2W1TA

Crystal structure of b. subtilis spovt
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
175
structure length
175
Chain Sequence
ATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGDVILKKYSPISELGDFAKEYADALYDSLGHSVLICDRDVYIAVSGSSKKDYLNKSISEMLERTMDQRSSVLESDAKSVQLVNGIDEDMNSYTVGPIVANGDPIGAVVIFSKDQTMGEVEHKAVETAAGFLARQME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords STAGE V SPORULATION PROTEIN T
publication title Crystal Structure of Spovt, the Final Modulator of Gene Expression During Spore Development in Bacillus Subtilis
pubmed doi rcsb
source organism Bacillus subtilis
total genus 43
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04014 MazE_antitoxin Antidote-toxin recognition MazE, bacterial antitoxin
A PF15714 SpoVT_C Stage V sporulation protein T C-terminal, transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.260.10 Mainly Beta Ribbon Pemi-like Protein 1; Chain: D Pemi-like Protein 1; Chain: D 2w1tA01
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w1tA02
2M7VA 2XRNA 3TRCA 5TJJA 4ME4A 3S7PA 3BJNA 2W3DA 3IBRA 4Y3IA 2GX5A 1F5MA 4FOFA 1MVFD 3OBFA 2M7UA 2VEAA 2O9CA 4BWIA 4CQHA 3EEAA 2W1TA 3K2NA 4G3WA 2GLWA 2VZWA 3OOVA 3S7NA 3S7QA 3KSGA 1TD5A 3O27A 4IUKA 2K1NA 4PAUA 4G3KA 5AJGA 1TF1A 4G3VA 3O5YA 5ITMA 4IUHA 2L66A 3RFBA 2KOIA 5I5LA 2XSSA 3KSHA 4YOFA 3DBAA 1Z0RA 4MCWA 2RO4A 5LBRA 4EUVA 5HPFA 4LRXC 2W3HA 3CITA 2OOLA 1UB4C 1MKMA 4ZRRA 2HGVA 2K31A 4Q0JA 3IBJA 4Y5FA 4Q0IA 2Y79A 4O0PA 4QPRA 4MN7A 1STZA 4O8GA 3HCYA 4DMZA 2G7UA 4GLQA 5DFXA 2Y8HA 2B18A 4IJGA 5HSQA 2O9AA 3G6OA 2XROA 2O9BA 2W3EA 3E0YA 3NOPC 4GW9A 2W1RA 4Q0HA 2W3GA 4R70A 4DN0A 3MQ0A 2FY9A 1ZTUA 3TNDB 4LRZE 4ETZA 4LRYC 4E04A 1YSQA 2QYBA 4Z1WA 3KO6A 1YKDA 4RQ9A 2LB9A 2ZMFA 5HL6A 5ITJA 3NOUC 2W1TB 3R4KA 4Y2FA 4ETXA 2IA2A 2RO3A 4EU0A 3VV4A 5C5KA 1MC0A 5L8MA 4R6LA 4MDZA 4MMNA 3W2ZA 1YSPA 5DFYA 3KSFA 2RO5A 3CI6A 3ZQ5A 5K5BA 3MF0A 2O99A 2O0YA 1YSFA 2K2NA 2KLIA 2VKSA 3E98A 2VJWA 3S7OA 1VHMA 1YFBA 3C2WA 3NHQA 2LB5A 4YNRA 2W3FA 4O01A 3MMHA 3D3OA 5HPIA 3KSIA 3LFVA 3NOTC
chains in the Genus database with same CATH superfamily
1WA9A 4ZTKA 4JGPA 3S7PA 3IF6B 2RL3A 3WWXA 1VETB 3FYZA 4CQHA 3LEQA 5AVEA 3TOIA 3S7QA 4EBLA 1ZHHB 3O86A 2ZQAA 4WELA 2J3WA 1GHMA 4BMWA 4HJ6A 3MZFA 4B93A 5GL9A 4M3KA 1OJGA 3HLCA 5G18A 4CLCD 1BLHA 4QD4A 3BLMA 2J80A 2KOIA 3C5AA 3HREA 1RCJA 3DBAA 1XGJA 1K6RA 3IXHA 4ZJ3A 1E3UD 3IBJA 1LT0A 2ZOIA 4JGQA 2QKPA 3K3CA 3BQ8A 2BLSA 4KZ4A 5L07A 4LGWA 2W3EA 4H6JB 3WS1A 3IX8A 2V0WA 3BM6A 5EVEA 4JXSA 1VB6A 1S1YA 4WL9A 4EWFA 1ES5A 3MQ0A 3MXSA 5TFQA 4P85A 3IF6C 1K56A 5EFWA 5F1GA 3C8CA 4LV3A 4OQGA 3ZNYA 3OPPA 3GDIA 1S4SA 1TDLA 2HDQA 5FI6A 4I3AA 5KSCA 1IKGA 5CGSA 1XJ2A 1BT5A 3UE6A 4IHQA 1P9RA 4PM7A 1Q2PA 3T4LA 2EX8A 2R9XA 1FR1A 2WKEA 3FPVA 2G2WA 4IVIA 2JE5A 2PU4A 1NJ4A 1CF0A 4R0QA 4D2OA 1P9WA 2O9CA 2VV8A 2ZOHA 3UB7A 3H82A 1FQGA 3CWFA 4E3KA 4HBTA 1NWZA 3F1OA 3B3XA 2HP6A 4ID4A 4YOFA 4DE1A 4X25A 1H0MA 1VQQA 3K3DA 4LRXC 3NDGA 4GDBA 3V39A 3VE4A 3VFFA 4X56A 1EROA 2ZC7A 2D01A 4JGRA 3IWOA 4WZ5A 1V9ZA 3MS6A 3VFHA 1H8ZA 2K7SA 2XD5A 2O9BA 3F1NA 4KZ6A 3ZG8B 2XF3A 2JKTI 3A0SA 2HDSA 1LL5A 1IYSA 2WKPA 4I39A 2EWVA 4L9FA 2JBFA 2YKHA 3F1PB 4JDMA 1UWPX 3T50A 2WADA 2OAQ1 3A3FA 3CLOA 5C5KA 3C38A 1FR6A 1FSWA 4YINA 3R7WB 3UE3A 1GA0A 3CI6A 5AQ9A 1ES4A 1YSFA 2WZZA 3G4PA 4JGOA 2HV1A 2Y2MA 1F9IA 4WLAA 2W3FA 2L4RA 3D3OA 1S0WA 2M7VA 1VEUB 2C5WB 1LSXA 4BL2A 3BLSA 4BWIA 2ZQ8A 4RA7A 4G3WA 1OTEA 2GLWA 3OOVA 4U0TA 3KSGA 3KX0X 1CEGA 1KE0A 3HUOA 3VOLA 1DP9A 4DXBA 1LSWA 1KGEA 1LI9A 4HHDA 1ERMA 2Z6CA 4KQQA 1QMFA 5IU1A 2L66A 2X02A 5J3WA 3N7WA 1PZOA 3ZVTA 2G2UA 2L1MA 1IKIA 1YLYA 5LBRA 5DKKA 5HPFA 2WKQA 5KZHA 3N8SA 4LV2A 4MN7A 4FSFA 5EUAA 2G7UA 2ZC6B 4ZJ2A 5CGXA 3Q7VA 4PMAA 1PI4A 4Y0OA 5HAQA 3BFEA 4UQIS 3CMZA 5TBMA 1ODVA 4Q8IA 3CPTB 1JNUA 3MQQA 3NULA 3PBRA 4E6WA 5AQAA 3D72A 1ZC2A 1OT6A 3VV4A 2Y2IA 4C6YA 1CK3A 4ESPA 2XA7M 4N1HA 4LV1A 5K5BA 2I72A 4EEPA 1DY6A 3O88A 4Y17A 2X71A 1SKFA 3UE0A 4E3MA 4KUOA 2OAP1 1PRQA 2R78A 1S4RA 2FFFB 4HESA 3OPLA 4ME4A 1J3WA 2P04A 5EVIB 5F6AA 2VZWA 3LIFA 2FH5A 1D7EA 1IOUA 4FCFA 4R4SA 5A8BA 2Y4AA 3GECA 5AVFA 1OMEA 1IEMA 3ZG5A 4X53A 1K57C 4DDSA 3BFGA 4X68A 2J3TC 2V2FF 1LL8A 5U47A 3VP1A 3GMWA 3PBOA 2W3HA 4ZRRA 4UHUA 5J8XA 2BTFP 3IWQA 3SH7A 5G4ZA 2BG1A 1YT4A 2MJ6A 2INWA 1FOFA 4E3NA 4NETA 4ARZB 2CC1A 3Q82A 4N92A 5FI7A 1YAXA 2ZQDA 5FATA 5L2FA 2HDUA 4EETB 1I2WA 4HI4A 1NRJA 3MKEA 4YWZA 2P9VB 2H28A 2Y2LA 4NK3A 4RQ9A 5FASA 1S1ZA 2QZ6A 3SH8A 2VV6A 3R4KA 4BL3A 5E2GA 4LENA 4MDZA 1WYBA 3G2ZA 5DKLA 3NBLA 3ZG9B 4DE3A 1ACFA 3PBNA 1IYQA 1DJAA 4HNBA 4O01A 1TS8A 1BLPA 2M7UA 4OPZA 5GHXA 2HJ9C 4OQIA 3V67A 4EESA 4OP8A 2J7VA 4MNRA 1NZUA 3HLDA 1MKIA 3S7NA 4S2PA 3A3DA 1OPXA 2PR6A 4R38A 2EXAA 2UV0E 2IWDA 1D06A 3UMEA 3IS2B 4OP5A 5EV0A 4NXBA 2EXBA 1PZPA 2PD8A 4IUHA 1NXYA 3BECA 3N8LA 3G31A 5CTNA 1KOUA 