2W1TA

Crystal structure of b. subtilis spovt
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
175
structure length
175
Chain Sequence
ATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGDVILKKYSPISELGDFAKEYADALYDSLGHSVLICDRDVYIAVSGSSKKDYLNKSISEMLERTMDQRSSVLESDAKSVQLVNGIDEDMNSYTVGPIVANGDPIGAVVIFSKDQTMGEVEHKAVETAAGFLARQME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAGE V SPORULATION PROTEIN T
publication title Crystal Structure of Spovt, the Final Modulator of Gene Expression During Spore Development in Bacillus Subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 43
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04014 MazE_antitoxin Antidote-toxin recognition MazE, bacterial antitoxin
A PF15714 SpoVT_C Stage V sporulation protein T C-terminal, transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.260.10 Mainly Beta Ribbon Pemi-like Protein 1; Chain: D Pemi-like Protein 1; Chain: D 2w1tA01
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w1tA02
4QPRA 2XRNA 4E04A 2W3EA 3S7PA 2OOLA 2G7UA 3NOPC 4MDZA 2RO5A 1VHMA 4ZRRA 4O01A 3HCYA 2L66A 4Y5FA 3NOTC 5K5BA 5HPFA 1ZTUA 3KO6A 4IJGA 5HSQA 2IA2A 4RQ9A 3G6OA 3VV4A 3CI6A 2K1NA 4Z1WA 2HGVA 2GX5A 3DBAA 2O9BA 3KSHA 3O27A 2FY9A 4G3WA 5L8MA 3D3OA 1MVFD 2KOIA 3EEAA 1YSFA 2VZWA 2O9CA 5TJJA 3TNDB 4Q0HA 5C5KA 2O99A 1TF1A 2LB9A 2M7UA 4YNRA 4EU0A 5HPIA 3IBRA 1YFBA 2W3GA 4DMZA 2W3HA 4LRXC 1Z0RA 2KLIA 4G3VA 3OOVA 3KSGA 2XSSA 4LRYC 4G3KA 3E98A 2K31A 4Y2FA 4GLQA 4MCWA 4R70A 2VEAA 3LFVA 3W2ZA 2O0YA 2GLWA 4DN0A 3E0YA 3S7NA 5AJGA 3C2WA 2RO3A 2RO4A 3O5YA 2W1TB 4IUKA 4O8GA 5HL6A 2XROA 4Q0IA 3RFBA 2VKSA 5ITJA 4BWIA 4EUVA 3S7QA 3OBFA 4ME4A 3KSIA 3S7OA 4Y3IA 3ZQ5A 3K2NA 2VJWA 1F5MA 1TD5A 3KSFA 4CQHA 3IBJA 5DFXA 1YKDA 3CITA 2W1RA 3MF0A 2W3DA 4YOFA 5I5LA 1UB4C 4GW9A 1YSPA 4FOFA 4LRZE 1YSQA 3R4KA 2K2NA 4MN7A 2QYBA 4MMNA 1STZA 1MC0A 2Y8HA 2M7VA 3MMHA 2B18A 2ZMFA 2Y79A 4PAUA 2LB5A 5ITMA 2W3FA 3TRCA 4O0PA 5DFYA 4R6LA 3MQ0A 4Q0JA 3NOUC 5LBRA 3BJNA 2O9AA 4IUHA 3NHQA 2W1TA 4ETZA 4ETXA 1MKMA
chains in the Genus database with same CATH superfamily
4S2JA 3F1OB 3BW6A 5CGXA 5FATA 4JXSA 2OOLA 1DP6A 2IWDA 1Y28A 5DTTA 2WKHA 1K54A 3N8LA 1A0KA 1RP5A 1L0FA 1S0WA 3KO6A 3C38A 4S2PA 4JLFA 1S66L 5FL3A 1MWUA 5CHUA 5EVEA 4Y13A 1K55C 2EFXA 2R78A 1OT9A 3LR4A 4BD0A 3LIFA 3LYXA 4GDNA 1AWIA 2A3UA 4I3IA 3T4TA 1JTDA 1N9LA 2JKTM 4DE2A 4I38A 4LGWA 3WS1A 3LR0A 4DXCA 4JF4A 4K91A 5GHXA 4PHTA 1YLTA 3M6BA 2A24A 4KQDA 3OLOA 3UPNA 1LSXA 3S7NA 3GTCA 4O8GA 4N9KA 3VOYA 1IYOA 1N9NA 2PR6A 3S7QA 3S7OA 3IWQA 2VV6A 1TD5A 5DFXA 3UE0A 2W3DA 1K56D 3WWXA 2J8YA 3DTIA 3E4OA 4DXBA 3R4KA 3NDEA 4X69A 1K57A 3VE4A 3DWKA 3N8RA 2OLVA 3H7WA 2ACGA 4EWFA 4OQHA 4R38A 3PBRA 1VETB 3ZNYA 4KQQA 4Q0JA 4U0TA 2PDRA 3N8SA 3LIDA 3FG8A 4ZTKA 4OPQA 2V9AA 3A3IA 2Y2PA 3S4XA 5CRFA 5TR7A 1D1JA 3UPPA 4E6XA 4RQ9A 3TE8A 2PU2A 3Q7VB 4Y7PA 4CPKA 4Z1WA 3MQOA 5E2FA 3UDFA 3IXBA 5EM1A 3IF6B 3ZG0A 1VEUB 2ZQAA 2OV5A 2VGLM 3UO9A 5TBMB 3PBQA 3DTKA 2HDUA 1I5QA 3C7VA 4EQIA 2J9OA 4GNUA 3ISGA 1S1YA 2K31A 4MBFA 5CHMA 4X55A 1ZG6A 5G4ZA 3FKWA 2VV8A 4R70A 4M3KA 4RYEA 3BFFA 3IQAA 5GLCA 1ES5A 5G4YA 3MKEA 3V3SA 2J9PA 2QWSA 5EVIA 1UWNX 4Y3IA 4FH4A 3KYZA 2HDRA 1SDEA 3NDGA 3IX4A 3CITA 2EWWA 4AFIA 3CG5A 3SW1A 4Q8IA 1IELA 5FQIA 3WRTA 3W4OA 1PZPA 4X53A 2ZMFA 4HBUA 4S2LA 1S67L 3UE6A 5DFYA 1PYYA 4R1GA 3I7JA 4JGOA 4IBXA 4HH3A 5FI2A 1P9RA 4IUHA 1K57C 4ETZA 3LR3A 2DMWA 1NLYA 1GSXA 4KG2A 4K0XA 3IXHA 4NK3A 1TVFA 1DJBA 1MWRA 3A3EA 1ZG4A 2WUQA 3NOTC 1FCMA 5F1GA 4QB8A 5HL1A 1LLBA 3G6OA 3VV4A 5AVEA 1OTIA 4WL9A 4D60A 2EX8A 2V1AA 2XD5A 1DP9A 1BSGA 3GVBA 4GD6A 5HAPA 1XP4A 3ITBA 2VGJA 2O9CA 4C3QA 4HJ3A 5GLBA 4II7A 3GDIA 3V3RA 2B95A 4OQ0A 3IF5A 4LV0A 5M19A 3K3CA 5CTNA 2A2LA 3NECA 1OPXA 4K0WA 3G30A 2ZC3B 4GD8A 2O0YA 4Z9QA 2HJ9C 2XEPA 1L0EA 4DF6A 4LCMA 2CC1A 4EETB 5FI7A 1TS8A 3EGDC 3L7HA 4ME4A 2PD8A 4Y0TA 3CMZA 2JKTI 2G2UA 2Y59A 3F1PB 2Z2MB 3LIAA 3G34A 1EWZA 4LRZE 4B88A 3A0RA 3T4KA 1PWGA 1MC0A 1BLHA 4R3BA 3HLFA 2Q9NA 3VSLA 2W3FA 4YFMA 4R6LA 1H8MA 4EBPA 3MQ0A 1GSVA 3UB9A 3ZG9B 3D4FA 2G7UA 3IF6C 5HPFA 4H6JA 4FUWA 4C6YA 2GJ3A 4WMCA 3VP4A 1JWZA 1LL5A 1OTDA 5HFOA 2WGIA 1MVFD 1M40A 5DF9A 3K3DA 3UY6A 2RL3A 3LI9A 1Q2PA 3QP4A 3CPTB 2WAFA 4YNRA 3PYPA 5FAPA 3SS5A 3HLGA 5L07A 1KGFA 5DF8A 4LRYC 3SH8A 4MN6A 4ZDXA 3BFCA 2ZC4B 4NXFA 5CECA 3W2ZA 2VLGA 2P7JA 4HP4A 3NY4A 5AQ9A 3D9YA 2RO3A 4KUKA 1YLJA 5DTKA 2W0NA 1G6AA 2BLSA 3TW8A 3QP2A 1FOFA 1W79A 2OLUA 1ODVA 4EUZA 4EXOA 3MSHA 1YKDA 2Y4AA 2ZM0A 3MF0A 1XJ6A 2EWVA 1MXOA 1S4SA 4S2MA 1KGEA 1T1AA 4XT2B 2D01A 3DW0A 2Y79A 4QY5A 4QU3A 4I3JA 5D3OA 3NI9A 3MS6A 4R23A 5CTMA 2ZM2A 3NHQA 5FAQA 4N1HA 3LEZA 1SCWA 2P9VB 2RO5A 1LT0A 5L10A 3ZNTA 3A3FA 2Y2IA 4Y5FA 4GOGA 4IVKA 4H8RA 3EEHA 4B9OA 4HIAA 5EM0A 1GSWA 3BLSA 3G31A 4CLCB 1L0GA 4I39A 1ERMA 1TDLA 4PMAA 2PYRA 3O3VA 3EEAA 5DKLA 3SOIA 4WM9A 1XA7A 