQA A;  1Q2P A;  1MC0 A;  4JF6 A;  2W27 A;  5FQ9 A;  3L9K A;  1YSQ A;  1U60 A;  2ZQ7 A;  2P74 A;  4WL9 A;  3A3F A;  3OOV A;  4DRT A;  4LLO B;  3ITA A;  2NUT C;  3QP4 A;  5AQA A;  1S4R A;  2HGV A;  2JKR I;  3V3R A;  4X1M A;  1XP4 A;  1YPR A;  3BLS A;  3EQV A;  2Y8H A;  3ISG A;  5FL3 A;  3EGX C;  2M7V A;  3RFB A;  1TS7 A;  2A3U A;  2DCF A;  4HHD A;  4X55 A;  3HLD A;  4H6J A;  4JPM A;  4E04 A;  3R7W A;  2ZQ9 A;  3JPU A;  1KDW A;  4FOF A;  1XFQ A;  4K08 A;  3T4S A;  1W63 Q;  1HVB A;  5FSR A;  3WS0 A;  1K56 A;  3K2N A;  3WS5 A;  1EWZ A;  4ARZ B;  3BW6 A;  4HQA A;  2BLS A;  1ES2 A;  4CQH A;  1IYO A;  5FI6 A;  2EWV A;  5HL6 A;  5C5K A;  1J9M A;  1XFN A;  4K0X A;  1BLH A;  2Q9M A;  4L0L A;  4KEN B;  1OTE A;  4E3I A;  2ZMF A;  2WZX A;  4OH0 A;  4BLM A;  3G34 A;  4S2L A;  4ZJ2 A;  2BTF P;  3BM6 A;  4PHT A;  1N9O A;  4DXB A;  4X53 A;  2J80 A;  4L9E A;  4JXG A;  3KSF A;  4R4R A;  1FSY A;  3GSG A;  3MKE A;  4Y17 A;  4I5S A;  1KE3 A;  3CJM A;  4OLD A;  3OPP A;  1YMX A;  1KGF A;  3IXB A;  2PHY A;  2WZZ A;  1Y4O A;  2P04 A;  2L1M A;  2ZQD A;  3OZH A;  3VP3 A;  1D06 A;  5EVI C;  2XR0 A;  4BL3 A;  3Q7V B;  1LT0 A;  4GHI A;  3SOI A;  4JGQ A;  1I2W A;  5TR7 A;  4EWF A;  3LIB A;  2HZ5 A;  3UY6 A;  1EI5 A;  1GA9 A;  3RH8 B;  1BUL A;  1XGJ A;  4DDY A;  3S1Y A;  3QP8 A;  5EUA A;  5CGS A;  1I2S A;  4EW7 A;  2Y79 A;  5EPH A;  1PW8 A;  2H28 A;  1NY0 A;  2D01 A;  3R4K A;  1VET B;  3KYQ A;  1ERQ A;  2OAP 1;  4DJ3 A;  5CED A;  2ZL1 A;  2K2N A;  4Y3I A;  4E3L A;  3IH9 A;  4NXG A;  4JBF A;  3VP0 A;  2Y2G A;  1YSP A;  2PT7 A;  1ES3 A;  2INW A;  4JGO A;  1YKD A;  3FV7 A;  4JKT A;  5FQJ A;  3DAV A;  5EE8 A;  3T1X A;  4ESP A;  1G6A A;  3BY8 A;  3Q7Z A;  1SKO A;  3ZDJ A;  5TFQ A;  4FD8 A;  4LRY C;  1KE0 A;  2XH9 A;  2ZC6 B;  1PFL A;  3IF6 A;  2PBY A;  5GLB A;  1DJC A;  3MXR A;  1CI9 A;  4HJ6 A;  4ETX A;  4AFI A;  5HW3 A;  3BLM A;  3T4K A;  4L9F A;  3M6H A;  3M6B A;  3G30 A;  2JE5 A;  1AXB A;  1FIL A;  4R4S A;  2J3W A;  1JTD A;  4EES A;  1O7E A;  2ZC3 B;  4U3T A;  4UA9 A;  4UA7 A;  5GHY A;  1RGZ A;  4K0W A;  1PIO A;  3GVB A;  4CLC C;  5DF8 A;  1A0K A;  3MZE A;  