4X56A

Structure of the class d beta-lactamase oxa-160 v130d in acyl-enzyme complex with ceftazidime
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
245
structure length
244
Chain Sequence
b'MHISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSADPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTSQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class D beta-lactamase OXA-160
publication title Structural Basis of Activity against Aztreonam and Extended Spectrum Cephalosporins for Two Carbapenem-Hydrolyzing Class D beta-Lactamases from Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 79
structure length 244
sequence length 245
ec nomenclature
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4x56A00
1W7FA 2A49A 4IEDA 4QB8A 2X71A 2FFYA 1KDWA 2WUQA 2XR0A 3D4FA 2ZMAA 1EWZA 4OQ0A 5CHUA 1YLZA 4E3KA 1E25A 3MFDA 1K56D 4K0WA 3W4PA 3FKVA 3P98A 4UA7A 5BOHA 4R1GA 1HVBA 2CC1A 1BTLA 3Q7VA 4LV3A 5FAPA 2I72A 4NETA 1E3UD 1HD8A 1NZOA 2XLNA 4KG6A 4X55A 4BD0A 4R0QA 3MZDA 1U60A 4JXGA 3WRZA 3UDXA 3B3XA 2Y91A 3SS4A 5FI6A 1ZG6A 1BLHA 3DWZA 3VOZA 3HLGA 4HBUA 3SH7A 2Y2KA 4EBLA 1OMEA 3MBZA 4E3NA 2WGVA 1ES5A 3W8KA 3NDGA 3OCNA 1CEFA 3WS4A 5GLDA 3ZHHA 3IF6A 4JXWA 1BZAA 3M2JA 5E2HA 5CRFA 2WZZA 1BT5A 2ZJ9A 2PBYA 3G34A 5FATA 4EUZA 3IH8A 2FFFB 2XH9A 5M1AA 1LI0A 2XFSA 3IWIA 3NC8A 1XX2A 3M6HA 4LV2A 1I5QA 4KQRA 5A91A 1DJCA 3UDIA 1GA0A 3WS2A 3OZHA 2Z2LB 3IT9A 2C6WB 4KENB 1TDGA 1YMSA 4S2MA 4WEJA 5GHZA 1XGJA 4S2LA 1M40A 4GD8A 3A3IA 2V2FF 3ZCZA 5DF8A 5CGXA 5F1GA 1ESIA 4OPZA 4KQQA 3ZNTA 4EV4A 1PWCA 1W5DA 3FKWA 3IWQA 1K56A 3UN7A 2XDMA 1NZUA 2V20A 3S4XA 2EX6A 3DW0A 2Y2JA 5U47A 1L2SA 4DRTA 5A93A 1JWZA 5F83A 1E4DA 2XF3A 1E3UA 1K54A 3QNCA 4XUZA 2X01A 3ZG7B 4KZ3A 1FOFA 4N9KA 1ES2A 4BL2A 3LO7A 4OQGA 3BYDA 4OOLA 5JYPA 1GHMA 3N4IA 3BFEA 3OC2A 4C3QA 1ZKJA 3NBLA 4ZAMA 2ZQAA 1YLWA 3Q7ZA 4IVKA 3ZG5A 4ZJ2A 5TGFA 5CXWA 4K91A 2ZQ9A 2H10A 4R3BA 1SCWA 2HP5A 2ZC5B 3LEZA 5HAPA 4JBFA 5FQJA 4KZ6A 1GCEA 1NJ4A 3M2KA 4JF4A 2WGWA 4RYEA 3A3JA 4ZBEA 3FV7A 3UO9A 5EVLA 5GHYA 3HLCA 3VMAA 4FH2A 2EX9A 4LCMA 4LENA 2Y2HA 3C5AA 5FSRA 1K6SA 3G31A 2Y59A 1H8ZA 5E2GA 2RL3A 3MKFA 1LL5A 2Q9MA 4OOYA 5M19A 1DJBA 2HDQA 3CJMA 1RGYA 4KZ4A 1XKZA 1ONGA 4R4RA 1FR6A 3N8SA 3UDFA 4D2OA 2WKEA 2ZM8A 4X56A 4E3LA 1TEMA 1VQQA 4OH0A 4OOMA 5L2FA 4BENA 3V5MA 1G68A 4OPRA 3FZCA 3SOIA 1K25A 4LCLA 4Y0TA 2WK0A 2BG1A 5GL9A 4DE1A 2Y2IA 4M3KA 4R23A 1VM1A 2Q9NA 3PBNA 3BLMA 1H8YA 2OSUA 3ITBA 4LV0A 4MBFA 1IYOA 3IXHA 1NYMA 2JBFA 3UE1A 4E6WA 2J9PA 4KZAA 4MBHA 2EXAA 3DWKA 3WS0A 3C4PA 5KZHA 1L0DA 1MY8A 2EFUA 3UNWA 3ZNYA 4C75A 4WELA 4MEZA 1CI9A 4S2JA 4UHUA 2ZC4B 5E43A 4DDSA 3HLDA 4WZ4A 4KG5A 4KG2A 4MLLA 5TR7A 5IHVA 4OKPA 4WZ5C 2JCHA 3MXRA 4BD1A 4U0TA 4N9LA 5D3OA 3WRTA 5FI2A 2J9OA 4S2NA 2V1ZA 2Y2NA 2VGJA 2IWBA 5DTSA 1K57C 2Y2QA 1FR1A 1L0EA 4JXVA 5FQIA 1H5XA 2HDUA 1IYQA 4ZDXA 1ALQA 1J9MA 3I7JA 2DCFA 1BLCA 1PZPA 3CZDA 3G32A 2HPBA 3HLFA 4PM8A 1S6RA 3HREA 1EROA 2EX2A 4KZ8A 1EI5A 1SDEA 2WZXA 3AGDA 1K55C 1JWVA 4RX3A 3VFFA 2QZ6A 4KZ9A 5FI7A 3Q1FA 3IXBA 3TSGA 3O88A 4E3IA 1ZC2A 3UE0A 1PI5A 2DRWA 3VFHA 1FCMA 3UE3A 4WMCD 2IWCA 3UPOA 1NXYA 2P74A 1YLYA 1O07A 5CERA 2JE5A 1QMFA 3IHAA 5FQMA 1KE0A 3MZEA 4KZ7A 1W8YA 4GNUA 3LCEA 4O7DA 4PM6A 4WEKA 4ID4A 4QU3A 2UWXA 5DF7A 4Y0UA 3WS1A 2XD1A 1Z6FA 4EBPA 3HUOA 1N9BA 2H0YA 1W8QA 2P9VB 3V3SA 3GSGA 5EOOA 4A5RA 2VGKA 1CI8A 3VP1A 1PYYA 2G2UA 1AXBA 4OPYA 2E8IA 4XXRA 1YMXA 3G4PA 2ZQ8A 4MBKA 3PAEA 4WBGA 4WM9A 1IEMA 1MKIA 2EX8A 3VP2A 2Y2MA 5AQAA 4E3OA 4P6BA 4DXCA 2DNSA 4NK3A 2IWDA 4N1XA 5DVAA 2R9XA 3G35A 3IF6C 1PWGA 5CGSA 5TFQA 3Q07A 4PMAA 3V39A 1KGEA 4R3JA 3MZFA 3ISGA 5CTMA 1BLPA 3UPNA 1XPBA 3GQZA 2P9VA 3C7VA 3BFCA 1MWRA 4IVIA 1RP5A 3EQUA 3ZG9B 3OPRA 4QD4A 3W4OA 1ERMA 1ZG4A 3C7UA 3HUMA 3ZFZA 1KVLA 1LI9A 3ZVTA 5EUAA 4S2IA 2Y55A 3N6IA 4OPQA 3SS5A 3HLWA 4UA6A 3N8LA 2GDNA 4UAAA 4E6XA 5HL1A 3GR2A 2ZM2A 4OQIA 2ZQ7A 5HARA 4WMCA 4DF6A 1TDLA 1W79A 1YLJA 5HX9A 5M18A 1K4EA 1IYPA 1KDSA 2Z2MB 2HDRA 4RX2A 4E3MA 3VP3A 1WYBA 2G2WA 2ZD8A 1IELA 5G18A 4BL3A 4CPKA 4S2KA 3VOYA 4HEFA 4GB7A 1IYSA 4XUXA 4DDYA 4FSFA 3NI9A 5CEDA 4JXSA 4N1HA 4OQHA 3OCLA 1PWDA 3NIAA 4GDNA 4GN2A 4JF5A 4PM9A 1L0FA 4WZ5A 5GLAA 5FQ9A 1GHIA 3BFGA 3N8RA 3SH9A 3VP0A 4K0XA 1LHYA 4B4XA 2J8YA 2XGNA 2ZC6B 4UA9A 3OPLA 1XXMA 4RA7A 1FCNA 3OPHA 2RCXA 5EVIB 1MWSA 1BLSA 4X53A 2WAEA 1FQGA 4Z9QA 5EECA 1TVFA 2HDSA 3IH9A 4MNRA 1XA1A 3ZDJA 2XK1A 3O3VA 4JLFA 5CECA 3SH8A 1HTZA 2OV5A 1S0WA 1IKIA 5A92A 2X02A 3IXGA 4IBXA 3ZVWA 3GTCA 4R4SA 3Q7VB 1CEGA 1ONHA 1K55A 2EXBA 2H0TA 3BFFA 4KZ5A 2XQZA 5GHXA 4BJPA 5FDHA 4ZTKA 1ES3A 1SHVA 4YFMA 3RXXA 1CK3A 2ZLYA 5CHMA 1C3BA 1NYYA 3HVFA 1MWUA 1BSGA 4OVDA 1YLPA 2ZM0A 1FCOA 3HL9A 2WGIA 4JPMA 3PBOA 2C5WB 1Q2QA 4ZJ3A 2WKHA 5CGWA 3UPPA 5JYOA 2WAFA 5AQBA 3IF6B 3V50A 3GVBA 1M6KA 4PM7A 2WADA 4WYYA 3C4OA 4U0XA 3HLBA 4KQOA 3HBRA 1JTDA 4P0MA 4OP5A 4S2PA 4P85A 3CMZA 4OLGA 4L0LA 1K38A 5A90A 3ITAA 1DY6A 1KE4A 1KGFA 1PI4A 3BEBA 3NCKA 4GOGA 4HBTA 5EVIC 4B88A 4CJNA 3FYZA 4X6TA 1WYCA 2OLUA 1YQSA 2A3UA 4GD6A 4X68A 2PU4A 3E2KA 3A3DA 5FQKA 2B5RA 5F82A 4JKTA 1IKGA 2Y2LA 4BQMA 4F94A 2BLSA 3JYIA 2R9WA 3IHBA 3IXDA 3TG9A 2QMIA 3Q82A 3UY6A 1O7EA 3VP4A 3O86A 4QJGA 2XFTA 3BECA 4QHCA 4PM5A 4LV1A 5DF9A 1GHPA 2QPNA 4OLDA 5KSHA 3BFDA 1DJAA 4S2NC 3PTEA 5FQQA 3DTMA 3GMWA 4DXBA 3GV9A 4GDBA 1G6AA 1K4FA 3PBQA 3PBSA 3EQVA 3W4QA 3P09A 4ZJ1A 3ZGAB 4C6YA 1MWTA 3LY4A 3V3RA 1PW1A 5FA7A 5EPHA 1RCJA 3S22A 2HP9A 2J7VA 4FCFA 5E2FA 1QMEA 1YM1A 3BLSA 4IBRA 3RJUA 1PW8A 3HLEA 4KZBA 3SS3A 3TOIA 1KGGA 1PZOA 3A3FA 3A3EA 5CTNA 5HFOA 1MBLA 4GKUA 2ZC3B 1Q2PA 3HUNA 5AQ7A 5DTKA 3QHYA 1NY0A 1K6RA 2ZQDA 5FASA 2WYXA 4JF6A 5CHJA 1L0GA 3MXSA 3BRMA 3AGEA 1BULA 1ERQA 3Q81A 1BUEA 1LL9A 1JTGA 1N4OA 2WGWB 4DE0A 2XD5A 5EVID 3RXWA 4B4ZA 2OLVA 4Y0OA 2Y2OA 3VSLA 1YLTA 1JWPA 3QNBA 4QY5A 1JVJA 2PU2A 2Y2GA 3PAGA 3VSKA 4N92A 1I2SA 3G30A 3LY3A 1KE3A 1XP4A 4FD8A 4DKIA 1I2WA 2WKIA 3O87A 3OPPA 3CG5A 1WE4A 1MPLA 4PPRA 4E3JA 5GLCA 3NY4A 5J8XA 4HESA 3FWLA 4U3TA 3G2ZA 3IF5A 1K54C 5AQ9A 3BM6A 2ZC7A 3IQAA 5DTTA 5CEBA 5FAOA 5GLBA 1KVMA 1RGZA 3MKEA 4Y7PA 4YINA 1PIOA 1HZOA 3E2LA 5FAQA 5HW3A 5EE8A 4P87A 3PBRA 4X69A 1LLBA 1Y54A 5E2EA 3GRJA 1K57A 2ZQCA 3N7WA 3NDEA 5HAQA 2Y4AA 1SDNA 3M6BA 3WS5A 1SKFA 4DE3A 3IWOA 1ESUA 1FSWA 1GA9A 4S2OA 4EBNA 5I94A 4FH4A 1MXOA 5F1FA 5KSCA 1ES4A 4OONA 3S1YA 3ZG8B 3PBTA 4Q8IA 5EOEA 3ZG0A 4H8RA 3G2YA 4OP8A 2H5SA 4EWFA 5KMWA 2HP6A 3AGFA 1XA7A 4EQIA 1NRFA 4GZBA 4RVAA 3WWXA 2Y2PA 1FSYA 2JC7A 2EFXA 5EVIA 4DE2A 2XEPA 4QY6A 4BLMA 5HAIA 1YT4A 1XGIA
chains in the Genus database with same CATH superfamily