2ZBBA 3LO7A 4OQ0A 3BFDA 3BRMA 1STZA 4N9KA 3UO9A 3WS5A 4OONA 5D3OA 3RH8B 1PWCA 4HY8A 2WGWA 4GJ4A 1W63Q 2ZMAA 4B9OA 1JWPA 3NOUC 5KSHA 2EX9A 3SW1A 3NJAA 4QB8A 4EQ1A 4OQHA 1K57A 2R9WA 3VMAA 1XP4A 3T12B 1HTZA 4BD0A 3EGXC 1E4DA 4IBXA 3S7OA 2WGVA 3WS0A 4HJ3A 4DJ2A 1I2SA 4CJNA 3VE3A 4EV4A 4GS9B 5HDDA 3BJNA 3KYEA 4K08A 4KG5A 1L2SA 3LEZA 4CPKA 5EE8A 1S6RA 1OTDA 1FIKA 2ZC5B 1FCOA 3T4QA 2OWHA 4P87A 2OLUA 5FQIA 1H5XA 1TVFA 5I5LA 3P98A 3T1RA 5FA7A 4GKUA 4X1LA 2QA4I 3NDEA 3WS2A 2WKRA 1GHIA 5FQJA 3BQAA 3FZCA 2PHYA 4JDOA 1U60A 3LIAA 4S2OA 3GRJA 1SHVA 2EFXA 4DMZA 4PM8A 1XA1A 1QMEA 4WUJA 1KGFA 5EECA 3V50A 4OLDA 4HEFA 5FQMA 3IXGA 1KDSA 1GSXA 3LY3A 2JKTM 3LYXA 4OKPA 5EOEA 3ZG7B 2HF6A 1YSQA 3FKWA 2DCFA 4MBKA 1ONGA 2RO3A 3NIAA 4GNUA 1MC0A 5MC7A 3T1XA 2P9VA 1KVMA 5DFYA 4IEDA 2VGLS 1TS7A 3Q1FA 1EWZA 5DJUA 3EQUA 3C4OA 1M6KA 5DF9A 1GA9A 3DAVA 4WMCA 3KSIA 2B95A 3MZEA 1JVJA 4LLOB 3JVUA 4JF6A 1K38A 4OPQA 4CLCB 3SOIA 4CLCE 3U2AA 1F5MA 2A24B 3GSGA 1MVFD 1YLZA 1SDNA 4OOYA 1DP8A 2XLNA 5HARA 5HW3A 1IFQA 3LI8A 4GDNA 3ITBA 1H8MA 1OJ5A 3NC8A 3JVVA 3T1SA 3BFCA 3T4OA 1L0FA 2V1ZA 5CX7A 2ZLYA 4PKYA 2VGKA 4MLLA 1PWGA 3AGEA 5GLDA 4Q0JA 5AQBA 3Q07A 1YMSA 3HJKA 2PAVP 2FZ0A 1XFQA 3A3JA 4GD8A 5EVLA 3A0RA 3BYDA 2XH9A 3UPPA 5M1AA 2XROA 1J9MA 4KQRA 4Q0HA 4GZBA 2QJ5A 1PI5A 2FY9A 1OT9A 1KE3A 4LRZE 2P74A 4LRYC 4EEUA 4S2NC 2RCXA 5ITJA 2W1TB 3MZDA 2ZMVA 3MKFA 1K55A 1MBLA 2EWWA 4MBHA 3UB8A 2O99A 3H7WA 1MWRA 2JKRI 4DJ3A 5GHYA 2XDMA 2WKHA 1ONHA 4YNRA 3NHQA 1TS0A 1UWNX 1JTGA 1YPRA 2XFSA 3M2JA 1ESUA 2QWSA 5M19A 2PBDP 4Y13A 3OBFA 5CGWA 3U4LP 3EEAA 3T4TA 3K2NA 2CMNA 5HFOA 2Q9NA 1XJ6A 1TD5A 3T4SA 3RTYA 4PAUA 3DTMA 1EI5A 4NXEA 5L09A 3BFFA 5ITMA 2Q9MA 5FSRA 4K91A 1SCWA 2HJEA 5HX9A 1Z0RA 3UPNA 2RO4A 4EUVA 3CG5A 1BUEA 4BBTA 4U0XA 1LLBA 2WGIA 4O0PA 4Y0UA 3VOZA 2WAEA 1ESIA 3IF6A 1FCMA 3FC7A 5A93A 1EW0A 4ZBEA 4EBPA 1MWUA 5L10A 1VETA 3LIDA 3NCKA 4R1GA 4PHTA 4XUZA 1PWDA 5A90A 3SS4A 2E8JA 3HL9A 1P0ZA 2J3TD 4BQMA 2WKIA 4PM6A 1ES3A 1YLTA 4FTXA 3W4OA 4JPMA 3IX4A 3W4PA 5J4EA 1LL9A 2NUPC 1I5QA 3FWLA 2Y2JA 3ZQ5A 4GB7A 5EM1A 2Z6DA 5HAIA 3L9KA 3S22A 2JC7A 2VKSA 4XT2B 3C30A 1N9OA 4B4ZA 2JHEA 5HDCA 4H6JA 1M40A 3LFVA 1E25A 2QHKA 4S2KA 2A49A 5E2FA 2GDNA 2I9VA 3T4KA 3QNCA 2XQZA 1N4OA 4XUXA 3EQVA 1GHPA 1O7EA 4YFMA 1IYPA 4UEYA 1TEMA 2J9OA 1TF1A 4G3VA 3QP8A 4EW7A 1XJ4A 2XD1A 4L9GA 2ZD8A 4PM5A 2Y2HA 5FAQA 3RFBA 2H0TA 4KG6A 3ZCZA 4QU3A 3MFXA 3CHWP 4S2MA 1W8QA 3N4IA 3W4QA 4Y5FA 3MXQA 4WZ4A 3WRZA 4BENA 4JF5A 1C3BA 3OLOA 3G6OA 4UA7A 4XXRA 1MY8A 4FH2A 4R70A 1SKOB 4KZAA 3VOYA 4JXGA 5FAPA 3V5MA 5KIZA 4DE2A 1NY0A 4PKYG 3ULFA 1K54C 2E8IA 3ZDJA 1FCNA 1Y54A 2Y2OA 4X55A 5L8MA 4P6BA 2X01A 4WMCD 3W2ZA 1UGUA 3W8KA 2RO5A 1NZOA 2O0YA 3HLBA 5CEDA 1YLJA 4OPYA 1ZG4A 3VP3A 2EX6A 5EVIC 4IBRA 2ACGA 1VM1A 2YKFA 3G30A 3L7HA 1K25A 5CHUA 4KZ3A 3E4OA 2H0YA 2V1BA 1G5UA 4A5RA 1F2KA 3IBRA 4Y3IA 3IQAA 1DJCA 3F1PA 2ZC3B 2VEAA 5F68A 1F98A 5TR7A 1NLYA 1W7FA 3GQZA 2OSUA 3R7WA 3PBSA 3VSKA 2HDRA 4DXCA 5FQQA 4GD6A 3CUEC 3O5YA 1BTLA 4KUKA 3NI9A 3IXDA 3PAGA 1OTBA 2H10A 3KSHA 3LIBA 4L9EA 2Y2KA 4WF0A 5EM0A 4K0WA 3EOIA 5CRFA 3UN7A 2K31A 4R23A 5F82A 5CTMA 3DTIA 3PR6A 4C75A 1VEUA 4O8GA 5DFXA 4EBNA 1NYYA 5HSQA 3NECA 2P08A 4FH4A 4GW9A 3FG8A 4Y7PA 5HZHA 5FQ9A 2VV7A 2IWCA 5E2HA 1AWIA 4RYEA 4HP4A 2Y91A 4E04A 4X69A 1RP5A 2QYBA 4Y0TA 2EFUA 2LB9A 3N8RA 5HL1A 3LY4A 1W5DA 2VK3A 3H82B 2C6WB 1BZAA 3P7NA 3RXXA 2WZXA 1K4EA 5EOOA 3F1OB 4MN6A 1HVBA 4KZ9A 1LI0A 2JKGA 4UA9A 3QP2A 3PTEA 1L0GA 1VHMA 3G35A 3OC2A 4P0MA 3E4QA 3MXRA 1YQSA 3G2YA 3D4FA 3HLWA 4QHCA 3MMHA 4LV0A 4JKTA 2W3DA 2GX5A 5F1FA 3E2LA 2PBYA 3CPTA 4S2IA 2Y55A 3F1NB 4AFIA 3M6BA 1YLWA 3OCNA 3IH8A 2M1CA 3IT9A 1K54A 5I94A 4X1MA 5AJGA 3LI9A 1TS6A 4NEED 3IF5A 3QP5A 5AQ7A 2OV5A 1NYMA 1H8YA 3O3VA 1HD8A 3ZVWA 2XSSA 3UY6A 2EA9A 1W8YA 2Q0OA 4HIAA 1Y4OA 5CERA 2J8YA 1MKMA 3G34A 1L3LA 3QP1A 4OLGA 2V8FA 4OVDA 1IELA 5GLAA 3E2KA 3B42A 1W79A 3OPRA 5EVIA 3VP2A 5HD3A 2ZQCA 4JXWA 3LR4A 4HJ4A 1BYWA 3MQOA 3MJQA 4WN5A 3V3SA 3E0YA 3NOPC 1XGIA 1YMXA 3LCEA 1CEFA 1TDGA 3BEBA 3ZG0A 3HBRA 4R4RA 1GCEA 3UMDA 4BLMA 5HL6A 1MXOA 4ETXA 4Y2FA 1KVLA 4NG2A 1MWTA 4II7A 3CUEA 1ES2A 3PXPA 5JYPA 1GSWA 4ARZA 4DKIA 3CJMA 2Y2PA 3C4PA 3UPOA 5G4YA 4KZBA 4I5SA 2JKRM 4R3BA 2VX8A 3DWZA 2Z2LB 1PNEA 4WBGA 4U3TA 4RVAA 1S66L 3RJUA 4FOFA 3Q7VB 3UDXA 4BBVA 3V3RA 4PPRA 2K1NA 4GOGA 4OOLA 5EPHA 2ZQ9A 4WEKA 5TBMB 2WAFA 4BBUA 4S2LA 3KYQA 5F5YA 2EX2A 2W27A 4I38A 3N6IA 3UB6A 4QPRA 3HCYA 1Z09A 3HUNA 1K6SA 2B18A 2WYXA 3S1YA 1Q2QA 2O9AA 3RXWA 3LR5A 3DTEA 3QP4A 4FD8A 3DW0A 3BY8A 2XK1A 2KDKA 2PR5A 3A0VA 1ZTUA 3TNDB 3IS2A 3SH9A 1PYYA 1MWSA 5JYOA 3PYPA 4P6ZM 2D02A 4DRTA 1ERQA 3HLEA 2ZC4B 3GV9A 3H9WA 1L0DA 1S67L 3LR3A 2W0NA 1L0EA 1K0KA 3BWLA 3KSFA 1FILA 3MF0A 4BJPA 5IHVA 5FQKA 1N9LA 2FFYA 4CLCC 3PHYA 5CECA 4UA6A 2PDRA 2GJ3A 3LGOA 2V20A 3M2KA 4C3QA 2XA7S 2XRNA 3C7UA 4HBUA 5TJJA 4B4XA 3EWKA 3ZHHA 1N9NA 