4X56A

Structure of the class d beta-lactamase oxa-160 v130d in acyl-enzyme complex with ceftazidime
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
245
structure length
244
Chain Sequence
MHISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSADPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTSQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class D beta-lactamase OXA-160
publication title Structural Basis of Activity against Aztreonam and Extended Spectrum Cephalosporins for Two Carbapenem-Hydrolyzing Class D beta-Lactamases from Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 79
structure length 244
sequence length 245
ec nomenclature
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4x56A00
1M6KA 3VOZA 1K57C 1DY6A 1VM1A 5FQQA 1ES5A 3WS4A 5CHJA 4DE0A 2WUQA 2OLUA 2GDNA 4NK3A 4QY5A 3PBNA 5TGFA 5TR7A 3ZGAB 1DJBA 3G2ZA 4JF4A 4UA7A 4ZTKA 2ZLYA 1PI5A 1J9MA 2VGJA 1XA7A 2Y2OA 3MZFA 4KENB 4MBKA 4X53A 4ZBEA 1FSWA 5E2EA 5FAQA 3N8LA 5F82A 2PU4A 5HFOA 1QMFA 3ZG5A 3C7VA 5GLAA 5GLCA 5EECA 3SS5A 1PW1A 3Q07A 4LV0A 2Y2KA 2Y55A 1K55A 1ES2A 4OPRA 2DNSA 4JPMA 3PBSA 1K38A 1E3UA 1PZPA 3VFFA 4PPRA 5AQ9A 3WRZA 1N9BA 4F94A 1K4EA 2DCFA 1GA9A 1FR6A 2WGIA 2OLVA 3DWKA 2HDUA 3BRMA 3G35A 1ES3A 1GHIA 1E25A 5KSHA 2EX9A 2JCHA 3N8RA 2XH9A 4GB7A 2ZM0A 4GDBA 3IHBA 3ITAA 1K55C 4IEDA 4OLDA 2PBYA 2R9WA 3M6HA 4JXGA 2Y2LA 4RYEA 4QHCA 3E2KA 1NXYA 1RGZA 1FCOA 1MBLA 3BM6A 3ZNYA 2XFSA 3A3IA 3HVFA 4U0TA 3LO7A 4L0LA 3DTMA 1KGFA 3ZG8B 2ZQ9A 1AXBA 1IYSA 1MKIA 1K4FA 4OP8A 3M6BA 1LL5A 3IF5A 4JF5A 3UPPA 1NY0A 1FSYA 2IWCA 4DRTA 3O3VA 3Q7VB 4QB8A 1QMEA 1L0DA 2E8IA 2WKHA 2EX2A 5DVAA 1YLWA 2Z2MB 1G68A 1WYBA 3AGEA 1LL9A 5KMWA 4N1HA 1L2SA 5A92A 4JLFA 4WELA 3ZDJA 4QY6A 2WGVA 1XGIA 1MWTA 3V3RA 5D3OA 4OONA 3OZHA 4WBGA 3WS2A 4Q8IA 1BLPA 1JWZA 5FQJA 2HP6A 3VSKA 4X6TA 3IQAA 5DTSA 2EFUA 4PM7A 4WMCD 1NZOA 4KZ5A 1ERQA 4KQQA 5HAPA 3G32A 4OOYA 5CHMA 2XF3A 1BLSA 2J9OA 3OCLA 3CMZA 4OP5A 3WS0A 1C3BA 3BFEA 2C6WB 2XK1A 1SKFA 4FSFA 3MBZA 3QNCA 4C3QA 4PM9A 4C75A 5I94A 1NZUA 1EI5A 5GHYA 3RXWA 5FAPA 1PIOA 1RCJA 3WS1A 3NDGA 2QPNA 3UE1A 4JBFA 2Y2PA 3BLMA 5E2GA 4RVAA 3VFHA 4OKPA 3UE0A 3ZHHA 1BT5A 3UDXA 1BSGA 2R9XA 4C6YA 5FI2A 1ZG4A 2HDRA 2H5SA 3NBLA 2X01A 1GHPA 3HLDA 1XXMA 4DXCA 1K25A 2HDSA 2H0TA 3M2JA 4E3IA 1JTGA 4BENA 2HP5A 4OQGA 5EVIB 4R3JA 1LI0A 4UHUA 4U0XA 5DF8A 3LEZA 5E2HA 2WGWA 3NI9A 3CJMA 4DE1A 1E4DA 2WZZA 4UAAA 4DF6A 4OQIA 1PWCA 3W4QA 2A3UA 3GRJA 4GD6A 4N9LA 4R4RA 4P0MA 1YLYA 3VP0A 2FFFB 4P87A 3NCKA 3UPNA 3VP1A 1W5DA 2Y2QA 3SH7A 4D2OA 5GLBA 3ZNTA 3HREA 1BTLA 2P9VA 1HTZA 1G6AA 4BJPA 5GLDA 5AQAA 4BQMA 1ONGA 1PI4A 2Y4AA 3CG5A 3P09A 4P6BA 1ESUA 1IELA 4PM5A 4OQHA 1FOFA 2XGNA 3EQUA 1L0EA 3IF6A 3N8SA 4DE2A 4OOMA 1L0GA 4WEJA 2RCXA 3PBOA 5GHXA 4H8RA 3IXHA 4E3JA 3UNWA 2ZM8A 3Q81A 4DDSA 3HLEA 1S6RA 4JXVA 2ZC7A 1KE3A 5M19A 5CGXA 3VMAA 3ZVWA 1BLCA 1DJCA 1MPLA 5FQ9A 5G18A 1HD8A 4X56A 3IF6C 2Y2JA 5EUAA 3GR2A 5HARA 3UDIA 2X02A 2Y2MA 5M1AA 1XX2A 5IHVA 1GCEA 4FD8A 2QMIA 1W8YA 3EQVA 5EVID 3PAEA 4ZJ2A 2Q9MA 1TEMA 1PW8A 1IYOA 3BFDA 1XA1A 3BEBA 4PM8A 3WS5A 2XLNA 1HVBA 1IKGA 1PZOA 4Y0TA 4WMCA 3HLBA 4BD0A 1EROA 3SS3A 3IXDA 4LV2A 2ZC3B 4IVKA 5HAQA 4E3NA 3JYIA 3S1YA 2G2WA 3V50A 1I2WA 4R0QA 2PU2A 2EFXA 2OV5A 4FCFA 1XPBA 4QU3A 3LCEA 4E6WA 4GD8A 4FH4A 1K6RA 4E3LA 3LY4A 3BYDA 3CZDA 3Q1FA 3OC2A 1K54A 4EUZA 3HUMA 1BLHA 2H0YA 4OPQA 1NYMA 5EOOA 3IT9A 1YQSA 2JC7A 3E2LA 2JBFA 5F83A 1WYCA 2XD1A 1ES4A 3HBRA 3ZG9B 4QJGA 5F1FA 2ZC6B 5CTNA 5CERA 1L0FA 4IBXA 1W8QA 3IWOA 2WZXA 3SH8A 3Q7VA 4HEFA 4KZ3A 4R3BA 3V39A 3UY6A 1ZKJA 1EWZA 3RXXA 4DE3A 1K54C 3UDFA 1Q2QA 1H8YA 2RL3A 4LCMA 5FA7A 3UE3A 4RA7A 1GA0A 4X69A 5AQ7A 2WYXA 4LV3A 3NY4A 4WZ5A 4JF6A 4MNRA 1Z6FA 4OPZA 4U3TA 2V1ZA 4R23A 4EQIA 1PWGA 4ZJ3A 3M2KA 2EX8A 5CRFA 2I72A 4OOLA 3TOIA 4E3MA 1NRFA 4N9KA 4EBPA 2J8YA 1FCNA 1JWPA 3GVBA 3OPHA 4KZAA 2C5WB 1MWRA 4A5RA 3IHAA 2J9PA 4KG5A 5A91A 2FFYA 3MXSA 3MFDA 4S2IA 4WZ5C 3HLFA 4YINA 4B4XA 1OMEA 4M3KA 5GHZA 1N4OA 5FATA 3DWZA 5EPHA 2XFTA 1W7FA 3BLSA 3SOIA 4S2OA 3BFGA 4XXRA 5CGSA 3PBRA 3HUNA 4MBFA 2ZJ9A 4ZJ1A 3OPRA 4S2JA 1FQGA 1Q2PA 1SCWA 3I7JA 4HESA 1ZG6A 4X68A 1KE4A 4Z9QA 3PBQA 1LI9A 4E3OA 4NETA 2ZC4B 1O7EA 3NDEA 1YLPA 3BECA 2XD5A 3IWIA 3A3DA 4GDNA 4N1XA 4BLMA 2EX6A 2Y2GA 3MZDA 5HAIA 4CPKA 3FKVA 3N4IA 1KDWA 4ID4A 4LV1A 1WE4A 2XR0A 3VSLA 2WAEA 3MZEA 1K56D 5EVIA 3V3SA 2Y91A 4GOGA 2Z2LB 3NC8A 1CI8A 2WAFA 4FH2A 2IWDA 1PYYA 1XGJA 3DW0A 2ZQCA 2HP9A 5DTTA 1KVLA 5U47A 3O87A 2EXAA 4BL3A 3UPOA 2ZD8A 2ZMAA 5FDHA 1JVJA 2Y59A 1NYYA 5CTMA 5DF9A 3O88A 1TDLA 4QD4A 4GNUA 2WGWB 4UA9A 5FASA 4WEKA 5EVIC 1KE0A 3ZFZA 4BD1A 4OH0A 1MWUA 1Y54A 4EBLA 1H5XA 2ZQ7A 4S2LA 5F1GA 3A3EA 2J7VA 3ITBA 4P85A 3ZCZA 3GSGA 4MBHA 5E2FA 3V5MA 3W4OA 4K0WA 2WKEA 2P9VB 1YT4A 1GHMA 1RGYA 2ZQAA 1NJ4A 3PTEA 3P98A 2BLSA 1SHVA 2BG1A 2H10A 4K0XA 2HDQA 3A3FA 3IF6B 5EE8A 1VQQA 2XDMA 3N6IA 1JTDA 3UO9A 3B3XA 3TG9A 3WRTA 3FZCA 1FCMA 4Y0OA 1LLBA 2WK0A 3C4PA 1SDNA 1KGGA 4LCLA 4Y0UA 1I5QA 1IYPA 1I2SA 4KZ9A 1IYQA 3IWQA 5E43A 5L2FA 3N7WA 3OPLA 4MLLA 4KZ4A 2V2FF 4GN2A 1CK3A 1KDSA 1YLTA 4S2MA 3SS4A 4PM6A 4IBRA 4IVIA 4B4ZA 5HW3A 5CHUA 1BZAA 1RP5A 2ZM2A 1XKZA 1K6SA 5FSRA 4S2NA 4ZAMA 3MKEA 4MEZA 3NIAA 3TSGA 2JE5A 3QHYA 4R1GA 1MY8A 4KZ7A 3G2YA 4PMAA 3O86A 5J8XA 4KG6A 3IXBA 4KZ8A 4JKTA 1LHYA 3AGFA 3RJUA 3HUOA 4WM9A 3HLGA 3S4XA 4RX3A 4YFMA 3OCNA 3G30A 5FQKA 2Q9NA 4S2NC 4XUXA 5HX9A 2WADA 4XUZA 4JXSA 4KQOA 3VP4A 1YMXA 5GL9A 4R4SA 5KZHA 5FAOA 3W4PA 3IH8A 3GTCA 3SH9A 4E3KA 4RX2A 4K91A 5A90A 4WZ4A 3C4OA 4WYYA 2B5RA 1W79A 4DXBA 4CJNA 3ZG7B 3Q7ZA 2DRWA 1S0WA 1K56A 4OVDA 1IKIA 5FQIA 1TDGA 2OSUA 3GV9A 4OPYA 5CEDA 3AGDA 1DJAA 3A3JA 2X71A 1ALQA 3C5AA 3BFFA 1MWSA 4LENA 2UWXA 4OQ0A 1ONHA 3UN7A 5BOHA 2EXBA 1BUEA 3IH9A 1PWDA 1XP4A 3GMWA 3VOYA 1CEGA 1U60A 1ZC2A 2XEPA 1E3UD 2WKIA 2Y2IA 1H8ZA 3D4FA 3FV7A 3W8KA 3C7UA 4UA6A 5M18A 1TVFA 2IWBA 3VP3A 4HBTA 2XQZA 2G2UA 3GQZA 3BFCA 4S2PA 3PBTA 4EV4A 4BL2A 5CECA 1ESIA 3MKFA 4O7DA 2VGKA 3ISGA 4EWFA 3IXGA 1YMSA 2P74A 3G31A 4GKUA 4HBUA 3G4PA 3MXRA 3PAGA 5CXWA 4EBNA 5AQBA 4ZDXA 5CEBA 1KVMA 2QZ6A 4Y7PA 3HLCA 5KSCA 4JXWA 5FQMA 4X55A 3OPPA 1ERMA 1CI9A 3HLWA 1YM1A 3LY3A 4KQRA 4B88A 1FR1A 2A49A 3ZG0A 5EOEA 2ZC5B 2Y2HA 2V20A 3Q82A 5A93A 4N92A 3HL9A 3VP2A 1SDEA 1M40A 2CC1A 4OLGA 4E6XA 3QNBA 1BULA 5FI7A 1MXOA 4GZBA 4DKIA 1O07A 4KG2A 1K57A 5HL1A 1IEMA 1YLJA 5JYOA 3FWLA 5DF7A 5EVLA 3FYZA 1JWVA 1CEFA 2ZQDA 4KZBA 4S2KA 4KZ6A 5CGWA 5TFQA 3WWXA 1KGEA 2ZQ8A 3S22A 3ZVTA 4DDYA 2HPBA 3G34A 1YLZA 5JYPA 1HZOA 5FI6A 5DTKA 2Y2NA 3FKWA
chains in the Genus database with same CATH superfamily
