4X56A

Structure of the class d beta-lactamase oxa-160 v130d in acyl-enzyme complex with ceftazidime
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
245
structure length
244
Chain Sequence
MHISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSADPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTSQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Class D beta-lactamase OXA-160
publication title Structural Basis of Activity against Aztreonam and Extended Spectrum Cephalosporins for Two Carbapenem-Hydrolyzing Class D beta-Lactamases from Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 79
structure length 244
sequence length 245
ec nomenclature
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4x56A00
1E3UD 3ZG0A 4OOLA 3HLGA 3IH8A 4KZ3A 2ZLYA 5M1AA 4OP5A 2X71A 2V20A 4S2JA 4DE3A 3P09A 3IWOA 3QNCA 4S2NC 2WK0A 4FSFA 2Y2LA 3HLFA 3IQAA 1MWSA 4MEZA 4JPMA 3CJMA 1BTLA 3O87A 4QY6A 1Y54A 1KE0A 3JYIA 2C5WB 3FV7A 4KG2A 4OVDA 4BJPA 1ERQA 3TG9A 1K57A 2PU2A 1XKZA 2RCXA 1TVFA 2XDMA 3P98A 3BFGA 2ZQDA 4B88A 3MZEA 3Q07A 3LY3A 2EX9A 4Y0TA 1KDSA 1CEGA 2OV5A 1XA7A 1BUEA 2HDRA 1H8YA 2H0TA 2WAFA 2ZQ9A 2GDNA 1BT5A 2J9PA 3ZG9B 2ZQAA 3G2YA 3HUOA 5E2GA 3WS5A 4ID4A 1BLPA 3IXDA 2HP6A 4HBUA 3TSGA 1YLPA 4WMCA 2Q9NA 2ZM2A 4U0XA 3W4PA 5FI2A 1K54A 5FI6A 3VOYA 1PYYA 4IBRA 5DTKA 3UPOA 3IHAA 4RYEA 5FA7A 5J8XA 2QPNA 2R9XA 2J8YA 4RX2A 1FOFA 4S2NA 3DTMA 5CHJA 2EFUA 1YQSA 2Y2GA 3G31A 3GVBA 3PBSA 4S2KA 4E6WA 5AQAA 4S2OA 3ZGAB 2WZZA 5CEDA 3WS2A 5FDHA 4ZJ1A 4OKPA 5EUAA 1PI4A 4KZ6A 3D4FA 4FD8A 1Q2PA 2UWXA 5HL1A 4MBKA 1NY0A 3W4OA 4S2MA 5EVID 5HAPA 4UAAA 3IF6C 2Z2LB 3HUMA 2BG1A 3M6BA 4P85A 3EQUA 4P87A 4KZ9A 3TOIA 5DF7A 1YMXA 3M2KA 4JF4A 1K4FA 1LHYA 3BEBA 1WYCA 4OQGA 4OONA 2OLUA 5JYOA 2WKEA 4ZBEA 1XGIA 4R4RA 5GHXA 3HLCA 1AXBA 4R23A 4PM7A 5GLAA 3C4PA 4Q8IA 3SH7A 2P9VA 3V3SA 1VQQA 1TDGA 5DF8A 1JVJA 4N9LA 1JWVA 4E3KA 3ZNYA 2Y2MA 1KGGA 4E3JA 3NC8A 1RGYA 3A3JA 3UE1A 3A3IA 1KE4A 2EX2A 1E4DA 3I7JA 1GHIA 5F83A 3BRMA 4EBLA 1YLYA 3G32A 1DJBA 5JYPA 4KZ5A 4MNRA 4B4ZA 4LV0A 4K0XA 5EVIC 3G34A 4GZBA 4NK3A 3G2ZA 3HUNA 3QNBA 4HBTA 1C3BA 1SHVA 5F82A 2X02A 1EI5A 3O3VA 1ZC2A 1SDEA 2XEPA 3UNWA 4BENA 4LCMA 5BOHA 3IF6B 4OP8A 4XUXA 3PBQA 4Y0UA 3OCLA 2J9OA 3C7UA 3OCNA 4HEFA 3PAEA 2ZD8A 4WBGA 3VP4A 2WGIA 3ZG7B 3ITAA 4JKTA 1ZG4A 4OQHA 4BL2A 3A3FA 3MKFA 1IYPA 2WYXA 1FCOA 4X68A 5U47A 3FKWA 1ALQA 1LI9A 1LL9A 2EX6A 2WAEA 2XQZA 1L2SA 3ZVWA 5EVLA 3SH9A 3M2JA 4PPRA 4DKIA 4D2OA 1S0WA 5CHMA 1W8QA 3FZCA 2H10A 3GV9A 3IXHA 5CGXA 1CI9A 1ZG6A 5M18A 3VP2A 3BM6A 4ZAMA 1KDWA 2ZC5B 1YM1A 3HL9A 4OPRA 5HAIA 3HVFA 5AQBA 1O07A 2BLSA 3HLBA 3DWKA 1MWTA 5EVIB 2QMIA 2G2WA 3UPNA 4DXCA 5KMWA 1FSYA 3VOZA 3N8LA 1M6KA 3ISGA 5A91A 3NI9A 3S1YA 2DCFA 2HDQA 5FATA 5TGFA 5D3OA 4P0MA 3RJUA 4H8RA 5KZHA 1J9MA 4E3NA 2IWBA 3BECA 2XFTA 1TEMA 1MWUA 1EROA 4O7DA 4DF6A 1YLZA 3A3EA 4OLGA 3QHYA 2R9WA 4E3IA 3DWZA 1E25A 4R1GA 3MXSA 4B4XA 2A3UA 3HLWA 1L0DA 1LLBA 3WS0A 2DRWA 4JF6A 5GL9A 1U60A 1NJ4A 5DF9A 4OPYA 4WYYA 2EXAA 4E3LA 2WZXA 3V3RA 5CGSA 4EBPA 3PTEA 1HZOA 2HP5A 4L0LA 5IHVA 3G30A 4F94A 1ES3A 1LI0A 1ES5A 1GHPA 1JWPA 2Y2KA 1GHMA 1SCWA 3VSLA 1PWDA 3IT9A 1GCEA 3VSKA 5I94A 3N6IA 2C6WB 1I2WA 4S2LA 2Y59A 4N92A 1Z6FA 2Y2PA 4OQIA 1NYMA 1PW8A 1PW1A 5HARA 3NDEA 3LCEA 4OLDA 1K55C 1K6SA 1IKGA 3IXBA 4GOGA 1OMEA 1DJCA 4UA7A 2Y2QA 4BD0A 2ZMAA 3BFFA 1LL5A 2QZ6A 2ZJ9A 3UN7A 2FFFB 2WGWB 3GR2A 3GSGA 5FQ9A 2X01A 2XD5A 2I72A 2ZQCA 4N1XA 5HX9A 4QJGA 1NXYA 4YFMA 3WS1A 3Q81A 1IEMA 1E3UA 3UY6A 1FR6A 4N1HA 2G2UA 3SS4A 3VMAA 3LO7A 1K56D 2EXBA 1L0EA 3E2KA 4CPKA 2Y4AA 1IYSA 4X55A 3NDGA 2JE5A 3UO9A 3W8KA 5E2EA 3M6HA 2ZC4B 4LCLA 5GLBA 5FAQA 5FQQA 1PI5A 2WUQA 1ONGA 1NZOA 1JTDA 3GRJA 4N9KA 5E2HA 3MXRA 4ZJ2A 2ZC3B 1DY6A 4QU3A 2Y55A 3BLSA 1FR1A 3EQVA 1ERMA 1K25A 4S2IA 3S4XA 4KZ7A 1CEFA 3ZCZA 5HW3A 3G35A 4LV3A 4DE0A 5A90A 1K55A 3CG5A 4GKUA 1ES4A 3WS4A 1MBLA 2Y2NA 2PBYA 3A3DA 3WRZA 3BLMA 3G4PA 1XGJA 3OZHA 4PM5A 1JWZA 2OSUA 3IF6A 4GN2A 4UHUA 1QMEA 3PBOA 1ONHA 2Y91A 4PM6A 5CTNA 3UE3A 5CRFA 4DXBA 1MWRA 4GDNA 2XK1A 1GA0A 4X6TA 2H5SA 4IBXA 4LV1A 5EECA 4ZJ3A 2Y2HA 2E8IA 3O88A 2FFYA 5EOOA 2WADA 2XD1A 4WMCD 1IYOA 1YMSA 2HPBA 4DDYA 5CGWA 4C3QA 4KZ4A 1YLTA 1ES2A 2HDSA 2JCHA 3OPLA 1CI8A 4JF5A 5KSCA 3N8SA 4LENA 1K57C 3NCKA 1BZAA 3SS5A 1KVMA 4OPQA 3UDIA 3DW0A 3MZFA 4QB8A 5EPHA 5CECA 4U3TA 3MZDA 4U0TA 4GB7A 5EVIA 5FASA 1ESIA 4KZAA 3V50A 1FCMA 1ZKJA 2JBFA 1IKIA 1MKIA 3CZDA 3S22A 3W4QA 1YLJA 3N7WA 1KE3A 2V2FF 2JC7A 4X69A 4Y7PA 2DNSA 4ZTKA 2XH9A 2ZQ7A 1H8ZA 1L0FA 1MY8A 1YT4A 3PBNA 4KQRA 2IWDA 5FQIA 4Z9QA 3V39A 2B5RA 3AGEA 3Q7ZA 3GTCA 1BLCA 4MBFA 5L2FA 1K54C 5CERA 2XFSA 2PU4A 4QD4A 1I2SA 4X53A 2XGNA 2Q9MA 4FCFA 5CTMA 2ZC7A 2OLVA 3BFEA 4JBFA 2Y2IA 4WEKA 2P74A 3ZHHA 5DTTA 3NY4A 1I5QA 1DJAA 4K91A 4KG5A 4PMAA 4R3BA 3IWQA 4KENB 3SH8A 3VFFA 1IELA 5TFQA 2Y2OA 5DVAA 2EFXA 1SKFA 3PAGA 4GDBA 3LEZA 4WZ5C 3VP3A 4S2PA 5F1FA 3UE0A 1NRFA 4R3JA 4E3MA 4A5RA 3NBLA 2ZM0A 3ZG8B 5G18A 3HLDA 3ZVTA 3UPPA 3FYZA 2XR0A 3HBRA 3OPPA 1M40A 3Q7VB 4GD6A 1HVBA 3N4IA 5EOEA 5FSRA 4JLFA 4R4SA 4EBNA 3Q7VA 3ZNTA 5M19A 2VGJA 4BQMA 1RP5A 3Q82A 1XPBA 4KG6A 3OPHA 4KZ8A 4OH0A 4WELA 4MLLA 5CEBA 2CC1A 1K4EA 4OQ0A 5GLDA 4EUZA 5KSHA 3ZFZA 4CJNA 4KQOA 3O86A 1WE4A 5E2FA 1KVLA 1HD8A 4E6XA 3C4OA 3AGDA 1ESUA 2WGWA 4FH2A 4DRTA 1IYQA 3VP0A 3MBZA 4GD8A 1W5DA 1FCNA 3E2LA 1BSGA 4RA7A 1PWCA 2Z2MB 1MPLA 2WKHA 4EWFA 3MFDA 4OOMA 3PBTA 1VM1A 4JXGA 4UA9A 5CHUA 5A93A 1YLWA 3OPRA 1W7FA 3IF5A 5A92A 4BLMA 5FAPA 1KGEA 3CMZA 1RGZA 2XF3A 3MKEA 5FI7A 4OOYA 3UDFA 4WZ5A 3FWLA 1MXOA 5GHYA 4HESA 4LV2A 4RX3A 1KGFA 1K38A 4NETA 3ZDJA 1N9BA 1W79A 1O7EA 4MBHA 4DE1A 1N4OA 3V5MA 3C5AA 1BLSA 4IVKA 1FSWA 1XP4A 4JXVA 3BFDA 5HFOA 3ZG5A 3GQZA 4WM9A 4R0QA 4XXRA 2J7VA 4K0WA 2P9VB 5FQMA 4EV4A 2H0YA 1GA9A 3HREA 1CK3A 3IH9A 4DE2A 5FAOA 4X56A 3BFCA 3PBRA 5F1GA 3IWIA 3RXXA 3BYDA 2ZM8A 4WZ4A 4C6YA 1PZPA 1PZOA 3FKVA 2Y2JA 1TDLA 3B3XA 4RVAA 3IHBA 1NZUA 4IEDA 2WKIA 1PWGA 1EWZA 1H5XA 4QY5A 3VFHA 5E43A 3VP1A 2XLNA 4PM8A 2A49A 4KZBA 1BULA 2IWCA 4Y0OA 3N8RA 4KQQA 4M3KA 3RXWA 1S6RA 5FQKA 5GHZA 4YINA 3IXGA 1QMFA 4P6BA 1L0GA 1G68A 3GMWA 1WYBA 2VGKA 3NIAA 4BD1A 4UA6A 3SOIA 4ZDXA 5AQ9A 2EX8A 3AGFA 3C7VA 4QHCA 1K6RA 1XA1A 3ITBA 5TR7A 5FQJA 2HDUA 3WWXA 1RCJA 1BLHA 4WEJA 3Q1FA 2RL3A 5CXWA 5DTSA 4OPZA 4BL3A 5HAQA 1FQGA 1JTGA 2WGVA 4GNUA 4IVIA 4EQIA 1NYYA 1W8YA 4XUZA 3WRTA 4DDSA 1Q2QA 5EE8A 4JXSA 2ZQ8A 2V1ZA 5GLCA 4PM9A 1PIOA 1XX2A 4FH4A 3SS3A 3UDXA 5AQ7A 4JXWA 3OC2A 1G6AA 1XXMA 2HP9A 4C75A 1HTZA 1K56A 3HLEA 1SDNA 4E3OA 3LY4A 2ZC6B
chains in the Genus database with same CATH superfamily