4RX2A 4KZ5A 4X6TA 3IX3A 5CHJA 1GSVA 2V1AA 3LIEA 1G68A 4Z9QA 1ZKJA 3O27A 3ICYA 2OLVA 2HPBA 3B33A 5DVAA 5DF7A 3MBZA 4D60A 4LCMA 3IWIA 3T4JA 3IH9A 4KG2A 2B02A 4L0LA 1ZG6A 2JCHA 3DTKA 4GS9A 1NRFA 1IYOA 2ZJ9A 1JWVA 4PM9A 3BY9A 3A3EA 3JPUA 4I3JA 4FUWA 4JF4A 5FDSA 3O87A 3FV7A 5HDSA 4BD1A 2HZ5A 4KQDA 4ZDXA 1FSYA 5CXWA 4ZAMA 1YLPA 3HVFA 2AVXA 4F3LB 3ZNTA 5DF8A 2ZL1B 1JWZA 4KQOA 4KZ8A 1T1AA 2V0UA 1K4FA 4HOIA 2VGLM 3BW6A 3ITAA 3NY4A 1YKDA 3TG9A 2ZMFA 2JN7A 3GTCA 3UB5P 3ISGA 4EU0A 3UE1A 2DMWA 5HWWA 4QJGA 2P7JA 1YSPA 5TGFA 4GHIB 1JTDA 5DTKA 4K0XA 2K2NA 4H8RA 1RGZA 1BSGA 1PW1A 4LPZA 4HH3A 1XJ3A 4RX3A 1XFNA 2XEPA 2PD7A 1MPLA 2VLGA 1Y28A 4JBFA 1G6AA 3MSHA 4GN2A 1MZUA 4KENB 3ZFZA 2PU2A 3LICA 5DJTA 1LHYA 2ZQ7A 2WGWB 3E4PA 2QPNA 2HP9A 4IUKA 4QWOA 5IS1A 4UAAA 5J7EA 3SS5A 3T1QB 1T1BA 3PAEA 3OZHA 3MR0A 5EVID 3UB9A 4MCWA 1W63M 4OPRA 5CEBA 4HQAA 4NXGA 4ZJ1A 1NLZA 1PFLA 5FAOA 1HLUP 4CLCA 3MFDA 5DTTA 1OTAA 4GLQA 5HWTA 4MBFA 2A24A 4S2NA 4IVKA 3FKVA 3VP0A 1HZOA 4M4XA 1YM1A 1PIOA 1E3UA 1N9BA 2W3GA 4DN0A 2WK0A 2V8CA 4QY6A 1XPBA 3D9YA 1CQAA 3SZTA 4N9LA 1LSVA 2VGJA 1BULA 4WYYA 4R6LA 1DRMA 4WM9A 2JKFA 3TE8A 3I7JA 4OH0A 2DRWA 5GLCA 3B47A 1DJBA 4QY5A 3CAXA 4EQIA 3P09A 2HP5A 4E3IA 5FI2A 3EEHA 5HPIA 2XFTA 3NOTC 3UDFA 4O7DA 5FL3A 4R3JA 3UNWA 1KE4A 1DP6A 2W1TA 5HD5A 5FEFA 3HLFA 3AGDA 4G3KA 1K56D 1XA7A 4Y15A 2VA0A 5IT5A 4NXFA 1OTIA 4JXVA 3WS4A 3IHBA 4E3JA 3CZDA 1XXMA 1BLCA 2OOLA 3SS3A 1UB4C 4LCLA 2HGVA 5CHMA 4HP9A 1CI9A 1D1JA 2Y79A 5M18A 5E2EA 4WEJA 1WE4A 1BLSA 1KGGA 2OWJA 4E6XA 2PT7A 5F83A 3PBQA 4DF6A 4S2JA 3OCLA 1KDWA 4B88A 3GVBA 3S4XA 4ETZA 1PW8A 2Y59A 2DNSA 2A2LA 4NKPA 3AGFA 1RGYA 1X0OA 4Z1WA 4UQIM 2ZM2A 4F3LA 4E3OA 2PRFA 2ZL1A 3VSLA 2PYRA 2XR0A 2Y2QA 5BOHA 4MMNA 5KMWA 4LFUA 5DTSA 1G28A 3ZGAB 1Z6FA 3E98A 1P97A 2VJWA 2V9AA 3C2WA 3QP6A 2LB5A 4R3AA 1WYCA 1AXBA 1XX2A 4GHIA 4MEZA 1T1CA 4F94A 3TRCA 1T19A 2B5RA 3FPWA 3P01A 4DDYA 4I3IA 4HH2A 1A0KA 5FDHA 3EGDC 5E43A 3OPHA 2IWBA 1CJFA 5A91A 2ZM0A 3IHAA 4EERA 2XGNA 3TJZC 2WUQA 2Y2NA 4XT2A 3TW8A 3KYZA 2Y2GA 5GLBA 2NUTC 3Q81A 2A3UA 1ALQA 3Q7ZA 3QHYA 2BASA 4JLFA 2J9PA 1XKZA 3CITA 5GHZA 3UDIA 1O07A 3WRTA 3PBTA 1T18A 1V9YA 4MN5A 2L0WA 5HAPA 4Q0IA 5HWVA 3G32A 4EUZA 3C7VA 2GNXA 2KX6A 2Y8HA 4E3LA 4IJGA 3H7WB 1SDEA 3A3IA 5A92A 1H3QA 2UWXA 2H5SA 5F69A 2W1RA 4OOMA 3DWKA 3QNBA 1G6OA 4GCZA 2Z2MB 4P6ZS 3KO6A 3HJIA 3LR0A 2GZAA 1CI8A 2IA2A 3ZYTA 5FEGA 2PYPA 4DE0A 4N1XA 3HUMA 3LUQA 4EXOA 3IXBA 3TSGA 3VP4A 2KLIA 2ZM8A 3GR2A 4WZ5C 2QJ7A 3HLGA 1YFBA 3JYIA 4KZ7A 3M6HA 1K55C 1SZVA 2QMIA 1SKOA
chains in the Genus database with same CATH topology
2XA7S 2QHKA 2XRNA 1WA9A 2HJ9C 4JGPA 5TJJA 3S7PA 3V67A 4EESA 3EWKA 1N9NA 1GSVA 2V1AA 3LIEA 2I9VA 4CQHA 3T4KA 5AVEA 3S7NA 3S7QA 1OPXA 3O27A 3ICYA 1ZHHB 4WELA 3EQVA 2J3WA 2PR6A 4BMWA 4HJ6A 4UEYA 4B93A 1TF1A 4G3VA 4R38A 3B33A 1OJGA 1D06A 3UMEA 4CLCD 4EW7A 3IS2B 4NXBA 1XJ4A 4L9GA 2PD8A 4IUHA 3RFBA 2J80A 2KOIA 3T4JA 3DBAA 3MFXA 2B02A 4L0LA 4GS9A 3IBJA 4Y5FA 1LT0A 1KOUA 2ZBBA 2ZOIA 3MXQA 4JGQA 2QKPA 3BY9A 3BQ8A 3K3CA 1STZA 4I3JA 3OLOA 3RH8B 3G6OA 5HDSA 4HY8A 4KQDA 2W3EA 4GJ4A 4H6JB 2V0WA 4F3LB 4R70A 1VB6A 1S1YA 4WL9A 3MQ0A 1W63Q 4KQOA 1T1AA 2V0UA 5KIZA 4HOIA 3ULFA 4PKYG 4B9OA 2VGLM 3BW6A 5EFWA 1YKDA 2ZMFA 2JN7A 3NOUC 5KSHA 4EU0A 2DMWA 3C8CA 5HWWA 3SW1A 3NJAA 5L8MA 2P7JA 3W2ZA 1UGUA 3GDIA 4EQ1A 1S4SA 1YSPA 4GHIB 2RO5A 4I3AA 2O0YA 2K2NA 1XJ2A 3UE6A 4IHQA 1P9RA 3EGXC 3S7OA 3T4LA 4HJ3A 4LPZA 4DJ2A 4HH3A 1XJ3A 2YKFA 3FPVA 3VE3A 1XFNA 4GS9B 2PD7A 2VLGA 1Y28A 3E4OA 2V1BA 5HDDA 3BJNA 4K08A 3IBRA 1MZUA 4Y3IA 3LICA 3F1PA 5DJTA 2M7UA 2VEAA 1P9WA 2O9CA 2VV8A 5F68A 1OTDA 2ZOHA 1F98A 1NLYA 3E4PA 3UB7A 3H82A 4IUKA 5IS1A 3CWFA 3R7WA 3PBSA 1NWZA 3T4QA 5J7EA 2OWHA 3F1OA 3CUEC 3O5YA 1T1BA 4KUKA 3MR0A 5I5LA 1OTBA 3KSHA 3LIBA 4YOFA 3UB9A 2QA4I 4L9EA 4MCWA 4WF0A 1W63M 3K3DA 2WKRA 4LRXC 3EOIA 3VE4A 3BQAA 4HQAA 2PHYA 2K31A 4NXGA 2D01A 4JDOA 3LIAA 4JGRA 1NLZA 3PR6A 4CLCA 4O8GA 1V9ZA 4DMZA 1OTAA 4GLQA 5DFXA 5HWTA 4WUJA 2A24A 5HSQA 2K7SA 2O9BA 3F1NA 2P08A 4M4XA 2JKTI 3A0SA 4GW9A 3FG8A 2W3GA 4DN0A 5HZHA 1GSXA 2WKPA 2VV7A 4I39A 2JKTM 3LYXA 2EWVA 4HP4A 4L9FA 4E04A 2HF6A 1YSQA 2QYBA 2YKHA 3F1PB 2LB9A 4JDMA 1UWPX 1LSVA 3T50A 2OAQ1 2RO3A 3CLOA 5C5KA 3C38A 1MC0A 4R6LA 3H82B 5MC7A 1DRMA 3TE8A 3R7WB 3P7NA 5DFYA 3UE3A 3F1OB 4MN6A 3CI6A 3B47A 2VGLS 1TS7A 3CAXA 5DJUA 1YSFA 1VHMA 3OC2A 4JGOA 2HV1A 3EQUA 1F9IA 4WLAA 3E4QA 5DF9A 2W3FA 3EEHA 2L4RA 3MMHA 3D3OA 5HPIA 3KSIA 3NOTC 4LLOB 2M7VA 3JVUA 4CLCB 5FL3A 2W3DA 4CLCE 2GX5A 3U2AA 1LSXA 1F5MA 2A24B 1MVFD 4BWIA 1DP6A 3F1NB 2W1TA 4AFIA 5HD5A 1OTEA 2GLWA 4G3WA 3OCNA 3OOVA 2M1CA 1DP8A 3KSGA 3KX0X 1IFQA 3VOLA 1DP9A 3LI8A 4G3KA 5AJGA 1LSWA 3LI9A 1TS6A 1H8MA 1OJ5A 5IT5A 2VA0A 3JVVA 4NEED 4HHDA 4NXFA 1OTIA 2Z6CA 3T4OA 5IU1A 2L66A 5J3WA 5CX7A 2XSSA 4PKYA 2EA9A 2L1MA 4HIAA 5LBRA 5DKKA 5HPFA 2OOLA 2WKQA 1UB4C 1MKMA 2HGVA 4HP9A 