1K0KA 1M6KA 3R4KA 1DY6A 1VM1A 1LT0A 2GDNA 3PBNA 3ZGAB 1DJBA 2I9VA 2VLGA 4EESA 2FH5A 4UA7A 1J9MA 4LPZA 4MBKA 1SKOB 4X53A 5E2EA 5HWWA 3N8LA 3ZG5A 3C7VA 5GLCA 2Y55A 3OBFA 3VOLA 4JPMA 1E3UA 5AQ9A 2W3EA 2DCFA 3LGOA 3IBRA 2HV1A 2JCHA 2XH9A 2ZM0A 2PBYA 2Y2LA 1NXYA 2QYBA 3MQQA 4EUVA 2D01A 3T4SA 2W1TB 1LL5A 3HJKA 3IF5A 1DP6A 4QB8A 2E8IA 5DVAA 2EX2A 1YLWA 4N1HA 5A92A 1D06A 4H6JA 4WELA 1MWTA 2VGLM 3V3RA 4OONA 2J3TC 1JWZA 4B93A 1ZHHB 5FQJA 3R7WB 5DTSA 3QP6A 3MQOA 4WMCD 1YPRA 2XF3A 1BLSA 3OCLA 2C6WB 2XK1A 1SKFA 1NZUA 1EI5A 2QPNA 4RQ9A 5HDDA 2GJ3A 3UE0A 1BT5A 2R9XA 3NBLA 1GHPA 1K25A 2HDSA 2H0TA 2ZOIA 2PR6A 2QHKA 4R38A 5G4YA 3D9YA 4CLCC 5K5BA 4UHUA 4X25A 3BQ8A 3PXPA 4DF6A 1PWCA 3W4QA 4II7A 2FFFB 4P87A 3NCKA 3UPNA 2Y2QA 2ZOHA 5GLBA 3ZNTA 4Q0IA 1BTLA 1G6AA 4L9GA 2Y4AA 4P6BA 1P0ZA 2XGNA 3EQUA 3IF6A 3N8SA 4DE2A 4OOMA 4WEJA 4E3JA 1SZVA 3QP5A 2PD8A 3CWFA 3VMAA 4ETXA 1HD8A 3JPUA 5HARA 2X02A 4XT2A 3EQVA 4FTXA 3PYPA 1PW8A 1S1ZA 2VV8A 4EEUA 3BFDA 3BJNA 4GS9A 2ZMFA 4Y0TA 1OJ5A 1PRQA 3IXDA 2ZC3B 4IVKA 4B9OA 4R0QA 1VEUA 3LY4A 3BYDA 2H0YA 4OPQA 2W3GA 3F1OB 2JBFA 3CPTA 5F83A 3ZG9B 5F1FA 2ZC6B 3CAXA 5CTNA 3DTKA 1L0FA 3LFVA 1W8QA 4EQ1A 4GJ4A 3Q7VA 3IX3A 3UY6A 1EWZA 3RXXA 3NOPC 3UDFA 4LCMA 3UE3A 4X69A 2WYXA 4LV3A 2VK3A 1Z6FA 2V1ZA 3M2KA 5CRFA 2I72A 2L4RA 4E3MA 1NRFA 4EBPA 1KOUA 4H6JB 1V9ZA 1XJ4A 2C5WB 5A91A 3MXSA 4YINA 5AVFA 1OMEA 4M3KA 4DMZA 5GHZA 5EPHA 3BLSA 3SOIA 2VJWA 5J7EA 3PBRA 4HP9A 3GDIA 4HI4A 1SCWA 3F1PB 4R6LA 3PBQA 4E3OA 3LEQA 3NDEA 1YLPA 2Y79A 4N1XA 4BLMA 2EX6A 4CPKA 1KDWA 4ID4A 4LV1A 2XR0A 2WAEA 3V3SA 5FEGA 3KX0X 3NC8A 1CI8A 4FH2A 2ZQCA 5DTTA 3O87A 4BMWA 2ZMAA 5C5KA 1NYYA 4QD4A 4UA9A 1W63Q 3ZFZA 4BD1A 1P9WA 1Y54A 4Y13A 3A3EA 3ITBA 4P85A 3GSGA 3V5MA 3V67A 2W1RA 4LRYC 4PHTA 2ZQAA 2H10A 3IF6B 4ARZB 4O8GA 1JTDA 3WRTA 1LLBA 4GLQA 5L2FA 2O9BA 5E43A 4L9EA 4MLLA 4KZ4A 4IBRA 4IVIA 5CHUA 1BZAA 1RP5A 2ZM2A 5FSRA 4KZ7A 4GS9B 4WM9A 3OCNA 3G30A 5FQKA 2Q9NA 3KSIA 3LR4A 1FILA 3VP4A 5FAOA 3IH8A 1T1AA 3NOTC 4E3KA 3C4OA 4WYYA 2B5RA 2VV6A 2JKGA 4JGQA 4OVDA 5FQIA 1DRMA 1F5MA 4YWZA 1MWSA 4LENA 1ONHA 5DKKA 5BOHA 4EEPA 1BUEA 1CEGA 3W8KA 1TVFA 4HIAA 4UEYA 3VP3A 2CMNA 3GQZA 2ZMVA 4S2PA 4BL2A 1ESIA 2W27A 3G31A 4HBUA 4F3LB 5CXWA 5AQBA 4PAUA 5CEBA 1MC0A 4Y7PA 3UB9A 4B88A 3HLWA 3LY3A 1FR1A 2A49A 5EOEA 3C8CA 2ZC5B 2Y2HA 1IOUA 3Q82A 4N92A 2LB9A 1M40A 2ZL1B 2Z6CA 4CLCE 3MS6A 1IEMA 1YLJA 2VA0A 3ICYA 3FYZA 5CGWA 2ZQ8A 3ZVTA 5L8MA 3EGXC 3VOZA 4EETB 5CHJA 2WUQA 5TGFA 5TR7A 3G2ZA 4ZTKA 3OLOA 1OT9A 2Y2OA 5I5LA 1L3LA 4ZBEA 1FSWA 5HFOA 2VV7A 2GNXA 5EECA 3SS5A 2Y2KA 1K55A 3SZTA 2MJ6A 1K38A 3F1NB 3TRCA 2P7JA 2XA7S 3WRZA 4MCWA 1FR6A 3QP2A 2B18A 2OLVA 3BRMA 1GHIA 2EX9A 4GB7A 4DJ2A 5EFWA 4OLDA 1T19A 3PR6A 3K3CA 3E2KA 1FCOA 1TD5A 4U0TA 2ZQ9A 1AXBA 2Q0OA 1K4FA 1FSYA 4DRTA 1QMEA 1L0DA 4MMNA 2WKHA 2Z2MB 1GSVA 1G68A 3DAVA 4WL9A 5KMWA 3ZDJA 4QY6A 2P08A 1YSPA 3WS2A 1F98A 4WLAA 3SW1A 1BLPA 3VSKA 3IQAA 2O9AA 1STZA 3LR3A 5HAPA 4OOYA 5LBRA 3CMZA 4OP5A 1C3BA 3BFEA 2G7UA 4C3QA 3QNCA 3RXWA 2V0UA 1PIOA 3TE8A 5E2GA 3VFHA 4OKPA 5AJGA 4PKYA 3T1SA 5FI2A 3DTIA 2H5SA 4DXCA 3BY9A 1VB6A 5L07A 1JTGA 5EVIB 3KYZA 3LEZA 2WGWA 1E4DA 2VX8A 3MFXA 4OQIA 2A3UA 3C38A 4N9LA 3VP0A 1YLYA 3SH7A 3G6OA 1NLZA 4FOFA 2P9VA 1ZTUA 4BJPA 4BQMA 5AQAA 1PI4A 3P09A 1IELA 3LUQA 5G4ZA 1UGUA 1ACFA 2O99A 1N9OA 1L0GA 2RCXA 5GHXA 3IXHA 2QJ5A 3Q81A 4DDSA 3P01A 2ZC7A 4JGRA 3W2ZA 3ZVWA 1MPLA 2W3FA 4X56A 5HDSA 2Y2JA 3GR2A 1OTIA 1XX2A 2A2LA 2P04A 5IHVA 4FUWA 4FD8A 2QMIA 5EVID 3PAEA 4ZJ2A 1TEMA 1IYOA 1XA1A 3BEBA 3WS5A 1D1JA 1IKGA 4BD0A 3SS3A 4Y17A 4LV2A 4WF0A 5HAQA 4E3NA 2G2WA 2PU2A 2JHEA 1XPBA 4QU3A 3LCEA 4GD8A 1VETA 3Q1FA 3OC2A 1K54A 1BLHA 3KYEA 5EOOA 1LSVA 1YQSA 3E2LA 3HBRA 2WKQA 2WKPA 5CERA 3OOVA 3E0YA 4IBXA 2WZXA 3SH8A 3C2WA 4HEFA 4KZ3A 5CX7A 3V39A 3UMEA 2RL3A 4RA7A 3A0SA 3NY4A 3NULA 4R23A 1PNEA 3T4QA 1Y28A 4OOLA 4N9KA 2ZBBA 4MN6A 3OPHA 4HP4A 4A5RA 3IHAA 4G3WA 5TBMA 3CI6A 5TJJA 4S2IA 3MFDA 4WZ5C 3HLFA 4B4XA 2VEAA 2EWVA 3BFGA 3HUNA 2ZJ9A 3OPRA 4S2JA 1Q2PA 3NHQA 3MXQA 5HD5A 1O7EA 2XD5A 1TS6A 3A3DA 2Y2GA 3CUEC 5HAIA 3MZEA 1K56D 5HWVA 1XJ2A 2Y91A 3DW0A 3LIAA 1NRJA 5U47A 3UPOA 3T4LA 3K2NA 5CTMA 1JVJA 2Y59A 4MN7A 3O88A 1TDLA 2WGWB 5FASA 5EVIC 4OH0A 1MWUA 3KSFA 3ZCZA 4ME4A 3W4OA 2ACGA 2WKEA 2P9VB 2XA7M 2A24A 1SHVA 2BG1A 3A3FA 2XDMA 3LR5A 3N6IA 4Q0JA 4BWIA 4EERA 5FL3A 3UO9A 2PT7A 3C4PA 3D72A 4Y0UA 1KGGA 1IYPA 1TS8A 4KZ9A 3OPLA 1CK3A 3SS4A 5HW3A 4X1LA 4ZAMA 3TSGA 2JKFA 3QHYA 3G2YA 4PMAA 3O86A 2OWHA 4KG6A 5J8XA 1LHYA 3AGFA 3MJQA 3S4XA 3VE4A 4S2NC 3TW8A 4R4SA 5KZHA 3SH9A 4KQDA 1D7EA 4DXBA 3ZG7B 3Q7ZA 2OWJA 2DRWA 4EW7A 1IKIA 3GV9A 4OPYA 4HJ4A 3BQAA 3C5AA 2JN7A 2EXBA 3IH9A 3GMWA 3VOYA 1TF1A 1ZC2A 1E3UD 3NOUC 4HBTA 1S4RA 2AVXA 2VGKA 3ISGA 4EWFA 1YMSA 3MXRA 4EBNA 1XFNA 4ZDXA 2QZ6A 2V1BA 5FQMA 3DTEA 1YM1A 5DJUA 5A93A 3MSHA 3VP2A 1NLYA 1SDEA 4OLGA 4NKPA 1BULA 5FI7A 4DKIA 5JYOA 3FWLA 3LIFA 1KGEA 1IFQA 3G34A 5JYPA 2K7SA 5FI6A 3FKWA 3LIEA 1K57C 4GCZA 5FQQA 3EWKA 3WS4A 2OLUA 4NK3A 4QY5A 1TS0A 2Z6DA 2O9CA 3PHYA 5F69A 4JF4A 3O5YA 2ZLYA 1PI5A 2VGJA 3T1RA 4WN5A 5F82A 2PU4A 4ESPA 1OTEA 4XT2B 4LV0A 2M7UA 4IUKA 4OPRA 1T18A 3FG8A 3PBSA 1PZPA 3VFFA 4PPRA 3U2AA 4F94A 1N9BA 1GA9A 2UV0E 2WGIA 5HZHA 2HDUA 3H82A 3IX8A 3CLOA 3G35A 2M1CA 1E25A 5KSHA 3IHBA 1VEUB 3ITAA 4IEDA 1XJ6A 3M6HA 4RYEA 1RGZA 1G28A 3BM6A 3ZNYA 3E4QA 3LO7A 3CPTB 3ZG8B 1KGFA 2V8CA 4OP8A 4MDZA 3M6BA 4JF5A 4DN0A 1NY0A 2IWCA 3O3VA 3Q7VB 1X0OA 4E04A 3IS2A 1LL9A 3LR0A 4WBGA 3UMDA 5L10A 4Q8IA 2HP6A 4X6TA 3BWLA 4PM7A 1NZOA 3BW6A 4KZ5A 4G3KA 3G32A 3NJAA 3MBZA 5GHYA 3T50A 3UE1A 3A0VA 3HJIA 2Y2PA 3BLMA 4RVAA 4CLCA 1BSGA 3IX4A 1ZG4A 2HDRA 2X01A 1XXMA 4R3AA 3H7WA 3M2JA 4IHQA 4NXGA 4KUKA 4YNRA 5DF8A 3NI9A 3CJMA 2WZZA 4R70A 3S7QA 2FZ0A 4D2OA 1ONGA 3CG5A 2YKFA 1GSWA 2QWSA 4LRZE 3PBOA 3UNWA 1S6RA 4JXVA 1KE3A 5M19A 1BLCA 5G18A 2Y8HA 1SKOA 1G6OA 1F2KA 3IF6C 5EUAA 3UDIA 5M1AA 1H8MA 2HZ5A 1GCEA 5HPFA 2KDKA 1W8YA 3LYXA 4YOFA 2K31A 1HVBA 4WMCA 3HLBA 4Y5FA 4DJ3A 3JYIA 3S1YA 3V50A 1OTBA 4HH3A 1VHMA 4QPRA 4EUZA 3HUMA 1NYMA 3IT9A 2JC7A 1WYCA 2XD1A 1ES4A 2W3HA 4QJGA 2W1TA 1EW0A 3IWOA 4I39A 4DE3A 1T1BA 1Q2QA 5HL6A 5FA7A 5AQ7A 1GA0A 3QP1A 2J80A 4JF6A 4MNRA 4OPZA 4U3TA 2BTFP 4EQIA 2PYPA 1PWGA 2EX8A 3IS2B 4Y2FA 4EU0A 4D60A 3H9WA 4Z1WA 2KOIA 2KLIA 3IBJA 4KZAA 1MWRA 2J9PA 2BASA 3E4OA 4UQIS 5J3WA 2XFTA 4S2OA 5CGSA 2V1AA 4MBFA 1FQGA 3I7JA 1ZG6A 4Z9QA 1LI9A 3T4JA 4NETA 2ZC4B 3BECA 4BBVA 4GDNA 4CLCB 5MC7A 1WE4A 1YKDA 2J3TD 3T4KA 2WAFA 2IWDA 1XGJA 2HP9A 1BYWA 4M4XA 2EXAA 4HOIA 1Z09A 4BL3A 1LL8A 2ZD8A 2XRNA 5FDHA 1CF0A 1LSXA 2V9AA 4NXBA 1KE0A 3EEAA 4EBLA 1H5XA 2PBDP 1S4SA 4NEED 2J7VA 3KSGA 4MBHA 2V0WA 4K0WA 3NECA 1GHMA 1RGYA 1NJ4A 3JVUA 3PTEA 3P98A 5F68A 3B42A 4K0XA 4L9FA 2HDQA 4K08A 3TG9A 3FZCA 1FCMA 4HQAA 2WK0A 4CLCD 4WUJA 2L1MA 3IWQA 3N7WA 4S2MA 3EOIA 5HD3A 1YLTA 4EXOA 2W3DA 1K6SA 3B33A 2W0NA 3S7PA 2EWWA 2JE5A 4IUHA 3IXBA 4JKTA 3HUOA 3HLGA 4RX3A 1OPXA 2KX6A 4HY8A 4XUXA 2WADA 3F1OA 3DBAA 2PHYA 3MF0A 4ETZA 4I3JA 5HSQA 3GTCA 1DP9A 4RX2A 4K91A 5A90A 1W79A 4CJNA 5F5YA 4Y15A 1TDGA 2OSUA 3K3DA 3AGDA 4MN5A 1DJAA 3ZQ5A 4G3VA 1ALQA 1W63M 4OQ0A 3UN7A 2HJEA 2EA9A 1PWDA 1XP4A 2XEPA 1Y4OA 