3Q81A 2Y2OA 2I72A 5HWWA 3Q7ZA 3HLEA 5FA7A 2OWJA 2Y2QA 2Y2MA 1CK3A 3OCNA 1CF0A 2WKIA 3HJIA 4HY8A 3C4PA 4LLOB 5AQ7A 1Y4OA 1TS6A 5I94A 1PWCA 4EW7A 2OAP1 3G35A 4N92A 1IYPA 4WEJA 5F82A 3EQUA 2VEAA 2Y2GA 1N9OA 3G32A 4UQIS 3U2AA 3C2WA 2RO4A 4LPZA 2W1TB 4EQ1A 3BFGA 4F3LB 4L0LA 2JKFA 4PM5A 1LSWA 4BWIA 3EWKA 4E6WA 2GZAA 3BRMA 4UA6A 1W63M 1K0KA 4XUXA 4R3AA 1FSYA 3KSFA 2HPBA 1P9WA 2CMNA 1O7EA 3V67A 4MEZA 2IWCA 5HARA 4PKYG 2QPNA 3Q07A 3FKVA 2K7SA 3UMDA 1CI8A 2HDSA 2ZC7A 2QJ5A 3RH8B 3T4QA 2O9AA 1KE4A 1CQAA 1MKMA 1NXYA 4PM9A 3MZEA 2ZOIA 2ZQCA 1MWTA 3WS4A 4KENB 1CEGA 4O01A 1PI4A 5E43A 4NXEA 2FFYA 2IA2A 2A24B 3IX8A 4M4XA 5FQKA 1V9YA 1FSWA 3UPOA 5FI6A 4IBRA 5L8MA 2L1MA 4LV2A 2JCHA 1TF1A 2XQZA 4LENA 4MBKA 4HI4A 4Y17A 4HNBA 4FTXA 1OT6A 3H7WB 2Q0OA 3LY4A 3ZGAB 3Q82A 4OPYA 4BENA 4HH2A 3IX3A 1JWVA 4X1MA 1SKFA 5HL6A 4Q0IA 1IKIA 1DY6A 3RFBA 2BG1A 4U0XA 5J8XA 2J3TC 3V39A 4PM7A 3VOLA 5BOHA 4JXWA 3HREA 3UE1A 4JDMA 3M2JA 3P09A 5GLAA 3V50A 4GW9A 1NJ4A 3PBTA 3UE3A 2ZC6B 2K2NA 4OOMA 1PZOA 3PHYA 1GHMA 5HZHA 1E25A 5ITMA 1G28A 1YLWA 1XJ3A 3PAEA 3VP1A 3IH9A 2GNXA 3T4OA 4GS9B 4QWOA 4R3JA 3B33A 3QHYA 1K4FA 3T4SA 4CLCC 2JKRM 2ZL1A 2Z6DA 2YKHA 4L9EA 3NOPC 1VHMA 1BLSA 3HCYA 1ES2A 2XFTA 3CLOA 1XFNA 3CUEA 3OPHA 5KSCA 5TGFA 2J3WA 1RCJA 3PTEA 4Y0OA 1FR6A 3LUQA 5EVIB 3A3DA 2KOIA 1PW1A 3QNBA 1YSFA 2XR0A 1RGYA 3HUOA 4GZBA 4N9LA 3OPRA 3IBRA 1WYCA 4WBGA 5DVAA 2XLNA 3AGEA 1Q2QA 4G3VA 1IEMA 1LL9A 4G3KA 5EVLA 1H5XA 2X02A 4ARZB 1K54C 3HLCA 1E4DA 1NYMA 1BT5A 4S2KA 4BL3A 4DE0A 3E0YA 3SZTA 2ZQDA 4BD1A 4GS9A 4HJ4A 2P04A 5ITJA 3UB6A 4E3MA 5CEBA 5FDHA 5FDSA 1T18A 5FAOA 2QMIA 3BQAA 4KZ4A 4KG6A 3IS2B 4JF5A 5J7EA 1MKIA 2XGNA 3HL9A 4WMCD 3O87A 2XFSA 2MJ6A 5HDSA 5TFQA 4OONA 5IHVA 3NC8A 3VE3A 5FQJA 4ETXA 3GECA 4DRTA 4MDZA 3T50A 4WYYA 1SDNA 4X1LA 1FIKA 4ARZA 5J4EA 5EPHA 2PT7A 4KZBA 1L2SA 4MLLA 2K1NA 5KMWA 3KYQA 1S1ZA 2B5RA 3PBNA 1NZOA 4HJ6A 3DTEA 2BASA 3CUEC 4HQAA 3PXPA 4X56A 3TNDB 2EX6A 2V0UA 4EU0A 1YFBA 2Z2LB 3UB7A 3IS2A 4E3LA 4I5SA 3KSGA 3DAVA 3JVUA 1FCNA 3JYIA 4MCWA 3LFVA 2WKEA 3PR6A 2H0TA 5U47A 3SS4A 1BLPA 3LIEA 3W8KA 1YT4A 2E8IA 3P98A 1PWDA 3TOIA 3OPPA 2ZQ9A 4U3TA 4E3OA 1W8YA 4H6JB 3UN7A 2AVXA 5CXWA 3L9KA 3T1QB 4FOFA 4BBTA 3C7UA 1JNUA 4FH2A 4X25A 2YKFA 5IU1A 2X01A 4IEDA 4WUJA 1LSVA 4UQIM 3O86A 2ZQ8A 2JBFA 3QP8A 1H3QA 1XFQA 4E3JA 1SKOA 1PFLA 1KE0A 4QPRA 4EESA 3NBLA 1XJ2A 4UA7A 2NUTC 5EVIC 2OSUA 1OJGA 4NETA 4KZ3A 2WZXA 4GN2A 4KZ7A 2J3TD 3CI6A 4OVDA 1YQSA 3ZG7B 2O9BA 1NRJA 3KSHA 4KG5A 3O27A 4OPRA 2QJ7A 5HX9A 2WKQA 4R0QA 5JYPA 3RTYA 3NULA 4PM8A 3VFFA 4Q0HA 1HTZA 2Y55A 1P97A 4JKTA 3F1NB 1L3LA 2DCFA 4B4ZA 3T4LA 1Z0RA 5FQMA 4EV4A 1QMEA 3T1SA 1HZOA 3S1YA 1P0ZA 4B93A 1CJFA 3VMAA 2ZQ7A 1GCEA 1Y54A 2JHEA 4CLCD 1LHYA 1E3UA 2GLWA 1AXBA 4XUZA 2XROA 3FWLA 3GV9A 3ZG5A 3NJAA 2H5SA 2RCXA 2OWHA 1W5DA 2KX6A 1BYWA 3LIBA 3DWZA 1XGJA 4E3IA 5DF7A 1YSQA 2H10A 4MN7A 1FCOA 2QKPA 4WELA 1MBLA 3PBOA 1OMEA 2V20A 2Z6CA 2LB5A 3LO7A 2HP6A 4O0PA 4WF0A 4S2NA 5KZHA 1XPBA 3NCKA 4OLDA 5LBRA 2A49A 1JTGA 1T1CA 3OZHA 3F1NA 5M18A 1NLZA 2WK0A 2P08A 1N9BA 1ZKJA 1XA1A 4QY6A 3OC2A 1DJCA 4E3NA 4C75A 1PIOA 4HOIA 1PNEA 1BULA 2FY9A 1IOUA 2Y2LA 1D06A 1WE4A 4OP5A 3TG9A 4RX2A 2LB9A 4KQOA 4NG2A 2JC7A 1IFQA 1YMSA 5HAQA 5IT5A 4BJPA 4D2OA 3MJQA 4Y2FA 2WGWA 4BL2A 5F68A 5EUAA 1W7FA 1KOUA 3FZCA 2Y2NA 4FSFA 5HWVA 4NKPA 4IUKA 3ULFA 4R4SA 2VX8A 4EUVA 5HAIA 4BBUA 3KSIA 3FC7A 2BTFP 3ZQ5A 5EFWA 3K2NA 4FD8A 4OQIA 2ZD8A 3WS2A 5FSRA 4PPRA 1K38A 4NXGA 2Y2JA 3CWFA 3BFDA 1VB6A 2Y8HA 3BWLA 3HJKA 2B18A 5A90A 4K08A 5KSHA 4WEKA 3TRCA 2C6WB 5A92A 3H82A 3HUMA 4KQRA 2WADA 4JDOA 4LV1A 5GHYA 4DJ2A 3T4JA 2VGKA 2ZOHA 4EEPA 2G2WA 1H0MA 1HVBA 4S2NC 1IYQA 4EBNA 1FQGA 5CEDA 4ZRRA 3LEQA 1I2WA 1ZTUA 5HSQA 4QD4A 4KZAA 1GHIA 4DJ3A 2C5WB 1GA0A 1PI5A 4G3WA 1D7EA 3VOZA 5FEFA 3MZFA 1O07A 3AGDA 2EXAA 2JE5A 3BECA 3HVFA 1YM1A 3VP0A 4P6ZM 4O7DA 3N7WA 2WGVA 2WKPA 2WZZA 3V5MA 4FCFA 4GHIB 3H9WA 5E2HA 2XA7S 3C30A 5EOOA 4CJNA 1ONGA 2IWBA 3B42A 5DTSA 2Y2HA 5AVFA 4DN0A 1YPRA 5FASA 4Y15A 5EVID 5DKKA 4BBVA 3UDIA 2ZL1B 1UGUA 4RA7A 1F2KA 1CI9A 3ZCZA 2PD7A 2XH9A 1XXMA 5AQAA 1J9MA 2P74A 3RJUA 2VV7A 4DDSA 3T12B 3MMHA 4PAUA 3BQ8A 1OTEA 5CGWA 1K6RA 5CX7A 2ZLYA 1YLPA 1WA9A 2ZJ9A 2R9WA 3LY3A 2Y91A 5TJJA 3E2KA 2PYPA 2XRNA 2V0WA 4E04A 4JGRA 5F83A 2HP5A 4GHIA 4OOLA 4L9GA 1K25A 4UA9A 4EERA 3BY9A 4BLMA 3M2KA 2PR5A 4LFUA 2X71A 3VFHA 5GHZA 5FEGA 4YWZA 3DBAA 1H8YA 4DE3A 1YAXA 3EGXC 2QHKA 3MZDA 3MXSA 4HEFA 3HLWA 2W27A 4QJGA 2VZWA 4GDBA 4OPZA 5A91A 3AGFA 1KDSA 4E3KA 3UDXA 1EROA 3E2LA 4ZJ1A 3RXXA 2W3GA 3BY8A 3MKFA 3F1OA 1MWSA 4ESPA 1NYYA 3ICYA 4GJ4A 1ACFA 1LL8A 3E98A 3ZVWA 4WN5A 4MBHA 3C4OA 3MR0A 4B4XA 2INWA 1ESUA 3O5YA 4LCLA 1W63Q 3GSGA 2L4RA 4QHCA 4IHQA 3B47A 3MXQA 1KGGA 4KZ8A 1FR1A 1F5MA 3MQQA 3GQZA 5I5LA 5EOEA 3UB5P 1KE3A 1YSPA 3VP3A 2I9VA 4HBTA 2QYBA 2PBYA 1STZA 2FH5A 5L2FA 1YLYA 1L0DA 3W4PA 3QP5A 3FPWA 2FZ0A 2PRFA 3FV7A 