4Q0JA 2Y79A 4WEJA 4MN7A 3HJKA 4FSFA 2G7UA 2FZ0A 1XFQA 3B42A 5HD3A 3A0RA 3LR4A 2OWJA 4HJ4A 1BYWA 2PT7A 2XROA 3PBQA 3MQOA 3MJQA 3OCLA 4WN5A 3E0YA 3NOPC 4Q0HA 2QJ5A 2FY9A 1OT9A 4UQIS 4LRZE 4ETZA 5TBMA 2A2LA 4LRYC 4NKPA 1ODVA 4EEUA 1X0OA 4Z1WA 3UMDA 4UQIM 4F3LA 5HL6A 5ITJA 1JNUA 3MQQA 4ETXA 2W1TB 3PBRA 4Y2FA 2PYRA 3D72A 2ZMVA 1OT6A 3VV4A 4II7A 3CUEA 4MMNA 2EWWA 2XA7M 3UB8A 3PXPA 5K5BA 1G28A 2O99A 1GSWA 4ARZA 3E98A 3H7WA 1P97A 4EEPA 2JKRI 4DJ3A 2VJWA 2V9AA 3C2WA 3NHQA 2LB5A 4YNRA 1TS0A 1UWNX 4KUOA 5G4YA 4R3AA 2OAP1 4I5SA 4GHIA 2JKRM 2R78A 1S4RA 1T1CA 3TRCA 2VX8A 1T19A 3FPWA 4ME4A 2P04A 3P01A 2QWSA 1S66L 4FOFA 4I3IA 4HH2A 3OBFA 3EEAA 5F6AA 3K2NA 3T4TA 2CMNA 2VZWA 4BBVA 3LIFA 1XJ6A 1TD5A 3EGDC 3T4SA 2FH5A 3RTYA 2K1NA 1D7EA 1IOUA 4PAUA 4OOLA 4EERA 5A8BA 3GECA 4WEKA 5AVFA 5TBMB 4NXEA 3TJZC 5ITMA 4XT2A 3TW8A 4BBUA 2J3TC 3KYZA 3KYQA 5F5YA 2HJEA 2NUTC 1LL8A 3PBOA 1Z0RA 2BASA 2W27A 2RO4A 4I38A 4EUVA 2W3HA 3CITA 4ZRRA 3PBTA 1T18A 1V9YA 4MN5A 3UB6A 2L0WA 4BBTA 4Q0IA 4O0PA 4QPRA 5HWVA 3HCYA 5G4ZA 2GNXA 2MJ6A 2KX6A 2INWA 3FC7A 2Y8HA 2B18A 4IJGA 1EW0A 2O9AA 4ARZB 3H7WB 3LR5A 3LIDA 1YAXA 1H3QA 5F69A 3BY8A 2W1RA 4OOMA 4PHTA 2KDKA 2PR5A 4EETB 3A0VA 1ZTUA 4HI4A 1NRJA 3TNDB 1G6OA 1P0ZA 2J3TD 3IS2A 4GCZA 4YWZA 4P6ZS 2H28A 3KO6A 3HJIA 3LR0A 4RQ9A 2GZAA 1S1ZA 2VV6A 3PYPA 2D02A 3R4KA 4P6ZM 2IA2A 5J4EA 3ZYTA 2PYPA 4MDZA 2NUPC 3H9WA 1S67L 3LR3A 2W0NA 3LUQA 3BWLA 3KSFA 4EXOA 3ZQ5A 5DKLA 3MF0A 4BJPA 2Z6DA 1N9LA 2KLIA 2VKSA 4XT2B 4CLCC 3PHYA 3C30A 1N9OA 3PBNA 2QJ7A 1YFBA 2JHEA 5HDCA 2PDRA 2GJ3A 4HNBA 4H6JA 4O01A 1TS8A 3LFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7V A;  2XRN A;  3TRC A;  5TJJ A;  4ME4 A;  3S7P A;  3BJN A;  2W3D A;  3IBR A;  4Y3I A;  2GX5 A;  1F5M A;  4FOF A;  1MVF D;  3OBF A;  2M7U A;  2VEA A;  2O9C A;  4BWI A;  4CQH A;  3EEA A;  2W1T A;  3K2N A;  4G3W A;  2GLW A;  2VZW A;  3OOV A;  3S7N A;  3S7Q A;  3KSG A;  1TD5 A;  3O27 A;  4IUK A;  2K1N A;  4PAU A;  4G3K A;  5AJG A;  1TF1 A;  4G3V A;  3O5Y A;  5ITM A;  4IUH A;  2L66 A;  3RFB A;  2KOI A;  5I5L A;  2XSS A;  3KSH A;  4YOF A;  3DBA A;  1Z0R A;  4MCW A;  2RO4 A;  5LBR A;  4EUV A;  5HPF A;  4LRX C;  2W3H A;  3CIT A;  2OOL A;  1UB4 C;  1MKM A;  4ZRR A;  2HGV A;  2K31 A;  4Q0J A;  3IBJ A;  4Y5F A;  4Q0I A;  2Y79 A;  4O0P A;  4QPR A;  4MN7 A;  1STZ A;  4O8G A;  3HCY A;  4DMZ A;  2G7U A;  4GLQ A;  5DFX A;  2Y8H A;  2B18 A;  4IJG A;  5HSQ A;  2O9A A;  3G6O A;  2XRO A;  2O9B A;  2W3E A;  3E0Y A;  3NOP C;  4GW9 A;  2W1R A;  4Q0H A;  2W3G A;  4R70 A;  4DN0 A;  3MQ0 A;  2FY9 A;  1ZTU A;  3TND B;  4LRZ E;  4ETZ A;  4LRY C;  4E04 A;  1YSQ A;  2QYB A;  4Z1W A;  3KO6 A;  1YKD A;  4RQ9 A;  2LB9 A;  2ZMF A;  5HL6 A;  5ITJ A;  3NOU C;  2W1T B;  3R4K A;  4Y2F A;  4ETX A;  2IA2 A;  2RO3 A;  4EU0 A;  3VV4 A;  5C5K A;  1MC0 A;  5L8M A;  4R6L A;  4MDZ A;  4MMN A;  3W2Z A;  1YSP A;  5DFY A;  3KSF A;  2RO5 A;  3CI6 A;  3ZQ5 A;  5K5B A;  3MF0 A;  2O99 A;  2O0Y A;  1YSF A;  2K2N A;  2KLI A;  2VKS A;  3E98 A;  2VJW A;  3S7O A;  1VHM A;  1YFB A;  3C2W A;  3NHQ A;  2LB5 A;  4YNR A;  2W3F A;  4O01 A;  3MMH A;  3D3O A;  5HPI A;  3KSI A;  3LFV A;  3NOT C; 
#chains in the Genus database with same CATH topology
 1WA9 A;  4ZTK A;  4JGP A;  3S7P A;  3IF6 B;  2RL3 A;  3WWX A;  1VET B;  3FYZ A;  4CQH A;  3LEQ A;  5AVE A;  3TOI A;  3S7Q A;  4EBL A;  1ZHH B;  3O86 A;  2ZQA A;  4WEL A;  2J3W A;  1GHM A;  4BMW A;  4HJ6 A;  3MZF A;  4B93 A;  5GL9 A;  4M3K A;  1OJG A;  3HLC A;  5G18 A;  4CLC D;  1BLH A;  4QD4 A;  3BLM A;  2J80 A;  2KOI A;  3C5A A;  3HRE A;  1RCJ A;  3DBA A;  1XGJ A;  1K6R A;  3IXH A;  4ZJ3 A;  1E3U D;  3IBJ A;  1LT0 A;  2ZOI A;  4JGQ A;  2QKP A;  3K3C A;  3BQ8 A;  2BLS A;  4KZ4 A;  5L07 A;  4LGW A;  2W3E A;  4H6J B;  3WS1 A;  3IX8 A;  2V0W A;  3BM6 A;  5EVE A;  4JXS A;  1VB6 A;  1S1Y A;  4WL9 A;  4EWF A;  1ES5 A;  3MQ0 A;  3MXS A;  5TFQ A;  4P85 A;  3IF6 C;  1K56 A;  5EFW A;  5F1G A;  3C8C A;  4LV3 A;  4OQG A;  3ZNY A;  3OPP A;  3GDI A;  1S4S A;  1TDL A;  2HDQ A;  5FI6 A;  4I3A A;  5KSC A;  1IKG A;  5CGS A;  1XJ2 A;  1BT5 A;  3UE6 A;  4IHQ A;  1P9R A;  4PM7 A;  1Q2P A;  3T4L A;  2EX8 A;  2R9X A;  1FR1 A;  2WKE A;  3FPV A;  2G2W A;  4IVI A;  2JE5 A;  2PU4 A;  1NJ4 A;  1CF0 A;  4R0Q A;  4D2O A;  1P9W A;  2O9C A;  2VV8 A;  2ZOH A;  3UB7 A;  3H82 A;  1FQG A;  3CWF A;  4E3K A;  4HBT A;  1NWZ A;  3F1O A;  3B3X A;  2HP6 A;  4ID4 A;  4YOF A;  4DE1 A;  4X25 A;  1H0M A;  1VQQ A;  3K3D A;  4LRX C;  3NDG A;  4GDB A;  3V39 A;  3VE4 A;  3VFF A;  4X56 A;  1ERO A;  2ZC7 A;  2D01 A;  4JGR A;  3IWO A;  4WZ5 A;  1V9Z A;  3MS6 A;  3VFH A;  1H8Z A;  2K7S A;  2XD5 A;  2O9B A;  3F1N A;  4KZ6 A;  3ZG8 B;  2XF3 A;  2JKT I;  3A0S A;  2HDS A;  1LL5 A;  1IYS A;  2WKP A;  4I39 A;  2EWV A;  4L9F A;  2JBF A;  2YKH A;  3F1P B;  4JDM A;  1UWP X;  3T50 A;  