2WKIA 2Y2IA 5EM0A 1H8ZA 3FV7A 5M18A 4UA6A 2O0YA 2IWBA 2G2UA 4IJGA 4O7DA 3IXGA 4X1MA 1JNUA 4GKUA 1G5UA 3F1PA 1UWPX 3PAGA 3UB7A 3C30A 3GECA 3HLCA 3D3OA 1OJGA 4JXWA 5KSCA 5FDSA 1CI9A 3ZG0A 3JVVA 2V20A 3T4OA 1OTDA 2CC1A 4E6XA 3QNBA 2XROA 1V9YA 1MXOA 4GZBA 4KG2A 3E4PA 2B95A 5EVLA 4KZBA 1CEFA 5TFQA 4S2KA 2H28A 3S22A 4DDYA 2DMWA 2HPBA 1YLZA 1HZOA 5DTKA 5KIZA 2LB5A 1ES5A 4DE0A 2JKTM 1MZUA 5DJTA 4I5SA 4ARZA 1XA7A 3MZFA 4KENB 5L09A 4P6ZS 1NWZA 5FAQA 1QMFA 5GLAA 1HLUP 1PW1A 3Q07A 3T12B 4HJ6A 1ES2A 3LI8A 5EV0A 2DNSA 1K4EA 1AWIA 2PD7A 3DWKA 1ES3A 3P7NA 3N8RA 4GDBA 2VKSA 1K55C 3FPVA 2R9WA 1VETB 3UB5P 3UB8A 4JXGA 4QHCA 4ZRRA 3VE3A 1MBLA 2XFSA 2WKRA 3A3IA 3HVFA 4L0LA 3MMHA 3DTMA 1IYSA 1MKIA 4UQIM 3UPPA 1XFQA 1WYBA 3AGEA 2D02A 3FC7A 1DP8A 1N9LA 1L2SA 1XJ3A 1S1YA 2V8FA 3A0RA 4JLFA 2WGVA 1XGIA 5D3OA 3OZHA 1A0KA 3T1XA 3L7HA 1ODVA 1H3QA 2EFUA 2GX5A 3L9KA 1ERQA 4KQQA 4QWOA 5TBMB 5CHMA 1OT6A 2J9OA 3MR0A 3WS0A 4FSFA 5I94A 4C75A 4PM9A 4F3LA 5FAPA 1RCJA 3WS1A 3NDGA 2PR5A 4JBFA 3EGDC 5FEFA 3ZHHA 2J3WA 3UDXA 4C6YA 2JKRM 3HLDA 1UWNX 4O01A 4E3IA 2QKPA 2ZL1A 4BENA 2HP5A 4OQGA 3MQ0A 4I3AA 4R3JA 1LI0A 1CQAA 4U0XA 5IU1A 2PYRA 5E2HA 4DE1A 1TS7A 4UAAA 3GRJA 4GD6A 4R4RA 1J3WA 1YAXA 4P0MA 4CQHA 2IA2A 1S66L 3KSHA 3VP1A 3TJZC 1W5DA 2M7VA 1PFLA 3HREA 1HTZA 5GLDA 1ESUA 4PM5A 4OQHA 5DFXA 1FOFA 1L0EA 3RTYA 4H8RA 1FIKA 2ZM8A 3HLEA 2A24B 5CGXA 1DJCA 3CHWP 5FQ9A 2E8JA 2Y2MA 4GHIA 2Q9MA 4JGOA 3LIDA 4Q0HA 3F1NA 4PM8A 2XLNA 1PZOA 1EROA 3ZYTA 1I2WA 2EFXA 2OV5A 4FCFA 3UE6A 4E6WA 4FH4A 1K6RA 4NG2A 4E3LA 2PAVP 3CZDA 1WA9A 1F9IA 3T4TA 5EM1A 3S7NA 1P9RA 4HNBA 4HH2A 4HHDA 4LRXC 2OAP1 5HPIA 4R3BA 1ZKJA 4JGPA 1K54C 1H8YA 4WZ5A 4I3IA 4ZJ3A 2OOLA 3KO6A 3TOIA 2J8YA 1FCNA 1JWPA 1YSQA 3GVBA 4KG5A 2FFYA 4Y3IA 3BY8A 1N4OA 5FATA 3DWZA 1W7FA 3CUEA 4XXRA 4NXEA 4ZJ1A 4LGWA 4HESA 1OTAA 2QJ7A 4X68A 1KE4A 3ULFA 2VGLS 1S67L 3IWIA 3S7OA 3LI9A 4LFUA 3CITA 2NUTC 3MZDA 3FKVA 3N4IA 4GW9A 3VSLA 5EVIA 4GOGA 2Z2LB 2NUPC 1PYYA 1KVLA 3EEHA 4HJ3A 2PRFA 2INWA 2OAQ1 2YKHA 5DF9A 3VV4A 4GNUA 5DKLA 4P6ZM 4WEKA 2JKTI 5EVEA 3UB6A 2ZQ7A 1GSXA 3QP8A 4S2LA 5F1GA 1T1CA 3U4LP 5E2FA 4BBUA 3RH8B 1YT4A 2BLSA 1LSWA 3B47A 5EE8A 2XSSA 1VQQA 3B3XA 4LLOB 4Y0OA 5HWTA 3FPWA 1SDNA 4LCLA 2L0WA 1I2SA 1I5QA 5J4EA 1IYQA 2V2FF 4GN2A 1KDSA 4PM6A 3LICA 4B4ZA 2HGVA 2R78A 1XKZA 4S2NA 3MKEA 4MEZA 3NIAA 4GHIB 4R1GA 4KUOA 1MY8A 1P97A 5AVEA 4KZ8A 3H82B 4O0PA 3RJUA 3LIBA 4YFMA 3KYQA 5HX9A 4XUZA 3RFBA 4JXSA 4KQOA 5A8BA 5DFYA 4AFIA 1YMXA 5GL9A 3W4PA 5IS1A 4WZ4A 4NXFA 1S0WA 1K56A 5F6AA 5CEDA 4PKYG 3T1QB 1MKMA 3A3JA 2X71A 3R7WA 4I38A 3BFFA 2UWXA 2K2NA 4BBTA 1H0MA 1U60A 3QP4A 3D4FA 3C7UA 2XQZA 3BFCA 4EV4A 3PBTA 2JKRI 5HDCA 5CECA 2VZWA 3MKFA 2P74A 3E98A 3G4PA 1N9NA 2HJ9C 2GZAA 1KVMA 2PDRA 4X55A 3OPPA 1ERMA 4KQRA 2HF6A 3H7WB 3HL9A 2B02A 1O07A 5IT5A 1K57A 5HL1A 5DF7A 1JWVA 2ZQDA 3HCYA 3WWXA 4KZ6A 1CJFA 2Y2NA
chains in the Genus database with same CATH topology
1M6KA 3VOZA 1K57C 1DY6A 1VM1A 5FQQA 1ES5A 3WS4A 5CHJA 4DE0A 2WUQA 2OLUA 2GDNA 4NK3A 4QY5A 3PBNA 5TGFA 5TR7A 3ZGAB 1DJBA 3G2ZA 4JF4A 4UA7A 4ZTKA 2ZLYA 1PI5A 1J9MA 2VGJA 1XA7A 2Y2OA 3MZFA 4KENB 4MBKA 4X53A 4ZBEA 1FSWA 5E2EA 5FAQA 3N8LA 5F82A 2PU4A 5HFOA 1QMFA 3ZG5A 3C7VA 5GLAA 5GLCA 5EECA 3SS5A 1PW1A 3Q07A 4LV0A 2Y2KA 2Y55A 1K55A 1ES2A 4OPRA 2DNSA 4JPMA 3PBSA 1K38A 1E3UA 1PZPA 3VFFA 4PPRA 5AQ9A 3WRZA 1N9BA 4F94A 1K4EA 2DCFA 1GA9A 1FR6A 2WGIA 2OLVA 3DWKA 2HDUA 3BRMA 3G35A 1ES3A 1GHIA 1E25A 5KSHA 2EX9A 2JCHA 3N8RA 2XH9A 4GB7A 2ZM0A 4GDBA 3IHBA 3ITAA 1K55C 4IEDA 4OLDA 2PBYA 2R9WA 3M6HA 4JXGA 2Y2LA 4RYEA 4QHCA 3E2KA 1NXYA 1RGZA 1FCOA 1MBLA 3BM6A 3ZNYA 2XFSA 3A3IA 3HVFA 4U0TA 3LO7A 4L0LA 3DTMA 1KGFA 3ZG8B 2ZQ9A 1AXBA 1IYSA 1MKIA 1K4FA 4OP8A 3M6BA 1LL5A 3IF5A 4JF5A 3UPPA 1NY0A 1FSYA 2IWCA 4DRTA 3O3VA 3Q7VB 4QB8A 1QMEA 1L0DA 2E8IA 2WKHA 2EX2A 5DVAA 1YLWA 2Z2MB 1G68A 1WYBA 3AGEA 1LL9A 5KMWA 4N1HA 1L2SA 5A92A 4JLFA 4WELA 3ZDJA 4QY6A 2WGVA 1XGIA 1MWTA 3V3RA 5D3OA 4OONA 3OZHA 4WBGA 3WS2A 4Q8IA 1BLPA 1JWZA 5FQJA 2HP6A 3VSKA 4X6TA 3IQAA 5DTSA 2EFUA 4PM7A 4WMCD 1NZOA 4KZ5A 1ERQA 4KQQA 5HAPA 3G32A 4OOYA 5CHMA 2XF3A 1BLSA 2J9OA 3OCLA 3CMZA 4OP5A 3WS0A 1C3BA 3BFEA 2C6WB 2XK1A 1SKFA 4FSFA 3MBZA 3QNCA 4C3QA 4PM9A 4C75A 5I94A 1NZUA 1EI5A 5GHYA 3RXWA 5FAPA 1PIOA 1RCJA 3WS1A 3NDGA 2QPNA 3UE1A 4JBFA 2Y2PA 3BLMA 5E2GA 4RVAA 3VFHA 4OKPA 3UE0A 3ZHHA 1BT5A 3UDXA 1BSGA 2R9XA 4C6YA 5FI2A 1ZG4A 2HDRA 2H5SA 3NBLA 2X01A 1GHPA 3HLDA 1XXMA 4DXCA 1K25A 2HDSA 2H0TA 3M2JA 4E3IA 1JTGA 4BENA 2HP5A 4OQGA 5EVIB 4R3JA 1LI0A 4UHUA 4U0XA 5DF8A 3LEZA 5E2HA 2WGWA 3NI9A 3CJMA 4DE1A 1E4DA 2WZZA 4UAAA 4DF6A 4OQIA 1PWCA 3W4QA 2A3UA 3GRJA 4GD6A 4N9LA 4R4RA 4P0MA 1YLYA 3VP0A 2FFFB 4P87A 3NCKA 3UPNA 3VP1A 1W5DA 2Y2QA 3SH7A 4D2OA 5GLBA 3ZNTA 3HREA 1BTLA 2P9VA 1HTZA 1G6AA 4BJPA 5GLDA 5AQAA 4BQMA 1ONGA 1PI4A 2Y4AA 3CG5A 3P09A 4P6BA 1ESUA 1IELA 4PM5A 4OQHA 1FOFA 2XGNA 3EQUA 1L0EA 3IF6A 3N8SA 4DE2A 4OOMA 1L0GA 4WEJA 2RCXA 3PBOA 5GHXA 4H8RA 3IXHA 4E3JA 3UNWA 2ZM8A 3Q81A 4DDSA 3HLEA 1S6RA 4JXVA 2ZC7A 1KE3A 5M19A 5CGXA 3VMAA 3ZVWA 1BLCA 1DJCA 1MPLA 5FQ9A 5G18A 1HD8A 4X56A 3IF6C 2Y2JA 5EUAA 3GR2A 5HARA 3UDIA 2X02A 2Y2MA 5M1AA 1XX2A 5IHVA 1GCEA 4FD8A 2QMIA 1W8YA 3EQVA 5EVID 3PAEA 4ZJ2A 2Q9MA 1TEMA 1PW8A 1IYOA 3BFDA 1XA1A 3BEBA 4PM8A 3WS5A 2XLNA 1HVBA 1IKGA 1PZOA 4Y0TA 4WMCA 3HLBA 4BD0A 1EROA 3SS3A 3IXDA 4LV2A 2ZC3B 4IVKA 5HAQA 4E3NA 3JYIA 3S1YA 2G2WA 3V50A 1I2WA 4R0QA 2PU2A 2EFXA 2OV5A 4FCFA 1XPBA 4QU3A 3LCEA 4E6WA 4GD8A 4FH4A 1K6RA 4E3LA 3LY4A 3BYDA 3CZDA 3Q1FA 3OC2A 1K54A 4EUZA 3HUMA 1BLHA 2H0YA 4OPQA 1NYMA 5EOOA 3IT9A 1YQSA 2JC7A 3E2LA 2JBFA 5F83A 1WYCA 2XD1A 1ES4A 3HBRA 3ZG9B 4QJGA 5F1FA 2ZC6B 5CTNA 5CERA 1L0FA 4IBXA 1W8QA 3IWOA 2WZXA 3SH8A 3Q7VA 4HEFA 4KZ3A 4R3BA 3V39A 3UY6A 1ZKJA 1EWZA 3RXXA 4DE3A 1K54C 3UDFA 1Q2QA 1H8YA 2RL3A 4LCMA 5FA7A 3UE3A 4RA7A 1GA0A 4X69A 5AQ7A 2WYXA 4LV3A 3NY4A 4WZ5A 4JF6A 4MNRA 1Z6FA 4OPZA 4U3TA 2V1ZA 4R23A 4EQIA 1PWGA 4ZJ3A 3M2KA 2EX8A 5CRFA 2I72A 4OOLA 3TOIA 4E3MA 1NRFA 4N9KA 4EBPA 2J8YA 1FCNA 1JWPA 3GVBA 3OPHA 4KZAA 2C5WB 1MWRA 4A5RA 3IHAA 2J9PA 4KG5A 5A91A 2FFYA 3MXSA 3MFDA 4S2IA 4WZ5C 3HLFA 4YINA 4B4XA 1OMEA 4M3KA 5GHZA 1N4OA 5FATA 3DWZA 5EPHA 2XFTA 1W7FA 3BLSA 3SOIA 4S2OA 3BFGA 4XXRA 5CGSA 3PBRA 3HUNA 4MBFA 2ZJ9A 4ZJ1A 3OPRA 4S2JA 1FQGA 1Q2PA 1SCWA 3I7JA 4HESA 1ZG6A 4X68A 1KE4A 4Z9QA 3PBQA 1LI9A 4E3OA 4NETA 2ZC4B 1O7EA 3NDEA 1YLPA 3BECA 2XD5A 3IWIA 3A3DA 4GDNA 4N1XA 4BLMA 2EX6A 2Y2GA 3MZDA 5HAIA 4CPKA 3FKVA 3N4IA 1KDWA 4ID4A 4LV1A 1WE4A 2XR0A 3VSLA 2WAEA 3MZEA 1K56D 5EVIA 3V3SA 2Y91A 4GOGA 2Z2LB 3NC8A 1CI8A 2WAFA 4FH2A 2IWDA 1PYYA 1XGJA 3DW0A 2ZQCA 2HP9A 5DTTA 1KVLA 5U47A 3O87A 2EXAA 4BL3A 3UPOA 2ZD8A 2ZMAA 5FDHA 1JVJA 2Y59A 1NYYA 5CTMA 5DF9A 3O88A 1TDLA 4QD4A 4GNUA 2WGWB 4UA9A 5FASA 4WEKA 5EVIC 1KE0A 3ZFZA 4BD1A 4OH0A 1MWUA 1Y54A 4EBLA 1H5XA 2ZQ7A 4S2LA 5F1GA 3A3EA 2J7VA 3ITBA 4P85A 3ZCZA 