2W1TA

Crystal structure of b. subtilis spovt
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
175
structure length
175
Chain Sequence
ATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGDVILKKYSPISELGDFAKEYADALYDSLGHSVLICDRDVYIAVSGSSKKDYLNKSISEMLERTMDQRSSVLESDAKSVQLVNGIDEDMNSYTVGPIVANGDPIGAVVIFSKDQTMGEVEHKAVETAAGFLARQME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAGE V SPORULATION PROTEIN T
publication title Crystal Structure of Spovt, the Final Modulator of Gene Expression During Spore Development in Bacillus Subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 43
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04014 MazE_antitoxin Antidote-toxin recognition MazE, bacterial antitoxin
A PF15714 SpoVT_C Stage V sporulation protein T C-terminal, transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.260.10 Mainly Beta Ribbon Pemi-like Protein 1; Chain: D Pemi-like Protein 1; Chain: D 2w1tA01
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w1tA02
3EEAA 2QYBA 2K1NA 4ZRRA 4GW9A 4QPRA 2IA2A 3CI6A 3D3OA 2ZMFA 2Y79A 4LRZE 5HL6A 1UB4C 5TJJA 3OOVA 1F5MA 4BWIA 3C2WA 3MF0A 4O0PA 2KLIA 1STZA 3NOTC 4EUVA 2RO4A 3O5YA 2W1TA 2K2NA 2GX5A 2VKSA 2XROA 2RO5A 1TD5A 2VZWA 5K5BA 4DMZA 3S7NA 5HSQA 2K31A 3ZQ5A 5DFYA 2O9CA 5AJGA 2XRNA 3S7OA 3TNDB 4ME4A 2W3FA 4EU0A 4DN0A 4E04A 5DFXA 3R4KA 4MDZA 5HPIA 4Y3IA 3DBAA 3HCYA 4Z1WA 2W3EA 3KSIA 2RO3A 1MC0A 3MMHA 3OBFA 2W1RA 3CITA 4GLQA 4MN7A 4PAUA 3VV4A 4Q0IA 1ZTUA 2LB9A 4LRYC 3NHQA 1YSPA 2M7UA 2O9BA 3S7PA 3MQ0A 3NOUC 2B18A 2VJWA 1MKMA 4Q0JA 5C5KA 1YKDA 2VEAA 3KSFA 5L8MA 1Z0RA 1MVFD 2O0YA 4YNRA 2O9AA 1TF1A 2M7VA 1YSFA 2W3HA 2W3GA 5ITJA 2XSSA 2W1TB 2G7UA 2O99A 3S7QA 4MCWA 4YOFA 5LBRA 1VHMA 2W3DA 3E98A 3IBRA 4IUHA 2FY9A 4R70A 4Y5FA 3NOPC 2KOIA 4FOFA 3W2ZA 2Y8HA 4ETZA 5ITMA 4ETXA 4O01A 3E0YA 4Y2FA 4Q0HA 3BJNA 1YFBA 3TRCA 2LB5A 4O8GA 4G3KA 4CQHA 4G3VA 3O27A 4RQ9A 4MMNA 2L66A 3LFVA 4G3WA 2HGVA 1YSQA 3KO6A 2GLWA 3KSHA 2OOLA 4IUKA 5HPFA 3IBJA 3KSGA 4R6LA 3RFBA 4LRXC 3K2NA 5I5LA 4IJGA 3G6OA
chains in the Genus database with same CATH superfamily
1N9NA 3IF6B 5KSHA 3UPPA 3B33A 4GJ4A 5HZHA 1OTIA 2HJ9C 1K56A 5HL6A 3RH8B 4EQIA 3PTEA 3DWZA 4DE2A 4IHQA 2KLIA 3NOTC 4OQIA 4HH2A 2QHKA 4X1MA 4HJ4A 5EOOA 1HLUP 3A3FA 3TNDB 3JYIA 1HD8A 4S2IA 5L10A 4C6YA 4MNRA 2ZM2A 1ES2A 3H7WB 5F69A 5F83A 2XFSA 4EV4A 3IXBA 3N7WA 4FUWA 3LR5A 1H3QA 4LRYC 2XDMA 1EWZA 4HNBA 5A90A 5M18A 2V1BA 4Q0JA 3F1NA 3KSFA 1IKGA 4BJPA 5L09A 1JWZA 3TJZC 1G6AA 5FQMA 3RXWA 1YLWA 3LIDA 3UB9A 4GD6A 4MCWA 4S2NC 2WZXA 2H5SA 3CHWP 4HOIA 2ZQCA 5HAIA 4Y7PA 2ZL1A 4JXVA 3BW6A 4Y0UA 3SZTA 2HDSA 3H9WA 4QY5A 1K56D 2K7SA 3JVUA 2Q9MA 2VGLS 3VOLA 4PMAA 4O7DA 1BT5A 4MMNA 5E43A 3KO6A 2WK0A 4R4RA 2OOLA 2QMIA 1BLPA 4WUJA 3T12B 3IS2A 4CLCE 2Q0OA 4GNUA 3MXSA 3G6OA 2ACGA 2YKFA 1ESIA 2HZ5A 4K0WA 2I72A 2WKQA 1QMFA 1LLBA 4C75A 2VA0A 4R23A 4KZ9A 5DF7A 5AVFA 2Y59A 3T50A 3U4LP 4BL2A 1H5XA 3LI9A 3MFDA 3BFFA 2G2UA 2ZQDA 5FI6A 1NZUA 5D3OA 5DTSA 4HP9A 5IU1A 3G34A 5GLCA 5CX7A 3ZDJA 3R7WA 3DAVA 3IQAA 1J3WA 5F1FA 3QHYA 3W4OA 4NEED 2W1RA 3CITA 3VE3A 1LI0A 2Y55A 4U0TA 3PYPA 1S6RA 4D2OA 3N8LA 4GS9A 3HJIA 3LR3A 5IT5A 3S1YA 2VJWA 5G4ZA 1DP8A 1FSYA 4WZ4A 1Z0RA 4R3BA 1XX2A 1K0KA 3IXGA 4B9OA 2DNSA 3UMDA 2M7VA 2CC1A 3SH8A 4XT2A 4GCZA 2H10A 5DKKA 2V1AA 2PD8A 3L7HA 1D1JA 5EM0A 2Y2MA 2W3DA 1JTGA 1K38A 4R70A 4Y5FA 3EWKA 1XJ6A 3F1PB 2C5WB 3MJQA 3VP3A 1RCJA 3N4IA 2JKTI 4G3KA 1W7FA 1NLZA 4R38A 4BBUA 3IX4A 3G35A 2WAFA 3KSHA 3OPRA 2P7JA 3WS0A 3KSGA 3BQAA 4EETB 3ZNYA 4ID4A 3ZG7B 2QYBA 4E6XA 4WMCA 3NECA 4GW9A 2WGWA 4LRZE 3AGDA 4JPMA 4HI4A 1ERMA 1WYBA 5DTTA 2XLNA 4LCMA 2W1TA 5AQBA 3DTKA 5AJGA 1KE0A 2B02A 5AQAA 3LIFA 3D4FA 5TR7A 3RTYA 3DBAA 1LSWA 2OLVA 3FPWA 1FQGA 2ZQAA 4GLQA 1CF0A 3KYZA 2ZM0A 3MQQA 3MR0A 1VEUB 2O9BA 1BULA 3NOUC 2OAP1 1O07A 3PBQA 4LLOB 2HP9A 1K55A 1Q2PA 5ITJA 1NY0A 2Y4AA 5FDHA 4E3NA 2G7UA 1OT9A 2O99A 4WZ5C 1PWGA 4H8RA 5U47A 4PM6A 4XXRA 2PBDP 3UE6A 3SS5A 2DCFA 4WMCD 1T18A 1GHPA 3C5AA 1W79A 3QP1A 3QP6A 1MPLA 2PR5A 3OPHA 3CUEC 2Y2KA 4OP8A 5A92A 5J8XA 5EM1A 2WGVA 4DE0A 3H82B 1YSQA 1ZG6A 4LV0A 2J3TD 2JC7A 2QZ6A 4R6LA 3RFBA 4LRXC 1H0MA 4N9KA 3OPPA 1G5UA 2ZC7A 4NK3A 4YWZA 4RYEA 2FH5A 1UB4C 4Y0OA 4OOLA 5TJJA 1F5MA 2ZQ7A 3GR2A 1UWNX 1KDWA 4FH4A 1I5QA 3ICYA 1TD5A 1YLTA 3HLWA 4Y0TA 3S7NA 2BLSA 1KVMA 2O9CA 2NUPC 3S7OA 4EWFA 4KZ5A 5DFXA 2JKGA 1W8YA 2CMNA 3QP4A 3HLEA 2ZJ9A 1PNEA 5EVIA 2HP6A 3O3VA 1XP4A 2V0UA 4DKIA 3VSLA 1H8ZA 2BTFP 4P87A 2V8FA 2M7UA 1DY6A 2OAQ1 3RXXA 1TDGA 1X0OA 2PYRA 4JF6A 5FA7A 3A3DA 2O0YA 1T19A 5F5YA 1PWCA 4I39A 5L2FA 3RJUA 2J80A 2OLUA 4X56A 2A24B 2ZD8A 4ZDXA 3LI8A 4D60A 3BFDA 5AVEA 3S22A 1FIKA 4R0QA 1IEMA 4H6JB 1JTDA 2W27A 3EEHA 3F1OB 1EROA 4ESPA 5CGSA 2YKHA 1YLYA 1ES5A 2BG1A 2L66A 3T4QA 2PD7A 4RX3A 3EGDC 5FSRA 4A5RA 1ES4A 1CEFA 3W8KA 2X71A 3GDIA 1OJ5A 1FR6A 2KDKA 1MZUA 5EFWA 