2WAD A;  2OAQ 1;  3A3F A;  3CLO A;  5C5K A;  3C38 A;  1FR6 A;  1FSW A;  4YIN A;  3R7W B;  3UE3 A;  1GA0 A;  3CI6 A;  5AQ9 A;  1ES4 A;  1YSF A;  2WZZ A;  3G4P A;  4JGO A;  2HV1 A;  2Y2M A;  1F9I A;  4WLA A;  2W3F A;  2L4R A;  3D3O A;  1S0W A;  2M7V A;  1VEU B;  2C5W B;  1LSX A;  4BL2 A;  3BLS A;  4BWI A;  2ZQ8 A;  4RA7 A;  4G3W A;  1OTE A;  2GLW A;  3OOV A;  4U0T A;  3KSG A;  3KX0 X;  1CEG A;  1KE0 A;  3HUO A;  3VOL A;  1DP9 A;  4DXB A;  1LSW A;  1KGE A;  1LI9 A;  4HHD A;  1ERM A;  2Z6C A;  4KQQ A;  1QMF A;  5IU1 A;  2L66 A;  2X02 A;  5J3W A;  3N7W A;  1PZO A;  3ZVT A;  2G2U A;  2L1M A;  1IKI A;  1YLY A;  5LBR A;  5DKK A;  5HPF A;  2WKQ A;  5KZH A;  3N8S A;  4LV2 A;  4MN7 A;  4FSF A;  5EUA A;  2G7U A;  2ZC6 B;  4ZJ2 A;  5CGX A;  3Q7V A;  4PMA A;  1PI4 A;  4Y0O A;  5HAQ A;  3BFE A;  4UQI S;  3CMZ A;  5TBM A;  1ODV A;  4Q8I A;  3CPT B;  1JNU A;  3MQQ A;  3NUL A;  3PBR A;  4E6W A;  5AQA A;  3D72 A;  1ZC2 A;  1OT6 A;  3VV4 A;  2Y2I A;  4C6Y A;  1CK3 A;  4ESP A;  2XA7 M;  4N1H A;  4LV1 A;  5K5B A;  2I72 A;  4EEP A;  1DY6 A;  3O88 A;  4Y17 A;  2X71 A;  1SKF A;  3UE0 A;  4E3M A;  4KUO A;  2OAP 1;  1PRQ A;  2R78 A;  1S4R A;  2FFF B;  4HES A;  3OPL A;  4ME4 A;  1J3W A;  2P04 A;  5EVI B;  5F6A A;  2VZW A;  3LIF A;  2FH5 A;  1D7E A;  1IOU A;  4FCF A;  4R4S A;  5A8B A;  2Y4A A;  3GEC A;  5AVF A;  1OME A;  1IEM A;  3ZG5 A;  4X53 A;  1K57 C;  4DDS A;  3BFG A;  4X68 A;  2J3T C;  2V2F F;  1LL8 A;  5U47 A;  3VP1 A;  3GMW A;  3PBO A;  2W3H A;  4ZRR A;  4UHU A;  5J8X A;  2BTF P;  3IWQ A;  3SH7 A;  5G4Z A;  2BG1 A;  1YT4 A;  2MJ6 A;  2INW A;  1FOF A;  4E3N A;  4NET A;  4ARZ B;  2CC1 A;  3Q82 A;  4N92 A;  5FI7 A;  1YAX A;  2ZQD A;  5FAT A;  5L2F A;  2HDU A;  4EET B;  1I2W A;  4HI4 A;  1NRJ A;  3MKE A;  4YWZ A;  2P9V B;  2H28 A;  2Y2L A;  4NK3 A;  4RQ9 A;  5FAS A;  1S1Z A;  2QZ6 A;  3SH8 A;  2VV6 A;  3R4K A;  4BL3 A;  5E2G A;  4LEN A;  4MDZ A;  1WYB A;  3G2Z A;  5DKL A;  3NBL A;  3ZG9 B;  4DE3 A;  1ACF A;  3PBN A;  1IYQ A;  1DJA A;  4HNB A;  4O01 A;  1TS8 A;  1BLP A;  2M7U A;  4OPZ A;  5GHX A;  2HJ9 C;  4OQI A;  3V67 A;  4EES A;  4OP8 A;  2J7V A;  4MNR A;  1NZU A;  3HLD A;  1MKI A;  3S7N A;  4S2P A;  3A3D A;  1OPX A;  2PR6 A;  4R38 A;  2EXA A;  2UV0 E;  2IWD A;  1D06 A;  3UME A;  3IS2 B;  4OP5 A;  5EV0 A;  4NXB A;  2EXB A;  1PZP A;  2PD8 A;  4IUH A;  1NXY A;  3BEC A;  3N8L A;  3G31 A;  5CTN A;  1KOU A;  2ZBB A;  3LO7 A;  4OQ0 A;  3BFD A;  3BRM A;  1STZ A;  4N9K A;  3UO9 A;  3WS5 A;  4OON A;  5D3O A;  3RH8 B;  1PWC A;  4HY8 A;  2WGW A;  4GJ4 A;  1W63 Q;  2ZMA A;  4B9O A;  1JWP A;  3NOU C;  5KSH A;  2EX9 A;  3SW1 A;  3NJA A;  4QB8 A;  4EQ1 A;  4OQH A;  1K57 A;  2R9W A;  3VMA A;  1XP4 A;  3T12 B;  1HTZ A;  4BD0 A;  3EGX C;  1E4D A;  4IBX A;  3S7O A;  2WGV A;  3WS0 A;  4HJ3 A;  4DJ2 A;  1I2S A;  4CJN A;  3VE3 A;  4EV4 A;  4GS9 B;  5HDD A;  3BJN A;  3KYE A;  4K08 A;  4KG5 A;  1L2S A;  3LEZ A;  4CPK A;  5EE8 A;  1S6R A;  1OTD A;  1FIK A;  2ZC5 B;  1FCO A;  3T4Q A;  2OWH A;  4P87 A;  2OLU A;  5FQI A;  1H5X A;  1TVF A;  5I5L A;  3P98 A;  3T1R A;  5FA7 A;  4GKU A;  4X1L A;  2QA4 I;  3NDE A;  3WS2 A;  2WKR A;  1GHI A;  5FQJ A;  3BQA A;  3FZC A;  2PHY A;  4JDO A;  1U60 A;  3LIA A;  4S2O A;  3GRJ A;  1SHV A;  2EFX A;  4DMZ A;  4PM8 A;  1XA1 A;  1QME A;  4WUJ A;  1KGF A;  5EEC A;  3V50 A;  4OLD A;  4HEF A;  5FQM A;  3IXG A;  1KDS A;  1GSX A;  3LY3 A;  2JKT M;  3LYX A;  4OKP A;  5EOE A;  3ZG7 B;  2HF6 A;  1YSQ A;  3FKW A;  2DCF A;  4MBK A;  1ONG A;  2RO3 A;  3NIA A;  4GNU A;  1MC0 A;  5MC7 A;  3T1X A;  2P9V A;  1KVM A;  5DFY A;  4IED A;  2VGL S;  1TS7 A;  3Q1F A;  1EWZ A;  5DJU A;  3EQU A;  3C4O A;  1M6K A;  5DF9 A;  1GA9 A;  3DAV A;  4WMC A;  3KSI A;  2B95 A;  3MZE A;  1JVJ A;  4LLO B;  3JVU A;  4JF6 A;  1K38 A;  4OPQ A;  4CLC B;  3SOI A;  4CLC E;  3U2A A;  1F5M A;  2A24 B;  3GSG A;  1MVF D;  1YLZ A;  1SDN A;  4OOY A;  1DP8 A;  2XLN A;  5HAR A;  5HW3 A;  1IFQ A;  3LI8 A;  4GDN A;  3ITB A;  1H8M A;  1OJ5 A;  3NC8 A;  3JVV A;  3T1S A;  3BFC A;  3T4O A;  1L0F A;  2V1Z A;  5CX7 A;  2ZLY A;  4PKY A;  2VGK A;  4MLL A;  1PWG A;  3AGE A;  5GLD A;  4Q0J A;  5AQB A;  3Q07 A;  1YMS A;  3HJK A;  2PAV P;  2FZ0 A;  1XFQ A;  3A3J A;  4GD8 A;  5EVL A;  3A0R A;  3BYD A;  2XH9 A;  3UPP A;  5M1A A;  2XRO A;  1J9M A;  4KQR A;  4Q0H A;  4GZB A;  2QJ5 A;  1PI5 A;  2FY9 A;  1OT9 A;  1KE3 A;  4LRZ E;  2P74 A;  4LRY C;  4EEU A;  4S2N C;  2RCX A;  5ITJ A;  2W1T B;  3MZD A;  2ZMV A;  3MKF A;  1K55 A;  1MBL A;  2EWW A;  4MBH A;  3UB8 A;  2O99 A;  3H7W A;  1MWR A;  2JKR I;  4DJ3 A;  5GHY A;  2XDM A;  2WKH A;  1ONH A;  4YNR A;  3NHQ A;  1TS0 A;  1UWN X;  1JTG A;  1YPR A;  2XFS A;  3M2J A;  1ESU A;  2QWS A;  5M19 A;  2PBD P;  4Y13 A;  3OBF A;  5CGW A;  3U4L P;  3EEA A;  3T4T A;  3K2N A;  2CMN A;  5HFO A;  