3GSGA 4MBHA 5E2FA 3V5MA 3W4OA 4K0WA 2WKEA 2P9VB 1YT4A 1GHMA 1RGYA 2ZQAA 1NJ4A 3PTEA 3P98A 2BLSA 1SHVA 2BG1A 2H10A 4K0XA 2HDQA 3A3FA 3IF6B 5EE8A 1VQQA 2XDMA 3N6IA 1JTDA 3UO9A 3B3XA 3TG9A 3WRTA 3FZCA 1FCMA 4Y0OA 1LLBA 2WK0A 3C4PA 1SDNA 1KGGA 4LCLA 4Y0UA 1I5QA 1IYPA 1I2SA 4KZ9A 1IYQA 3IWQA 5E43A 5L2FA 3N7WA 3OPLA 4MLLA 4KZ4A 2V2FF 4GN2A 1CK3A 1KDSA 1YLTA 4S2MA 3SS4A 4PM6A 4IBRA 4IVIA 4B4ZA 5HW3A 5CHUA 1BZAA 1RP5A 2ZM2A 1XKZA 1K6SA 5FSRA 4S2NA 4ZAMA 3MKEA 4MEZA 3NIAA 3TSGA 2JE5A 3QHYA 4R1GA 1MY8A 4KZ7A 3G2YA 4PMAA 3O86A 5J8XA 4KG6A 3IXBA 4KZ8A 4JKTA 1LHYA 3AGFA 3RJUA 3HUOA 4WM9A 3HLGA 3S4XA 4RX3A 4YFMA 3OCNA 3G30A 5FQKA 2Q9NA 4S2NC 4XUXA 5HX9A 2WADA 4XUZA 4JXSA 4KQOA 3VP4A 1YMXA 5GL9A 4R4SA 5KZHA 5FAOA 3W4PA 3IH8A 3GTCA 3SH9A 4E3KA 4RX2A 4K91A 5A90A 4WZ4A 3C4OA 4WYYA 2B5RA 1W79A 4DXBA 4CJNA 3ZG7B 3Q7ZA 2DRWA 1S0WA 1K56A 4OVDA 1IKIA 5FQIA 1TDGA 2OSUA 3GV9A 4OPYA 5CEDA 3AGDA 1DJAA 3A3JA 2X71A 1ALQA 3C5AA 3BFFA 1MWSA 4LENA 2UWXA 4OQ0A 1ONHA 3UN7A 5BOHA 2EXBA 1BUEA 3IH9A 1PWDA 1XP4A 3GMWA 3VOYA 1CEGA 1U60A 1ZC2A 2XEPA 1E3UD 2WKIA 2Y2IA 1H8ZA 3D4FA 3FV7A 3W8KA 3C7UA 4UA6A 5M18A 1TVFA 2IWBA 3VP3A 4HBTA 2XQZA 2G2UA 3GQZA 3BFCA 4S2PA 3PBTA 4EV4A 4BL2A 5CECA 1ESIA 3MKFA 4O7DA 2VGKA 3ISGA 4EWFA 3IXGA 1YMSA 2P74A 3G31A 4GKUA 4HBUA 3G4PA 3MXRA 3PAGA 5CXWA 4EBNA 5AQBA 4ZDXA 5CEBA 1KVMA 2QZ6A 4Y7PA 3HLCA 5KSCA 4JXWA 5FQMA 4X55A 3OPPA 1ERMA 1CI9A 3HLWA 1YM1A 3LY3A 4KQRA 4B88A 1FR1A 2A49A 3ZG0A 5EOEA 2ZC5B 2Y2HA 2V20A 3Q82A 5A93A 4N92A 3HL9A 3VP2A 1SDEA 1M40A 2CC1A 4OLGA 4E6XA 3QNBA 1BULA 5FI7A 1MXOA 4GZBA 4DKIA 1O07A 4KG2A 1K57A 5HL1A 1IEMA 1YLJA 5JYOA 3FWLA 5DF7A 5EVLA 3FYZA 1JWVA 1CEFA 2ZQDA 4KZBA 4S2KA 4KZ6A 5CGWA 5TFQA 3WWXA 1KGEA 2ZQ8A 3S22A 3ZVTA 4DDYA 2HPBA 3G34A 1YLZA 5JYPA 1HZOA 5FI6A 5DTKA 2Y2NA 3FKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M6K A;  3VOZ A;  1K57 C;  1DY6 A;  1VM1 A;  5FQQ A;  1ES5 A;  3WS4 A;  5CHJ A;  4DE0 A;  2WUQ A;  2OLU A;  2GDN A;  4NK3 A;  4QY5 A;  3PBN A;  5TGF A;  5TR7 A;  3ZGA B;  1DJB A;  3G2Z A;  4JF4 A;  4UA7 A;  4ZTK A;  2ZLY A;  1PI5 A;  1J9M A;  2VGJ A;  1XA7 A;  2Y2O A;  3MZF A;  4KEN B;  4MBK A;  4X53 A;  4ZBE A;  1FSW A;  5E2E A;  5FAQ A;  3N8L A;  5F82 A;  2PU4 A;  5HFO A;  1QMF A;  3ZG5 A;  3C7V A;  5GLA A;  5GLC A;  5EEC A;  3SS5 A;  1PW1 A;  3Q07 A;  4LV0 A;  2Y2K A;  2Y55 A;  1K55 A;  1ES2 A;  4OPR A;  2DNS A;  4JPM A;  3PBS A;  1K38 A;  1E3U A;  1PZP A;  3VFF A;  4PPR A;  5AQ9 A;  3WRZ A;  1N9B A;  4F94 A;  1K4E A;  2DCF A;  1GA9 A;  1FR6 A;  2WGI A;  2OLV A;  3DWK A;  2HDU A;  3BRM A;  3G35 A;  1ES3 A;  1GHI A;  1E25 A;  5KSH A;  2EX9 A;  2JCH A;  3N8R A;  2XH9 A;  4GB7 A;  2ZM0 A;  4GDB A;  3IHB A;  3ITA A;  1K55 C;  4IED A;  4OLD A;  2PBY A;  2R9W A;  3M6H A;  4JXG A;  2Y2L A;  4RYE A;  4QHC A;  3E2K A;  1NXY A;  1RGZ A;  1FCO A;  1MBL A;  3BM6 A;  3ZNY A;  2XFS A;  3A3I A;  3HVF A;  4U0T A;  3LO7 A;  4L0L A;  3DTM A;  1KGF A;  3ZG8 B;  2ZQ9 A;  1AXB A;  1IYS A;  1MKI A;  1K4F A;  4OP8 A;  3M6B A;  1LL5 A;  3IF5 A;  4JF5 A;  3UPP A;  1NY0 A;  1FSY A;  2IWC A;  4DRT A;  3O3V A;  3Q7V B;  4QB8 A;  1QME A;  1L0D A;  2E8I A;  2WKH A;  2EX2 A;  5DVA A;  1YLW A;  2Z2M B;  1G68 A;  1WYB A;  3AGE A;  1LL9 A;  5KMW A;  4N1H A;  1L2S A;  5A92 A;  4JLF A;  4WEL A;  3ZDJ A;  4QY6 A;  2WGV A;  1XGI A;  1MWT A;  3V3R A;  5D3O A;  4OON A;  3OZH A;  4WBG A;  3WS2 A;  4Q8I A;  1BLP A;  1JWZ A;  5FQJ A;  2HP6 A;  3VSK A;  4X6T A;  3IQA A;  5DTS A;  2EFU A;  4PM7 A;  4WMC D;  1NZO A;  4KZ5 A;  1ERQ A;  4KQQ A;  5HAP A;  3G32 A;  4OOY A;  5CHM A;  2XF3 A;  1BLS A;  2J9O A;  3OCL A;  3CMZ A;  4OP5 A;  3WS0 A;  1C3B A;  3BFE A;  2C6W B;  2XK1 A;  1SKF A;  4FSF A;  3MBZ A;  3QNC A;  4C3Q A;  4PM9 A;  4C75 A;  5I94 A;  1NZU A;  1EI5 A;  5GHY A;  3RXW A;  5FAP A;  1PIO A;  1RCJ A;  3WS1 A;  3NDG A;  2QPN A;  3UE1 A;  4JBF A;  2Y2P A;  3BLM A;  5E2G A;  4RVA A;  3VFH A;  4OKP A;  3UE0 A;  3ZHH A;  1BT5 A;  3UDX A;  1BSG A;  2R9X A;  4C6Y A;  5FI2 A;  1ZG4 A;  2HDR A;  2H5S A;  3NBL A;  2X01 A;  1GHP A;  3HLD A;  1XXM A;  4DXC A;  1K25 A;  2HDS A;  2H0T A;  3M2J A;  4E3I A;  1JTG A;  4BEN A;  2HP5 A;  4OQG A;  5EVI B;  4R3J A;  1LI0 A;  4UHU A;  4U0X A;  5DF8 A;  3LEZ A;  5E2H A;  2WGW A;  3NI9 A;  3CJM A;  4DE1 A;  1E4D A;  2WZZ A;  4UAA A;  4DF6 A;  4OQI A;  1PWC A;  3W4Q A;  2A3U A;  3GRJ A;  4GD6 A;  4N9L A;  4R4R A;  4P0M A;  1YLY A;  3VP0 A;  2FFF B;  4P87 A;  3NCK A;  3UPN A;  3VP1 A;  1W5D A;  2Y2Q A;  3SH7 A;  4D2O A;  5GLB A;  3ZNT A;  3HRE A;  1BTL A;  2P9V A;  1HTZ A;  1G6A A;  4BJP A;  5GLD A;  5AQA A;  4BQM A;  1ONG A;  1PI4 A;  2Y4A A;  3CG5 A;  3P09 A;  4P6B A;  1ESU A;  1IEL A;  4PM5 A;  4OQH A;  1FOF A;  2XGN A;  3EQU A;  1L0E A;  3IF6 A;  3N8S A;  4DE2 A;  4OOM A;  1L0G A;  4WEJ A;  2RCX A;  3PBO A;  5GHX A;  4H8R A;  3IXH A;  4E3J A;  3UNW A;  2ZM8 A;  3Q81 A;  4DDS A;  3HLE A;  1S6R A;  4JXV A;  2ZC7 A;  1KE3 A;  5M19 A;  5CGX A;  3VMA A;  3ZVW A;  1BLC A;  1DJC A;  1MPL A;  5FQ9 A;  5G18 A;  1HD8 A;  4X56 A;  3IF6 C;  2Y2J A;  5EUA A;  3GR2 A;  5HAR A;  3UDI A;  2X02 A;  2Y2M A;  5M1A A;  1XX2 A;  5IHV A;  1GCE A;  4FD8 A;  2QMI A;  1W8Y A;  3EQV A;  5EVI D;  3PAE A;  4ZJ2 A;  2Q9M A;  1TEM A;  1PW8 A;  1IYO A;  3BFD A;  1XA1 A;  3BEB A;  4PM8 A;  3WS5 A;  2XLN A;  1HVB A;  1IKG A;  1PZO A;  4Y0T A;  4WMC A;  3HLB A;  4BD0 A;  1ERO A;  3SS3 A;  3IXD A;  4LV2 A;  2ZC3 B;  4IVK A;  5HAQ A;  4E3N A;  3JYI A;  3S1Y A;  2G2W A;  3V50 A;  1I2W A;  4R0Q A;  2PU2 A;  2EFX A;  2OV5 A;  4FCF A;  1XPB A;  4QU3 A;  3LCE A;  4E6W A;  4GD8 A;  4FH4 A;  1K6R A;  4E3L A;  3LY4 A;  3BYD A;  3CZD A;  3Q1F A;  3OC2 A;  1K54 A;  4EUZ A;  3HUM A;  1BLH A;  2H0Y A;  4OPQ A;  1NYM A;  5EOO A;  3IT9 A;  1YQS A;  2JC7 A;  3E2L A;  2JBF A;  5F83 A;  1WYC A;  2XD1 A;  1ES4 A;  3HBR A;  3ZG9 B;  4QJG A;  5F1F A;  2ZC6 B;  5CTN A;  5CER A;  1L0F A;  4IBX A;  1W8Q A;  3IWO A;  2WZX A;  3SH8 A;  3Q7V A;  4HEF A;  4KZ3 A;  4R3B A;  3V39 A;  3UY6 A;  1ZKJ A;  1EWZ A;  3RXX A;  4DE3 A;  1K54 C;  3UDF A;  1Q2Q A;  1H8Y A;  2RL3 A;  4LCM A;  5FA7 A;  3UE3 A;  4RA7 A;  1GA0 A;  4X69 A;  5AQ7 A;  2WYX A;  4LV3 A;  3NY4 A;  4WZ5 A;  4JF6 A;  4MNR A;  1Z6F A;  4OPZ A;  4U3T A;  2V1Z A;  4R23 A;  4EQI A;  1PWG A;  4ZJ3 A;  3M2K A;  2EX8 A;  5CRF A;  2I72 A;  4OOL A;  3TOI A;  4E3M A;  1NRF A;  4N9K A;  4EBP A;  2J8Y A;  1FCN A;  1JWP A;  3GVB A;  3OPH A;  4KZA A;  2C5W B;  1MWR A;  4A5R A;  3IHA A;  2J9P A;  4KG5 A;  5A91 A;  2FFY A;  3MXS A;  3MFD A;  4S2I A;  4WZ5 C;  3HLF A;  4YIN A;  4B4X A;  1OME A;  4M3K A;  5GHZ A;  1N4O A;  5FAT A;  3DWZ A;  5EPH A;  2XFT A;  1W7F A;  3BLS A;  3SOI A;  4S2O A;  3BFG A;  4XXR A;  5CGS A;  3PBR A;  3HUN A;  4MBF A;  2ZJ9 A;  4ZJ1 A;  3OPR A;  4S2J