1DJAA

Structure of beta-lactamase precursor, k73h mutant, at 298k
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
258
structure length
258
Chain Sequence
b'MKELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSHAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Structure and kinetics of the beta-lactamase mutants S70A and K73H from Staphylococcus aureus PC1.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 93
structure length 258
sequence length 258
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1996-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1djaA00
4E3KA 2CC1A 4JF4A 3QNCA 3HREA 2XDMA 1MWTA 1MKIA 3AGEA 2Y2JA 4HESA 4JXSA 4KZ9A 1JWVA 4OQIA 3E2KA 5FQ9A 3VP4A 5J8XA 3VP0A 2Y2IA 5DTTA 3NY4A 3IXHA 1FCNA 4S2NC 1ESUA 1NRFA 1RGZA 2GDNA 4GD8A 3M2JA 4KZ4A 4KZ5A 1Q2PA 4GDNA 4HBTA 3ZVWA 3M6HA 3GR2A 5EECA 5D3OA 1YMXA 2EX6A 3GSGA 4JF5A 1YLWA 5DF9A 3GTCA 4HBUA 5HFOA 2RL3A 1K57A 2WGWB 2A3UA 4OPRA 1DJBA 5GHXA 4WMCA 1DJAA 3HUNA 4KG2A 4E3OA 4M3KA 1M40A 4KENB 1NXYA 1TDGA 4KQQA 2XFTA 3VSLA 4Y0UA 2RCXA 3HLDA 3ZCZA 4Y0OA 4RA7A 4OPZA 3FWLA 2VGJA 2ZC6B 3SH9A 1TDLA 3BFGA 3IF6A 3IT9A 4RYEA 3WS1A 4Y0TA 5CERA 1KE0A 5GLAA 3W4PA 4E3LA 4DE1A 1L0GA 1GHIA 1N9BA 2WZXA 5CGSA 3N4IA 3HUOA 1DJCA 4FSFA 2VGKA 3HLCA 5FA7A 5EVIC 2QZ6A 1KDSA 1K4EA 3OPLA 1K56D 1ZKJA 2WK0A 2ZJ9A 4X69A 5FAPA 1SCWA 3G31A 3IF5A 5DTSA 1YLTA 2J8YA 5FI2A 4DE0A 5HAIA 5A93A 1K6RA 2BLSA 2I72A 1WE4A 3PAGA 3C4PA 5E43A 2Y2KA 5U47A 4BL2A 1MWUA 3IF6B 5A92A 4WZ5A 2V2FF 5GHYA 1XP4A 2P74A 4OP8A 4BQMA 1FOFA 1BZAA 5KSCA 4R0QA 4WM9A 5KMWA 1W5DA 3CMZA 1K54A 1K55A 2EFXA 4IBXA 3ZG0A 4NETA 4ID4A 1GHMA 3ZHHA 5FDHA 2XGNA 3A3EA 3EQUA 4OONA 4XUXA 1PZPA 4CPKA 4OPYA 1QMFA 3HLBA 3BEBA 4S2IA 3AGFA 4NK3A 5FATA 4QJGA 1BUEA 1SHVA 