2Q9N A;  1XJ6 A;  1TD5 A;  3T4S A;  3RTY A;  4PAU A;  3DTM A;  1EI5 A;  4NXE A;  5L09 A;  3BFF A;  5ITM A;  2Q9M A;  5FSR A;  4K91 A;  1SCW A;  2HJE A;  5HX9 A;  1Z0R A;  3UPN A;  2RO4 A;  4EUV A;  3CG5 A;  1BUE A;  4BBT A;  4U0X A;  1LLB A;  2WGI A;  4O0P A;  4Y0U A;  3VOZ A;  2WAE A;  1ESI A;  3IF6 A;  1FCM A;  3FC7 A;  5A93 A;  1EW0 A;  4ZBE A;  4EBP A;  1MWU A;  5L10 A;  1VET A;  3LID A;  3NCK A;  4R1G A;  4PHT A;  4XUZ A;  1PWD A;  5A90 A;  3SS4 A;  2E8J A;  3HL9 A;  1P0Z A;  2J3T D;  4BQM A;  2WKI A;  4PM6 A;  1ES3 A;  1YLT A;  4FTX A;  3W4O A;  4JPM A;  3IX4 A;  3W4P A;  5J4E A;  1LL9 A;  2NUP C;  1I5Q A;  3FWL A;  2Y2J A;  3ZQ5 A;  4GB7 A;  5EM1 A;  2Z6D A;  5HAI A;  3L9K A;  3S22 A;  2JC7 A;  2VKS A;  4XT2 B;  3C30 A;  1N9O A;  4B4Z A;  2JHE A;  5HDC A;  4H6J A;  1M40 A;  3LFV A;  1E25 A;  2QHK A;  4S2K A;  2A49 A;  5E2F A;  2GDN A;  2I9V A;  3T4K A;  3QNC A;  2XQZ A;  1N4O A;  4XUX A;  3EQV A;  1GHP A;  1O7E A;  4YFM A;  1IYP A;  4UEY A;  1TEM A;  2J9O A;  1TF1 A;  4G3V A;  3QP8 A;  4EW7 A;  1XJ4 A;  2XD1 A;  4L9G A;  2ZD8 A;  4PM5 A;  2Y2H A;  5FAQ A;  3RFB A;  2H0T A;  4KG6 A;  3ZCZ A;  4QU3 A;  3MFX A;  3CHW P;  4S2M A;  1W8Q A;  3N4I A;  3W4Q A;  4Y5F A;  3MXQ A;  4WZ4 A;  3WRZ A;  4BEN A;  4JF5 A;  1C3B A;  3OLO A;  3G6O A;  4UA7 A;  4XXR A;  1MY8 A;  4FH2 A;  4R70 A;  1SKO B;  4KZA A;  3VOY A;  4JXG A;  5FAP A;  3V5M A;  5KIZ A;  4DE2 A;  1NY0 A;  4PKY G;  3ULF A;  1K54 C;  2E8I A;  3ZDJ A;  1FCN A;  1Y54 A;  2Y2O A;  4X55 A;  5L8M A;  4P6B A;  2X01 A;  4WMC D;  3W2Z A;  1UGU A;  3W8K A;  2RO5 A;  1NZO A;  2O0Y A;  3HLB A;  5CED A;  1YLJ A;  4OPY A;  1ZG4 A;  3VP3 A;  2EX6 A;  5EVI C;  4IBR A;  2ACG A;  1VM1 A;  2YKF A;  3G30 A;  3L7H A;  1K25 A;  5CHU A;  4KZ3 A;  3E4O A;  2H0Y A;  2V1B A;  1G5U A;  4A5R A;  1F2K A;  3IBR A;  4Y3I A;  3IQA A;  1DJC A;  3F1P A;  2ZC3 B;  2VEA A;  5F68 A;  1F98 A;  5TR7 A;  1NLY A;  1W7F A;  3GQZ A;  2OSU A;  3R7W A;  3PBS A;  3VSK A;  2HDR A;  4DXC A;  5FQQ A;  4GD6 A;  3CUE C;  3O5Y A;  1BTL A;  4KUK A;  3NI9 A;  3IXD A;  3PAG A;  1OTB A;  2H10 A;  3KSH A;  3LIB A;  4L9E A;  2Y2K A;  4WF0 A;  5EM0 A;  4K0W A;  3EOI A;  5CRF A;  3UN7 A;  2K31 A;  4R23 A;  5F82 A;  5CTM A;  3DTI A;  3PR6 A;  4C75 A;  1VEU A;  4O8G A;  5DFX A;  4EBN A;  1NYY A;  5HSQ A;  3NEC A;  2P08 A;  4FH4 A;  4GW9 A;  3FG8 A;  4Y7P A;  5HZH A;  5FQ9 A;  2VV7 A;  2IWC A;  5E2H A;  1AWI A;  4RYE A;  4HP4 A;  2Y91 A;  4E04 A;  4X69 A;  1RP5 A;  2QYB A;  4Y0T A;  2EFU A;  2LB9 A;  3N8R A;  5HL1 A;  3LY4 A;  1W5D A;  2VK3 A;  3H82 B;  2C6W B;  1BZA A;  3P7N A;  3RXX A;  2WZX A;  1K4E A;  5EOO A;  3F1O B;  4MN6 A;  1HVB A;  4KZ9 A;  1LI0 A;  2JKG A;  4UA9 A;  3QP2 A;  3PTE A;  1L0G A;  1VHM A;  3G35 A;  3OC2 A;  4P0M A;  3E4Q A;  3MXR A;  1YQS A;  3G2Y A;  3D4F A;  3HLW A;  4QHC A;  3MMH A;  4LV0 A;  4JKT A;  2W3D A;  2GX5 A;  5F1F A;  3E2L A;  2PBY A;  3CPT A;  4S2I A;  2Y55 A;  3F1N B;  4AFI A;  3M6B A;  1YLW A;  3OCN A;  3IH8 A;  2M1C A;  3IT9 A;  1K54 A;  5I94 A;  4X1M A;  5AJG A;  3LI9 A;  1TS6 A;  4NEE D;  3IF5 A;  3QP5 A;  5AQ7 A;  2OV5 A;  1NYM A;  1H8Y A;  3O3V A;  1HD8 A;  3ZVW A;  2XSS A;  3UY6 A;  2EA9 A;  1W8Y A;  2Q0O A;  4HIA A;  1Y4O A;  5CER A;  2J8Y A;  1MKM A;  3G34 A;  1L3L A;  3QP1 A;  4OLG A;  2V8F A;  4OVD A;  1IEL A;  5GLA A;  3E2K A;  3B42 A;  1W79 A;  3OPR A;  5EVI A;  3VP2 A;  5HD3 A;  2ZQC A;  4JXW A;  3LR4 A;  4HJ4 A;  1BYW A;  3MQO A;  3MJQ A;  4WN5 A;  3V3S A;  3E0Y A;  3NOP C;  1XGI A;  1YMX A;  3LCE A;  1CEF A;  1TDG A;  3BEB A;  3ZG0 A;  3HBR A;  4R4R A;  1GCE A;  3UMD A;  4BLM A;  5HL6 A;  1MXO A;  4ETX A;  4Y2F A;  1KVL A;  4NG2 A;  1MWT A;  4II7 A;  3CUE A;  1ES2 A;  3PXP A;  5JYP A;  1GSW A;  4ARZ A;  4DKI A;  3CJM A;  2Y2P A;  3C4P A;  3UPO A;  5G4Y A;  4KZB A;  4I5S A;  2JKR M;  4R3B A;  2VX8 A;  3DWZ A;  2Z2L B;  1PNE A;  4WBG A;  4U3T A;  4RVA A;  1S66 L;  3RJU A;  4FOF A;  3Q7V B;  3UDX A;  4BBV A;  3V3R A;  4PPR A;  2K1N A;  4GOG A;  4OOL A;  5EPH A;  2ZQ9 A;  4WEK A;  5TBM B;  2WAF A;  4BBU A;  4S2L A;  3KYQ A;  5F5Y A;  2EX2 A;  2W27 A;  4I38 A;  3N6I A;  3UB6 A;  4QPR A;  3HCY A;  1Z09 A;  3HUN A;  1K6S A;  2B18 A;  2WYX A;  3S1Y A;  1Q2Q A;  2O9A A;  3RXW A;  3LR5 A;  3DTE A;  3QP4 A;  4FD8 A;  3DW0 A;  3BY8 A;  2XK1 A;  2KDK A;  2PR5 A;  3A0V A;  1ZTU A;  3TND B;  3IS2 A;  3SH9 A;  1PYY A;  1MWS A;  5JYO A;  3PYP A;  4P6Z M;  2D02 A;  4DRT A;  1ERQ A;  3HLE A;  2ZC4 B;  3GV9 A;  3H9W A;  1L0D A;  1S67 L;  3LR3 A;  2W0N A;  1L0E A;  1K0K A;  3BWL A;  3KSF A;  1FIL A;  3MF0 A;  4BJP A;  5IHV A;  5FQK A;  1N9L A;  2FFY A;  4CLC C;  3PHY A;  5CEC A;  4UA6 A;  2PDR A;  2GJ3 A;  3LGO A;  2V20 A;  3M2K A;  4C3Q A;  2XA7 S;  2XRN A;  3C7U A;  4HBU A;  5TJJ A;  4B4X A;  3EWK A;  3ZHH A;  