1E3UD 4ARZB 1TF1A 2ZLYA 4F3LB 4S2JA 4F3LA 3QNCA 2WK0A 2Y2LA 3IQAA 4JPMA 4QY6A 1H3QA 1Z09A 4OVDA 4CLCC 1STZA 2PU2A 3BFGA 3LICA 3H9WA 4HP9A 3Q07A 2EX9A 1CEGA 2OV5A 1S4RA 2W3HA 1H8YA 2H0TA 4KQDA 1BT5A 3HUOA 5E2GA 1HLUP 3IXDA 4HBUA 3OLOA 4PAUA 1DP6A 3FG8A 1G5UA 3UPOA 2J8YA 4UQIS 3G31A 3CAXA 5AQAA 4S2OA 2XRNA 3T1XA 5FDHA 4ZJ1A 1PNEA 5HWVA 3LR5A 4CLCB 4R38A 1NY0A 4UAAA 2MJ6A 4FOFA 3R7WA 2JN7A 1YMXA 3M2KA 1K4FA 1WYCA 4OONA 5JYOA 3HLCA 4R23A 2H28A 5GLAA 2QHKA 2L0WA 3V3SA 1CJFA 1JWVA 4E3JA 3A3IA 2EX2A 3TJZC 3I7JA 4NXFA 5F83A 2P08A 4K0XA 1UGUA 4EETB 3HUNA 1C3BA 3O3VA 1EI5A 2XEPA 3E4QA 3TE8A 3OCLA 2J9OA 4WBGA 3ITAA 4X68A 1ALQA 1LI9A 2XQZA 3DTEA 1L2SA 3D9YA 3L7HA 3QP2A 3SH9A 1NRJA 3FZCA 3KYQA 3PHYA 3BM6A 3HLBA 3DWKA 1MWTA 4DXCA 2QMIA 1FSYA 3NI9A 3CHWP 5TGFA 3BWLA 5D3OA 1J9MA 4K08A 3BECA 3GDIA 1MWUA 1J3WA 4DF6A 4OLGA 3MXSA 1TD5A 2A3UA 1L0DA 5GL9A 4OPYA 2EXAA 4E3LA 4ETZA 3LIBA 3BW6A 3G30A 4LPZA 3V67A 3CUEA 1ES3A 1GHMA 1PWDA 3MR0A 4S2LA 3D3OA 1Z6FA 4PHTA 1NYMA 1PW8A 2Z6CA 1YSQA 4H6JB 2PD8A 1LL5A 5FQ9A 3GSGA 3NJAA 5DJUA 1W63M 4LGWA 1DRMA 1NXYA 2PBDP 5J4EA 1E3UA 3UY6A 4Y5FA 3SS4A 2G2UA 3VMAA 3LO7A 5HPIA 4CPKA 2Y4AA 1IYSA 4X55A 2JE5A 4BBTA 3W8KA 2J3TC 5E2EA 3M6HA 5FAQA 3CI6A 2GJ3A 1PI5A 1P97A 2OAQ1 3E4OA 2PAVP 3UB8A 2ZC3B 4QU3A 2Y55A 4Y13A 3ZCZA 1CEFA 4KUKA 3CG5A 5DKKA 3S7QA 2PT7A 4GN2A 4JGOA 3PYPA 4GDNA 1GA0A 4IBXA 4WF0A 2W0NA 3O88A 2XD1A 1IYOA 2HPBA 2GNXA 1VETB 4DDYA 4C3QA 1VETA 2JCHA 1CI8A 4JF5A 1OTDA 4EU0A 2XA7S 3OOVA 3MZFA 5CECA 3RTYA 2I9VA 1V9YA 2HV1A 1ESIA 3V50A 4PKYA 1IKIA 1MKIA 3W4QA 5L8MA 1YLJA 2V2FF 4L9GA 3CLOA 4ZTKA 1H8ZA 3PBNA 1YT4A 3AGEA 3GTCA 5L09A 1I2SA 4X53A 2XGNA 4FCFA 2OLVA 3UB5P 1DJAA 4R3BA 1XJ2A 4KENB 4L9EA 3S7NA 2V1BA 3SH8A 1IELA 5HDCA 5HDSA 2A24A 1SKFA 3PAGA 1LL8A 4R3JA 3E98A 5G18A 3ZVTA 3KSFA 4GD6A 2PRFA 3N4IA 4EBNA 4QWOA 3PR6A 3UB7A 1OJGA 3ZNTA 4KZ8A 4WELA 5CEBA 2CC1A 4OQ0A 1G28A 4Q0IA 2VKSA 1KVLA 2VGLM 3AGDA 4DRTA 3VP0A 4GD8A 3D72A 3E2LA 2Z2MB 1OJ5A 3KX0X 2WKHA 4AFIA 1YLWA 3OPRA 4BLMA 1KGEA 3CMZA 2XF3A 3FWLA 1MXOA 4HESA 1W79A 3T4KA 3F1PB 3U2AA 1S1YA 3F1PA 2D01A 2OAP1 1CK3A 3PBRA 3IWIA 4NG2A 3RXXA 5CX7A 3FKVA 3B3XA 2WKIA 1PWGA 1EWZA 2W3GA 5E43A 3VP1A 4KZBA 4MMNA 2EWVA 3F1OA 3N8RA 4KQQA 5FDSA 4WUJA 4P6BA 2O9AA 1L0GA 1XA1A 5TR7A 3ITBA 2WKPA 1ZTUA 4HY8A 1RCJA 5DTSA 4OPZA 1YAXA 4BL3A 4I3JA 4GNUA 2W3FA 2PYPA 4GJ4A 1Q2QA 2ZQ8A 4CLCD 2V8FA 4G3KA 3KYZA 4HOIA 4G3WA 4FH4A 1T1AA 5F5YA 3OC2A 1V9ZA 2DMWA 2HP9A 5EM1A 3HLEA 1DP8A 4HJ6A 3HLGA 5M1AA 4OP5A 2LB9A 2V20A 4DE3A 1S4SA 3F1NA 2VK3A 4MEZA 3O87A 3PXPA 4O0PA 2C5WB 4BJPA 4UEYA 2IA2A 1K57A 1XKZA 2RCXA 5AVFA 3LY3A 4Y0TA 1XA7A 2HDRA 1ODVA 2ZQ9A 2GDNA 3ZG9B 1OTIA 2ZQAA 3G2YA 3C2WA 1OTAA 1YSPA 1K54A 1PYYA 4WN5A 5J8XA 3DAVA 5CHJA 3KO6A 3PBSA 3GVBA 1GSWA 3RH8B 5CEDA 4II7A 1PI4A 3H7WA 2UWXA 5L10A 4S2MA 3CPTB 3IF6C 3HUMA 1JNUA 3M6BA 4P85A 3EQUA 4WL9A 5DF7A 2W3DA 5KIZA 2OLUA 4ZBEA 1XGIA 4R4RA 5AJGA 3HJKA 2W1TA 4Q8IA 2P9VA 1MC0A 5DF8A 1JVJA 4XT2A 1LT0A 2Y2MA 3NC8A 3A3JA 3UE1A 2L1MA 3G32A 1DJBA 5JYPA 3A0SA 4KZ5A 4B4ZA 5EVIC 3QNBA 4HBTA 5EV0A 3T4OA 3UNWA 1SDEA 1VHMA 3IF6B 4XUXA 3OCNA 3PAEA 3IX8A 4IJGA 2KOIA 4P6ZM 1L3LA 1IYPA 2WYXA 5U47A 3FKWA 2R78A 2WAEA 3ZVWA 3QP1A 5IT5A 3CITA 3M2JA 4PPRA 3ICYA 1CI9A 1GSXA 3VP2A 4ZAMA 2ZC5B 5HAIA 1O07A 1NLZA 2BLSA 5EVIB 5KMWA 4ARZA 4E04A 3VOZA 3N8LA 5A91A 3UMDA 2DCFA 3RJUA 4H8RA 4NXBA 4HH2A 4E3NA 2IWBA 2XFTA 1TEMA 1YLZA 3A3EA 3VV4A 2R9WA 4B4XA 3LIFA 1XFNA 5L07A 1CQAA 4L0LA 1GHPA 1JWPA 3LR4A 3IT9A 5I94A 3VSKA 3MMHA 2C6WB 2J3TD 3LI8A 4OQIA 4IUKA 4OLDA 2HF6A 2INWA 1OMEA 1DJCA 2Y2QA 2VA0A 4CLCA 2E8JA 1SZVA 2QZ6A 2ZJ9A 4UQIM 3UN7A 2WGWB 3GR2A 2I72A 2ZQCA 4N1XA 4Y17A 5HX9A 4YFMA 3Q81A 1KOUA 1FR6A 4N1HA 3FPVA 4NKPA 2EXBA 1L0EA 3E4PA 5J7EA 2ZC4B 1ONGA 4N9KA 3MXRA 2NUTC 3EQVA 1K25A 3S4XA 5HW3A 3G35A 1X0OA 5A90A 2EA9A 5HZHA 3WRZA 4PM5A 1QMEA 1ONHA 2Y91A 4Y15A 1MWRA 1G6OA 4IUHA 3EGDC 3JVVA 5EOOA 4WMCD 4ZRRA 1YLTA 2HDSA 5KSCA 3P01A 3SW1A 3SS5A 1KVMA 3EEHA 3BY9A 2OWHA 4KZAA 1FCMA 5F68A 3S22A 1S1ZA 4BWIA 3N7WA 3IS2B 2JC7A 3IS2A 4IHQA 4Y7PA 2ZQ7A 3MQ0A 4KQRA 5FQIA 4Z9QA 5L2FA 5CERA 2XFSA 4GLQA 2PU4A 2JKTI 4JBFA 3MFXA 2P74A 3ZHHA 4K91A 2EFXA 2O0YA 1T19A 1IOUA 3LEZA 5DKLA 4B9OA 3UE0A 4GW9A 5IU1A 3LI9A 3UPPA 2XR0A 3HBRA 1M40A 3NHQA 5M19A 4X1LA 2VLGA 2VGJA 4KG6A 4MLLA 5GLDA 4H6JA 3ZFZA 5EM0A 3LIEA 3O86A 1HD8A 4M4XA 4E6XA 4HI4A 4FH2A 3UB9A 1XJ4A 4GS9B 2AVXA 1W5DA 1FCNA 1BSGA 3L9KA 3MFDA 1VM1A 5CHUA 3IF5A 5A92A 1Y28A 5FAPA 3MKEA 1RGZA 4OOYA 2V0UA 5GHYA 4RX3A 4NETA 4MBHA 3VOLA 3TW8A 3C5AA 3T4LA 4JXVA 3ZG5A 5HFOA 4WM9A 4R0QA 2J7VA 1TS8A 4K0WA 2XROA 4EV4A 2H0YA 2Y79A 1F98A 3IH9A 5FAOA 4X56A 4I5SA 4WZ4A 2ZM8A 5TJJA 1PZOA 2Y2JA 1TDLA 4RVAA 3IHBA 1UWNX 3KSHA 2A49A 4Y0OA 2JKRI 4D60A 5HD3A 1G68A 3GMWA 1WYBA 4BD1A 5AQ9A 4QHCA 1K6RA 5FQJA 3QP4A 3WWXA 4WEJA 3Q1FA 3OBFA 2ZL1B 1FQGA 1JTGA 4IVIA 1NYYA 3WRTA 2V1ZA 5I5LA 3RFBA 1PIOA 1XX2A 2XA7M 4JXWA 5EVEA 3LY4A 2ZC6B 2WKQA 3T12B 4OOLA 3ZG0A 1D06A 3IH8A 3CWFA 3R4KA 3MS6A 4S2NC 4FSFA 4LRXC 1T1BA 1MWSA 1BTLA 1Y54A 1LSXA 1A0KA 1KE0A 1F5MA 2O9BA 3JYIA 3FV7A 4EUVA 4O01A 2XDMA 3ZYTA 3MZEA 1KDSA 2OOLA 5EFWA 2J9PA 4GCZA 4MN7A 4ID4A 1TS0A 4CQHA 1YLPA 4WMCA 2GZAA 2Q9NA 3W4PA 3MQQA 5FI6A 3BQAA 3VOYA 5DTKA 3T4QA 4RYEA 5FA7A 1N9LA 4S2NA 1FOFA 3KYEA 2WZZA 3WS2A 1BYWA 2QYBA 5HL1A 4MBKA 4BMWA 5J3WA 5EVID 5HAPA 4O8GA 2Z2LB 3P7NA 4P87A 3KSIA 4HJ3A 4KZ9A 3TOIA 3LUQA 3HCYA 1LHYA 3BEBA 4LRYC 4OQGA 1LSVA 2VV6A 1EW0A 2QJ5A 4DJ2A 3W2ZA 5HPFA 4E3KA 3ZNYA 1RGYA 2Y8HA 3FPWA 1KE4A 1E4DA 3BRMA 4EBLA 2V1AA 4MNRA 4LV0A 3EOIA 4GZBA 3BY8A 1SHVA 4LLOB 2X02A 1ZC2A 4LCMA 5HWWA 5BOHA 1ACFA 2WKRA 3PBQA 5HDDA 2YKFA 1CF0A 4R3AA 2WGIA 4OQHA 4BL2A 5F6AA 1FCOA 3K3DA 2EX6A 2PR5A 1OT9A 5EVLA 3B33A 1S0WA 5CHMA 3IXHA 3E0YA 3SZTA 3T50A 1KDWA 3HVFA 4FTXA 5HD5A 4Z1WA 5FATA 5KZHA 3LR3A 2ZOIA 1EROA 3VE4A 4O7DA 1OTBA 1NLYA 3QHYA 4E3IA 4R1GA 1LLBA 3H82B 2DRWA 3WS0A 5FL3A 1NJ4A 5DF9A 4WYYA 2JKTM 5CGSA 4EBPA 2P04A 4F94A 1LI0A 1ES5A 2Y2KA 1XJ3A 3N6IA 1I2WA 2Y59A 3K3CA 4N92A 2G7UA 3NOPC 3LCEA 1K55C 4YOFA 1K6SA 2FZ0A 4UA7A 5FEGA 2ZMAA 3C30A 3BFFA 2M7UA 1P9RA 3MXQA 2FFFB 3CPTA 3WS1A 1IEMA 2W3EA 4EW7A 3E2KA 3T1QB 4EQ1A 4ME4A 3UO9A 2XSSA 4LCLA 5GLBA 3T4SA 2PDRA 3LR0A 1N9OA 2WUQA 3C8CA 2V9AA 1NZOA 2O99A 3GRJA 5E2HA 4ZJ2A 1TS7A 1DY6A 5DJTA 3A0RA 3BLSA 1FR1A 3BJNA 1K55A 2VJWA 4I3IA 2Y2NA 2PBYA 3A3DA 3G4PA 1XGJA 2OSUA 3IF6A 1FILA 4PM6A 5CTNA 3UE3A 4Q0HA 4DXBA 2XK1A 4LV1A 5EECA 4ZJ3A 4HHDA 1YMSA 2JKRM 4KZ4A 3OPLA 1IFQA 4LENA 3LYXA 1BZAA 3UDIA 3DW0A 4I38A 2JHEA 4QB8A 4X25A 4U3TA 4U0TA 5EVIA 2BTFP 1ZKJA 2JBFA 2EWWA 2Q0OA 2YKHA 2J80A 1KE3A 4X69A 3T1RA 2DNSA 1L0FA 2VEAA 4HIAA 3U4LP 2IWDA 3NECA 3V39A 4ESPA 3Q7ZA 1BLCA 1VEUB 2Q9MA 5CTMA 1VEUA 3S7OA 2KX6A 5DTTA 4KG5A 4PMAA 1T18A 5TFQA 2Y2OA 4JGRA 1W63Q 1F9IA 4GDBA 2HZ5A 3VP3A 4S2PA 5F1FA 4E3MA 3NBLA 2ZM0A 3ZG8B 3HLDA 2K7SA 3UE6A 3Q7VB 4JLFA 3Q7VA 4BQMA 3Q82A 1XPBA 3G6OA 2UV0E 1S66L 1K4EA 5HWTA 4EUZA 5KSHA 4KQOA 5E2FA 1WE4A 4RQ9A 3C4OA 2WGWA 3K2NA 1IYQA 5LBRA 5HSQA 1PWCA 1MPLA 4JXGA 5A93A 4UA9A 1W7FA 2ZBBA 4HP4A 3R7WB 4DN0A 1K38A 3LEQA 1YPRA 1O7EA 1T1CA 1N4OA 3V5MA 1XP4A 3BFDA 3EWKA 4XXRA 3S7PA 