2ZM8A 2HDQA 1DP8A 2Q9MA 1ALQA 1BZAA 5CERA 3GMWA 3WS5A 4X68A 5DJTA 1S4RA 2D02A 3JVVA 2WYXA 1M6KA 4PM6A 3TSGA 3ZFZA 3PBSA 2L66A 2V8CA 5K5BA 3BFEA 3PAGA 3T1XA 2V1ZA 4OOYA 4CLCE 1G5UA 3BYDA 3G2ZA 5EV0A 1E3UD 2HGVA 2EX2A 2GX5A 5M1AA 1T19A 4P6ZS 2PU4A 1K4EA 4LV3A 3OCLA 5HD3A 1WYBA 3HLDA 3EQVA 4GCZA 1ES4A 3EOIA 1VETA 2ZC5B 2O99A 3O88A 5HD5A 5E2GA 1S6RA 2KLIA 2HP9A 4KZ5A 5HDCA 3MFDA 3E4QA 1N4OA 3M6HA 2XDMA 3BEBA 4HP9A 4DDYA 2XF3A 3Q7VA 1H8ZA 1LI0A 1ESIA 1YLZA 3IWOA 1SKOB 3LICA 2VKSA 3JPUA 2PAVP 3IF6A 1J3WA 4ZJ2A 1VEUA 2J80A 4EEUA 3FYZA 3ZYTA 2VJWA 4HHDA 3E4PA 4YINA 5TBMA 1X0OA 3Q1FA 2JN7A 3S22A 1SZVA 3A0SA 3LGOA 3R7WB 2VA0A 2HF6A 1XKZA 1MY8A 2UV0E 4RX3A 1XGIA 3OPLA 2H28A 3NOUC 1HLUP 1T1BA 1VQQA 1EW0A 2JKGA 2PBDP 3KYEA 2DNSA 2W3EA 3MBZA 3WRZA 4P85A 4BMWA 5JYOA 5F69A 2R9XA 1C3BA 3ITAA 2ZMVA 2OAQ1 5HW3A 1OTAA 1ES3A 2WKRA 1K56A 1F98A 1JWPA 1W8QA 3HUNA 2EX9A 4ID4A 2EFUA 3VP2A 2ZMAA 5AQBA 3HBRA 5HDDA 2H0YA 3D3OA 4JGPA 3ZG8B 3LI8A 4IVIA 1NRFA 4NEED 4JBFA 3DTMA 4KZ9A 5C5KA 5F5YA 2M7UA 5HPIA 4DMZA 2W3HA 5HWTA 4OLGA 1SHVA 4WZ5A 1KVMA 3TJZC 3OOVA 2UWXA 3R7WA 2XD1A 4Y0UA 1IYSA 5KIZA 3IXGA 2B02A 2HJEA 1XX2A 4JXVA 2JKRI 4R4RA 4L9FA 1MPLA 2V2FF 1FILA 1F9IA 3A3JA 1KDWA 3IHBA 3SS3A 5GLDA 3P7NA 2XK1A 1V9ZA 3RXWA 5A8BA 4CQHA 4YOFA 1ZC2A 1UB4C 3N4IA 2EXBA 4UEYA 1YMXA 4MNRA 3ZHHA 2XA7M 3SH7A 3P01A 3T1RA 4JGQA 3WS0A 5L09A 4KUOA 3UNWA 3LR5A 5GL9A 2NUPC 3BJNA 3FPVA 2VGLS 5FQQA 4KZ6A 3GRJA 1EI5A 3HLBA 1CEFA 1OJ5A 3LCEA 2WGWB 3N6IA 4UHUA 3F1PA 4N1XA 1XJ4A 1K6SA 3A0VA 1Z6FA 3BLMA 5E2EA 1UWPX 1NY0A 4JPMA 4P0MA 1NWZA 1JVJA 1TS7A 4DKIA 1G6OA 2V1BA 4DE1A 2PHYA 4OQGA 1LI9A 3QP1A 4ZAMA 2FFFB 4I3AA 4LRXC 5A93A 1BUEA 4ZBEA 2KDKA 4JXGA 1DJAA 3H82B 2VK3A 3C8CA 4NXBA 4WZ5C 5AJGA 3C5AA 5F6AA 3IH8A 5DJUA 3MXRA 1VM1A 1KVLA 3OBFA 3CHWP 5CGSA 2L0WA 1U60A 1GHPA 3IBJA 3CPTA 5CHJA 3UB8A 4UAAA 4WZ4A 4MMNA 2M7VA 2J7VA 3G2YA 4X6TA 3G4PA 2Y2KA 3IXDA 5J3WA 4OH0A 5EE8A 4ZJ3A 4OKPA 2EA9A 3S7PA 3VSKA 4GKUA 2V8FA 1G68A 1PRQA 1K55A 4JF6A 4IJGA 1MZUA 4XXRA 3IWIA 4RVAA 3IT9A 3NIAA 1DRMA 1BTLA 4S2OA 1BLCA 1NZUA 3D72A 4XT2A 2ZBBA 3KX0X 1Z09A 3B3XA 3ZDJA 1OTBA 4P6BA 3SH9A 5EECA 4HESA 3BM6A 4EBLA 2QA4I 1GA9A 2M1CA 1RGZA 2WAEA 4BQMA 2P9VA 2XSSA 1IKGA 3CZDA 5G18A 2E8JA 4GLQA 3UMEA 3U4LP 2QZ6A 2DRWA 1QMFA 1PW8A 3CJMA 3QP6A 5F1FA 3GR2A 1TEMA 3QNCA 4CLCA 4P87A 3MFXA 3ZVTA 3W4QA 5IS1A 1I2SA 1TS0A 1ONHA 3CAXA 1HD8A 5FQ9A 5MC7A 2W1RA 3IHAA 4A5RA 4PKYA 1ERQA 1TDGA 4S2IA 4GB7A 2HV1A 4F94A 2GDNA 4OP8A 2HZ5A 4MN5A 2W1TA 1ZHHB 4F3LA 4WLAA
chains in the Genus database with same CATH topology
3F1OB 4QPRA 2D02A 3BW6A 4EESA 3JVVA 2OOLA 1DP6A 1XJ2A 2RO5A 2NUTC 1LT0A 1Y28A 3PBSA 2L66A 4Y5FA 5K5BA 1OJGA 3EEHA 4B9OA 3KO6A 3C38A 4HIAA 2J3TD 1GSWA 3CI6A 4CLCE 1S66L 5FL3A 2HGVA 2GX5A 2O9BA 1T19A 4P6ZS 4CLCB 1NRJA 3KSHA 3O27A 4I39A 3OCLA 5HD3A 2QJ7A 2PYRA 2WKQA 2R78A 3EEAA 1OT9A 3RTYA 3EQVA 4GCZA 5DKLA 3LR4A 3EOIA 4Q0HA 2O99A 3LIFA 3LYXA 5HWWA 2OWJA 5HD5A 1P97A 4I3IA 3F1NB 3OCNA 3T4TA 3T4LA 1Z0RA 2KLIA 3HJIA 1N9LA 2JKTM 4HY8A 4LLOB 1P0ZA 4B93A 1TS6A 4I38A 4EW7A 2JHEA 2OAP1 5HDCA 3LR0A 3E4QA 4CLCD 4WEJA 4PHTA 3EQUA 2VEAA 4HP9A 2A24A 1N9OA 2GLWA 4KQDA 3OLOA 1LSXA 4UQIS 3S7NA 3C2WA 3U2AA 2RO4A 4LPZA 2W1TB 4O8GA 4EQ1A 2XROA 4F3LB 4L0LA 1N9NA 3LICA 2VKSA 2PR6A 1LSWA 4BWIA 3EWKA 3S7QA 3NJAA 3S7OA 2GZAA 2OWHA 1W63M 2J80A 4EEUA 2KX6A 1BYWA 2VV6A 3LIBA 3ZYTA 2VJWA 1TD5A 4R3AA 4HHDA 3E4PA 3KSFA 5DFXA 5TBMA 2W3DA 1X0OA 2JN7A 3E4OA 1P9WA 2CMNA 3A0SA 1YSQA 3R4KA 3R7WB 4MN7A 3V67A 2QKPA 4WELA 3VE4A 3PBOA 2VA0A 3H7WA 2HF6A 2Z6CA 4PKYG 2LB5A 4O0PA 4WF0A 4R38A 3PBRA 2K7SA 3UMDA 4Q0JA 2H28A 2PDRA 2QJ5A 3NOUC 5LBRA 3RH8B 3T4QA 1T1BA 2O9AA 3LIDA 3FG8A 1T1CA 1MKMA 1EW0A 2W3EA 2V9AA 4BMWA 3F1NA 5F69A 2ZOIA 1NLZA 2P08A 2ZMVA 2OAQ1 4O01A 1OTAA 2WKRA 4NXEA 3OC2A 2IA2A 2A24B 1F98A 4M4XA 4RQ9A 1V9YA 3TE8A 4Z1WA 3MQOA 4HOIA 2FY9A 5HDDA 5L8MA 3D3OA 2L1MA 4JGPA 3LI8A 4NEED 1IOUA 1D06A 5C5KA 5F5YA 1TF1A 2VGLM 2LB9A 5TBMB 3PBQA 2M7UA 4KQOA 5HPIA 4DMZA 4HI4A 2W3HA 5HWTA 1IFQA 4HNBA 3TJZC 3OOVA 5IT5A 1OT6A 3H7WB 4BJPA 3R7WA 1S1YA 2K31A 3MJQA 4Y2FA 5G4ZA 5F68A 2VV8A 4R70A 4HH2A 1KOUA 5KIZA 4FSFA 2B02A 2HJEA 5HWVA 4NKPA 2JKRI 4L9FA 4IUKA 5HL6A 3ULFA 4Q0IA 1F9IA 3RFBA 5G4YA 2VX8A 4EUVA 2J3TC 4BBUA 3VOLA 2QWSA 3KSIA 1UWNX 3FC7A 4Y3IA 3P7NA 3KYZA 1V9ZA 3ZQ5A 5A8BA 5EFWA 3K2NA 4CQHA 4JDMA 3CITA 2EWWA 4YOFA 4AFIA 1UB4C 3SW1A 4NXGA 4GW9A 4UEYA 3PBTA 2XA7M 3CWFA 3UE3A 2K2NA 4OOMA 1VB6A 2Y8HA 3BWLA 3HJKA 3PHYA 3P01A 2B18A 5HZHA 2ZMFA 4JGQA 5ITMA 1G28A 4K08A 5KSHA 4WEKA 3TRCA 1XJ3A 1S67L 3UE6A 5DFYA 3H82A 4KUOA 4JGOA 3LR5A 2GNXA 4HH3A 3T4OA 4GS9B 2NUPC 4JDOA 1P9RA 3BJNA 3B33A 4IUHA 3FPVA 2VGLS 4ETZA 3LR3A 2DMWA 3T4SA 1NLYA 4CLCC 1GSXA 2JKRM 4DJ2A 3T4JA 2ZOHA 2Z6DA 4EEPA 2YKHA 4L9EA 3NOPC 1VHMA 4ZRRA 1OJ5A 3HCYA 3NOTC 1ZTUA 3CLOA 1XFNA 5HSQA 3CUEA 3F1PA 3G6OA 3VV4A 2J3WA 5AVEA 