A;  1FQG A;  1Q2P A;  1SCW A;  3I7J A;  4HES A;  1ZG6 A;  4X68 A;  1KE4 A;  4Z9Q A;  3PBQ A;  1LI9 A;  4E3O A;  4NET A;  2ZC4 B;  1O7E A;  3NDE A;  1YLP A;  3BEC A;  2XD5 A;  3IWI A;  3A3D A;  4GDN A;  4N1X A;  4BLM A;  2EX6 A;  2Y2G A;  3MZD A;  5HAI A;  4CPK A;  3FKV A;  3N4I A;  1KDW A;  4ID4 A;  4LV1 A;  1WE4 A;  2XR0 A;  3VSL A;  2WAE A;  3MZE A;  1K56 D;  5EVI A;  3V3S A;  2Y91 A;  4GOG A;  2Z2L B;  3NC8 A;  1CI8 A;  2WAF A;  4FH2 A;  2IWD A;  1PYY A;  1XGJ A;  3DW0 A;  2ZQC A;  2HP9 A;  5DTT A;  1KVL A;  5U47 A;  3O87 A;  2EXA A;  4BL3 A;  3UPO A;  2ZD8 A;  2ZMA A;  5FDH A;  1JVJ A;  2Y59 A;  1NYY A;  5CTM A;  5DF9 A;  3O88 A;  1TDL A;  4QD4 A;  4GNU A;  2WGW B;  4UA9 A;  5FAS A;  4WEK A;  5EVI C;  1KE0 A;  3ZFZ A;  4BD1 A;  4OH0 A;  1MWU A;  1Y54 A;  4EBL A;  1H5X A;  2ZQ7 A;  4S2L A;  5F1G A;  3A3E A;  2J7V A;  3ITB A;  4P85 A;  3ZCZ A;  3GSG A;  4MBH A;  5E2F A;  3V5M A;  3W4O A;  4K0W A;  2WKE A;  2P9V B;  1YT4 A;  1GHM A;  1RGY A;  2ZQA A;  1NJ4 A;  3PTE A;  3P98 A;  2BLS A;  1SHV A;  2BG1 A;  2H10 A;  4K0X A;  2HDQ A;  3A3F A;  3IF6 B;  5EE8 A;  1VQQ A;  2XDM A;  3N6I A;  1JTD A;  3UO9 A;  3B3X A;  3TG9 A;  3WRT A;  3FZC A;  1FCM A;  4Y0O A;  1LLB A;  2WK0 A;  3C4P A;  1SDN A;  1KGG A;  4LCL A;  4Y0U A;  1I5Q A;  1IYP A;  1I2S A;  4KZ9 A;  1IYQ A;  3IWQ A;  5E43 A;  5L2F A;  3N7W A;  3OPL A;  4MLL A;  4KZ4 A;  2V2F F;  4GN2 A;  1CK3 A;  1KDS A;  1YLT A;  4S2M A;  3SS4 A;  4PM6 A;  4IBR A;  4IVI A;  4B4Z A;  5HW3 A;  5CHU A;  1BZA A;  1RP5 A;  2ZM2 A;  1XKZ A;  1K6S A;  5FSR A;  4S2N A;  4ZAM A;  3MKE A;  4MEZ A;  3NIA A;  3TSG A;  2JE5 A;  3QHY A;  4R1G A;  1MY8 A;  4KZ7 A;  3G2Y A;  4PMA A;  3O86 A;  5J8X A;  4KG6 A;  3IXB A;  4KZ8 A;  4JKT A;  1LHY A;  3AGF A;  3RJU A;  3HUO A;  4WM9 A;  3HLG A;  3S4X A;  4RX3 A;  4YFM A;  3OCN A;  3G30 A;  5FQK A;  2Q9N A;  4S2N C;  4XUX A;  5HX9 A;  2WAD A;  4XUZ A;  4JXS A;  4KQO A;  3VP4 A;  1YMX A;  5GL9 A;  4R4S A;  5KZH A;  5FAO A;  3W4P A;  3IH8 A;  3GTC A;  3SH9 A;  4E3K A;  4RX2 A;  4K91 A;  5A90 A;  4WZ4 A;  3C4O A;  4WYY A;  2B5R A;  1W79 A;  4DXB A;  4CJN A;  3ZG7 B;  3Q7Z A;  2DRW A;  1S0W A;  1K56 A;  4OVD A;  1IKI A;  5FQI A;  1TDG A;  2OSU A;  3GV9 A;  4OPY A;  5CED A;  3AGD A;  1DJA A;  3A3J A;  2X71 A;  1ALQ A;  3C5A A;  3BFF A;  1MWS A;  4LEN A;  2UWX A;  4OQ0 A;  1ONH A;  3UN7 A;  5BOH A;  2EXB A;  1BUE A;  3IH9 A;  1PWD A;  1XP4 A;  3GMW A;  3VOY A;  1CEG A;  1U60 A;  1ZC2 A;  2XEP A;  1E3U D;  2WKI A;  2Y2I A;  1H8Z A;  3D4F A;  3FV7 A;  3W8K A;  3C7U A;  4UA6 A;  5M18 A;  1TVF A;  2IWB A;  3VP3 A;  4HBT A;  2XQZ A;  2G2U A;  3GQZ A;  3BFC A;  4S2P A;  3PBT A;  4EV4 A;  4BL2 A;  5CEC A;  1ESI A;  3MKF A;  4O7D A;  2VGK A;  3ISG A;  4EWF A;  3IXG A;  1YMS A;  2P74 A;  3G31 A;  4GKU A;  4HBU A;  3G4P A;  3MXR A;  3PAG A;  5CXW A;  4EBN A;  5AQB A;  4ZDX A;  5CEB A;  1KVM A;  2QZ6 A;  4Y7P A;  3HLC A;  5KSC A;  4JXW A;  5FQM A;  4X55 A;  3OPP A;  1ERM A;  1CI9 A;  3HLW A;  1YM1 A;  3LY3 A;  4KQR A;  4B88 A;  1FR1 A;  2A49 A;  3ZG0 A;  5EOE A;  2ZC5 B;  2Y2H A;  2V20 A;  3Q82 A;  5A93 A;  4N92 A;  3HL9 A;  3VP2 A;  1SDE A;  1M40 A;  2CC1 A;  4OLG A;  4E6X A;  3QNB A;  1BUL A;  5FI7 A;  1MXO A;  4GZB A;  4DKI A;  1O07 A;  4KG2 A;  1K57 A;  5HL1 A;  1IEM A;  1YLJ A;  5JYO A;  3FWL A;  5DF7 A;  5EVL A;  3FYZ A;  1JWV A;  1CEF A;  2ZQD A;  4KZB A;  4S2K A;  4KZ6 A;  5CGW A;  5TFQ A;  3WWX A;  1KGE A;  2ZQ8 A;  3S22 A;  3ZVT A;  4DDY A;  2HPB A;  3G34 A;  1YLZ A;  5JYP A;  1HZO A;  5FI6 A;  5DTK A;  2Y2N A;  3FKW A; 
#chains in the Genus database with same CATH topology
 1K0K A;  1M6K A;  3R4K A;  1DY6 A;  1VM1 A;  1LT0 A;  2GDN A;  3PBN A;  3ZGA B;  1DJB A;  2I9V A;  2VLG A;  4EES A;  2FH5 A;  4UA7 A;  1J9M A;  4LPZ A;  4MBK A;  1SKO B;  4X53 A;  5E2E A;  5HWW A;  3N8L A;  3ZG5 A;  3C7V A;  5GLC A;  2Y55 A;  3OBF A;  3VOL A;  4JPM A;  1E3U A;  5AQ9 A;  2W3E A;  2DCF A;  3LGO A;  3IBR A;  2HV1 A;  2JCH A;  2XH9 A;  2ZM0 A;  2PBY A;  2Y2L A;  1NXY A;  2QYB A;  3MQQ A;  4EUV A;  2D01 A;  3T4S A;  2W1T B;  1LL5 A;  3HJK A;  3IF5 A;  1DP6 A;  4QB8 A;  2E8I A;  5DVA A;  2EX2 A;  1YLW A;  4N1H A;  5A92 A;  1D06 A;  4H6J A;  4WEL A;  1MWT A;  2VGL M;  3V3R A;  4OON A;  2J3T C;  1JWZ A;  4B93 A;  1ZHH B;  5FQJ A;  3R7W B;  5DTS A;  3QP6 A;  3MQO A;  4WMC D;  1YPR A;  2XF3 A;  1BLS A;  3OCL A;  2C6W B;  2XK1 A;  1SKF A;  1NZU A;  1EI5 A;  2QPN A;  4RQ9 A;  5HDD A;  2GJ3 A;  3UE0 A;  1BT5 A;  2R9X A;  3NBL A;  1GHP A;  1K25 A;  2HDS A;  2H0T A;  2ZOI A;  2PR6 A;  2QHK A;  4R38 A;  5G4Y A;  3D9Y A;  4CLC C;  5K5B A;  4UHU A;  4X25 A;  3BQ8 A;  3PXP A;  4DF6 A;  1PWC A;  3W4Q A;  4II7 A;  2FFF B;  4P87 A;  3NCK A;  3UPN A;  2Y2Q A;  2ZOH A;  5GLB A;  3ZNT A;  4Q0I A;  1BTL A;  1G6A A;  4L9G A;  2Y4A A;  4P6B A;  1P0Z A;  2XGN A;  3EQU A;  3IF6 A;  3N8S A;  4DE2 A;  4OOM A;  4WEJ A;  4E3J A;  1SZV A;  3QP5 A;  2PD8 A;  3CWF A;  3VMA A;  4ETX A;  1HD8 A;  3JPU A;  5HAR A;  2X02 A;  4XT2 A;  3EQV A;  4FTX A;  3PYP A;  1PW8 A;  1S1Z A;  2VV8 A;  4EEU A;  3BFD A;  3BJN A;  4GS9 A;  2ZMF A;  4Y0T A;  1OJ5 A;  1PRQ A;  3IXD A;  2ZC3 B;  4IVK A;  4B9O A;  4R0Q A;  1VEU A;  3LY4 A;  3BYD A;  2H0Y A;  4OPQ A;  2W3G A;  3F1O B;  2JBF A;  3CPT A;  5F83 A;  3ZG9 B;  5F1F A;  2ZC6 B;  3CAX A;  5CTN A;  3DTK A;  1L0F A;  3LFV A;  1W8Q A;  4EQ1 A;  4GJ4 A;  3Q7V A;  3IX3 A;  3UY6 A;  1EWZ A;  3RXX A;  3NOP C;  3UDF A;  4LCM A;  3UE3 A;  4X69 A;  2WYX A;  4LV3 A;  2VK3 A;  1Z6F A;  2V1Z A;  3M2K A;  5CRF A;  2I72 A;  2L4R A;  4E3M A;  1NRF A;  4EBP A;  1KOU A;  4H6J B;  1V9Z A;  1XJ4 A;  2C5W B;  5A91 A;  3MXS A;  4YIN A;  5AVF A;  1OME A;  4M3K A;  4DMZ A;  5GHZ A;  5EPH A;  3BLS A;  3SOI A;  2VJW A;  5J7E A;  3PBR A;  4HP9 A;  3GDI A;  4HI4 A;  1SCW A;  3F1P B;  4R6L A;  3PBQ A;  4E3O A;  3LEQ A;  3NDE A;  1YLP A;  2Y79 A;  4N1X A;  4BLM A;  2EX6 A;  4CPK A;  1KDW A;  4ID4 A;  4LV1 A;  2XR0 A;  2WAE A;  3V3S A;  5FEG A;  3KX0 X;  3NC8 A;  1CI8 A;  4FH2 A;  2ZQC A;  5DTT A;  3O87 A;  4BMW A;  2ZMA A;  5C5K A;  1NYY A;  4QD4 A;  4UA9 A;  1W63 Q;  3ZFZ A;  4BD1 A;  1P9W A;  1Y54 A;  4Y13 A;  3A3E A;  3ITB A;  4P85 A;  3GSG A;  3V5M A;  3V67 A;  2W1R A;  4LRY C;  4PHT A;  2ZQA A;  2H10 A;  3IF6 B;  4ARZ B;  4O8G A;  1JTD A;  3WRT A;  1LLB A;  4GLQ A;  5L2F A;  2O9B A;  5E43 A;  4L9E A;  4MLL A;  4KZ4 A;  4IBR A;  4IVI A;  5CHU A;  1BZA A;  1RP5 A;  2ZM2 A;  5FSR A;  4KZ7 A;  4GS9 B;  4WM9 A;  3OCN A;  3G30 A;  5FQK A;  2Q9N A;  3KSI A;  3LR4 A;  1FIL A;  3VP4 A;  5FAO A;  3IH8 A;  1T1A A;  3NOT C;  4E3K A;  3C4O A;  4WYY A;  2B5R A;  2VV6 A;  2JKG A;  4JGQ A;  4OVD A;  5FQI A;  1DRM A;  1F5M A;  4YWZ A;  1MWS A;  4LEN A;  1ONH A;  5DKK A;  5BOH A;  4EEP A;  