5FQMA 1YKDA 4DE2A 3BFCA 5F1GA 2QKPA 3NOUC 4HQAA 3LFVA 1NZUA 4IEDA 2M7VA 1H5XA 4QY5A 2XLNA 1BULA 1XFQA 1S6RA 5FQKA 5GHZA 3JVUA 2HJEA 2A2LA 3SOIA 2EX8A 3C7VA 2ZOHA 5G4YA 5DFXA 2RL3A 5CXWA 1K0KA 5DFYA 4EQIA 1W8YA 4XUZA 5EE8A 4JXSA 5GLCA 4YWZA 1NWZA 1OPXA 5AQ7A 1G6AA 1HTZA 1OTEA 3CUEC 1SDNA 4G3VA 4KZ3A 1D7EA 3JPUA 2X71A 3P09A 3IWOA 2CMNA 3HLFA 5HL6A 3UB6A 4Y3IA 3CJMA 4CLCE 4KG2A 1TS6A 1ERQA 3TG9A 2VV7A 1TVFA 3P98A 3BQ8A 2L4RA 2ZQDA 4B88A 1P9WA 3LIAA 1BUEA 2WAFA 3WS5A 1BLPA 3QP8A 2HP6A 3TSGA 4HNBA 1D1JA 2ZM2A 2JKGA 4U0XA 5FI2A 4IBRA 1VB6A 3IHAA 2QPNA 2R9XA 4RX2A 5TBMB 3DTMA 2EFUA 5TBMA 1YQSA 2Y2GA 4S2KA 4E6WA 4GS9A 3ZGAB 1SKOB 4OKPA 5EUAA 4KZ6A 1SKOA 3D4FA 4FD8A 1Q2PA 1N9NA 4MN6A 3W4OA 2W1RA 5FEFA 2BG1A 4I39A 2NUPC 3B47A 4ETXA 4JF4A 1GSVA 2Z6DA 2WKEA 5GHXA 1AXBA 3LGOA 2D02A 4PM7A 3C4PA 3SH7A 4EERA 1VQQA 1TDGA 2GX5A 4N9LA 4LRZE 1KGGA 2QJ7A 1GHIA 1YLYA 1LSWA 3C38A 3G34A 4NK3A 3G2ZA 3IX3A 5F82A 4NXEA 3B42A 4BENA 4NEED 1PRQA 4OP8A 4Y0UA 3C7UA 4HEFA 3VP4A 2ZD8A 3ZG7B 2VV8A 4JKTA 1ZG4A 3A3FA 2ZL1A 3MKFA 1LL9A 2OWJA 4DKIA 4D2OA 3EEAA 1W8QA 2H10A 3GV9A 5CGXA 3UMEA 1ZG6A 4KUOA 5M18A 4OPRA 1YM1A 3HL9A 5AQBA 1OT6A 2G2WA 3UPNA 3T4TA 1M6KA 3ISGA 3S1YA 3TRCA 3NOTC 2HDQA 4P0MA 1MKMA 3DWZA 1E25A 4EEUA 2PYRA 3HLWA 4JF6A 1U60A 5C5KA 2WZXA 3V3RA 3PTEA 1HZOA 1FIKA 2HP5A 2A24B 5IHVA 1PFLA 1SCWA 3VSLA 5MC7A 1GCEA 2K2NA 3HJIA 2VGLS 3QP5A 1MZUA 2Y2PA 1PW1A 5HARA 3NDEA 1IKGA 3IXBA 4GOGA 4L9FA 4LFUA 4BD0A 2O9CA 1XJ6A 4B93A 3DTIA 2X01A 2XD5A 4QJGA 2M1CA 3IBRA 4GHIB 4WLAA 3ULFA 2KLIA 4GHIA 1K56D 3NDGA 5AVEA 3IBJA 5FQQA 1P0ZA 1Y4OA 3DTKA 1JTDA 2HJ9C 4BBVA 2B02A 2W27A 1ERMA 1F2KA 4S2IA 4KZ7A 4LV3A 4DE0A 4GKUA 1ES4A 1WA9A 3WS4A 1MBLA 2ACGA 3BLMA 3OZHA 1JWZA 2LB5A 4UHUA 3PBOA 5CRFA 4R70A 4X6TA 2H5SA 4QPRA 3ZQ5A 3F1OB 1H8MA 2Y2HA 2E8IA 2V8CA 2FFYA 2WADA 5CGWA 2J3WA 3EGXC 1ES2A 4FUWA 3N8SA 1K57C 5IS1A 3NCKA 2FH5A 4OPQA 5EPHA 3MZDA 4GB7A 1ZHHB 4HH3A 4HJ4A 5FASA 3KSGA 3IX4A 3CZDA 4DMZA 5A8BA 2XH9A 4NXGA 1MY8A 1AWIA 2B5RA 2JKFA 4MBFA 1K54C 4QD4A 4X1MA 2BASA 2ZC7A 3F1NB 3BFEA 2Y2IA 3H82A 3QP6A 4WEKA 3NY4A 1I5QA 3GECA 3IWQA 4PKYG 4R6LA 3VFFA 4EEPA 2P7JA 5DVAA 3T4JA 5K5BA 4WZ5C 1DP9A 1NRFA 4MN5A 4DJ3A 4A5RA 3FYZA 3OPPA 1HVBA 5FSRA 5EOEA 4R4SA 1RP5A 2HGVA 3OPHA 4OH0A 4MCWA 4JGPA 3DBAA 4CJNA 1UWPX 4I3AA 1ESUA 3MBZA 4RA7A 2KDKA 3H7WB 4EWFA 4OOMA 3PBTA 4YNRA 2ZMFA 3MJQA 5FI7A 3VE3A 3UDFA 4WZ5A 4LV2A 3ZDJA 1KGFA 1S67L 4Q0JA 1N9BA 4DE1A 1BLSA 4IVKA 1FSWA 3GQZA 3FC7A 2W1TB 2P9VB 1GA9A 3HREA 4XT2B 2B18A 2VX8A 3BYDA 4C6YA 3NULA 4Y2FA 1PZPA 2QWSA 3MQOA 2PD7A 2V0WA 3VFHA 4PM8A 2IWCA 4P6ZS 3MSHA 4M3KA 3RXWA 3O5YA 4YINA 3IXGA 1QMFA 2B95A 2PR6A 2VGKA 3NIAA 4UA6A 4ZDXA 3AGFA 4BBUA 2HDUA 2PHYA 1BLHA 1H0MA 3MF0A 4EESA 5HAQA 2WGVA 3LIDA 3T1SA 2VZWA 4MDZA 4DDSA 4JGQA 2ZMVA 4EXOA 4PM9A 3A0VA 3SS3A 5G4ZA 3UDXA 2K31A 1XXMA 4C75A 4E3OA 1K56A 5F69A
chains in the Genus database with same CATH topology
1E3UD 3ZG0A 4OOLA 3HLGA 3IH8A 4KZ3A 2ZLYA 5M1AA 4OP5A 2X71A 2V20A 4S2JA 4DE3A 3P09A 3IWOA 3QNCA 4S2NC 2WK0A 4FSFA 2Y2LA 3HLFA 3IQAA 1MWSA 4MEZA 4JPMA 3CJMA 1BTLA 3O87A 4QY6A 1Y54A 1KE0A 3JYIA 2C5WB 3FV7A 4KG2A 4OVDA 4BJPA 1ERQA 3TG9A 1K57A 2PU2A 1XKZA 2RCXA 1TVFA 2XDMA 3P98A 3BFGA 2ZQDA 4B88A 3MZEA 3Q07A 3LY3A 2EX9A 4Y0TA 1KDSA 1CEGA 2OV5A 1XA7A 1BUEA 2HDRA 1H8YA 2H0TA 2WAFA 2ZQ9A 2GDNA 1BT5A 2J9PA 3ZG9B 2ZQAA 3G2YA 3HUOA 5E2GA 3WS5A 4ID4A 1BLPA 3IXDA 2HP6A 4HBUA 3TSGA 1YLPA 4WMCA 2Q9NA 2ZM2A 4U0XA 3W4PA 5FI2A 1K54A 5FI6A 3VOYA 1PYYA 4IBRA 5DTKA 3UPOA 3IHAA 4RYEA 5FA7A 5J8XA 2QPNA 2R9XA 2J8YA 4RX2A 1FOFA 4S2NA 3DTMA 5CHJA 2EFUA 1YQSA 2Y2GA 3G31A 3GVBA 3PBSA 4S2KA 4E6WA 5AQAA 4S2OA 3ZGAB 2WZZA 5CEDA 3WS2A 5FDHA 4ZJ1A 4OKPA 5EUAA 1PI4A 4KZ6A 3D4FA 4FD8A 1Q2PA 2UWXA 5HL1A 4MBKA 1NY0A 3W4OA 4S2MA 5EVID 5HAPA 4UAAA 3IF6C 2Z2LB 3HUMA 2BG1A 3M6BA 4P85A 3EQUA 4P87A 4KZ9A 3TOIA 5DF7A 1YMXA 3M2KA 4JF4A 1K4FA 1LHYA 3BEBA 1WYCA 4OQGA 4OONA 2OLUA 5JYOA 2WKEA 4ZBEA 1XGIA 4R4RA 5GHXA 3HLCA 1AXBA 4R23A 4PM7A 5GLAA 3C4PA 4Q8IA 3SH7A 2P9VA 3V3SA 1VQQA 1TDGA 5DF8A 1JVJA 4N9LA 1JWVA 4E3KA 3ZNYA 2Y2MA 1KGGA 4E3JA 3NC8A 1RGYA 3A3JA 3UE1A 3A3IA 1KE4A 2EX2A 1E4DA 3I7JA 1GHIA 5F83A 3BRMA 4EBLA 1YLYA 3G32A 1DJBA 5JYPA 4KZ5A 4MNRA 4B4ZA 4LV0A 4K0XA 5EVIC 3G34A 4GZBA 4NK3A 3G2ZA 3HUNA 3QNBA 4HBTA 1C3BA 1SHVA 5F82A 2X02A 1EI5A 3O3VA 1ZC2A 1SDEA 2XEPA 3UNWA 4BENA 4LCMA 5BOHA 3IF6B 4OP8A 4XUXA 3PBQA 4Y0UA 3OCLA 2J9OA 3C7UA 3OCNA 4HEFA 3PAEA 2ZD8A 4WBGA 3VP4A 2WGIA 3ZG7B 3ITAA 4JKTA 1ZG4A 4OQHA 4BL2A 3A3FA 3MKFA 1IYPA 2WYXA 1FCOA 4X68A 5U47A 3FKWA 1ALQA 1LI9A 1LL9A 2EX6A 2WAEA 2XQZA 1L2SA 3ZVWA 5EVLA 3SH9A 3M2JA 4PPRA 4DKIA 4D2OA 1S0WA 5CHMA 1W8QA 3FZCA 2H10A 3GV9A 3IXHA 5CGXA 1CI9A 1ZG6A 5M18A 3VP2A 3BM6A 4ZAMA 1KDWA 2ZC5B 1YM1A 3HL9A 4OPRA 5HAIA 3HVFA 5AQBA 1O07A 2BLSA 3HLBA 3DWKA 1MWTA 5EVIB 2QMIA 2G2WA 3UPNA 4DXCA 5KMWA 1FSYA 3VOZA 3N8LA 1M6KA 3ISGA 5A91A 3NI9A 3S1YA 2DCFA 2HDQA 5FATA 5TGFA 5D3OA 4P0MA 3RJUA 4H8RA 5KZHA 1J9MA 4E3NA 2IWBA 3BECA 2XFTA 1TEMA 1MWUA 1EROA 4O7DA 4DF6A 1YLZA 3A3EA 4OLGA 3QHYA 2R9WA 4E3IA 3DWZA 1E25A 4R1GA 3MXSA 4B4XA 2A3UA 3HLWA 1L0DA 1LLBA 3WS0A 2DRWA 4JF6A 5GL9A 1U60A 1NJ4A 5DF9A 4OPYA 4WYYA 2EXAA 4E3LA 2WZXA 3V3RA 5CGSA 4EBPA 3PTEA 1HZOA 2HP5A 4L0LA 5IHVA 3G30A 4F94A 1ES3A 1LI0A 1ES5A 1GHPA 1JWPA 2Y2KA 1GHMA 1SCWA 3VSLA 1PWDA 3IT9A 1GCEA 3VSKA 5I94A 3N6IA 2C6WB 1I2WA 4S2LA 2Y59A 4N92A 1Z6FA 2Y2PA 4OQIA 1NYMA 1PW8A 1PW1A 5HARA 3NDEA 3LCEA 4OLDA 1K55C 1K6SA 1IKGA 3IXBA 4GOGA 1OMEA 1DJCA 4UA7A 2Y2QA 4BD0A 2ZMAA 3BFFA 1LL5A 2QZ6A 2ZJ9A 3UN7A 2FFFB 2WGWB 3GR2A 3GSGA 5FQ9A 2X01A 2XD5A 2I72A 2ZQCA 4N1XA 5HX9A 4QJGA 1NXYA 4YFMA 3WS1A 3Q81A 1IEMA 1E3UA 3UY6A 1FR6A 4N1HA 2G2UA 3SS4A 3VMAA 3LO7A 1K56D 2EXBA 1L0EA 3E2KA 4CPKA 2Y4AA 1IYSA 4X55A 3NDGA 2JE5A 3UO9A 3W8KA 5E2EA 3M6HA 2ZC4B 4LCLA 5GLBA 5FAQA 5FQQA 1PI5A 2WUQA 1ONGA 1NZOA 1JTDA 3GRJA 4N9KA 5E2HA 3MXRA 4ZJ2A 2ZC3B 1DY6A 4QU3A 2Y55A 3BLSA 1FR1A 3EQVA 1ERMA 1K25A 4S2IA 3S4XA 4KZ7A 1CEFA 3ZCZA 5HW3A 3G35A 4LV3A 4DE0A 5A90A 1K55A 3CG5A 4GKUA 1ES4A 3WS4A 1MBLA 2Y2NA 2PBYA 3A3DA 3WRZA 3BLMA 3G4PA 1XGJA 3OZHA 4PM5A 1JWZA 2OSUA 3IF6A 4GN2A 4UHUA 1QMEA 3PBOA 1ONHA 2Y91A 4PM6A 5CTNA 3UE3A 5CRFA 4DXBA 1MWRA 4GDNA 2XK1A 1GA0A 4X6TA 2H5SA 4IBXA 4LV1A 5EECA 4ZJ3A 2Y2HA 2E8IA 3O88A 2FFYA 5EOOA 2WADA 2XD1A 4WMCD 1IYOA 1YMSA 2HPBA 4DDYA 5CGWA 4C3QA 4KZ4A 1YLTA 1ES2A 2HDSA 2JCHA 3OPLA 1CI8A 4JF5A 5KSCA 3N8SA 4LENA 1K57C 3NCKA 1BZAA 3SS5A 1KVMA 4OPQA 3UDIA 3DW0A 3MZFA 4QB8A 5EPHA 5CECA 4U3TA 3MZDA 4U0TA 4GB7A 5EVIA 5FASA 1ESIA 4KZAA 3V50A 1FCMA 1ZKJA 2JBFA 1IKIA 1MKIA 3CZDA 3S22A 3W4QA 1YLJA 3N7WA 1KE3A 2V2FF 2JC7A 4X69A 4Y7PA 2DNSA 4ZTKA 2XH9A 2ZQ7A 1H8ZA 1L0FA 1MY8A 1YT4A 3PBNA 4KQRA 2IWDA 5FQIA 4Z9QA 3V39A 2B5RA 3AGEA 3Q7ZA 3GTCA 1BLCA 4MBFA 5L2FA 1K54C 5CERA 2XFSA 2PU4A 4QD4A 1I2SA 4X53A 2XGNA 2Q9MA 4FCFA 5CTMA 2ZC7A 2OLVA 3BFEA 