1LSV A;  3DTI A;  5CHU A;  1VEU A;  2XGN A;  1YLZ A;  2Z6D A;  5E2H A;  3S7Q A;  3ZVW A;  2OAQ 1;  1DRM A;  3ICY A;  4YFM A;  3HVF A;  3VE4 A;  3WRT A;  1PNE A;  2ZM0 A;  4RA7 A;  4FH4 A;  1NWZ A;  3QNC A;  5A8B A;  3D72 A;  1ES5 A;  1H8M A;  2PD8 A;  3G32 A;  3ZG5 A;  4IBR A;  3MFX A;  4ZAM A;  3V67 A;  1IFQ A;  5GLA A;  2ZLY A;  2Y59 A;  5EVE A;  3UMD A;  3HLF A;  3CWF A;  4LGW A;  4WEK A;  1N4O A;  2JCH A;  5DTT A;  3CMZ A;  1K54 C;  3NIA A;  1BLS A;  4DXC A;  4P6Z S;  2HF6 A;  4ZTK A;  3SH7 A;  2Y4A A;  4RX3 A;  3ZGA B;  4WMC A;  1H8Z A;  2O99 A;  3NHQ A;  3NY4 A;  1V9Y A;  4X6T A;  3WS2 A;  1ODV A;  5D3O A;  3MKF A;  3S7O A;  3C7U A;  5GLC A;  3P09 A;  4GCZ A;  1GHI A;  4KUO A;  2XRN A;  3LY3 A;  4NET A;  1HD8 A;  3B33 A;  5EEC A;  2OLV A;  3RXW A;  4OVD A;  2XDM A;  5HX9 A;  3GR2 A;  2XA7 M;  2OLU A;  3NUL A;  1T1B A;  1MWR A;  3GMW A;  3IWQ A;  3KYZ A;  1TDL A;  2C5W B;  1YLP A;  4LV2 A;  4R3A A;  1LI9 A;  4H8R A;  1NYM A;  1YMS A;  2W3G A;  3NJA A;  4EV4 A;  1S4S A;  4BWI A;  3D9Y A;  1W8Y A;  1IKI A;  4S2P A;  3H7W A;  3BWL A;  2V20 A;  5HAI A;  1ZG4 A;  3VMA A;  1FCO A;  3T4L A;  3MFD A;  5KMW A;  5FQM A;  2WKI A;  1BLP A;  4FUW A;  3PBT A;  2PR5 A;  2VV6 A;  2PYR A;  4CLC E;  3FYZ A;  3IHB A;  2G2U A;  5LBR A;  5E2G A;  1ERM A;  1JWZ A;  2XSS A;  4R38 A;  5M19 A;  3HLG A;  4S2J A;  1L2S A;  1PZP A;  3LIE A;  3VP1 A;  4U0X A;  4KZB A;  4DDS A;  5KIZ A;  5FQI A;  1YLW A;  4EEU A;  1AWI A;  3BJN A;  3QNB A;  4C6Y A;  2WYX A;  3F1O B;  5FAO A;  5CX7 A;  4IED A;  3ZHH A;  3V50 A;  3OCN A;  1FR1 A;  4Q0H A;  5M18 A;  3VP4 A;  5HAR A;  3FKV A;  3N8L A;  4D2O A;  3HBR A;  1LSX A;  2W3H A;  3B3X A;  4YOF A;  2J3T C;  1JWP A;  1GHP A;  1TDG A;  3LIC A;  2KOI A;  2YKF A;  5HWW A;  1ERO A;  4N92 A;  3MBZ A;  1F5M A;  5AVE A;  5GHX A;  4ZDX A;  4QWO A;  1ALQ A;  1KVM A;  3HUN A;  4EQ1 A;  4Q0J A;  4CPK A;  2JHE A;  3BFG A;  3WS1 A;  3HLC A;  4FH2 A;  1VB6 A;  4Y7P A;  3MZF A;  4BL2 A;  1IYQ A;  3SZT A;  3CLO A;  1G6O A;  1MWU A;  4OKP A;  3CUE A;  1D1J A;  2IWB A;  2Z2M B;  3ZG8 B; 
#chains in the Genus database with same CATH homology