3IH8A 3Q07A 3GSGA 5F68A 1BZAA 4BD0A 5EVID 1VM1A 1YLJA 4EBPA 4QHCA 5FEFA 1BYWA 1F98A 3IH9A 1GHIA 2OWHA 5GLDA 2K31A 1YMXA 4PM9A 5HFOA 4ARZB 3UB6A 2WKPA 4HBTA 4IBXA 4Z1WA 3MFXA 1FCNA 5G18A 2JBFA 5EUAA 2QJ5A 4S2NA 5DVAA 1L0DA 4E3IA 4LV1A 1SKFA 4OH0A 5CTMA 3MQ0A 1L3LA 1XGJA 4YNRA 1FILA 3Q7VA 3NI9A 2L4RA 4JF4A 4NKPA 4CLCA 3NDGA 3WRZA 3BLSA 4NXBA 5LBRA 4E3KA 2HDUA 4OPZA 5G4YA 3UPNA 1ZC2A 5CERA 1QMEA 1OTAA 4UQIS 5TGFA 3DWKA 3P7NA 3NOPC 2B5RA 1OTDA 2QWSA 2ZM8A 1XFQA 2EA9A 1Y4OA 5I94A 2M1CA 1RGZA 3UE3A 1W8QA 1FCMA 3PBSA 4N1HA 2OV5A 4YFMA 3F1NB 1P9WA 4R4SA 3C30A 4ZAMA 3G30A 3WS2A 2EWWA 4I3JA 2XGNA 3PHYA 2D02A 1W63Q 3QNCA 1LHYA 1DRMA 2WUQA 3E2KA 1IYOA 1K54C 1TDLA 1XFNA 2R9WA 1ZKJA 4EERA 3MF0A 4X25A 4L9GA 2ZL1B 1ERQA 3PAEA 2XROA 5FI7A 2HV1A 4DMZA 4Y13A 3CJMA 4WM9A 2PR6A 4R3AA 3MQOA 4EU0A 4CLCD 5KIZA 5DTKA 4ZBEA 1NYYA 4OPRA 2V20A 1HVBA 2JKRM 3IS2B 4GD8A 4S2KA 4MN6A 3OC2A 4NXGA 1CI8A 4MBHA 4FH2A 4KZBA 3DTIA 1LL5A 1M40A 4WLAA 3SOIA 3UNWA 4KZ4A 3GQZA 1TF1A 5HAQA 1PI5A 3LR4A 3PAGA 3A0VA 5J7EA 2WZZA 3HLDA 5TBMA 2QPNA 3GTCA 5KZHA 3UE1A 5ITMA 3ZG5A 3WS1A 3R7WB 4FCFA 1XXMA 3E0YA 5GHXA 3VP1A 2EX6A 1XA7A 4RX2A 2C6WB 5HWTA 4GS9B 4OLDA 3HLCA 1VETA 3HBRA 2Z2MB 5GHZA 1LSXA 1L0FA 2ZC5B 2UWXA 1S1ZA 1D7EA 3A0RA 4XT2B 3MXQA 3MKFA 3QNBA 1GSVA 1L2SA 3M6HA 1V9ZA 3LY3A 4ZJ1A 1JVJA 2HF6A 3PXPA 3LIBA 4DDSA 3W4PA 3PBTA 5KMWA 2JCHA 4JF5A 4R1GA 1ACFA 3BFCA 3ZQ5A 1HTZA 3BFGA 2DRWA 1K4FA 1O7EA 4UQIM 2H0TA 4LGWA 4E04A 1K6RA 1J9MA 3OCNA 1PRQA 1NYMA 2Z2LB 1MC0A 2FFFB 3LIAA 3OBFA 3C7VA 4WN5A 3IHAA 1SKOA 4WZ5A 2JN7A 1YSPA 1W63M 3CPTA 2WGWB 2QKPA 3OZHA 3S7PA 1AXBA 5HDSA 3NC8A 2B18A 3GECA 3VOYA 1YKDA 2VEAA 5L8MA 2VK3A 2O9AA 3T1SA 5FL3A 4N1XA 3FWLA 1OTBA 2W1TB 3CUEA 5KSCA 3NY4A 4HQAA 1ONHA 2P04A 1S67L 4M4XA 4HEFA 5HL1A 4S2OA 4GHIA 4ZJ2A 3S4XA 3KX0X 2FZ0A 4KZAA 5FDSA 2ZBBA 4O01A 5HW3A 4KZ8A 1KGGA 2J8YA 3C8CA 4GOGA 4OKPA 2WKRA 3WWXA 1G68A 4G3WA 4LV3A 4N92A 1E3UA 4BD1A 3CWFA 4IUKA 2Y91A 3IWQA 4EBLA 3VMAA 2HP5A 5AQ9A 1GA0A 3P98A 3D3OA 4DE3A 3B47A 4DJ3A 3FKVA 4F3LA 4KQQA 4EQ1A 5F6AA 3WS4A 1MBLA 1MWUA 4PKYA 3MXRA 3EQUA 1PI4A 1DJCA 2VV7A 4E6WA 4NETA 4OP5A 2XEPA 5CXWA 3BLMA 5DFYA 3M6BA 3N6IA 1SZVA 4K08A 3LR0A 2HDRA 3PR6A 3PBRA 5E2FA 2EWVA 2XK1A 1CEGA 5CEDA 2GJ3A 2GDNA 2ZQ9A 4UEYA 3V3RA 3MKEA 1TS0A 2PHYA 3GRJA 1YQSA 2XR0A 3ZFZA 1YM1A 3E2LA 1FR1A 3E4PA 3JPUA 2HPBA 1E3UD 2EX8A 2RL3A 3T4KA 1VB6A 2VGLM 5E2EA 4NXEA 1DJBA 4X55A 1K6SA 5EVIB 2EFUA 2JKFA 1I2WA 1YFBA 3IF6C 3NJAA 4QY6A 4CQHA 4Q8IA 1DJAA 2Y2NA 2H28A 1V9YA 5HWWA 1A0KA 4I38A 4CPKA 4KQOA 4JXGA 4IUHA 4X6TA 4PM7A 1KE3A 4BBVA 3ITAA 2ZLYA 1LSVA 1BSGA 4EBNA 2EFXA 4KUOA 3TW8A 4LCLA 4LENA 1XJ3A 3MBZA 2BASA 2VLGA 4E3JA 1C3BA 3HJKA 4UA7A 1KOUA 2GX5A 4KZ3A 4PM5A 3WRTA 5GL9A 1PW1A 1YMSA 1NLYA 1RGYA 2WYXA 4LV2A 2IWDA 3O88A 4E3MA 2XA7S 2PAVP 5M1AA 3LO7A 3VV4A 1IOUA 2LB9A 3ZGAB 3NHQA 3FG8A 3UMEA 3W4QA 4DE1A 3FKWA 4EW7A 3N8SA 4HY8A 3UDIA 4S2JA 2W3GA 4LFUA 1T1AA 2ZQ8A 2IWBA 3HREA 3T1QB 5FASA 2INWA 4RVAA 2D01A 1RP5A 4ETXA 2PRFA 3VP4A 4Q0HA 1FOFA 5DJTA 3V50A 3DW0A 4G3VA 5A93A 3BY9A 4S2PA 1K54A 1KGFA 1IYQA 1TS8A 2Y2QA 4NXFA 3V67A 5L07A 4BL3A 1DP9A 2EX9A 5FQIA 3Q7VB 4IVKA 2Q9NA 3BY8A 5FQJA 1GHMA 3LGOA 4IJGA 4CLCB 3QP8A 3SW1A 3A0SA 5J3WA 2ZMFA 3OOVA 1FCOA 3ZVTA 5F1GA 3IWIA 4B93A 4HH3A 2J3TC 4QU3A 3T4TA 4WELA 1YAXA 4EUVA 5HWVA 5HDDA 4OPQA 3A3JA 3FYZA 3CAXA 1S4SA 1S66L 3FPVA 3BWLA 3IXHA 3HCYA 3GV9A 5HDCA 3QP5A 3JVVA 1HZOA 3MMHA 4MN7A 2J9OA 4PKYG 3E4QA 1PZOA 3M2KA 1CQAA 1K55C 1WA9A 1JWPA 1E25A 4B4XA 1YSFA 5CRFA 1OTEA 3HLFA 2KX6A 4OQGA 1CI9A 1K4EA 5MC7A 5IS1A 4S2MA 4I3AA 3IF5A 4YOFA 1SHVA 1N9LA 3E98A 3LIEA 5A91A 1M6KA 3IBRA 4JKTA 3VFHA 2P9VA 3UY6A 4QB8A 5EECA 3ZYTA 3TRCA 3BEBA 1MWTA 3D72A 1NRFA 2XD1A 3T4LA 4L0LA 2P08A 4X69A 4I3IA 2A49A 3MS6A 4XUXA 4OQHA 1P97A 2XA7M 5CTNA 3CMZA 4WYYA 2QA4I 5TBMB 4IBRA 4FD8A 4EEUA 5CGXA 2VV6A 3AGEA 3C4PA 2VKSA 3NCKA 4P6BA 2WADA 5K5BA 3UDXA 3KYEA 2XQZA 2XF3A 5EVLA 5EVIC 1OT6A 4WF0A 3R4KA 1VETB 2Y2LA 2IWCA 3G4PA 3VP2A 2L1MA 4Q0IA 1PIOA 3V3SA 3SS3A 1IYPA 1IELA 3O86A 3V5MA 1KDSA 2VV8A 2ZC3B 1ESUA 2GNXA 1MVFD 2VGKA 4GDNA 4IVIA 4HJ3A 3BYDA 1GSXA 1LL8A 2ZC4B 4GB7A 2PDRA 1IKIA 2EX2A 1AWIA 2JE5A 3IXDA 1K57C 3CZDA 3UO9A 1CJFA 4L9EA 2LB5A 4O8GA 1T1CA 3C38A 3EOIA 1SKOB 3O27A 1P0ZA 1LI9A 3TE8A 4C3QA 3CPTB 5HAPA 2JKRI 2XFTA 1Q2QA 1XGIA 4QD4A 2W0NA 1NJ4A 5I5LA 5JYOA 2Y2JA 2IA2A 5EPHA 2Y79A 2RCXA 4BMWA 4XUZA 5DKLA 2V8CA 4GHIB 3MSHA 2HJEA 3HUNA 3GVBA 1STZA 1MWSA 3N8RA 4NG2A 4HJ6A 2WKHA 5CHJA 4BBTA 2J7VA 2XRNA 2X02A 1ZG4A 2FFYA 3HUMA 1TEMA 4YINA 1IYSA 5DJUA 1OPXA 1N9BA 4UHUA 5HD5A 3T4SA 4F3LB 1N9OA 4KG6A 4F94A 4CLCC 2G2WA 5FQQA 4X1LA 3VFFA 4KG2A 2W3HA 4DXBA 2XSSA 3HL9A 5AQ7A 3IF6A 1ALQA 4X53A 1IFQA 1VHMA 3TG9A 3MZDA 4JXWA 3LEQA 4M3KA 4ETZA 3SS4A 3UPOA 1MKIA 1G28A 1NZOA 3A3IA 4GZBA 3NDEA 4WEKA 1L0GA 3LFVA 3I7JA 2R9XA 1BLCA 1KGEA 4I5SA 1S4RA 1UWPX 3O87A 5CEBA 