1DJAA

Structure of beta-lactamase precursor, k73h mutant, at 298k
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
258
structure length
258
Chain Sequence
b'MKELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSHAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Structure and kinetics of the beta-lactamase mutants S70A and K73H from Staphylococcus aureus PC1.
pubmed doi rcsb
total genus 93
structure length 258
sequence length 258
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1996-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1djaA00
1Y54A 4ZJ2A 5FAPA 2Y91A 2ZC5B 1L0DA 1AXBA 1IYQA 1C3BA 4PMAA 4GN2A 5IHVA 1K55C 1W8YA 3TOIA 3A3EA 3ZG9B 5FATA 1L0EA 4OP8A 4QHCA 4B88A 5CECA 3UN7A 3IXDA 4RVAA 1CI9A 1K54A 2H5SA 1RCJA 3NC8A 4BQMA 3NBLA 2HDRA 2ZC4B 3AGEA 4F94A 4EBNA 5EVID 3VP4A 4WELA 3WWXA 2EX2A 1YLYA 4KZBA 5GHZA 3WS0A 1TVFA 3WS4A 1IKGA 3FWLA 3ZNTA 2WKHA 4WM9A 3CJMA 1ONGA 4KQOA 4KZAA 3OPRA 5CEBA 3G2YA 1PWDA 1ES5A 2HDUA 2QPNA 5U47A 5AQAA 3O3VA 2Z2LB 1LLBA 4UA6A 3UY6A 5DTSA 3V3RA 3N4IA 4KG6A 3NDGA 1K56A 4BL2A 4GOGA 4LENA 4LV1A 4WEJA 3FYZA 5HAQA 1YLTA 1LI9A 1BZAA 3MFDA 3P98A 3IWIA 3PBOA 4HESA 4E6XA 1NY0A 1K4FA 3BFDA 5KSHA 3HLCA 1HD8A 4LV3A 4OOLA 2X71A 3VP0A 4DKIA 5D3OA 3I7JA 1SDNA 1QMFA 5DF8A 2WKEA 2ZQ9A 1ZC2A 4HEFA 4P87A 2Y2PA 4OQGA 4OKPA 2Y2LA 3VOZA 1GHMA 5CGXA 1L0FA 1ONHA 1KGFA 2P9VB 3G2ZA 4E3LA 4S2MA 5DTTA 3PAEA 5A93A 4OONA 3UPNA 4K0WA 1E3UD 4N92A 1K25A 3QHYA 2UWXA 1PYYA 1EI5A 4IVKA 2DCFA 1RGYA 1CEFA 2XFTA 1PWCA 1FSYA 5FAOA 5FAQA 1K6SA 1TDLA 3IF6A 4HBUA 4C3QA 1WYBA 3MXSA 3G35A 2OV5A 3V3SA 1PZOA 2V1ZA 1GA0A 4WZ5A 1M40A 3W8KA 1K57A 2H10A 3FKWA 4JKTA 4X6TA 3N6IA 4U3TA 2WGWA 4YFMA 3V5MA 1YT4A 2Q9MA 5E2GA 5EVIB 2FFYA 5EOOA 1MBLA 5EVLA 1K57C 5E2FA 1IYOA 5FI6A 3CZDA 1ZG4A 4OQ0A 4C6YA 1XKZA 4L0LA 2XR0A 2ZQCA 4ZTKA 3VFHA 1W7FA 1KVLA 3C4PA 4R23A 4B4ZA 1MPLA 5EVIA 4FCFA 1BT5A 4EBLA 5F1FA 2ZMAA 3PBSA 5E2EA 5HARA 1GHPA 3N8RA 1O7EA 4U0TA 4DE2A 4DF6A 1BLCA 1K38A 3IHAA 1JTDA 2ZM2A 4O7DA 2RCXA 3WRTA 1PZPA 2X01A 1IYPA 3NI9A 3IF6B 1KVMA 1JTGA 2VGKA 4FH2A 4IBRA 2Y4AA 4E3MA 3MBZA 4KQQA 2OLVA 4EV4A 1EROA 1ESUA 3HLFA 1XA1A 2H0TA 1HVBA 3LY3A 1TEMA 4KENB 2V20A 3BFGA 3S22A 2PU2A 4OPRA 4PM7A 1G68A 4QD4A 5DTKA 4JF4A 4RX3A 5HX9A 3ZCZA 4X56A 4S2OA 2HP9A 5GHXA 3SS3A 5CRFA 1BLHA 4PPRA 2Y2HA 3ITBA 4NETA 1NZOA 5EE8A 5CGWA 1NYMA 3ISGA 4R1GA 5FA7A 5J8XA 3ZG7B 2JCHA 3G32A 3IQAA 5E43A 3AGFA 5EOEA 4OPZA 4WMCA 2I72A 5AQBA 3UDIA 3GV9A 4JXVA 3GR2A 2HP6A 2IWBA 1YM1A 3WRZA 3HLBA 2EXAA 2ZC3B 5AQ7A 5FASA 3GSGA 2G2WA 1MWUA 1SKFA 2WADA 3NY4A 4S2KA 3SH8A 5JYPA 2QZ6A 3GTCA 3Q7VB 4EWFA 4PM5A 3HUNA 3HREA 1CEGA 3GQZA 1LI0A 2XDMA 3OCNA 4OP5A 3FZCA 3SS5A 1WYCA 2Y2OA 2EFUA 3TG9A 5FQQA 1W79A 4Y0OA 4C75A 1BLPA 3DTMA 1NXYA 1YMSA 3PBNA 2J8YA 2XF3A 2DRWA 4FH4A 5CGSA 5EUAA 5CERA 1HTZA 3MKFA 3ZG0A 4QY6A 3GVBA 3MZFA 4X53A 5DF9A 3ZG5A 3A3FA 3M2KA 3VP3A 2ZC6B 3G4PA 5FQMA 1BULA 4KG2A 1QMEA 4OQHA 4R3BA 3JYIA 1ERQA 2R9WA 3A3IA 4EBPA 3OCLA 4ID4A 1RP5A 4OOMA 3SS4A 3BECA 3LCEA 1E3UA 4E3IA 2XGNA 4FSFA 3VP1A 1BTLA 3IWOA 4P6BA 5CTNA 1YLZA 3SOIA 4A5RA 3VP2A 4OOYA 1BLSA 3BLSA 1SDEA 4OVDA 3D4FA 3UE3A 5AQ9A 2Y2MA 2QMIA 3IXHA 1E25A 4KZ7A 3IHBA 4E6WA 3IF5A 4KZ9A 2HP5A 3IF6C 4LCMA 4X55A 4QY5A 5JYOA 2Y2IA 1U60A 5CEDA 2J7VA 1GHIA 1Q2PA 4PM6A 2HPBA 1ALQA 1H5XA 2XK1A 4KZ4A 2XLNA 4PM9A 4BL3A 1ES2A 4WMCD 5A90A 5HW3A 2WZXA 1XGJA 5DF7A 4K91A 1YQSA 4ZDXA 1KE3A 4R4RA 1MWRA 1IKIA 1FOFA 3N7WA 1DJAA 3LO7A 3O88A 5G18A 3UDXA 1YLPA 5KMWA 1H8ZA 4DE0A 2XQZA 3G34A 5KZHA 4WYYA 4NK3A 3E2KA 1GA9A 1MY8A 3A3JA 4H8RA 3E2LA 4MBKA 4JXSA 3IWQA 5TFQA 3WS2A 2XEPA 4DDSA 5FI7A 3A3DA 4KZ5A 5GLDA 4KQRA 4X68A 4BLMA 4EUZA 1VQQA 4OLDA 3VSKA 2OLUA 3G31A 2XH9A 2Y2JA 5TGFA 3M6HA 5HFOA 3RJUA 1Q2QA 4GNUA 3UNWA 3FV7A 1VM1A 2C5WB 2RL3A 3LY4A 4QB8A 2ZQAA 1I5QA 1KDSA 2BG1A 3HVFA 2JC7A 3PBTA 1LL9A 2GDNA 3Q81A 4OH0A 4R0QA 3HBRA 5M18A 2Y2NA 2ZM0A 4OPYA 3V50A 5GL9A 1XGIA 4GKUA 3TSGA 4UAAA 3BRMA 1FCOA 1HZOA 2Y59A 2G2UA 3C7UA 4P85A 5FQJA 3GMWA 1K6RA 1Z6FA 2ZM8A 3RXXA 5CHUA 1DY6A 3LEZA 5A91A 5HAPA 3HL9A 3ZDJA 1E4DA 4BJPA 4IEDA 5FSRA 4S2LA 2A49A 2ZD8A 4GDNA 4JLFA 2HDQA 3N8LA 3HLWA 4JXWA 2EX6A 3NDEA 4JXGA 5GLBA 1KE0A 4N9KA 3UE1A 4JF5A 1PI5A 4N9LA 3PBRA 1JWPA 3ZNYA 1G6AA 4KZ3A 2ZQDA 4N1HA 4IVIA 4OQIA 1CI8A 2DNSA 2WYXA 1KGEA 4GB7A 2XD1A 1ZG6A 2EXBA 3HUMA 3HLEA 2BLSA 2H0YA 4DE1A 4S2NA 3ZVWA 1J9MA 1I2WA 3N8SA 4OPQA 3ZHHA 2VGJA 1W5DA 1FSWA 4S2NC 1DJCA 2PBYA 5M1AA 1IELA 2WAEA 4N1XA 3FKVA 5CHMA 2Q9NA 1XA7A 4GD8A 3DWZA 5EPHA 1PI4A 1GCEA 1PW1A 2XFSA 2J9PA 4UA9A 3W4QA 4RA7A 2IWDA 4Y0UA 4K0XA 5FI2A 4UHUA 3QNCA 4R3JA 3BFFA 2WZZA 3BYDA 4MEZA 3C4OA 2P9VA 2ZC7A 2A3UA 2WK0A 1NJ4A 2E8IA 4E3JA 3M6BA 4E3OA 5F83A 4IBXA 3IXBA 5BOHA 4CPKA 3Q1FA 3UPOA 1N9BA 1XXMA 2PU4A 4XUZA 4CJNA 2IWCA 1L0GA 1YLWA 4S2JA 4MLLA 5FQ9A 4HBTA 4MBHA 4GDBA 1ZKJA 4BENA 3OC2A 3NIAA 3O87A 1FCMA 5CXWA 5FDHA 3NCKA 3IT9A 5I94A 5TR7A 3C5AA 3VSLA 4Z9QA 4Y0TA 2ZQ8A 4MNRA 1JWVA 1SCWA 2CC1A 4WZ5C 1XX2A 1YMXA 2WUQA 5KSCA 5GHYA 5CTMA 4QU3A 3BM6A 3M2JA 2Y2KA 1M6KA 2Y55A 1K4EA 3HLDA 3UE0A 2X02A 2ZJ9A 2EX8A 3OPHA 3WS1A 1IYSA 1K56D 3Q82A 3BEBA 1NZUA 3MXRA 3PTEA 4XXRA 1DJBA 1NYYA 4Q8IA 3C7VA 4LV2A 1K54C 1ES3A 3Q07A 2WAFA 3BLMA 2R9XA 1LHYA 2FFFB 3VOYA 1MWTA 2EFXA 1PWGA 4DRTA 3QNBA 4FD8A 4Y7PA 3ITAA 4GZBA 3WS5A 3ZFZA 1FQGA 1MWSA 3CMZA 2Z2MB 4BD1A 3PAGA 5FQKA 2P74A 4RYEA 4DDYA 1ESIA 1ES4A 2ZLYA 4ZBEA 4S2PA 3SH7A 3P09A 1MKIA 4S2IA 4LCLA 3Q7VA 2OSUA 4R4SA 1IEMA 1S0WA 5GLAA 2V2FF 1O07A 3HUOA 2WGWB 5A92A 4WBGA 5EVIC 4JPMA 4D2OA 3AGDA 4ZAMA 4YINA 3IXGA 1BUEA 3MZEA 3IH8A 1WE4A 4JBFA 4RX2A 4XUXA 2J9OA 3O86A 4ZJ3A 1OMEA 1KGGA 3DWKA 4LV0A 3IH9A 1K55A 5L2FA 4UA7A 3UO9A 5FQIA 5M19A 3MKEA 3ZG8B 1W8QA 3SH9A 4B4XA 2HDSA 1BSGA 1XPBA 2WGVA 1N4OA 3GRJA 3OPLA 4ZJ1A 4PM8A 1TDGA 4KZ8A 5F1GA 1EWZA 3Q7ZA 1LL5A 3OPPA 4GD6A 2C6WB 1RGZA 3BFEA 3G30A 5GLCA 3RXWA 4M3KA 2Y2GA 1FR1A 1PW8A 3VMAA 4EQIA 5E2HA 1KDWA 1XP4A 5DVAA 4P0MA 3VFFA 1FCNA 4OLGA 3S1YA 4X69A 1FR6A 1L2SA 1JVJA 3HLGA 1SHVA 3EQVA 3W4OA 5EECA 4JF6A 3ZVTA 3BFCA 4WZ4A 4DXCA 5HL1A 3EQUA 4DXBA 2ZQ7A 2XD5A 4BD0A 2B5RA 3DW0A 1YLJA 5CHJA 3OZHA 5HAIA 1KE4A 4MBFA 1ERMA 4KG5A 1JWZA 2JBFA 4U0XA 3CG5A 3V39A 1PIOA 4DE3A 1I2SA 3MZDA 4QJGA 3S4XA 2WGIA 2EX9A 3PBQA 3UDFA 3UPPA 2Y2QA 1H8YA 4KZ6A 5F82A 1MXOA 1S6RA 3B3XA 3ZGAB 3W4PA 4E3KA 4E3NA 2WKIA 1NRFA 4WEKA 1CK3A 2JE5A
chains in the Genus database with same CATH superfamily