1N9N A;  4RX2 A;  4KZ5 A;  4X6T A;  3IX3 A;  5CHJ A;  1GSV A;  2V1A A;  3LIE A;  1G68 A;  4Z9Q A;  1ZKJ A;  3O27 A;  3ICY A;  2OLV A;  2HPB A;  3B33 A;  5DVA A;  5DF7 A;  3MBZ A;  4D60 A;  4LCM A;  3IWI A;  3T4J A;  3IH9 A;  4KG2 A;  2B02 A;  4L0L A;  1ZG6 A;  2JCH A;  3DTK A;  4GS9 A;  1NRF A;  1IYO A;  2ZJ9 A;  1JWV A;  4PM9 A;  3BY9 A;  3A3E A;  3JPU A;  4I3J A;  4FUW A;  4JF4 A;  5FDS A;  3O87 A;  3FV7 A;  5HDS A;  4BD1 A;  2HZ5 A;  4KQD A;  4ZDX A;  1FSY A;  5CXW A;  4ZAM A;  1YLP A;  3HVF A;  2AVX A;  4F3L B;  3ZNT A;  5DF8 A;  2ZL1 B;  1JWZ A;  4KQO A;  4KZ8 A;  1T1A A;  2V0U A;  1K4F A;  4HOI A;  2VGL M;  3BW6 A;  3ITA A;  3NY4 A;  1YKD A;  3TG9 A;  2ZMF A;  2JN7 A;  3GTC A;  3UB5 P;  3ISG A;  4EU0 A;  3UE1 A;  2DMW A;  5HWW A;  4QJG A;  2P7J A;  1YSP A;  5TGF A;  4GHI B;  1JTD A;  5DTK A;  4K0X A;  2K2N A;  4H8R A;  1RGZ A;  1BSG A;  1PW1 A;  4LPZ A;  4HH3 A;  1XJ3 A;  4RX3 A;  1XFN A;  2XEP A;  2PD7 A;  1MPL A;  2VLG A;  1Y28 A;  4JBF A;  1G6A A;  3MSH A;  4GN2 A;  1MZU A;  4KEN B;  3ZFZ A;  2PU2 A;  3LIC A;  5DJT A;  1LHY A;  2ZQ7 A;  2WGW B;  3E4P A;  2QPN A;  2HP9 A;  4IUK A;  4QWO A;  5IS1 A;  4UAA A;  5J7E A;  3SS5 A;  3T1Q B;  1T1B A;  3PAE A;  3OZH A;  3MR0 A;  5EVI D;  3UB9 A;  4MCW A;  1W63 M;  4OPR A;  5CEB A;  4HQA A;  4NXG A;  4ZJ1 A;  1NLZ A;  1PFL A;  5FAO A;  1HLU P;  4CLC A;  3MFD A;  5DTT A;  1OTA A;  4GLQ A;  5HWT A;  4MBF A;  2A24 A;  4S2N A;  4IVK A;  3FKV A;  3VP0 A;  1HZO A;  4M4X A;  1YM1 A;  1PIO A;  1E3U A;  1N9B A;  2W3G A;  4DN0 A;  2WK0 A;  2V8C A;  4QY6 A;  1XPB A;  3D9Y A;  1CQA A;  3SZT A;  4N9L A;  1LSV A;  2VGJ A;  1BUL A;  4WYY A;  4R6L A;  1DRM A;  4WM9 A;  2JKF A;  3TE8 A;  3I7J A;  4OH0 A;  2DRW A;  5GLC A;  3B47 A;  1DJB A;  4QY5 A;  3CAX A;  4EQI A;  3P09 A;  2HP5 A;  4E3I A;  5FI2 A;  3EEH A;  5HPI A;  2XFT A;  3NOT C;  3UDF A;  4O7D A;  5FL3 A;  4R3J A;  3UNW A;  1KE4 A;  1DP6 A;  2W1T A;  5HD5 A;  5FEF A;  3HLF A;  3AGD A;  4G3K A;  1K56 D;  1XA7 A;  4Y15 A;  2VA0 A;  5IT5 A;  4NXF A;  1OTI A;  4JXV A;  3WS4 A;  3IHB A;  4E3J A;  3CZD A;  1XXM A;  1BLC A;  2OOL A;  3SS3 A;  1UB4 C;  4LCL A;  2HGV A;  5CHM A;  4HP9 A;  1CI9 A;  1D1J A;  2Y79 A;  5M18 A;  5E2E A;  4WEJ A;  1WE4 A;  1BLS A;  1KGG A;  2OWJ A;  4E6X A;  2PT7 A;  5F83 A;  3PBQ A;  4DF6 A;  4S2J A;  3OCL A;  1KDW A;  4B88 A;  3GVB A;  3S4X A;  4ETZ A;  1PW8 A;  2Y59 A;  2DNS A;  2A2L A;  4NKP A;  3AGF A;  1RGY A;  1X0O A;  4Z1W A;  4UQI M;  2ZM2 A;  4F3L A;  4E3O A;  2PRF A;  2ZL1 A;  3VSL A;  2PYR A;  2XR0 A;  2Y2Q A;  5BOH A;  4MMN A;  5KMW A;  4LFU A;  5DTS A;  1G28 A;  3ZGA B;  1Z6F A;  3E98 A;  1P97 A;  2VJW A;  2V9A A;  3C2W A;  3QP6 A;  2LB5 A;  4R3A A;  1WYC A;  1AXB A;  1XX2 A;  4GHI A;  4MEZ A;  1T1C A;  4F94 A;  3TRC A;  1T19 A;  2B5R A;  3FPW A;  3P01 A;  4DDY A;  4I3I A;  4HH2 A;  1A0K A;  5FDH A;  3EGD C;  5E43 A;  3OPH A;  2IWB A;  1CJF A;  5A91 A;  2ZM0 A;  3IHA A;  4EER A;  2XGN A;  3TJZ C;  2WUQ A;  2Y2N A;  4XT2 A;  3TW8 A;  3KYZ A;  2Y2G A;  5GLB A;  2NUT C;  3Q81 A;  2A3U A;  1ALQ A;  3Q7Z A;  3QHY A;  2BAS A;  4JLF A;  2J9P A;  1XKZ A;  3CIT A;  5GHZ A;  3UDI A;  1O07 A;  3WRT A;  3PBT A;  1T18 A;  1V9Y A;  4MN5 A;  2L0W A;  5HAP A;  4Q0I A;  5HWV A;  3G32 A;  4EUZ A;  3C7V A;  2GNX A;  2KX6 A;  2Y8H A;  4E3L A;  4IJG A;  3H7W B;  1SDE A;  3A3I A;  5A92 A;  1H3Q A;  2UWX A;  2H5S A;  5F69 A;  2W1R A;  4OOM A;  3DWK A;  3QNB A;  1G6O A;  4GCZ A;  2Z2M B;  4P6Z S;  3KO6 A;  3HJI A;  3LR0 A;  2GZA A;  1CI8 A;  2IA2 A;  3ZYT A;  5FEG A;  2PYP A;  4DE0 A;  4N1X A;  3HUM A;  3LUQ A;  4EXO A;  3IXB A;  3TSG A;  3VP4 A;  2KLI A;  2ZM8 A;  3GR2 A;  4WZ5 C;  2QJ7 A;  3HLG A;  1YFB A;  3JYI A;  4KZ7 A;  3M6H A;  1K55 C;  1SZV A;  2QMI A;  1SKO A; 
#chains in the Genus database with same CATH homology
 2XA7 S;  2QHK A;  2XRN A;  1WA9 A;  2HJ9 C;  4JGP A;  5TJJ A;  3S7P A;  3V67 A;  4EES A;  3EWK A;  1N9N A;  1GSV A;  2V1A A;  3LIE A;  2I9V A;  4CQH A;  3T4K A;  5AVE A;  3S7N A;  3S7Q A;  1OPX A;  3O27 A;  3ICY A;  1ZHH B;  4WEL A;  3EQV A;  2J3W A;  2PR6 A;  4BMW A;  4HJ6 A;  4UEY A;  4B93 A;  1TF1 A;  4G3V A;  4R38 A;  3B33 A;  1OJG A;  1D06 A;  3UME A;  4CLC D;  4EW7 A;  3IS2 B;  4NXB A;  1XJ4 A;  4L9G A;  2PD8 A;  4IUH A;  3RFB A;  2J80 A;  2KOI A;  3T4J A;  3DBA A;  3MFX A;  2B02 A;  4L0L A;  4GS9 A;  3IBJ A;  4Y5F A;  1LT0 A;  1KOU A;  2ZBB A;  2ZOI A;  3MXQ A;  4JGQ A;  2QKP A;  3BY9 A;  3BQ8 A;  3K3C A;  1STZ A;  4I3J A;  3OLO A;  3RH8 B;  3G6O A;  5HDS A;  4HY8 A;  4KQD A;  2W3E A;  4GJ4 A;  4H6J B;  2V0W A;  4F3L B;  4R70 A;  1VB6 A;  1S1Y A;  4WL9 A;  3MQ0 A;  1W63 Q;  4KQO A;  1T1A A;  2V0U A;  5KIZ A;  4HOI A;  3ULF A;  4PKY G;  4B9O A;  2VGL M;  3BW6 A;  5EFW A;  1YKD A;  2ZMF A;  2JN7 A;  3NOU C;  5KSH