 2A3U A;  2DCF A;  3G4P A;  4R23 A;  4X56 A;  4WEJ A;  2R9X A;  5HFO A;  1E25 A;  4X55 A;  2EX9 A;  3HLD A;  4JPM A;  5EOE A;  5A93 A;  4FSF A;  4LV3 A;  4DE0 A;  2ZQ9 A;  3NCK A;  4LCM A;  5AQB A;  1KDW A;  4E6X A;  1LHY A;  5FA7 A;  5EOO A;  3I7J A;  2Y2O A;  2Y2Q A;  1W5D A;  1HVB A;  4OOL A;  5FSR A;  3WS0 A;  1K56 A;  2ZD8 A;  2R9W A;  1PI5 A;  1EWZ A;  1M6K A;  3WS5 A;  4UA6 A;  2EFX A;  3OPH A;  1N9B A;  2Q9N A;  2EFU A;  4HBU A;  3GQZ A;  5CEC A;  3S22 A;  2Y2K A;  3A3E A;  3ZCZ A;  1RGY A;  4QY6 A;  3HRE A;  2BLS A;  1ES2 A;  1S6R A;  3M2K A;  4S2N A;  1TVF A;  1IYO A;  3QHY A;  5FI6 A;  4E3M A;  2Y2L A;  1MWS A;  3IF6 B;  4EQI A;  4PM6 A;  1CEF A;  3IF6 C;  1J9M A;  3OC2 A;  4K0X A;  1BLH A;  4S2K A;  4X69 A;  2Q9M A;  3IT9 A;  4KEN B;  4L0L A;  1DY6 A;  1YLY A;  2DNS A;  2VGK A;  2A49 A;  1W7F A;  4E3I A;  2IWC A;  2WZX A;  1MBL A;  4OH0 A;  3UDF A;  2E8I A;  2Z2M B;  1YLT A;  4OP5 A;  4BLM A;  5E2F A;  2RL3 A;  3G34 A;  4S2L A;  4ZJ2 A;  4KQO A;  4O7D A;  3BM6 A;  3V39 A;  1BZA A;  4JF5 A;  3LCE A;  3CG5 A;  4DKI A;  3ITB A;  4DXB A;  4X53 A;  4N9K A;  3ZNY A;  1BTL A;  1BLC A;  5F1G A;  4ZBE A;  1M40 A;  2P9V B;  2RCX A;  2OSU A;  4GKU A;  4JXG A;  3G2Z A;  1WYC A;  2JC7 A;  4R4R A;  2Y2P A;  1FSY A;  3GSG A;  3MKE A;  3NC8 A;  4PM5 A;  1KE3 A;  3CJM A;  2Y2M A;  2Y55 A;  5AQ9 A;  4GDB A;  3W4O A;  4NK3 A;  4OLD A;  4OPQ A;  1SDN A;  3NDE A;  3OPP A;  1YMX A;  1KGF A;  1HTZ A;  1XGI A;  4E3O A;  3VOY A;  3IXB A;  5FI7 A;  2WZZ A;  1KE4 A;  3RJU A;  2GDN A;  1YLJ A;  2ZQD A;  3C4P A;  3OZH A;  5EVI B;  3VFH A;  3VP3 A;  5EVI C;  3DTM A;  4EUZ A;  2XR0 A;  3FZC A;  3UPN A;  3Q7V B;  4GZB A;  4BL3 A;  3EQU A;  5GHZ A;  3SOI A;  2V1Z A;  1I2W A;  4EBL A;  5TR7 A;  3BEC A;  4EWF A;  5FDH A;  4KZA A;  3HLB A;  4DE1 A;  2J9P A;  1TEM A;  3PAG A;  4ZJ1 A;  3A3J A;  1W79 A;  3UY6 A;  1EI5 A;  2WGV A;  1GA9 A;  1PWG A;  4MBK A;  1JVJ A;  3DWZ A;  1BUL A;  1K38 A;  4KQQ A;  4KZ5 A;  2XFT A;  1K57 A;  4BEN A;  1XGJ A;  4B88 A;  3S1Y A;  4DDY A;  2HDR A;  1K4E A;  2UWX A;  2X71 A;  1ONH A;  1FQG A;  5A92 A;  3VSL A;  