1OTIA 1XJ4A 4WL9A 3A0VA 4DJ3A 2V1AA 1UWPX 4G3WA 1D7EA 1DP9A 3LUQA 1NWZA 2KOIA 1TS7A 1YSFA 2O9CA 1G6OA 2V1BA 4HJ3A 2PHYA 4P6ZM 4II7A 3GDIA 2WKPA 3IBRA 4I3AA 4GHIB 4LRXC 3H9WA 4G3VA 3K3CA 2XA7S 3C30A 2KDKA 2A2LA 4G3KA 1OPXA 4ARZB 3H82B 3B42A 3C8CA 4NXBA 2O0YA 5AVFA 4DN0A 3E0YA 5AJGA 2HJ9C 5DKKA 4BBVA 4GS9A 5F6AA 4HJ4A 2P04A 5ITJA 3UB6A 5DJUA 1UGUA 4EETB 1TS8A 3EGDC 3OBFA 4ME4A 2PD8A 2L0WA 1T18A 3BQAA 2PD7A 3IBJA 2JKTI 3IS2B 3F1PB 3LIAA 3UB8A 5J7EA 4LRZE 3A0RA 3T4KA 2VV7A 4MMNA 1MC0A 2M7VA 3MMHA 4PAUA 3BQ8A 2MJ6A 5HDSA 2W3FA 1OTEA 4R6LA 1H8MA 5CX7A 3MQ0A 1GSVA 3UB9A 5J3WA 3VE3A 1WA9A 4ETXA 5TJJA 2PYPA 2EA9A 2XRNA 3GECA 2V0WA 4E04A 3S7PA 4JGRA 2G7UA 4MDZA 4GHIA 4OOLA 4L9GA 3T50A 5HPFA 4H6JA 4EERA 4IJGA 2GJ3A 3BY9A 1MZUA 4ARZA 5J4EA 2PT7A 1DRMA 2PR5A 2K1NA 3KYQA 1S1ZA 3D72A 3DBAA 1OTDA 4YWZA 4XT2A 3PBNA 1YAXA 2ZBBA 2QHKA 3EGXC 3KX0X 4HJ6A 1MVFD 2BASA 1OTBA 2W27A 3CUEC 4HQAA 5DF9A 3PXPA 2VZWA 3K3DA 3LI9A 3TNDB 2QA4I 4YNRA 2M1CA 3PYPA 2V0UA 4EU0A 1YFBA 2W3GA 3BY8A 3UB7A 3IS2A 3F1OA 4I5SA 3KSGA 3ICYA 4GJ4A 2XSSA 4LRYC 3JVUA 4MN6A 1LL8A 3E98A 4GLQA 3UMEA 4WN5A 4NXFA 4MCWA 3MR0A 3W2ZA 2VLGA 3LFVA 2P7JA 2INWA 3PR6A 4HP4A 2RO3A 3O5YA 4KUKA 1W63Q 4CLCA 2W0NA 2L4RA 3MFXA 3TW8A 4IHQA 3LIEA 3B47A 3MXQA 5IS1A 1ODVA 3CAXA 1TS0A 1F5MA 4EXOA 5MC7A 4H6JB 1YKDA 3MQQA 2W1RA 3MF0A 5I5LA 1XJ6A 2EWVA 4PKYA 1YSPA 4FOFA 4BBTA 1S4SA 1JNUA 2I9VA 1T1AA 2D01A 4XT2B 2QYBA 1STZA 2FH5A 2HV1A 3FPWA 2Y79A 2YKFA 2FZ0A 5IU1A 4I3JA 4WUJA 1LSVA 4UQIM 1DP8A 3NHQA 1H3QA 1XFQA 4MN5A 2W1TA 5DJTA 1S4RA 1ZHHB 4F3LA 4WLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QPR A;  2XRN A;  4E04 A;  2W3E A;  3S7P A;  2OOL A;  2G7U A;  3NOP C;  4MDZ A;  2RO5 A;  1VHM A;  4ZRR A;  4O01 A;  3HCY A;  2L66 A;  4Y5F A;  3NOT C;  5K5B A;  5HPF A;  1ZTU A;  3KO6 A;  4IJG A;  5HSQ A;  2IA2 A;  4RQ9 A;  3G6O A;  3VV4 A;  3CI6 A;  2K1N A;  4Z1W A;  2HGV A;  2GX5 A;  3DBA A;  2O9B A;  3KSH A;  3O27 A;  2FY9 A;  4G3W A;  5L8M A;  3D3O A;  1MVF D;  2KOI A;  3EEA A;  1YSF A;  2VZW A;  2O9C A;  5TJJ A;  3TND B;  4Q0H A;  5C5K A;  2O99 A;  1TF1 A;  2LB9 A;  2M7U A;  4YNR A;  4EU0 A;  5HPI A;  3IBR A;  1YFB A;  2W3G A;  4DMZ A;  2W3H A;  4LRX C;  1Z0R A;  2KLI A;  4G3V A;  3OOV A;  3KSG A;  2XSS A;  4LRY C;  4G3K A;  3E98 A;  2K31 A;  4Y2F A;  4GLQ A;  4MCW A;  4R70 A;  2VEA A;  3LFV A;  3W2Z A;  2O0Y A;  2GLW A;  4DN0 A;  3E0Y A;  3S7N A;  5AJG A;  3C2W A;  2RO3 A;  2RO4 A;  3O5Y A;  2W1T B;  4IUK A;  4O8G A;  5HL6 A;  2XRO A;  4Q0I A;  3RFB A;  2VKS A;  5ITJ A;  4BWI A;  4EUV A;  3S7Q A;  3OBF A;  4ME4 A;  3KSI A;  3S7O A;  4Y3I A;  3ZQ5 A;  3K2N A;  2VJW A;  1F5M A;  1TD5 A;  3KSF A;  4CQH A;  3IBJ A;  5DFX A;  1YKD A;  3CIT A;  2W1R A;  3MF0 A;  2W3D A;  4YOF A;  5I5L A;  1UB4 C;  4GW9 A;  1YSP A;  4FOF A;  4LRZ E;  1YSQ A;  3R4K A;  2K2N A;  4MN7 A;  2QYB A;  4MMN A;  1STZ A;  1MC0 A;  2Y8H A;  2M7V A;  3MMH A;  2B18 A;  2ZMF A;  2Y79 A;  4PAU A;  2LB5 A;  5ITM A;  2W3F A;  3TRC A;  4O0P A;  5DFY A;  4R6L A;  3MQ0 A;  4Q0J A;  3NOU C;  5LBR A;  3BJN A;  2O9A A;  4IUH A;  3NHQ A;  2W1T A;  4ETZ A;  4ETX A;  1MKM A; 
#chains in the Genus database with same CATH topology
 4S2J A;  3F1O B;  3BW6 A;  5CGX A;  5FAT A;  4JXS A;  2OOL A;  1DP6 A;  2IWD A;  1Y28 A;  5DTT A;  2WKH A;  1K54 A;  3N8L A;  1A0K A;  1RP5 A;  1L0F A;  1S0W A;  3KO6 A;  3C38 A;  4S2P A;  4JLF A;  1S66 L;  5FL3 A;  1MWU A;  5CHU A;  5EVE A;  4Y13 A;  1K55 C;  2EFX A;  2R78 A;  1OT9 A;  3LR4 A;  4BD0 A;  3LIF A;  3LYX A;  4GDN A;  1AWI A;  2A3U A;  4I3I A;  3T4T A;  1JTD A;  1N9L A;  2JKT M;  4DE2 A;  4I38 A;  4LGW A;  3WS1 A;  3LR0 A;  4DXC A;  4JF4 A;  4K91 A;  5GHX A;  4PHT A;  1YLT A;  3M6B A;  2A24 A;  4KQD A;  3OLO A;  3UPN A;  1LSX A;  3S7N A;  3GTC A;  4O8G A;  4N9K A;  3VOY A;  1IYO A;  1N9N A;  2PR6 A;  3S7Q A;  3S7O A;  3IWQ A;  2VV6 A;  1TD5 A;  5DFX A;  3UE0 A;  2W3D A;  1K56 D;  3WWX A;  2J8Y A;  3DTI A;  3E4O A;  4DXB A;  3R4K A;  3NDE A;  4X69 A;  1K57 A;  3VE4 A;  3DWK A;  3N8R A;  2OLV A;  3H7W A;  2ACG A;  4EWF A;  4OQH A;  4R38 A;  3PBR A;  1VET B;  3ZNY A;  4KQQ A;  4Q0J A;  4U0T A;  2PDR A;  3N8S A;  3LID A;  3FG8 A;  4ZTK A;  4OPQ A;  2V9A A;  3A3I A;  2Y2P A;  3S4X A;  5CRF A;  5TR7 A;  1D1J A;  3UPP A;  4E6X A;  4RQ9 A;  3TE8 A;  2PU2 A;  3Q7V B;  4Y7P A;  4CPK A;  4Z1W A;  3MQO A;  5E2F A;  3UDF A;  3IXB A;  5EM1 A;  3IF6 B;  3ZG0 A;  1VEU B;  2ZQA A;  2OV5 A;  2VGL M;  3UO9 A;  5TBM B;  3PBQ A;  3DTK A;  2HDU A;  1I5Q A;  3C7V A;  4EQI A;  2J9O A;  4GNU A;  3ISG A;  1S1Y A;  2K31 A;  4MBF A;  5CHM A;  4X55 A;  1ZG6 A;  5G4Z A;  3FKW A;  2VV8 A;  4R70 A;  4M3K A;  4RYE A;  3BFF A;  3IQA A;  5GLC A;  1ES5 A;  5G4Y A;  3MKE A;  3V3S A;  2J9P A;  2QWS A;  5EVI A;  1UWN X;  4Y3I A;  4FH4 A;  3KYZ A;  2HDR A;  