4JBFA 2Y2IA 4WEKA 2P74A 3ZHHA 5DTTA 3NY4A 1I5QA 1DJAA 4K91A 4KG5A 4PMAA 4R3BA 3IWQA 4KENB 3SH8A 3VFFA 1IELA 5TFQA 2Y2OA 5DVAA 2EFXA 1SKFA 3PAGA 4GDBA 3LEZA 4WZ5C 3VP3A 4S2PA 5F1FA 3UE0A 1NRFA 4R3JA 4E3MA 4A5RA 3NBLA 2ZM0A 3ZG8B 5G18A 3HLDA 3ZVTA 3UPPA 3FYZA 2XR0A 3HBRA 3OPPA 1M40A 3Q7VB 4GD6A 1HVBA 3N4IA 5EOEA 5FSRA 4JLFA 4R4SA 4EBNA 3Q7VA 3ZNTA 5M19A 2VGJA 4BQMA 1RP5A 3Q82A 1XPBA 4KG6A 3OPHA 4KZ8A 4OH0A 4WELA 4MLLA 5CEBA 2CC1A 1K4EA 4OQ0A 5GLDA 4EUZA 5KSHA 3ZFZA 4CJNA 4KQOA 3O86A 1WE4A 5E2FA 1KVLA 1HD8A 4E6XA 3C4OA 3AGDA 1ESUA 2WGWA 4FH2A 4DRTA 1IYQA 3VP0A 3MBZA 4GD8A 1W5DA 1FCNA 3E2LA 1BSGA 4RA7A 1PWCA 2Z2MB 1MPLA 2WKHA 4EWFA 3MFDA 4OOMA 3PBTA 1VM1A 4JXGA 4UA9A 5CHUA 5A93A 1YLWA 3OPRA 1W7FA 3IF5A 5A92A 4BLMA 5FAPA 1KGEA 3CMZA 1RGZA 2XF3A 3MKEA 5FI7A 4OOYA 3UDFA 4WZ5A 3FWLA 1MXOA 5GHYA 4HESA 4LV2A 4RX3A 1KGFA 1K38A 4NETA 3ZDJA 1N9BA 1W79A 1O7EA 4MBHA 4DE1A 1N4OA 3V5MA 3C5AA 1BLSA 4IVKA 1FSWA 1XP4A 4JXVA 3BFDA 5HFOA 3ZG5A 3GQZA 4WM9A 4R0QA 4XXRA 2J7VA 4K0WA 2P9VB 5FQMA 4EV4A 2H0YA 1GA9A 3HREA 1CK3A 3IH9A 4DE2A 5FAOA 4X56A 3BFCA 3PBRA 5F1GA 3IWIA 3RXXA 3BYDA 2ZM8A 4WZ4A 4C6YA 1PZPA 1PZOA 3FKVA 2Y2JA 1TDLA 3B3XA 4RVAA 3IHBA 1NZUA 4IEDA 2WKIA 1PWGA 1EWZA 1H5XA 4QY5A 3VFHA 5E43A 3VP1A 2XLNA 4PM8A 2A49A 4KZBA 1BULA 2IWCA 4Y0OA 3N8RA 4KQQA 4M3KA 3RXWA 1S6RA 5FQKA 5GHZA 4YINA 3IXGA 1QMFA 4P6BA 1L0GA 1G68A 3GMWA 1WYBA 2VGKA 3NIAA 4BD1A 4UA6A 3SOIA 4ZDXA 5AQ9A 2EX8A 3AGFA 3C7VA 4QHCA 1K6RA 1XA1A 3ITBA 5TR7A 5FQJA 2HDUA 3WWXA 1RCJA 1BLHA 4WEJA 3Q1FA 2RL3A 5CXWA 5DTSA 4OPZA 4BL3A 5HAQA 1FQGA 1JTGA 2WGVA 4GNUA 4IVIA 4EQIA 1NYYA 1W8YA 4XUZA 3WRTA 4DDSA 1Q2QA 5EE8A 4JXSA 2ZQ8A 2V1ZA 5GLCA 4PM9A 1PIOA 1XX2A 4FH4A 3SS3A 3UDXA 5AQ7A 4JXWA 3OC2A 1G6AA 1XXMA 2HP9A 4C75A 1HTZA 1K56A 3HLEA 1SDNA 4E3OA 3LY4A 2ZC6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3U D;  3ZG0 A;  4OOL A;  3HLG A;  3IH8 A;  4KZ3 A;  2ZLY A;  5M1A A;  4OP5 A;  2X71 A;  2V20 A;  4S2J A;  4DE3 A;  3P09 A;  3IWO A;  3QNC A;  4S2N C;  2WK0 A;  4FSF A;  2Y2L A;  3HLF A;  3IQA A;  1MWS A;  4MEZ A;  4JPM A;  3CJM A;  1BTL A;  3O87 A;  4QY6 A;  1Y54 A;  1KE0 A;  3JYI A;  2C5W B;  3FV7 A;  4KG2 A;  4OVD A;  4BJP A;  1ERQ A;  3TG9 A;  1K57 A;  2PU2 A;  1XKZ A;  2RCX A;  1TVF A;  2XDM A;  3P98 A;  3BFG A;  2ZQD A;  4B88 A;  3MZE A;  3Q07 A;  3LY3 A;  2EX9 A;  4Y0T A;  1KDS A;  1CEG A;  2OV5 A;  1XA7 A;  1BUE A;  2HDR A;  1H8Y A;  2H0T A;  2WAF A;  2ZQ9 A;  2GDN A;  1BT5 A;  2J9P A;  3ZG9 B;  2ZQA A;  3G2Y A;  3HUO A;  5E2G A;  3WS5 A;  4ID4 A;  1BLP A;  3IXD A;  2HP6 A;  4HBU A;  3TSG A;  1YLP A;  4WMC A;  2Q9N A;  2ZM2 A;  4U0X A;  3W4P A;  5FI2 A;  1K54 A;  5FI6 A;  3VOY A;  1PYY A;  4IBR A;  5DTK A;  3UPO A;  3IHA A;  4RYE A;  5FA7 A;  5J8X A;  2QPN A;  2R9X A;  2J8Y A;  4RX2 A;  1FOF A;  4S2N A;  3DTM A;  5CHJ A;  2EFU A;  1YQS A;  2Y2G A;  3G31 A;  3GVB A;  3PBS A;  4S2K A;  4E6W A;  5AQA A;  4S2O A;  3ZGA B;  2WZZ A;  5CED A;  3WS2 A;  5FDH A;  4ZJ1 A;  4OKP A;  5EUA A;  1PI4 A;  4KZ6 A;  3D4F A;  4FD8 A;  1Q2P A;  2UWX A;  5HL1 A;  4MBK A;  1NY0 A;  3W4O A;  4S2M A;  5EVI D;  5HAP A;  4UAA A;  3IF6 C;  2Z2L B;  3HUM A;  2BG1 A;  3M6B A;  4P85 A;  3EQU A;  4P87 A;  4KZ9 A;  3TOI A;  5DF7 A;  1YMX A;  3M2K A;  4JF4 A;  1K4F A;  1LHY A;  3BEB A;  1WYC A;  4OQG A;  4OON A;  2OLU A;  5JYO A;  2WKE A;  4ZBE A;  1XGI A;  4R4R A;  5GHX A;  3HLC A;  1AXB A;  4R23 A;  4PM7 A;  5GLA A;  3C4P A;  4Q8I A;  3SH7 A;  2P9V A;  3V3S A;  1VQQ A;  1TDG A;  5DF8 A;  1JVJ A;  4N9L A;  1JWV A;  4E3K A;  3ZNY A;  2Y2M A;  1KGG A;  4E3J A;  3NC8 A;  1RGY A;  3A3J A;  3UE1 A;  3A3I A;  1KE4 A;  2EX2 A;  1E4D A;  3I7J A;  1GHI A;  5F83 A;  3BRM A;  4EBL A;  1YLY A;  3G32 A;  1DJB A;  5JYP A;  4KZ5 A;  4MNR A;  4B4Z A;  4LV0 A;  4K0X A;  5EVI C;  3G34 A;  4GZB A;  4NK3 A;  3G2Z A;  3HUN A;  3QNB A;  4HBT A;  1C3B A;  1SHV A;  5F82 A;  2X02 A;  1EI5 A;  3O3V A;  1ZC2 A;  1SDE A;  2XEP A;  3UNW A;  4BEN A;  4LCM A;  5BOH A;  3IF6 B;  4OP8 A;  4XUX A;  3PBQ A;  4Y0U A;  3OCL A;  2J9O A;  3C7U A;  3OCN A;  4HEF A;  3PAE A;  2ZD8 A;  4WBG A;  3VP4 A;  2WGI A;  3ZG7 B;  3ITA A;  4JKT A;  1ZG4 A;  4OQH A;  4BL2 A;  3A3F A;  3MKF A;  1IYP A;  2WYX A;  1FCO A;  4X68 A;  5U47 A;  3FKW A;  1ALQ A;  1LI9 A;  1LL9 A;  2EX6 A;  2WAE A;  2XQZ A;  1L2S A;  3ZVW A;  5EVL A;  3SH9 A;  3M2J A;  4PPR A;  4DKI A;  4D2O A;  1S0W A;  5CHM A;  1W8Q A;  3FZC A;  2H10 A;  3GV9 A;  3IXH A;  5CGX A;  1CI9 A;  1ZG6 A;  5M18 A;  3VP2 A;  3BM6 A;  4ZAM A;  1KDW A;  2ZC5 B;  1YM1 A;  3HL9 A;  4OPR A;  5HAI A;  3HVF A;  5AQB A;  1O07 A;  2BLS A;  3HLB A;  3DWK A;  1MWT A;  5EVI B;  2QMI A;  2G2W A;  3UPN A;  4DXC A;  5KMW A;  1FSY A;  3VOZ A;  3N8L A;  1M6K A;  3ISG A;  5A91 A;  3NI9 A;  3S1Y A;  2DCF A;  2HDQ A;  5FAT A;  5TGF A;  5D3O A;  4P0M A;  3RJU A;  4H8R A;  5KZH A;  1J9M A;  4E3N A;  2IWB A;  3BEC A;  2XFT A;  1TEM A;  1MWU A;  1ERO A;  4O7D A;  4DF6 A;  1YLZ A;  3A3E A;  4OLG A;  3QHY A;  2R9W A;  4E3I A;  3DWZ A;  1E25 A;  4R1G A;  3MXS A;  4B4X A;  2A3U A;  3HLW A;  1L0D A;  1LLB A;  3WS0 A;  2DRW A;  4JF6 A;  5GL9 A;  1U60 A;  1NJ4 A;  5DF9 A;  4OPY A;  4WYY A;  2EXA A;  4E3L A;  2WZX A;  3V3R A;  5CGS A;  4EBP A;  3PTE A;  1HZO A;  2HP5 A;  4L0L A;  5IHV A;  3G30 A;  4F94 A;  1ES3 A;  1LI0 A;  1ES5 A;  1GHP A;  1JWP A;  2Y2K A;  1GHM A;  1SCW A;  3VSL A;  1PWD A;  3IT9 A;  1GCE A;  3VSK A;  5I94 A;  3N6I A;  2C6W B;  1I2W A;  4S2L A;  2Y59 A;  4N92 A;  1Z6F A;  2Y2P A;  4OQI A;  1NYM A;  1PW8 A;  1PW1 A;  5HAR A;  3NDE A;  3LCE A;  4OLD A;  1K55 C;  1K6S A;  1IKG A;  3IXB A;  4GOG A;  1OME A;  1DJC A;  4UA7 A;  2Y2Q A;  4BD0 A;  2ZMA A;  3BFF A;  1LL5 A;  2QZ6 A;  2ZJ9 A;  3UN7 A;  2FFF B;  2WGW B;  3GR2 A;  3GSG A;  5FQ9 A;  2X01 A;  2XD5 A;  2I72 A;  2ZQC A;  4N1X A;  5HX9 A;  4QJG A;  1NXY A;  4YFM A;  3WS1 A;  3Q81 A;  1IEM A;  1E3U A;  3UY6 A;  1FR6 A;  4N1H A;  2G2U A;  3SS4 A;  3VMA A;  3LO7 A;  1K56 D;  2EXB A;  1L0E A;  3E2K A;  4CPK A;  2Y4A A;  1IYS A;  4X55 A;  3NDG A;  2JE5 A;  3UO9 A;  3W8K A;  5E2E A;  3M6H A;  2ZC4 B;  4LCL A;  5GLB A;  5FAQ A;  5FQQ A;  1PI5 A;  2WUQ A;  1ONG A;  1NZO A;  1JTD A;  3GRJ A;  4N9K A;  5E2H A;  3MXR A;  4ZJ2 A;  2ZC3 B;  1DY6 A;  4QU3 A;  2Y55 A;  3BLS A;  1FR1 A;  3EQV A;  1ERM A;  1K25 A;  4S2I A;  3S4X A;  4KZ7 A;  1CEF A;  3ZCZ A;  5HW3 A;  3G35 A;  4LV3 A;  4DE0 A;  5A90 A;  1K55 A;  3CG5 A;  4GKU A;  1ES4 A;  3WS4 A;  1MBL A;  2Y2N A;  2PBY A;  3A3D A;  3WRZ A;  3BLM A;  3G4P A;  1XGJ A;  3OZH A;  4PM5 A;  1JWZ A;  2OSU A;  3IF6 A;  4GN2 A;  4UHU A;  1QME A;  3PBO A;  1ONH A;  2Y91 A;  4PM6 A;  5CTN A;  3UE3 A;  5CRF A;  4DXB A;  1MWR A;  4GDN A;  2XK1 A;  1GA0 A;  4X6T A;  2H5S A;  4IBX A;  4LV1 A;  5EEC A;  4ZJ3 A;  2Y2H