2B18A 2ZC5B 1L0DA 3TOIA 3DTKA 3BW6A 4GN2A 4LFUA 5HPIA 4OP8A 3F1OB 4B9OA 1CI9A 1RCJA 2H5SA 1YSPA 4NXBA 2HDRA 4EBNA 3VP4A 4WELA 3WWXA 1YLYA 2LB9A 4KZBA 3WS0A 5A8BA 4PAUA 2PDRA 3HJKA 2E8JA 3ZNTA 3T4TA 1PWDA 1ES5A 2QPNA 2J80A 5KIZA 3N4IA 1MC0A 3F1OA 4LENA 4WEJA 1YKDA 3FYZA 5HAQA 1BZAA 4E6XA 3BFDA 5KSHA 1QMFA 1KGFA 4P6ZM 3G2ZA 3TRCA 1CF0A 4K0WA 1VHMA 1UWNX 4N92A 3QHYA 2GJ3A 1CEFA 1FSYA 4HH2A 5FAQA 3IF6A 3LIFA 4C3QA 2JKFA 2ZL1A 3MXSA 3LIBA 1GA0A 4Q0JA 5HWTA 3DBAA 2Q9MA 2FFYA 1K57C 1Y4OA 4ZTKA 3NHQA 2O9BA 4HI4A 4R23A 1G6OA 4ARZB 4BBVA 4R3AA 3N8RA 5F6AA 4DE2A 4DF6A 3IX4A 3IHAA 3RFBA 3KSGA 2X01A 2A24A 1IYPA 3NI9A 2INWA 3P7NA 4E3MA 1TD5A 4LPZA 5FL3A 1XA1A 3BFGA 4PM7A 4JF4A 5HDDA 3ZCZA 2K7SA 4S2OA 5HSQA 4PPRA 1NZOA 1NYMA 1KOUA 1OTBA 5J8XA 4II7A 4IUKA 5AQBA 1S67L 1OJ5A 3CUEA 3HLBA 1JNUA 1SKFA 5JYPA 2QZ6A 3H9WA 3Q7VB 1DP8A 1S66L 3HREA 3OCNA 2EFUA 4C75A 3DTMA 1NXYA 4FH4A 2ZMVA 5EUAA 1S1ZA 3QP6A 2PHYA 4QY6A 3MZFA 4X53A 3A3FA 2ZC6B 3S7QA 3G4PA 4OQHA 3JYIA 2R9WA 2VEAA 3A3IA 4EBPA 4ID4A 4JGQA 4E3IA 4P6BA 4OOYA 2V0UA 3BLSA 3KYEA 5AQ9A 3IXHA 2VV8A 4E6WA 3E4QA 4HQAA 4E04A 2J7VA 1GHIA 1Q2PA 1ES2A 2WKRA 2M7UA 1IKIA 1FOFA 3EEHA 3LO7A 3O88A 1YLPA 3G34A 4NK3A 1GA9A 4LRZE 3A3JA 3E2LA 4I3IA 3WS2A 4DDSA 5FI7A 3T1QB 4KZ5A 5GLDA 5K5BA 1T18A 3CPTB 3LI9A 4EUZA 5DFXA 5HFOA 3S7PA 1Q2QA 2RL3A 2C5WB 4WN5A 3LY4A 1I5QA 2JC7A 2VV6A 5HDCA 2Y2NA 2ZM0A 2L1MA 3V50A 2G2UA 5DKKA 4L9GA 1XJ4A 5FSRA 2A24B 3IBJA 4S2LA 5HDSA 2ACGA 4JXWA 3QP5A 4WF0A 5GLBA 1KE0A 3ZNYA 1G6AA 2ZQDA 3MJQA 4N1HA 2OAQ1 5F68A 1CI8A 2BLSA 2H0YA 4DE1A 3PXPA 1YPRA 4S2NC 4WUJA 3LR4A 4N1XA 3FKVA 4DJ3A 3CWFA 3DWZA 3IS2A 3UB9A 2IWDA 4K0XA 3C4OA 2P9VA 2QJ7A 2ZOHA 1LT0A 2WK0A 3MSHA 5F83A 4IBXA 3IXBA 5BOHA 4CPKA 5AVFA 3S7NA 2W27A 1YLWA 3H7WB 1ZKJA 3NIAA 3O87A 5FDHA 4QWOA 5HPFA 1PRQA 3VSLA 1JWVA 1OPXA 1SCWA 2ZBBA 1YMXA 5KSCA 2V8FA 4HHDA 2AVXA 1M6KA 3UE0A 4NXFA 1DJBA 1OTIA 3BLMA 2R9XA 1LHYA 2FFFB 3EOIA 1PWGA 3QNBA 4Y7PA 1GSXA 1MWSA 3CMZA 1T1AA 4BD1A 4RYEA 4S2PA 3P09A 2MJ6A 1MKIA 4LCLA 1S0WA 3EWKA 4UEYA 4GHIB 2V2FF 1O07A 3HUOA 2WGWB 4JPMA 3K2NA 4ETXA 1BUEA 2PD7A 3IH8A 1F98A 3OBFA 3MF0A 3LI8A 3UO9A 3MKEA 4CLCC 3GRJA 1N9LA 2EWWA 3IX8A 3Q7ZA 1LL5A 4CLCA 3RXWA 4F3LB 3BFEA 2ZOIA 5GLCA 4M3KA 3VMAA 5E2HA 2NUPC 5HWWA 2PR5A 2KX6A 1FR6A 2PBDP 5IT5A 1JVJA 1T1BA 1SHVA 2NUTC 5EECA 2V0WA 4WZ4A 5HL1A 4DXBA 2XD5A 3C8CA 3MQ0A 5HAIA 1ERMA 1JWZA 2JBFA 1F5MA 2FH5A 2Y2QA 1H8YA 3B3XA 3MXQA 3ZGAB 4ZJ2A 4HOIA 4ME4A 1AXBA 4PMAA 5IHVA 1K55C 3ZG9B 4B88A 3UN7A 5EM1A 4JGOA 3DTEA 2YKHA 2ZC4B 3AGEA 1V9ZA 5GHZA 1TVFA 3WS4A 2ZMFA 1IKGA 1TS6A 4WM9A 4KZAA 1ONGA 5DJTA 5CEBA 3KX0X 3G2YA 2HDUA 5U47A 3O3VA 2Z2LB 1LLBA 3UY6A 1K56A 4BL2A 1W63Q 3UMDA 4GOGA 4LV1A 1YLTA 1T1CA 3IWIA 3HLCA 4LV3A 4OOLA 4DKIA 2X71A 3VP0A 3VE3A 2Q0OA 5DF8A 5LBRA 2ZQ9A 1WA9A 2J3TD 2Y2PA 3DAVA 4OKPA 4OQGA 2Y2LA 2VKSA 3UPNA 4EXOA 1E3UD 1UGUA 4HP4A 2UWXA 1OT9A 1PWCA 1K6SA 3G35A 3V3SA 1M40A 2H10A 3FKWA 4JKTA 4PKYA 1NRJA 1YT4A 5EVIB 2O0YA 1MBLA 5EVLA 3R4KA 1IYOA 1ZG4A 4L0LA 2XR0A 2ZQCA 1W7FA 3LR0A 4D60A 2XA7M 1STZA 3CLOA 1MPLA 4EBLA 2ZMAA 5HARA 1BLCA 1JTDA 1PZPA 1KVMA 1JTGA 2VGKA 2W1TA 4Q0HA 2M1CA 4EV4A 1EROA 1HVBA 3LY3A 4KENB 3RTYA 3K3CA 3S22A 1G68A 4QD4A 4RX3A 2HP9A 5GHXA 1BLHA 2GNXA 3ITBA 5CGWA 4JGRA 3ZG7B 3G32A 5E43A 1D06A 2V1BA 1MKMA 1W63M 4B93A 4JXVA 3GR2A 2HP6A 2IWBA 5AQ7A 2YKFA 2G2WA 2WADA 3NY4A 4S2KA 4EWFA 3HUNA 4OP5A 2XDMA 2Y2OA 3L7HA 5FQQA 1W79A 3KO6A 1BLPA 2P04A 3CPTA 3PBNA 2DRWA 5CGSA 4MCWA 4DN0A 3ZG0A 3VV4A 3FPWA 4IHQA 4KG2A 1QMEA 3KYZA 4R6LA 3SS4A 3IBRA 4X25A 3BECA 3BQ8A 3LCEA 4FSFA 3R7WB 3IWOA 5DKLA 1SDEA 3D4FA 1E25A 1GSVA 3ULFA 3T50A 1ALQA 2XK1A 4CLCB 4BL3A 3P01A 5DF7A 4YOFA 2BASA 1XJ6A 1YQSA 1KE3A 3H82B 2QWSA 3N7WA 1DJAA 2OWHA 4KQDA 1H8ZA 2PYRA 4DE0A 4YWZA 4WYYA 1SKOA 2GX5A 4H8RA 4MBKA 4OLDA 5J3WA 2OLUA 5TGFA 3RJUA 2R78A 1NLZA 1GSWA 2ZQAA 2GDNA 3C2WA 3HBRA 5M18A 4OPYA 2W3EA 4GKUA 4UAAA 3LFVA 2Y59A 3C7UA 5FQJA 3UB5P 2ZL1B 2ZM8A 2PT7A 1PNEA 5CHUA 1DY6A 3LEZA 5HAPA 4IEDA 4GDNA 2HDQA 3U2AA 3UE1A 4JF5A 4N9LA 3JVUA 3ZYTA 1MZUA 1VETB 2W3DA 2XD1A 1ZG6A 2EXBA 2QHKA 3G6OA 2D02A 3ZVWA 1I2WA 3T1SA 2VGJA 3FG8A 2W1TB 4LRXC 1LSVA 2Q9NA 3GDIA 3H82A 1GCEA 2J9PA 4UA9A 3W4QA 5FI2A 3MS6A 2WZZA 3BYDA 4E3JA 3EGDC 2K31A 4CJNA 4X1LA 4NXGA 4GDBA 1VETA 5CXWA 1S4RA 4CQHA 3NCKA 2HJ9C 5TR7A 4Z9QA 4IUHA 2ZQ8A 4WZ5C 2WUQA 5GHYA 5CTMA 1ACFA 3BM6A 2X02A 2ZJ9A 2EX8A 4R70A 1IYSA 3Q82A 3BEBA 1NZUA 3MXRA 3PTEA 4DMZA 1Y28A 3BY9A 3T4QA 3VOYA 1MWTA 4DRTA 1D1JA 4FD8A 3ITAA 4MN6A 2QYBA 2VGLM 2Z2MB 5FQKA 4MN5A 4DDYA 3JPUA 2L0WA 4ZBEA 3SH7A 4S2IA 4R4SA 1IEMA 1P97A 1HLUP 4WBGA 4D2OA 3AGDA 1F9IA 3UB7A 4ZAMA 3IXGA 2KDKA 2J9OA 2JKRM 4LV0A 3T12B 3ZG8B 4B4XA 1BSGA 3KYQA 1XPBA 2XA7S 3OPLA 4PM8A 4LLOB 1VEUB 5F1GA 3OPPA 4GD6A 2C6WB 4EQIA 1FR1A 3T1XA 1XP4A 4EW7A 3VFFA 4OLGA 3S1YA 4X69A 3C38A 4MN7A 3EQUA 3MMHA 5CHJA 1KE4A 4KG5A 4U0XA 3CG5A 2JHEA 2K2NA 1PIOA 3S4XA 3PBQA 5F82A 4ZRRA 4G3KA 3SW1A 3KSFA 4E3KA 4MMNA 1Y54A 3CITA 2IA2A 5FAPA 2Y91A 1IYQA 1W8YA 2VA0A 4Y13A 1L0EA 4QHCA 3IXDA 4RVAA 4BQMA 4F94A 5EVID 2VX8A 3FWLA 3CJMA 4KQOA 1XJ3A 5AQAA 3A0VA 4UA6A 3T4OA 5DTSA 4KG6A 5EFWA 2HF6A 1LI9A 3P98A 1TF1A 3MFDA 3PBOA 4HESA 1NY0A 1HD8A 1FIKA 2V9AA 1ZTUA 2OOLA 4HEFA 5CGXA 1L0FA 2CMNA 3TJZC 3PAEA 5A93A 1PYYA 1EI5A 4IVKA 4O0PA 2DCFA 4O01A 5FAOA 4ARZA 3CUEC 3LEQA 2VK3A 1WYBA 4HBUA 2V1ZA 3UB8A 3N6IA 4U3TA 3T4JA 3VE4A 2WGWA 1H0MA 5I5LA 3V5MA 4PKYG 2VV7A 5E2GA 2W3GA 3LIEA 5E2FA 2V8CA 4I38A 4OQ0A 4C6YA 2XROA 3F1NA 4EEUA 3LUQA 1KVLA 1N9NA 3LR5A 3E0YA 4B4ZA 4NXEA 5EVIA 3NULA 3BJNA 1BT5A 4O8GA 4Z1WA 2JKRI 5E2EA 5F1FA 4L9EA 1GHPA 1O7EA 4K08A 4EU0A 3HJIA 2J3TC 2ZM2A 2KLIA 2RCXA 3WRTA 3T1RA 3NOUC 3IF6B 2A2LA 1D7EA 1Z09A 4FH2A 4IBRA 2Y4AA 3MBZA 2OLVA 5HZHA 4GLQA 1ESUA 1TEMA 1OT6A 3ZQ5A 2D01A 5HX9A 3SS3A 5CRFA 2Y2HA 5HD5A 5EE8A 2Z6CA 4R1GA 3KSIA 5FA7A 2VGLS 3LYXA 4FTXA 3IQAA 3AGFA 2I72A 3UDIA 4G3WA 3GV9A 2EXAA 2ZC3B 5FASA 1MWUA 4HJ6A 1PFLA 5HL6A 1OTAA 4BBUA 3FZCA 3TG9A 4X1MA 4Y0OA 2VLGA 2V1AA 1YMSA 2J8YA 2XF3A 2O9AA 3ZG5A 2WKPA 1EW0A 4M4XA 5CX7A 1BULA 4R3BA 2HGVA 3TE8A 3V67A 3OCLA 1RP5A 3MFXA 1E3UA 5TBMA 5CTNA 1YLZA 3SOIA 3JVVA 1BLSA 3EEAA 2W3FA 4KZ7A 3IHBA 5C5KA 4H6JA 3IF5A 4KZ9A 2HP5A 3IF6C 4LCMA 5JYOA 2Y2IA 1DRMA 1U60A 2L4RA 4PM6A 2HPBA 4BWIA 4KZ4A 2XLNA 2XSSA 4WMCD 5A90A 4K91A 2HJEA 2M7VA 4R4RA 3UDXA 5KMWA 5AVEA 4G3VA 5KZHA 1A0KA 2EWVA 4I5SA 4JXSA 1J3WA 3D3OA 4BLMA 3LR3A 1VQQA 2GZAA 3G31A 2Z6DA 4YNRA 3EGXC 4GNUA 1DP6A 3VOLA 3FV7A 1VM1A 4QB8A 5TJJA 2BG1A 3HVFA 1LL9A 4R0QA 1VB6A 3W2ZA 5GL9A 1XGIA 4P85A 1H8MA 1K6RA 2VJWA 3IX3A 5A91A 3UE6A 3BQAA 1E4DA 2OWJA 4BJPA 1IOUA 2A49A 4CLCE 4EUVA 3N8LA 3HLWA 4CLCD 3NOPC 5G4ZA 4N9KA 1PI5A 4R38A 1JWPA 4KZ3A 4OQIA 2G7UA 2O9CA 2DNSA 4P6ZS 2UV0E 2WYXA 4S2NA 3B42A 3N8SA 4OPQA 3ZHHA 4MDZA 1W5DA 1S4SA 2PBYA 2W1RA 5M1AA 2WAEA 2JKGA 1XA7A 3DTIA 3SZTA 1PW1A 4RA7A 4Y0UA 1SZVA 1SKOB 1XFQA 2ZC7A 2A3UA 3UPOA 3Q1FA 2PU4A 2IWCA 5EM0A 5J7EA 4MLLA 1FCMA 5FEFA 3C5AA 1TS0A 2CC1A 2QKPA 3OLOA 4I3AA 3HLDA 3WS1A 1LSXA 5TBMB 1NYYA 4Q8IA 3C7VA 4LV2A 3Q07A 4Y3IA 3H7WA 2EFXA 4GZBA 3WS5A 3PYPA 3PAGA 2P74A 2WKQA 1ES4A 2PR6A 4EQ1A 5EV0A 3OOVA 2OSUA 5DFYA 3FPVA 3T4SA 3MZEA 4RX2A 1WE4A 4XUXA 3LGOA 1OMEA 1KGGA 3DWKA 4ESPA 3QP8A 1K55A 5L2FA 4UA7A 1UWPX 3RH8B 4LGWA 1V9YA 3F1NB 2WGVA 1N4OA 