2OSUA 3H7WA 1D06A 4ZRRA 3AGFA 3KYQA 5E2HA 3UE0A 3VOZA 4BWIA 1XJ4A 3P09A 4P0MA 3NULA 1PFLA 3LUQA 3LCEA 3PBNA 3O5YA 1MWRA 1WYCA 3T1XA 4MBKA 2ZOHA 5HSQA 3HLBA 3UB8A 1Y28A 3B42A 3UB7A 1VQQA 1KE4A 4ME4A 4BLMA 4BENA 5GLAA 2JKTM 4KQDA 4JBFA 2PT7A 2J3WA 1PZPA 1G6OA 4R3JA 2P74A 5JYPA 3NBLA 3KSIA 3Q1FA 5GHYA 1ZTUA 3FC7A 4MN5A 4FSFA 2WGIA 4JDMA 3G2YA 3FZCA 2UV0E 4OOMA 5HX9A 2V2FF 3P01A 1GSWA 3VSKA 3OCLA 4S2LA 4DRTA 2V1ZA 4UA6A 3G2ZA 1F9IA 3CG5A 3DTEA 3UB5P 2Z6DA 3DTMA 5EE8A 4PHTA 4ZJ3A 1BTLA 5EOEA 2MJ6A 1LT0A 3CLOA 2EXAA 3Q82A 3W2ZA 2Y8HA 4GKUA 4EEPA 4Y2FA 2A2LA 5FQ9A 4OQ0A 1XJ2A 3ZCZA 5E2GA 3IX8A 2XD5A 1XPBA 3ZVWA 1NWZA 1I2SA 1ZHHB 5HPFA 2JHEA 4EUZA 2A3UA 3HUOA 2WKIA 1FSWA 4PPRA 1Z6FA 3SH9A 4QWOA 3C2WA 1BUEA 3VE4A 2EXBA 1XKZA 5TFQA 4DJ2A 1WE4A 1TVFA 4ZTKA 2VX8A 4UA9A 5CGWA 4OPYA 3UN7A 1NXYA 3F1PA 1ONGA 4P6ZS 5HPIA 4EESA 5F82A 4JGPA 5FAPA 5HARA 4DDYA 4LPZA 3Q7ZA 4PAUA 3MZEA 1SDNA 4HIAA 4JGRA 3BRMA 1Y54A 1H8MA 3A3EA 4UAAA 3T4OA 3ISGA 2PYPA 2Y2IA 3ITBA 4HP4A 1S1YA 1UGUA 1DP6A 3GMWA 5EVEA 4WL9A 3K3DA 1YLZA 1PYYA 1BLHA 4MEZA 2PBYA 4E3OA 1TS6A 1P9RA 2Z6CA 2ZMVA 2HGVA 1U60A 3G32A 5CHMA 2XH9A 4JXSA 4N9LA 3K2NA 3EEAA 1N4OA 2K1NA 4Y17A 4B88A 4II7A 3CI6A 3UDFA 1VEUA 4DF6A 3LICA 2OWJA 2V9AA 1SCWA 4IEDA 2P9VB 3ZG8B 3IT9A 3QP2A 3NIAA 2WKEA 4U0XA 2DMWA 2VGJA 3OPLA 2K2NA 2RO5A 2B95A 4Z9QA 4U3TA 4JDOA 4KZ6A 1ES3A 4X68A 3V39A 3SH7A 4K91A 4MDZA 5DF9A 2J9PA 2ZOIA 1H8YA 3U2AA 2NUTC 1YT4A 1EI5A 2PU2A 4RA7A 4BQMA 4EXOA 1E4DA 3H82A 2PU4A 4JGOA 5CHUA 5CECA 5C5KA 5FATA 1K57A 1L0EA 3IX3A 3K3CA 1PWDA 4QJGA 1LL9A 1OMEA 2WAEA 3S7QA 3PBOA 5FAOA 3L9KA 4L9FA 2FY9A 4FTXA 2QJ7A 3E4OA 4JLFA 1YLPA 4FOFA 3WS5A 1NRJA 1GCEA 3TSGA 3VP0A 5M19A 4Y15A 3BJNA 3T4JA 3TOIA 1GA9A 4RQ9A 2Y2PA 3IHBA 4GDBA 4KUKA 4E3LA 5EV0A 2GLWA 1W5DA 2E8JA 2H0YA 4P6ZM 3ZG0A 1ODVA 4OOYA 4QPRA 3FV7A 4AFIA 3C7UA 5DF8A 2ZC6B 4HESA 3BQ8A 3B3XA 1BLSA 4O0PA 3BECA 2RO4A 2VZWA 2A24A 5IHVA 4KG5A 1S0WA 2R78A 3IWOA 3ZG9B 1YPRA 4P85A 2W3FA 2Y2OA 5BOHA 4DN0A 4DXCA 3Q81A 1Z09A 3EGXC 4H6JA 4Y3IA 2X01A 3T1RA 3BM6A 1JWVA 3F1OA 2E8IA 2W3EA 4OONA 2V0WA 2RO3A 1OJGA 1MY8A 4WEJA 3EQVA 4B4ZA 3OLOA 4KQRA 1PW8A 1JNUA 2L0WA 1MKMA 3ZNTA 4WBGA 1EW0A 4MLLA 4K0XA 3LYXA 2ZMAA 1TS7A 3LY4A 3M2JA 5J4EA 2GZAA 3BFEA 4HBUA 2Y2GA 4CJNA 5HD3A 2I9VA 3LEZA 5A8BA 2KOIA 1CK3A 4JGQA 5GLBA 4KZ7A 3ZHHA 4OVDA 1XA1A 4OLGA 4MBFA 1MXOA 3G31A 3MZFA 5FAQA 2AVXA 1T1BA 4ARZA 4GN2A 1KVLA 3HLGA 4KENB 5FI2A 5FQKA 3D9YA 1F2KA 1K25A 3ULFA 3IBJA 1SDEA 4HHDA 2HDQA 2Y2HA 4PM8A 3C4OA 3HVFA 5FEGA
chains in the Genus database with same CATH topology
4BBVA 4ZRRA 1LSVA 1N9NA 5KSHA 5F68A 3B33A 4GJ4A 3KYQA 5HZHA 1OTIA 2HJ9C 4KUOA 5HL6A 3RH8B 3TW8A 4BWIA 4IHQA 1XJ3A 1XJ4A 1BYWA 1F98A 2BASA 2VLGA 2KLIA 3NOTC 3HJKA 3LUQA 1KOUA 3PBNA 3O5YA 2OWHA 2GX5A 4HH2A 2QHKA 2ZOHA 5HSQA 2K31A 3UB8A 1Y28A 1NLYA 4HJ4A 3B42A 3UB7A 4ARZB 3UB6A 3TNDB 2WKPA 4ME4A 2JKTM 4KQDA 2PT7A 2J3WA 1G6OA 4Z1WA 3H7WB 5F69A 3KSIA 3MFXA 2XA7S 3VV4A 1IOUA 3LR5A 1H3QA 1ZTUA 2LB9A 4LRYC 2QJ5A 3FC7A 3NHQA 3FG8A 4HNBA 4MN5A 3UMEA 3MQ0A 4FSFA 2V1BA 4Q0JA 3F1NA 4JDMA 3KSFA 4YNRA 4EW7A 4OOMA 4BJPA 3P01A 2L4RA 1GSWA 4NKPA 3TJZC 3OCLA 4HY8A 2W3GA 4CLCA 1T1AA 1F9IA 3LIDA 2Z6DA 3UB9A 4MCWA 4NXBA 4PHTA 5LBRA 5G4YA 1OTAA 4HOIA 4UQIS 2MJ6A 1LT0A 3P7NA 3CLOA 3NOPC 1OTDA 3W2ZA 2INWA 2Y8HA 2QWSA 3BW6A 1XFQA 2D01A 2EA9A 4EEPA 3H9WA 4ETXA 4Y2FA 4Q0HA 2K7SA 2M1CA 2A2LA 3JVUA 5DJTA 2VGLS 3VOLA 4G3VA 3UE3A 3BY9A 4MMNA 1XJ2A 3PBSA 1NWZA 1ZHHB 1TS8A 3KO6A 4NXFA 3V67A 3F1NB 1P9WA 3C30A 2OOLA 5HPFA 2JHEA 1DP9A 4WUJA 2EWWA 3BY8A 4I3JA 3PHYA 2D02A 3IS2A 1W63Q 4CLCE 1DRMA 4IJGA 3G6OA 4CLCB 2YKFA 3SW1A 3A0SA 5J3WA 2ZMFA 1XFNA 2WKQA 3OOVA 2VA0A 4B93A 4HH3A 3C2WA 4EERA 2J3TC 3MF0A 3T4TA 4WELA 3VE4A 4L9GA 1YAXA 4EUVA 5HWVA 5AVFA 5HDDA 3T50A 2XROA 4DJ2A 3LI9A 2HV1A 4DMZA 3CAXA 2VX8A 1S4SA 1S66L 4HP9A 3FPVA 2PR6A 4R3AA 3BWLA 3MQOA 4EU0A 5IU1A 4CLCD 5KIZA 5CX7A 3F1PA 5HPIA 4P6ZS 3HCYA 4EESA 5HDCA 3R7WA 4JGPA 3JVVA 4LPZA 3MMHA 4MN7A 2W1RA 3CITA 2JKRM 3IS2B 4NEED 4PAUA 4PKYG 3VE3A 4HIAA 3PYPA 4JGRA 3E4QA 4GS9A 3HJIA 3LR3A 5IT5A 4MN6A 3OC2A 1H8MA 4NXGA 2VJWA 5G4ZA 1DP8A 1WA9A 1Z0RA 4WLAA 4B9OA 1TF1A 3UMDA 2M7VA 1YSFA 3T4OA 1OTEA 2KX6A 2PYPA 4XT2A 3LR4A 4GCZA 4HP4A 3A0VA 5MC7A 5DKKA 1S1YA 5IS1A 1UGUA 2V1AA 1DP6A 4I3AA 4YOFA 2PD8A 1N9LA 2W3DA 3E98A 3LIEA 5J7EA 3IBRA 4WL9A 4R70A 4Y5FA 5TBMA 3EWKA 3K3DA 1XJ6A 3F1PB 5ITMA 3MJQA 3R7WB 3E0YA 3ZYTA 3TRCA 2JKTI 4G3KA 1NLZA 4R38A 1TS6A 1P9RA 4BBUA 2Z6CA 5HWTA 2ZMVA 3D72A 4GS9B 3T4LA 4L0LA 2HGVA 2P08A 3KSHA 2P7JA 4I3IA 3KSGA 1LSXA 3K2NA 1P97A 3BQAA 4EETB 1S1ZA 1D7EA 2XA7M 2QYBA 3A0RA 2K1NA 3EEAA 4XT2B 4GW9A 4II7A 3CI6A 3MXQA 1GSVA 1V9ZA 2QA4I 4LRZE 3LICA 2OWJA 2V9AA 2HF6A 3PXPA 4HI4A 3LIBA 5TBMB 4EEUA 3PBTA 2DMWA 2VV6A 2W1TA 2K2NA 2VKSA 2RO5A 5K5BA 4JDOA 3ZQ5A 5AJGA 1OT6A 4WF0A 2B02A 4UQIM 4E04A 3R4KA 3LIFA 4MDZA 3RTYA 