2FFYA 1KDWA 4JGOA 2J3WA 5CHUA 1YLZA 3MFDA 3FKVA 1FILA 5BOHA 1HVBA 1TD5A 4LV3A 2I72A 4NETA 4KG6A 1NZOA 4RQ9A 2ZMVA 4X55A 4BD0A 3DBAA 4JXGA 3WRZA 4LPZA 3TE8A 4HBUA 5HL6A 2Y2KA 3NDGA 3H7WB 4JXWA 2WZZA 2ZJ9A 5FATA 5HZHA 2VGLM 2XFSA 2INWA 3M6HA 4KQRA 1DJCA 3KSGA 3OZHA 2ZBBA 1YAXA 4IUHA 4Y5FA 2A24A 1S1YA 4S2LA 2PYPA 4GD8A 1IFQA 4HJ6A 2V2FF 2J3TC 4D60A 5DJUA 3T4KA 4EV4A 3F1OB 3IWQA 4DN0A 3T4OA 1GSWA 3MF0A 4R38A 5A93A 4DRTA 5F83A 2PD7A 3QNCA 4KZ3A 1FOFA 3MQQA 1GHMA 3SW1A 3BFEA 3OC2A 5EM0A 3OBFA 1ZKJA 3NBLA 4ZAMA 4C3QA 3ZG5A 5CXWA 2H10A 2ZC5B 3ZQ5A 4KZ6A 1GCEA 3M2KA 4JF4A 2WGWA 1VB6A 3FV7A 5IU1A 4ZRRA 5GHYA 4FH2A 2HF6A 5FSRA 1K6SA 2V1AA 5FDSA 5LBRA 5E2GA 2RL3A 4KZ4A 1XKZA 4QWOA 3O5YA 3UDFA 4D2OA 4E3LA 1TEMA 2ZL1B 4OH0A 2L0WA 3V5MA 1D7EA 4LCLA 1UWPX 1KOUA 1F98A 2BG1A 4DE1A 2Y2IA 4M3KA 2OSUA 3IXHA 4BBVA 3UE1A 2J9PA 4MBHA 4MDZA 1MY8A 3UB9A 4MEZA 4S2JA 3RH8B 3KYZA 1TS7A 3G6OA 3D9YA 5CX7A 5IHVA 3MXRA 4BD1A 4U0TA 5D3OA 1YSQA 4NXBA 4S2NA 2VGJA 2M7UA 3F1PB 2QHKA 3IX3A 2O9AA 3CUEC 3I7JA 1J9MA 1T1BA 2QJ7A 4EEPA 4PM8A 1ACFA 2EX2A 1JWVA 4RX3A 3FPVA 3K2NA 5FI7A 3Q1FA 4E3IA 2DRWA 2OAP1 2IWCA 3UPOA 2P74A 4UQIS 1S1ZA 5CERA 3KX0X 3EWKA 4PM6A 4ID4A 3B33A 4EUVA 3HUOA 3KO6A 3OLOA 5FEFA 1TS8A 3VP1A 2G2UA 2E8IA 4XXRA 4MBKA 2ZQ8A 2FH5A 2EX8A 4FTXA 5G4ZA 1T1CA 2O9BA 4DXCA 1T19A 2DNSA 4M4XA 5TFQA 3V39A 4R3JA 3BY9A 3GQZA 1LSXA 4IVIA 4NG2A 3T4TA 2XA7M 3KSIA 3W4OA 4S2IA 2Y55A 4HHDA 2ZOIA 3PR6A 2ZQ7A 5HARA 4WMCA 1YLJA 1P97A 5M18A 1K4EA 3C2WA 2G2WA 1IELA 1AWIA 4HY8A 2JHEA 3NI9A 5GLAA 5FQ9A 3VP0A 1LHYA 4B4XA 2QJ5A 1FCNA 2RCXA 5EVIB 2WAEA 1FQGA 1CJFA 4JLFA 1HTZA 4ME4A 3EEHA 1PNEA 2ZL1A 3FG8A 3U2AA 4KZ5A 1DP9A 1N9OA 1Y4OA 2ZLYA 3MMHA 5CHMA 1NYYA 1MWUA 5J7EA 4Q0JA 4OVDA 4R70A 4ZJ3A 2C5WB 3E98A 2D01A 5JYOA 3KYEA 3GVBA 2WADA 5EVEA 3B47A 4L0LA 1PI4A 3BEBA 4B88A 3U4LP 3F1PA 1P9RA 1YQSA 4EESA 4KUOA 4ETZA 2PU4A 3CAXA 1SKOA 4Y2FA 5FQKA 3ICYA 4JKTA 4BBUA 4F94A 3TG9A 1ODVA 3BECA 4Z1WA 4YWZA 3QP2A 2QPNA 4LRYC 1VEUB 3PBQA 4MN5A 3EQVA 4GLQA 3S22A 1OJ5A 4L9EA 5E2FA 1QMEA 1YM1A 1MC0A 1LT0A 5CTNA 2PYRA 5HFOA 2ZC3B 3LYXA 3QHYA 2ZQDA 5FASA 5CHJA 3MJQA 1BULA 1JTGA 2VLGA 4B4ZA 2OLVA 3C38A 2Y2OA 4II7A 1JWPA 3PAGA 2PU2A 4N92A 3G30A 1LSWA 5HD5A 1G6OA 4FD8A 4DKIA 5AVFA 3B42A 3CITA 1WE4A 3K3CA 4U3TA 3G2ZA 2GNXA 5AQ9A 3BM6A 2ZC7A 3IQAA 5GLBA 1KVMA 3LFVA 4X69A 1OJGA 3GRJA 4WF0A 2W1RA 3N7WA 2Y4AA 5HPFA 1SZVA 5L10A 1FSWA 4EBNA 4S2OA 5I94A 3S1YA 4HI4A 4Q8IA 5KMWA 2HP6A 3AGFA 4G3KA 1XA7A 1XJ6A 3LICA 4GZBA 4RVAA 1ZTUA 1FSYA 5EVIA 2EFXA 1YT4A 5J3WA 3F1NA 5GLCA 4LRXC 1W7FA 2WUQA 1EWZA 4OQ0A 2UV0E 1K56D 2PR5A 4GHIB 1NWZA 4UA7A 4DJ2A 1E3UD 1HD8A 2XRNA 4HOIA 3UDXA 3B3XA 4IHQA 3SS4A 5FI6A 1ZG6A 3VOZA 3HLGA 5HWTA 5AVEA 3W8KA 1CEFA 5F6AA 5GLDA 3ZHHA 1BZAA 2GJ3A 5CRFA 4EUZA 3UB5P 2PBYA 3G34A 5M1AA 1OTAA 3IWIA 3NC8A 4LV2A 1I5QA 2D02A 3UDIA 4KENB 4Q0IA 4S2MA 5GHZA 4G3WA 2OWJA 1XGJA 4YOFA 3A3IA 3ZCZA 3ZNTA 3FKWA 3UN7A 2XDMA 2B18A 3S4XA 2EX6A 2H28A 2Y2JA 1E4DA 2X01A 3DTIA 2G7UA 1ES2A 2VA0A 3BYDA 4OOLA 4NKPA 5JYPA 3T12B 1XJ2A 1PFLA 2ZQAA 3Q7ZA 4P6ZS 2KOIA 4EW7A 1YSPA 4R3BA 1S4RA 5A8BA 2HP5A 5HAPA 3LEZA 3R7WB 4BWIA 3A3JA 4ZBEA 2VX8A 2V8CA 3HLCA 2XSSA 2EX9A 4LCMA 4LENA 2Y2HA 3C5AA 4KUKA 1OT6A 2Y59A 3UB8A 4WLAA 2J3TD 4OOYA 2Q9MA 4PAUA 3MR0A 1OTDA 1ONGA 3A0RA 1FR6A 2WKEA 2ZM8A 3CHWP 4X56A 4BENA 3KSHA 4OPRA 3FZCA 3SOIA 4Y0TA 5GL9A 2JKGA 1VM1A 3ITBA 4R6LA 4E6WA 4KZAA 2B02A 3WS0A 3UNWA 4C75A 2VGLS 4WELA 4DDSA 4WZ4A 4KG5A 4MLLA 4OKPA 3JPUA 4N9LA 2J9OA 3T50A 3C30A 2V1ZA 2Y2QA 1L0EA 4JXVA 2HDUA 2OOLA 2DCFA 1PZPA 3NJAA 4GHIA 2HPBA 3HLFA 3EOIA 5L09A 1EROA 1SDEA 2WZXA 2ZMFA 3GDIA 3MQ0A 2W3HA 1PI5A 2Y79A 4Y15A 4PHTA 4KZ7A 3W2ZA 3LCEA 3WS1A 2UWXA 1N9BA 2H0YA 4EXOA 2E8JA 3V3SA 1CI8A 1AXBA 3R4KA 3D72A 1YMXA 4WM9A 4WBGA 4WL9A 1IEMA 2LB5A 3VP2A 2A2LA 5AQAA 3P01A 2VKSA 2WKQA 2VJWA 4NK3A 2IWDA 5CGSA 2K2NA 4WN5A 2P08A 3MZFA 3QP1A 3ISGA 3CLOA 5HSQA 3TJZC 1BLPA 4LLOB 2P9VA 1RP5A 3ZG9B 4QD4A 3C7UA 1KVLA 1LI9A 3BJNA 4OPQA 3SS5A 4E6XA 3GECA 4WUJA 1D1JA 1IYPA 3E4OA 2HDRA 4CPKA 4BL3A 3IX4A 4GB7A 3R7WA 5CEDA 4N1HA 3NIAA 4WZ5A 3BFGA 4LRZE 3LUQA 3VOLA 4L9FA 1OPXA 3H9WA 3SH9A 4K0XA 3LR0A 3OPLA 3OPHA 4X53A 3D3OA 5C5KA 2HDSA 3IH9A 4MNRA 3ZDJA 2XK1A 3SH8A 2OV5A 2VV8A 3VE4A 1S0WA 3E0YA 5F68A 2KLIA 2NUTC 3QP8A 3GTCA 4R4SA 1DP8A 3Q7VB 2PT7A 1K55A 2PAVP 2JKFA 1OT9A 3HVFA 1H3QA 1BSGA 1YLPA 2ZM0A 3HL9A 5HDDA 1SKOB 1MZUA 2WKHA 5CGWA 3LI8A 5AQBA 4BBTA 4KQDA 1YKDA 2Q0OA 4PM7A 4ETXA 3C4OA 3HLBA 4KQOA 3HBRA 3CPTA 3NOTC 5FEGA 1KE4A 1KGFA 4GOGA 4HBTA 3NCKA 5EVIC 4X6TA 2OLUA 4GD6A 3A3DA 2B5RA 2BLSA 2R9WA 3VP4A 5DKLA 4QHCA 4PM5A 2K31A 4UEYA 3BFDA 2XA7S 1OTIA 3PTEA 3DTMA 4R3AA 3GMWA 3GV9A 2V0WA 4ARZB 1XFNA 3ZGAB 4C6YA 3V3RA 1PW1A 5FA7A 5EPHA 1RCJA 3RJUA 4FCFA 2VV7A 3BLSA 4IBRA 1PW8A 3HLEA 3SS3A 3A3FA 4BMWA 1NY0A 1DRMA 2L4RA 3BRMA 3Q81A 3NOPC 3MQOA 1N4OA 4DE0A 3RXWA 1JVJA 1GSVA 3BWLA 1MPLA 3T1RA 4CLCC 3NY4A 5J8XA 4HESA 3ULFA 4NXEA 5FAOA 1RGZA 4YINA 4DJ3A 1HZOA 2VEAA 3E2LA 3BW6A 1G28A 5EE8A 3FPWA 2DMWA 2PDRA 3F1NB 3BQAA 4GCZA 4EQ1A 4DE3A 1XFQA 3IWOA 1GA9A 3H82A 1ES4A 3ZG8B 5EOEA 3ZG0A 4OP8A 4EWFA 2H5SA 3LR4A 2W3DA 4QY6A 4QB8A 2XR0A 3D4FA 2M7VA 2V8FA 4B93A 4K0WA 3W4PA 3P98A 3T4LA 4R1GA 2CC1A 1BTLA 3Q7VA 3C8CA 4Q0HA 3TRCA 2XLNA 4R0QA 3DWZA 3SH7A 1OMEA 3MBZA 1D06A 4E04A 4E3NA 1ES5A 3OCNA 3WS4A 2KX6A 4LGWA 3M2JA 1BT5A 3IH8A 2FFFB 2XH9A 4NXGA 1XX2A 5MC7A 5A91A 1XJ3A 2Z2LB 4CLCB 2C6WB 1TDGA 2ACGA 1YMSA 1M40A 5CGXA 3NOUC 4KQQA 1BYWA 1W5DA 2Z6DA 2V20A 3SZTA 5U47A 4ARZA 2Z6CA 3IS2B 5AJGA 3ZG7B 4XUZA 4N9KA 3QP5A 5HD3A 4BL2A 3LO7A 4OQGA 3L9KA 3N4IA 2XROA 4O0PA 3EEAA 1TF1A 2I9VA 3UB6A 4K91A 3T4JA 1SCWA 4X1LA 4RYEA 3UO9A 3VMAA 4EETB 5IS1A 4NEED 3G31A 4K08A 5M19A 1DJBA 3CJMA 1RGYA 5EM1A 2V1BA 2EWVA 5L2FA 1VQQA 4OOMA 1G68A 1K25A 1W63Q 4R23A 3PBNA 1H8YA 4LV0A 1IYOA 1NYMA 4MMNA 5KZHA 1L0DA 2EFUA 1IOUA 1CI9A 5E43A 2ZC4B 1ZHHB 3HLDA 4KG2A 5TR7A 4WZ5C 3RFBA 2JCHA 3WRTA 5FI2A 2Y2NA 1J3WA 3LR5A 1HLUP 2PRFA 3MSHA 5FQIA 1NRJA 5IT5A 5TJJA 4I3AA 1LL8A 3EGXC 3G32A 4NXFA 3NULA 5J4EA 4KZ8A 1EI5A 3AGDA 4EEUA 1K55C 3VFFA 2QZ6A 3TSGA 3IXBA 4DMZA 2W3EA 1H0MA 1ZC2A 3UE0A 3UE3A 4WMCD 1NXYA 1YLYA 2JE5A 3IHAA 5FQMA 4PKYA 3MZEA 1W8YA 4O7DA 4WEKA 4QU3A 4Y0UA 2XD1A 1K0KA 2HJ9C 4F3LA 3NECA 2P9VB 4A5RA 3GSGA 5EOOA 1PYYA 4OPYA 3G4PA 4CLCA 4E3OA 4P6BA 3HJKA 1Y28A 1TS6A 4GW9A 2R9XA 3G35A 3IF6C 1PWGA 3Q07A 3E4PA 4PMAA 1KGEA 1JNUA 1MWRA 5L07A 4QPRA 2FZ0A 3EQUA 2WKPA 1ZG4A 3ZVTA 3IS2A 4PKYG 3N6IA 4UAAA 4UA6A 3PYPA 3LGOA 1KDSA 2M1CA 4RX2A 3VP3A 5G18A 2L1MA 3L7HA 3VOYA 5FL3A 4HEFA 4DDYA 2R78A 4FSFA 4OQHA 1PWDA 4GDNA 4JF5A 4PM9A 4HP9A 1L0FA 1GHIA 2JKTM 2YKHA 2J8YA 4RA7A 1XXMA 1MWSA 4Z9QA 4FOFA 5EECA 1TVFA 3K3DA 4GJ4A 2K7SA 5CECA 3O3VA 2VZWA 5A92A 4CQHA 2IA2A 2X02A 4IBXA 3ZVWA 4H6JB 1NLYA 3S7OA 1CEGA 2EXBA 2H0TA 3CPTB 3KSFA 5FDHA 4ZTKA 1SHVA 4YFMA 3RXXA 1C3BA 2EWWA 5TBMA 1TS0A 2JN7A 4JPMA 3PHYA 1X0OA 3PBOA 1Q2QA 4JGQA 3UPPA 3V50A 3IF6B 4I39A 1GSXA 4ESPA 2W3FA 4OP5A 4IJGA 4P85A 1K38A 4XT2B 3ITAA 1DY6A 5A90A 4CJNA 5EV0A 4JGRA 2A3UA 4X68A 3E4QA 3UE6A 3PXPA 1IKGA 3UY6A 2QMIA 3Q82A 4QJGA 3O86A 2Y8HA 2XFTA 2HJEA 4HJ4A 5DF9A 1GHPA 4OLDA 5KSHA 3IBJA 