1L0D A;  5EUA A;  4Z9Q A;  1FSW A;  5CGS A;  1I2S A;  2Y91 A;  1IEL A;  3BFE A;  2Y2I A;  4F94 A;  5EPH A;  1PW8 A;  5EVI D;  1NY0 A;  2WK0 A;  4HEF A;  5BOH A;  3UPO A;  5M1A A;  5JYP A;  2ZQ8 A;  3UDI A;  4QJG A;  5CHJ A;  1L0E A;  3D4F A;  1IEM A;  1NZU A;  4PMA A;  1ERQ A;  4OPR A;  3N8S A;  1K6S A;  2FFF B;  5GL9 A;  2HP6 A;  5CED A;  3PBR A;  1VM1 A;  2EXB A;  4E3L A;  3IH9 A;  3VP0 A;  4JBF A;  2Y2G A;  4JXS A;  4A5R A;  2ZQC A;  4KZ8 A;  1ES3 A;  1ESU A;  1JWV A;  4PM8 A;  3VSK A;  3ZG9 B;  3FV7 A;  4N1X A;  4JKT A;  5FQJ A;  1ESI A;  3V5M A;  4E6W A;  5EE8 A;  4M3K A;  4OOM A;  5L2F A;  5F82 A;  3UNW A;  2ZMA A;  4BD0 A;  1G6A A;  4RYE A;  3Q7Z A;  4QHC A;  3TG9 A;  4N1H A;  2J9O A;  1NYY A;  1XA7 A;  3ZDJ A;  4DE2 A;  5IHV A;  5TFQ A;  3AGD A;  4FD8 A;  4PPR A;  1KE0 A;  2XH9 A;  2HP9 A;  2ZC6 B;  4JXW A;  2XD5 A;  3CZD A;  4K91 A;  2EX8 A;  3IF6 A;  4KG2 A;  2PBY A;  1E4D A;  4OPZ A;  3UE0 A;  5GLB A;  1DJC A;  3MXR A;  5TGF A;  1CI9 A;  4Y0T A;  3P98 A;  4MLL A;  3GTC A;  1DJB A;  3BLM A;  5HW3 A;  3JYI A;  5CHM A;  1WE4 A;  5CTN A;  4CJN A;  5FAT A;  2ZM2 A;  1QME A;  5CTM A;  5AQ7 A;  4GB7 A;  3O87 A;  1YQS A;  3M6H A;  3M6B A;  4R3B A;  3G30 A;  3UO9 A;  1IYS A;  1PZO A;  2WAE A;  1PW1 A;  2JE5 A;  4KZ3 A;  1AXB A;  5EVL A;  3E2L A;  1NRF A;  4UHU A;  4WMC D;  3DWK A;  4R4S A;  3O88 A;  1IYP A;  2ZC4 B;  1JTD A;  2P9V A;  1O7E A;  2ZC3 B;  5FQQ A;  3MZD A;  3BFC A;  3GV9 A;  4U3T A;  4UA9 A;  4ID4 A;  4QY5 A;  3Q1F A;  3VFF A;  1FCM A;  3AGF A;  4UA7 A;  5GHY A;  1RGZ A;  4K0W A;  2WGI A;  1K25 A;  3G31 A;  1PIO A;  1XXM A;  1VQQ A;  3GVB A;  3N8R A;  5DF8 A;  2VGJ A;  4IVK A;  3PBS A;  4MBF A;  3S4X A;  4OQ0 A;  4RVA A;  2CC1 A;  3MZE A;  2BG1 A;  1H8Y A;  5CHU A;  4OLG A;  5EVI A;  5E2E A;  5A90 A;  3PBQ A;  2XGN A;  3TSG A;  3FKW A;  2PU2 A;  5DVA A;  3SH9 A;  1H5X A;  4DE3 A;  2FFY A;  1YLZ A;  3IHA A;  1KVL A;  3ZVW A;  5E2H A;  3HUO A;  1XPB A;  3IWO A;  5DTK A;  1FCN A;  1L0F A;  1Y54 A;  4E3J A;  4YFM A;  3DW0 A;  1G68 A;  3HVF A;  4RX2 A;  2J8Y A;  3WRT A;  2ZM0 A;  2QPN A;  3IH8 A;  4GN2 A;  3Q81 A;  