1TDGA 4KZ8A 1EWZA 1RGZA 3G30A 1PW8A 3T4KA 4NEED 1FCNA 3E98A 5IU1A 2EA9A 4JF6A 2P08A 3BFCA 3E4OA 2ZQ7A 4BD0A 2B5RA 3DW0A 4PHTA 1T19A 3T4LA 3C30A 4DE3A 1I2SA 3MZDA 4QJGA 2EX9A 3B33A 5L10A 4AFIA 3UPPA 4KZ6A 1FILA 1MXOA 1S6RA 4NKPA 2WKIA 1FQGA 4I3JA 2JE5A 1XJ2A 1N9OA 1C3BA 3A3EA 5FATA 4H6JB 4WLAA 5CECA 1ODVA 1K54A 3NC8A 3NBLA 5L07A 3PR6A 2EX2A 4WL9A 1P9WA 3R7WA 2WKHA 3OPRA 3QP1A 2W0NA 5L8MA 3V3RA 3NDGA 4BMWA 1K4FA 5D3OA 3I7JA 1SDNA 3KSHA 2WKEA 1ZC2A 4P87A 2I9VA 1GHMA 3VOZA 1ONHA 2P9VB 4E3LA 4S2MA 5DTTA 4HP9A 4OONA 2Y79A 1K25A 1RGYA 2P7JA 2XFTA 2O99A 1TDLA 3A0SA 3O5YA 2OV5A 3LICA 1PZOA 4WZ5A 2J3WA 3W8KA 1K57A 3E4PA 4EEPA 4X6TA 5HD3A 1IFQA 3D9YA 4YFMA 5EOOA 1VEUA 5FI6A 3CZDA 1XKZA 4FUWA 3VFHA 3C4PA 3A0RA 4FCFA 3PBSA 3U4LP 4U0TA 1K38A 3CHWP 4O7DA 4KQQA 4DJ2A 3HLFA 2H0TA 2B02A 2QJ5A 2V20A 2PU2A 4OPRA 5DTKA 4L9FA 4X56A 3NECA 4QPRA 1TS7A 4NETA 3ISGA 2JCHA 1G28A 5EOEA 4OPZA 4JGPA 4WMCA 1YM1A 3WRZA 3LIDA 3GSGA 3SH8A 5IS1A 3GTCA 4PM5A 1CEGA 1CQAA 2BTFP 2Y8HA 3GQZA 1LI0A 3SS5A 1WYCA 2LB5A 4GHIA 1L3LA 5CERA 4KUKA 1HTZA 3MKFA 5MC7A 3GVBA 5DF9A 3M2KA 3VP3A 4Q0IA 5FQMA 1ERQA 4HIAA 1X0OA 4OOMA 4NG2A 5J4EA 3B47A 2XGNA 3VP1A 1BTLA 4A5RA 1OJGA 3VP2A 4OVDA 3UE3A 2Y2MA 2QMIA 4XT2A 4Y2FA 1DP9A 4X55A 4QY5A 3L9KA 5CEDA 3F1PA 4GS9A 1H5XA 4GW9A 4PM9A 1LL8A 5HW3A 2WZXA 1XGJA 4ZDXA 4ETZA 1MWRA 2OAP1 5G18A 4HH3A 4UQIM 2XQZA 3BY8A 3BWLA 3E2KA 1MY8A 5L09A 5TFQA 3IS2B 3IWQA 2XEPA 3A3DA 4KQRA 4X68A 3TW8A 3VSKA 2XH9A 2Y2JA 3M6HA 5EVEA 3UNWA 3LIAA 5AJGA 4GCZA 1KDSA 3Q81A 4OH0A 2DMWA 3PBTA 5FEGA 2FZ0A 4F3LA 2PD8A 2HZ5A 3TSGA 3BRMA 1FCOA 1HZOA 2W3HA 1YAXA 3GMWA 4HY8A 4EETB 1Z6FA 3RXXA 4GJ4A 3HL9A 3ZDJA 2ZD8A 2H28A 4JLFA 4I39A 4RQ9A 2EX6A 3NDEA 4JXGA 3FC7A 5DJUA 3CI6A 3PBRA 5HWVA 2JN7A 1P9RA 4IVIA 4LRYC 5FDSA 1KGEA 4GB7A 3HUMA 3HLEA 1J9MA 1XFNA 3MR0A 1FSWA 1DJCA 1IELA 2PAVP 5CHMA 5G4YA 1ZHHB 1S1YA 3NOTC 4GD8A 5EPHA 1PI4A 2XFSA 1NLYA 4UHUA 3QNCA 4R3JA 3BFFA 2B95A 4MEZA 1TS8A 3F1PB 4GS9B 1NJ4A 2E8IA 3M6BA 4E3OA 1N9BA 1XXMA 4XUZA 1L0GA 4HNBA 4S2JA 5FQ9A 4HBTA 4MBHA 4Y17A 3HCYA 4BENA 3OC2A 2HV1A 3IT9A 5I94A 1NWZA 2VZWA 1F2KA 2KOIA 4Y0TA 4MNRA 1XX2A 4QU3A 3M2JA 2Y2KA 2Y55A 1K4EA 3OPHA 1K56D 2JKTI 3MQOA 1P0ZA 4XXRA 3CAXA 3GECA 1ES3A 1K54C 2WAFA 1OTDA 4HJ3A 3ZFZA 3QP4A 4KUOA 4XT2B 3MQQA 1ESIA 2ZLYA 3K3DA 1LSWA 4BBTA 3Q7VA 4Y5FA 5GLAA 5A92A 3NJAA 5EVIC 1OTEA 2PYPA 4YINA 3UB6A 4JBFA 3O86A 4ZJ3A 1K0KA 3IH9A 4UQIS 3S7OA 5FQIA 5M19A 4EERA 1W8QA 3SH9A 2XRNA 2HDSA 4EESA 4ZJ1A 4HJ4A 1CJFA 2Y2GA 1KDWA 1BYWA 5DVAA 3UMEA 4P0MA 4IJGA 4Y15A 1AWIA 3QP2A 1L2SA 4FOFA 3HLGA 3EQVA 3W4OA 1YSQA 3ZVTA 4DXCA 3ICYA 1YLJA 3OZHA 1G5UA 1H3QA 4MBFA 2JKTM 3V39A 3PHYA 2WGIA 3UDFA 3D72A 5F5YA 5F69A 3W4PA 2PRFA 4E3NA 1NRFA 1CK3A 4WEKA
chains in the Genus database with same CATH topology
1Y54A 4ZJ2A 5FAPA 2Y91A 2ZC5B 1L0DA 1AXBA 1IYQA 1C3BA 4PMAA 4GN2A 5IHVA 1K55C 1W8YA 3TOIA 3A3EA 3ZG9B 5FATA 1L0EA 4OP8A 4QHCA 4B88A 5CECA 3UN7A 3IXDA 4RVAA 1CI9A 1K54A 2H5SA 1RCJA 3NC8A 4BQMA 3NBLA 2HDRA 2ZC4B 3AGEA 4F94A 4EBNA 5EVID 3VP4A 4WELA 3WWXA 2EX2A 1YLYA 4KZBA 5GHZA 3WS0A 1TVFA 3WS4A 1IKGA 3FWLA 3ZNTA 2WKHA 4WM9A 3CJMA 1ONGA 4KQOA 4KZAA 3OPRA 5CEBA 3G2YA 1PWDA 1ES5A 2HDUA 2QPNA 5U47A 5AQAA 3O3VA 2Z2LB 1LLBA 4UA6A 3UY6A 5DTSA 3V3RA 3N4IA 4KG6A 3NDGA 1K56A 4BL2A 4GOGA 4LENA 4LV1A 4WEJA 3FYZA 5HAQA 1YLTA 1LI9A 1BZAA 3MFDA 3P98A 3IWIA 3PBOA 4HESA 4E6XA 1NY0A 1K4FA 3BFDA 5KSHA 3HLCA 1HD8A 4LV3A 4OOLA 2X71A 3VP0A 4DKIA 5D3OA 3I7JA 1SDNA 1QMFA 5DF8A 2WKEA 2ZQ9A 1ZC2A 4HEFA 4P87A 2Y2PA 4OQGA 4OKPA 2Y2LA 3VOZA 1GHMA 5CGXA 1L0FA 1ONHA 1KGFA 2P9VB 3G2ZA 4E3LA 4S2MA 5DTTA 3PAEA 5A93A 4OONA 3UPNA 4K0WA 1E3UD 4N92A 1K25A 3QHYA 2UWXA 1PYYA 1EI5A 4IVKA 2DCFA 1RGYA 1CEFA 2XFTA 1PWCA 1FSYA 5FAOA 5FAQA 1K6SA 1TDLA 3IF6A 4HBUA 4C3QA 1WYBA 3MXSA 3G35A 2OV5A 3V3SA 1PZOA 2V1ZA 1GA0A 4WZ5A 1M40A 3W8KA 1K57A 2H10A 3FKWA 4JKTA 4X6TA 3N6IA 4U3TA 2WGWA 4YFMA 3V5MA 1YT4A 2Q9MA 5E2GA 5EVIB 2FFYA 5EOOA 1MBLA 5EVLA 1K57C 5E2FA 1IYOA 5FI6A 3CZDA 1ZG4A 4OQ0A 4C6YA 1XKZA 4L0LA 2XR0A 2ZQCA 4ZTKA 3VFHA 1W7FA 1KVLA 3C4PA 4R23A 4B4ZA 1MPLA 5EVIA 4FCFA 1BT5A 4EBLA 5F1FA 2ZMAA 3PBSA 5E2EA 5HARA 1GHPA 3N8RA 1O7EA 4U0TA 4DE2A 4DF6A 1BLCA 1K38A 3IHAA 1JTDA 2ZM2A 4O7DA 2RCXA 3WRTA 1PZPA 2X01A 1IYPA 3NI9A 3IF6B 1KVMA 1JTGA 2VGKA 4FH2A 4IBRA 2Y4AA 4E3MA 3MBZA 4KQQA 2OLVA 4EV4A 1EROA 1ESUA 3HLFA 1XA1A 2H0TA 1HVBA 3LY3A 1TEMA 4KENB 2V20A 3BFGA 3S22A 2PU2A 4OPRA 4PM7A 1G68A 4QD4A 5DTKA 4JF4A 4RX3A 5HX9A 3ZCZA 4X56A 4S2OA 2HP9A 5GHXA 3SS3A 5CRFA 1BLHA 4PPRA 2Y2HA 3ITBA 4NETA 1NZOA 5EE8A 5CGWA 1NYMA 3ISGA 4R1GA 5FA7A 5J8XA 3ZG7B 2JCHA 3G32A 3IQAA 5E43A 3AGFA 5EOEA 4OPZA 4WMCA 2I72A 5AQBA 3UDIA 3GV9A 4JXVA 3GR2A 2HP6A 2IWBA 1YM1A 3WRZA 3HLBA 2EXAA 2ZC3B 5AQ7A 5FASA 3GSGA 2G2WA 1MWUA 1SKFA 2WADA 3NY4A 4S2KA 3SH8A 5JYPA 2QZ6A 3GTCA 3Q7VB 4EWFA 4PM5A 3HUNA 3HREA 1CEGA 3GQZA 1LI0A 2XDMA 3OCNA 4OP5A 3FZCA 3SS5A 1WYCA 2Y2OA 2EFUA 3TG9A 5FQQA 1W79A 4Y0OA 4C75A 1BLPA 3DTMA 1NXYA 1YMSA 3PBNA 2J8YA 2XF3A 2DRWA 4FH4A 5CGSA 5EUAA 5CERA 1HTZA 3MKFA 3ZG0A 4QY6A 3GVBA 3MZFA 4X53A 5DF9A 3ZG5A 3A3FA 3M2KA 3VP3A 2ZC6B 3G4PA 5FQMA 1BULA 4KG2A 1QMEA 4OQHA 4R3BA 3JYIA 1ERQA 2R9WA 3A3IA 4EBPA 3OCLA 4ID4A 1RP5A 4OOMA 3SS4A 3BECA 3LCEA 1E3UA 4E3IA 2XGNA 4FSFA 3VP1A 1BTLA 3IWOA 4P6BA 5CTNA 1YLZA 3SOIA 4A5RA 3VP2A 4OOYA 1BLSA 3BLSA 1SDEA 4OVDA 3D4FA 3UE3A 5AQ9A 2Y2MA 2QMIA 3IXHA 1E25A 4KZ7A 3IHBA 4E6WA 3IF5A 4KZ9A 2HP5A 3IF6C 4LCMA 4X55A 4QY5A 5JYOA 2Y2IA 1U60A 5CEDA 2J7VA 1GHIA 1Q2PA 4PM6A 2HPBA 1ALQA 1H5XA 2XK1A 4KZ4A 2XLNA 4PM9A 4BL3A 1ES2A 4WMCD 5A90A 5HW3A 2WZXA 1XGJA 5DF7A 4K91A 1YQSA 4ZDXA 1KE3A 4R4RA 1MWRA 1IKIA 1FOFA 3N7WA 1DJAA 3LO7A 3O88A 5G18A 3UDXA 1YLPA 5KMWA 1H8ZA 4DE0A 2XQZA 3G34A 5KZHA 4WYYA 4NK3A 3E2KA 1GA9A 1MY8A 3A3JA 4H8RA 3E2LA 4MBKA 4JXSA 3IWQA 5TFQA 3WS2A 2XEPA 4DDSA 5FI7A 3A3DA 4KZ5A 5GLDA 4KQRA 4X68A 4BLMA 4EUZA 1VQQA 4OLDA 3VSKA 2OLUA 3G31A 2XH9A 2Y2JA 5TGFA 3M6HA 5HFOA 3RJUA 1Q2QA 4GNUA 3UNWA 3FV7A 1VM1A 2C5WB 2RL3A 3LY4A 4QB8A 2ZQAA 1I5QA 1KDSA 2BG1A 3HVFA 2JC7A 3PBTA 1LL9A 2GDNA 3Q81A 4OH0A 4R0QA 3HBRA 5M18A 2Y2NA 2ZM0A 4OPYA 3V50A 5GL9A 1XGIA 4GKUA 3TSGA 4UAAA 3BRMA 1FCOA 1HZOA 2Y59A 2G2UA 3C7UA 4P85A 5FQJA 3GMWA 1K6RA 1Z6FA 2ZM8A 3RXXA 5CHUA 1DY6A 3LEZA 5A91A 5HAPA 3HL9A 3ZDJA 1E4DA 4BJPA 4IEDA 5FSRA 4S2LA 2A49A 2ZD8A 4GDNA 4JLFA 2HDQA 3N8LA 3HLWA 4JXWA 2EX6A 3NDEA 4JXGA 5GLBA 1KE0A 4N9KA 3UE1A 4JF5A 1PI5A 4N9LA 3PBRA 1JWPA 3ZNYA 1G6AA 4KZ3A 2ZQDA 4N1HA 4IVIA 4OQIA 1CI8A 2DNSA 2WYXA 1KGEA 4GB7A 2XD1A 1ZG6A 2EXBA 3HUMA 3HLEA 2BLSA 2H0YA 4DE1A 4S2NA 3ZVWA 1J9MA 1I2WA 3N8SA 4OPQA 3ZHHA 2VGJA 1W5DA 1FSWA 4S2NC 1DJCA 2PBYA 5M1AA 1IELA 2WAEA 4N1XA 3FKVA 5CHMA 2Q9NA 1XA7A 4GD8A 3DWZA 5EPHA 1PI4A 1GCEA 1PW1A 2XFSA 2J9PA 4UA9A 3W4QA 4RA7A 2IWDA 4Y0UA 4K0XA 5FI2A 4UHUA 3QNCA 4R3JA 3BFFA 2WZZA 3BYDA 4MEZA 3C4OA 