2CMNA 2GZAA 2LB9A 2JKTI 3P09A 4ZJ1A 1MWTA 3LIBA 4KZBA 3TOIA 1KGGA 1PZOA 3A3EA 2W3GA 3A0VA 4GKUA 1Q2PA 1PRQA 2BTFP 4JF6A 1L0GA 3MXSA 1BUEA 5F69A 1LL9A 1A0KA 5EVID 3JVVA 3VSLA 3DTKA 3QNBA 4QY5A 2HZ5A 2W0NA 1I2SA 4LFUA 1KE3A 4MN7A 3S7NA 3O87A 3OPPA 4PPRA 4HJ3A 4JGPA 3H82B 3IF5A 3MKEA 5HWVA 4Y7PA 2PBDP 1PIOA 5FAQA 2P04A 5KIZA 5HW3A 4P87A 3PBRA 1LLBA 1Y54A 3HCYA 4MN6A 3V67A 5HAQA 1SDNA 3M6BA 3WS5A 3UB7A 1SKFA 1ESUA 1MXOA 5F1FA 2EA9A 2O9CA 3G2YA 4H8RA 3MFXA 3WWXA 2JC7A 4DE2A 2XEPA 4BLMA 5HAIA 2A49A 4IEDA 2X71A 5DKKA 2W1TB 2ZMAA 4E3KA 1E25A 3T1XA 4CLCD 4H6JA 3FC7A 5FAPA 1Z09A 3LR3A 3MZDA 1U60A 2Y91A 2VK3A 1BLHA 4EBLA 2WGVA 1MKMA 1VETB 3IF6A 5E2HA 3DTEA 4I3JA 1LI0A 4XT2A 2J80A 4GS9B 1GA0A 3WS2A 3IT9A 4MCWA 1T18A 2PD8A 4WEJA 3UMDA 4G3VA 3H7WA 3LIDA 3KYQA 5DF8A 5F1GA 1ESIA 4OPZA 3EGDC 1PWCA 5L8MA 1K56A 1NZUA 3DW0A 1L2SA 1JWZA 4Y17A 2XF3A 1E3UA 1K54A 4UQIM 2NUPC 1CQAA 4X1MA 4IVKA 1YLWA 3F1OA 4ZJ2A 5TGFA 2ZQ9A 1N9NA 4JBFA 5FQJA 1NJ4A 5EVLA 1P9WA 1H8ZA 2MJ6A 3IBRA 1V9ZA 3MKFA 1LL5A 2JKRM 2HDQA 2PR6A 1LSVA 4R4RA 3N8SA 3QP4A 2WK0A 4HH2A 2Q9NA 3BLMA 4MBFA 4FUWA 2W27A 2JBFA 3A0SA 4HIAA 5DJTA 2EXAA 3DWKA 3C4PA 3ZNYA 1CF0A 4HNBA 4UHUA 5I5LA 3ZYTA 1N9LA 3VV4A 2IWBA 3LIFA 5DTSA 1K57C 1FR1A 4I5SA 3UMEA 1H5XA 3T1QB 2W1TA 3T1SA 1IYQA 4ZDXA 1ALQA 1BLCA 3CZDA 3S7QA 1S6RA 3HREA 2WKRA 4F3LB 4KZ9A 3O88A 4Y3IA 3OOVA 2QYBA 3VFHA 1FCMA 1T1AA 1O07A 1QMFA 1KE0A 1VETA 4GNUA 2OWHA 1DP6A 2JKRI 5DF7A 1OTEA 1Z6FA 4EBPA 3DAVA 1V9YA 1W8QA 2P7JA 2VGKA 3LIEA 4GS9A 3TW8A 3PAEA 1MKIA 2Y2MA 5EFWA 3MS6A 4N1XA 5DVAA 1L3LA 1P0ZA 5CTMA 3UPNA 1XPBA 2V0UA 3C7VA 3BFCA 3LI9A 3BY8A 1W63M 3OPRA 3CI6A 1ERMA 3HUMA 3ZFZA 5EUAA 4EU0A 1NLZA 2ZOHA 3HLWA 2BASA 2GDNA 3LEQA 3N8LA 5HL1A 3GR2A 2ZM2A 4OQIA 1FIKA 4DF6A 1TDLA 1W79A 5HX9A 2Z2MB 5HDCA 4E3MA 1WYBA 2ZD8A 4S2KA 1F5MA 5HPIA 1IYSA 2V9AA 4XUXA 4JXSA 3LIAA 3OCLA 4GN2A 3N8RA 4HP4A 1H8MA 2XGNA 2ZC6B 4UA9A 2OAQ1 1BLSA 5TBMB 3CUEA 5HDSA 1F9IA 1XA1A 2O99A 1IKIA 3IXGA 2B95A 4I38A 3IX8A 1ONHA 3BFFA 4X25A 5GHXA 2XQZA 4BJPA 1EW0A 1ES3A 1CK3A 2VV6A 4IUKA 1YPRA 1FCOA 2WGIA 1G5UA 2WAFA 1M6KA 4Y13A 3MXQA 4WYYA 4U0XA 1JTDA 3NHQA 4P0MA 4S2PA 2KDKA 3CWFA 4CLCE 3CMZA 4OLGA 1UGUA 3FYZA 5HWWA 1WYCA 4B9OA 3E2KA 3T4SA 2A24B 3P7NA 1OTBA 4O8GA 5F82A 4BQMA 2Y2LA 3JYIA 3IHBA 3IXDA 1S67L 3HJIA 5K5BA 1O7EA 3S7PA 4LV1A 1UWNX 2QWSA 1DJAA 4S2NC 5FQQA 4DXBA 4I3IA 4GDBA 2HV1A 1G6AA 1K4FA 3RTYA 3PBSA 3W4QA 3LY4A 2HP9A 2J7VA 1MBLA 3VE3A 1VEUA 3HUNA 5AQ7A 5DTKA 3QP6A 1K6RA 4HQAA 2O0YA 2WYXA 1F2KA 3AGEA 1ERQA 2GX5A 1VHMA 2WGWB 2XD5A 4AFIA 3T4QA 2HGVA 4Y0OA 1XJ4A 1YLTA 3BQ8A 2Y2GA 3VSKA 3LY3A 4EERA 1XP4A 1I2WA 2WKIA 4YNRA 5G4YA 3CG5A 4L9GA 4O01A 2AVXA 1S66L 4E3JA 4HH3A 3FWLA 1K54C 5DTTA 5CEBA 2QKPA 2YKFA 1STZA 5E2EA 2PHYA 5DFYA 1K57A 2ZQCA 4P6ZM 3NDEA 1WA9A 3JVUA 5F5YA 4FH4A 5KSCA 4OONA 3PBTA 4EQIA 1NRFA 5DFXA 2Y2PA 1S4SA 1XGIA
chains in the Genus database with same CATH topology
1W7FA 2A49A 4IEDA 4QB8A 2X71A 2FFYA 1KDWA 2WUQA 2XR0A 3D4FA 2ZMAA 1EWZA 4OQ0A 5CHUA 1YLZA 4E3KA 1E25A 3MFDA 1K56D 4K0WA 3W4PA 3FKVA 3P98A 4UA7A 5BOHA 4R1GA 1HVBA 2CC1A 1BTLA 3Q7VA 4LV3A 5FAPA 2I72A 4NETA 1E3UD 1HD8A 1NZOA 2XLNA 4KG6A 4X55A 4BD0A 4R0QA 3MZDA 1U60A 4JXGA 3WRZA 3UDXA 3B3XA 2Y91A 3SS4A 5FI6A 1ZG6A 1BLHA 3DWZA 3VOZA 3HLGA 4HBUA 3SH7A 2Y2KA 4EBLA 1OMEA 3MBZA 4E3NA 2WGVA 1ES5A 3W8KA 3NDGA 3OCNA 1CEFA 3WS4A 5GLDA 3ZHHA 3IF6A 4JXWA 1BZAA 3M2JA 5E2HA 5CRFA 2WZZA 1BT5A 2ZJ9A 2PBYA 3G34A 5FATA 4EUZA 3IH8A 2FFFB 2XH9A 5M1AA 1LI0A 2XFSA 3IWIA 3NC8A 1XX2A 3M6HA 4LV2A 1I5QA 4KQRA 5A91A 1DJCA 3UDIA 1GA0A 3WS2A 3OZHA 2Z2LB 3IT9A 2C6WB 4KENB 1TDGA 1YMSA 4S2MA 4WEJA 5GHZA 1XGJA 4S2LA 1M40A 4GD8A 3A3IA 2V2FF 3ZCZA 5DF8A 5CGXA 5F1GA 1ESIA 4OPZA 4KQQA 3ZNTA 4EV4A 1PWCA 1W5DA 3FKWA 3IWQA 1K56A 3UN7A 2XDMA 1NZUA 2V20A 3S4XA 2EX6A 3DW0A 2Y2JA 5U47A 1L2SA 4DRTA 5A93A 1JWZA 5F83A 1E4DA 2XF3A 1E3UA 1K54A 3QNCA 4XUZA 2X01A 3ZG7B 4KZ3A 1FOFA 4N9KA 1ES2A 4BL2A 3LO7A 4OQGA 3BYDA 4OOLA 5JYPA 1GHMA 3N4IA 3BFEA 3OC2A 4C3QA 1ZKJA 3NBLA 4ZAMA 2ZQAA 1YLWA 3Q7ZA 4IVKA 3ZG5A 4ZJ2A 5TGFA 5CXWA 4K91A 2ZQ9A 2H10A 4R3BA 1SCWA 2HP5A 2ZC5B 3LEZA 5HAPA 4JBFA 5FQJA 4KZ6A 1GCEA 1NJ4A 3M2KA 4JF4A 2WGWA 4RYEA 3A3JA 4ZBEA 3FV7A 3UO9A 5EVLA 5GHYA 3HLCA 3VMAA 4FH2A 2EX9A 4LCMA 4LENA 2Y2HA 3C5AA 5FSRA 1K6SA 3G31A 2Y59A 1H8ZA 5E2GA 2RL3A 3MKFA 1LL5A 2Q9MA 4OOYA 5M19A 1DJBA 2HDQA 3CJMA 1RGYA 4KZ4A 1XKZA 1ONGA 4R4RA 1FR6A 3N8SA 3UDFA 4D2OA 2WKEA 2ZM8A 4X56A 4E3LA 1TEMA 1VQQA 4OH0A 4OOMA 5L2FA 4BENA 3V5MA 1G68A 4OPRA 3FZCA 3SOIA 1K25A 4LCLA 4Y0TA 2WK0A 2BG1A 5GL9A 4DE1A 2Y2IA 4M3KA 4R23A 1VM1A 2Q9NA 3PBNA 3BLMA 1H8YA 2OSUA 3ITBA 4LV0A 4MBFA 1IYOA 3IXHA 1NYMA 2JBFA 3UE1A 4E6WA 2J9PA 4KZAA 4MBHA 2EXAA 3DWKA 3WS0A 3C4PA 5KZHA 1L0DA 1MY8A 2EFUA 3UNWA 3ZNYA 4C75A 4WELA 4MEZA 1CI9A 4S2JA 4UHUA 2ZC4B 5E43A 4DDSA 3HLDA 4WZ4A 4KG5A 4KG2A 4MLLA 5TR7A 5IHVA 4OKPA 4WZ5C 2JCHA 3MXRA 4BD1A 4U0TA 4N9LA 5D3OA 3WRTA 5FI2A 2J9OA 4S2NA 2V1ZA 2Y2NA 2VGJA 2IWBA 5DTSA 1K57C 2Y2QA 1FR1A 1L0EA 4JXVA 5FQIA 1H5XA 2HDUA 1IYQA 4ZDXA 1ALQA 1J9MA 3I7JA 2DCFA 1BLCA 1PZPA 3CZDA 3G32A 2HPBA 3HLFA 4PM8A 1S6RA 3HREA 1EROA 2EX2A 4KZ8A 1EI5A 1SDEA 2WZXA 3AGDA 1K55C 1JWVA 4RX3A 3VFFA 2QZ6A 4KZ9A 5FI7A 3Q1FA 3IXBA 3TSGA 3O88A 4E3IA 1ZC2A 3UE0A 1PI5A 2DRWA 3VFHA 1FCMA 3UE3A 4WMCD 2IWCA 3UPOA 1NXYA 2P74A 1YLYA 1O07A 5CERA 2JE5A 1QMFA 3IHAA 5FQMA 1KE0A 3MZEA 4KZ7A 1W8YA 4GNUA 3LCEA 4O7DA 4PM6A 4WEKA 4ID4A 4QU3A 2UWXA 5DF7A 4Y0UA 3WS1A 2XD1A 1Z6FA 4EBPA 3HUOA 1N9BA 2H0YA 1W8QA 2P9VB 3V3SA 3GSGA 5EOOA 4A5RA 2VGKA 1CI8A 3VP1A 1PYYA 2G2UA 1AXBA 4OPYA 2E8IA 4XXRA 1YMXA 3G4PA 2ZQ8A 4MBKA 3PAEA 4WBGA 4WM9A 1IEMA 1MKIA 2EX8A 3VP2A 2Y2MA 5AQAA 4E3OA 4P6BA 4DXCA 2DNSA 4NK3A 2IWDA 4N1XA 5DVAA 2R9XA 3G35A 3IF6C 1PWGA 5CGSA 5TFQA 3Q07A 4PMAA 3V39A 1KGEA 4R3JA 3MZFA 3ISGA 5CTMA 1BLPA 3UPNA 1XPBA 3GQZA 2P9VA 3C7VA 3BFCA 1MWRA 4IVIA 1RP5A 3EQUA 3ZG9B 3OPRA 4QD4A 3W4OA 1ERMA 1ZG4A 3C7UA 3HUMA 3ZFZA 1KVLA 1LI9A 3ZVTA 5EUAA 4S2IA 2Y55A 3N6IA 4OPQA 3SS5A 3HLWA 4UA6A 3N8LA 2GDNA 4UAAA 4E6XA 5HL1A 3GR2A 2ZM2A 4OQIA 2ZQ7A 5HARA 4WMCA 4DF6A 1TDLA 1W79A 1YLJA 5HX9A 5M18A 1K4EA 1IYPA 1KDSA 2Z2MB 2HDRA 4RX2A 4E3MA 3VP3A 1WYBA 2G2WA 2ZD8A 1IELA 5G18A 4BL3A 4CPKA 4S2KA 3VOYA 4HEFA 4GB7A 1IYSA 4XUXA 4DDYA 4FSFA 3NI9A 5CEDA 4JXSA 4N1HA 4OQHA 3OCLA 1PWDA 3NIAA 4GDNA 4GN2A 4JF5A 4PM9A 1L0FA 4WZ5A 5GLAA 5FQ9A 1GHIA 3BFGA 3N8RA 3SH9A 3VP0A 4K0XA 1LHYA 4B4XA 2J8YA 2XGNA 2ZC6B 4UA9A 3OPLA 1XXMA 4RA7A 1FCNA 3OPHA 2RCXA 5EVIB 1MWSA 1BLSA 4X53A 2WAEA 1FQGA 4Z9QA 5EECA 1TVFA 2HDSA 3IH9A 4MNRA 1XA1A 3ZDJA 2XK1A 3O3VA 4JLFA 5CECA 3SH8A 1HTZA 2OV5A 1S0WA 1IKIA 5A92A 2X02A 3IXGA 4IBXA 3ZVWA 3GTCA 4R4SA 3Q7VB 1CEGA 1ONHA 1K55A 2EXBA 2H0TA 3BFFA 4KZ5A 2XQZA 5GHXA 4BJPA 5FDHA 4ZTKA 1ES3A 1SHVA 4YFMA 3RXXA 1CK3A 2ZLYA 5CHMA 1C3BA 1NYYA 3HVFA 1MWUA 1BSGA 4OVDA 1YLPA 2ZM0A 1FCOA 3HL9A 2WGIA 4JPMA 