1BUE A;  1CEG A;  3W8K A;  1TVF A;  4HIA A;  4UEY A;  3VP3 A;  2CMN A;  3GQZ A;  2ZMV A;  4S2P A;  4BL2 A;  1ESI A;  2W27 A;  3G31 A;  4HBU A;  4F3L B;  5CXW A;  5AQB A;  4PAU A;  5CEB A;  1MC0 A;  4Y7P A;  3UB9 A;  4B88 A;  3HLW A;  3LY3 A;  1FR1 A;  2A49 A;  5EOE A;  3C8C A;  2ZC5 B;  2Y2H A;  1IOU A;  3Q82 A;  4N92 A;  2LB9 A;  1M40 A;  2ZL1 B;  2Z6C A;  4CLC E;  3MS6 A;  1IEM A;  1YLJ A;  2VA0 A;  3ICY A;  3FYZ A;  5CGW A;  2ZQ8 A;  3ZVT A;  5L8M A;  3EGX C;  3VOZ A;  4EET B;  5CHJ A;  2WUQ A;  5TGF A;  5TR7 A;  3G2Z A;  4ZTK A;  3OLO A;  1OT9 A;  2Y2O A;  5I5L A;  1L3L A;  4ZBE A;  1FSW A;  5HFO A;  2VV7 A;  2GNX A;  5EEC A;  3SS5 A;  2Y2K A;  1K55 A;  3SZT A;  2MJ6 A;  1K38 A;  3F1N B;  3TRC A;  2P7J A;  2XA7 S;  3WRZ A;  4MCW A;  1FR6 A;  3QP2 A;  2B18 A;  2OLV A;  3BRM A;  1GHI A;  2EX9 A;  4GB7 A;  4DJ2 A;  5EFW A;  4OLD A;  1T19 A;  3PR6 A;  3K3C A;  3E2K A;  1FCO A;  1TD5 A;  4U0T A;  2ZQ9 A;  1AXB A;  2Q0O A;  1K4F A;  1FSY A;  4DRT A;  1QME A;  1L0D A;  4MMN A;  2WKH A;  2Z2M B;  1GSV A;  1G68 A;  3DAV A;  4WL9 A;  5KMW A;  3ZDJ A;  4QY6 A;  2P08 A;  1YSP A;  3WS2 A;  1F98 A;  4WLA A;  3SW1 A;  1BLP A;  3VSK A;  3IQA A;  2O9A A;  1STZ A;  3LR3 A;  5HAP A;  4OOY A;  5LBR A;  3CMZ A;  4OP5 A;  1C3B A;  3BFE A;  2G7U A;  4C3Q A;  3QNC A;  3RXW A;  2V0U A;  1PIO A;  3TE8 A;  5E2G A;  3VFH A;  4OKP A;  5AJG A;  4PKY A;  3T1S A;  5FI2 A;  3DTI A;  2H5S A;  4DXC A;  3BY9 A;  1VB6 A;  5L07 A;  1JTG A;  5EVI B;  3KYZ A;  3LEZ A;  2WGW A;  1E4D A;  2VX8 A;  3MFX A;  4OQI A;  2A3U A;  3C38 A;  4N9L A;  3VP0 A;  1YLY A;  3SH7 A;  3G6O A;  1NLZ A;  4FOF A;  2P9V A;  1ZTU A;  4BJP A;  4BQM A;  5AQA A;  1PI4 A;  3P09 A;  1IEL A;  3LUQ A;  5G4Z A;  1UGU A;  1ACF A;  2O99 A;  1N9O A;  1L0G A;  2RCX A;  5GHX A;  3IXH A;  2QJ5 A;  3Q81 A;  4DDS A;  3P01 A;  2ZC7 A;  4JGR A;  3W2Z A;  3ZVW A;  1MPL A;  2W3F A;  4X56 A;  5HDS A;  2Y2J A;  3GR2 A;  1OTI A;  1XX2 A;  2A2L A;  2P04 A;  5IHV A;  4FUW A;  4FD8 A;  2QMI A;  5EVI D;  3PAE A;  4ZJ2 A;  1TEM A;  1IYO A;  1XA1 A;  3BEB A;  3WS5 A;  1D1J A;  1IKG A;  4BD0 A;  3SS3 A;  4Y17 A;  4LV2 A;  4WF0 A;  5HAQ A;  4E3N A;  2G2W A;  2PU2 A;  2JHE A;  1XPB A;  4QU3 A;  3LCE A;  4GD8 A;  1VET A;  3Q1F A;  3OC2 A;  1K54 A;  1BLH A;  3KYE A;  5EOO A;  1LSV A;  1YQS A;  3E2L A;  3HBR A;  2WKQ A;  2WKP A;  5CER A;  3OOV A;  3E0Y A;  4IBX A;  2WZX A;  3SH8 A;  3C2W A;  4HEF A;  4KZ3 A;  5CX7 A;  3V39 A;  3UME A;  2RL3 A;  4RA7 A;  3A0S A;  3NY4 A;  3NUL A;  4R23 A;  1PNE A;  3T4Q A;  1Y28 A;  4OOL A;  4N9K A;  2ZBB A;  4MN6 A;  3OPH A;  4HP4 A;  4A5R A;  3IHA A;  4G3W A;  5TBM A;  3CI6 A;  5TJJ A;  4S2I A;  3MFD A;  4WZ5 C;  3HLF A;  4B4X A;  2VEA A;  2EWV A;  3BFG A;  3HUN A;  2ZJ9 A;  3OPR A;  4S2J A;  1Q2P A;  3NHQ A;  3MXQ A;  5HD5 A;  1O7E A;  2XD5 A;  1TS6 A;  3A3D A;  2Y2G A;  3CUE C;  5HAI A;  3MZE A;  1K56 D;  5HWV A;  1XJ2 A;  2Y91 A;  3DW0 A;  3LIA A;  1NRJ A;  5U47 A;  3UPO A;  3T4L A;  3K2N A;  5CTM A;  1JVJ A;  2Y59 A;  4MN7 A;  3O88 A;  1TDL A;  2WGW B;  5FAS A;  5EVI C;  4OH0 A;  1MWU A;  3KSF A;  3ZCZ A;  4ME4 A;  3W4O A;  2ACG A;  2WKE A;  2P9V B;  2XA7 M;  2A24 A;  1SHV A;  2BG1 A;  3A3F A;  2XDM A;  3LR5 A;  3N6I A;  4Q0J A;  4BWI A;  4EER A;  5FL3 A;  3UO9 A;  2PT7 A;  3C4P A;  3D72 A;  4Y0U A;  1KGG A;  1IYP A;  1TS8 A;  4KZ9 A;  3OPL A;  1CK3 A;  3SS4 A;  5HW3 A;  4X1L A;  4ZAM A;  3TSG A;  2JKF A;  3QHY A;  3G2Y A;  4PMA A;  3O86 A;  2OWH A;  4KG6 A;  5J8X A;  1LHY A;  3AGF A;  3MJQ A;  3S4X A;  3VE4 A;  4S2N C;  3TW8 A;  4R4S A;  5KZH A;  3SH9 A;  4KQD A;  1D7E A;  4DXB A;  3ZG7 B;  3Q7Z A;  2OWJ A;  2DRW A;  4EW7 A;  1IKI A;  3GV9 A;  4OPY A;  4HJ4 A;  3BQA A;  3C5A A;  2JN7 A;  2EXB A;  3IH9 A;  3GMW A;  3VOY A;  1TF1 A;  1ZC2 A;  1E3U D;  3NOU C;  4HBT A;  1S4R A;  2AVX A;  2VGK A;  3ISG A;  4EWF A;  1YMS A;  3MXR A;  4EBN A;  1XFN A;  4ZDX A;  2QZ6 A;  2V1B A;  5FQM A;  3DTE A;  1YM1 A;  5DJU A;  5A93 A;  3MSH A;  3VP2 A;  1NLY A;  1SDE A;  4OLG A;  4NKP A;  1BUL A;  5FI7 A;  4DKI A;  5JYO A;  3FWL A;  3LIF A;  1KGE A;  1IFQ A;  3G34 A;  5JYP A;  2K7S A;  5FI6 A;  3FKW A;  3LIE A;  1K57 C;  4GCZ A;  5FQQ A;  3EWK A;  3WS4 A;  2OLU A;  4NK3 A;  4QY5 A;  1TS0 A;  2Z6D A;  2O9C A;  3PHY A;  5F69 A;  4JF4 A;  3O5Y A;  2ZLY A;  1PI5 A;  2VGJ A;  3T1R A;  4WN5 A;  5F82 A;  2PU4 A;  4ESP A;  1OTE A;  4XT2 B;  4LV0 A;  2M7U A;  4IUK A;  4OPR A;  1T18 A;  3FG8 A;  3PBS A;  1PZP A;  3VFF A;  4PPR A;  3U2A A;  4F94 A;  1N9B A;  1GA9 A;  2UV0 E;  2WGI A;  5HZH A;  2HDU A;  3H82 A;  3IX8 A;  3CLO A;  3G35 A;  2M1C A;  1E25 A;  5KSH A;  3IHB A;  1VEU B;  3ITA A;  4IED A;  1XJ6 A;  3M6H A;  4RYE A;  1RGZ A;  1G28 A;  3BM6 A;  3ZNY A;  3E4Q A;  3LO7 A;  3CPT B;  3ZG8 B;  1KGF A;  2V8C A;  4OP8 A;  4MDZ A;  3M6B A;  4JF5 A;  4DN0 A;  1NY0 A;  2IWC A;  3O3V A;  3Q7V B;  1X0O A;  4E04 A;  3IS2 A;  1LL9 A;  3LR0 A;  4WBG A;  3UMD A;  5L10 A;  4Q8I A;  2HP6 A;  4X6T A;  3BWL A;  4PM7 A;  1NZO A;  3BW6 A;  4KZ5 A;  4G3K A;  3G32 A;  3NJA A;  3MBZ A;  5GHY A;  3T50 A;  3UE1 A;  3A0V A;  3HJI A;  2Y2P A;  3BLM A;  4RVA A;  4CLC A;  1BSG A;  3IX4 A;  1ZG4 A;  2HDR A;  2X01 A;  1XXM A;  4R3A A;  3H7W A;  3M2J A;  4IHQ A;  4NXG A;  4KUK A;  4YNR A;  5DF8 A;  3NI9 A;  3CJM A;  2WZZ A;  4R70 A;  3S7Q A;  2FZ0 A;  4D2O A;  1ONG A;  3CG5 A;  2YKF A;  1GSW A;  2QWS A;  4LRZ E;  3PBO A;  3UNW A;  1S6R A;  4JXV A;  1KE3 A;  5M19 A;  1BLC A;  5G18 A;  2Y8H A;  1SKO A;  1G6O A;  1F2K A;  3IF6 C;  5EUA A;  3UDI A;  5M1A A;  1H8M A;  2HZ5 A;  1GCE A;  5HPF A;  2KDK A;  1W8Y A;  3LYX A;  4YOF A;  2K31 A;  1HVB A;  4WMC A;  3HLB A;  4Y5F A;  4DJ3 A;  3JYI A;  3S1Y A;  3V50 A;  1OTB A;  4HH3 A;  1VHM A;  4QPR A;  4EUZ A;  3HUM A;  1NYM A;  3IT9 A;  2JC7 A;  1WYC A;  2XD1 A;  1ES4 A;  2W3H A;  4QJG A;  2W1T A;  1EW0 A;  3IWO A;  4I39 A;  4DE3 A;  1T1B A;  1Q2Q A;  5HL6 A;  5FA7 A;  5AQ7 A;  1GA0 A;  3QP1 A;  2J80 A;  4JF6 A;  4MNR A;  4OPZ A;  4U3T A;  2BTF P;  4EQI A;  2PYP A;  1PWG A;  2EX8 A;  3IS2 B;  4Y2F A;  4EU0 A;  4D60 A;  3H9W A;  4Z1W A;  2KOI A;  2KLI A;  3IBJ A;  4KZA A;  1MWR A;  2J9P A;  2BAS A;  3E4O A;  4UQI S;  5J3W A;  2XFT A;  4S2O A;  5CGS A;  2V1A A;  4MBF A;  1FQG A;  3I7J A;  1ZG6 A;  4Z9Q A;  1LI9 A;  3T4J A;  4NET A;  2ZC4 B;  3BEC A;  4BBV A;  4GDN A;  4CLC B;  5MC7 A;  1WE4 A;  1YKD A;  2J3T D;  3T4K A;  2WAF A;  2IWD A;  1XGJ A;  2HP9 A;  1BYW A;  4M4X A;  2EXA A;  4HOI A;  1Z09 A;  4BL3 A;  1LL8 A;  2ZD8 A;  2XRN A;  5FDH A;  1CF0 A;  1LSX A;  2V9A A;  4NXB A;  1KE0 A;  3EEA A;  4EBL A;  1H5X A;  2PBD P;  1S4S A;  4NEE D;  2J7V A;  3KSG A;  4MBH A;  2V0W A;  4K0W A;  3NEC A;  1GHM A;  1RGY A;  1NJ4 A;  3JVU A;  3PTE A;  3P98 A;  5F68 A;  3B42 