A;  2E8I A;  3O88 A;  2FFY A;  5EOO A;  2WAD A;  2XD1 A;  4WMC D;  1IYO A;  1YMS A;  2HPB A;  4DDY A;  5CGW A;  4C3Q A;  4KZ4 A;  1YLT A;  1ES2 A;  2HDS A;  2JCH A;  3OPL A;  1CI8 A;  4JF5 A;  5KSC A;  3N8S A;  4LEN A;  1K57 C;  3NCK A;  1BZA A;  3SS5 A;  1KVM A;  4OPQ A;  3UDI A;  3DW0 A;  3MZF A;  4QB8 A;  5EPH A;  5CEC A;  4U3T A;  3MZD A;  4U0T A;  4GB7 A;  5EVI A;  5FAS A;  1ESI A;  4KZA A;  3V50 A;  1FCM A;  1ZKJ A;  2JBF A;  1IKI A;  1MKI A;  3CZD A;  3S22 A;  3W4Q A;  1YLJ A;  3N7W A;  1KE3 A;  2V2F F;  2JC7 A;  4X69 A;  4Y7P A;  2DNS A;  4ZTK A;  2XH9 A;  2ZQ7 A;  1H8Z A;  1L0F A;  1MY8 A;  1YT4 A;  3PBN A;  4KQR A;  2IWD A;  5FQI A;  4Z9Q A;  3V39 A;  2B5R A;  3AGE A;  3Q7Z A;  3GTC A;  1BLC A;  4MBF A;  5L2F A;  1K54 C;  5CER A;  2XFS A;  2PU4 A;  4QD4 A;  1I2S A;  4X53 A;  2XGN A;  2Q9M A;  4FCF A;  5CTM A;  2ZC7 A;  2OLV A;  3BFE A;  4JBF A;  2Y2I A;  4WEK A;  2P74 A;  3ZHH A;  5DTT A;  3NY4 A;  1I5Q A;  1DJA A;  4K91 A;  4KG5 A;  4PMA A;  4R3B A;  3IWQ A;  4KEN B;  3SH8 A;  3VFF A;  1IEL A;  5TFQ A;  2Y2O A;  5DVA A;  2EFX A;  1SKF A;  3PAG A;  4GDB A;  3LEZ A;  4WZ5 C;  3VP3 A;  4S2P A;  5F1F A;  3UE0 A;  1NRF A;  4R3J A;  4E3M A;  4A5R A;  3NBL A;  2ZM0 A;  3ZG8 B;  5G18 A;  3HLD A;  3ZVT A;  3UPP A;  3FYZ A;  2XR0 A;  3HBR A;  3OPP A;  1M40 A;  3Q7V B;  4GD6 A;  1HVB A;  3N4I A;  5EOE A;  5FSR A;  4JLF A;  4R4S A;  4EBN A;  3Q7V A;  3ZNT A;  5M19 A;  2VGJ A;  4BQM A;  1RP5 A;  3Q82 A;  1XPB A;  4KG6 A;  3OPH A;  4KZ8 A;  4OH0 A;  4WEL A;  4MLL A;  5CEB A;  2CC1 A;  1K4E A;  4OQ0 A;  5GLD A;  4EUZ A;  5KSH A;  3ZFZ A;  4CJN A;  4KQO A;  3O86 A;  1WE4 A;  5E2F A;  1KVL A;  1HD8 A;  4E6X A;  3C4O A;  3AGD A;  1ESU A;  2WGW A;  4FH2 A;  4DRT A;  1IYQ A;  3VP0 A;  3MBZ A;  4GD8 A;  1W5D A;  1FCN A;  3E2L A;  1BSG A;  4RA7 A;  1PWC A;  2Z2M B;  1MPL A;  2WKH A;  4EWF A;  3MFD A;  4OOM A;  3PBT A;  1VM1 A;  4JXG A;  4UA9 A;  5CHU A;  5A93 A;  1YLW A;  3OPR A;  1W7F A;  3IF5 A;  5A92 A;  4BLM A;  5FAP A;  1KGE A;  3CMZ A;  1RGZ A;  2XF3 A;  3MKE A;  5FI7 A;  4OOY A;  3UDF A;  4WZ5 A;  3FWL A;  1MXO A;  5GHY A;  4HES A;  4LV2 A;  4RX3 A;  1KGF A;  1K38 A;  4NET A;  3ZDJ A;  1N9B A;  1W79 A;  1O7E A;  4MBH A;  4DE1 A;  1N4O A;  3V5M A;  3C5A A;  1BLS A;  4IVK A;  1FSW A;  1XP4 A;  4JXV A;  3BFD A;  5HFO A;  3ZG5 A;  3GQZ A;  4WM9 A;  4R0Q A;  4XXR A;  2J7V A;  4K0W A;  2P9V B;  5FQM A;  4EV4 A;  2H0Y A;  1GA9 A;  3HRE A;  1CK3 A;  3IH9 A;  4DE2 A;  5FAO A;  4X56 A;  3BFC A;  3PBR A;  5F1G A;  3IWI A;  3RXX A;  3BYD A;  2ZM8 A;  4WZ4 A;  4C6Y A;  1PZP A;  1PZO A;  3FKV A;  2Y2J A;  1TDL A;  3B3X A;  4RVA A;  3IHB A;  1NZU A;  4IED A;  2WKI A;  1PWG A;  1EWZ A;  1H5X A;  4QY5 A;  3VFH A;  5E43 A;  3VP1 A;  2XLN A;  4PM8 A;  2A49 A;  4KZB A;  1BUL A;  2IWC A;  4Y0O A;  3N8R A;  4KQQ A;  4M3K A;  3RXW A;  1S6R A;  5FQK A;  5GHZ A;  4YIN A;  3IXG A;  1QMF A;  4P6B A;  1L0G A;  1G68 A;  3GMW A;  1WYB A;  2VGK A;  3NIA A;  4BD1 A;  4UA6 A;  3SOI A;  4ZDX A;  5AQ9 A;  2EX8 A;  3AGF A;  3C7V A;  4QHC A;  1K6R A;  1XA1 A;  3ITB A;  5TR7 A;  5FQJ A;  2HDU A;  3WWX A;  1RCJ A;  1BLH A;  4WEJ A;  3Q1F A;  2RL3 A;  5CXW A;  5DTS A;  4OPZ A;  4BL3 A;  5HAQ A;  1FQG A;  1JTG A;  2WGV A;  4GNU A;  4IVI A;  4EQI A;  1NYY A;  1W8Y A;  4XUZ A;  3WRT A;  4DDS A;  1Q2Q A;  5EE8 A;  4JXS A;  2ZQ8 A;  2V1Z A;  5GLC A;  4PM9 A;  1PIO A;  1XX2 A;  4FH4 A;  3SS3 A;  3UDX A;  5AQ7 A;  4JXW A;  3OC2 A;  1G6A A;  1XXM A;  2HP9 A;  4C75 A;  1HTZ A;  1K56 A;  3HLE A;  1SDN A;  4E3O A;  3LY4 A;  2ZC6 B; 
#chains in the Genus database with same CATH topology
 1E3U D;  4ARZ B;  1TF1 A;  2ZLY A;  4F3L B;  4S2J A;  4F3L A;  3QNC A;  2WK0 A;  2Y2L A;  3IQA A;  4JPM A;  4QY6 A;  1H3Q A;  1Z09 A;  4OVD A;  4CLC C;  1STZ A;  2PU2 A;  3BFG A;  3LIC A;  3H9W A;  4HP9 A;  3Q07 A;  2EX9 A;  1CEG A;  2OV5 A;  1S4R A;  2W3H A;  1H8Y A;  2H0T A;  4KQD A;  1BT5 A;  3HUO A;  5E2G A;  1HLU P;  3IXD A;  4HBU A;  3OLO A;  4PAU A;  1DP6 A;  3FG8 A;  1G5U A;  3UPO A;  2J8Y A;  4UQI S;  3G31 A;  3CAX A;  5AQA A;  4S2O A;  2XRN A;  3T1X A;  5FDH A;  4ZJ1 A;  1PNE A;  5HWV A;  3LR5 A;  4CLC B;  4R38 A;  1NY0 A;  4UAA A;  2MJ6 A;  4FOF A;  3R7W A;  2JN7 A;  1YMX A;  3M2K A;  1K4F A;  1WYC A;  4OON A;  5JYO A;  3HLC A;  4R23 A;  2H28 A;  5GLA A;  2QHK A;  2L0W A;  3V3S A;  1CJF A;  1JWV A;  4E3J A;  3A3I A;  2EX2 A;  3TJZ C;  3I7J A;  4NXF A;  5F83 A;  2P08 A;  4K0X A;  1UGU A;  4EET B;  3HUN A;  1C3B A;  3O3V A;  1EI5 A;  2XEP A;  3E4Q A;  3TE8 A;  3OCL A;  2J9O A;  4WBG A;  3ITA A;  4X68 A;  1ALQ A;  1LI9 A;  2XQZ A;  3DTE A;  1L2S A;  3D9Y A;  3L7H A;  3QP2 A;  3SH9 A;  1NRJ A;  3FZC A;  3KYQ A;  3PHY A;  3BM6 A;  3HLB A;  3DWK A;  1MWT A;  4DXC A;  2QMI A;  1FSY A;  3NI9 A;  3CHW P;  5TGF A;  3BWL A;  5D3O A;  1J9M A;  4K08 A;  3BEC A;  3GDI A;  1MWU A;  1J3W A;  4DF6 A;  4OLG A;  3MXS A;  1TD5 A;  2A3U A;  1L0D A;  5GL9 A;  4OPY A;  2EXA A;  4E3L A;  4ETZ A;  3LIB A;  3BW6 A;  3G30 A;  4LPZ A;  3V67 A;  3CUE A;  1ES3 A;  1GHM A;  1PWD A;  3MR0 A;  4S2L A;  3D3O A;  1Z6F A;  4PHT A;  1NYM A;  1PW8 A;  2Z6C A;  1YSQ A;  4H6J B;  2PD8 A;  1LL5 A;  5FQ9 A;  3GSG A;  3NJA A;  5DJU A;  1W63 M;  4LGW A;  1DRM A;  1NXY A;  2PBD P;  5J4E A;  1E3U A;  3UY6 A;  4Y5F A;  3SS4 A;  2G2U A;  3VMA A;  3LO7 A;  5HPI A;  4CPK A;  2Y4A A;  1IYS A;  4X55 A;  2JE5 A;  4BBT A;  3W8K A;  2J3T C;  5E2E A;  3M6H A;  5FAQ A;  3CI6 A;  2GJ3 A;  1PI5 A;  1P97 A;  2OAQ 1;  3E4O A;  2PAV P;  3UB8 A;  2ZC3 B;  4QU3 A;  2Y55 A;  4Y13 A;  3ZCZ A;  1CEF A;  4KUK A;  3CG5 A;  5DKK A;  3S7Q A;  2PT7 A;  4GN2 A;  4JGO A;  3PYP A;  4GDN A;  1GA0 A;  4IBX A;  4WF0 A;  2W0N A;  3O88 A;  2XD1 A;  1IYO A;  2HPB A;  2GNX A;  1VET B;  4DDY A;  4C3Q A;  1VET A;  2JCH A;  1CI8 A;  4JF5 A;  1OTD A;  4EU0 A;  2XA7 S;  3OOV A;  3MZF A;  5CEC A;  3RTY A;  2I9V A;  1V9Y A;  2HV1 A;  1ESI A;  3V50 A;  4PKY A;  1IKI A;  1MKI A;  3W4Q A;  5L8M A;  1YLJ A;  2V2F F;  4L9G A;  3CLO A;  4ZTK A;  1H8Z A;  3PBN A;  1YT4 A;  3AGE A;  3GTC A;  5L09 A;  1I2S A;  4X53 A;  2XGN A;  4FCF A;  2OLV A;  3UB5 P;  1DJA A;  4R3B A;  1XJ2 A;  4KEN B;  4L9E A;  3S7N A;  2V1B A;  3SH8 A;  1IEL A;  5HDC A;  5HDS A;  2A24 A;  1SKF A;  3PAG A;  1LL8 A;  4R3J A;  3E98 A;  5G18 A;  3ZVT A;  3KSF A;  4GD6 A;  2PRF A;  3N4I A;  4EBN A;  4QWO A;  3PR6 A;  3UB7 A;  1OJG A;  3ZNT A;  4KZ8 A;  4WEL A;  5CEB A;  2CC1 A;  4OQ0 A;  1G28 A;  4Q0I A;  2VKS A;  1KVL A;  2VGL M;  3AGD A;  4DRT A;  3VP0 A;  4GD8 A;  3D72 A;  3E2L A;  2Z2M B;  1OJ5 A;  3KX0 X;  2WKH A;  4AFI A;  1YLW A;  3OPR A;  4BLM A;  1KGE A;  3CMZ A;  2XF3 A;  3FWL A;  1MXO A;  4HES A;  1W79 A;  3T4K A;  3F1P B;  3U2A A;  1S1Y A;  3F1P A;  2D01 A;  2OAP 1;  