3PBOA 2C5WB 1Q2QA 4ZJ3A 2WKHA 5CGWA 3UPPA 5JYOA 2WAFA 5AQBA 3IF6B 3V50A 3GVBA 1M6KA 4PM7A 2WADA 4WYYA 3C4OA 4U0XA 3HLBA 4KQOA 3HBRA 1JTDA 4P0MA 4OP5A 4S2PA 4P85A 3CMZA 4OLGA 4L0LA 1K38A 5A90A 3ITAA 1DY6A 1KE4A 1KGFA 1PI4A 3BEBA 3NCKA 4GOGA 4HBTA 5EVIC 4B88A 4CJNA 3FYZA 4X6TA 1WYCA 2OLUA 1YQSA 2A3UA 4GD6A 4X68A 2PU4A 3E2KA 3A3DA 5FQKA 2B5RA 5F82A 4JKTA 1IKGA 2Y2LA 4BQMA 4F94A 2BLSA 3JYIA 2R9WA 3IHBA 3IXDA 3TG9A 2QMIA 3Q82A 3UY6A 1O7EA 3VP4A 3O86A 4QJGA 2XFTA 3BECA 4QHCA 4PM5A 4LV1A 5DF9A 1GHPA 2QPNA 4OLDA 5KSHA 3BFDA 1DJAA 4S2NC 3PTEA 5FQQA 3DTMA 3GMWA 4DXBA 3GV9A 4GDBA 1G6AA 1K4FA 3PBQA 3PBSA 3EQVA 3W4QA 3P09A 4ZJ1A 3ZGAB 4C6YA 1MWTA 3LY4A 3V3RA 1PW1A 5FA7A 5EPHA 1RCJA 3S22A 2HP9A 2J7VA 4FCFA 5E2FA 1QMEA 1YM1A 3BLSA 4IBRA 3RJUA 1PW8A 3HLEA 4KZBA 3SS3A 3TOIA 1KGGA 1PZOA 3A3FA 3A3EA 5CTNA 5HFOA 1MBLA 4GKUA 2ZC3B 1Q2PA 3HUNA 5AQ7A 5DTKA 3QHYA 1NY0A 1K6RA 2ZQDA 5FASA 2WYXA 4JF6A 5CHJA 1L0GA 3MXSA 3BRMA 3AGEA 1BULA 1ERQA 3Q81A 1BUEA 1LL9A 1JTGA 1N4OA 2WGWB 4DE0A 2XD5A 5EVID 3RXWA 4B4ZA 2OLVA 4Y0OA 2Y2OA 3VSLA 1YLTA 1JWPA 3QNBA 4QY5A 1JVJA 2PU2A 2Y2GA 3PAGA 3VSKA 4N92A 1I2SA 3G30A 3LY3A 1KE3A 1XP4A 4FD8A 4DKIA 1I2WA 2WKIA 3O87A 3OPPA 3CG5A 1WE4A 1MPLA 4PPRA 4E3JA 5GLCA 3NY4A 5J8XA 4HESA 3FWLA 4U3TA 3G2ZA 3IF5A 1K54C 5AQ9A 3BM6A 2ZC7A 3IQAA 5DTTA 5CEBA 5FAOA 5GLBA 1KVMA 1RGZA 3MKEA 4Y7PA 4YINA 1PIOA 1HZOA 3E2LA 5FAQA 5HW3A 5EE8A 4P87A 3PBRA 4X69A 1LLBA 1Y54A 5E2EA 3GRJA 1K57A 2ZQCA 3N7WA 3NDEA 5HAQA 2Y4AA 1SDNA 3M6BA 3WS5A 1SKFA 4DE3A 3IWOA 1ESUA 1FSWA 1GA9A 4S2OA 4EBNA 5I94A 4FH4A 1MXOA 5F1FA 5KSCA 1ES4A 4OONA 3S1YA 3ZG8B 3PBTA 4Q8IA 5EOEA 3ZG0A 4H8RA 3G2YA 4OP8A 2H5SA 4EWFA 5KMWA 2HP6A 3AGFA 1XA7A 4EQIA 1NRFA 4GZBA 4RVAA 3WWXA 2Y2PA 1FSYA 2JC7A 2EFXA 5EVIA 4DE2A 2XEPA 4QY6A 4BLMA 5HAIA 1YT4A 1XGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W7F A;  2A49 A;  4IED A;  4QB8 A;  2X71 A;  2FFY A;  1KDW A;  2WUQ A;  2XR0 A;  3D4F A;  2ZMA A;  1EWZ A;  4OQ0 A;  5CHU A;  1YLZ A;  4E3K A;  1E25 A;  3MFD A;  1K56 D;  4K0W A;  3W4P A;  3FKV A;  3P98 A;  4UA7 A;  5BOH A;  4R1G A;  1HVB A;  2CC1 A;  1BTL A;  3Q7V A;  4LV3 A;  5FAP A;  2I72 A;  4NET A;  1E3U D;  1HD8 A;  1NZO A;  2XLN A;  4KG6 A;  4X55 A;  4BD0 A;  4R0Q A;  3MZD A;  1U60 A;  4JXG A;  3WRZ A;  3UDX A;  3B3X A;  2Y91 A;  3SS4 A;  5FI6 A;  1ZG6 A;  1BLH A;  3DWZ A;  3VOZ A;  3HLG A;  4HBU A;  3SH7 A;  2Y2K A;  4EBL A;  1OME A;  3MBZ A;  4E3N A;  2WGV A;  1ES5 A;  3W8K A;  3NDG A;  3OCN A;  1CEF A;  3WS4 A;  5GLD A;  3ZHH A;  3IF6 A;  4JXW A;  1BZA A;  3M2J A;  5E2H A;  5CRF A;  2WZZ A;  1BT5 A;  2ZJ9 A;  2PBY A;  3G34 A;  5FAT A;  4EUZ A;  3IH8 A;  2FFF B;  2XH9 A;  5M1A A;  1LI0 A;  2XFS A;  3IWI A;  3NC8 A;  1XX2 A;  3M6H A;  4LV2 A;  1I5Q A;  4KQR A;  5A91 A;  1DJC A;  3UDI A;  1GA0 A;  3WS2 A;  3OZH A;  2Z2L B;  3IT9 A;  2C6W B;  4KEN B;  1TDG A;  1YMS A;  4S2M A;  4WEJ A;  5GHZ A;  1XGJ A;  4S2L A;  1M40 A;  4GD8 A;  3A3I A;  2V2F F;  3ZCZ A;  5DF8 A;  5CGX A;  5F1G A;  1ESI A;  4OPZ A;  4KQQ A;  3ZNT A;  4EV4 A;  1PWC A;  1W5D A;  3FKW A;  3IWQ A;  1K56 A;  3UN7 A;  2XDM A;  1NZU A;  2V20 A;  3S4X A;  2EX6 A;  3DW0 A;  2Y2J A;  5U47 A;  1L2S A;  4DRT A;  5A93 A;  1JWZ A;  5F83 A;  1E4D A;  2XF3 A;  1E3U A;  1K54 A;  3QNC A;  4XUZ A;  2X01 A;  3ZG7 B;  4KZ3 A;  1FOF A;  4N9K A;  1ES2 A;  4BL2 A;  3LO7 A;  4OQG A;  3BYD A;  4OOL A;  5JYP A;  1GHM A;  3N4I A;  3BFE A;  3OC2 A;  4C3Q A;  1ZKJ A;  3NBL A;  4ZAM A;  2ZQA A;  1YLW A;  3Q7Z A;  4IVK A;  3ZG5 A;  4ZJ2 A;  5TGF A;  5CXW A;  4K91 A;  2ZQ9 A;  2H10 A;  4R3B A;  1SCW A;  2HP5 A;  2ZC5 B;  3LEZ A;  5HAP A;  4JBF A;  5FQJ A;  4KZ6 A;  1GCE A;  1NJ4 A;  3M2K A;  4JF4 A;  2WGW A;  4RYE A;  3A3J A;  4ZBE A;  3FV7 A;  3UO9 A;  5EVL A;  5GHY A;  3HLC A;  3VMA A;  4FH2 A;  2EX9 A;  4LCM A;  4LEN A;  2Y2H A;  3C5A A;  5FSR A;  1K6S A;  3G31 A;  2Y59 A;  1H8Z A;  5E2G A;  2RL3 A;  3MKF A;  1LL5 A;  2Q9M A;  4OOY A;  5M19 A;  1DJB A;  2HDQ A;  3CJM A;  1RGY A;  4KZ4 A;  1XKZ A;  1ONG A;  4R4R A;  1FR6 A;  3N8S A;  3UDF A;  4D2O A;  2WKE A;  2ZM8 A;  4X56 A;  4E3L A;  1TEM A;  1VQQ A;  4OH0 A;  4OOM A;  5L2F A;  4BEN A;  3V5M A;  1G68 A;  4OPR A;  3FZC A;  3SOI A;  1K25 A;  4LCL A;  4Y0T A;  2WK0 A;  2BG1 A;  5GL9 A;  4DE1 A;  2Y2I A;  4M3K A;  4R23 A;  1VM1 A;  2Q9N A;  3PBN A;  3BLM A;  1H8Y A;  2OSU A;  3ITB A;  4LV0 A;  4MBF A;  1IYO A;  3IXH A;  1NYM A;  2JBF A;  3UE1 A;  4E6W A;  2J9P A;  4KZA A;  4MBH A;  2EXA A;  3DWK A;  3WS0 A;  3C4P A;  5KZH A;  1L0D A;  1MY8 A;  2EFU A;  3UNW A;  3ZNY A;  4C75 A;  4WEL A;  4MEZ A;  1CI9 A;  4S2J A;  4UHU A;  2ZC4 B;  5E43 A;  4DDS A;  3HLD A;  4WZ4 A;  4KG5 A;  4KG2 A;  4MLL A;  5TR7 A;  5IHV A;  4OKP A;  4WZ5 C;  2JCH A;  3MXR A;  4BD1 A;  4U0T A;  4N9L A;  5D3O A;  3WRT A;  5FI2 A;  2J9O A;  4S2N A;  2V1Z A;  2Y2N A;  2VGJ A;  2IWB A;  5DTS A;  1K57 C;  2Y2Q A;  1FR1 A;  1L0E A;  4JXV A;  5FQI A;  1H5X A;  2HDU A;  1IYQ A;  4ZDX A;  1ALQ A;  1J9M A;  3I7J A;  2DCF A;  1BLC A;  1PZP A;  3CZD A;  3G32 A;  2HPB A;  3HLF A;  4PM8 A;  1S6R A;  3HRE A;  1ERO A;  2EX2 A;  4KZ8 A;  1EI5 A;  1SDE A;  2WZX A;  3AGD A;  1K55 C;  1JWV A;  4RX3 A;  3VFF A;  2QZ6 A;  4KZ9 A;  5FI7 A;  3Q1F A;  3IXB A;  3TSG A;  3O88 A;  4E3I A;  1ZC2 A;  3UE0 A;  1PI5 A;  2DRW A;  3VFH A;  1FCM A;  3UE3 A;  4WMC D;  2IWC A;  3UPO A;  1NXY A;  2P74 A;  1YLY A;  1O07 A;  5CER A;  2JE5 A;  1QMF A;  3IHA A;  5FQM A;  1KE0 A;  3MZE A;  4KZ7 A;  1W8Y A;  4GNU A;  3LCE A;  4O7D A;  4PM6 A;  4WEK A;  4ID4 A;  4QU3 A;  2UWX A;  5DF7 A;  4Y0U A;  3WS1 A;  2XD1 A;  1Z6F A;  4EBP A;  3HUO A;  1N9B A;  2H0Y A;  1W8Q A;  2P9V B;  3V3S A;  3GSG A;  5EOO A;  4A5R A;  2VGK A;  1CI8 A;  3VP1 A;  1PYY A;  2G2U A;  1AXB A;  4OPY A;  2E8I A;  4XXR A;  1YMX A;  3G4P A;  2ZQ8 A;  4MBK A;  3PAE A;  4WBG A;  4WM9 A;  1IEM A;  1MKI A;  2EX8 A;  3VP2 A;  2Y2M A;  5AQA A;  4E3O A;  4P6B A;  4DXC A;  2DNS A;  4NK3 A;  2IWD A;  4N1X A;  5DVA A;  2R9X A;  3G35 A;  3IF6 C;  1PWG A;  5CGS A;  5TFQ A;  3Q07 A;  4PMA A;  3V39 A;  1KGE A;  4R3J A;  3MZF A;  3ISG A;  5CTM A;  1BLP A;  3UPN A;  1XPB A;  3GQZ A;  2P9V A;  3C7V A;  3BFC A;  1MWR A;  4IVI A;  1RP5 A;  3EQU A;  3ZG9 B;  3OPR A;  4QD4 A;  3W4O A;  1ERM A;  1ZG4 A;  3C7U A;  3HUM A;  3ZFZ A;  1KVL A;  1LI9 A;  3ZVT A;  5EUA A;  4S2I A;  2Y55 A;  3N6I A;  4OPQ A;  3SS5 A;  3HLW A;  4UA6 A;  3N8L A;  2GDN A;  4UAA A;  4E6X A;  5HL1 A;  3GR2 A;  2ZM2 A;  4OQI A;  2ZQ7 A;  5HAR A;  4WMC A;  4DF6 A;  1TDL A;  1W79 A;  1YLJ A;  5HX9 A;  5M18 A;  1K4E A;  1IYP A;  1KDS A;  2Z2M B;  2HDR A;  4RX2 A;  4E3M A;  3VP3 A;  1WYB A;  2G2W A;  2ZD8 A;  1IEL A;  5G18 A;  4BL3 A;  4CPK A;  4S2K A;  3VOY A;  4HEF A;  4GB7 A;  1IYS A;  4XUX A;  4DDY A;  4FSF A;  3NI9 