5DF9A 2ZOIA 3DBAA 1LSWA 3FPWA 3OCNA 1MC0A 4GLQA 3LIAA 3OBFA 3U2AA 2L1MA 2NUTC 4WN5A 3KYZA 4Q0IA 2JN7A 3MQQA 3MR0A 1YSPA 1W63M 4EXOA 2QKPA 2O9BA 2VV8A 3S7PA 3H82A 5HDSA 3NOUC 4JGOA 2B18A 2OAP1 3GECA 2GNXA 3PBQA 5C5KA 1YKDA 2VEAA 4LLOB 5L8MA 1MVFD 2O9AA 5FL3A 3K3CA 4HJ3A 5ITJA 1GSXA 1OTBA 2W1TB 1LL8A 3CUEA 4HQAA 2G7UA 1OT9A 2O99A 3S7QA 2P04A 1S67L 4M4XA 2PDRA 3PBOA 4GHIA 4L9FA 3UE6A 2FY9A 2QJ7A 3E4OA 3KX0X 2FZ0A 4FOFA 1NRJA 1T18A 2ZBBA 4O01A 2PR5A 3BJNA 4L9EA 3T4JA 2LB5A 3CUEC 4O8GA 1T1CA 3C38A 3EOIA 3O27A 4RQ9A 1P0ZA 3C8CA 3TE8A 2WKRA 4G3WA 2JKRI 3H82B 4KUKA 1YSQA 2GLWA 2J3TD 3CWFA 4IUKA 2W0NA 4P6ZM 4R6LA 3RFBA 4LRXC 5I5LA 1ODVA 4QPRA 2IA2A 3D3OA 4YWZA 3B47A 4DJ3A 2Y79A 4F3LA 2FH5A 4AFIA 4EQ1A 5F6AA 4BMWA 1UB4C 5TJJA 4OOLA 1F5MA 3BQ8A 5DKLA 4GHIB 4PKYA 1UWNX 2HJEA 3EQUA 4O0PA 1STZA 2RO4A 2VV7A 3ICYA 2VZWA 1TD5A 4HJ6A 2A24A 3S7NA 5DFYA 4BBTA 2R78A 2O9CA 2NUPC 3S7OA 2XRNA 2W3FA 4K08A 3LR0A 4DN0A 3PR6A 5DFXA 3EGXC 4H6JA 4Y3IA 2CMNA 3F1OA 3PBRA 5DJUA 1OPXA 2W3EA 2V0WA 2RO3A 1OJGA 2EWVA 2V0UA 5HD5A 4WEJA 3EQVA 2GJ3A 2M7UA 3OLOA 3T4SA 2OAQ1 4F3LB 1N9OA 1JNUA 2L0WA 1MKMA 1X0OA 2PYRA 1EW0A 2O0YA 4CLCC 1T19A 4UEYA 5F5YA 4I39A 3LYXA 1TS0A 2PHYA 2W3HA 2XSSA 2J80A 3E4PA 1TS7A 2A24B 3LI8A 1IFQA 5J4EA 1VHMA 2GZAA 5AVEA 3T4KA 1VB6A 2VGLM 5HD3A 2I9VA 4NXEA 5A8BA 2KOIA 4H6JB 4JGQA 4ETZA 2W27A 3EEHA 3F1OB 1G28A 1YFBA 3NJAA 4CQHA 2YKHA 1T1BA 4WEKA 2L66A 4ARZA 3T4QA 2PD7A 3LFVA 3EGDC 2H28A 4I5SA 1S4RA 1V9YA 5HWWA 1UWPX 4I38A 3ULFA 4KQOA 3IBJA 4HHDA 3GDIA 1OJ5A 3H7WA 1D06A 2KDKA 1MZUA 5EFWA 4IUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EEA A;  2QYB A;  2K1N A;  4ZRR A;  4GW9 A;  4QPR A;  2IA2 A;  3CI6 A;  3D3O A;  2ZMF A;  2Y79 A;  4LRZ E;  5HL6 A;  1UB4 C;  5TJJ A;  3OOV A;  1F5M A;  4BWI A;  3C2W A;  3MF0 A;  4O0P A;  2KLI A;  1STZ A;  3NOT C;  4EUV A;  2RO4 A;  3O5Y A;  2W1T A;  2K2N A;  2GX5 A;  2VKS A;  2XRO A;  2RO5 A;  1TD5 A;  2VZW A;  5K5B A;  4DMZ A;  3S7N A;  5HSQ A;  2K31 A;  3ZQ5 A;  5DFY A;  2O9C A;  5AJG A;  2XRN A;  3S7O A;  3TND B;  4ME4 A;  2W3F A;  4EU0 A;  4DN0 A;  4E04 A;  5DFX A;  3R4K A;  4MDZ A;  5HPI A;  4Y3I A;  3DBA A;  3HCY A;  4Z1W A;  2W3E A;  3KSI A;  2RO3 A;  1MC0 A;  3MMH A;  3OBF A;  2W1R A;  3CIT A;  4GLQ A;  4MN7 A;  4PAU A;  3VV4 A;  4Q0I A;  1ZTU A;  2LB9 A;  4LRY C;  3NHQ A;  1YSP A;  2M7U A;  2O9B A;  3S7P A;  3MQ0 A;  3NOU C;  2B18 A;  2VJW A;  1MKM A;  4Q0J A;  5C5K A;  1YKD A;  2VEA A;  3KSF A;  5L8M A;  1Z0R A;  1MVF D;  2O0Y A;  4YNR A;  2O9A A;  1TF1 A;  2M7V A;  1YSF A;  2W3H A;  2W3G A;  5ITJ A;  2XSS A;  2W1T B;  2G7U A;  2O99 A;  3S7Q A;  4MCW A;  4YOF A;  5LBR A;  1VHM A;  2W3D A;  3E98 A;  3IBR A;  4IUH A;  2FY9 A;  4R70 A;  4Y5F A;  3NOP C;  2KOI A;  4FOF A;  3W2Z A;  2Y8H A;  4ETZ A;  5ITM A;  4ETX A;  4O01 A;  3E0Y A;  4Y2F A;  4Q0H A;  3BJN A;  1YFB A;  3TRC A;  2LB5 A;  4O8G A;  4G3K A;  4CQH A;  4G3V A;  3O27 A;  4RQ9 A;  4MMN A;  2L66 A;  3LFV A;  4G3W A;  2HGV A;  1YSQ A;  3KO6 A;  2GLW A;  3KSH A;  2OOL A;  4IUK A;  5HPF A;  3IBJ A;  3KSG A;  4R6L A;  3RFB A;  4LRX C;  3K2N A;  5I5L A;  4IJG A;  3G6O A; 
#chains in the Genus database with same CATH topology
 1N9N A;  3IF6 B;  5KSH A;  3UPP A;  3B33 A;  4GJ4 A;  5HZH A;  1OTI A;  2HJ9 C;  1K56 A;  5HL6 A;  3RH8 B;  4EQI A;  3PTE A;  3DWZ A;  4DE2 A;  4IHQ A;  2KLI A;  3NOT C;  4OQI A;  4HH2 A;  2QHK A;  4X1M A;  4HJ4 A;  5EOO A;  1HLU P;  3A3F A;  3TND B;  3JYI A;  1HD8 A;  4S2I A;  5L10 A;  4C6Y A;  4MNR A;  2ZM2 A;  1ES2 A;  3H7W B;  5F69 A;  5F83 A;  2XFS A;  4EV4 A;  3IXB A;  3N7W A;  4FUW A;  3LR5 A;  1H3Q A;  4LRY C;  2XDM A;  1EWZ A;  4HNB A;  5A90 A;  5M18 A;  2V1B A;  4Q0J A;  3F1N A;  3KSF A;  1IKG A;  4BJP A;  5L09 A;  1JWZ A;  3TJZ C;  1G6A A;  5FQM A;  3RXW A;  1YLW A;  3LID A;  3UB9 A;  4GD6 A;  4MCW A;  4S2N C;  2WZX A;  2H5S A;  3CHW P;  4HOI A;  2ZQC A;  5HAI A;  4Y7P A;  2ZL1 A;  4JXV A;  3BW6 A;  4Y0U A;  3SZT A;  2HDS A;  3H9W A;  4QY5 A;  1K56 D;  2K7S A;  3JVU A;  2Q9M A;  2VGL S;  3VOL A;  4PMA A;  4O7D A;  1BT5 A;  4MMN A;  5E43 A;  3KO6 A;  2WK0 A;  4R4R A;  2OOL A;  2QMI A;  1BLP A;  4WUJ A;  3T12 B;  3IS2 A;  4CLC E;  2Q0O A;  4GNU A;  3MXS A;  3G6O A;  2ACG A;  2YKF A;  1ESI A;  2HZ5 A;  4K0W A;  2I72 A;  2WKQ A;  1QMF A;  1LLB A;  4C75 A;  2VA0 A;  4R23 A;  4KZ9 A;  5DF7 A;  5AVF A;  2Y59 A;  3T50 A;  3U4L P;  4BL2 A;  1H5X A;  3LI9 A;  3MFD A;  3BFF A;  2G2U A;  2ZQD A;  5FI6 A;  1NZU A;  5D3O A;  5DTS A;  4HP9 A;  5IU1 A;  3G34 A;  5GLC A;  5CX7 A;  3ZDJ A;  3R7W A;  3DAV A;  3IQA A;  1J3W A;  5F1F A;  3QHY A;  3W4O A;  4NEE D;  2W1R A;  3CIT A;  3VE3 A;  1LI0 A;  2Y55 A;  4U0T A;  3PYP A;  1S6R A;  4D2O A;  3N8L A;  4GS9 A;  3HJI A;  3LR3 A;  5IT5 A;  3S1Y A;  2VJW A;  5G4Z A;  1DP8 A;  1FSY A;  4WZ4 A;  