1CK3 A;  3PBR A;  3IWI A;  4NG2 A;  3RXX A;  5CX7 A;  3FKV A;  3B3X A;  2WKI A;  1PWG A;  1EWZ A;  2W3G A;  5E43 A;  3VP1 A;  4KZB A;  4MMN A;  2EWV A;  3F1O A;  3N8R A;  4KQQ A;  5FDS A;  4WUJ A;  4P6B A;  2O9A A;  1L0G A;  1XA1 A;  5TR7 A;  3ITB A;  2WKP A;  1ZTU A;  4HY8 A;  1RCJ A;  5DTS A;  4OPZ A;  1YAX A;  4BL3 A;  4I3J A;  4GNU A;  2W3F A;  2PYP A;  4GJ4 A;  1Q2Q A;  2ZQ8 A;  4CLC D;  2V8F A;  4G3K A;  3KYZ A;  4HOI A;  4G3W A;  4FH4 A;  1T1A A;  5F5Y A;  3OC2 A;  1V9Z A;  2DMW A;  2HP9 A;  5EM1 A;  3HLE A;  1DP8 A;  4HJ6 A;  3HLG A;  5M1A A;  4OP5 A;  2LB9 A;  2V20 A;  4DE3 A;  1S4S A;  3F1N A;  2VK3 A;  4MEZ A;  3O87 A;  3PXP A;  4O0P A;  2C5W B;  4BJP A;  4UEY A;  2IA2 A;  1K57 A;  1XKZ A;  2RCX A;  5AVF A;  3LY3 A;  4Y0T A;  1XA7 A;  2HDR A;  1ODV A;  2ZQ9 A;  2GDN A;  3ZG9 B;  1OTI A;  2ZQA A;  3G2Y A;  3C2W A;  1OTA A;  1YSP A;  1K54 A;  1PYY A;  4WN5 A;  5J8X A;  3DAV A;  5CHJ A;  3KO6 A;  3PBS A;  3GVB A;  1GSW A;  3RH8 B;  5CED A;  4II7 A;  1PI4 A;  3H7W A;  2UWX A;  5L10 A;  4S2M A;  3CPT B;  3IF6 C;  3HUM A;  1JNU A;  3M6B A;  4P85 A;  3EQU A;  4WL9 A;  5DF7 A;  2W3D A;  5KIZ A;  2OLU A;  4ZBE A;  1XGI A;  4R4R A;  5AJG A;  3HJK A;  2W1T A;  4Q8I A;  2P9V A;  1MC0 A;  5DF8 A;  1JVJ A;  4XT2 A;  1LT0 A;  2Y2M A;  3NC8 A;  3A3J A;  3UE1 A;  2L1M A;  3G32 A;  1DJB A;  5JYP A;  3A0S A;  4KZ5 A;  4B4Z A;  5EVI C;  3QNB A;  4HBT A;  5EV0 A;  3T4O A;  3UNW A;  1SDE A;  1VHM A;  3IF6 B;  4XUX A;  3OCN A;  3PAE A;  3IX8 A;  4IJG A;  2KOI A;  4P6Z M;  1L3L A;  1IYP A;  2WYX A;  5U47 A;  3FKW A;  2R78 A;  2WAE A;  3ZVW A;  3QP1 A;  5IT5 A;  3CIT A;  3M2J A;  4PPR A;  3ICY A;  1CI9 A;  1GSX A;  3VP2 A;  4ZAM A;  2ZC5 B;  5HAI A;  1O07 A;  1NLZ A;  2BLS A;  5EVI B;  5KMW A;  4ARZ A;  4E04 A;  3VOZ A;  3N8L A;  5A91 A;  3UMD A;  2DCF A;  3RJU A;  4H8R A;  4NXB A;  4HH2 A;  4E3N A;  2IWB A;  2XFT A;  1TEM A;  1YLZ A;  3A3E A;  3VV4 A;  2R9W A;  4B4X A;  3LIF A;  1XFN A;  5L07 A;  1CQA A;  4L0L A;  1GHP A;  1JWP A;  3LR4 A;  3IT9 A;  5I94 A;  3VSK A;  3MMH A;  2C6W B;  2J3T D;  3LI8 A;  4OQI A;  4IUK A;  4OLD A;  2HF6 A;  2INW A;  1OME A;  1DJC A;  2Y2Q A;  2VA0 A;  4CLC A;  2E8J A;  1SZV A;  2QZ6 A;  2ZJ9 A;  4UQI M;  3UN7 A;  2WGW B;  3GR2 A;  2I72 A;  2ZQC A;  4N1X A;  4Y17 A;  5HX9 A;  4YFM A;  3Q81 A;  1KOU A;  1FR6 A;  4N1H A;  3FPV A;  4NKP A;  2EXB A;  1L0E A;  3E4P A;  5J7E A;  2ZC4 B;  1ONG A;  4N9K A;  3MXR A;  2NUT C;  3EQV A;  1K25 A;  3S4X A;  5HW3 A;  3G35 A;  1X0O A;  5A90 A;  2EA9 A;  5HZH A;  3WRZ A;  4PM5 A;  1QME A;  1ONH A;  2Y91 A;  4Y15 A;  1MWR A;  1G6O A;  4IUH A;  3EGD C;  3JVV A;  5EOO A;  4WMC D;  4ZRR A;  1YLT A;  2HDS A;  5KSC A;  3P01 A;  3SW1 A;  3SS5 A;  1KVM A;  3EEH A;  3BY9 A;  2OWH A;  4KZA A;  1FCM A;  5F68 A;  3S22 A;  1S1Z A;  4BWI A;  3N7W A;  3IS2 B;  2JC7 A;  3IS2 A;  4IHQ A;  4Y7P A;  2ZQ7 A;  3MQ0 A;  4KQR A;  5FQI A;  4Z9Q A;  5L2F A;  5CER A;  2XFS A;  4GLQ A;  2PU4 A;  2JKT I;  4JBF A;  3MFX A;  2P74 A;  3ZHH A;  4K91 A;  2EFX A;  2O0Y A;  1T19 A;  1IOU A;  3LEZ A;  5DKL A;  4B9O A;  3UE0 A;  4GW9 A;  5IU1 A;  3LI9 A;  3UPP A;  2XR0 A;  3HBR A;  1M40 A;  3NHQ A;  5M19 A;  4X1L A;  2VLG A;  2VGJ A;  4KG6 A;  4MLL A;  5GLD A;  4H6J A;  3ZFZ A;  5EM0 A;  3LIE A;  3O86 A;  1HD8 A;  4M4X A;  4E6X A;  4HI4 A;  4FH2 A;  3UB9 A;  1XJ4 A;  4GS9 B;  2AVX A;  1W5D A;  1FCN A;  1BSG A;  3L9K A;  3MFD A;  1VM1 A;  5CHU A;  3IF5 A;  5A92 A;  1Y28 A;  5FAP A;  3MKE A;  1RGZ A;  4OOY A;  2V0U A;  5GHY A;  4RX3 A;  4NET A;  4MBH A;  3VOL A;  3TW8 A;  3C5A A;  3T4L A;  4JXV A;  3ZG5 A;  5HFO A;  4WM9 A;  4R0Q A;  2J7V A;  1TS8 A;  4K0W A;  2XRO A;  4EV4 A;  2H0Y A;  2Y79 A;  1F98 A;  3IH9 A;  5FAO A;  4X56 A;  4I5S A;  4WZ4 A;  2ZM8 A;  5TJJ A;  1PZO A;  2Y2J A;  1TDL A;  4RVA A;  3IHB A;  1UWN X;  3KSH A;  2A49 A;  4Y0O A;  2JKR I;  4D60 A;  5HD3 A;  1G68 A;  3GMW A;  1WYB A;  4BD1 A;  5AQ9 A;  4QHC A;  1K6R A;  5FQJ A;  3QP4 A;  3WWX A;  4WEJ A;  3Q1F A;  3OBF A;  2ZL1 B;  1FQG A;  1JTG A;  4IVI A;  1NYY A;  3WRT A;  2V1Z A;  5I5L A;  3RFB A;  1PIO A;  1XX2 A;  2XA7 M;  4JXW A;  5EVE A;  3LY4 A;  2ZC6 B;  2WKQ A;  3T12 B;  4OOL A;  3ZG0 A;  1D06 A;  3IH8 A;  3CWF A;  3R4K A;  3MS6 A;  4S2N C;  4FSF A;  4LRX C;  1T1B A;  1MWS A;  1BTL A;  1Y54 A;  1LSX A;  1A0K A;  1KE0 A;  1F5M A;  2O9B A;  3JYI A;  3FV7 A;  4EUV A;  4O01 A;  2XDM A;  3ZYT A;  3MZE A;  1KDS A;  2OOL A;  5EFW A;  2J9P A;  4GCZ A;  4MN7 A;  4ID4 A;  1TS0 A;  4CQH A;  1YLP A;  4WMC A;  2GZA A;  2Q9N A;  3W4P A;  3MQQ A;  5FI6 A;  3BQA A;  3VOY A;  5DTK A;  3T4Q A;  4RYE A;  5FA7 A;  1N9L A;  4S2N A;  1FOF A;  3KYE A;  2WZZ A;  3WS2 A;  1BYW A;  2QYB A;  5HL1 A;  4MBK A;  4BMW A;  5J3W A;  5EVI D;  5HAP A;  4O8G A;  2Z2L B;  3P7N A;  4P87 A;  3KSI A;  4HJ3 A;  4KZ9 A;  3TOI A;  3LUQ A;  3HCY A;  1LHY A;  3BEB A;  4LRY C;  4OQG A;  1LSV A;  2VV6 A;  1EW0 A;  2QJ5 A;  4DJ2 A;  3W2Z A;  5HPF A;  4E3K A;  3ZNY A;  1RGY A;  2Y8H A;  3FPW A;  1KE4 A;  1E4D A;  3BRM A;  4EBL A;  2V1A A;  4MNR A;  4LV0 A;  3EOI A;  4GZB A;  3BY8 A;  1SHV A;  4LLO B;  2X02 A;  1ZC2 A;  4LCM A;  5HWW A;  5BOH A;  1ACF A;  2WKR A;  3PBQ A;  5HDD A;  2YKF A;  1CF0 A;  4R3A A;  2WGI A;  4OQH A;  4BL2 A;  5F6A A;  1FCO A;  3K3D A;  2EX6 A;  2PR5 A;  1OT9 A;  5EVL A;  3B33 A;  1S0W A;  5CHM A;  3IXH A;  3E0Y A;  3SZT A;  3T50 A;  1KDW A;  3HVF A;  4FTX A;  5HD5 A;  4Z1W A;  5FAT A;  5KZH A;  3LR3 A;  2ZOI A;  1ERO A;  3VE4 A;  4O7D A;  1OTB A;  1NLY A;  3QHY A;  4E3I A;  4R1G A;  1LLB A;  3H82 B;  2DRW A;  3WS0 A;  5FL3 A;  1NJ4 A;  5DF9 A;  4WYY A;  2JKT M;  5CGS A;  4EBP A;  2P04 A;  4F94 A;  1LI0 A;  1ES5 A;  2Y2K A;  1XJ3 A;  3N6I A;  1I2W A;  2Y59 A;  3K3C A;  4N92 A;  2G7U A;  3NOP C;  3LCE A;  1K55 C;  4YOF A;  1K6S A;  2FZ0 A;  4UA7 A;  5FEG A;  2ZMA A;  3C30 A;  3BFF A;  2M7U A;  1P9R A;  3MXQ A;  2FFF B;  3CPT A;  3WS1 A;  1IEM A;  2W3E A;  4EW7 A;  3E2K A;  3T1Q B;  4EQ1 A;  4ME4 A;  3UO9 A;  2XSS A;  4LCL A;  5GLB A;  3T4S A;  2PDR A;  3LR0 A;  1N9O A;  2WUQ A;  3C8C A;  2V9A A;  1NZO A;  2O99 A;  3GRJ A;  5E2H A;  4ZJ2 A;  1TS7 A;  1DY6 A;  5DJT A;  3A0R A;  3BLS A;  1FR1 A;  3BJN A;  1K55 A;  2VJW A;  4I3I A;  2Y2N A;  2PBY A;  3A3D A;  3G4P A;  1XGJ A;  2OSU A;  3IF6 A;  1FIL A;  4PM6 A;  5CTN A;  3UE3 A;  4Q0H A;  4DXB A;  2XK1 A;  4LV1 A;  5EEC A;  4ZJ3 A;  4HHD A;  1YMS A;  2JKR M;  4KZ4 A;  3OPL A;  1IFQ A;  4LEN A;  3LYX A;  1BZA A;  3UDI A;  3DW0 A;  4I38 A;  2JHE A;  4QB8 A;  4X25 A;  4U3T A;  4U0T A;  5EVI A;  2BTF P;  1ZKJ A;  2JBF A;  2EWW A;  2Q0O A;  2YKH A;  2J80 A;  1KE3 A;  4X69 A;  3T1R A;  2DNS A;  1L0F A;  2VEA A;  4HIA A;  3U4L P;  2IWD A;  3NEC A;  3V39 A;  4ESP A;  3Q7Z A;  1BLC A;  1VEU