2EFUA 3WS0A 1H8ZA 3N7WA 3BFFA 2Y2QA 5CXWA 1FR6A 3Q7ZA 5EVLA 4OOMA 4EBLA 4LCMA 3D4FA 1J9MA 1ES5A 1ESIA 4KQOA 3MXRA 5E2EA 1PW8A 3V3RA 4E3MA 4OVDA 1MBLA 3NIAA 3A3JA 4OH0A 4X6TA 3BRMA 3FYZA 1FCOA 2ZQ9A 3M6BA 1KE4A 2J7VA 1GHPA 1ES2A 5GL9A 3C5AA 4DDYA 1IEMA 1BLSA 4DXBA 1NZOA 3IH8A 1IELA 1CK3A 2ZQ8A 3GVBA 3BFCA 3LY3A 1YLJA 1YQSA 2EX8A 2H10A 3ZDJA 3B3XA 2Y2PA 3NBLA 2ZD8A 4KZ6A 3ITBA 5KZHA 1XKZA 3CG5A 4LV1A 3SS4A 3OCNA 1PI4A 3SH8A 1XX2A 3BYDA 1KDWA 5E2GA 4DE3A 1HZOA 2WAEA 2QPNA 3Q82A 4YINA 3NCKA 3NC8A 4OPQA 2HDRA 1ES3A 2BG1A 1KVLA 3W8KA 2WUQA 4KZ8A 4GZBA 5HL1A 4EUZA 4OQGA 1EROA 3V50A 3MKEA 2Y4AA 1S0WA 4JKTA 1MWSA 3EQVA 4P87A 3MZFA 1PIOA 1K25A 3HLEA 5DVAA 4UA9A 1W79A 2ZC5B 4LCLA 4UHUA 2HDUA 3NDEA 4GOGA 1KE3A 3HUMA 4L0LA 3WRZA 3ZG8B 3LEZA 5FAOA 5BOHA 5AQAA 3OZHA 5EUAA 1ERMA 3AGDA 2B5RA 1I2SA 3VMAA 1VQQA 1CEFA 3N8LA 4S2JA 4YFMA 1HTZA 3DTMA 4QHCA 5HARA 2IWBA 4R23A 5M1AA 4B4ZA 1ZG6A 3V39A 3SS5A 1LL9A 2DRWA 4KZBA 5JYPA 2Y2GA 4MBKA 5F1GA 2JC7A 2ZC4B 1EI5A 1H8YA 2WGIA 1IKIA 1N4OA 1LI0A 3VP2A 4EWFA 1C3BA 4KZ3A 4UA6A 1JTGA 2JCHA 1NYYA 3PBNA 3UDFA 5GLDA 2JBFA 2UWXA 3VFHA 1KGGA 2Y2NA 1BULA 4S2KA 1ZG4A 1IKGA 4JXWA 1G68A 2OSUA 2Y2OA 4R4RA 1FSYA 1RGYA 1PW1A 4EBNA 4GN2A 1LI9A 4Z9QA 2XEPA 4CJNA 1YLPA 5FQJA 5TR7A 4Y7PA 1NJ4A 4S2MA 1FSWA 3HL9A 2G2WA 3ZG5A 1SDNA 4MNRA 3ZGAB 3VOZA 3IXBA 4OP5A 2Q9MA 3BM6A 3HLGA 2XF3A 5I94A 4C6YA 5F82A 1XPBA 1U60A 1WYCA 2X71A 2ZM2A 3MKFA 3N8RA 3O88A 1BT5A 4QD4A 1ONHA 4S2NA 1KGFA 4U0TA 4C3QA 3LY4A 5CHJA 2C5WB 1HD8A 4K0XA 4XUZA 5M18A 3GV9A 4N9LA 1IYOA 4WELA 5CTMA 4KG5A 4QU3A 1JWZA 1W8YA 3PBTA 3UDIA 4DKIA 1YT4A 5FQIA 5A91A 3MZDA 3P09A 2WKHA 2Q9NA 1E3UA 1XGJA 3C7UA 4JXGA 3UPOA 1XGIA 3N6IA 3C7VA 3ZVTA 5F1FA 5GHZA 3WS4A 3S22A 3JYIA 4FCFA 4XXRA 5L2FA 2XK1A 4S2LA 3G35A 