1Z0R A;  4R3B A;  1XX2 A;  1K0K A;  3IXG A;  4B9O A;  2DNS A;  3UMD A;  2M7V A;  2CC1 A;  3SH8 A;  4XT2 A;  4GCZ A;  2H10 A;  5DKK A;  2V1A A;  2PD8 A;  3L7H A;  1D1J A;  5EM0 A;  2Y2M A;  2W3D A;  1JTG A;  1K38 A;  4R70 A;  4Y5F A;  3EWK A;  1XJ6 A;  3F1P B;  2C5W B;  3MJQ A;  3VP3 A;  1RCJ A;  3N4I A;  2JKT I;  4G3K A;  1W7F A;  1NLZ A;  4R38 A;  4BBU A;  3IX4 A;  3G35 A;  2WAF A;  3KSH A;  3OPR A;  2P7J A;  3WS0 A;  3KSG A;  3BQA A;  4EET B;  3ZNY A;  4ID4 A;  3ZG7 B;  2QYB A;  4E6X A;  4WMC A;  3NEC A;  4GW9 A;  2WGW A;  4LRZ E;  3AGD A;  4JPM A;  4HI4 A;  1ERM A;  1WYB A;  5DTT A;  2XLN A;  4LCM A;  2W1T A;  5AQB A;  3DTK A;  5AJG A;  1KE0 A;  2B02 A;  5AQA A;  3LIF A;  3D4F A;  5TR7 A;  3RTY A;  3DBA A;  1LSW A;  2OLV A;  3FPW A;  1FQG A;  2ZQA A;  4GLQ A;  1CF0 A;  3KYZ A;  2ZM0 A;  3MQQ A;  3MR0 A;  1VEU B;  2O9B A;  1BUL A;  3NOU C;  2OAP 1;  1O07 A;  3PBQ A;  4LLO B;  2HP9 A;  1K55 A;  1Q2P A;  5ITJ A;  1NY0 A;  2Y4A A;  5FDH A;  4E3N A;  2G7U A;  1OT9 A;  2O99 A;  4WZ5 C;  1PWG A;  4H8R A;  5U47 A;  4PM6 A;  4XXR A;  2PBD P;  3UE6 A;  3SS5 A;  2DCF A;  4WMC D;  1T18 A;  1GHP A;  3C5A A;  1W79 A;  3QP1 A;  3QP6 A;  1MPL A;  2PR5 A;  3OPH A;  3CUE C;  2Y2K A;  4OP8 A;  5A92 A;  5J8X A;  5EM1 A;  2WGV A;  4DE0 A;  3H82 B;  1YSQ A;  1ZG6 A;  4LV0 A;  2J3T D;  2JC7 A;  2QZ6 A;  4R6L A;  3RFB A;  4LRX C;  1H0M A;  4N9K A;  3OPP A;  1G5U A;  2ZC7 A;  4NK3 A;  4YWZ A;  4RYE A;  2FH5 A;  1UB4 C;  4Y0O A;  4OOL A;  5TJJ A;  1F5M A;  2ZQ7 A;  3GR2 A;  1UWN X;  1KDW A;  4FH4 A;  1I5Q A;  3ICY A;  1TD5 A;  1YLT A;  3HLW A;  4Y0T A;  3S7N A;  2BLS A;  1KVM A;  2O9C A;  2NUP C;  3S7O A;  4EWF A;  4KZ5 A;  5DFX A;  2JKG A;  1W8Y A;  2CMN A;  3QP4 A;  3HLE A;  2ZJ9 A;  1PNE A;  5EVI A;  2HP6 A;  3O3V A;  1XP4 A;  2V0U A;  4DKI A;  3VSL A;  1H8Z A;  2BTF P;  4P87 A;  2V8F A;  2M7U A;  1DY6 A;  2OAQ 1;  3RXX A;  1TDG A;  1X0O A;  2PYR A;  4JF6 A;  5FA7 A;  3A3D A;  2O0Y A;  1T19 A;  5F5Y A;  1PWC A;  4I39 A;  5L2F A;  3RJU A;  2J80 A;  2OLU A;  4X56 A;  2A24 B;  2ZD8 A;  4ZDX A;  3LI8 A;  4D60 A;  3BFD A;  5AVE A;  3S22 A;  1FIK A;  4R0Q A;  1IEM A;  4H6J B;  1JTD A;  2W27 A;  3EEH A;  3F1O B;  1ERO A;  4ESP A;  5CGS A;  2YKH A;  1YLY A;  1ES5 A;  2BG1 A;  2L66 A;  3T4Q A;  2PD7 A;  4RX3 A;  3EGD C;  5FSR A;  4A5R A;  1ES4 A;  1CEF A;  3W8K A;  2X71 A;  3GDI A;  1OJ5 A;  1FR6 A;  2KDK A;  1MZU A;  5EFW A;  3IH8 A;  3Q07 A;  3GSG A;  5F68 A;  1BZA A;  4BD0 A;  5EVI D;  1VM1 A;  1YLJ A;  4EBP A;  4QHC A;  5FEF A;  1BYW A;  1F98 A;  3IH9 A;  1GHI A;  2OWH A;  5GLD A;  2K31 A;  1YMX A;  4PM9 A;  5HFO A;  4ARZ B;  3UB6 A;  2WKP A;  4HBT A;  4IBX A;  4Z1W A;  3MFX A;  1FCN A;  5G18 A;  2JBF A;  5EUA A;  2QJ5 A;  4S2N A;  5DVA A;  1L0D A;  4E3I A;  4LV1 A;  1SKF A;  4OH0 A;  5CTM A;  3MQ0 A;  1L3L A;  1XGJ A;  4YNR A;  1FIL A;  3Q7V A;  3NI9 A;  2L4R A;  4JF4 A;  4NKP A;  4CLC A;  3NDG A;  3WRZ A;  3BLS A;  4NXB A;  5LBR A;  4E3K A;  2HDU A;  4OPZ A;  5G4Y A;  3UPN A;  1ZC2 A;  5CER A;  1QME A;  1OTA A;  4UQI S;  5TGF A;  3DWK A;  3P7N A;  3NOP C;  2B5R A;  1OTD A;  2QWS A;  2ZM8 A;  1XFQ A;  2EA9 A;  1Y4O A;  5I94 A;  2M1C A;  1RGZ A;  3UE3 A;  1W8Q A;  1FCM A;  3PBS A;  4N1H A;  2OV5 A;  4YFM A;  3F1N B;  1P9W A;  4R4S A;  3C30 A;  4ZAM A;  3G30 A;  3WS2 A;  2EWW A;  4I3J A;  2XGN A;  3PHY A;  2D02 A;  1W63 Q;  3QNC A;  1LHY A;  1DRM A;  2WUQ A;  3E2K A;  1IYO A;  1K54 C;  1TDL A;  1XFN A;  2R9W A;  1ZKJ A;  4EER A;  3MF0 A;  4X25 A;  4L9G A;  2ZL1 B;  1ERQ A;  3PAE A;  2XRO A;  5FI7 A;  2HV1 A;  4DMZ A;  4Y13 A;  3CJM A;  4WM9 A;  2PR6 A;  4R3A A;  3MQO A;  4EU0 A;  4CLC D;  5KIZ A;  5DTK A;  4ZBE A;  1NYY A;  4OPR A;  2V20 A;  1HVB A;  2JKR M;  3IS2 B;  4GD8 A;  4S2K A;  4MN6 A;  3OC2 A;  4NXG A;  1CI8 A;  4MBH A;  4FH2 A;  4KZB A;  3DTI A;  1LL5 A;  1M40 A;  4WLA A;  3SOI A;  3UNW A;  4KZ4 A;  3GQZ A;  1TF1 A;  5HAQ A;  1PI5 A;  3LR4 A;  3PAG A;  3A0V A;  5J7E A;  2WZZ A;  3HLD A;  5TBM A;  2QPN A;  3GTC A;  5KZH A;  3UE1 A;  5ITM A;  3ZG5 A;  3WS1 A;  3R7W B;  4FCF A;  1XXM A;  3E0Y A;  5GHX A;  3VP1 A;  2EX6 A;  1XA7 A;  4RX2 A;  2C6W B;  5HWT A;  4GS9 B;  4OLD A;  3HLC A;  1VET A;  3HBR A;  2Z2M B;  5GHZ A;  1LSX A;  1L0F A;  2ZC5 B;  2UWX A;  1S1Z A;  1D7E A;  3A0R A;  4XT2 B;  3MXQ A;  3MKF A;  3QNB A;  1GSV A;  1L2S A;  3M6H A;  1V9Z A;  3LY3 A;  4ZJ1 A;  1JVJ A;  2HF6 A;  3PXP A;  3LIB A;  4DDS A;  3W4P A;  3PBT A;  5KMW A;  2JCH A;  4JF5 A;  4R1G A;  1ACF A;  3BFC A;  3ZQ5 A;  1HTZ A;  3BFG A;  2DRW A;  1K4F A;  1O7E A;  4UQI M;  2H0T A;  4LGW A;  4E04 A;  1K6R A;  1J9M A;  3OCN A;  1PRQ A;  1NYM A;  2Z2L B;  1MC0 A;  2FFF B;  3LIA A;  3OBF A;  3C7V A;  4WN5 A;  3IHA A;  1SKO A;  4WZ5 A;  2JN7 A;  1YSP A;  1W63 M;  3CPT A;  2WGW B;  2QKP