A;  5CED A;  4JXS A;  4N1H A;  4OQH A;  3OCL A;  1PWD A;  3NIA A;  4GDN A;  4GN2 A;  4JF5 A;  4PM9 A;  1L0F A;  4WZ5 A;  5GLA A;  5FQ9 A;  1GHI A;  3BFG A;  3N8R A;  3SH9 A;  3VP0 A;  4K0X A;  1LHY A;  4B4X A;  2J8Y A;  2XGN A;  2ZC6 B;  4UA9 A;  3OPL A;  1XXM A;  4RA7 A;  1FCN A;  3OPH A;  2RCX A;  5EVI B;  1MWS A;  1BLS A;  4X53 A;  2WAE A;  1FQG A;  4Z9Q A;  5EEC A;  1TVF A;  2HDS A;  3IH9 A;  4MNR A;  1XA1 A;  3ZDJ A;  2XK1 A;  3O3V A;  4JLF A;  5CEC A;  3SH8 A;  1HTZ A;  2OV5 A;  1S0W A;  1IKI A;  5A92 A;  2X02 A;  3IXG A;  4IBX A;  3ZVW A;  3GTC A;  4R4S A;  3Q7V B;  1CEG A;  1ONH A;  1K55 A;  2EXB A;  2H0T A;  3BFF A;  4KZ5 A;  2XQZ A;  5GHX A;  4BJP A;  5FDH A;  4ZTK A;  1ES3 A;  1SHV A;  4YFM A;  3RXX A;  1CK3 A;  2ZLY A;  5CHM A;  1C3B A;  1NYY A;  3HVF A;  1MWU A;  1BSG A;  4OVD A;  1YLP A;  2ZM0 A;  1FCO A;  3HL9 A;  2WGI A;  4JPM A;  3PBO A;  2C5W B;  1Q2Q A;  4ZJ3 A;  2WKH A;  5CGW A;  3UPP A;  5JYO A;  2WAF A;  5AQB A;  3IF6 B;  3V50 A;  3GVB A;  1M6K A;  4PM7 A;  2WAD A;  4WYY A;  3C4O A;  4U0X A;  3HLB A;  4KQO A;  3HBR A;  1JTD A;  4P0M A;  4OP5 A;  4S2P A;  4P85 A;  3CMZ A;  4OLG A;  4L0L A;  1K38 A;  5A90 A;  3ITA A;  1DY6 A;  1KE4 A;  1KGF A;  1PI4 A;  3BEB A;  3NCK A;  4GOG A;  4HBT A;  5EVI C;  4B88 A;  4CJN A;  3FYZ A;  4X6T A;  1WYC A;  2OLU A;  1YQS A;  2A3U A;  4GD6 A;  4X68 A;  2PU4 A;  3E2K A;  3A3D A;  5FQK A;  2B5R A;  5F82 A;  4JKT A;  1IKG A;  2Y2L A;  4BQM A;  4F94 A;  2BLS A;  3JYI A;  2R9W A;  3IHB A;  3IXD A;  3TG9 A;  2QMI A;  3Q82 A;  3UY6 A;  1O7E A;  3VP4 A;  3O86 A;  4QJG A;  2XFT A;  3BEC A;  4QHC A;  4PM5 A;  4LV1 A;  5DF9 A;  1GHP A;  2QPN A;  4OLD A;  5KSH A;  3BFD A;  1DJA A;  4S2N C;  3PTE A;  5FQQ A;  3DTM A;  3GMW A;  4DXB A;  3GV9 A;  4GDB A;  1G6A A;  1K4F A;  3PBQ A;  3PBS A;  3EQV A;  3W4Q A;  3P09 A;  4ZJ1 A;  3ZGA B;  4C6Y A;  1MWT A;  3LY4 A;  3V3R A;  1PW1 A;  5FA7 A;  5EPH A;  1RCJ A;  3S22 A;  2HP9 A;  2J7V A;  4FCF A;  5E2F A;  1QME A;  1YM1 A;  3BLS A;  4IBR A;  3RJU A;  1PW8 A;  3HLE A;  4KZB A;  3SS3 A;  3TOI A;  1KGG A;  1PZO A;  3A3F A;  3A3E A;  5CTN A;  5HFO A;  1MBL A;  4GKU A;  2ZC3 B;  1Q2P A;  3HUN A;  5AQ7 A;  5DTK A;  3QHY A;  1NY0 A;  1K6R A;  2ZQD A;  5FAS A;  2WYX A;  4JF6 A;  5CHJ A;  1L0G A;  3MXS A;  3BRM A;  3AGE A;  1BUL A;  1ERQ A;  3Q81 A;  1BUE A;  1LL9 A;  1JTG A;  1N4O A;  2WGW B;  4DE0 A;  2XD5 A;  5EVI D;  3RXW A;  4B4Z A;  2OLV A;  4Y0O A;  2Y2O A;  3VSL A;  1YLT A;  1JWP A;  3QNB A;  4QY5 A;  1JVJ A;  2PU2 A;  2Y2G A;  3PAG A;  3VSK A;  4N92 A;  1I2S A;  3G30 A;  3LY3 A;  1KE3 A;  1XP4 A;  4FD8 A;  4DKI A;  1I2W A;  2WKI A;  3O87 A;  3OPP A;  3CG5 A;  1WE4 A;  1MPL A;  4PPR A;  4E3J A;  5GLC A;  3NY4 A;  5J8X A;  4HES A;  3FWL A;  4U3T A;  3G2Z A;  3IF5 A;  1K54 C;  5AQ9 A;  3BM6 A;  2ZC7 A;  3IQA A;  5DTT A;  5CEB A;  5FAO A;  5GLB A;  1KVM A;  1RGZ A;  3MKE A;  4Y7P A;  4YIN A;  1PIO A;  1HZO A;  3E2L A;  5FAQ A;  5HW3 A;  5EE8 A;  4P87 A;  3PBR A;  4X69 A;  1LLB A;  1Y54 A;  5E2E A;  3GRJ A;  1K57 A;  2ZQC A;  3N7W A;  3NDE A;  5HAQ A;  2Y4A A;  1SDN A;  3M6B A;  3WS5 A;  1SKF A;  4DE3 A;  3IWO A;  1ESU A;  1FSW A;  1GA9 A;  4S2O A;  4EBN A;  5I94 A;  4FH4 A;  1MXO A;  5F1F A;  5KSC A;  1ES4 A;  4OON A;  3S1Y A;  3ZG8 B;  3PBT A;  4Q8I A;  5EOE A;  3ZG0 A;  4H8R A;  3G2Y A;  4OP8 A;  2H5S A;  4EWF A;  5KMW A;  2HP6 A;  3AGF A;  1XA7 A;  4EQI A;  1NRF A;  4GZB A;  4RVA A;  3WWX A;  2Y2P A;  1FSY A;  2JC7 A;  2EFX A;  5EVI A;  4DE2 A;  2XEP A;  4QY6 A;  4BLM A;  5HAI A;  1YT4 A;  1XGI A; 
#chains in the Genus database with same CATH topology
 2FFY A;  1KDW A;  4JGO A;  2J3W A;  5CHU A;  1YLZ A;  3MFD A;  3FKV A;  1FIL A;  5BOH A;  1HVB A;  1TD5 A;  4LV3 A;  2I72 A;  4NET A;  4KG6 A;  1NZO A;  4RQ9 A;  2ZMV A;  4X55 A;  4BD0 A;  3DBA A;  4JXG A;  3WRZ A;  4LPZ A;  3TE8 A;  4HBU A;  5HL6 A;  2Y2K A;  3NDG A;  3H7W B;  4JXW A;  2WZZ A;  2ZJ9 A;  5FAT A;  5HZH A;  2VGL M;  2XFS A;  2INW A;  3M6H A;  4KQR A;  1DJC A;  3KSG A;  3OZH A;  2ZBB A;  1YAX A;  4IUH A;  4Y5F A;  2A24 A;  1S1Y A;  4S2L A;  2PYP A;  4GD8 A;  1IFQ A;  4HJ6 A;  2V2F F;  2J3T C;  4D60 A;  5DJU A;  3T4K A;  4EV4 A;  3F1O B;  3IWQ A;  4DN0 A;  3T4O A;  1GSW A;  3MF0 A;  4R38 A;  5A93 A;  4DRT A;  5F83 A;  2PD7 A;  3QNC A;  4KZ3 A;  1FOF A;  3MQQ A;  1GHM A;  3SW1 A;  3BFE A;  3OC2 A;  5EM0 A;  3OBF A;  1ZKJ A;  3NBL A;  4ZAM A;  4C3Q A;  3ZG5 A;  5CXW A;  2H10 A;  2ZC5 B;  3ZQ5 A;  4KZ6 A;  1GCE A;  3M2K A;  4JF4 A;  2WGW A;  1VB6 A;  3FV7 A;  5IU1 A;  4ZRR A;  5GHY A;  4FH2 A;  2HF6 A;  5FSR A;  1K6S A;  2V1A A;  5FDS A;  5LBR A;  5E2G A;  2RL3 A;  4KZ4 A;  1XKZ A;  4QWO A;  3O5Y A;  3UDF A;  4D2O A;  4E3L A;  1TEM A;  2ZL1 B;  4OH0 A;  2L0W A;  3V5M A;  1D7E A;  4LCL A;  1UWP X;  1KOU A;  1F98 A;  2BG1 A;  4DE1 A;  2Y2I A;  4M3K A;  2OSU A;  3IXH A;  4BBV A;  3UE1 A;  2J9P A;  4MBH A;  4MDZ A;  1MY8 A;  3UB9 A;  4MEZ A;  4S2J A;  3RH8 B;  3KYZ A;  1TS7 A;  3G6O A;  3D9Y A;  5CX7 A;  5IHV A;  3MXR A;  4BD1 A;  4U0T A;  5D3O A;  1YSQ A;  4NXB A;  4S2N A;  2VGJ A;  2M7U A;  3F1P B;  2QHK A;  3IX3 A;  2O9A A;  3CUE C;  3I7J A;  1J9M A;  1T1B A;  2QJ7 A;  4EEP A;  4PM8 A;  1ACF A;  2EX2 A;  1JWV A;  4RX3 A;  3FPV A;  3K2N A;  5FI7 A;  3Q1F A;  4E3I A;  2DRW A;  2OAP 1;  2IWC A;  3UPO A;  2P74 A;  4UQI S;  1S1Z A;  5CER A;  3KX0 X;  3EWK A;  4PM6 A;  4ID4 A;  3B33 A;  4EUV A;  3HUO A;  3KO6 A;  3OLO A;  5FEF A;  1TS8 A;  3VP1 A;  2G2U A;  2E8I A;  4XXR A;  4MBK A;  2ZQ8 A;  2FH5 A;  2EX8 A;  4FTX A;  5G4Z A;  1T1C A;  2O9B A;  4DXC A;  1T19 A;  2DNS A;  4M4X A;  5TFQ A;  3V39 A;  4R3J A;  3BY9 A;  3GQZ A;  1LSX A;  4IVI A;  4NG2 A;  3T4T A;  2XA7 M;  3KSI A;  3W4O A;  4S2I A;  2Y55 A;  4HHD A;  2ZOI A;  3PR6 A;  2ZQ7 A;  5HAR A;  4WMC A;  1YLJ A;  1P97 A;  5M18 A;  1K4E A;  3C2W A;  2G2W A;  1IEL A;  1AWI A;  4HY8 A;  2JHE A;  3NI9 A;  5GLA A;  5FQ9 A;  3VP0 A;  1LHY A;  4B4X A;  2QJ5 A;  1FCN A;  2RCX A;  5EVI B;  2WAE A;  1FQG A;  1CJF A;  4JLF A;  1HTZ A;  4ME4 A;  3EEH A;  1PNE A;  2ZL1 A;  3FG8 A;  3U2A A;  4KZ5 A;  1DP9 A;  1N9O A;  1Y4O A;  2ZLY A;  3MMH A;  5CHM A;  1NYY A;  1MWU A;  5J7E A;  4Q0J A;  4OVD A;  4R70 A;  4ZJ3 A;  2C5W B;  3E98 A;  2D01 A;  5JYO A;  3KYE A;  3GVB A;  2WAD A;  5EVE A;  3B47 A;  4L0L A;  1PI4 A;  3BEB A;  4B88 A;  3U4L P;  3F1P A;  1P9R A;  1YQS A;  4EES A;  4KUO A;  4ETZ A;  2PU4 A;  3CAX A;  1SKO A;  4Y2F A;  5FQK A;  3ICY A;  4JKT A;  4BBU A;  4F94 A;  3TG9 A;  1ODV A;  3BEC A;  4Z1W A;  4YWZ A;  3QP2 A;  2QPN A;  4LRY C;  1VEU B;  3PBQ A;  4MN5 A;  3EQV A;  4GLQ A;  3S22 A;  1OJ5 A;  4L9E A;  5E2F A;  1QME A;  1YM1 A;  1MC0 A;  1LT0 A;  5CTN A;  2PYR A;  5HFO A;  2ZC3 B;  3LYX A;  3QHY A;  2ZQD A;  