1SDE A;  3NDG A;  3IX4 A;  3CIT A;  2EWW A;  4AFI A;  3CG5 A;  3SW1 A;  4Q8I A;  1IEL A;  5FQI A;  3WRT A;  3W4O A;  1PZP A;  4X53 A;  2ZMF A;  4HBU A;  4S2L A;  1S67 L;  3UE6 A;  5DFY A;  1PYY A;  4R1G A;  3I7J A;  4JGO A;  4IBX A;  4HH3 A;  5FI2 A;  1P9R A;  4IUH A;  1K57 C;  4ETZ A;  3LR3 A;  2DMW A;  1NLY A;  1GSX A;  4KG2 A;  4K0X A;  3IXH A;  4NK3 A;  1TVF A;  1DJB A;  1MWR A;  3A3E A;  1ZG4 A;  2WUQ A;  3NOT C;  1FCM A;  5F1G A;  4QB8 A;  5HL1 A;  1LLB A;  3G6O A;  3VV4 A;  5AVE A;  1OTI A;  4WL9 A;  4D60 A;  2EX8 A;  2V1A A;  2XD5 A;  1DP9 A;  1BSG A;  3GVB A;  4GD6 A;  5HAP A;  1XP4 A;  3ITB A;  2VGJ A;  2O9C A;  4C3Q A;  4HJ3 A;  5GLB A;  4II7 A;  3GDI A;  3V3R A;  2B95 A;  4OQ0 A;  3IF5 A;  4LV0 A;  5M19 A;  3K3C A;  5CTN A;  2A2L A;  3NEC A;  1OPX A;  4K0W A;  3G30 A;  2ZC3 B;  4GD8 A;  2O0Y A;  4Z9Q A;  2HJ9 C;  2XEP A;  1L0E A;  4DF6 A;  4LCM A;  2CC1 A;  4EET B;  5FI7 A;  1TS8 A;  3EGD C;  3L7H A;  4ME4 A;  2PD8 A;  4Y0T A;  3CMZ A;  2JKT I;  2G2U A;  2Y59 A;  3F1P B;  2Z2M B;  3LIA A;  3G34 A;  1EWZ A;  4LRZ E;  4B88 A;  3A0R A;  3T4K A;  1PWG A;  1MC0 A;  1BLH A;  4R3B A;  3HLF A;  2Q9N A;  3VSL A;  2W3F A;  4YFM A;  4R6L A;  1H8M A;  4EBP A;  3MQ0 A;  1GSV A;  3UB9 A;  3ZG9 B;  3D4F A;  2G7U A;  3IF6 C;  5HPF A;  4H6J A;  4FUW A;  4C6Y A;  2GJ3 A;  4WMC A;  3VP4 A;  1JWZ A;  1LL5 A;  1OTD A;  5HFO A;  2WGI A;  1MVF D;  1M40 A;  5DF9 A;  3K3D A;  3UY6 A;  2RL3 A;  3LI9 A;  1Q2P A;  3QP4 A;  3CPT B;  2WAF A;  4YNR A;  3PYP A;  5FAP A;  3SS5 A;  3HLG A;  5L07 A;  1KGF A;  5DF8 A;  4LRY C;  3SH8 A;  4MN6 A;  4ZDX A;  3BFC A;  2ZC4 B;  4NXF A;  5CEC A;  3W2Z A;  2VLG A;  2P7J A;  4HP4 A;  3NY4 A;  5AQ9 A;  3D9Y A;  2RO3 A;  4KUK A;  1YLJ A;  5DTK A;  2W0N A;  1G6A A;  2BLS A;  3TW8 A;  3QP2 A;  1FOF A;  1W79 A;  2OLU A;  1ODV A;  4EUZ A;  4EXO A;  3MSH A;  1YKD A;  2Y4A A;  2ZM0 A;  3MF0 A;  1XJ6 A;  2EWV A;  1MXO A;  1S4S A;  4S2M A;  1KGE A;  1T1A A;  4XT2 B;  2D01 A;  3DW0 A;  2Y79 A;  4QY5 A;  4QU3 A;  4I3J A;  5D3O A;  3NI9 A;  3MS6 A;  4R23 A;  5CTM A;  2ZM2 A;  3NHQ A;  5FAQ A;  4N1H A;  3LEZ A;  1SCW A;  2P9V B;  2RO5 A;  1LT0 A;  5L10 A;  3ZNT A;  3A3F A;  2Y2I A;  4Y5F A;  4GOG A;  4IVK A;  4H8R A;  3EEH A;  4B9O A;  4HIA A;  5EM0 A;  1GSW A;  3BLS A;  3G31 A;  4CLC B;  1L0G A;  4I39 A;  1ERM A;  1TDL A;  4PMA A;  2PYR A;  3O3V A;  3EEA A;  5DKL A;  3SOI A;  4WM9 A;  1XA7 A;  3Q81 A;  2Y2O A;  2I72 A;  5HWW A;  3Q7Z A;  3HLE A;  5FA7 A;  2OWJ A;  2Y2Q A;  2Y2M A;  1CK3 A;  3OCN A;  1CF0 A;  2WKI A;  3HJI A;  4HY8 A;  3C4P A;  4LLO B;  5AQ7 A;  1Y4O A;  1TS6 A;  5I94 A;  1PWC A;  4EW7 A;  2OAP 1;  3G35 A;  4N92 A;  1IYP A;  4WEJ A;  5F82 A;  3EQU A;  2VEA A;  2Y2G A;  1N9O A;  3G32 A;  4UQI S;  3U2A A;  3C2W A;  2RO4 A;  4LPZ A;  2W1T B;  4EQ1 A;  3BFG A;  4F3L B;  4L0L A;  2JKF A;  4PM5 A;  1LSW A;  4BWI A;  3EWK A;  4E6W A;  2GZA A;  3BRM A;  4UA6 A;  1W63 M;  1K0K A;  4XUX A;  4R3A A;  1FSY A;  3KSF A;  2HPB A;  1P9W A;  2CMN A;  1O7E A;  3V67 A;  4MEZ A;  2IWC A;  5HAR A;  4PKY G;  2QPN A;  3Q07 A;  3FKV A;  2K7S A;  3UMD A;  1CI8 A;  2HDS A;  2ZC7 A;  2QJ5 A;  3RH8 B;  3T4Q A;  2O9A A;  1KE4 A;  1CQA A;  1MKM A;  1NXY A;  4PM9 A;  3MZE A;  2ZOI A;  2ZQC A;  1MWT A;  3WS4 A;  4KEN B;  1CEG A;  4O01 A;  1PI4 A;  5E43 A;  4NXE A;  2FFY A;  2IA2 A;  2A24 B;  3IX8 A;  4M4X A;  5FQK A;  1V9Y A;  1FSW A;  3UPO A;  5FI6 A;  4IBR A;  5L8M A;  2L1M A;  4LV2 A;  2JCH A;  1TF1 A;  2XQZ A;  4LEN A;  4MBK A;  4HI4 A;  4Y17 A;  4HNB A;  4FTX A;  1OT6 A;  3H7W B;  2Q0O A;  3LY4 A;  3ZGA B;  3Q82 A;  4OPY A;  4BEN A;  4HH2 A;  3IX3 A;  1JWV A;  4X1M A;  1SKF A;  5HL6 A;  4Q0I A;  1IKI A;  1DY6 A;  3RFB A;  2BG1 A;  4U0X A;  5J8X A;  2J3T C;  3V39 A;  4PM7 A;  3VOL A;  5BOH A;  4JXW A;  3HRE A;  3UE1 A;  4JDM A;  3M2J A;  3P09 A;  5GLA A;  3V50 A;  4GW9 A;  1NJ4 A;  3PBT A;  3UE3 A;  2ZC6 B;  2K2N A;  4OOM A;  1PZO A;  3PHY A;  1GHM A;  5HZH A;  1E25 A;  5ITM A;  1G28 A;  1YLW A;  1XJ3 A;  3PAE A;  3VP1 A;  3IH9 A;  2GNX A;  3T4O A;  4GS9 B;  4QWO A;  4R3J A;  3B33 A;  3QHY A;  1K4F A;  3T4S A;  4CLC C;  2JKR M;  2ZL1 A;  2Z6D A;  2YKH A;  4L9E A;  3NOP C;  1VHM A;  1BLS A;  3HCY A;  1ES2 A;  2XFT A;  3CLO A;  1XFN A;  3CUE A;  3OPH A;  5KSC A;  5TGF A;  2J3W A;  1RCJ A;  3PTE A;  4Y0O A;  1FR6 A;  3LUQ A;  5EVI B;  3A3D A;  2KOI A;  1PW1 A;  3QNB A;  1YSF A;  2XR0 A;  1RGY A;  3HUO A;  4GZB A;  4N9L A;  3OPR A;  3IBR A;  1WYC A;  4WBG A;  5DVA A;  2XLN A;  3AGE A;  1Q2Q A;  4G3V A;  1IEM A;  1LL9 A;  4G3K A;  5EVL A;  1H5X A;  2X02 A;  4ARZ B;  1K54 C;  3HLC A;  1E4D A;  1NYM A;  1BT5 A;  4S2K A;  4BL3 A;  4DE0 A;  3E0Y A;  3SZT A;  2ZQD A;  4BD1 A;  4GS9 A;  4HJ4 A;  2P04 A;  5ITJ A;  3UB6 A;  4E3M A;  5CEB A;  5FDH A;  5FDS