A;  4EU0 A;  2DMW A;  3C8C A;  5HWW A;  3SW1 A;  3NJA A;  5L8M A;  2P7J A;  3W2Z A;  1UGU A;  3GDI A;  4EQ1 A;  1S4S A;  1YSP A;  4GHI B;  2RO5 A;  4I3A A;  2O0Y A;  2K2N A;  1XJ2 A;  3UE6 A;  4IHQ A;  1P9R A;  3EGX C;  3S7O A;  3T4L A;  4HJ3 A;  4LPZ A;  4DJ2 A;  4HH3 A;  1XJ3 A;  2YKF A;  3FPV A;  3VE3 A;  1XFN A;  4GS9 B;  2PD7 A;  2VLG A;  1Y28 A;  3E4O A;  2V1B A;  5HDD A;  3BJN A;  4K08 A;  3IBR A;  1MZU A;  4Y3I A;  3LIC A;  3F1P A;  5DJT A;  2M7U A;  2VEA A;  1P9W A;  2O9C A;  2VV8 A;  5F68 A;  1OTD A;  2ZOH A;  1F98 A;  1NLY A;  3E4P A;  3UB7 A;  3H82 A;  4IUK A;  5IS1 A;  3CWF A;  3R7W A;  3PBS A;  1NWZ A;  3T4Q A;  5J7E A;  2OWH A;  3F1O A;  3CUE C;  3O5Y A;  1T1B A;  4KUK A;  3MR0 A;  5I5L A;  1OTB A;  3KSH A;  3LIB A;  4YOF A;  3UB9 A;  2QA4 I;  4L9E A;  4MCW A;  4WF0 A;  1W63 M;  3K3D A;  2WKR A;  4LRX C;  3EOI A;  3VE4 A;  3BQA A;  4HQA A;  2PHY A;  2K31 A;  4NXG A;  2D01 A;  4JDO A;  3LIA A;  4JGR A;  1NLZ A;  3PR6 A;  4CLC A;  4O8G A;  1V9Z A;  4DMZ A;  1OTA A;  4GLQ A;  5DFX A;  5HWT A;  4WUJ A;  2A24 A;  5HSQ A;  2K7S A;  2O9B A;  3F1N A;  2P08 A;  4M4X A;  2JKT I;  3A0S A;  4GW9 A;  3FG8 A;  2W3G A;  4DN0 A;  5HZH A;  1GSX A;  2WKP A;  2VV7 A;  4I39 A;  2JKT M;  3LYX A;  2EWV A;  4HP4 A;  4L9F A;  4E04 A;  2HF6 A;  1YSQ A;  2QYB A;  2YKH A;  3F1P B;  2LB9 A;  4JDM A;  1UWP X;  1LSV A;  3T50 A;  2OAQ 1;  2RO3 A;  3CLO A;  5C5K A;  3C38 A;  1MC0 A;  4R6L A;  3H82 B;  5MC7 A;  1DRM A;  3TE8 A;  3R7W B;  3P7N A;  5DFY A;  3UE3 A;  3F1O B;  4MN6 A;  3CI6 A;  3B47 A;  2VGL S;  1TS7 A;  3CAX A;  5DJU A;  1YSF A;  1VHM A;  3OC2 A;  4JGO A;  2HV1 A;  3EQU A;  1F9I A;  4WLA A;  3E4Q A;  5DF9 A;  2W3F A;  3EEH A;  2L4R A;  3MMH A;  3D3O A;  5HPI A;  3KSI A;  3NOT C;  4LLO B;  2M7V A;  3JVU A;  4CLC B;  5FL3 A;  2W3D A;  4CLC E;  2GX5 A;  3U2A A;  1LSX A;  1F5M A;  2A24 B;  1MVF D;  4BWI A;  1DP6 A;  3F1N B;  2W1T A;  4AFI A;  5HD5 A;  1OTE A;  2GLW A;  4G3W A;  3OCN A;  3OOV A;  2M1C A;  1DP8 A;  3KSG A;  3KX0 X;  1IFQ A;  3VOL A;  1DP9 A;  3LI8 A;  4G3K A;  5AJG A;  1LSW A;  3LI9 A;  1TS6 A;  1H8M A;  1OJ5 A;  5IT5 A;  2VA0 A;  3JVV A;  4NEE D;  4HHD A;  4NXF A;  1OTI A;  2Z6C A;  3T4O A;  5IU1 A;  2L66 A;  5J3W A;  5CX7 A;  2XSS A;  4PKY A;  2EA9 A;  2L1M A;  4HIA A;  5LBR A;  5DKK A;  5HPF A;  2OOL A;  2WKQ A;  1UB4 C;  1MKM A;  2HGV A;  4HP9 A;  4Q0J A;  2Y79 A;  4WEJ A;  4MN7 A;  3HJK A;  4FSF A;  2G7U A;  2FZ0 A;  1XFQ A;  3B42 A;  5HD3 A;  3A0R A;  3LR4 A;  2OWJ A;  4HJ4 A;  1BYW A;  2PT7 A;  2XRO A;  3PBQ A;  3MQO A;  3MJQ A;  3OCL A;  4WN5 A;  3E0Y A;  3NOP C;  4Q0H A;  2QJ5 A;  2FY9 A;  1OT9 A;  4UQI S;  4LRZ E;  4ETZ A;  5TBM A;  2A2L A;  4LRY C;  4NKP A;  1ODV A;  4EEU A;  1X0O A;  4Z1W A;  3UMD A;  4UQI M;  4F3L A;  5HL6 A;  5ITJ A;  1JNU A;  3MQQ A;  4ETX A;  2W1T B;  3PBR A;  4Y2F A;  2PYR A;  3D72 A;  2ZMV A;  1OT6 A;  3VV4 A;  4II7 A;  3CUE A;  4MMN A;  2EWW A;  2XA7 M;  3UB8 A;  3PXP A;  5K5B A;  1G28 A;  2O99 A;  1GSW A;  4ARZ A;  3E98 A;  3H7W A;  1P97 A;  4EEP A;  2JKR I;  4DJ3 A;  2VJW A;  2V9A A;  3C2W A;  3NHQ A;  2LB5 A;  4YNR A;  1TS0 A;  1UWN X;  4KUO A;  5G4Y A;  4R3A A;  2OAP 1;  4I5S A;  4GHI A;  2JKR M;  2R78 A;  1S4R A;  1T1C A;  3TRC A;  2VX8 A;  1T19 A;  3FPW A;  4ME4 A;  2P04 A;  3P01 A;  2QWS A;  1S66 L;  4FOF A;  4I3I A;  4HH2 A;  3OBF A;  3EEA A;  5F6A A;  3K2N A;  3T4T A;  2CMN A;  2VZW A;  4BBV A;  3LIF A;  1XJ6 A;  1TD5 A;  3EGD C;  3T4S A;  2FH5 A;  3RTY A;  2K1N A;  1D7E A;  1IOU A;  4PAU A;  4OOL A;  4EER A;  5A8B A;  3GEC A;  4WEK A;  5AVF A;  5TBM B;  4NXE A;  3TJZ C;  5ITM A;  4XT2 A;  3TW8 A;  4BBU A;  2J3T C;  3KYZ A;  3KYQ A;  5F5Y A;  2HJE A;  2NUT C;  1LL8 A;  3PBO A;  1Z0R A;  2BAS A;  2W27 A;  2RO4 A;  4I38 A;  4EUV A;  2W3H A;  3CIT A;  4ZRR A;  3PBT A;  1T18 A;  1V9Y A;  4MN5 A;  3UB6 A;  2L0W A;  4BBT A;  4Q0I A;  4O0P A;  4QPR A;  5HWV A;  3HCY A;  5G4Z A;  2GNX A;  2MJ6 A;  2KX6 A;  2INW A;  3FC7 A;  2Y8H A;  2B18 A;  4IJG A;  1EW0 A;  2O9A A;  4ARZ B;  3H7W B;  3LR5 A;  3LID A;  1YAX A;  1H3Q A;  5F69 A;  3BY8 A;  2W1R A;  4OOM A;  4PHT A;  2KDK A;  2PR5 A;  4EET B;  3A0V A;  1ZTU A;  4HI4 A;  1NRJ A;  3TND B;  1G6O A;  1P0Z A;  2J3T D;  3IS2 A;  4GCZ A;  4YWZ A;  4P6Z S;  2H28 A;  3KO6 A;  3HJI A;  3LR0 A;  4RQ9 A;  2GZA A;  1S1Z A;  2VV6 A;  3PYP A;  2D02 A;  3R4K A;  4P6Z M;  2IA2 A;  5J4E A;  3ZYT A;  2PYP A;  4MDZ A;  2NUP C;  3H9W A;  1S67 L;  3LR3 A;  2W0N A;  3LUQ A;  3BWL A;  3KSF A;  4EXO A;  3ZQ5 A;  5DKL A;  3MF0 A;  4BJP A;  2Z6D A;  1N9L A;  2KLI A;  2VKS A;  4XT2 B;  4CLC C;  3PHY A;  3C30 A;  1N9O A;  3PBN A;  2QJ7 A;  1YFB A;  2JHE A;  5HDC A;  2PDR A;  2GJ3 A;  4HNB A;  4H6J A;  4O01 A;  1TS8 A;  3LFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...