A;  4K0X A;  4L9F A;  2HDQ A;  4K08 A;  3TG9 A;  3FZC A;  1FCM A;  4HQA A;  2WK0 A;  4CLC D;  4WUJ A;  2L1M A;  3IWQ A;  3N7W A;  4S2M A;  3EOI A;  5HD3 A;  1YLT A;  4EXO A;  2W3D A;  1K6S A;  3B33 A;  2W0N A;  3S7P A;  2EWW A;  2JE5 A;  4IUH A;  3IXB A;  4JKT A;  3HUO A;  3HLG A;  4RX3 A;  1OPX A;  2KX6 A;  4HY8 A;  4XUX A;  2WAD A;  3F1O A;  3DBA A;  2PHY A;  3MF0 A;  4ETZ A;  4I3J A;  5HSQ A;  3GTC A;  1DP9 A;  4RX2 A;  4K91 A;  5A90 A;  1W79 A;  4CJN A;  5F5Y A;  4Y15 A;  1TDG A;  2OSU A;  3K3D A;  3AGD A;  4MN5 A;  1DJA A;  3ZQ5 A;  4G3V A;  1ALQ A;  1W63 M;  4OQ0 A;  3UN7 A;  2HJE A;  2EA9 A;  1PWD A;  1XP4 A;  2XEP A;  1Y4O A;  2WKI A;  2Y2I A;  5EM0 A;  1H8Z A;  3FV7 A;  5M18 A;  4UA6 A;  2O0Y A;  2IWB A;  2G2U A;  4IJG A;  4O7D A;  3IXG A;  4X1M A;  1JNU A;  4GKU A;  1G5U A;  3F1P A;  1UWP X;  3PAG A;  3UB7 A;  3C30 A;  3GEC A;  3HLC A;  3D3O A;  1OJG A;  4JXW A;  5KSC A;  5FDS A;  1CI9 A;  3ZG0 A;  3JVV A;  2V20 A;  3T4O A;  1OTD A;  2CC1 A;  4E6X A;  3QNB A;  2XRO A;  1V9Y A;  1MXO A;  4GZB A;  4KG2 A;  3E4P A;  2B95 A;  5EVL A;  4KZB A;  1CEF A;  5TFQ A;  4S2K A;  2H28 A;  3S22 A;  4DDY A;  2DMW A;  2HPB A;  1YLZ A;  1HZO A;  5DTK A;  5KIZ A;  2LB5 A;  1ES5 A;  4DE0 A;  2JKT M;  1MZU A;  5DJT A;  4I5S A;  4ARZ A;  1XA7 A;  3MZF A;  4KEN B;  5L09 A;  4P6Z S;  1NWZ A;  5FAQ A;  1QMF A;  5GLA A;  1HLU P;  1PW1 A;  3Q07 A;  3T12 B;  4HJ6 A;  1ES2 A;  3LI8 A;  5EV0 A;  2DNS A;  1K4E A;  1AWI A;  2PD7 A;  3DWK A;  1ES3 A;  3P7N A;  3N8R A;  4GDB A;  2VKS A;  1K55 C;  3FPV A;  2R9W A;  1VET B;  3UB5 P;  3UB8 A;  4JXG A;  4QHC A;  4ZRR A;  3VE3 A;  1MBL A;  2XFS A;  2WKR A;  3A3I A;  3HVF A;  4L0L A;  3MMH A;  3DTM A;  1IYS A;  1MKI A;  4UQI M;  3UPP A;  1XFQ A;  1WYB A;  3AGE A;  2D02 A;  3FC7 A;  1DP8 A;  1N9L A;  1L2S A;  1XJ3 A;  1S1Y A;  2V8F A;  3A0R A;  4JLF A;  2WGV A;  1XGI A;  5D3O A;  3OZH A;  1A0K A;  3T1X A;  3L7H A;  1ODV A;  1H3Q A;  2EFU A;  2GX5 A;  3L9K A;  1ERQ A;  4KQQ A;  4QWO A;  5TBM B;  5CHM A;  1OT6 A;  2J9O A;  3MR0 A;  3WS0 A;  4FSF A;  5I94 A;  4C75 A;  4PM9 A;  4F3L A;  5FAP A;  1RCJ A;  3WS1 A;  3NDG A;  2PR5 A;  4JBF A;  3EGD C;  5FEF A;  3ZHH A;  2J3W A;  3UDX A;  4C6Y A;  2JKR M;  3HLD A;  1UWN X;  4O01 A;  4E3I A;  2QKP A;  2ZL1 A;  4BEN A;  2HP5 A;  4OQG A;  3MQ0 A;  4I3A A;  4R3J A;  1LI0 A;  1CQA A;  4U0X A;  5IU1 A;  2PYR A;  5E2H A;  4DE1 A;  1TS7 A;  4UAA A;  3GRJ A;  4GD6 A;  4R4R A;  1J3W A;  1YAX A;  4P0M A;  4CQH A;  2IA2 A;  1S66 L;  3KSH A;  3VP1 A;  3TJZ C;  1W5D A;  2M7V A;  1PFL A;  3HRE A;  1HTZ A;  5GLD A;  1ESU A;  4PM5 A;  4OQH A;  5DFX A;  1FOF A;  1L0E A;  3RTY A;  4H8R A;  1FIK A;  2ZM8 A;  3HLE A;  2A24 B;  5CGX A;  1DJC A;  3CHW P;  5FQ9 A;  2E8J A;  2Y2M A;  4GHI A;  2Q9M A;  4JGO A;  3LID A;  4Q0H A;  3F1N A;  4PM8 A;  2XLN A;  1PZO A;  1ERO A;  3ZYT A;  1I2W A;  2EFX A;  2OV5 A;  4FCF A;  3UE6 A;  4E6W A;  4FH4 A;  1K6R A;  4NG2 A;  4E3L A;  2PAV P;  3CZD A;  1WA9 A;  1F9I A;  3T4T A;  5EM1 A;  3S7N A;  1P9R A;  4HNB A;  4HH2 A;  4HHD A;  4LRX C;  2OAP 1;  5HPI A;  4R3B A;  1ZKJ A;  4JGP A;  1K54 C;  1H8Y A;  4WZ5 A;  4I3I A;  4ZJ3 A;  2OOL A;  3KO6 A;  3TOI A;  2J8Y A;  1FCN A;  1JWP A;  1YSQ A;  3GVB A;  4KG5 A;  2FFY A;  4Y3I A;  3BY8 A;  1N4O A;  5FAT A;  3DWZ A;  1W7F A;  3CUE A;  4XXR A;  4NXE A;  4ZJ1 A;  4LGW A;  4HES A;  1OTA A;  2QJ7 A;  4X68 A;  1KE4 A;  3ULF A;  2VGL S;  1S67 L;  3IWI A;  3S7O A;  3LI9 A;  4LFU A;  3CIT A;  2NUT C;  3MZD A;  3FKV A;  3N4I A;  4GW9 A;  3VSL A;  5EVI A;  4GOG A;  2Z2L B;  2NUP C;  1PYY A;  1KVL A;  3EEH A;  4HJ3 A;  2PRF A;  2INW A;  2OAQ 1;  2YKH A;  5DF9 A;  3VV4 A;  4GNU A;  5DKL A;  4P6Z M;  4WEK A;  2JKT I;  5EVE A;  3UB6 A;  2ZQ7 A;  1GSX A;  3QP8 A;  4S2L A;  5F1G A;  1T1C A;  3U4L P;  5E2F A;  4BBU A;  3RH8 B;  1YT4 A;  2BLS A;  1LSW A;  3B47 A;  5EE8 A;  2XSS A;  1VQQ A;  3B3X A;  4LLO B;  4Y0O A;  5HWT A;  3FPW A;  1SDN A;  4LCL A;  2L0W A;  1I2S A;  1I5Q A;  5J4E A;  1IYQ A;  2V2F F;  4GN2 A;  1KDS A;  4PM6 A;  3LIC A;  4B4Z A;  2HGV A;  2R78 A;  1XKZ A;  4S2N A;  3MKE A;  4MEZ A;  3NIA A;  4GHI B;  4R1G A;  4KUO A;  1MY8 A;  1P97 A;  5AVE A;  4KZ8 A;  3H82 B;  4O0P A;  3RJU A;  3LIB A;  4YFM A;  3KYQ A;  5HX9 A;  4XUZ A;  3RFB A;  4JXS A;  4KQO A;  5A8B A;  5DFY A;  4AFI A;  1YMX A;  5GL9 A;  3W4P A;  5IS1 A;  4WZ4 A;  4NXF A;  1S0W A;  1K56 A;  5F6A A;  5CED A;  4PKY G;  3T1Q B;  1MKM A;  3A3J A;  2X71 A;  3R7W A;  4I38 A;  3BFF A;  2UWX A;  2K2N A;  4BBT A;  1H0M A;  1U60 A;  3QP4 A;  3D4F A;  3C7U A;  2XQZ A;  3BFC A;  4EV4 A;  3PBT A;  2JKR I;  5HDC A;  5CEC A;  2VZW A;  3MKF A;  2P74 A;  3E98 A;  3G4P A;  1N9N A;  2HJ9 C;  2GZA A;  1KVM A;  2PDR A;  4X55 A;  3OPP A;  1ERM A;  4KQR A;  2HF6 A;  3H7W B;  3HL9 A;  2B02 A;  1O07 A;  5IT5 A;  1K57 A;  5HL1 A;  5DF7 A;  1JWV A;  2ZQD A;  3HCY A;  3WWX A;  4KZ6 A;  1CJF A;  2Y2N A; 
#chains in the Genus database with same CATH homology
 1M6K A;  3VOZ A;  1K57 C;  1DY6 A;  1VM1 A;  5FQQ A;  1ES5 A;  3WS4 A;  5CHJ A;  4DE0 A;  2WUQ A;  2OLU A;  2GDN A;  4NK3 A;  4QY5 A;  3PBN A;  5TGF A;  5TR7 A;  3ZGA B;  1DJB A;  3G2Z A;  4JF4 A;  4UA7 A;  4ZTK A;  2ZLY A;  1PI5 A;  1J9M A;  2VGJ A;  1XA7 A;  2Y2O A;  3MZF A;  4KEN B;  4MBK A;  4X53 A;  4ZBE A;  1FSW A;  5E2E A;  5FAQ A;  3N8L A;  5F82 A;  2PU4 A;  5HFO A;  1QMF A;  3ZG5 A;  3C7V A;  5GLA A;  5GLC A;  5EEC A;  3SS5 A;  1PW1 A;  3Q07 A;  4LV0 A;  2Y2K A;  2Y55 A;  1K55 A;  1ES2 A;  4OPR A;  2DNS A;  4JPM A;  3PBS A;  1K38 A;  1E3U A;  1PZP A;  3VFF A;  4PPR A;  5AQ9 A;  3WRZ A;  1N9B A;  4F94 A;  1K4E A;  2DCF A;  1GA9 A;  1FR6 A;  2WGI A;  2OLV A;  3DWK A;  2HDU A;  3BRM A;  3G35 A;  1ES3 A;  1GHI A;  1E25 A;  5KSH A;  2EX9 A;  2JCH A;  3N8R A;  2XH9 A;  4GB7 A;  2ZM0 A;  4GDB A;  3IHB A;  3ITA A;  1K55 C;  4IED A;  4OLD A;  2PBY A;  2R9W A;  3M6H A;  4JXG A;  2Y2L A;  4RYE A;  4QHC A;  3E2K A;  1NXY A;  1RGZ A;  1FCO A;  1MBL A;  3BM6 A;  3ZNY A;  2XFS A;  3A3I A;  3HVF A;  4U0T A;  3LO7 A;  4L0L A;  3DTM A;  1KGF A;  3ZG8 B;  2ZQ9 A;  1AXB A;  1IYS A;  1MKI A;  1K4F A;  4OP8 A;  3M6B A;  1LL5 A;  3IF5 A;  4JF5 A;  3UPP A;  1NY0 A;  1FSY A;  2IWC A;  4DRT A;  3O3V A;  3Q7V B;  4QB8 A;  1QME A;  1L0D A;  2E8I A;  2WKH A;  2EX2 A;  5DVA A;  1YLW A;  2Z2M B;  1G68 A;  1WYB A;  3AGE A;  1LL9 A;  5KMW A;  4N1H A;  1L2S A;  5A92 A;  4JLF A;  4WEL A;  3ZDJ A;  4QY6 A;  2WGV A;  1XGI A;  1MWT A;  3V3R A;  5D3O A;  4OON A;  3OZH A;  4WBG A;  3WS2 A;  4Q8I A;  1BLP A;  1JWZ A;  5FQJ A;  2HP6 A;  3VSK A;  4X6T A;  3IQA A;  5DTS A;  2EFU A;  4PM7 A;  4WMC D;  1NZO A;  4KZ5 A;  1ERQ A;  4KQQ A;  5HAP A;  3G32 A;  4OOY A;  5CHM A;  2XF3 A;  1BLS A;  2J9O A;  3OCL A;  3CMZ A;  4OP5 A;  