A;  3OZH A;  3S7P A;  1AXB A;  5HDS A;  3NC8 A;  2B18 A;  3GEC A;  3VOY A;  1YKD A;  2VEA A;  5L8M A;  2VK3 A;  2O9A A;  3T1S A;  5FL3 A;  4N1X A;  3FWL A;  1OTB A;  2W1T B;  3CUE A;  5KSC A;  3NY4 A;  4HQA A;  1ONH A;  2P04 A;  1S67 L;  4M4X A;  4HEF A;  5HL1 A;  4S2O A;  4GHI A;  4ZJ2 A;  3S4X A;  3KX0 X;  2FZ0 A;  4KZA A;  5FDS A;  2ZBB A;  4O01 A;  5HW3 A;  4KZ8 A;  1KGG A;  2J8Y A;  3C8C A;  4GOG A;  4OKP A;  2WKR A;  3WWX A;  1G68 A;  4G3W A;  4LV3 A;  4N92 A;  1E3U A;  4BD1 A;  3CWF A;  4IUK A;  2Y91 A;  3IWQ A;  4EBL A;  3VMA A;  2HP5 A;  5AQ9 A;  1GA0 A;  3P98 A;  3D3O A;  4DE3 A;  3B47 A;  4DJ3 A;  3FKV A;  4F3L A;  4KQQ A;  4EQ1 A;  5F6A A;  3WS4 A;  1MBL A;  1MWU A;  4PKY A;  3MXR A;  3EQU A;  1PI4 A;  1DJC A;  2VV7 A;  4E6W A;  4NET A;  4OP5 A;  2XEP A;  5CXW A;  3BLM A;  5DFY A;  3M6B A;  3N6I A;  1SZV A;  4K08 A;  3LR0 A;  2HDR A;  3PR6 A;  3PBR A;  5E2F A;  2EWV A;  2XK1 A;  1CEG A;  5CED A;  2GJ3 A;  2GDN A;  2ZQ9 A;  4UEY A;  3V3R A;  3MKE A;  1TS0 A;  2PHY A;  3GRJ A;  1YQS A;  2XR0 A;  3ZFZ A;  1YM1 A;  3E2L A;  1FR1 A;  3E4P A;  3JPU A;  2HPB A;  1E3U D;  2EX8 A;  2RL3 A;  3T4K A;  1VB6 A;  2VGL M;  5E2E A;  4NXE A;  1DJB A;  4X55 A;  1K6S A;  5EVI B;  2EFU A;  2JKF A;  1I2W A;  1YFB A;  3IF6 C;  3NJA A;  4QY6 A;  4CQH A;  4Q8I A;  1DJA A;  2Y2N A;  2H28 A;  1V9Y A;  5HWW A;  1A0K A;  4I38 A;  4CPK A;  4KQO A;  4JXG A;  4IUH A;  4X6T A;  4PM7 A;  1KE3 A;  4BBV A;  3ITA A;  2ZLY A;  1LSV A;  1BSG A;  4EBN A;  2EFX A;  4KUO A;  3TW8 A;  4LCL A;  4LEN A;  1XJ3 A;  3MBZ A;  2BAS A;  2VLG A;  4E3J A;  1C3B A;  3HJK A;  4UA7 A;  1KOU A;  2GX5 A;  4KZ3 A;  4PM5 A;  3WRT A;  5GL9 A;  1PW1 A;  1YMS A;  1NLY A;  1RGY A;  2WYX A;  4LV2 A;  2IWD A;  3O88 A;  4E3M A;  2XA7 S;  2PAV P;  5M1A A;  3LO7 A;  3VV4 A;  1IOU A;  2LB9 A;  3ZGA B;  3NHQ A;  3FG8 A;  3UME A;  3W4Q A;  4DE1 A;  3FKW A;  4EW7 A;  3N8S A;  4HY8 A;  3UDI A;  4S2J A;  2W3G A;  4LFU A;  1T1A A;  2ZQ8 A;  2IWB A;  3HRE A;  3T1Q B;  5FAS A;  2INW A;  4RVA A;  2D01 A;  1RP5 A;  4ETX A;  2PRF A;  3VP4 A;  4Q0H A;  1FOF A;  5DJT A;  3V50 A;  3DW0 A;  4G3V A;  5A93 A;  3BY9 A;  4S2P A;  1K54 A;  1KGF A;  1IYQ A;  1TS8 A;  2Y2Q A;  4NXF A;  3V67 A;  5L07 A;  4BL3 A;  1DP9 A;  2EX9 A;  5FQI A;  3Q7V B;  4IVK A;  2Q9N A;  3BY8 A;  5FQJ A;  1GHM A;  3LGO A;  4IJG A;  4CLC B;  3QP8 A;  3SW1 A;  3A0S A;  5J3W A;  2ZMF A;  3OOV A;  1FCO A;  3ZVT A;  5F1G A;  3IWI A;  4B93 A;  4HH3 A;  2J3T C;  4QU3 A;  3T4T A;  4WEL A;  1YAX A;  4EUV A;  5HWV A;  5HDD A;  4OPQ A;  3A3J A;  3FYZ A;  3CAX A;  1S4S A;  1S66 L;  3FPV A;  3BWL A;  3IXH A;  3HCY A;  3GV9 A;  5HDC A;  3QP5 A;  3JVV A;  1HZO A;  3MMH A;  4MN7 A;  2J9O A;  4PKY G;  3E4Q A;  1PZO A;  3M2K A;  1CQA A;  1K55 C;  1WA9 A;  1JWP A;  1E25 A;  4B4X A;  1YSF A;  5CRF A;  1OTE A;  3HLF A;  2KX6 A;  4OQG A;  1CI9 A;  1K4E A;  5MC7 A;  5IS1 A;  4S2M A;  4I3A A;  3IF5 A;  4YOF A;  1SHV A;  1N9L A;  3E98 A;  3LIE A;  5A91 A;  1M6K A;  3IBR A;  4JKT A;  3VFH A;  2P9V A;  3UY6 A;  4QB8 A;  5EEC A;  3ZYT A;  3TRC A;  3BEB A;  1MWT A;  3D72 A;  1NRF A;  2XD1 A;  3T4L A;  4L0L A;  2P08 A;  4X69 A;  4I3I A;  2A49 A;  3MS6 A;  4XUX A;  4OQH A;  1P97 A;  2XA7 M;  5CTN A;  3CMZ A;  4WYY A;  2QA4 I;  5TBM B;  4IBR A;  4FD8 A;  4EEU A;  5CGX A;  2VV6 A;  3AGE A;  3C4P A;  2VKS A;  3NCK A;  4P6B A;  2WAD A;  5K5B A;  3UDX A;  3KYE A;  2XQZ A;  2XF3 A;  5EVL A;  5EVI C;  1OT6 A;  4WF0 A;  3R4K A;  1VET B;  2Y2L A;  2IWC A;  3G4P A;  3VP2 A;  2L1M A;  4Q0I A;  1PIO A;  3V3S A;  3SS3 A;  1IYP A;  1IEL A;  3O86 A;  3V5M A;  1KDS A;  2VV8 A;  2ZC3 B;  1ESU A;  2GNX A;  1MVF D;  2VGK A;  4GDN A;  4IVI A;  4HJ3 A;  3BYD A;  1GSX A;  1LL8 A;  2ZC4 B;  4GB7 A;  2PDR A;  1IKI A;  2EX2 A;  1AWI A;  2JE5 A;  3IXD A;  1K57 C;  3CZD A;  3UO9 A;  1CJF A;  4L9E A;  2LB5 A;  4O8G A;  1T1C A;  3C38 A;  3EOI A;  1SKO B;  3O27 A;  1P0Z A;  1LI9 A;  3TE8 A;  4C3Q A;  3CPT B;  5HAP A;  2JKR I;  2XFT A;  1Q2Q A;  1XGI A;  4QD4 A;  2W0N A;  1NJ4 A;  5I5L A;  5JYO A;  2Y2J A;  2IA2 A;  5EPH A;  2Y79 A;  2RCX A;  4BMW A;  4XUZ A;  5DKL A;  2V8C A;  4GHI B;  3MSH A;  2HJE A;  3HUN A;  3GVB A;  1STZ A;  1MWS A;  3N8R A;  4NG2 A;  4HJ6 A;  2WKH A;  5CHJ A;  4BBT A;  2J7V A;  2XRN A;  2X02 A;  1ZG4 A;  2FFY A;  3HUM A;  1TEM A;  4YIN A;  1IYS A;  5DJU A;  1OPX A;  1N9B A;  4UHU A;  5HD5 A;  3T4S A;  4F3L B;  1N9O A;  4KG6 A;  4F94 A;  4CLC C;  2G2W A;  5FQQ A;  4X1L A;  3VFF A;  4KG2 A;  2W3H A;  4DXB A;  2XSS A;  3HL9 A;  5AQ7 A;  3IF6 A;  1ALQ A;  4X53 A;  1IFQ A;  1VHM A;  3TG9 A;  3MZD A;  4JXW A;  3LEQ A;  4M3K A;  4ETZ A;  3SS4 A;  3UPO A;  1MKI A;  1G28 A;  1NZO A;  3A3I A;  4GZB A;  3NDE A;  4WEK A;  1L0G A;  3LFV A;  3I7J A;  2R9X A;  1BLC A;  1KGE A;  4I5S A;  1S4R