2P9VA 2ZC7A 2A3UA 2WK0A 1NJ4A 2E8IA 4E3JA 3M6BA 4E3OA 5F83A 4IBXA 3IXBA 5BOHA 4CPKA 3Q1FA 3UPOA 1N9BA 1XXMA 2PU4A 4XUZA 4CJNA 2IWCA 1L0GA 1YLWA 4S2JA 4MLLA 5FQ9A 4HBTA 4MBHA 4GDBA 1ZKJA 4BENA 3OC2A 3NIAA 3O87A 1FCMA 5CXWA 5FDHA 3NCKA 3IT9A 5I94A 5TR7A 3C5AA 3VSLA 4Z9QA 4Y0TA 2ZQ8A 4MNRA 1JWVA 1SCWA 2CC1A 4WZ5C 1XX2A 1YMXA 2WUQA 5KSCA 5GHYA 5CTMA 4QU3A 3BM6A 3M2JA 2Y2KA 1M6KA 2Y55A 1K4EA 3HLDA 3UE0A 2X02A 2ZJ9A 2EX8A 3OPHA 3WS1A 1IYSA 1K56D 3Q82A 3BEBA 1NZUA 3MXRA 3PTEA 4XXRA 1DJBA 1NYYA 4Q8IA 3C7VA 4LV2A 1K54C 1ES3A 3Q07A 2WAFA 3BLMA 2R9XA 1LHYA 2FFFB 3VOYA 1MWTA 2EFXA 1PWGA 4DRTA 3QNBA 4FD8A 4Y7PA 3ITAA 4GZBA 3WS5A 3ZFZA 1FQGA 1MWSA 3CMZA 2Z2MB 4BD1A 3PAGA 5FQKA 2P74A 4RYEA 4DDYA 1ESIA 1ES4A 2ZLYA 4ZBEA 4S2PA 3SH7A 3P09A 1MKIA 4S2IA 4LCLA 3Q7VA 2OSUA 4R4SA 1IEMA 1S0WA 5GLAA 2V2FF 1O07A 3HUOA 2WGWB 5A92A 4WBGA 5EVIC 4JPMA 4D2OA 3AGDA 4ZAMA 4YINA 3IXGA 1BUEA 3MZEA 3IH8A 1WE4A 4JBFA 4RX2A 4XUXA 2J9OA 3O86A 4ZJ3A 1OMEA 1KGGA 3DWKA 4LV0A 3IH9A 1K55A 5L2FA 4UA7A 3UO9A 5FQIA 5M19A 3MKEA 3ZG8B 1W8QA 3SH9A 4B4XA 2HDSA 1BSGA 1XPBA 2WGVA 1N4OA 3GRJA 3OPLA 4ZJ1A 4PM8A 1TDGA 4KZ8A 5F1GA 1EWZA 3Q7ZA 1LL5A 3OPPA 4GD6A 2C6WB 1RGZA 3BFEA 3G30A 5GLCA 3RXWA 4M3KA 2Y2GA 1FR1A 1PW8A 3VMAA 4EQIA 5E2HA 1KDWA 1XP4A 5DVAA 4P0MA 3VFFA 1FCNA 4OLGA 3S1YA 4X69A 1FR6A 1L2SA 1JVJA 3HLGA 1SHVA 3EQVA 3W4OA 5EECA 4JF6A 3ZVTA 3BFCA 4WZ4A 4DXCA 5HL1A 3EQUA 4DXBA 2ZQ7A 2XD5A 4BD0A 2B5RA 3DW0A 1YLJA 5CHJA 3OZHA 5HAIA 1KE4A 4MBFA 1ERMA 4KG5A 1JWZA 2JBFA 4U0XA 3CG5A 3V39A 1PIOA 4DE3A 1I2SA 3MZDA 4QJGA 3S4XA 2WGIA 2EX9A 3PBQA 3UDFA 3UPPA 2Y2QA 1H8YA 4KZ6A 5F82A 1MXOA 1S6RA 3B3XA 3ZGAB 3W4PA 4E3KA 4E3NA 2WKIA 1NRFA 4WEKA 1CK3A 2JE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y54 A;  4ZJ2 A;  5FAP A;  2Y91 A;  2ZC5 B;  1L0D A;  1AXB A;  1IYQ A;  1C3B A;  4PMA A;  4GN2 A;  5IHV A;  1K55 C;  1W8Y A;  3TOI A;  3A3E A;  3ZG9 B;  5FAT A;  1L0E A;  4OP8 A;  4QHC A;  4B88 A;  5CEC A;  3UN7 A;  3IXD A;  4RVA A;  1CI9 A;  1K54 A;  2H5S A;  1RCJ A;  3NC8 A;  4BQM A;  3NBL A;  2HDR A;  2ZC4 B;  3AGE A;  4F94 A;  4EBN A;  5EVI D;  3VP4 A;  4WEL A;  3WWX A;  2EX2 A;  1YLY A;  4KZB A;  5GHZ A;  3WS0 A;  1TVF A;  3WS4 A;  1IKG A;  3FWL A;  3ZNT A;  2WKH A;  4WM9 A;  3CJM A;  1ONG A;  4KQO A;  4KZA A;  3OPR A;  5CEB A;  3G2Y A;  1PWD A;  1ES5 A;  2HDU A;  2QPN A;  5U47 A;  5AQA A;  3O3V A;  2Z2L B;  1LLB A;  4UA6 A;  3UY6 A;  5DTS A;  3V3R A;  3N4I A;  4KG6 A;  3NDG A;  1K56 A;  4BL2 A;  4GOG A;  4LEN A;  4LV1 A;  4WEJ A;  3FYZ A;  5HAQ A;  1YLT A;  1LI9 A;  1BZA A;  3MFD A;  3P98 A;  3IWI A;  3PBO A;  4HES A;  4E6X A;  1NY0 A;  1K4F A;  3BFD A;  5KSH A;  3HLC A;  1HD8 A;  4LV3 A;  4OOL A;  2X71 A;  3VP0 A;  4DKI A;  5D3O A;  3I7J A;  1SDN A;  1QMF A;  5DF8 A;  2WKE A;  2ZQ9 A;  1ZC2 A;  4HEF A;  4P87 A;  2Y2P A;  4OQG A;  4OKP A;  2Y2L A;  3VOZ A;  1GHM A;  5CGX A;  1L0F A;  1ONH A;  1KGF A;  2P9V B;  3G2Z A;  4E3L A;  4S2M A;  5DTT A;  3PAE A;  5A93 A;  4OON A;  3UPN A;  4K0W A;  1E3U D;  4N92 A;  1K25 A;  3QHY A;  2UWX A;  1PYY A;  1EI5 A;  4IVK A;  2DCF A;  1RGY A;  1CEF A;  2XFT A;  1PWC A;  1FSY A;  5FAO A;  5FAQ A;  1K6S A;  1TDL A;  3IF6 A;  4HBU A;  4C3Q A;  1WYB A;  3MXS A;  3G35 A;  2OV5 A;  3V3S A;  1PZO A;  2V1Z A;  1GA0 A;  4WZ5 A;  1M40 A;  3W8K A;  1K57 A;  2H10 A;  3FKW A;  4JKT A;  4X6T A;  3N6I A;  4U3T A;  2WGW A;  4YFM A;  3V5M A;  1YT4 A;  2Q9M A;  5E2G A;  5EVI B;  2FFY A;  5EOO A;  1MBL A;  5EVL A;  1K57 C;  5E2F A;  1IYO A;  5FI6 A;  3CZD A;  1ZG4 A;  4OQ0 A;  4C6Y A;  1XKZ A;  4L0L A;  2XR0 A;  2ZQC A;  4ZTK A;  3VFH A;  1W7F A;  1KVL A;  3C4P A;  4R23 A;  4B4Z A;  1MPL A;  5EVI A;  4FCF A;  1BT5 A;  4EBL A;  5F1F A;  2ZMA A;  3PBS A;  5E2E A;  5HAR A;  1GHP A;  3N8R A;  1O7E A;  4U0T A;  4DE2 A;  4DF6 A;  1BLC A;  1K38 A;  3IHA A;  1JTD A;  2ZM2 A;  4O7D A;  2RCX A;  3WRT A;  1PZP A;  2X01 A;  1IYP A;  3NI9 A;  3IF6 B;  1KVM A;  1JTG A;  2VGK A;  4FH2 A;  4IBR A;  2Y4A A;  4E3M A;  3MBZ A;  4KQQ A;  2OLV A;  4EV4 A;  1ERO A;  1ESU A;  3HLF A;  1XA1 A;  2H0T A;  1HVB A;  3LY3 A;  1TEM A;  4KEN B;  2V20 A;  3BFG A;  3S22 A;  2PU2 A;  4OPR A;  4PM7 A;  1G68 A;  4QD4 A;  5DTK A;  4JF4 A;  4RX3 A;  5HX9 A;  3ZCZ A;  4X56 A;  4S2O A;  2HP9 A;  5GHX A;  3SS3 A;  5CRF A;  1BLH A;  4PPR A;  2Y2H A;  3ITB A;  4NET A;  1NZO A;  5EE8 A;  5CGW A;  1NYM A;  3ISG A;  4R1G A;  5FA7 A;  5J8X A;  3ZG7 B;  2JCH A;  3G32 A;  3IQA A;  5E43 A;  3AGF A;  5EOE A;  4OPZ A;  4WMC A;  2I72 A;  5AQB A;  3UDI A;  3GV9 A;  4JXV A;  3GR2 A;  2HP6 A;  2IWB A;  1YM1 A;  3WRZ A;  3HLB A;  2EXA A;  2ZC3 B;  5AQ7 A;  5FAS A;  3GSG A;  2G2W A;  1MWU A;  1SKF A;  2WAD A;  3NY4 A;  4S2K A;  3SH8 A;  5JYP A;  2QZ6 A;  3GTC A;  3Q7V B;  4EWF A;  4PM5 A;  3HUN A;  3HRE A;  1CEG A;  3GQZ A;  1LI0 A;  2XDM A;  3OCN A;  4OP5 A;  3FZC A;  3SS5 A;  1WYC A;  2Y2O A;  2EFU A;  3TG9 A;  5FQQ A;  1W79 A;  4Y0O A;  4C75 A;  1BLP A;  3DTM A;  1NXY A;  1YMS A;  3PBN A;  2J8Y A;  2XF3 A;  2DRW A;  4FH4 A;  5CGS A;  5EUA A;  5CER A;  1HTZ A;  3MKF A;  3ZG0 A;  4QY6 A;  3GVB A;  3MZF A;  4X53 A;  5DF9 A;  3ZG5 A;  3A3F A;  3M2K A;  3VP3 A;  2ZC6 B;  3G4P A;  5FQM A;  1BUL A;  4KG2 A;  1QME A;  4OQH A;  4R3B A;  3JYI A;  1ERQ A;  2R9W A;  3A3I A;  4EBP A;  3OCL A;  4ID4 A;  1RP5 A;  4OOM A;  3SS4 A;  3BEC A;  3LCE A;  1E3U A;  4E3I A;  2XGN A;  4FSF A;  3VP1 A;  1BTL A;  3IWO A;  4P6B A;  5CTN A;  1YLZ A;  3SOI A;  4A5R A;  3VP2 A;  4OOY A;  1BLS A;  3BLS A;  1SDE A;  4OVD A;  3D4F A;  3UE3 A;  5AQ9 A;  2Y2M A;  2QMI A;  3IXH A;  1E25 A;  4KZ7 A;  3IHB A;  4E6W A;  3IF5 A;  4KZ9 A;  2HP5 A;  3IF6 C;  4LCM A;  4X55 A;  4QY5 A;  5JYO A;  2Y2I A;  1U60 A;  5CED A;  2J7V A;  1GHI A;  1Q2P A;  4PM6 A;  2HPB A;  1ALQ A;  1H5X A;  2XK1 A;  4KZ4 A;  2XLN A;  4PM9 A;  4BL3 A;  1ES2 A;  4WMC D;  5A90 A;  5HW3 A;  2WZX A;  1XGJ A;  5DF7 A;  4K91 A;  1YQS A;  4ZDX A;  1KE3 A;  4R4R A;  1MWR A;  1IKI A;  1FOF A;  3N7W A;  1DJA A;  3LO7 A;  3O88 A;  5G18 A;  3UDX A;  1YLP A;  5KMW A;  1H8Z A;  4DE0 A;  2XQZ A;  3G34 A;  5KZH A;  4WYY A;  4NK3 A;  3E2K A;  1GA9 A;  1MY8 A;  3A3J A;  4H8R A;  3E2L A;  4MBK A;  4JXS A;  3IWQ A;  5TFQ A;  3WS2 A;  2XEP A;  4DDS A;  5FI7 A;  3A3D A;  4KZ5 A;  5GLD A;  4KQR A;  4X68 A;  4BLM A;  4EUZ A;  1VQQ A;  4OLD A;  3VSK A;  2OLU A;  3G31 A;  2XH9 A;  2Y2J A;  5TGF A;  3M6H A;  5HFO A;  3RJU A;  1Q2Q A;  4GNU A;  3UNW A;  3FV7 A;  1VM1 A;  2C5W B;  2RL3 A;  3LY4 A;  4QB8 A;  2ZQA A;  1I5Q A;  1KDS A;  2BG1 A;  3HVF A;  2JC7 A;  3PBT A;  1LL9 A;  2GDN A;  3Q81 A;  4OH0 A;  4R0Q A;  3HBR A;  5M18 A;  2Y2N A;  2ZM0 A;  4OPY A;  3V50 A;  5GL9 A;  1XGI A;  4GKU A;  3TSG A;  4UAA A;  3BRM A;  1FCO A;  1HZO A;  2Y59 A;  2G2U A;  3C7U A;  