4RA7 A;  4GOG A;  5FQK A;  3BRM A;  3BFF A;  4FH4 A;  4XUZ A;  2ZC5 B;  3ZG7 B;  1LLB A;  4WZ5 A;  1OME A;  3QNC A;  3O86 A;  2XK1 A;  3IF5 A;  4QU3 A;  3NBL A;  1ES5 A;  3NI9 A;  3G32 A;  3ZG5 A;  3MXS A;  3ZNT A;  1CEG A;  4IBR A;  4MBH A;  4DF6 A;  4ZAM A;  4JXV A;  4Y0U A;  1XKZ A;  1LL9 A;  3ZFZ A;  5GLA A;  2ZLY A;  2Y59 A;  4WBG A;  1JTG A;  2XFS A;  4C75 A;  3HLF A;  1RP5 A;  3PAE A;  4JF4 A;  5DF7 A;  2WUQ A;  4GNU A;  4WEK A;  1N4O A;  1E3U D;  4WZ5 C;  2JCH A;  3GRJ A;  5DTT A;  1KGE A;  1IKG A;  3CMZ A;  4QD4 A;  4WYY A;  1K54 C;  3NIA A;  4BJP A;  1MPL A;  1BLS A;  2HDU A;  4GD8 A;  4OQI A;  4DXC A;  3BEB A;  2HPB A;  5DF9 A;  4QB8 A;  4ZTK A;  3SH7 A;  2XQZ A;  3ZG0 A;  4P87 A;  3VOZ A;  2Y4A A;  4RX3 A;  3ZGA B;  4XXR A;  3PBO A;  4WMC A;  1H8Z A;  1Q2Q A;  4JLF A;  2Y2N A;  1DJA A;  3NY4 A;  3UE1 A;  5FAQ A;  4ZJ3 A;  1XX2 A;  1CI8 A;  1PWD A;  3G2Y A;  4WEL A;  4S2O A;  4X6T A;  3WS2 A;  3IXG A;  3SS4 A;  2WAD A;  4LEN A;  4UAA A;  5FAP A;  5FAS A;  4E3N A;  2WKH A;  3IWI A;  2EXA A;  1ES4 A;  5D3O A;  3MKF A;  3C7U A;  2X02 A;  4GD6 A;  4N9L A;  5GLC A;  3P09 A;  3UN7 A;  1GCE A;  1GHI A;  3PTE A;  5CEB A;  4OQG A;  5KZH A;  1QMF A;  5JYO A;  1YT4 A;  3Q82 A;  3UDX A;  4IBX A;  3W8K A;  5J8X A;  3LY3 A;  4NET A;  1MKI A;  3G35 A;  1K6R A;  3E2K A;  4OON A;  1HD8 A;  2EX2 A;  5KSH A;  1PYY A;  4KZ4 A;  5EEC A;  1PI4 A;  2OLV A;  2WGW B;  3RXW A;  4OVD A;  3W4Q A;  3W4P A;  1ONG A;  2XDM A;  4PM9 A;  5HX9 A;  3IXD A;  2ZJ9 A;  3GR2 A;  2C6W B;  2PU4 A;  1KGG A;  4KG6 A;  2WKE A;  2XD1 A;  2OLU A;  1NZO A;  3HLE A;  2B5R A;  1MWR A;  3LY4 A;  5HAP A;  3GMW A;  3IWQ A;  1SKF A;  1TDL A;  1C3B A;  2C5W B;  1YLP A;  4LV2 A;  2ZC7 A;  4S2I A;  4BD1 A;  1ZKJ A;  4B4X A;  1LI9 A;  2HP5 A;  3LO7 A;  4H8R A;  4KG5 A;  1LI0 A;  2H5S A;  1NYM A;  1YMS A;  3HL9 A;  2WAF A;  4LV0 A;  1ZC2 A;  5E43 A;  4EV4 A;  4OQH A;  3PBN A;  1XA1 A;  1W8Y A;  1IKI A;  4LV1 A;  3HUM A;  4IVI A;  5FI2 A;  3RXX A;  4S2P A;  5KSC A;  3TOI A;  4MEZ A;  2V20 A;  3BFD A;  5HAI A;  1ZG4 A;  4BQM A;  4OP8 A;  3C4O A;  4XUX A;  1E3U A;  4WZ4 