A;  1T18 A;  5FAO A;  2QMI A;  3BQA A;  4KZ4 A;  4KG6 A;  3IS2 B;  4JF5 A;  5J7E A;  1MKI A;  2XGN A;  3HL9 A;  4WMC D;  3O87 A;  2XFS A;  2MJ6 A;  5HDS A;  5TFQ A;  4OON A;  5IHV A;  3NC8 A;  3VE3 A;  5FQJ A;  4ETX A;  3GEC A;  4DRT A;  4MDZ A;  3T50 A;  4WYY A;  1SDN A;  4X1L A;  1FIK A;  4ARZ A;  5J4E A;  5EPH A;  2PT7 A;  4KZB A;  1L2S A;  4MLL A;  2K1N A;  5KMW A;  3KYQ A;  1S1Z A;  2B5R A;  3PBN A;  1NZO A;  4HJ6 A;  3DTE A;  2BAS A;  3CUE C;  4HQA A;  3PXP A;  4X56 A;  3TND B;  2EX6 A;  2V0U A;  4EU0 A;  1YFB A;  2Z2L B;  3UB7 A;  3IS2 A;  4E3L A;  4I5S A;  3KSG A;  3DAV A;  3JVU A;  1FCN A;  3JYI A;  4MCW A;  3LFV A;  2WKE A;  3PR6 A;  2H0T A;  5U47 A;  3SS4 A;  1BLP A;  3LIE A;  3W8K A;  1YT4 A;  2E8I A;  3P98 A;  1PWD A;  3TOI A;  3OPP A;  2ZQ9 A;  4U3T A;  4E3O A;  1W8Y A;  4H6J B;  3UN7 A;  2AVX A;  5CXW A;  3L9K A;  3T1Q B;  4FOF A;  4BBT A;  3C7U A;  1JNU A;  4FH2 A;  4X25 A;  2YKF A;  5IU1 A;  2X01 A;  4IED A;  4WUJ A;  1LSV A;  4UQI M;  3O86 A;  2ZQ8 A;  2JBF A;  3QP8 A;  1H3Q A;  1XFQ A;  4E3J A;  1SKO A;  1PFL A;  1KE0 A;  4QPR A;  4EES A;  3NBL A;  1XJ2 A;  4UA7 A;  2NUT C;  5EVI C;  2OSU A;  1OJG A;  4NET A;  4KZ3 A;  2WZX A;  4GN2 A;  4KZ7 A;  2J3T D;  3CI6 A;  4OVD A;  1YQS A;  3ZG7 B;  2O9B A;  1NRJ A;  3KSH A;  4KG5 A;  3O27 A;  4OPR A;  2QJ7 A;  5HX9 A;  2WKQ A;  4R0Q A;  5JYP A;  3RTY A;  3NUL A;  4PM8 A;  3VFF A;  4Q0H A;  1HTZ A;  2Y55 A;  1P97 A;  4JKT A;  3F1N B;  1L3L A;  2DCF A;  4B4Z A;  3T4L A;  1Z0R A;  5FQM A;  4EV4 A;  1QME A;  3T1S A;  1HZO A;  3S1Y A;  1P0Z A;  4B93 A;  1CJF A;  3VMA A;  2ZQ7 A;  1GCE A;  1Y54 A;  2JHE A;  4CLC D;  1LHY A;  1E3U A;  2GLW A;  1AXB A;  4XUZ A;  2XRO A;  3FWL A;  3GV9 A;  3ZG5 A;  3NJA A;  2H5S A;  2RCX A;  2OWH A;  1W5D A;  2KX6 A;  1BYW A;  3LIB A;  3DWZ A;  1XGJ A;  4E3I A;  5DF7 A;  1YSQ A;  2H10 A;  4MN7 A;  1FCO A;  2QKP A;  4WEL A;  1MBL A;  3PBO A;  1OME A;  2V20 A;  2Z6C A;  2LB5 A;  3LO7 A;  2HP6 A;  4O0P A;  4WF0 A;  4S2N A;  5KZH A;  1XPB A;  3NCK A;  4OLD A;  5LBR A;  2A49 A;  1JTG A;  1T1C A;  3OZH A;  3F1N A;  5M18 A;  1NLZ A;  2WK0 A;  2P08 A;  1N9B A;  1ZKJ A;  1XA1 A;  4QY6 A;  3OC2 A;  1DJC A;  4E3N A;  4C75 A;  1PIO A;  4HOI A;  1PNE A;  1BUL A;  2FY9 A;  1IOU A;  2Y2L A;  1D06 A;  1WE4 A;  4OP5 A;  3TG9 A;  4RX2 A;  2LB9 A;  4KQO A;  4NG2 A;  2JC7 A;  1IFQ A;  1YMS A;  5HAQ A;  5IT5 A;  4BJP A;  4D2O A;  3MJQ A;  4Y2F A;  2WGW A;  4BL2 A;  5F68 A;  5EUA A;  1W7F A;  1KOU A;  3FZC A;  2Y2N A;  4FSF A;  5HWV A;  4NKP A;  4IUK A;  3ULF A;  4R4S A;  2VX8 A;  4EUV A;  5HAI A;  4BBU A;  3KSI A;  3FC7 A;  2BTF P;  3ZQ5 A;  5EFW A;  3K2N A;  4FD8 A;  4OQI A;  2ZD8 A;  3WS2 A;  5FSR A;  4PPR A;  1K38 A;  4NXG A;  2Y2J A;  3CWF A;  3BFD A;  1VB6 A;  2Y8H A;  3BWL A;  3HJK A;  2B18 A;  5A90 A;  4K08 A;  5KSH A;  4WEK A;  3TRC A;  2C6W B;  5A92 A;  3H82 A;  3HUM A;  4KQR A;  2WAD A;  4JDO A;  4LV1 A;  5GHY A;  4DJ2 A;  3T4J A;  2VGK A;  2ZOH A;  4EEP A;  2G2W A;  1H0M A;  1HVB A;  4S2N C;  1IYQ A;  4EBN A;  1FQG A;  5CED A;  4ZRR A;  3LEQ A;  1I2W A;  1ZTU A;  5HSQ A;  4QD4 A;  4KZA A;  1GHI A;  4DJ3 A;  2C5W B;  1GA0 A;  1PI5 A;  4G3W A;  1D7E A;  3VOZ A;  5FEF A;  3MZF A;  1O07 A;  3AGD A;  2EXA A;  2JE5 A;  3BEC A;  3HVF A;  1YM1 A;  3VP0 A;  4P6Z M;  4O7D A;  3N7W A;  2WGV A;  2WKP A;  2WZZ A;  3V5M A;  4FCF A;  4GHI B;  3H9W A;  5E2H A;  2XA7 S;  3C30 A;  5EOO A;  4CJN A;  1ONG A;  2IWB A;  3B42 A;  5DTS A;  2Y2H A;  5AVF A;  4DN0 A;  1YPR A;  5FAS A;  4Y15 A;  5EVI D;  5DKK A;  4BBV A;  3UDI A;  2ZL1 B;  1UGU A;  4RA7 A;  1F2K A;  1CI9 A;  3ZCZ A;  2PD7 A;  2XH9 A;  1XXM A;  5AQA A;  1J9M A;  2P74 A;  3RJU A;  2VV7 A;  4DDS A;  3T12 B;  3MMH A;  4PAU A;  3BQ8 A;  1OTE A;  5CGW A;  1K6R A;  5CX7 A;  2ZLY A;  1YLP A;  1WA9 A;  2ZJ9 A;  2R9W A;  3LY3 A;  2Y91 A;  5TJJ A;  3E2K A;  2PYP A;  2XRN A;  2V0W A;  4E04 A;  4JGR A;  5F83 A;  2HP5 A;  4GHI A;  4OOL A;  4L9G A;  1K25 A;  4UA9 A;  4EER A;  3BY9 A;  4BLM A;  3M2K A;  2PR5 A;  4LFU A;  2X71 A;  3VFH A;  5GHZ A;  5FEG A;  4YWZ A;  3DBA A;  1H8Y A;  4DE3 A;  1YAX A;  3EGX C;  2QHK A;  3MZD A;  3MXS A;  4HEF A;  3HLW A;  2W27 A;  4QJG A;  2VZW A;  4GDB A;  4OPZ A;  5A91 A;  3AGF A;  1KDS A;  4E3K A;  3UDX A;  1ERO A;  3E2L A;  4ZJ1 A;  3RXX A;  2W3G A;  3BY8 A;  3MKF A;  3F1O A;  1MWS A;  4ESP A;  1NYY A;  3ICY A;  4GJ4 A;  1ACF A;  1LL8 A;  3E98 A;  3ZVW A;  4WN5 A;  4MBH A;  3C4O A;  3MR0 A;  4B4X A;  2INW A;  1ESU A;  3O5Y A;  4LCL A;  1W63 Q;  3GSG A;  2L4R A;  4QHC A;  4IHQ A;  3B47 A;  3MXQ A;  1KGG A;  4KZ8 A;  1FR1 A;  1F5M A;  3MQQ A;  3GQZ A;  5I5L A;  5EOE A;  3UB5 P;  1KE3 A;  1YSP A;  3VP3 A;  2I9V A;  4HBT A;  2QYB A;  2PBY A;  1STZ A;  2FH5 A;  5L2F A;  1YLY A;  1L0D A;  3W4P A;  3QP5 A;  3FPW