4P85 A;  5FQJ A;  3GMW A;  1K6R A;  1Z6F A;  2ZM8 A;  3RXX A;  5CHU A;  1DY6 A;  3LEZ A;  5A91 A;  5HAP A;  3HL9 A;  3ZDJ A;  1E4D A;  4BJP A;  4IED A;  5FSR A;  4S2L A;  2A49 A;  2ZD8 A;  4GDN A;  4JLF A;  2HDQ A;  3N8L A;  3HLW A;  4JXW A;  2EX6 A;  3NDE A;  4JXG A;  5GLB A;  1KE0 A;  4N9K A;  3UE1 A;  4JF5 A;  1PI5 A;  4N9L A;  3PBR A;  1JWP A;  3ZNY A;  1G6A A;  4KZ3 A;  2ZQD A;  4N1H A;  4IVI A;  4OQI A;  1CI8 A;  2DNS A;  2WYX A;  1KGE A;  4GB7 A;  2XD1 A;  1ZG6 A;  2EXB A;  3HUM A;  3HLE A;  2BLS A;  2H0Y A;  4DE1 A;  4S2N A;  3ZVW A;  1J9M A;  1I2W A;  3N8S A;  4OPQ A;  3ZHH A;  2VGJ A;  1W5D A;  1FSW A;  4S2N C;  1DJC A;  2PBY A;  5M1A A;  1IEL A;  2WAE A;  4N1X A;  3FKV A;  5CHM A;  2Q9N A;  1XA7 A;  4GD8 A;  3DWZ A;  5EPH A;  1PI4 A;  1GCE A;  1PW1 A;  2XFS A;  2J9P A;  4UA9 A;  3W4Q A;  4RA7 A;  2IWD A;  4Y0U A;  4K0X A;  5FI2 A;  4UHU A;  3QNC A;  4R3J A;  3BFF A;  2WZZ A;  3BYD A;  4MEZ A;  3C4O A;  2P9V A;  2ZC7 A;  2A3U A;  2WK0 A;  1NJ4 A;  2E8I A;  4E3J A;  3M6B A;  4E3O A;  5F83 A;  4IBX A;  3IXB A;  5BOH A;  4CPK A;  3Q1F A;  3UPO A;  1N9B A;  1XXM A;  2PU4 A;  4XUZ A;  4CJN A;  2IWC A;  1L0G A;  1YLW A;  4S2J A;  4MLL A;  5FQ9 A;  4HBT A;  4MBH A;  4GDB A;  1ZKJ A;  4BEN A;  3OC2 A;  3NIA A;  3O87 A;  1FCM A;  5CXW A;  5FDH A;  3NCK A;  3IT9 A;  5I94 A;  5TR7 A;  3C5A A;  3VSL A;  4Z9Q A;  4Y0T A;  2ZQ8 A;  4MNR A;  1JWV A;  1SCW A;  2CC1 A;  4WZ5 C;  1XX2 A;  1YMX A;  2WUQ A;  5KSC A;  5GHY A;  5CTM A;  4QU3 A;  3BM6 A;  3M2J A;  2Y2K A;  1M6K A;  2Y55 A;  1K4E A;  3HLD A;  3UE0 A;  2X02 A;  2ZJ9 A;  2EX8 A;  3OPH A;  3WS1 A;  1IYS A;  1K56 D;  3Q82 A;  3BEB A;  1NZU A;  3MXR A;  3PTE A;  4XXR A;  1DJB A;  1NYY A;  4Q8I A;  3C7V A;  4LV2 A;  1K54 C;  1ES3 A;  3Q07 A;  2WAF A;  3BLM A;  2R9X A;  1LHY A;  2FFF B;  3VOY A;  1MWT A;  2EFX A;  1PWG A;  4DRT A;  3QNB A;  4FD8 A;  4Y7P A;  3ITA A;  4GZB A;  3WS5 A;  3ZFZ A;  1FQG A;  1MWS A;  3CMZ A;  2Z2M B;  4BD1 A;  3PAG A;  5FQK A;  2P74 A;  4RYE A;  4DDY A;  1ESI A;  1ES4 A;  2ZLY A;  4ZBE A;  4S2P A;  3SH7 A;  3P09 A;  1MKI A;  4S2I A;  4LCL A;  3Q7V A;  2OSU A;  4R4S A;  1IEM A;  1S0W A;  5GLA A;  2V2F F;  1O07 A;  3HUO A;  2WGW B;  5A92 A;  4WBG A;  5EVI C;  4JPM A;  4D2O A;  3AGD A;  4ZAM A;  4YIN A;  3IXG A;  1BUE A;  3MZE A;  3IH8 A;  1WE4 A;  4JBF A;  4RX2 A;  4XUX A;  2J9O A;  3O86 A;  4ZJ3 A;  1OME A;  1KGG A;  3DWK A;  4LV0 A;  3IH9 A;  1K55 A;  5L2F A;  4UA7 A;  3UO9 A;  5FQI A;  5M19 A;  3MKE A;  3ZG8 B;  1W8Q A;  3SH9 A;  4B4X A;  2HDS A;  1BSG A;  1XPB A;  2WGV A;  1N4O A;  3GRJ A;  3OPL A;  4ZJ1 A;  4PM8 A;  1TDG A;  4KZ8 A;  5F1G A;  1EWZ A;  3Q7Z A;  1LL5 A;  3OPP A;  4GD6 A;  2C6W B;  1RGZ A;  3BFE A;  3G30 A;  5GLC A;  3RXW A;  4M3K A;  2Y2G A;  1FR1 A;  1PW8 A;  3VMA A;  4EQI A;  5E2H A;  1KDW A;  1XP4 A;  5DVA A;  4P0M A;  3VFF A;  1FCN A;  4OLG A;  3S1Y A;  4X69 A;  1FR6 A;  1L2S A;  1JVJ A;  3HLG A;  1SHV A;  3EQV A;  3W4O A;  5EEC A;  4JF6 A;  3ZVT A;  3BFC A;  4WZ4 A;  4DXC A;  5HL1 A;  3EQU A;  4DXB A;  2ZQ7 A;  2XD5 A;  4BD0 A;  2B5R A;  3DW0 A;  1YLJ A;  5CHJ A;  3OZH A;  5HAI A;  1KE4 A;  4MBF A;  1ERM A;  4KG5 A;  1JWZ A;  2JBF A;  4U0X A;  3CG5 A;  3V39 A;  1PIO A;  4DE3 A;  1I2S A;  3MZD A;  4QJG A;  3S4X A;  2WGI A;  2EX9 A;  3PBQ A;  3UDF A;  3UPP A;  2Y2Q A;  1H8Y A;  4KZ6 A;  5F82 A;  1MXO A;  1S6R A;  3B3X A;  3ZGA B;  3W4P A;  4E3K A;  4E3N A;  2WKI A;  1NRF A;  4WEK A;  1CK3 A;  2JE5 A; 
#chains in the Genus database with same CATH topology
 2B18 A;  2ZC5 B;  1L0D A;  3TOI A;  3DTK A;  3BW6 A;  4GN2 A;  4LFU A;  5HPI A;  4OP8 A;  3F1O B;  4B9O A;  1CI9 A;  1RCJ A;  2H5S A;  1YSP A;  4NXB A;  2HDR A;  4EBN A;  3VP4 A;  4WEL A;  3WWX A;  1YLY A;  2LB9 A;  4KZB A;  3WS0 A;  5A8B A;  4PAU A;  2PDR A;  3HJK A;  2E8J A;  3ZNT A;  3T4T A;  1PWD A;  1ES5 A;  2QPN A;  2J80 A;  5KIZ A;  3N4I A;  1MC0 A;  3F1O A;  4LEN A;  4WEJ A;  1YKD A;  3FYZ A;  5HAQ A;  1BZA A;  4E6X A;  3BFD A;  5KSH A;  1QMF A;  1KGF A;  4P6Z M;  3G2Z A;  3TRC A;  1CF0 A;  4K0W A;  1VHM A;  1UWN X;  4N92 A;  3QHY A;  2GJ3 A;  1CEF A;  1FSY A;  4HH2 A;  5FAQ A;  3IF6 A;  3LIF A;  4C3Q A;  2JKF A;  2ZL1 A;  3MXS A;  3LIB A;  1GA0 A;  4Q0J A;  5HWT A;  3DBA A;  2Q9M A;  2FFY A;  1K57 C;  1Y4O A;  4ZTK A;  3NHQ A;  2O9B A;  4HI4 A;  4R23 A;  1G6O A;  4ARZ B;  4BBV A;  4R3A A;  3N8R A;  5F6A A;  4DE2 A;  4DF6 A;  3IX4 A;  3IHA A;  3RFB A;  3KSG A;  2X01 A;  2A24 A;  1IYP A;  3NI9 A;  2INW A;  3P7N A;  4E3M A;  1TD5 A;  4LPZ A;  5FL3 A;  1XA1 A;  3BFG A;  4PM7 A;  4JF4 A;  5HDD A;  3ZCZ A;  2K7S A;  4S2O A;  5HSQ A;  4PPR A;  1NZO A;  1NYM A;  1KOU A;  1OTB A;  5J8X A;  4II7 A;  4IUK A;  5AQB A;  1S67 L;  1OJ5 A;  3CUE A;  3HLB A;  1JNU A;  1SKF A;  5JYP A;  2QZ6 A;  3H9W A;  3Q7V B;  1DP8 A;  1S66 L;  3HRE A;  3OCN A;  2EFU A;  4C75 A;  3DTM A;  1NXY A;  4FH4 A;  2ZMV A;  5EUA A;  1S1Z A;  3QP6 A;  2PHY A;  4QY6 A;  3MZF A;  4X53 A;  3A3F A;  2ZC6 B;  3S7Q A;  3G4P A;  4OQH A;  3JYI A;  2R9W A;  2VEA A;  3A3I A;  4EBP A;  4ID4 A;  4JGQ A;  4E3I A;  4P6B A;  4OOY A;  2V0U A;  3BLS A;  3KYE A;  5AQ9 A;  3IXH A;  2VV8 A;  4E6W A;  3E4Q A;  4HQA A;  4E04 A;  2J7V A;  1GHI A;  1Q2P A;  1ES2 A;  2WKR A;  2M7U A;  1IKI A;  1FOF A;  3EEH A;  3LO7 A;  3O88 A;  1YLP A;  3G34 A;  4NK3 A;  1GA9 A;  4LRZ E;  3A3J A;  3E2L A;  4I3I A;  3WS2 A;  4DDS A;  5FI7 A;  3T1Q B;  4KZ5 A;  5GLD A;  5K5B A;  1T18 A;  3CPT B;  3LI9 A;  4EUZ A;  5DFX A;  5HFO A;  3S7P A;  1Q2Q A;  2RL3 A;  2C5W B;  4WN5 A;  3LY4 A;  1I5Q A;  2JC7 A;  2VV6 A;  5HDC A;  2Y2N A;  2ZM0 A;  2L1M A;  3V50 A;  2G2U A;  5DKK A;  4L9G A;  1XJ4 A;  5FSR A;  2A24 B;  3IBJ A;  4S2L A;  5HDS A;  2ACG A;  4JXW A;  3QP5 A;  4WF0 A;  5GLB A;  1KE0 A;  3ZNY A;  1G6A A;  2ZQD A;  3MJQ A;  4N1H A;  2OAQ 1;  5F68 A;  1CI8 A;  2BLS A;  2H0Y A;  4DE1 A;  3PXP A;  1YPR A;  4S2N C;  4WUJ A;  3LR4 A;  4N1X A;  3FKV A;  4DJ3 A;  3CWF A;  3DWZ A;  3IS2 A;  3UB9 A;  2IWD A;  4K0X A;  3C4O A;  2P9V A;  2QJ7 A;  2ZOH A;  1LT0 A;  2WK0 A;  3MSH A;  5F83 A;  4IBX A;  3IXB A;  5BOH A;  4CPK A;  5AVF A;  3S7N A;  2W27 A;  1YLW A;  3H7W B;  1ZKJ A;  3NIA A;  3O87 A;  5FDH A;  4QWO A;  5HPF A;  1PRQ A;  3VSL A;  1JWV A;  1OPX A;  1SCW A;  2ZBB A;  1YMX A;  5KSC A;  2V8F A;  4HHD A;  2AVX A;  1M6K A;  3UE0 A;  4NXF A;  1DJB A;  1OTI A;  3BLM A;  2R9X A;  1LHY A;  2FFF B;  3EOI A;  1PWG A;  3QNB A;  4Y7P A;  1GSX A;  1MWS A;  3CMZ A;  1T1A A;  4BD1 A;  4RYE A;  4S2P A;  3P09 A;  2MJ6 A;  1MKI A;  4LCL A;  1S0W A;  3EWK A;  4UEY A;  4GHI B;  2V2F F;  1O07 A;  3HUO A;  2WGW B;  4JPM A;  3K2N A;  4ETX A;  1BUE A;  2PD7 A;  3IH8 A;  1F98 A;  3OBF A;  3MF0 A;  3LI8 A;  3UO9 A;  3MKE A;  