A;  2V2F F;  4X68 A;  1FCO A;  1K4F A;  4S2M A;  3VMA A;  1K55 A;  1BUE A;  3WWX A;  3MFD A;  1GA0 A;  3IXH A;  5G18 A;  5FQM A;  5KMW A;  3NDG A;  2WKI A;  2G2W A;  1BLP A;  4R3J A;  4R0Q A;  1O07 A;  2Y2J A;  3OPR A;  3Q7V A;  2EX6 A;  3PBT A;  4LCL A;  5U47 A;  1SCW A;  3OPL A;  3SS3 A;  3WS4 A;  1Z6F A;  2ZM8 A;  1GHM A;  1MY8 A;  3BYD A;  3M2J A;  3WRZ A;  3FYZ A;  3IHB A;  2G2U A;  5E2G A;  2ZQA A;  4S2N C;  4HBT A;  3N7W A;  1SHV A;  1ERM A;  1JWZ A;  3N6I A;  3HLW A;  2Y2H A;  1YM1 A;  5HAQ A;  5M19 A;  3HLG A;  1K55 C;  4S2J A;  2QZ6 A;  1L2S A;  1PZP A;  3VP1 A;  4U0X A;  5GLD A;  4KZB A;  4DDS A;  1HZO A;  1NXY A;  2X01 A;  5F83 A;  3FWL A;  2Z2L B;  4P85 A;  1K54 A;  4HES A;  1YLW A;  2I72 A;  5FQI A;  4KZ9 A;  2H0Y A;  4P0M A;  4U0T A;  2DRW A;  4YIN A;  3QNB A;  1K56 D;  2WYX A;  4R1G A;  2OV5 A;  4C3Q A;  3LEZ A;  3SS5 A;  4C6Y A;  3AGE A;  1ZG6 A;  4PM7 A;  5CXW A;  5FAO A;  1L0G A;  4FCF A;  4B4Z A;  4GDN A;  1BSG A;  1FOF A;  4IED A;  1KDS A;  3ZHH A;  3V50 A;  3OCN A;  1FR6 A;  2JBF A;  3C5A A;  1FR1 A;  5M18 A;  2XLN A;  5F1F A;  3VP4 A;  5CRF A;  5HAR A;  3FKV A;  4MNR A;  4KZ7 A;  3A3D A;  2J7V A;  3N8L A;  1NJ4 A;  4D2O A;  3HBR A;  4P6B A;  3ZVT A;  4E3K A;  4Q8I A;  1MWT A;  1SDE A;  4KQR A;  3B3X A;  4Y0O A;  4OPY A;  4WM9 A;  1JWP A;  3V3S A;  2IWD A;  1PWC A;  1GHP A;  1TDG A;  2HDQ A;  3C7V A;  3O3V A;  5DTS A;  3IQA A;  1S0W A;  2XEP A;  3UPP A;  1Q2P A;  1ERO A;  4JF6 A;  1CK3 A;  2H0T A;  5FQ9 A;  4N92 A;  5CER A;  3MBZ A;  1BT5 A;  1I5Q A;  2WGW A;  5CGX A;  1U60 A;  2XF3 A;  2ZQ7 A;  2QMI A;  2P74 A;  5GHX A;  4ZDX A;  2HDS A;  1ALQ A;  4EBN A;  5HL1 A;  3A3F A;  1KVM A;  3HUN A;  3VP2 A;  3A3I A;  4DRT A;  4OOY A;  4CPK A;  1RCJ A;  3ITA A;  3BFG A;  3WS1 A;  3HLC A;  4FH2 A;  5AQA A;  2H10 A;  5CGW A;  1K57 C;  4Y7P A;  5A91 A;  3MZF A;  4BL2 A;  1WYB A;  1IYQ A;  4KZ6 A;  3V3R A;  1XP4 A;  3N4I A;  1MXO A;  3BLS A;  1MWU A;  3Q07 A;  5I94 A;  3EQV A;  4OKP A;  3OCL A;  1LL5 A;  3ISG A;  3UE3 A;  3SH8 A;  4EBP A;  2IWB A;  1W8Q A;  3ZG8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...