A;  2FZ0 A;  2PRF A;  3FV7 A;  2ZM8 A;  2HDQ A;  1DP8 A;  2Q9M A;  1ALQ A;  1BZA A;  5CER A;  3GMW A;  3WS5 A;  4X68 A;  5DJT A;  1S4R A;  2D02 A;  3JVV A;  2WYX A;  1M6K A;  4PM6 A;  3TSG A;  3ZFZ A;  3PBS A;  2L66 A;  2V8C A;  5K5B A;  3BFE A;  3PAG A;  3T1X A;  2V1Z A;  4OOY A;  4CLC E;  1G5U A;  3BYD A;  3G2Z A;  5EV0 A;  1E3U D;  2HGV A;  2EX2 A;  2GX5 A;  5M1A A;  1T19 A;  4P6Z S;  2PU4 A;  1K4E A;  4LV3 A;  3OCL A;  5HD3 A;  1WYB A;  3HLD A;  3EQV A;  4GCZ A;  1ES4 A;  3EOI A;  1VET A;  2ZC5 B;  2O99 A;  3O88 A;  5HD5 A;  5E2G A;  1S6R A;  2KLI A;  2HP9 A;  4KZ5 A;  5HDC A;  3MFD A;  3E4Q A;  1N4O A;  3M6H A;  2XDM A;  3BEB A;  4HP9 A;  4DDY A;  2XF3 A;  3Q7V A;  1H8Z A;  1LI0 A;  1ESI A;  1YLZ A;  3IWO A;  1SKO B;  3LIC A;  2VKS A;  3JPU A;  2PAV P;  3IF6 A;  1J3W A;  4ZJ2 A;  1VEU A;  2J80 A;  4EEU A;  3FYZ A;  3ZYT A;  2VJW A;  4HHD A;  3E4P A;  4YIN A;  5TBM A;  1X0O A;  3Q1F A;  2JN7 A;  3S22 A;  1SZV A;  3A0S A;  3LGO A;  3R7W B;  2VA0 A;  2HF6 A;  1XKZ A;  1MY8 A;  2UV0 E;  4RX3 A;  1XGI A;  3OPL A;  2H28 A;  3NOU C;  1HLU P;  1T1B A;  1VQQ A;  1EW0 A;  2JKG A;  2PBD P;  3KYE A;  2DNS A;  2W3E A;  3MBZ A;  3WRZ A;  4P85 A;  4BMW A;  5JYO A;  5F69 A;  2R9X A;  1C3B A;  3ITA A;  2ZMV A;  2OAQ 1;  5HW3 A;  1OTA A;  1ES3 A;  2WKR A;  1K56 A;  1F98 A;  1JWP A;  1W8Q A;  3HUN A;  2EX9 A;  4ID4 A;  2EFU A;  3VP2 A;  2ZMA A;  5AQB A;  3HBR A;  5HDD A;  2H0Y A;  3D3O A;  4JGP A;  3ZG8 B;  3LI8 A;  4IVI A;  1NRF A;  4NEE D;  4JBF A;  3DTM A;  4KZ9 A;  5C5K A;  5F5Y A;  2M7U A;  5HPI A;  4DMZ A;  2W3H A;  5HWT A;  4OLG A;  1SHV A;  4WZ5 A;  1KVM A;  3TJZ C;  3OOV A;  2UWX A;  3R7W A;  2XD1 A;  4Y0U A;  1IYS A;  5KIZ A;  3IXG A;  2B02 A;  2HJE A;  1XX2 A;  4JXV A;  2JKR I;  4R4R A;  4L9F A;  1MPL A;  2V2F F;  1FIL A;  1F9I A;  3A3J A;  1KDW A;  3IHB A;  3SS3 A;  5GLD A;  3P7N A;  2XK1 A;  1V9Z A;  3RXW A;  5A8B A;  4CQH A;  4YOF A;  1ZC2 A;  1UB4 C;  3N4I A;  2EXB A;  4UEY A;  1YMX A;  4MNR A;  3ZHH A;  2XA7 M;  3SH7 A;  3P01 A;  3T1R A;  4JGQ A;  3WS0 A;  5L09 A;  4KUO A;  3UNW A;  3LR5 A;  5GL9 A;  2NUP C;  3BJN A;  3FPV A;  2VGL S;  5FQQ A;  4KZ6 A;  3GRJ A;  1EI5 A;  3HLB A;  1CEF A;  1OJ5 A;  3LCE A;  2WGW B;  3N6I A;  4UHU A;  3F1P A;  4N1X A;  1XJ4 A;  1K6S A;  3A0V A;  1Z6F A;  3BLM A;  5E2E A;  1UWP X;  1NY0 A;  4JPM A;  4P0M A;  1NWZ A;  1JVJ A;  1TS7 A;  4DKI A;  1G6O A;  2V1B A;  4DE1 A;  2PHY A;  4OQG A;  1LI9 A;  3QP1 A;  4ZAM A;  2FFF B;  4I3A A;  4LRX C;  5A93 A;  1BUE A;  4ZBE A;  2KDK A;  4JXG A;  1DJA A;  3H82 B;  2VK3 A;  3C8C A;  4NXB A;  4WZ5 C;  5AJG A;  3C5A A;  5F6A A;  3IH8 A;  5DJU A;  3MXR A;  1VM1 A;  1KVL A;  3OBF A;  3CHW P;  5CGS A;  2L0W A;  1U60 A;  1GHP A;  3IBJ A;  3CPT A;  5CHJ A;  3UB8 A;  4UAA A;  4WZ4 A;  4MMN A;  2M7V A;  2J7V A;  3G2Y A;  4X6T A;  3G4P A;  2Y2K A;  3IXD A;  5J3W A;  4OH0 A;  5EE8 A;  4ZJ3 A;  4OKP A;  2EA9 A;  3S7P A;  3VSK A;  4GKU A;  2V8F A;  1G68 A;  1PRQ A;  1K55 A;  4JF6 A;  4IJG A;  1MZU A;  4XXR A;  3IWI A;  4RVA A;  3IT9 A;  3NIA A;  1DRM A;  1BTL A;  4S2O A;  1BLC A;  1NZU A;  3D72 A;  4XT2 A;  2ZBB A;  3KX0 X;  1Z09 A;  3B3X A;  3ZDJ A;  1OTB A;  4P6B A;  3SH9 A;  5EEC A;  4HES A;  3BM6 A;  4EBL A;  2QA4 I;  1GA9 A;  2M1C A;  1RGZ A;  2WAE A;  4BQM A;  2P9V A;  2XSS A;  1IKG A;  3CZD A;  5G18 A;  2E8J A;  4GLQ A;  3UME A;  3U4L P;  2QZ6 A;  2DRW A;  1QMF A;  1PW8 A;  3CJM A;  3QP6 A;  5F1F A;  3GR2 A;  1TEM A;  3QNC A;  4CLC A;  4P87 A;  3MFX A;  3ZVT A;  3W4Q A;  5IS1 A;  1I2S A;  1TS0 A;  1ONH A;  3CAX A;  1HD8 A;  5FQ9 A;  5MC7 A;  2W1R A;  3IHA A;  4A5R A;  4PKY A;  1ERQ A;  1TDG A;  4S2I A;  4GB7 A;  2HV1 A;  4F94 A;  2GDN A;  4OP8 A;  2HZ5 A;  4MN5 A;  2W1T A;  1ZHH B;  4F3L A;  4WLA A; 
#chains in the Genus database with same CATH homology
 3F1O B;  4QPR A;  2D02 A;  3BW6 A;  4EES A;  3JVV A;  2OOL A;  1DP6 A;  1XJ2 A;  2RO5 A;  2NUT C;  1LT0 A;  1Y28 A;  3PBS A;  2L66 A;  4Y5F A;  5K5B A;  1OJG A;  3EEH A;  4B9O A;  3KO6 A;  3C38 A;  4HIA A;  2J3T D;  1GSW A;  3CI6 A;  4CLC E;  1S66 L;  5FL3 A;  2HGV A;  2GX5 A;  2O9B A;  1T19 A;  4P6Z S;  4CLC B;  1NRJ A;  3KSH A;  3O27 A;  4I39 A;  3OCL A;  5HD3 A;  2QJ7 A;  2PYR A;  2WKQ A;  2R78 A;  3EEA A;  1OT9 A;  3RTY A;  3EQV A;  4GCZ A;  5DKL A;  3LR4 A;  3EOI A;  4Q0H A;  2O99 A;  3LIF A;  3LYX A;  5HWW A;  2OWJ A;  5HD5 A;  1P97 A;  4I3I A;  3F1N B;  3OCN A;  3T4T A;  3T4L A;  1Z0R A;  2KLI A;  3HJI A;  1N9L A;  2JKT M;  4HY8 A;  4LLO B;  1P0Z A;  4B93 A;  1TS6 A;  4I38 A;  4EW7 A;  2JHE A;  2OAP 1;  5HDC A;  3LR0 A;  3E4Q A;  4CLC D;  4WEJ A;  4PHT A;  3EQU A;  2VEA A;  4HP9 A;  2A24 A;  1N9O A;  2GLW A;  4KQD A;  3OLO A;  1LSX A;  4UQI S;  3S7N A;  3C2W A;  3U2A A;  2RO4 A;  4LPZ A;  2W1T B;  4O8G A;  4EQ1 A;  