B;  2Q9M A;  5CTM A;  1VEU A;  3S7O A;  2KX6 A;  5DTT A;  4KG5 A;  4PMA A;  1T18 A;  5TFQ A;  2Y2O A;  4JGR A;  1W63 Q;  1F9I A;  4GDB A;  2HZ5 A;  3VP3 A;  4S2P A;  5F1F A;  4E3M A;  3NBL A;  2ZM0 A;  3ZG8 B;  3HLD A;  2K7S A;  3UE6 A;  3Q7V B;  4JLF A;  3Q7V A;  4BQM A;  3Q82 A;  1XPB A;  3G6O A;  2UV0 E;  1S66 L;  1K4E A;  5HWT A;  4EUZ A;  5KSH A;  4KQO A;  5E2F A;  1WE4 A;  4RQ9 A;  3C4O A;  2WGW A;  3K2N A;  1IYQ A;  5LBR A;  5HSQ A;  1PWC A;  1MPL A;  4JXG A;  5A93 A;  4UA9 A;  1W7F A;  2ZBB A;  4HP4 A;  3R7W B;  4DN0 A;  1K38 A;  3LEQ A;  1YPR A;  1O7E A;  1T1C A;  1N4O A;  3V5M A;  1XP4 A;  3BFD A;  3EWK A;  4XXR A;  3S7P A;  5FQM A;  1YKD A;  4DE2 A;  3BFC A;  5F1G A;  2QKP A;  3NOU C;  4HQA A;  3LFV A;  1NZU A;  4IED A;  2M7V A;  1H5X A;  4QY5 A;  2XLN A;  1BUL A;  1XFQ A;  1S6R A;  5FQK A;  5GHZ A;  3JVU A;  2HJE A;  2A2L A;  3SOI A;  2EX8 A;  3C7V A;  2ZOH A;  5G4Y A;  5DFX A;  2RL3 A;  5CXW A;  1K0K A;  5DFY A;  4EQI A;  1W8Y A;  4XUZ A;  5EE8 A;  4JXS A;  5GLC A;  4YWZ A;  1NWZ A;  1OPX A;  5AQ7 A;  1G6A A;  1HTZ A;  1OTE A;  3CUE C;  1SDN A;  4G3V A;  4KZ3 A;  1D7E A;  3JPU A;  2X71 A;  3P09 A;  3IWO A;  2CMN A;  3HLF A;  5HL6 A;  3UB6 A;  4Y3I A;  3CJM A;  4CLC E;  4KG2 A;  1TS6 A;  1ERQ A;  3TG9 A;  2VV7 A;  1TVF A;  3P98 A;  3BQ8 A;  2L4R A;  2ZQD A;  4B88 A;  1P9W A;  3LIA A;  1BUE A;  2WAF A;  3WS5 A;  1BLP A;  3QP8 A;  2HP6 A;  3TSG A;  4HNB A;  1D1J A;  2ZM2 A;  2JKG A;  4U0X A;  5FI2 A;  4IBR A;  1VB6 A;  3IHA A;  2QPN A;  2R9X A;  4RX2 A;  5TBM B;  3DTM A;  2EFU A;  5TBM A;  1YQS A;  2Y2G A;  4S2K A;  4E6W A;  4GS9 A;  3ZGA B;  1SKO B;  4OKP A;  5EUA A;  4KZ6 A;  1SKO A;  3D4F A;  4FD8 A;  1Q2P A;  1N9N A;  4MN6 A;  3W4O A;  2W1R A;  5FEF A;  2BG1 A;  4I39 A;  2NUP C;  3B47 A;  4ETX A;  4JF4 A;  1GSV A;  2Z6D A;  2WKE A;  5GHX A;  1AXB A;  3LGO A;  2D02 A;  4PM7 A;  3C4P A;  3SH7 A;  4EER A;  1VQQ A;  1TDG A;  2GX5 A;  4N9L A;  4LRZ E;  1KGG A;  2QJ7 A;  1GHI A;  1YLY A;  1LSW A;  3C38 A;  3G34 A;  4NK3 A;  3G2Z A;  3IX3 A;  5F82 A;  4NXE A;  3B42 A;  4BEN A;  4NEE D;  1PRQ A;  4OP8 A;  4Y0U A;  3C7U A;  4HEF A;  3VP4 A;  2ZD8 A;  3ZG7 B;  2VV8 A;  4JKT A;  1ZG4 A;  3A3F A;  2ZL1 A;  3MKF A;  1LL9 A;  2OWJ A;  4DKI A;  4D2O A;  3EEA A;  1W8Q A;  2H10 A;  3GV9 A;  5CGX A;  3UME A;  1ZG6 A;  4KUO A;  5M18 A;  4OPR A;  1YM1 A;  3HL9 A;  5AQB A;  1OT6 A;  2G2W A;  3UPN A;  3T4T A;  1M6K A;  3ISG A;  3S1Y A;  3TRC A;  3NOT C;  2HDQ A;  4P0M A;  1MKM A;  3DWZ A;  1E25 A;  4EEU A;  2PYR A;  3HLW A;  4JF6 A;  1U60 A;  5C5K A;  2WZX A;  3V3R A;  3PTE A;  1HZO A;  1FIK A;  2HP5 A;  2A24 B;  5IHV A;  1PFL A;  1SCW A;  3VSL A;  5MC7 A;  1GCE A;  2K2N A;  3HJI A;  2VGL S;  3QP5 A;  1MZU A;  2Y2P A;  1PW1 A;  5HAR A;  3NDE A;  1IKG A;  3IXB A;  4GOG A;  4L9F A;  4LFU A;  4BD0 A;  2O9C A;  1XJ6 A;  4B93 A;  3DTI A;  2X01 A;  2XD5 A;  4QJG A;  2M1C A;  3IBR A;  4GHI B;  4WLA A;  3ULF A;  2KLI A;  4GHI A;  1K56 D;  3NDG A;  5AVE A;  3IBJ A;  5FQQ A;  1P0Z A;  1Y4O A;  3DTK A;  1JTD A;  2HJ9 C;  4BBV A;  2B02 A;  2W27 A;  1ERM A;  1F2K A;  4S2I A;  4KZ7 A;  4LV3 A;  4DE0 A;  4GKU A;  1ES4 A;  1WA9 A;  3WS4 A;  1MBL A;  2ACG A;  3BLM A;  3OZH A;  1JWZ A;  2LB5 A;  4UHU A;  3PBO A;  5CRF A;  4R70 A;  4X6T A;  2H5S A;  4QPR A;  3ZQ5 A;  3F1O B;  1H8M A;  2Y2H A;  2E8I A;  2V8C A;  2FFY A;  2WAD A;  5CGW A;  2J3W A;  3EGX C;  1ES2 A;  4FUW A;  3N8S A;  1K57 C;  5IS1 A;  3NCK A;  2FH5 A;  4OPQ A;  5EPH A;  3MZD A;  4GB7 A;  1ZHH B;  4HH3 A;  4HJ4 A;  5FAS A;  3KSG A;  3IX4 A;  3CZD A;  4DMZ A;  5A8B A;  2XH9 A;  4NXG A;  1MY8 A;  1AWI A;  2B5R A;  2JKF A;  4MBF A;  1K54 C;  4QD4 A;  4X1M A;  2BAS A;  2ZC7 A;  3F1N B;  3BFE A;  2Y2I A;  3H82 A;  3QP6 A;  4WEK A;  3NY4 A;  1I5Q A;  3GEC A;  3IWQ A;  4PKY G;  4R6L A;  3VFF A;  4EEP A;  2P7J A;  5DVA A;  3T4J A;  5K5B A;  4WZ5 C;  1DP9 A;  1NRF A;  4MN5 A;  4DJ3 A;  4A5R A;  3FYZ A;  3OPP A;  1HVB A;  5FSR A;  5EOE A;  4R4S A;  1RP5 A;  2HGV A;  3OPH A;  4OH0 A;  4MCW A;  4JGP A;  3DBA A;  4CJN A;  1UWP X;  4I3A A;  1ESU A;  3MBZ A;  4RA7 A;  2KDK A;  3H7W B;  4EWF A;  4OOM A;  3PBT A;  4YNR A;  2ZMF A;  3MJQ A;  5FI7 A;  3VE3 A;  3UDF A;  4WZ5 A;  4LV2 A;  3ZDJ A;  1KGF A;  1S67 L;  4Q0J A;  1N9B A;  4DE1 A;  1BLS A;  4IVK A;  1FSW A;  3GQZ A;  3FC7 A;  2W1T B;  2P9V B;  1GA9 A;  3HRE A;  4XT2 B;  2B18 A;  2VX8 A;  3BYD A;  4C6Y A;  3NUL A;  4Y2F A;  1PZP A;  2QWS A;  3MQO A;  2PD7 A;  2V0W A;  3VFH A;  4PM8 A;  2IWC A;  4P6Z S;  3MSH A;  4M3K A;  3RXW A;  3O5Y A;  4YIN A;  3IXG A;  1QMF A;  2B95 A;  2PR6 A;  2VGK A;  3NIA A;  4UA6 A;  4ZDX A;  3AGF A;  4BBU A;  2HDU A;  2PHY A;  1BLH A;  1H0M A;  3MF0 A;  4EES A;  5HAQ A;  2WGV A;  3LID A;  3T1S A;  2VZW A;  4MDZ A;  4DDS A;  4JGQ A;  2ZMV A;  4EXO A;  4PM9 A;  3A0V A;  3SS3 A;  5G4Z A;  3UDX A;  2K31 A;  1XXM A;  4C75 A;  4E3O A;  1K56 A;  5F69 A; 
#chains in the Genus database with same CATH homology
 1E3U D;  3ZG0 A;  4OOL A;  3HLG A;  3IH8 A;  4KZ3 A;  2ZLY A;  5M1A A;  4OP5 A;  2X71 A;  2V20 A;  4S2J A;  4DE3 A;  3P09 A;  3IWO A;  3QNC A;  4S2N C;  2WK0 A;  4FSF A;  2Y2L A;  3HLF A;  3IQA A;  1MWS A;  4MEZ A;  4JPM A;  3CJM A;  1BTL A;  3O87 A;  4QY6 A;  1Y54 A;  1KE0 A;  3JYI A;  2C5W B;  3FV7 A;  4KG2 A;  4OVD A;  4BJP A;  1ERQ A;  3TG9 A;  1K57 A;  2PU2 A;  1XKZ A;  2RCX A;  1TVF A;  2XDM A;  3P98 A;  3BFG A;  2ZQD A;  4B88 A;  3MZE A;  3Q07 A;  3LY3 A;  2EX9 A;  4Y0T A;  1KDS A;  1CEG A;  2OV5 A;  1XA7 A;  1BUE A;  2HDR A;  1H8Y A;  2H0T A;  2WAF A;  2ZQ9 A;  2GDN A;  1BT5 A;  2J9P A;  3ZG9 B;  2ZQA A;  3G2Y A;  3HUO A;  5E2G A;  3WS5 A;  4ID4 A;  1BLP A;  3IXD A;  2HP6 A;  4HBU A;  3TSG A;  1YLP A;  4WMC A;  2Q9N A;  2ZM2 A;  4U0X A;  3W4P A;  5FI2 A;  1K54 A;  5FI6 A;  3VOY A;  1PYY A;  4IBR A;  5DTK A;  3UPO A;  3IHA A;  4RYE A;  5FA7 A;  5J8X A;  2QPN A;  2R9X A;  2J8Y A;  4RX2 A;  1FOF A;  4S2N A;  3DTM A;  5CHJ A;  2EFU A;  1YQS A;  2Y2G A;  3G31 A;  3GVB A;  3PBS A;  4S2K A;  4E6W A;  5AQA A;  4S2O A;  3ZGA B;  2WZZ A;  5CED A;  3WS2 A;  5FDH A;  4ZJ1 A;  4OKP A;  5EUA A;  1PI4 A;  4KZ6 A;  3D4F A;  4FD8 A;  1Q2P A;  2UWX A;  5HL1 A;  4MBK A;  1NY0 A;  3W4O A;  4S2M A;  5EVI D;  5HAP A;  4UAA A;  3IF6 C;  2Z2L B;  3HUM A;  2BG1 A;  3M6B A;  4P85 A;  3EQU A;  4P87 A;  4KZ9 A;  3TOI A;  5DF7 A;  1YMX A;  3M2K A;  4JF4 A;  1K4F A;  1LHY A;  3BEB A;  1WYC A;  4OQG A;  4OON A;  2OLU A;  5JYO A;  2WKE A;  4ZBE A;  1XGI A;  4R4R A;  5GHX A;  3HLC A;  1AXB A;  4R23 A;  4PM7 A;  5GLA A;  3C4P A;  4Q8I A;  3SH7 A;  2P9V A;  3V3S A;  1VQQ A;  1TDG A;  5DF8 A;  1JVJ A;  4N9L A;  1JWV A;  4E3K A;  3ZNY A;  2Y2M A;  1KGG A;  4E3J A;  3NC8 A;  1RGY A;  3A3J A;  3UE1 A;  3A3I A;  1KE4 A;  