4CLC C;  3GRJ A;  1N9L A;  2EWW A;  3IX8 A;  3Q7Z A;  1LL5 A;  4CLC A;  3RXW A;  4F3L B;  3BFE A;  2ZOI A;  5GLC A;  4M3K A;  3VMA A;  5E2H A;  2NUP C;  5HWW A;  2PR5 A;  2KX6 A;  1FR6 A;  2PBD P;  5IT5 A;  1JVJ A;  1T1B A;  1SHV A;  2NUT C;  5EEC A;  2V0W A;  4WZ4 A;  5HL1 A;  4DXB A;  2XD5 A;  3C8C A;  3MQ0 A;  5HAI A;  1ERM A;  1JWZ A;  2JBF A;  1F5M A;  2FH5 A;  2Y2Q A;  1H8Y A;  3B3X A;  3MXQ A;  3ZGA B;  4ZJ2 A;  4HOI A;  4ME4 A;  1AXB A;  4PMA A;  5IHV A;  1K55 C;  3ZG9 B;  4B88 A;  3UN7 A;  5EM1 A;  4JGO A;  3DTE A;  2YKH A;  2ZC4 B;  3AGE A;  1V9Z A;  5GHZ A;  1TVF A;  3WS4 A;  2ZMF A;  1IKG A;  1TS6 A;  4WM9 A;  4KZA A;  1ONG A;  5DJT A;  5CEB A;  3KX0 X;  3G2Y A;  2HDU A;  5U47 A;  3O3V A;  2Z2L B;  1LLB A;  3UY6 A;  1K56 A;  4BL2 A;  1W63 Q;  3UMD A;  4GOG A;  4LV1 A;  1YLT A;  1T1C A;  3IWI A;  3HLC A;  4LV3 A;  4OOL A;  4DKI A;  2X71 A;  3VP0 A;  3VE3 A;  2Q0O A;  5DF8 A;  5LBR A;  2ZQ9 A;  1WA9 A;  2J3T D;  2Y2P A;  3DAV A;  4OKP A;  4OQG A;  2Y2L A;  2VKS A;  3UPN A;  4EXO A;  1E3U D;  1UGU A;  4HP4 A;  2UWX A;  1OT9 A;  1PWC A;  1K6S A;  3G35 A;  3V3S A;  1M40 A;  2H10 A;  3FKW A;  4JKT A;  4PKY A;  1NRJ A;  1YT4 A;  5EVI B;  2O0Y A;  1MBL A;  5EVL A;  3R4K A;  1IYO A;  1ZG4 A;  4L0L A;  2XR0 A;  2ZQC A;  1W7F A;  3LR0 A;  4D60 A;  2XA7 M;  1STZ A;  3CLO A;  1MPL A;  4EBL A;  2ZMA A;  5HAR A;  1BLC A;  1JTD A;  1PZP A;  1KVM A;  1JTG A;  2VGK A;  2W1T A;  4Q0H A;  2M1C A;  4EV4 A;  1ERO A;  1HVB A;  3LY3 A;  4KEN B;  3RTY A;  3K3C A;  3S22 A;  1G68 A;  4QD4 A;  4RX3 A;  2HP9 A;  5GHX A;  1BLH A;  2GNX A;  3ITB A;  5CGW A;  4JGR A;  3ZG7 B;  3G32 A;  5E43 A;  1D06 A;  2V1B A;  1MKM A;  1W63 M;  4B93 A;  4JXV A;  3GR2 A;  2HP6 A;  2IWB A;  5AQ7 A;  2YKF A;  2G2W A;  2WAD A;  3NY4 A;  4S2K A;  4EWF A;  3HUN A;  4OP5 A;  2XDM A;  2Y2O A;  3L7H A;  5FQQ A;  1W79 A;  3KO6 A;  1BLP A;  2P04 A;  3CPT A;  3PBN A;  2DRW A;  5CGS A;  4MCW A;  4DN0 A;  3ZG0 A;  3VV4 A;  3FPW A;  4IHQ A;  4KG2 A;  1QME A;  3KYZ A;  4R6L A;  3SS4 A;  3IBR A;  4X25 A;  3BEC A;  3BQ8 A;  3LCE A;  4FSF A;  3R7W B;  3IWO A;  5DKL A;  1SDE A;  3D4F A;  1E25 A;  1GSV A;  3ULF A;  3T50 A;  1ALQ A;  2XK1 A;  4CLC B;  4BL3 A;  3P01 A;  5DF7 A;  4YOF A;  2BAS A;  1XJ6 A;  1YQS A;  1KE3 A;  3H82 B;  2QWS A;  3N7W A;  1DJA A;  2OWH A;  4KQD A;  1H8Z A;  2PYR A;  4DE0 A;  4YWZ A;  4WYY A;  1SKO A;  2GX5 A;  4H8R A;  4MBK A;  4OLD A;  5J3W A;  2OLU A;  5TGF A;  3RJU A;  2R78 A;  1NLZ A;  1GSW A;  2ZQA A;  2GDN A;  3C2W A;  3HBR A;  5M18 A;  4OPY A;  2W3E A;  4GKU A;  4UAA A;  3LFV A;  2Y59 A;  3C7U A;  5FQJ A;  3UB5 P;  2ZL1 B;  2ZM8 A;  2PT7 A;  1PNE A;  5CHU A;  1DY6 A;  3LEZ A;  5HAP A;  4IED A;  4GDN A;  2HDQ A;  3U2A A;  3UE1 A;  4JF5 A;  4N9L A;  3JVU A;  3ZYT A;  1MZU A;  1VET B;  2W3D A;  2XD1 A;  1ZG6 A;  2EXB A;  2QHK A;  3G6O A;  2D02 A;  3ZVW A;  1I2W A;  3T1S A;  2VGJ A;  3FG8 A;  2W1T B;  4LRX C;  1LSV A;  2Q9N A;  3GDI A;  3H82 A;  1GCE A;  2J9P A;  4UA9 A;  3W4Q A;  5FI2 A;  3MS6 A;  2WZZ A;  3BYD A;  4E3J A;  3EGD C;  2K31 A;  4CJN A;  4X1L A;  4NXG A;  4GDB A;  1VET A;  5CXW A;  1S4R A;  4CQH A;  3NCK A;  2HJ9 C;  5TR7 A;  4Z9Q A;  4IUH A;  2ZQ8 A;  4WZ5 C;  2WUQ A;  5GHY A;  5CTM A;  1ACF A;  3BM6 A;  2X02 A;  2ZJ9 A;  2EX8 A;  4R70 A;  1IYS A;  3Q82 A;  3BEB A;  1NZU A;  3MXR A;  3PTE A;  4DMZ A;  1Y28 A;  3BY9 A;  3T4Q A;  3VOY A;  1MWT A;  4DRT A;  1D1J A;  4FD8 A;  3ITA A;  4MN6 A;  2QYB A;  2VGL M;  2Z2M B;  5FQK A;  4MN5 A;  4DDY A;  3JPU A;  2L0W A;  4ZBE A;  3SH7 A;  4S2I A;  4R4S A;  1IEM A;  1P97 A;  1HLU P;  4WBG A;  4D2O A;  3AGD A;  1F9I A;  3UB7 A;  4ZAM A;  3IXG A;  2KDK A;  2J9O A;  2JKR M;  4LV0 A;  3T12 B;  3ZG8 B;  4B4X A;  1BSG A;  3KYQ A;  1XPB A;  2XA7 S;  3OPL A;  4PM8 A;  4LLO B;  1VEU B;  5F1G A;  3OPP A;  4GD6 A;  2C6W B;  4EQI A;  1FR1 A;  3T1X A;  1XP4 A;  4EW7 A;  3VFF A;  4OLG A;  3S1Y A;  4X69 A;  3C38 A;  4MN7 A;  3EQU A;  3MMH A;  5CHJ A;  1KE4 A;  4KG5 A;  4U0X A;  3CG5 A;  2JHE A;  2K2N A;  1PIO A;  3S4X A;  3PBQ A;  5F82 A;  4ZRR A;  4G3K A;  3SW1 A;  3KSF A;  4E3K A;  4MMN A;  1Y54 A;  3CIT A;  2IA2 A;  5FAP A;  2Y91 A;  1IYQ A;  1W8Y A;  2VA0 A;  4Y13 A;  1L0E A;  4QHC A;  3IXD A;  4RVA A;  4BQM A;  4F94 A;  5EVI D;  2VX8 A;  3FWL A;  3CJM A;  4KQO A;  1XJ3 A;  5AQA A;  3A0V A;  4UA6 A;  3T4O A;  5DTS A;  4KG6 A;  5EFW A;  2HF6 A;  1LI9 A;  3P98 A;  1TF1 A;  3MFD A;  3PBO A;  4HES A;  1NY0 A;  1HD8 A;  1FIK A;  2V9A A;  1ZTU A;  2OOL A;  4HEF A;  5CGX A;  1L0F A;  2CMN A;  3TJZ C;  3PAE A;  5A93 A;  1PYY A;  1EI5 A;  4IVK A;  4O0P A;  2DCF A;  4O01 A;  5FAO A;  4ARZ A;  3CUE C;  3LEQ A;  2VK3 A;  1WYB A;  4HBU A;  2V1Z A;  3UB8 A;  3N6I A;  4U3T A;  3T4J A;  3VE4 A;  2WGW A;  1H0M A;  5I5L A;  3V5M A;  4PKY G;  2VV7 A;  5E2G A;  2W3G A;  3LIE A;  5E2F A;  2V8C A;  4I38 A;  4OQ0 A;  4C6Y A;  2XRO A;  3F1N A;  4EEU A;  3LUQ A;  1KVL A;  1N9N A;  3LR5 A;  3E0Y A;  4B4Z A;  4NXE A;  5EVI A;  3NUL A;  3BJN A;  1BT5 A;  4O8G A;  4Z1W A;  2JKR I;  5E2E A;  5F1F A;  4L9E A;  1GHP A;  1O7E A;  4K08 A;  4EU0 A;  3HJI A;  2J3T C;  2ZM2 A;  2KLI A;  2RCX A;  3WRT A;  3T1R A;  3NOU C;  3IF6 B;  2A2L A;  1D7E A;  1Z09 A;  4FH2 A;  4IBR A;  2Y4A A;  3MBZ A;  2OLV A;  5HZH A;  4GLQ A;  1ESU A;  1TEM A;  1OT6 A;  3ZQ5 A;  2D01 A;  5HX9 A;  3SS3 A;  5CRF A;  2Y2H A;  5HD5 A;  5EE8 A;  2Z6C A;  4R1G A;  3KSI A;  5FA7 A;  2VGL S;  3LYX A;  4FTX A;  3IQA A;  3AGF A;  2I72 A;  3UDI A;  4G3W A;  3GV9 A;  2EXA A;  2ZC3 B;  5FAS A;  1MWU A;  4HJ6 A;  1PFL A;  5HL6 A;  1OTA A;  4BBU A;  3FZC A;  3TG9 A;  4X1M A;  4Y0O A;  2VLG A;  2V1A A;  1YMS A;  2J8Y A;  2XF3 A;  2O9A A;  3ZG5 A;  2WKP A;  1EW0 A;  4M4X A;  5CX7 A;  1BUL A;  4R3B A;  2HGV A;  3TE8 A;  3V67 A;  3OCL A;  1RP5 A;  3MFX A;  1E3U A;  5TBM A;  5CTN A;  1YLZ A;  3SOI A;  3JVV A;  1BLS A;  3EEA A;  2W3F A;  4KZ7 A;  3IHB A;  5C5K A;  4H6J A;  3IF5 A;  4KZ9 A;  2HP5 A;  3IF6 C;  4LCM A;  5JYO A;  2Y2I A;  1DRM A;  1U60 A;  2L4R A;  4PM6 A;  2HPB A;  4BWI A;  4KZ4 A;  2XLN A;  2XSS A;  4WMC D;  5A90 A;  4K91 A;  2HJE A;  2M7V A;  4R4R A;  3UDX A;  5KMW A;  5AVE A;  4G3V A;  5KZH A;  1A0K A;  2EWV A;  4I5S A;  4JXS A;  1J3W A;  3D3O A;  4BLM A;  3LR3 A;  1VQQ A;  2GZA A;  3G31 A;  2Z6D A;  4YNR A;  3EGX C;  4GNU A;  1DP6 A;  3VOL A;  3FV7 A;  1VM1 A;  4QB8 A;  5TJJ A;  2BG1 A;  3HVF A;  1LL9 A;  4R0Q A;  1VB6 A;  3W2Z A;  5GL9 A;  1XGI A;  4P85 A;  1H8M A;  1K6R A;  2VJW A;  3IX3 A;  5A91 A;  3UE6 A;  3BQA A;  1E4D A;  2OWJ A;  4BJP A;  1IOU A;  2A49 A;  4CLC E;  4EUV A;  3N8L A;  3HLW A;  4CLC D;  3NOP C;  5G4Z A;  4N9K A;  1PI5 A;  4R38 A;  1JWP A;  4KZ3 A;  4OQI A;  2G7U A;  2O9C A;  2DNS A;  4P6Z S;  