2XRO A;  4F3L B;  4L0L A;  1N9N A;  3LIC A;  2VKS A;  2PR6 A;  1LSW A;  4BWI A;  3EWK A;  3S7Q A;  3NJA A;  3S7O A;  2GZA A;  2OWH A;  1W63 M;  2J80 A;  4EEU A;  2KX6 A;  1BYW A;  2VV6 A;  3LIB A;  3ZYT A;  2VJW A;  1TD5 A;  4R3A A;  4HHD A;  3E4P A;  3KSF A;  5DFX A;  5TBM A;  2W3D A;  1X0O A;  2JN7 A;  3E4O A;  1P9W A;  2CMN A;  3A0S A;  1YSQ A;  3R4K A;  3R7W B;  4MN7 A;  3V67 A;  2QKP A;  4WEL A;  3VE4 A;  3PBO A;  2VA0 A;  3H7W A;  2HF6 A;  2Z6C A;  4PKY G;  2LB5 A;  4O0P A;  4WF0 A;  4R38 A;  3PBR A;  2K7S A;  3UMD A;  4Q0J A;  2H28 A;  2PDR A;  2QJ5 A;  3NOU C;  5LBR A;  3RH8 B;  3T4Q A;  1T1B A;  2O9A A;  3LID A;  3FG8 A;  1T1C A;  1MKM A;  1EW0 A;  2W3E A;  2V9A A;  4BMW A;  3F1N A;  5F69 A;  2ZOI A;  1NLZ A;  2P08 A;  2ZMV A;  2OAQ 1;  4O01 A;  1OTA A;  2WKR A;  4NXE A;  3OC2 A;  2IA2 A;  2A24 B;  1F98 A;  4M4X A;  4RQ9 A;  1V9Y A;  3TE8 A;  4Z1W A;  3MQO A;  4HOI A;  2FY9 A;  5HDD A;  5L8M A;  3D3O A;  2L1M A;  4JGP A;  3LI8 A;  4NEE D;  1IOU A;  1D06 A;  5C5K A;  5F5Y A;  1TF1 A;  2VGL M;  2LB9 A;  5TBM B;  3PBQ A;  2M7U A;  4KQO A;  5HPI A;  4DMZ A;  4HI4 A;  2W3H A;  5HWT A;  1IFQ A;  4HNB A;  3TJZ C;  3OOV A;  5IT5 A;  1OT6 A;  3H7W B;  4BJP A;  3R7W A;  1S1Y A;  2K31 A;  3MJQ A;  4Y2F A;  5G4Z A;  5F68 A;  2VV8 A;  4R70 A;  4HH2 A;  1KOU A;  5KIZ A;  4FSF A;  2B02 A;  2HJE A;  5HWV A;  4NKP A;  2JKR I;  4L9F A;  4IUK A;  5HL6 A;  3ULF A;  4Q0I A;  1F9I A;  3RFB A;  5G4Y A;  2VX8 A;  4EUV A;  2J3T C;  4BBU A;  3VOL A;  2QWS A;  3KSI A;  1UWN X;  3FC7 A;  4Y3I A;  3P7N A;  3KYZ A;  1V9Z A;  3ZQ5 A;  5A8B A;  5EFW A;  3K2N A;  4CQH A;  4JDM A;  3CIT A;  2EWW A;  4YOF A;  4AFI A;  1UB4 C;  3SW1 A;  4NXG A;  4GW9 A;  4UEY A;  3PBT A;  2XA7 M;  3CWF A;  3UE3 A;  2K2N A;  4OOM A;  1VB6 A;  2Y8H A;  3BWL A;  3HJK A;  3PHY A;  3P01 A;  2B18 A;  5HZH A;  2ZMF A;  4JGQ A;  5ITM A;  1G28 A;  4K08 A;  5KSH A;  4WEK A;  3TRC A;  1XJ3 A;  1S67 L;  3UE6 A;  5DFY A;  3H82 A;  4KUO A;  4JGO A;  3LR5 A;  2GNX A;  4HH3 A;  3T4O A;  4GS9 B;  2NUP C;  4JDO A;  1P9R A;  3BJN A;  3B33 A;  4IUH A;  3FPV A;  2VGL S;  4ETZ A;  3LR3 A;  2DMW A;  3T4S A;  1NLY A;  4CLC C;  1GSX A;  2JKR M;  4DJ2 A;  3T4J A;  2ZOH A;  2Z6D A;  4EEP A;  2YKH A;  4L9E A;  3NOP C;  1VHM A;  4ZRR A;  1OJ5 A;  3HCY A;  3NOT C;  1ZTU A;  3CLO A;  1XFN A;  5HSQ A;  3CUE A;  3F1P A;  3G6O A;  3VV4 A;  2J3W A;  5AVE A;  1OTI A;  1XJ4 A;  4WL9 A;  3A0V A;  4DJ3 A;  2V1A A;  1UWP X;  4G3W A;  1D7E A;  1DP9 A;  3LUQ A;  1NWZ A;  2KOI A;  1TS7 A;  1YSF A;  2O9C A;  1G6O A;  2V1B A;  4HJ3 A;  2PHY A;  4P6Z M;  4II7 A;  3GDI A;  2WKP A;  3IBR A;  4I3A A;  4GHI B;  4LRX C;  3H9W A;  4G3V A;  3K3C A;  2XA7 S;  3C30 A;  2KDK A;  2A2L A;  4G3K A;  1OPX A;  4ARZ B;  3H82 B;  3B42 A;  3C8C A;  4NXB A;  2O0Y A;  5AVF A;  4DN0 A;  3E0Y A;  5AJG A;  2HJ9 C;  5DKK A;  4BBV A;  4GS9 A;  5F6A A;  4HJ4 A;  2P04 A;  5ITJ A;  3UB6 A;  5DJU A;  1UGU A;  4EET B;  1TS8 A;  3EGD C;  3OBF A;  4ME4 A;  2PD8 A;  2L0W A;  1T18 A;  3BQA A;  2PD7 A;  3IBJ A;  2JKT I;  3IS2 B;  3F1P B;  3LIA A;  3UB8 A;  5J7E A;  4LRZ E;  3A0R A;  3T4K A;  2VV7 A;  4MMN A;  1MC0 A;  2M7V A;  3MMH A;  4PAU A;  3BQ8 A;  2MJ6 A;  5HDS A;  2W3F A;  1OTE A;  4R6L A;  1H8M A;  5CX7 A;  3MQ0 A;  1GSV A;  3UB9 A;  5J3W A;  3VE3 A;  1WA9 A;  4ETX A;  5TJJ A;  2PYP A;  2EA9 A;  2XRN A;  3GEC A;  2V0W A;  4E04 A;  3S7P A;  4JGR A;  2G7U A;  4MDZ A;  4GHI A;  4OOL A;  4L9G A;  3T50 A;  5HPF A;  4H6J A;  4EER A;  4IJG A;  2GJ3 A;  3BY9 A;  1MZU A;  4ARZ A;  5J4E A;  2PT7 A;  1DRM A;  2PR5 A;  2K1N A;  3KYQ A;  1S1Z A;  3D72 A;  3DBA A;  1OTD A;  4YWZ A;  4XT2 A;  3PBN A;  1YAX A;  2ZBB A;  2QHK A;  3EGX C;  3KX0 X;  4HJ6 A;  1MVF D;  2BAS A;  1OTB A;  2W27 A;  3CUE C;  4HQA A;  5DF9 A;  3PXP A;  2VZW A;  3K3D A;  3LI9 A;  3TND B;  2QA4 I;  4YNR A;  2M1C A;  3PYP A;  2V0U A;  4EU0 A;  1YFB A;  2W3G A;  3BY8 A;  3UB7 A;  3IS2 A;  3F1O A;  4I5S A;  3KSG A;  3ICY A;  4GJ4 A;  2XSS A;  4LRY C;  3JVU A;  4MN6 A;  1LL8 A;  3E98 A;  4GLQ A;  3UME A;  4WN5 A;  4NXF A;  4MCW A;  3MR0 A;  3W2Z A;  2VLG A;  3LFV A;  2P7J A;  2INW A;  3PR6 A;  4HP4 A;  2RO3 A;  3O5Y A;  4KUK A;  1W63 Q;  4CLC A;  2W0N A;  2L4R A;  3MFX A;  3TW8 A;  4IHQ A;  3LIE A;  3B47 A;  3MXQ A;  5IS1 A;  1ODV A;  3CAX A;  1TS0 A;  1F5M A;  4EXO A;  5MC7 A;  4H6J B;  1YKD A;  3MQQ A;  2W1R A;  3MF0 A;  5I5L A;  1XJ6 A;  2EWV A;  4PKY A;  1YSP A;  4FOF A;  4BBT A;  1S4S A;  1JNU A;  2I9V A;  1T1A A;  2D01 A;  4XT2 B;  2QYB A;  1STZ A;  2FH5 A;  2HV1 A;  3FPW A;  2Y79 A;  2YKF A;  2FZ0 A;  5IU1 A;  4I3J A;  4WUJ A;  1LSV A;  4UQI M;  1DP8 A;  3NHQ A;  1H3Q A;  1XFQ A;  4MN5 A;  2W1T A;  5DJT A;  1S4R A;  1ZHH B;  4F3L A;  4WLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...