5FAS A;  5CHJ A;  3MJQ A;  1BUL A;  1JTG A;  2VLG A;  4B4Z A;  2OLV A;  3C38 A;  2Y2O A;  4II7 A;  1JWP A;  3PAG A;  2PU2 A;  4N92 A;  3G30 A;  1LSW A;  5HD5 A;  1G6O A;  4FD8 A;  4DKI A;  5AVF A;  3B42 A;  3CIT A;  1WE4 A;  3K3C A;  4U3T A;  3G2Z A;  2GNX A;  5AQ9 A;  3BM6 A;  2ZC7 A;  3IQA A;  5GLB A;  1KVM A;  3LFV A;  4X69 A;  1OJG A;  3GRJ A;  4WF0 A;  2W1R A;  3N7W A;  2Y4A A;  5HPF A;  1SZV A;  5L10 A;  1FSW A;  4EBN A;  4S2O A;  5I94 A;  3S1Y A;  4HI4 A;  4Q8I A;  5KMW A;  2HP6 A;  3AGF A;  4G3K A;  1XA7 A;  1XJ6 A;  3LIC A;  4GZB A;  4RVA A;  1ZTU A;  1FSY A;  5EVI A;  2EFX A;  1YT4 A;  5J3W A;  3F1N A;  5GLC A;  4LRX C;  1W7F A;  2WUQ A;  1EWZ A;  4OQ0 A;  2UV0 E;  1K56 D;  2PR5 A;  4GHI B;  1NWZ A;  4UA7 A;  4DJ2 A;  1E3U D;  1HD8 A;  2XRN A;  4HOI A;  3UDX A;  3B3X A;  4IHQ A;  3SS4 A;  5FI6 A;  1ZG6 A;  3VOZ A;  3HLG A;  5HWT A;  5AVE A;  3W8K A;  1CEF A;  5F6A A;  5GLD A;  3ZHH A;  1BZA A;  2GJ3 A;  5CRF A;  4EUZ A;  3UB5 P;  2PBY A;  3G34 A;  5M1A A;  1OTA A;  3IWI A;  3NC8 A;  4LV2 A;  1I5Q A;  2D02 A;  3UDI A;  4KEN B;  4Q0I A;  4S2M A;  5GHZ A;  4G3W A;  2OWJ A;  1XGJ A;  4YOF A;  3A3I A;  3ZCZ A;  3ZNT A;  3FKW A;  3UN7 A;  2XDM A;  2B18 A;  3S4X A;  2EX6 A;  2H28 A;  2Y2J A;  1E4D A;  2X01 A;  3DTI A;  2G7U A;  1ES2 A;  2VA0 A;  3BYD A;  4OOL A;  4NKP A;  5JYP A;  3T12 B;  1XJ2 A;  1PFL A;  2ZQA A;  3Q7Z A;  4P6Z S;  2KOI A;  4EW7 A;  1YSP A;  4R3B A;  1S4R A;  5A8B A;  2HP5 A;  5HAP A;  3LEZ A;  3R7W B;  4BWI A;  3A3J A;  4ZBE A;  2VX8 A;  2V8C A;  3HLC A;  2XSS A;  2EX9 A;  4LCM A;  4LEN A;  2Y2H A;  3C5A A;  4KUK A;  1OT6 A;  2Y59 A;  3UB8 A;  4WLA A;  2J3T D;  4OOY A;  2Q9M A;  4PAU A;  3MR0 A;  1OTD A;  1ONG A;  3A0R A;  1FR6 A;  2WKE A;  2ZM8 A;  3CHW P;  4X56 A;  4BEN A;  3KSH A;  4OPR A;  3FZC A;  3SOI A;  4Y0T A;  5GL9 A;  2JKG A;  1VM1 A;  3ITB A;  4R6L A;  4E6W A;  4KZA A;  2B02 A;  3WS0 A;  3UNW A;  4C75 A;  2VGL S;  4WEL A;  4DDS A;  4WZ4 A;  4KG5 A;  4MLL A;  4OKP A;  3JPU A;  4N9L A;  2J9O A;  3T50 A;  3C30 A;  2V1Z A;  2Y2Q A;  1L0E A;  4JXV A;  2HDU A;  2OOL A;  2DCF A;  1PZP A;  3NJA A;  4GHI A;  2HPB A;  3HLF A;  3EOI A;  5L09 A;  1ERO A;  1SDE A;  2WZX A;  2ZMF A;  3GDI A;  3MQ0 A;  2W3H A;  1PI5 A;  2Y79 A;  4Y15 A;  4PHT A;  4KZ7 A;  3W2Z A;  3LCE A;  3WS1 A;  2UWX A;  1N9B A;  2H0Y A;  4EXO A;  2E8J A;  3V3S A;  1CI8 A;  1AXB A;  3R4K A;  3D72 A;  1YMX A;  4WM9 A;  4WBG A;  4WL9 A;  1IEM A;  2LB5 A;  3VP2 A;  2A2L A;  5AQA A;  3P01 A;  2VKS A;  2WKQ A;  2VJW A;  4NK3 A;  2IWD A;  5CGS A;  2K2N A;  4WN5 A;  2P08 A;  3MZF A;  3QP1 A;  3ISG A;  3CLO A;  5HSQ A;  3TJZ C;  1BLP A;  4LLO B;  2P9V A;  1RP5 A;  3ZG9 B;  4QD4 A;  3C7U A;  1KVL A;  1LI9 A;  3BJN A;  4OPQ A;  3SS5 A;  4E6X A;  3GEC A;  4WUJ A;  1D1J A;  1IYP A;  3E4O A;  2HDR A;  4CPK A;  4BL3 A;  3IX4 A;  4GB7 A;  3R7W A;  5CED A;  4N1H A;  3NIA A;  4WZ5 A;  3BFG A;  4LRZ E;  3LUQ A;  3VOL A;  4L9F A;  1OPX A;  3H9W A;  3SH9 A;  4K0X A;  3LR0 A;  3OPL A;  3OPH A;  4X53 A;  3D3O A;  5C5K A;  2HDS A;  3IH9 A;  4MNR A;  3ZDJ A;  2XK1 A;  3SH8 A;  2OV5 A;  2VV8 A;  3VE4 A;  1S0W A;  3E0Y A;  5F68 A;  2KLI A;  2NUT C;  3QP8 A;  3GTC A;  4R4S A;  1DP8 A;  3Q7V B;  2PT7 A;  1K55 A;  2PAV P;  2JKF A;  1OT9 A;  3HVF A;  1H3Q A;  1BSG A;  1YLP A;  2ZM0 A;  3HL9 A;  5HDD A;  1SKO B;  1MZU A;  2WKH A;  5CGW A;  3LI8 A;  5AQB A;  4BBT A;  4KQD A;  1YKD A;  2Q0O A;  4PM7 A;  4ETX A;  3C4O A;  3HLB A;  4KQO A;  3HBR A;  3CPT A;  3NOT C;  5FEG A;  1KE4 A;  1KGF A;  4GOG A;  4HBT A;  3NCK A;  5EVI C;  4X6T A;  2OLU A;  4GD6 A;  3A3D A;  2B5R A;  2BLS A;  2R9W A;  3VP4 A;  5DKL A;  4QHC A;  4PM5 A;  2K31 A;  4UEY A;  3BFD A;  2XA7 S;  1OTI A;  3PTE A;  3DTM A;  4R3A A;  3GMW A;  3GV9 A;  2V0W A;  4ARZ B;  1XFN A;  3ZGA B;  4C6Y A;  3V3R A;  1PW1 A;  5FA7 A;  5EPH A;  1RCJ A;  3RJU A;  4FCF A;  2VV7 A;  3BLS A;  4IBR A;  1PW8 A;  3HLE A;  3SS3 A;  3A3F A;  4BMW A;  1NY0 A;  1DRM A;  2L4R A;  3BRM A;  3Q81 A;  3NOP C;  3MQO A;  1N4O A;  4DE0 A;  3RXW A;  1JVJ A;  1GSV A;  3BWL A;  1MPL A;  3T1R A;  4CLC C;  3NY4 A;  5J8X A;  4HES A;  3ULF A;  4NXE A;  5FAO A;  1RGZ A;  4YIN A;  4DJ3 A;  1HZO A;  2VEA A;  3E2L A;  3BW6 A;  1G28 A;  5EE8 A;  3FPW A;  2DMW A;  2PDR A;  3F1N B;  3BQA A;  4GCZ A;  4EQ1 A;  4DE3 A;  1XFQ A;  3IWO A;  1GA9 A;  3H82 A;  1ES4 A;  3ZG8 B;  5EOE A;  3ZG0 A;  4OP8 A;  4EWF A;  2H5S A;  3LR4 A;  2W3D A;  4QY6 A;  4QB8 A;  2XR0 A;  3D4F A;  2M7V A;  2V8F A;  4B93 A;  4K0W A;  3W4P A;  3P98 A;  3T4L A;  4R1G A;  2CC1 A;  1BTL A;  3Q7V A;  3C8C A;  4Q0H A;  3TRC A;  2XLN A;  4R0Q A;  3DWZ A;  3SH7 A;  1OME A;  3MBZ A;  1D06 A;  4E04 A;  4E3N A;  1ES5 A;  3OCN A;  3WS4 A;  2KX6 A;  4LGW A;  3M2J A;  1BT5 A;  3IH8 A;  2FFF B;  2XH9 A;  4NXG A;  1XX2 A;  5MC7 A;  5A91 A;  1XJ3 A;  2Z2L B;  4CLC B;  2C6W B;  1TDG A;  2ACG A;  1YMS A;  1M40 A;  5CGX A;  3NOU C;  4KQQ A;  1BYW A;  1W5D A;  2Z6D A;  2V20 A;  3SZT A;  5U47 A;  4ARZ A;  2Z6C A;  3IS2 B;  5AJG A;  3ZG7 B;  4XUZ A;  4N9K A;  3QP5 A;  5HD3 A;  4BL2 A;  3LO7 A;  4OQG A;  3L9K A;  3N4I A;  2XRO A;  4O0P A;  3EEA A;  1TF1 A;  2I9V A;  3UB6 A;  4K91 A;  3T4J A;  1SCW A;  4X1L A;  4RYE A;  3UO9 A;  3VMA A;  4EET B;  5IS1 A;  4NEE D;  3G31 A;  4K08 A;  5M19 A;  1DJB A;  3CJM A;  1RGY A;  5EM1 A;  2V1B A;  2EWV A;  5L2F A;  1VQQ A;  4OOM A;  1G68 A;  1K25 A;  1W63 Q;  4R23 A;  3PBN A;  1H8Y A;  4LV0 A;  1IYO A;  1NYM A;  4MMN A;  5KZH A;  1L0D A;  2EFU A;  1IOU A;  1CI9 A;  5E43 A;  2ZC4 B;  1ZHH B;  3HLD A;  4KG2 A;  5TR7 A;  4WZ5 C;  3RFB A;  2JCH A;  3WRT A;  5FI2 A;  2Y2N A;  1J3W A;  3LR5 A;  1HLU P;  2PRF A;  3MSH A;  5FQI A;  1NRJ A;  5IT5 A;  5TJJ A;  4I3A A;  1LL8 A;  3EGX C;  3G32 A;  4NXF A;  3NUL A;  5J4E A;  4KZ8 A;  1EI5 A;  3AGD A;  4EEU A;  1K55 C;  3VFF A;  2QZ6 A;  3TSG A;  3IXB A;  4DMZ A;  2W3E A;  1H0M A;  1ZC2 A;  3UE0 A;  3UE3 A;  4WMC D;  1NXY A;  1YLY A;  2JE5 A;  3IHA A;  5FQM A;  4PKY A;  3MZE A;  1W8Y A;  4O7D A;  4WEK A;  4QU3 A;  4Y0U A;  2XD1 A;  1K0K A;  2HJ9 C;  4F3L A;  3NEC A;  2P9V B;  4A5R A;  3GSG A;  5EOO A;  1PYY A;  4OPY A;  3G4P A;  4CLC A;  4E3O A;  4P6B A;  3HJK A;  1Y28 A;  1TS6 A;  4GW9 A;  2R9X A;  3G35 A;  3IF6 C;  1PWG A;  3Q07 A;  3E4P A;  4PMA A;  1KGE A;  1JNU A;  1MWR A;  5L07 A;  4QPR A;  2FZ0 A;  3EQU A;  2WKP A;  1ZG4 A;  3ZVT A;  3IS2 A;  4PKY G;  3N6I A;  4UAA A;  4UA6 A;  3PYP A;  3LGO A;  1KDS A;  2M1C A;  4RX2 A;  3VP3 A;  5G18 A;  2L1M A;  3L7H A;  3VOY A;  5FL3 A;  4HEF A;  4DDY A;  2R78 A;  4FSF A;  4OQH A;  1PWD A;  4GDN A;  4JF5 A;  4PM9 A;  4HP9 A;  1L0F A;  1GHI A;  2JKT M;  2YKH A;  2J8Y A;  4RA7 A;  1XXM A;  1MWS A;  4Z9Q A;  4FOF A;  5EEC A;  1TVF A;  3K3D A;  4GJ4 A;  2K7S