A;  1UWP X;  3O87 A;  5CEB A;  2OSU A;  3H7W A;  1D06 A;  4ZRR A;  3AGF A;  3KYQ A;  5E2H A;  3UE0 A;  3VOZ A;  4BWI A;  1XJ4 A;  3P09 A;  4P0M A;  3NUL A;  1PFL A;  3LUQ A;  3LCE A;  3PBN A;  3O5Y A;  1MWR A;  1WYC A;  3T1X A;  4MBK A;  2ZOH A;  5HSQ A;  3HLB A;  3UB8 A;  1Y28 A;  3B42 A;  3UB7 A;  1VQQ A;  1KE4 A;  4ME4 A;  4BLM A;  4BEN A;  5GLA A;  2JKT M;  4KQD A;  4JBF A;  2PT7 A;  2J3W A;  1PZP A;  1G6O A;  4R3J A;  2P74 A;  5JYP A;  3NBL A;  3KSI A;  3Q1F A;  5GHY A;  1ZTU A;  3FC7 A;  4MN5 A;  4FSF A;  2WGI A;  4JDM A;  3G2Y A;  3FZC A;  2UV0 E;  4OOM A;  5HX9 A;  2V2F F;  3P01 A;  1GSW A;  3VSK A;  3OCL A;  4S2L A;  4DRT A;  2V1Z A;  4UA6 A;  3G2Z A;  1F9I A;  3CG5 A;  3DTE A;  3UB5 P;  2Z6D A;  3DTM A;  5EE8 A;  4PHT A;  4ZJ3 A;  1BTL A;  5EOE A;  2MJ6 A;  1LT0 A;  3CLO A;  2EXA A;  3Q82 A;  3W2Z A;  2Y8H A;  4GKU A;  4EEP A;  4Y2F A;  2A2L A;  5FQ9 A;  4OQ0 A;  1XJ2 A;  3ZCZ A;  5E2G A;  3IX8 A;  2XD5 A;  1XPB A;  3ZVW A;  1NWZ A;  1I2S A;  1ZHH B;  5HPF A;  2JHE A;  4EUZ A;  2A3U A;  3HUO A;  2WKI A;  1FSW A;  4PPR A;  1Z6F A;  3SH9 A;  4QWO A;  3C2W A;  1BUE A;  3VE4 A;  2EXB A;  1XKZ A;  5TFQ A;  4DJ2 A;  1WE4 A;  1TVF A;  4ZTK A;  2VX8 A;  4UA9 A;  5CGW A;  4OPY A;  3UN7 A;  1NXY A;  3F1P A;  1ONG A;  4P6Z S;  5HPI A;  4EES A;  5F82 A;  4JGP A;  5FAP A;  5HAR A;  4DDY A;  4LPZ A;  3Q7Z A;  4PAU A;  3MZE A;  1SDN A;  4HIA A;  4JGR A;  3BRM A;  1Y54 A;  1H8M A;  3A3E A;  4UAA A;  3T4O A;  3ISG A;  2PYP A;  2Y2I A;  3ITB A;  4HP4 A;  1S1Y A;  1UGU A;  1DP6 A;  3GMW A;  5EVE A;  4WL9 A;  3K3D A;  1YLZ A;  1PYY A;  1BLH A;  4MEZ A;  2PBY A;  4E3O A;  1TS6 A;  1P9R A;  2Z6C A;  2ZMV A;  2HGV A;  1U60 A;  3G32 A;  5CHM A;  2XH9 A;  4JXS A;  4N9L A;  3K2N A;  3EEA A;  1N4O A;  2K1N A;  4Y17 A;  4B88 A;  4II7 A;  3CI6 A;  3UDF A;  1VEU A;  4DF6 A;  3LIC A;  2OWJ A;  2V9A A;  1SCW A;  4IED A;  2P9V B;  3ZG8 B;  3IT9 A;  3QP2 A;  3NIA A;  2WKE A;  4U0X A;  2DMW A;  2VGJ A;  3OPL A;  2K2N A;  2RO5 A;  2B95 A;  4Z9Q A;  4U3T A;  4JDO A;  4KZ6 A;  1ES3 A;  4X68 A;  3V39 A;  3SH7 A;  4K91 A;  4MDZ A;  5DF9 A;  2J9P A;  2ZOI A;  1H8Y A;  3U2A A;  2NUT C;  1YT4 A;  1EI5 A;  2PU2 A;  4RA7 A;  4BQM A;  4EXO A;  1E4D A;  3H82 A;  2PU4 A;  4JGO A;  5CHU A;  5CEC A;  5C5K A;  5FAT A;  1K57 A;  1L0E A;  3IX3 A;  3K3C A;  1PWD A;  4QJG A;  1LL9 A;  1OME A;  2WAE A;  3S7Q A;  3PBO A;  5FAO A;  3L9K A;  4L9F A;  2FY9 A;  4FTX A;  2QJ7 A;  3E4O A;  4JLF A;  1YLP A;  4FOF A;  3WS5 A;  1NRJ A;  1GCE A;  3TSG A;  3VP0 A;  5M19 A;  4Y15 A;  3BJN A;  3T4J A;  3TOI A;  1GA9 A;  4RQ9 A;  2Y2P A;  3IHB A;  4GDB A;  4KUK A;  4E3L A;  5EV0 A;  2GLW A;  1W5D A;  2E8J A;  2H0Y A;  4P6Z M;  3ZG0 A;  1ODV A;  4OOY A;  4QPR A;  3FV7 A;  4AFI A;  3C7U A;  5DF8 A;  2ZC6 B;  4HES A;  3BQ8 A;  3B3X A;  1BLS A;  4O0P A;  3BEC A;  2RO4 A;  2VZW A;  2A24 A;  5IHV A;  4KG5 A;  1S0W A;  2R78 A;  3IWO A;  3ZG9 B;  1YPR A;  4P85 A;  2W3F A;  2Y2O A;  5BOH A;  4DN0 A;  4DXC A;  3Q81 A;  1Z09 A;  3EGX C;  4H6J A;  4Y3I A;  2X01 A;  3T1R A;  3BM6 A;  1JWV A;  3F1O A;  2E8I A;  2W3E A;  4OON A;  2V0W A;  2RO3 A;  1OJG A;  1MY8 A;  4WEJ A;  3EQV A;  4B4Z A;  3OLO A;  4KQR A;  1PW8 A;  1JNU A;  2L0W A;  1MKM A;  3ZNT A;  4WBG A;  1EW0 A;  4MLL A;  4K0X A;  3LYX A;  2ZMA A;  1TS7 A;  3LY4 A;  3M2J A;  5J4E A;  2GZA A;  3BFE A;  4HBU A;  2Y2G A;  4CJN A;  5HD3 A;  2I9V A;  3LEZ A;  5A8B A;  2KOI A;  1CK3 A;  4JGQ A;  5GLB A;  4KZ7 A;  3ZHH A;  4OVD A;  1XA1 A;  4OLG A;  4MBF A;  1MXO A;  3G31 A;  3MZF A;  5FAQ A;  2AVX A;  1T1B A;  4ARZ A;  4GN2 A;  1KVL A;  3HLG A;  4KEN B;  5FI2 A;  5FQK A;  3D9Y A;  1F2K A;  1K25 A;  3ULF A;  3IBJ A;  1SDE A;  4HHD A;  2HDQ A;  2Y2H A;  4PM8 A;  3C4O A;  3HVF A;  5FEG A; 
#chains in the Genus database with same CATH homology
 4BBV A;  4ZRR A;  1LSV A;  1N9N A;  5KSH A;  5F68 A;  3B33 A;  4GJ4 A;  3KYQ A;  5HZH A;  1OTI A;  2HJ9 C;  4KUO A;  5HL6 A;  3RH8 B;  3TW8 A;  4BWI A;  4IHQ A;  1XJ3 A;  1XJ4 A;  1BYW A;  1F98 A;  2BAS A;  2VLG A;  2KLI A;  3NOT C;  3HJK A;  3LUQ A;  1KOU A;  3PBN A;  3O5Y A;  2OWH A;  2GX5 A;  4HH2 A;  2QHK A;  2ZOH A;  5HSQ A;  2K31 A;  3UB8 A;  1Y28 A;  1NLY A;  4HJ4 A;  3B42 A;  3UB7 A;  4ARZ B;  3UB6 A;  3TND B;  2WKP A;  4ME4 A;  2JKT M;  4KQD A;  2PT7 A;  2J3W A;  1G6O A;  4Z1W A;  3H7W B;  5F69 A;  3KSI A;  3MFX A;  2XA7 S;  3VV4 A;  1IOU A;  3LR5 A;  1H3Q A;  1ZTU A;  2LB9 A;  4LRY C;  2QJ5 A;  3FC7 A;  3NHQ A;  3FG8 A;  4HNB A;  4MN5 A;  3UME A;  3MQ0 A;  4FSF A;  2V1B A;  4Q0J A;  3F1N A;  4JDM A;  3KSF A;  4YNR A;  4EW7 A;  4OOM A;  4BJP A;  3P01 A;  2L4R A;  1GSW A;  4NKP A;  3TJZ C;  3OCL A;  4HY8 A;  2W3G A;  4CLC A;  1T1A A;  1F9I A;  3LID A;  2Z6D A;  3UB9 A;  4MCW A;  4NXB A;  4PHT A;  5LBR A;  5G4Y A;  