2EX2 A;  1E4D A;  3I7J A;  1GHI A;  5F83 A;  3BRM A;  4EBL A;  1YLY A;  3G32 A;  1DJB A;  5JYP A;  4KZ5 A;  4MNR A;  4B4Z A;  4LV0 A;  4K0X A;  5EVI C;  3G34 A;  4GZB A;  4NK3 A;  3G2Z A;  3HUN A;  3QNB A;  4HBT A;  1C3B A;  1SHV A;  5F82 A;  2X02 A;  1EI5 A;  3O3V A;  1ZC2 A;  1SDE A;  2XEP A;  3UNW A;  4BEN A;  4LCM A;  5BOH A;  3IF6 B;  4OP8 A;  4XUX A;  3PBQ A;  4Y0U A;  3OCL A;  2J9O A;  3C7U A;  3OCN A;  4HEF A;  3PAE A;  2ZD8 A;  4WBG A;  3VP4 A;  2WGI A;  3ZG7 B;  3ITA A;  4JKT A;  1ZG4 A;  4OQH A;  4BL2 A;  3A3F A;  3MKF A;  1IYP A;  2WYX A;  1FCO A;  4X68 A;  5U47 A;  3FKW A;  1ALQ A;  1LI9 A;  1LL9 A;  2EX6 A;  2WAE A;  2XQZ A;  1L2S A;  3ZVW A;  5EVL A;  3SH9 A;  3M2J A;  4PPR A;  4DKI A;  4D2O A;  1S0W A;  5CHM A;  1W8Q A;  3FZC A;  2H10 A;  3GV9 A;  3IXH A;  5CGX A;  1CI9 A;  1ZG6 A;  5M18 A;  3VP2 A;  3BM6 A;  4ZAM A;  1KDW A;  2ZC5 B;  1YM1 A;  3HL9 A;  4OPR A;  5HAI A;  3HVF A;  5AQB A;  1O07 A;  2BLS A;  3HLB A;  3DWK A;  1MWT A;  5EVI B;  2QMI A;  2G2W A;  3UPN A;  4DXC A;  5KMW A;  1FSY A;  3VOZ A;  3N8L A;  1M6K A;  3ISG A;  5A91 A;  3NI9 A;  3S1Y A;  2DCF A;  2HDQ A;  5FAT A;  5TGF A;  5D3O A;  4P0M A;  3RJU A;  4H8R A;  5KZH A;  1J9M A;  4E3N A;  2IWB A;  3BEC A;  2XFT A;  1TEM A;  1MWU A;  1ERO A;  4O7D A;  4DF6 A;  1YLZ A;  3A3E A;  4OLG A;  3QHY A;  2R9W A;  4E3I A;  3DWZ A;  1E25 A;  4R1G A;  3MXS A;  4B4X A;  2A3U A;  3HLW A;  1L0D A;  1LLB A;  3WS0 A;  2DRW A;  4JF6 A;  5GL9 A;  1U60 A;  1NJ4 A;  5DF9 A;  4OPY A;  4WYY A;  2EXA A;  4E3L A;  2WZX A;  3V3R A;  5CGS A;  4EBP A;  3PTE A;  1HZO A;  2HP5 A;  4L0L A;  5IHV A;  3G30 A;  4F94 A;  1ES3 A;  1LI0 A;  1ES5 A;  1GHP A;  1JWP A;  2Y2K A;  1GHM A;  1SCW A;  3VSL A;  1PWD A;  3IT9 A;  1GCE A;  3VSK A;  5I94 A;  3N6I A;  2C6W B;  1I2W A;  4S2L A;  2Y59 A;  4N92 A;  1Z6F A;  2Y2P A;  4OQI A;  1NYM A;  1PW8 A;  1PW1 A;  5HAR A;  3NDE A;  3LCE A;  4OLD A;  1K55 C;  1K6S A;  1IKG A;  3IXB A;  4GOG A;  1OME A;  1DJC A;  4UA7 A;  2Y2Q A;  4BD0 A;  2ZMA A;  3BFF A;  1LL5 A;  2QZ6 A;  2ZJ9 A;  3UN7 A;  2FFF B;  2WGW B;  3GR2 A;  3GSG A;  5FQ9 A;  2X01 A;  2XD5 A;  2I72 A;  2ZQC A;  4N1X A;  5HX9 A;  4QJG A;  1NXY A;  4YFM A;  3WS1 A;  3Q81 A;  1IEM A;  1E3U A;  3UY6 A;  1FR6 A;  4N1H A;  2G2U A;  3SS4 A;  3VMA A;  3LO7 A;  1K56 D;  2EXB A;  1L0E A;  3E2K A;  4CPK A;  2Y4A A;  1IYS A;  4X55 A;  3NDG A;  2JE5 A;  3UO9 A;  3W8K A;  5E2E A;  3M6H A;  2ZC4 B;  4LCL A;  5GLB A;  5FAQ A;  5FQQ A;  1PI5 A;  2WUQ A;  1ONG A;  1NZO A;  1JTD A;  3GRJ A;  4N9K A;  5E2H A;  3MXR A;  4ZJ2 A;  2ZC3 B;  1DY6 A;  4QU3 A;  2Y55 A;  3BLS A;  1FR1 A;  3EQV A;  1ERM A;  1K25 A;  4S2I A;  3S4X A;  4KZ7 A;  1CEF A;  3ZCZ A;  5HW3 A;  3G35 A;  4LV3 A;  4DE0 A;  5A90 A;  1K55 A;  3CG5 A;  4GKU A;  1ES4 A;  3WS4 A;  1MBL A;  2Y2N A;  2PBY A;  3A3D A;  3WRZ A;  3BLM A;  3G4P A;  1XGJ A;  3OZH A;  4PM5 A;  1JWZ A;  2OSU A;  3IF6 A;  4GN2 A;  4UHU A;  1QME A;  3PBO A;  1ONH A;  2Y91 A;  4PM6 A;  5CTN A;  3UE3 A;  5CRF A;  4DXB A;  1MWR A;  4GDN A;  2XK1 A;  1GA0 A;  4X6T A;  2H5S A;  4IBX A;  4LV1 A;  5EEC A;  4ZJ3 A;  2Y2H A;  2E8I A;  3O88 A;  2FFY A;  5EOO A;  2WAD A;  2XD1 A;  4WMC D;  1IYO A;  1YMS A;  2HPB A;  4DDY A;  5CGW A;  4C3Q A;  4KZ4 A;  1YLT A;  1ES2 A;  2HDS A;  2JCH A;  3OPL A;  1CI8 A;  4JF5 A;  5KSC A;  3N8S A;  4LEN A;  1K57 C;  3NCK A;  1BZA A;  3SS5 A;  1KVM A;  4OPQ A;  3UDI A;  3DW0 A;  3MZF A;  4QB8 A;  5EPH A;  5CEC A;  4U3T A;  3MZD A;  4U0T A;  4GB7 A;  5EVI A;  5FAS A;  1ESI A;  4KZA A;  3V50 A;  1FCM A;  1ZKJ A;  2JBF A;  1IKI A;  1MKI A;  3CZD A;  3S22 A;  3W4Q A;  1YLJ A;  3N7W A;  1KE3 A;  2V2F F;  2JC7 A;  4X69 A;  4Y7P A;  2DNS A;  4ZTK A;  2XH9 A;  2ZQ7 A;  1H8Z A;  1L0F A;  1MY8 A;  1YT4 A;  3PBN A;  4KQR A;  2IWD A;  5FQI A;  4Z9Q A;  3V39 A;  2B5R A;  3AGE A;  3Q7Z A;  3GTC A;  1BLC A;  4MBF A;  5L2F A;  1K54 C;  5CER A;  2XFS A;  2PU4 A;  4QD4 A;  1I2S A;  4X53 A;  2XGN A;  2Q9M A;  4FCF A;  5CTM A;  2ZC7 A;  2OLV A;  3BFE A;  4JBF A;  2Y2I A;  4WEK A;  2P74 A;  3ZHH A;  5DTT A;  3NY4 A;  1I5Q A;  1DJA A;  4K91 A;  4KG5 A;  4PMA A;  4R3B A;  3IWQ A;  4KEN B;  3SH8 A;  3VFF A;  1IEL A;  5TFQ A;  2Y2O A;  5DVA A;  2EFX A;  1SKF A;  3PAG A;  4GDB A;  3LEZ A;  4WZ5 C;  3VP3 A;  4S2P A;  5F1F A;  3UE0 A;  1NRF A;  4R3J A;  4E3M A;  4A5R A;  3NBL A;  2ZM0 A;  3ZG8 B;  5G18 A;  3HLD A;  3ZVT A;  3UPP A;  3FYZ A;  2XR0 A;  3HBR A;  3OPP A;  1M40 A;  3Q7V B;  4GD6 A;  1HVB A;  3N4I A;  5EOE A;  5FSR A;  4JLF A;  4R4S A;  4EBN A;  3Q7V A;  3ZNT A;  5M19 A;  2VGJ A;  4BQM A;  1RP5 A;  3Q82 A;  1XPB A;  4KG6 A;  3OPH A;  4KZ8 A;  4OH0 A;  4WEL A;  4MLL A;  5CEB A;  2CC1 A;  1K4E A;  4OQ0 A;  5GLD A;  4EUZ A;  5KSH A;  3ZFZ A;  4CJN A;  4KQO A;  3O86 A;  1WE4 A;  5E2F A;  1KVL A;  1HD8 A;  4E6X A;  3C4O A;  3AGD A;  1ESU A;  2WGW A;  4FH2 A;  4DRT A;  1IYQ A;  3VP0 A;  3MBZ A;  4GD8 A;  1W5D A;  1FCN A;  3E2L A;  1BSG A;  4RA7 A;  1PWC A;  2Z2M B;  1MPL A;  2WKH A;  4EWF A;  3MFD A;  4OOM A;  3PBT A;  1VM1 A;  4JXG A;  4UA9 A;  5CHU A;  5A93 A;  1YLW A;  3OPR A;  1W7F A;  3IF5 A;  5A92 A;  4BLM A;  5FAP A;  1KGE A;  3CMZ A;  1RGZ A;  2XF3 A;  3MKE A;  5FI7 A;  4OOY A;  3UDF A;  4WZ5 A;  3FWL A;  1MXO A;  5GHY A;  4HES A;  4LV2 A;  4RX3 A;  1KGF A;  1K38 A;  4NET A;  3ZDJ A;  1N9B A;  1W79 A;  1O7E A;  4MBH A;  4DE1 A;  1N4O A;  3V5M A;  3C5A A;  1BLS A;  4IVK A;  1FSW A;  1XP4 A;  4JXV A;  3BFD A;  5HFO A;  3ZG5 A;  3GQZ A;  4WM9 A;  4R0Q A;  4XXR A;  2J7V A;  4K0W A;  2P9V B;  5FQM A;  4EV4 A;  2H0Y A;  1GA9 A;  3HRE A;  1CK3 A;  3IH9 A;  4DE2 A;  5FAO A;  4X56 A;  3BFC A;  3PBR A;  5F1G A;  3IWI A;  3RXX A;  3BYD A;  2ZM8 A;  4WZ4 A;  4C6Y A;  1PZP A;  1PZO A;  3FKV A;  2Y2J A;  1TDL A;  3B3X A;  4RVA A;  3IHB A;  1NZU A;  4IED A;  2WKI A;  1PWG A;  1EWZ A;  1H5X A;  4QY5 A;  3VFH A;  5E43 A;  3VP1 A;  2XLN A;  4PM8 A;  2A49 A;  4KZB A;  1BUL A;  2IWC A;  4Y0O A;  3N8R A;  4KQQ A;  4M3K A;  3RXW A;  1S6R A;  5FQK A;  5GHZ A;  4YIN A;  3IXG A;  1QMF A;  4P6B A;  1L0G A;  1G68 A;  3GMW A;  1WYB A;  2VGK A;  3NIA A;  4BD1 A;  4UA6 A;  3SOI A;  4ZDX A;  5AQ9 A;  2EX8 A;  3AGF A;  3C7V A;  4QHC A;  1K6R A;  1XA1 A;  3ITB A;  5TR7 A;  5FQJ A;  2HDU A;  3WWX A;  1RCJ A;  1BLH A;  4WEJ A;  3Q1F A;  2RL3 A;  5CXW A;  5DTS A;  4OPZ A;  4BL3 A;  5HAQ A;  1FQG A;  1JTG A;  2WGV A;  4GNU A;  4IVI A;  4EQI A;  1NYY A;  1W8Y A;  4XUZ A;  3WRT A;  4DDS A;  1Q2Q A;  5EE8 A;  4JXS A;  2ZQ8 A;  2V1Z A;  5GLC A;  4PM9 A;  1PIO A;  1XX2 A;  4FH4 A;  3SS3 A;  3UDX A;  5AQ7 A;  4JXW A;  3OC2 A;  1G6A A;  1XXM A;  2HP9 A;  4C75 A;  1HTZ A;  1K56 A;  3HLE A;  1SDN A;  4E3O A;  3LY4 A;  2ZC6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...