A;  5CEC A;  3O3V A;  2VZW A;  5A92 A;  4CQH A;  2IA2 A;  2X02 A;  4IBX A;  3ZVW A;  4H6J B;  1NLY A;  3S7O A;  1CEG A;  2EXB A;  2H0T A;  3CPT B;  3KSF A;  5FDH A;  4ZTK A;  1SHV A;  4YFM A;  3RXX A;  1C3B A;  2EWW A;  5TBM A;  1TS0 A;  2JN7 A;  4JPM A;  3PHY A;  1X0O A;  3PBO A;  1Q2Q A;  4JGQ A;  3UPP A;  3V50 A;  3IF6 B;  4I39 A;  1GSX A;  4ESP A;  2W3F A;  4OP5 A;  4IJG A;  4P85 A;  1K38 A;  4XT2 B;  3ITA A;  1DY6 A;  5A90 A;  4CJN A;  5EV0 A;  4JGR A;  2A3U A;  4X68 A;  3E4Q A;  3UE6 A;  3PXP A;  1IKG A;  3UY6 A;  2QMI A;  3Q82 A;  4QJG A;  3O86 A;  2Y8H A;  2XFT A;  2HJE A;  4HJ4 A;  5DF9 A;  1GHP A;  4OLD A;  5KSH A;  3IBJ A;  2CMN A;  2GZA A;  2LB9 A;  2JKT I;  3P09 A;  4ZJ1 A;  1MWT A;  3LIB A;  4KZB A;  3TOI A;  1KGG A;  1PZO A;  3A3E A;  2W3G A;  3A0V A;  4GKU A;  1Q2P A;  1PRQ A;  2BTF P;  4JF6 A;  1L0G A;  3MXS A;  1BUE A;  5F69 A;  1LL9 A;  1A0K A;  5EVI D;  3JVV A;  3VSL A;  3DTK A;  3QNB A;  4QY5 A;  2HZ5 A;  2W0N A;  1I2S A;  4LFU A;  1KE3 A;  4MN7 A;  3S7N A;  3O87 A;  3OPP A;  4PPR A;  4HJ3 A;  4JGP A;  3H82 B;  3IF5 A;  3MKE A;  5HWV A;  4Y7P A;  2PBD P;  1PIO A;  5FAQ A;  2P04 A;  5KIZ A;  5HW3 A;  4P87 A;  3PBR A;  1LLB A;  1Y54 A;  3HCY A;  4MN6 A;  3V67 A;  5HAQ A;  1SDN A;  3M6B A;  3WS5 A;  3UB7 A;  1SKF A;  1ESU A;  1MXO A;  5F1F A;  2EA9 A;  2O9C A;  3G2Y A;  4H8R A;  3MFX A;  3WWX A;  2JC7 A;  4DE2 A;  2XEP A;  4BLM A;  5HAI A;  2A49 A;  4IED A;  2X71 A;  5DKK A;  2W1T B;  2ZMA A;  4E3K A;  1E25 A;  3T1X A;  4CLC D;  4H6J A;  3FC7 A;  5FAP A;  1Z09 A;  3LR3 A;  3MZD A;  1U60 A;  2Y91 A;  2VK3 A;  1BLH A;  4EBL A;  2WGV A;  1MKM A;  1VET B;  3IF6 A;  5E2H A;  3DTE A;  4I3J A;  1LI0 A;  4XT2 A;  2J80 A;  4GS9 B;  1GA0 A;  3WS2 A;  3IT9 A;  4MCW A;  1T18 A;  2PD8 A;  4WEJ A;  3UMD A;  4G3V A;  3H7W A;  3LID A;  3KYQ A;  5DF8 A;  5F1G A;  1ESI A;  4OPZ A;  3EGD C;  1PWC A;  5L8M A;  1K56 A;  1NZU A;  3DW0 A;  1L2S A;  1JWZ A;  4Y17 A;  2XF3 A;  1E3U A;  1K54 A;  4UQI M;  2NUP C;  1CQA A;  4X1M A;  4IVK A;  1YLW A;  3F1O A;  4ZJ2 A;  5TGF A;  2ZQ9 A;  1N9N A;  4JBF A;  5FQJ A;  1NJ4 A;  5EVL A;  1P9W A;  1H8Z A;  2MJ6 A;  3IBR A;  1V9Z A;  3MKF A;  1LL5 A;  2JKR M;  2HDQ A;  2PR6 A;  1LSV A;  4R4R A;  3N8S A;  3QP4 A;  2WK0 A;  4HH2 A;  2Q9N A;  3BLM A;  4MBF A;  4FUW A;  2W27 A;  2JBF A;  3A0S A;  4HIA A;  5DJT A;  2EXA A;  3DWK A;  3C4P A;  3ZNY A;  1CF0 A;  4HNB A;  4UHU A;  5I5L A;  3ZYT A;  1N9L A;  3VV4 A;  2IWB A;  3LIF A;  5DTS A;  1K57 C;  1FR1 A;  4I5S A;  3UME A;  1H5X A;  3T1Q B;  2W1T A;  3T1S A;  1IYQ A;  4ZDX A;  1ALQ A;  1BLC A;  3CZD A;  3S7Q A;  1S6R A;  3HRE A;  2WKR A;  4F3L B;  4KZ9 A;  3O88 A;  4Y3I A;  3OOV A;  2QYB A;  3VFH A;  1FCM A;  1T1A A;  1O07 A;  1QMF A;  1KE0 A;  1VET A;  4GNU A;  2OWH A;  1DP6 A;  2JKR I;  5DF7 A;  1OTE A;  1Z6F A;  4EBP A;  3DAV A;  1V9Y A;  1W8Q A;  2P7J A;  2VGK A;  3LIE A;  4GS9 A;  3TW8 A;  3PAE A;  1MKI A;  2Y2M A;  5EFW A;  3MS6 A;  4N1X A;  5DVA A;  1L3L A;  1P0Z A;  5CTM A;  3UPN A;  1XPB A;  2V0U A;  3C7V A;  3BFC A;  3LI9 A;  3BY8 A;  1W63 M;  3OPR A;  3CI6 A;  1ERM A;  3HUM A;  3ZFZ A;  5EUA A;  4EU0 A;  1NLZ A;  2ZOH A;  3HLW A;  2BAS A;  2GDN A;  3LEQ A;  3N8L A;  5HL1 A;  3GR2 A;  2ZM2 A;  4OQI A;  1FIK A;  4DF6 A;  1TDL A;  1W79 A;  5HX9 A;  2Z2M B;  5HDC A;  4E3M A;  1WYB A;  2ZD8 A;  4S2K A;  1F5M A;  5HPI A;  1IYS A;  2V9A A;  4XUX A;  4JXS A;  3LIA A;  3OCL A;  4GN2 A;  3N8R A;  4HP4 A;  1H8M A;  2XGN A;  2ZC6 B;  4UA9 A;  2OAQ 1;  1BLS A;  5TBM B;  3CUE A;  5HDS A;  1F9I A;  1XA1 A;  2O99 A;  1IKI A;  3IXG A;  2B95 A;  4I38 A;  3IX8 A;  1ONH A;  3BFF A;  4X25 A;  5GHX A;  2XQZ A;  4BJP A;  1EW0 A;  1ES3 A;  1CK3 A;  2VV6 A;  4IUK A;  1YPR A;  1FCO A;  2WGI A;  1G5U A;  2WAF A;  1M6K A;  4Y13 A;  3MXQ A;  4WYY A;  4U0X A;  1JTD A;  3NHQ A;  4P0M A;  4S2P A;  2KDK A;  3CWF A;  4CLC E;  3CMZ A;  4OLG A;  1UGU A;  3FYZ A;  5HWW A;  1WYC A;  4B9O A;  3E2K A;  3T4S A;  2A24 B;  3P7N A;  1OTB A;  4O8G A;  5F82 A;  4BQM A;  2Y2L A;  3JYI A;  3IHB A;  3IXD A;  1S67 L;  3HJI A;  5K5B A;  1O7E A;  3S7P A;  4LV1 A;  1UWN X;  2QWS A;  1DJA A;  4S2N C;  5FQQ A;  4DXB A;  4I3I A;  4GDB A;  2HV1 A;  1G6A A;  1K4F A;  3RTY A;  3PBS A;  3W4Q A;  3LY4 A;  2HP9 A;  2J7V A;  1MBL A;  3VE3 A;  1VEU A;  3HUN A;  5AQ7 A;  5DTK A;  3QP6 A;  1K6R A;  4HQA A;  2O0Y A;  2WYX A;  1F2K A;  3AGE A;  1ERQ A;  2GX5 A;  1VHM A;  2WGW B;  2XD5 A;  4AFI A;  3T4Q A;  2HGV A;  4Y0O A;  1XJ4 A;  1YLT A;  3BQ8 A;  2Y2G A;  3VSK A;  3LY3 A;  4EER A;  1XP4 A;  1I2W A;  2WKI A;  4YNR A;  5G4Y A;  3CG5 A;  4L9G A;  4O01 A;  2AVX A;  1S66 L;  4E3J A;  4HH3 A;  3FWL A;  1K54 C;  5DTT A;  5CEB A;  2QKP A;  2YKF A;  1STZ A;  5E2E A;  2PHY A;  5DFY A;  1K57 A;  2ZQC A;  4P6Z M;  3NDE A;  1WA9 A;  3JVU A;  5F5Y A;  4FH4 A;  5KSC A;  4OON A;  3PBT A;  4EQI A;  1NRF A;  5DFX A;  2Y2P A;  1S4S A;  1XGI A; 
#chains in the Genus database with same CATH homology
 1W7F A;  2A49 A;  4IED A;  4QB8 A;  2X71 A;  2FFY A;  1KDW A;  2WUQ A;  2XR0 A;  3D4F A;  2ZMA A;  1EWZ A;  4OQ0 A;  5CHU A;  1YLZ A;  4E3K A;  1E25 A;  3MFD A;  1K56 D;  4K0W A;  3W4P A;  3FKV A;  3P98 A;  4UA7 A;  5BOH A;  4R1G A;  1HVB A;  2CC1 A;  1BTL A;  3Q7V A;  4LV3 A;  5FAP A;  2I72 A;  4NET A;  1E3U D;  1HD8 A;  1NZO A;  2XLN A;  4KG6 A;  4X55 A;  4BD0 A;  4R0Q A;  3MZD A;  1U60 A;  4JXG A;  3WRZ A;  3UDX A;  3B3X A;  2Y91 A;  3SS4 A;  5FI6 A;  1ZG6 A;  1BLH A;  3DWZ A;  3VOZ A;  3HLG A;  4HBU A;  3SH7 A;  2Y2K A;  4EBL A;  1OME A;  3MBZ A;  4E3N A;  2WGV A;  1ES5 A;  3W8K A;  3NDG A;  3OCN A;  1CEF A;  3WS4 A;  5GLD A;  3ZHH A;  3IF6 A;  4JXW A;  1BZA A;  3M2J A;  5E2H A;  5CRF A;  2WZZ A;  1BT5 A;  2ZJ9 A;  2PBY A;  3G34 A;  5FAT A;  4EUZ A;  3IH8 A;  2FFF B;  2XH9 A;  5M1A A;  1LI0 A;  2XFS A;  3IWI A;  3NC8 A;  1XX2 A;  3M6H A;  4LV2 A;  1I5Q A;  4KQR A;  5A91 A;  1DJC A;  3UDI A;  1GA0 A;  3WS2 A;  3OZH A;  2Z2L B;  3IT9 A;  2C6W B;  4KEN B;  1TDG A;  1YMS A;  4S2M A;  4WEJ A;  5GHZ A;  1XGJ A;  4S2L A;  1M40 A;  4GD8 A;  3A3I A;  2V2F F;  3ZCZ A;  5DF8 A;  5CGX A;  5F1G A;  1ESI A;  4OPZ A;  4KQQ A;  3ZNT A;  4EV4 A;  1PWC A;  1W5D A;  3FKW A;  3IWQ A;  1K56 A;  3UN7 A;  2XDM A;  1NZU A;  2V20 A;  3S4X A;  2EX6 A;  3DW0 A;  2Y2J A;  5U47 A;  1L2S A;  4DRT A;  5A93 A;  1JWZ A;  5F83 A;  1E4D A;  2XF3 A;  1E3U A;  1K54 A;  3QNC A;  4XUZ A;  2X01 A;  3ZG7 B;  4KZ3 A;  1FOF A;  4N9K A;  1ES2 A;  4BL2 A;  3LO7 A;  4OQG A;  3BYD A;  4OOL A;  5JYP A;  1GHM A;  3N4I A;  3BFE A;  3OC2 A;  4C3Q A;  1ZKJ A;  3NBL A;  4ZAM A;  2ZQA A;  1YLW A;  3Q7Z A;  4IVK A;  3ZG5 A;  4ZJ2 A;  5TGF A;  5CXW A;  4K91 A;  2ZQ9 A;  2H10 A;  4R3B A;  1SCW A;  2HP5 A;  2ZC5 B;  3LEZ A;  5HAP A;  4JBF A;  