3WS0 A;  1C3B A;  3BFE A;  2C6W B;  2XK1 A;  1SKF A;  4FSF A;  3MBZ A;  3QNC A;  4C3Q A;  4PM9 A;  4C75 A;  5I94 A;  1NZU A;  1EI5 A;  5GHY A;  3RXW A;  5FAP A;  1PIO A;  1RCJ A;  3WS1 A;  3NDG A;  2QPN A;  3UE1 A;  4JBF A;  2Y2P A;  3BLM A;  5E2G A;  4RVA A;  3VFH A;  4OKP A;  3UE0 A;  3ZHH A;  1BT5 A;  3UDX A;  1BSG A;  2R9X A;  4C6Y A;  5FI2 A;  1ZG4 A;  2HDR A;  2H5S A;  3NBL A;  2X01 A;  1GHP A;  3HLD A;  1XXM A;  4DXC A;  1K25 A;  2HDS A;  2H0T A;  3M2J A;  4E3I A;  1JTG A;  4BEN A;  2HP5 A;  4OQG A;  5EVI B;  4R3J A;  1LI0 A;  4UHU A;  4U0X A;  5DF8 A;  3LEZ A;  5E2H A;  2WGW A;  3NI9 A;  3CJM A;  4DE1 A;  1E4D A;  2WZZ A;  4UAA A;  4DF6 A;  4OQI A;  1PWC A;  3W4Q A;  2A3U A;  3GRJ A;  4GD6 A;  4N9L A;  4R4R A;  4P0M A;  1YLY A;  3VP0 A;  2FFF B;  4P87 A;  3NCK A;  3UPN A;  3VP1 A;  1W5D A;  2Y2Q A;  3SH7 A;  4D2O A;  5GLB A;  3ZNT A;  3HRE A;  1BTL A;  2P9V A;  1HTZ A;  1G6A A;  4BJP A;  5GLD A;  5AQA A;  4BQM A;  1ONG A;  1PI4 A;  2Y4A A;  3CG5 A;  3P09 A;  4P6B A;  1ESU A;  1IEL A;  4PM5 A;  4OQH A;  1FOF A;  2XGN A;  3EQU A;  1L0E A;  3IF6 A;  3N8S A;  4DE2 A;  4OOM A;  1L0G A;  4WEJ A;  2RCX A;  3PBO A;  5GHX A;  4H8R A;  3IXH A;  4E3J A;  3UNW A;  2ZM8 A;  3Q81 A;  4DDS A;  3HLE A;  1S6R A;  4JXV A;  2ZC7 A;  1KE3 A;  5M19 A;  5CGX A;  3VMA A;  3ZVW A;  1BLC A;  1DJC A;  1MPL A;  5FQ9 A;  5G18 A;  1HD8 A;  4X56 A;  3IF6 C;  2Y2J A;  5EUA A;  3GR2 A;  5HAR A;  3UDI A;  2X02 A;  2Y2M A;  5M1A A;  1XX2 A;  5IHV A;  1GCE A;  4FD8 A;  2QMI A;  1W8Y A;  3EQV A;  5EVI D;  3PAE A;  4ZJ2 A;  2Q9M A;  1TEM A;  1PW8 A;  1IYO A;  3BFD A;  1XA1 A;  3BEB A;  4PM8 A;  3WS5 A;  2XLN A;  1HVB A;  1IKG A;  1PZO A;  4Y0T A;  4WMC A;  3HLB A;  4BD0 A;  1ERO A;  3SS3 A;  3IXD A;  4LV2 A;  2ZC3 B;  4IVK A;  5HAQ A;  4E3N A;  3JYI A;  3S1Y A;  2G2W A;  3V50 A;  1I2W A;  4R0Q A;  2PU2 A;  2EFX A;  2OV5 A;  4FCF A;  1XPB A;  4QU3 A;  3LCE A;  4E6W A;  4GD8 A;  4FH4 A;  1K6R A;  4E3L A;  3LY4 A;  3BYD A;  3CZD A;  3Q1F A;  3OC2 A;  1K54 A;  4EUZ A;  3HUM A;  1BLH A;  2H0Y A;  4OPQ A;  1NYM A;  5EOO A;  3IT9 A;  1YQS A;  2JC7 A;  3E2L A;  2JBF A;  5F83 A;  1WYC A;  2XD1 A;  1ES4 A;  3HBR A;  3ZG9 B;  4QJG A;  5F1F A;  2ZC6 B;  5CTN A;  5CER A;  1L0F A;  4IBX A;  1W8Q A;  3IWO A;  2WZX A;  3SH8 A;  3Q7V A;  4HEF A;  4KZ3 A;  4R3B A;  3V39 A;  3UY6 A;  1ZKJ A;  1EWZ A;  3RXX A;  4DE3 A;  1K54 C;  3UDF A;  1Q2Q A;  1H8Y A;  2RL3 A;  4LCM A;  5FA7 A;  3UE3 A;  4RA7 A;  1GA0 A;  4X69 A;  5AQ7 A;  2WYX A;  4LV3 A;  3NY4 A;  4WZ5 A;  4JF6 A;  4MNR A;  1Z6F A;  4OPZ A;  4U3T A;  2V1Z A;  4R23 A;  4EQI A;  1PWG A;  4ZJ3 A;  3M2K A;  2EX8 A;  5CRF A;  2I72 A;  4OOL A;  3TOI A;  4E3M A;  1NRF A;  4N9K A;  4EBP A;  2J8Y A;  1FCN A;  1JWP A;  3GVB A;  3OPH A;  4KZA A;  2C5W B;  1MWR A;  4A5R A;  3IHA A;  2J9P A;  4KG5 A;  5A91 A;  2FFY A;  3MXS A;  3MFD A;  4S2I A;  4WZ5 C;  3HLF A;  4YIN A;  4B4X A;  1OME A;  4M3K A;  5GHZ A;  1N4O A;  5FAT A;  3DWZ A;  5EPH A;  2XFT A;  1W7F A;  3BLS A;  3SOI A;  4S2O A;  3BFG A;  4XXR A;  5CGS A;  3PBR A;  3HUN A;  4MBF A;  2ZJ9 A;  4ZJ1 A;  3OPR A;  4S2J A;  1FQG A;  1Q2P A;  1SCW A;  3I7J A;  4HES A;  1ZG6 A;  4X68 A;  1KE4 A;  4Z9Q A;  3PBQ A;  1LI9 A;  4E3O A;  4NET A;  2ZC4 B;  1O7E A;  3NDE A;  1YLP A;  3BEC A;  2XD5 A;  3IWI A;  3A3D A;  4GDN A;  4N1X A;  4BLM A;  2EX6 A;  2Y2G A;  3MZD A;  5HAI A;  4CPK A;  3FKV A;  3N4I A;  1KDW A;  4ID4 A;  4LV1 A;  1WE4 A;  2XR0 A;  3VSL A;  2WAE A;  3MZE A;  1K56 D;  5EVI A;  3V3S A;  2Y91 A;  4GOG A;  2Z2L B;  3NC8 A;  1CI8 A;  2WAF A;  4FH2 A;  2IWD A;  1PYY A;  1XGJ A;  3DW0 A;  2ZQC A;  2HP9 A;  5DTT A;  1KVL A;  5U47 A;  3O87 A;  2EXA A;  4BL3 A;  3UPO A;  2ZD8 A;  2ZMA A;  5FDH A;  1JVJ A;  2Y59 A;  1NYY A;  5CTM A;  5DF9 A;  3O88 A;  1TDL A;  4QD4 A;  4GNU A;  2WGW B;  4UA9 A;  5FAS A;  4WEK A;  5EVI C;  1KE0 A;  3ZFZ A;  4BD1 A;  4OH0 A;  1MWU A;  1Y54 A;  4EBL A;  1H5X A;  2ZQ7 A;  4S2L A;  5F1G A;  3A3E A;  2J7V A;  3ITB A;  4P85 A;  3ZCZ A;  3GSG A;  4MBH A;  5E2F A;  3V5M A;  3W4O A;  4K0W A;  2WKE A;  2P9V B;  1YT4 A;  1GHM A;  1RGY A;  2ZQA A;  1NJ4 A;  3PTE A;  3P98 A;  2BLS A;  1SHV A;  2BG1 A;  2H10 A;  4K0X A;  2HDQ A;  3A3F A;  3IF6 B;  5EE8 A;  1VQQ A;  2XDM A;  3N6I A;  1JTD A;  3UO9 A;  3B3X A;  3TG9 A;  3WRT A;  3FZC A;  1FCM A;  4Y0O A;  1LLB A;  2WK0 A;  3C4P A;  1SDN A;  1KGG A;  4LCL A;  4Y0U A;  1I5Q A;  1IYP A;  1I2S A;  4KZ9 A;  1IYQ A;  3IWQ A;  5E43 A;  5L2F A;  3N7W A;  3OPL A;  4MLL A;  4KZ4 A;  2V2F F;  4GN2 A;  1CK3 A;  1KDS A;  1YLT A;  4S2M A;  3SS4 A;  4PM6 A;  4IBR A;  4IVI A;  4B4Z A;  5HW3 A;  5CHU A;  1BZA A;  1RP5 A;  2ZM2 A;  1XKZ A;  1K6S A;  5FSR A;  4S2N A;  4ZAM A;  3MKE A;  4MEZ A;  3NIA A;  3TSG A;  2JE5 A;  3QHY A;  4R1G A;  1MY8 A;  4KZ7 A;  3G2Y A;  4PMA A;  3O86 A;  5J8X A;  4KG6 A;  3IXB A;  4KZ8 A;  4JKT A;  1LHY A;  3AGF A;  3RJU A;  3HUO A;  4WM9 A;  3HLG A;  3S4X A;  4RX3 A;  4YFM A;  3OCN A;  3G30 A;  5FQK A;  2Q9N A;  4S2N C;  4XUX A;  5HX9 A;  2WAD A;  4XUZ A;  4JXS A;  4KQO A;  3VP4 A;  1YMX A;  5GL9 A;  4R4S A;  5KZH A;  5FAO A;  3W4P A;  3IH8 A;  3GTC A;  3SH9 A;  4E3K A;  4RX2 A;  4K91 A;  5A90 A;  4WZ4 A;  3C4O A;  4WYY A;  2B5R A;  1W79 A;  4DXB A;  4CJN A;  3ZG7 B;  3Q7Z A;  2DRW A;  1S0W A;  1K56 A;  4OVD A;  1IKI A;  5FQI A;  1TDG A;  2OSU A;  3GV9 A;  4OPY A;  5CED A;  3AGD A;  1DJA A;  3A3J A;  2X71 A;  1ALQ A;  3C5A A;  3BFF A;  1MWS A;  4LEN A;  2UWX A;  4OQ0 A;  1ONH A;  3UN7 A;  5BOH A;  2EXB A;  1BUE A;  3IH9 A;  1PWD A;  1XP4 A;  3GMW A;  3VOY A;  1CEG A;  1U60 A;  1ZC2 A;  2XEP A;  1E3U D;  2WKI A;  2Y2I A;  1H8Z A;  3D4F A;  3FV7 A;  3W8K A;  3C7U A;  4UA6 A;  5M18 A;  1TVF A;  2IWB A;  3VP3 A;  4HBT A;  2XQZ A;  2G2U A;  3GQZ A;  3BFC A;  4S2P A;  3PBT A;  4EV4 A;  4BL2 A;  5CEC A;  1ESI A;  3MKF A;  4O7D A;  2VGK A;  3ISG A;  4EWF A;  3IXG A;  1YMS A;  2P74 A;  3G31 A;  4GKU A;  4HBU A;  3G4P A;  3MXR A;  3PAG A;  5CXW A;  4EBN A;  5AQB A;  4ZDX A;  5CEB A;  1KVM A;  2QZ6 A;  4Y7P A;  3HLC A;  5KSC A;  4JXW A;  5FQM A;  4X55 A;  3OPP A;  1ERM A;  1CI9 A;  3HLW A;  1YM1 A;  3LY3 A;  4KQR A;  4B88 A;  1FR1 A;  2A49 A;  3ZG0 A;  5EOE A;  2ZC5 B;  2Y2H A;  2V20 A;  3Q82 A;  5A93 A;  4N92 A;  3HL9 A;  3VP2 A;  1SDE A;  1M40 A;  2CC1 A;  4OLG A;  4E6X A;  3QNB A;  1BUL A;  5FI7 A;  1MXO A;  4GZB A;  4DKI A;  1O07 A;  4KG2 A;  1K57 A;  5HL1 A;  1IEM A;  1YLJ A;  5JYO A;  3FWL A;  5DF7 A;  5EVL A;  3FYZ A;  1JWV A;  1CEF A;  2ZQD A;  4KZB A;  4S2K A;  4KZ6 A;  5CGW A;  5TFQ A;  3WWX A;  1KGE A;  2ZQ8 A;  3S22 A;  3ZVT A;  4DDY A;  2HPB A;  3G34 A;  1YLZ A;  5JYP A;  1HZO A;  5FI6 A;  5DTK A;  2Y2N A;  3FKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...