1OTA A;  4HOI A;  4UQI S;  2MJ6 A;  1LT0 A;  3P7N A;  3CLO A;  3NOP C;  1OTD A;  3W2Z A;  2INW A;  2Y8H A;  2QWS A;  3BW6 A;  1XFQ A;  2D01 A;  2EA9 A;  4EEP A;  3H9W A;  4ETX A;  4Y2F A;  4Q0H A;  2K7S A;  2M1C A;  2A2L A;  3JVU A;  5DJT A;  2VGL S;  3VOL A;  4G3V A;  3UE3 A;  3BY9 A;  4MMN A;  1XJ2 A;  3PBS A;  1NWZ A;  1ZHH B;  1TS8 A;  3KO6 A;  4NXF A;  3V67 A;  3F1N B;  1P9W A;  3C30 A;  2OOL A;  5HPF A;  2JHE A;  1DP9 A;  4WUJ A;  2EWW A;  3BY8 A;  4I3J A;  3PHY A;  2D02 A;  3IS2 A;  1W63 Q;  4CLC E;  1DRM A;  4IJG A;  3G6O A;  4CLC B;  2YKF A;  3SW1 A;  3A0S A;  5J3W A;  2ZMF A;  1XFN A;  2WKQ A;  3OOV A;  2VA0 A;  4B93 A;  4HH3 A;  3C2W A;  4EER A;  2J3T C;  3MF0 A;  3T4T A;  4WEL A;  3VE4 A;  4L9G A;  1YAX A;  4EUV A;  5HWV A;  5AVF A;  5HDD A;  3T50 A;  2XRO A;  4DJ2 A;  3LI9 A;  2HV1 A;  4DMZ A;  3CAX A;  2VX8 A;  1S4S A;  1S66 L;  4HP9 A;  3FPV A;  2PR6 A;  4R3A A;  3BWL A;  3MQO A;  4EU0 A;  5IU1 A;  4CLC D;  5KIZ A;  5CX7 A;  3F1P A;  5HPI A;  4P6Z S;  3HCY A;  4EES A;  5HDC A;  3R7W A;  4JGP A;  3JVV A;  4LPZ A;  3MMH A;  4MN7 A;  2W1R A;  3CIT A;  2JKR M;  3IS2 B;  4NEE D;  4PAU A;  4PKY G;  3VE3 A;  4HIA A;  3PYP A;  4JGR A;  3E4Q A;  4GS9 A;  3HJI A;  3LR3 A;  5IT5 A;  4MN6 A;  3OC2 A;  1H8M A;  4NXG A;  2VJW A;  5G4Z A;  1DP8 A;  1WA9 A;  1Z0R A;  4WLA A;  4B9O A;  1TF1 A;  3UMD A;  2M7V A;  1YSF A;  3T4O A;  1OTE A;  2KX6 A;  2PYP A;  4XT2 A;  3LR4 A;  4GCZ A;  4HP4 A;  3A0V A;  5MC7 A;  5DKK A;  1S1Y A;  5IS1 A;  1UGU A;  2V1A A;  1DP6 A;  4I3A A;  4YOF A;  2PD8 A;  1N9L A;  2W3D A;  3E98 A;  3LIE A;  5J7E A;  3IBR A;  4WL9 A;  4R70 A;  4Y5F A;  5TBM A;  3EWK A;  3K3D A;  1XJ6 A;  3F1P B;  5ITM A;  3MJQ A;  3R7W B;  3E0Y A;  3ZYT A;  3TRC A;  2JKT I;  4G3K A;  1NLZ A;  4R38 A;  1TS6 A;  1P9R A;  4BBU A;  2Z6C A;  5HWT A;  2ZMV A;  3D72 A;  4GS9 B;  3T4L A;  4L0L A;  2HGV A;  2P08 A;  3KSH A;  2P7J A;  4I3I A;  3KSG A;  1LSX A;  3K2N A;  1P97 A;  3BQA A;  4EET B;  1S1Z A;  1D7E A;  2XA7 M;  2QYB A;  3A0R A;  2K1N A;  3EEA A;  4XT2 B;  4GW9 A;  4II7 A;  3CI6 A;  3MXQ A;  1GSV A;  1V9Z A;  2QA4 I;  4LRZ E;  3LIC A;  2OWJ A;  2V9A A;  2HF6 A;  3PXP A;  4HI4 A;  3LIB A;  5TBM B;  4EEU A;  3PBT A;  2DMW A;  2VV6 A;  2W1T A;  2K2N A;  2VKS A;  2RO5 A;  5K5B A;  4JDO A;  3ZQ5 A;  5AJG A;  1OT6 A;  4WF0 A;  2B02 A;  4UQI M;  4E04 A;  3R4K A;  3LIF A;  4MDZ A;  3RTY A;  5DF9 A;  2ZOI A;  3DBA A;  1LSW A;  3FPW A;  3OCN A;  1MC0 A;  4GLQ A;  3LIA A;  3OBF A;  3U2A A;  2L1M A;  2NUT C;  4WN5 A;  3KYZ A;  4Q0I A;  2JN7 A;  3MQQ A;  3MR0 A;  1YSP A;  1W63 M;  4EXO A;  2QKP A;  2O9B A;  2VV8 A;  3S7P A;  3H82 A;  5HDS A;  3NOU C;  4JGO A;  2B18 A;  2OAP 1;  3GEC A;  2GNX A;  3PBQ A;  5C5K A;  1YKD A;  2VEA A;  4LLO B;  5L8M A;  1MVF D;  2O9A A;  5FL3 A;  3K3C A;  4HJ3 A;  5ITJ A;  1GSX A;  1OTB A;  2W1T B;  1LL8 A;  3CUE A;  4HQA A;  2G7U A;  1OT9 A;  2O99 A;  3S7Q A;  2P04 A;  1S67 L;  4M4X A;  2PDR A;  3PBO A;  4GHI A;  4L9F A;  3UE6 A;  2FY9 A;  2QJ7 A;  3E4O A;  3KX0 X;  2FZ0 A;  4FOF A;  1NRJ A;  1T18 A;  2ZBB A;  4O01 A;  2PR5 A;  3BJN A;  4L9E A;  3T4J A;  2LB5 A;  3CUE C;  4O8G A;  1T1C A;  3C38 A;  3EOI A;  3O27 A;  4RQ9 A;  1P0Z A;  3C8C A;  3TE8 A;  2WKR A;  4G3W A;  2JKR I;  3H82 B;  4KUK A;  1YSQ A;  2GLW A;  2J3T D;  3CWF A;  4IUK A;  2W0N A;  4P6Z M;  4R6L A;  3RFB A;  4LRX C;  5I5L A;  1ODV A;  4QPR A;  2IA2 A;  3D3O A;  4YWZ A;  3B47 A;  4DJ3 A;  2Y79 A;  4F3L A;  2FH5 A;  4AFI A;  4EQ1 A;  5F6A A;  4BMW A;  1UB4 C;  5TJJ A;  4OOL A;  1F5M A;  3BQ8 A;  5DKL A;  4GHI B;  4PKY A;  1UWN X;  2HJE A;  3EQU A;  4O0P A;  1STZ A;  2RO4 A;  2VV7 A;  3ICY A;  2VZW A;  1TD5 A;  4HJ6 A;  2A24 A;  3S7N A;  5DFY A;  4BBT A;  2R78 A;  2O9C A;  2NUP C;  3S7O A;  2XRN A;  2W3F A;  4K08 A;  3LR0 A;  4DN0 A;  3PR6 A;  5DFX A;  3EGX C;  4H6J A;  4Y3I A;  2CMN A;  3F1O A;  3PBR A;  5DJU A;  1OPX A;  2W3E A;  2V0W A;  2RO3 A;  1OJG A;  2EWV A;  2V0U A;  5HD5 A;  4WEJ A;  3EQV A;  2GJ3 A;  2M7U A;  3OLO A;  3T4S A;  2OAQ 1;  4F3L B;  1N9O A;  1JNU A;  2L0W A;  1MKM A;  1X0O A;  2PYR A;  1EW0 A;  2O0Y A;  4CLC C;  1T19 A;  4UEY A;  5F5Y A;  4I39 A;  3LYX A;  1TS0 A;  2PHY A;  2W3H A;  2XSS A;  2J80 A;  3E4P A;  1TS7 A;  2A24 B;  3LI8 A;  1IFQ A;  5J4E A;  1VHM A;  2GZA A;  5AVE A;  3T4K A;  1VB6 A;  2VGL M;  5HD3 A;  2I9V A;  4NXE A;  5A8B A;  2KOI A;  4H6J B;  4JGQ A;  4ETZ A;  2W27 A;  3EEH A;  3F1O B;  1G28 A;  1YFB A;  3NJA A;  4CQH A;  2YKH A;  1T1B A;  4WEK A;  2L66 A;  4ARZ A;  3T4Q A;  2PD7 A;  3LFV A;  3EGD C;  2H28 A;  4I5S A;  1S4R A;  1V9Y A;  5HWW A;  1UWP X;  4I38 A;  3ULF A;  4KQO A;  3IBJ A;  4HHD A;  3GDI A;  1OJ5 A;  3H7W A;  1D06 A;  2KDK A;  1MZU A;  5EFW A;  4IUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...