5FQJ A;  4KZ6 A;  1GCE A;  1NJ4 A;  3M2K A;  4JF4 A;  2WGW A;  4RYE A;  3A3J A;  4ZBE A;  3FV7 A;  3UO9 A;  5EVL A;  5GHY A;  3HLC A;  3VMA A;  4FH2 A;  2EX9 A;  4LCM A;  4LEN A;  2Y2H A;  3C5A A;  5FSR A;  1K6S A;  3G31 A;  2Y59 A;  1H8Z A;  5E2G A;  2RL3 A;  3MKF A;  1LL5 A;  2Q9M A;  4OOY A;  5M19 A;  1DJB A;  2HDQ A;  3CJM A;  1RGY A;  4KZ4 A;  1XKZ A;  1ONG A;  4R4R A;  1FR6 A;  3N8S A;  3UDF A;  4D2O A;  2WKE A;  2ZM8 A;  4X56 A;  4E3L A;  1TEM A;  1VQQ A;  4OH0 A;  4OOM A;  5L2F A;  4BEN A;  3V5M A;  1G68 A;  4OPR A;  3FZC A;  3SOI A;  1K25 A;  4LCL A;  4Y0T A;  2WK0 A;  2BG1 A;  5GL9 A;  4DE1 A;  2Y2I A;  4M3K A;  4R23 A;  1VM1 A;  2Q9N A;  3PBN A;  3BLM A;  1H8Y A;  2OSU A;  3ITB A;  4LV0 A;  4MBF A;  1IYO A;  3IXH A;  1NYM A;  2JBF A;  3UE1 A;  4E6W A;  2J9P A;  4KZA A;  4MBH A;  2EXA A;  3DWK A;  3WS0 A;  3C4P A;  5KZH A;  1L0D A;  1MY8 A;  2EFU A;  3UNW A;  3ZNY A;  4C75 A;  4WEL A;  4MEZ A;  1CI9 A;  4S2J A;  4UHU A;  2ZC4 B;  5E43 A;  4DDS A;  3HLD A;  4WZ4 A;  4KG5 A;  4KG2 A;  4MLL A;  5TR7 A;  5IHV A;  4OKP A;  4WZ5 C;  2JCH A;  3MXR A;  4BD1 A;  4U0T A;  4N9L A;  5D3O A;  3WRT A;  5FI2 A;  2J9O A;  4S2N A;  2V1Z A;  2Y2N A;  2VGJ A;  2IWB A;  5DTS A;  1K57 C;  2Y2Q A;  1FR1 A;  1L0E A;  4JXV A;  5FQI A;  1H5X A;  2HDU A;  1IYQ A;  4ZDX A;  1ALQ A;  1J9M A;  3I7J A;  2DCF A;  1BLC A;  1PZP A;  3CZD A;  3G32 A;  2HPB A;  3HLF A;  4PM8 A;  1S6R A;  3HRE A;  1ERO A;  2EX2 A;  4KZ8 A;  1EI5 A;  1SDE A;  2WZX A;  3AGD A;  1K55 C;  1JWV A;  4RX3 A;  3VFF A;  2QZ6 A;  4KZ9 A;  5FI7 A;  3Q1F A;  3IXB A;  3TSG A;  3O88 A;  4E3I A;  1ZC2 A;  3UE0 A;  1PI5 A;  2DRW A;  3VFH A;  1FCM A;  3UE3 A;  4WMC D;  2IWC A;  3UPO A;  1NXY A;  2P74 A;  1YLY A;  1O07 A;  5CER A;  2JE5 A;  1QMF A;  3IHA A;  5FQM A;  1KE0 A;  3MZE A;  4KZ7 A;  1W8Y A;  4GNU A;  3LCE A;  4O7D A;  4PM6 A;  4WEK A;  4ID4 A;  4QU3 A;  2UWX A;  5DF7 A;  4Y0U A;  3WS1 A;  2XD1 A;  1Z6F A;  4EBP A;  3HUO A;  1N9B A;  2H0Y A;  1W8Q A;  2P9V B;  3V3S A;  3GSG A;  5EOO A;  4A5R A;  2VGK A;  1CI8 A;  3VP1 A;  1PYY A;  2G2U A;  1AXB A;  4OPY A;  2E8I A;  4XXR A;  1YMX A;  3G4P A;  2ZQ8 A;  4MBK A;  3PAE A;  4WBG A;  4WM9 A;  1IEM A;  1MKI A;  2EX8 A;  3VP2 A;  2Y2M A;  5AQA A;  4E3O A;  4P6B A;  4DXC A;  2DNS A;  4NK3 A;  2IWD A;  4N1X A;  5DVA A;  2R9X A;  3G35 A;  3IF6 C;  1PWG A;  5CGS A;  5TFQ A;  3Q07 A;  4PMA A;  3V39 A;  1KGE A;  4R3J A;  3MZF A;  3ISG A;  5CTM A;  1BLP A;  3UPN A;  1XPB A;  3GQZ A;  2P9V A;  3C7V A;  3BFC A;  1MWR A;  4IVI A;  1RP5 A;  3EQU A;  3ZG9 B;  3OPR A;  4QD4 A;  3W4O A;  1ERM A;  1ZG4 A;  3C7U A;  3HUM A;  3ZFZ A;  1KVL A;  1LI9 A;  3ZVT A;  5EUA A;  4S2I A;  2Y55 A;  3N6I A;  4OPQ A;  3SS5 A;  3HLW A;  4UA6 A;  3N8L A;  2GDN A;  4UAA A;  4E6X A;  5HL1 A;  3GR2 A;  2ZM2 A;  4OQI A;  2ZQ7 A;  5HAR A;  4WMC A;  4DF6 A;  1TDL A;  1W79 A;  1YLJ A;  5HX9 A;  5M18 A;  1K4E A;  1IYP A;  1KDS A;  2Z2M B;  2HDR A;  4RX2 A;  4E3M A;  3VP3 A;  1WYB A;  2G2W A;  2ZD8 A;  1IEL A;  5G18 A;  4BL3 A;  4CPK A;  4S2K A;  3VOY A;  4HEF A;  4GB7 A;  1IYS A;  4XUX A;  4DDY A;  4FSF A;  3NI9 A;  5CED A;  4JXS A;  4N1H A;  4OQH A;  3OCL A;  1PWD A;  3NIA A;  4GDN A;  4GN2 A;  4JF5 A;  4PM9 A;  1L0F A;  4WZ5 A;  5GLA A;  5FQ9 A;  1GHI A;  3BFG A;  3N8R A;  3SH9 A;  3VP0 A;  4K0X A;  1LHY A;  4B4X A;  2J8Y A;  2XGN A;  2ZC6 B;  4UA9 A;  3OPL A;  1XXM A;  4RA7 A;  1FCN A;  3OPH A;  2RCX A;  5EVI B;  1MWS A;  1BLS A;  4X53 A;  2WAE A;  1FQG A;  4Z9Q A;  5EEC A;  1TVF A;  2HDS A;  3IH9 A;  4MNR A;  1XA1 A;  3ZDJ A;  2XK1 A;  3O3V A;  4JLF A;  5CEC A;  3SH8 A;  1HTZ A;  2OV5 A;  1S0W A;  1IKI A;  5A92 A;  2X02 A;  3IXG A;  4IBX A;  3ZVW A;  3GTC A;  4R4S A;  3Q7V B;  1CEG A;  1ONH A;  1K55 A;  2EXB A;  2H0T A;  3BFF A;  4KZ5 A;  2XQZ A;  5GHX A;  4BJP A;  5FDH A;  4ZTK A;  1ES3 A;  1SHV A;  4YFM A;  3RXX A;  1CK3 A;  2ZLY A;  5CHM A;  1C3B A;  1NYY A;  3HVF A;  1MWU A;  1BSG A;  4OVD A;  1YLP A;  2ZM0 A;  1FCO A;  3HL9 A;  2WGI A;  4JPM A;  3PBO A;  2C5W B;  1Q2Q A;  4ZJ3 A;  2WKH A;  5CGW A;  3UPP A;  5JYO A;  2WAF A;  5AQB A;  3IF6 B;  3V50 A;  3GVB A;  1M6K A;  4PM7 A;  2WAD A;  4WYY A;  3C4O A;  4U0X A;  3HLB A;  4KQO A;  3HBR A;  1JTD A;  4P0M A;  4OP5 A;  4S2P A;  4P85 A;  3CMZ A;  4OLG A;  4L0L A;  1K38 A;  5A90 A;  3ITA A;  1DY6 A;  1KE4 A;  1KGF A;  1PI4 A;  3BEB A;  3NCK A;  4GOG A;  4HBT A;  5EVI C;  4B88 A;  4CJN A;  3FYZ A;  4X6T A;  1WYC A;  2OLU A;  1YQS A;  2A3U A;  4GD6 A;  4X68 A;  2PU4 A;  3E2K A;  3A3D A;  5FQK A;  2B5R A;  5F82 A;  4JKT A;  1IKG A;  2Y2L A;  4BQM A;  4F94 A;  2BLS A;  3JYI A;  2R9W A;  3IHB A;  3IXD A;  3TG9 A;  2QMI A;  3Q82 A;  3UY6 A;  1O7E A;  3VP4 A;  3O86 A;  4QJG A;  2XFT A;  3BEC A;  4QHC A;  4PM5 A;  4LV1 A;  5DF9 A;  1GHP A;  2QPN A;  4OLD A;  5KSH A;  3BFD A;  1DJA A;  4S2N C;  3PTE A;  5FQQ A;  3DTM A;  3GMW A;  4DXB A;  3GV9 A;  4GDB A;  1G6A A;  1K4F A;  3PBQ A;  3PBS A;  3EQV A;  3W4Q A;  3P09 A;  4ZJ1 A;  3ZGA B;  4C6Y A;  1MWT A;  3LY4 A;  3V3R A;  1PW1 A;  5FA7 A;  5EPH A;  1RCJ A;  3S22 A;  2HP9 A;  2J7V A;  4FCF A;  5E2F A;  1QME A;  1YM1 A;  3BLS A;  4IBR A;  3RJU A;  1PW8 A;  3HLE A;  4KZB A;  3SS3 A;  3TOI A;  1KGG A;  1PZO A;  3A3F A;  3A3E A;  5CTN A;  5HFO A;  1MBL A;  4GKU A;  2ZC3 B;  1Q2P A;  3HUN A;  5AQ7 A;  5DTK A;  3QHY A;  1NY0 A;  1K6R A;  2ZQD A;  5FAS A;  2WYX A;  4JF6 A;  5CHJ A;  1L0G A;  3MXS A;  3BRM A;  3AGE A;  1BUL A;  1ERQ A;  3Q81 A;  1BUE A;  1LL9 A;  1JTG A;  1N4O A;  2WGW B;  4DE0 A;  2XD5 A;  5EVI D;  3RXW A;  4B4Z A;  2OLV A;  4Y0O A;  2Y2O A;  3VSL A;  1YLT A;  1JWP A;  3QNB A;  4QY5 A;  1JVJ A;  2PU2 A;  2Y2G A;  3PAG A;  3VSK A;  4N92 A;  1I2S A;  3G30 A;  3LY3 A;  1KE3 A;  1XP4 A;  4FD8 A;  4DKI A;  1I2W A;  2WKI A;  3O87 A;  3OPP A;  3CG5 A;  1WE4 A;  1MPL A;  4PPR A;  4E3J A;  5GLC A;  3NY4 A;  5J8X A;  4HES A;  3FWL A;  4U3T A;  3G2Z A;  3IF5 A;  1K54 C;  5AQ9 A;  3BM6 A;  2ZC7 A;  3IQA A;  5DTT A;  5CEB A;  5FAO A;  5GLB A;  1KVM A;  1RGZ A;  3MKE A;  4Y7P A;  4YIN A;  1PIO A;  1HZO A;  3E2L A;  5FAQ A;  5HW3 A;  5EE8 A;  4P87 A;  3PBR A;  4X69 A;  1LLB A;  1Y54 A;  5E2E A;  3GRJ A;  1K57 A;  2ZQC A;  3N7W A;  3NDE A;  5HAQ A;  2Y4A A;  1SDN A;  3M6B A;  3WS5 A;  1SKF A;  4DE3 A;  3IWO A;  1ESU A;  1FSW A;  1GA9 A;  4S2O A;  4EBN A;  5I94 A;  4FH4 A;  1MXO A;  5F1F A;  5KSC A;  1ES4 A;  4OON A;  3S1Y A;  3ZG8 B;  3PBT A;  4Q8I A;  5EOE A;  3ZG0 A;  4H8R A;  3G2Y A;  4OP8 A;  2H5S A;  4EWF A;  5KMW A;  2HP6 A;  3AGF A;  1XA7 A;  4EQI A;  1NRF A;  4GZB A;  4RVA A;  3WWX A;  2Y2P A;  1FSY A;  2JC7 A;  2EFX A;  5EVI A;  4DE2 A;  2XEP A;  4QY6 A;  4BLM A;  5HAI A;  1YT4 A;  1XGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...