2UV0 E;  2WYX A;  4S2N A;  3B42 A;  3N8S A;  4OPQ A;  3ZHH A;  4MDZ A;  1W5D A;  1S4S A;  2PBY A;  2W1R A;  5M1A A;  2WAE A;  2JKG A;  1XA7 A;  3DTI A;  3SZT A;  1PW1 A;  4RA7 A;  4Y0U A;  1SZV A;  1SKO B;  1XFQ A;  2ZC7 A;  2A3U A;  3UPO A;  3Q1F A;  2PU4 A;  2IWC A;  5EM0 A;  5J7E A;  4MLL A;  1FCM A;  5FEF A;  3C5A A;  1TS0 A;  2CC1 A;  2QKP A;  3OLO A;  4I3A A;  3HLD A;  3WS1 A;  1LSX A;  5TBM B;  1NYY A;  4Q8I A;  3C7V A;  4LV2 A;  3Q07 A;  4Y3I A;  3H7W A;  2EFX A;  4GZB A;  3WS5 A;  3PYP A;  3PAG A;  2P74 A;  2WKQ A;  1ES4 A;  2PR6 A;  4EQ1 A;  5EV0 A;  3OOV A;  2OSU A;  5DFY A;  3FPV A;  3T4S A;  3MZE A;  4RX2 A;  1WE4 A;  4XUX A;  3LGO A;  1OME A;  1KGG A;  3DWK A;  4ESP A;  3QP8 A;  1K55 A;  5L2F A;  4UA7 A;  1UWP X;  3RH8 B;  4LGW A;  1V9Y A;  3F1N B;  2WGV A;  1N4O A;  1TDG A;  4KZ8 A;  1EWZ A;  1RGZ A;  3G30 A;  1PW8 A;  3T4K A;  4NEE D;  1FCN A;  3E98 A;  5IU1 A;  2EA9 A;  4JF6 A;  2P08 A;  3BFC A;  3E4O A;  2ZQ7 A;  4BD0 A;  2B5R A;  3DW0 A;  4PHT A;  1T19 A;  3T4L A;  3C30 A;  4DE3 A;  1I2S A;  3MZD A;  4QJG A;  2EX9 A;  3B33 A;  5L10 A;  4AFI A;  3UPP A;  4KZ6 A;  1FIL A;  1MXO A;  1S6R A;  4NKP A;  2WKI A;  1FQG A;  4I3J A;  2JE5 A;  1XJ2 A;  1N9O A;  1C3B A;  3A3E A;  5FAT A;  4H6J B;  4WLA A;  5CEC A;  1ODV A;  1K54 A;  3NC8 A;  3NBL A;  5L07 A;  3PR6 A;  2EX2 A;  4WL9 A;  1P9W A;  3R7W A;  2WKH A;  3OPR A;  3QP1 A;  2W0N A;  5L8M A;  3V3R A;  3NDG A;  4BMW A;  1K4F A;  5D3O A;  3I7J A;  1SDN A;  3KSH A;  2WKE A;  1ZC2 A;  4P87 A;  2I9V A;  1GHM A;  3VOZ A;  1ONH A;  2P9V B;  4E3L A;  4S2M A;  5DTT A;  4HP9 A;  4OON A;  2Y79 A;  1K25 A;  1RGY A;  2P7J A;  2XFT A;  2O99 A;  1TDL A;  3A0S A;  3O5Y A;  2OV5 A;  3LIC A;  1PZO A;  4WZ5 A;  2J3W A;  3W8K A;  1K57 A;  3E4P A;  4EEP A;  4X6T A;  5HD3 A;  1IFQ A;  3D9Y A;  4YFM A;  5EOO A;  1VEU A;  5FI6 A;  3CZD A;  1XKZ A;  4FUW A;  3VFH A;  3C4P A;  3A0R A;  4FCF A;  3PBS A;  3U4L P;  4U0T A;  1K38 A;  3CHW P;  4O7D A;  4KQQ A;  4DJ2 A;  3HLF A;  2H0T A;  2B02 A;  2QJ5 A;  2V20 A;  2PU2 A;  4OPR A;  5DTK A;  4L9F A;  4X56 A;  3NEC A;  4QPR A;  1TS7 A;  4NET A;  3ISG A;  2JCH A;  1G28 A;  5EOE A;  4OPZ A;  4JGP A;  4WMC A;  1YM1 A;  3WRZ A;  3LID A;  3GSG A;  3SH8 A;  5IS1 A;  3GTC A;  4PM5 A;  1CEG A;  1CQA A;  2BTF P;  2Y8H A;  3GQZ A;  1LI0 A;  3SS5 A;  1WYC A;  2LB5 A;  4GHI A;  1L3L A;  5CER A;  4KUK A;  1HTZ A;  3MKF A;  5MC7 A;  3GVB A;  5DF9 A;  3M2K A;  3VP3 A;  4Q0I A;  5FQM A;  1ERQ A;  4HIA A;  1X0O A;  4OOM A;  4NG2 A;  5J4E A;  3B47 A;  2XGN A;  3VP1 A;  1BTL A;  4A5R A;  1OJG A;  3VP2 A;  4OVD A;  3UE3 A;  2Y2M A;  2QMI A;  4XT2 A;  4Y2F A;  1DP9 A;  4X55 A;  4QY5 A;  3L9K A;  5CED A;  3F1P A;  4GS9 A;  1H5X A;  4GW9 A;  4PM9 A;  1LL8 A;  5HW3 A;  2WZX A;  1XGJ A;  4ZDX A;  4ETZ A;  1MWR A;  2OAP 1;  5G18 A;  4HH3 A;  4UQI M;  2XQZ A;  3BY8 A;  3BWL A;  3E2K A;  1MY8 A;  5L09 A;  5TFQ A;  3IS2 B;  3IWQ A;  2XEP A;  3A3D A;  4KQR A;  4X68 A;  3TW8 A;  3VSK A;  2XH9 A;  2Y2J A;  3M6H A;  5EVE A;  3UNW A;  3LIA A;  5AJG A;  4GCZ A;  1KDS A;  3Q81 A;  4OH0 A;  2DMW A;  3PBT A;  5FEG A;  2FZ0 A;  4F3L A;  2PD8 A;  2HZ5 A;  3TSG A;  3BRM A;  1FCO A;  1HZO A;  2W3H A;  1YAX A;  3GMW A;  4HY8 A;  4EET B;  1Z6F A;  3RXX A;  4GJ4 A;  3HL9 A;  3ZDJ A;  2ZD8 A;  2H28 A;  4JLF A;  4I39 A;  4RQ9 A;  2EX6 A;  3NDE A;  4JXG A;  3FC7 A;  5DJU A;  3CI6 A;  3PBR A;  5HWV A;  2JN7 A;  1P9R A;  4IVI A;  4LRY C;  5FDS A;  1KGE A;  4GB7 A;  3HUM A;  3HLE A;  1J9M A;  1XFN A;  3MR0 A;  1FSW A;  1DJC A;  1IEL A;  2PAV P;  5CHM A;  5G4Y A;  1ZHH B;  1S1Y A;  3NOT C;  4GD8 A;  5EPH A;  1PI4 A;  2XFS A;  1NLY A;  4UHU A;  3QNC A;  4R3J A;  3BFF A;  2B95 A;  4MEZ A;  1TS8 A;  3F1P B;  4GS9 B;  1NJ4 A;  2E8I A;  3M6B A;  4E3O A;  1N9B A;  1XXM A;  4XUZ A;  1L0G A;  4HNB A;  4S2J A;  5FQ9 A;  4HBT A;  4MBH A;  4Y17 A;  3HCY A;  4BEN A;  3OC2 A;  2HV1 A;  3IT9 A;  5I94 A;  1NWZ A;  2VZW A;  1F2K A;  2KOI A;  4Y0T A;  4MNR A;  1XX2 A;  4QU3 A;  3M2J A;  2Y2K A;  2Y55 A;  1K4E A;  3OPH A;  1K56 D;  2JKT I;  3MQO A;  1P0Z A;  4XXR A;  3CAX A;  3GEC A;  1ES3 A;  1K54 C;  2WAF A;  1OTD A;  4HJ3 A;  3ZFZ A;  3QP4 A;  4KUO A;  4XT2 B;  3MQQ A;  1ESI A;  2ZLY A;  3K3D A;  1LSW A;  4BBT A;  3Q7V A;  4Y5F A;  5GLA A;  5A92 A;  3NJA A;  5EVI C;  1OTE A;  2PYP A;  4YIN A;  3UB6 A;  4JBF A;  3O86 A;  4ZJ3 A;  1K0K A;  3IH9 A;  4UQI S;  3S7O A;  5FQI A;  5M19 A;  4EER A;  1W8Q A;  3SH9 A;  2XRN A;  2HDS A;  4EES A;  4ZJ1 A;  4HJ4 A;  1CJF A;  2Y2G A;  1KDW A;  1BYW A;  5DVA A;  3UME A;  4P0M A;  4IJG A;  4Y15 A;  1AWI A;  3QP2 A;  1L2S A;  4FOF A;  3HLG A;  3EQV A;  3W4O A;  1YSQ A;  3ZVT A;  4DXC A;  3ICY A;  1YLJ A;  3OZH A;  1G5U A;  1H3Q A;  4MBF A;  2JKT M;  3V39 A;  3PHY A;  2WGI A;  3UDF A;  3D72 A;  5F5Y A;  5F69 A;  3W4P A;  2PRF A;  4E3N A;  1NRF A;  1CK3 A;  4WEK A; 
#chains in the Genus database with same CATH homology
 1Y54 A;  4ZJ2 A;  5FAP A;  2Y91 A;  2ZC5 B;  1L0D A;  1AXB A;  1IYQ A;  1C3B A;  4PMA A;  4GN2 A;  5IHV A;  1K55 C;  1W8Y A;  3TOI A;  3A3E A;  3ZG9 B;  5FAT A;  1L0E A;  4OP8 A;  4QHC A;  4B88 A;  5CEC A;  3UN7 A;  3IXD A;  4RVA A;  1CI9 A;  1K54 A;  2H5S A;  1RCJ A;  3NC8 A;  4BQM A;  3NBL A;  2HDR A;  2ZC4 B;  3AGE A;  4F94 A;  4EBN A;  5EVI D;  3VP4 A;  4WEL A;  3WWX A;  2EX2 A;  1YLY A;  4KZB A;  5GHZ A;  3WS0 A;  1TVF A;  3WS4 A;  1IKG A;  3FWL A;  3ZNT A;  2WKH A;  4WM9 A;  3CJM A;  1ONG A;  4KQO A;  4KZA A;  3OPR A;  5CEB A;  3G2Y A;  1PWD A;  1ES5 A;  2HDU A;  2QPN A;  5U47 A;  5AQA A;  3O3V A;  2Z2L B;  1LLB A;  4UA6 A;  3UY6 A;  5DTS A;  3V3R A;  3N4I A;  4KG6 A;  3NDG A;  1K56 A;  4BL2 A;  4GOG A;  4LEN A;  4LV1 A;  4WEJ A;  3FYZ A;  5HAQ A;  1YLT A;  1LI9 A;  1BZA A;  3MFD A;  3P98 A;  3IWI A;  3PBO A;  4HES A;  4E6X A;  1NY0 A;  1K4F A;  3BFD A;  5KSH A;  3HLC A;  1HD8 A;  4LV3 A;  4OOL A;  2X71 A;  3VP0 A;  4DKI A;  5D3O A;  3I7J A;  1SDN A;  1QMF A;  5DF8 A;  2WKE A;  2ZQ9 A;  1ZC2 A;  4HEF A;  4P87 A;  2Y2P A;  4OQG A;  4OKP A;  2Y2L A;  3VOZ A;  1GHM A;  5CGX A;  1L0F A;  1ONH A;  1KGF A;  2P9V B;  3G2Z A;  4E3L A;  4S2M A;  5DTT A;  3PAE A;  5A93 A;  4OON A;  3UPN A;  4K0W A;  1E3U D;  4N92 A;  1K25 A;  3QHY A;  2UWX A;  1PYY A;  1EI5 A;  4IVK A;  2DCF A;  1RGY A;  1CEF A;  2XFT A;  1PWC A;  1FSY A;  5FAO A;  5FAQ A;  1K6S A;  1TDL A;  3IF6 A;  4HBU A;  4C3Q A;  1WYB A;  3MXS A;  3G35 A;  2OV5 A;  3V3S A;  1PZO A;  2V1Z A;  1GA0 A;  4WZ5 A;  1M40 A;  3W8K A;  1K57 A;  2H10 A;  3FKW A;  4JKT A;  4X6T A;  3N6I A;  4U3T A;  2WGW A;  4YFM A;  3V5M A;  1YT4 A;  2Q9M A;  5E2G A;  5EVI B;  2FFY A;  5EOO A;  1MBL A;  5EVL A;  1K57 C;  5E2F A;  1IYO A;  5FI6 A;  3CZD A;  1ZG4 A;  4OQ0 A;  4C6Y A;  1XKZ A;  4L0L A;  2XR0 A;  2ZQC A;  4ZTK A;  3VFH A;  1W7F A;  1KVL A;  3C4P A;  4R23 A;  4B4Z A;  1MPL A;  5EVI A;  4FCF A;  1BT5 A;  4EBL A;  5F1F A;  2ZMA A;  3PBS A;  5E2E A;  5HAR A;  1GHP A;  3N8R A;  1O7E A;  4U0T A;  4DE2 A;  4DF6 A;  1BLC A;  1K38 A;  3IHA A;  1JTD A;  2ZM2 A;  4O7D A;  2RCX A;  3WRT A;  1PZP A;  2X01 A;  1IYP A;  3NI9 A;  3IF6 B;  1KVM A;  1JTG A;  2VGK A;  4FH2 A;  4IBR A;  2Y4A A;  4E3M A;  3MBZ A;  4KQQ A;  2OLV A;  4EV4 A;  1ERO A;  1ESU A;  3HLF A;  1XA1 A;  2H0T A;  1HVB A;  3LY3 A;  1TEM A;  4KEN B;  2V20 A;  3BFG A;  3S22 A;  2PU2 A;  4OPR A;  4PM7 A;  1G68 A;  4QD4 A;  5DTK A;  4JF4 A;  4RX3 A;  5HX9 A;  3ZCZ A;  4X56 A;  4S2O A;  2HP9 A;  5GHX A;  3SS3 A;  5CRF A;  1BLH A;  4PPR A;  2Y2H A;  3ITB A;  4NET A;  1NZO A;  5EE8 A;  5CGW A;  1NYM A;  3ISG A;  4R1G A;  5FA7 A;  5J8X A;  3ZG7 B;  2JCH A;  3G32 A;  3IQA A;  5E43 A;  3AGF A;  5EOE A;  4OPZ A;  4WMC A;  2I72 A;  5AQB A;  3UDI A;  3GV9 A;  4JXV A;  3GR2 A;  2HP6 A;  2IWB A;  1YM1 A;  3WRZ A;  3HLB A;  2EXA A;  2ZC3 B;  5AQ7 A;  5FAS A;  3GSG A;  2G2W A;  1MWU A;  1SKF A;  2WAD A;  3NY4 A;  4S2K A;  3SH8 A;  5JYP A;  2QZ6 A;  3GTC A;  3Q7V B;  4EWF A;  4PM5 A;  3HUN A;  3HRE A;  1CEG A;  3GQZ A;  1LI0 A;  2XDM A;  3OCN A;  4OP5 A;  3FZC A;  3SS5 A;  1WYC A;  2Y2O A;  2EFU A;  3TG9 A;  5FQQ A;  1W79 A;  4Y0O A;  4C75 A;  1BLP A;  3DTM A;  1NXY A;  1YMS A;  3PBN A;  2J8Y A;  2XF3 A;  2DRW A;  4FH4 A;  5CGS A;  5EUA A;  5CER A;  1HTZ A;  3MKF A;  3ZG0 A;  4QY6 A;  3GVB A;  3MZF A;  4X53 A;  5DF9 A;  3ZG5 A;  3A3F A;  3M2K A;  3VP3 A;  2ZC6 B;  3G4P A;  5FQM A;  1BUL A;  4KG2 A;  1QME A;  4OQH A;  4R3B A;  3JYI A;  1ERQ A;  2R9W A;  3A3I A;  4EBP A;  3OCL A;  4ID4 A;  1RP5 A;  4OOM A;  3SS4 A;  3BEC A;  3LCE A;  1E3U A;  4E3I A;  2XGN A;  4FSF A;  3VP1 A;  1BTL A;  3IWO A;  4P6B A;  5CTN A;  1YLZ A;  3SOI A;  4A5R A;  3VP2 A;  4OOY A;  1BLS A;  3BLS A;  1SDE A;  4OVD A;  3D4F A;  3UE3 A;  5AQ9 A;  2Y2M A;  2QMI A;  3IXH A;  1E25 A;  4KZ7 A;  3IHB A;  4E6W A;  3IF5 A;  4KZ9 A;  2HP5 A;  3IF6 C;  4LCM A;  4X55 A;  4QY5 A;  5JYO A;  2Y2I A;  1U60 A;  5CED A;  2J7V A;  1GHI A;  1Q2P A;  4PM6 A;  2HPB A;  1ALQ A;  1H5X A;  2XK1 A;  4KZ4 A;  2XLN A;  4PM9 A;  4BL3 A;  1ES2 A;  4WMC D;  5A90 A;  5HW3 A;  2WZX A;  1XGJ A;  5DF7 A;  4K91 A;  1YQS A;  4ZDX A;  1KE3 A;  4R4R A;  1MWR A;  1IKI A;  1FOF A;  3N7W A;  1DJA A;  3LO7 A;  3O88 A;  5G18 A;  3UDX A;  1YLP A;  5KMW A;  1H8Z A;  4DE0 A;  2XQZ A;  3G34 A;  5KZH A;  4WYY A;  4NK3 A;  3E2K A;  1GA9 A;  1MY8 A;  3A3J A;  4H8R A;  3E2L A;  4MBK A;  4JXS A;  3IWQ A;  5TFQ A;  3WS2 A;  2XEP A;  4DDS A;  5FI7 A;  3A3D A;  4KZ5 A;  5GLD A;  4KQR A;  4X68 A;  4BLM A;  4EUZ A;  1VQQ A;  4OLD A;  3VSK A;  2OLU A;  3G31 A;  2XH9 A;  2Y2J A;  5TGF A;  3M6H A;  5HFO A;  3RJU A;  1Q2Q A;  4GNU A;  3UNW A;  3FV7 A;  1VM1 A;  2C5W B;  2RL3 A;  3LY4 A;  4QB8 A;  2ZQA A;  1I5Q A;  1KDS A;  2BG1 A;  3HVF A;  2JC7 A;  3PBT A;  1LL9 A;  2GDN A;  3Q81 A;  4OH0 A;  4R0Q A;  3HBR A;  5M18 A;  2Y2N A;  2ZM0 A;  4OPY A;  3V50 A;  5GL9 A;  1XGI A;  4GKU A;  3TSG A;  4UAA A;  3BRM A;  1FCO A;  1HZO A;  2Y59 A;  2G2U A;  3C7U A;  4P85 A;  5FQJ A;  3GMW A;  1K6R A;  1Z6F A;  2ZM8 A;  3RXX A;  5CHU A;  1DY6 A;  3LEZ A;  5A91 A;  5HAP A;  3HL9 A;  3ZDJ A;  1E4D A;  4BJP A;  4IED A;  5FSR A;  4S2L A;  2A49 A;  2ZD8 A;  4GDN A;  4JLF A;  2HDQ A;  3N8L A;  3HLW A;  4JXW A;  2EX6 A;  3NDE A;  4JXG A;  5GLB A;  1KE0 A;  4N9K A;  3UE1 A;  4JF5 A;  1PI5 A;  4N9L A;  3PBR A;  1JWP A;  3ZNY A;  1G6A A;  4KZ3 A;  2ZQD A;  4N1H A;  4IVI A;  4OQI A;  1CI8 A;  2DNS A;  2WYX A;  1KGE A;  4GB7 A;  2XD1 A;  1ZG6 A;  2EXB A;  3HUM A;  3HLE A;  2BLS A;  2H0Y A;  4DE1 A;  4S2N A;  3ZVW A;  1J9M A;  1I2W A;  3N8S A;  4OPQ A;  3ZHH A;  2VGJ A;  1W5D A;  1FSW A;  4S2N C;  1DJC A;  2PBY A;  5M1A A;  1IEL A;  2WAE A;  4N1X A;  3FKV A;  5CHM A;  2Q9N A;  1XA7 A;  4GD8 A;  3DWZ A;  5EPH A;  1PI4 A;  1GCE A;  1PW1 A;  2XFS A;  2J9P A;  4UA9 A;  3W4Q A;  4RA7 A;  2IWD A;  4Y0U A;  4K0X A;  5FI2 A;  4UHU A;  3QNC A;  4R3J A;  3BFF A;  2WZZ A;  3BYD A;  4MEZ A;  3C4O A;  2P9V A;  2ZC7 A;  2A3U A;  2WK0 A;  1NJ4 A;  2E8I A;  4E3J A;  3M6B A;  4E3O A;  5F83 A;  4IBX A;  3IXB A;  5BOH A;  4CPK A;  3Q1F A;  3UPO A;  1N9B A;  1XXM A;  2PU4 A;  4XUZ A;  4CJN A;  2IWC A;  1L0G A;  1YLW A;  4S2J A;  4MLL A;  5FQ9 A;  4HBT A;  4MBH A;  4GDB A;  1ZKJ A;  4BEN A;  3OC2 A;  3NIA A;  3O87 A;  1FCM A;  5CXW A;  5FDH A;  3NCK A;  3IT9 A;  5I94 A;  5TR7 A;  3C5A A;  3VSL A;  4Z9Q A;  4Y0T A;  2ZQ8 A;  4MNR A;  1JWV A;  1SCW A;  2CC1 A;  4WZ5 C;  1XX2 A;  1YMX A;  2WUQ A;  5KSC A;  5GHY A;  5CTM A;  4QU3 A;  3BM6 A;  3M2J A;  2Y2K A;  1M6K A;  2Y55 A;  1K4E A;  3HLD A;  3UE0 A;  2X02 A;  2ZJ9 A;  2EX8 A;  3OPH A;  3WS1 A;  1IYS A;  1K56 D;  3Q82 A;  3BEB A;  1NZU A;  3MXR A;  3PTE A;  4XXR A;  1DJB A;  1NYY A;  4Q8I A;  3C7V A;  4LV2 A;  1K54 C;  1ES3 A;  3Q07 A;  2WAF A;  3BLM A;  2R9X A;  1LHY A;  2FFF B;  3VOY A;  1MWT A;  2EFX A;  1PWG A;  4DRT A;  3QNB A;  4FD8 A;  4Y7P A;  3ITA A;  4GZB A;  3WS5 A;  3ZFZ A;  1FQG A;  1MWS A;  3CMZ A;  2Z2M B;  4BD1 A;  3PAG A;  5FQK A;  2P74 A;  4RYE A;  4DDY A;  1ESI A;  1ES4 A;  2ZLY A;  4ZBE A;  4S2P A;  3SH7 A;  3P09 A;  1MKI A;  4S2I A;  4LCL A;  3Q7V A;  2OSU A;  4R4S A;  1IEM A;  1S0W A;  5GLA A;  2V2F F;  1O07 A;  3HUO A;  2WGW B;  5A92 A;  4WBG A;  5EVI C;  4JPM A;  4D2O A;  3AGD A;  4ZAM A;  4YIN A;  3IXG A;  1BUE A;  3MZE A;  3IH8 A;  1WE4 A;  4JBF A;  4RX2 A;  4XUX A;  2J9O A;  3O86 A;  4ZJ3 A;  1OME A;  1KGG A;  3DWK A;  4LV0 A;  3IH9 A;  1K55 A;  5L2F A;  4UA7 A;  3UO9 A;  5FQI A;  5M19 A;  3MKE A;  3ZG8 B;  1W8Q A;  3SH9 A;  4B4X A;  2HDS A;  1BSG A;  1XPB A;  2WGV A;  1N4O A;  3GRJ A;  3OPL A;  4ZJ1 A;  4PM8 A;  1TDG A;  4KZ8 A;  5F1G A;  1EWZ A;  3Q7Z A;  1LL5 A;  3OPP A;  4GD6 A;  2C6W B;  1RGZ A;  3BFE A;  3G30 A;  5GLC A;  3RXW A;  4M3K A;  2Y2G A;  1FR1 A;  1PW8 A;  3VMA A;  4EQI A;  5E2H A;  1KDW A;  1XP4 A;  5DVA A;  4P0M A;  3VFF A;  1FCN A;  4OLG A;  3S1Y A;  4X69 A;  1FR6 A;  1L2S A;  1JVJ A;  3HLG A;  1SHV A;  3EQV A;  3W4O A;  5EEC A;  4JF6 A;  3ZVT A;  3BFC A;  4WZ4 A;  4DXC A;  5HL1 A;  3EQU A;  4DXB A;  2ZQ7 A;  2XD5 A;  4BD0 A;  2B5R A;  3DW0 A;  1YLJ A;  5CHJ A;  3OZH A;  5HAI A;  1KE4 A;  4MBF A;  1ERM A;  4KG5 A;  1JWZ A;  2JBF A;  4U0X A;  3CG5 A;  3V39 A;  1PIO A;  4DE3 A;  1I2S A;  3MZD A;  4QJG A;  3S4X A;  2WGI A;  2EX9 A;  3PBQ A;  3UDF A;  3UPP A;  2Y2Q A;  1H8Y A;  4KZ6 A;  5F82 A;  1MXO A;  1S6R A;  3B3X A;  3ZGA B;  3W4P A;  4E3K A;  4E3N A;  2WKI A;  1NRF A;  4WEK A;  1CK3 A;  2JE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...