1L0FA 5E2FA 1SDEA 5DF7A 3A3FA 3V5MA 1KGEA 5HX9A 4E3NA 5CECA 4K0WA 4ZJ1A 3V3SA 1GA9A 3A3IA 2XR0A 3BLMA 4KZAA 2Y59A 2P9VA 3UNWA 4GD6A 4FH2A 2HPBA 2IWCA 3NDGA 1MXOA 3UE0A 2Y2LA 4BD1A 4FH4A 5FI7A 3QNBA 3UDXA 1L2SA 3RJUA 1FR1A 3Q07A 1EWZA 5EVIA 3Q1FA 4RVAA 1W7FA 3CJMA 4H8RA 1K6SA 1MY8A 2HP9A 5HAPA 1BLPA 3WWXA 4BENA 3UE1A 4UAAA 2ZLYA 1QMEA 5AQ7A 4ZBEA 1CI9A 2P9VB 3MZEA 1ERQA 1DY6A 3N8SA 3PTEA 4EBPA 4UA7A 4X68A 1RP5A 3IXDA 4GB7A 2Y91A 2R9XA 4KQRA 4R1GA 3C4OA 3ITAA 3A3DA 4BJPA 3HVFA 1PI5A 3OPRA 3SS3A 3IWQA 3G32A 3PBQA 2Z2LB 3DWZA 4ZTKA 3VFFA 4ZDXA 3MBZA 5CEBA 3MFDA 1K57C 3IHBA 4JF6A 4MBFA 4IVKA 1BLCA 4OLGA 1E4DA 2EXBA 2ZQ7A 2C6WB 1IYSA 2Z2MB 4HEFA 3Q7VA 4N92A 1LHYA 1NZUA 2V1ZA 4S2OA 3ZNTA 2XLNA 1E25A 5JYOA 3UPPA 3RXXA 4D2OA 4P0MA 4GKUA 4OQHA 2H0TA 1S6RA 1VM1A 2WYXA 4PM9A 1NYMA 2XD5A 5CRFA 5CEDA 5HW3A 2Y2MA 3IWOA 3O86A 2Y55A 3PBSA 3IF6C 4O7DA 2XFSA 3DWKA 4N1HA 1W8QA 3UE3A 3HLFA 3WRTA 1Y54A 3DW0A 3E2LA 1GA0A 4BD0A 5FAQA 1TVFA 3W4QA 1I2WA 2H5SA 4A5RA 4PM5A 2OLVA 2HDSA 1RCJA 3IH9A 3O87A 4OQ0A 4IVIA 4DXCA 3OPPA 1Z6FA 3Q7VB 2ZC7A 3I7JA 4OLDA 1JWPA 4PPRA 5CGWA 2HP5A 4PM8A 4QY6A 5TFQA 4R4SA 2H0YA 5F83A 1L0DA 2PU2A 4S2PA 1ONGA 3GQZA 5TGFA 4WZ5C 5HAQA 3SOIA 4JBFA 3UPNA 4BL3A 3G2ZA 4OOLA 3FV7A 4MEZA 3BLSA 4EQIA 5GLCA 5G18A 4DDSA 1K54C 5KSHA 1K55C 5DTKA 1XA1A 4X53A 2G2UA 5FSRA 3GRJA 1XXMA 4WEJA 1E3UD 4KZ7A 1IYPA 4BLMA 4JPMA 2ZQDA 1I5QA 3TSGA 4DRTA 1TEMA 3G30A 2DCFA 3PAEA 3S1YA 3IWIA 1YM1A 3W4OA 1L0EA 2EX2A 1ES4A 3NI9A 1BTLA 4WYYA 4B4XA 5CHMA 1LL5A 3UY6A 3ISGA 1K38A 1LLBA 1ALQA 4WBGA 5CHUA 1PYYA 3P98A 4DF6A 5E2HA 3WS5A 4P85A 3IHAA 4KG6A 2E8IA 3PBRA 4PM6A 3ZG7B 1WYBA 4LENA 4ZJ2A 3TG9A 1FCMA 4OOYA 5EOEA 5EVID 4DE2A 2WZZA 5DF8A 4RX2A 3BECA 1YLYA 2R9WA 5GLBA 4C75A 1O07A 1Q2QA 2WADA 1JVJA 2WKEA 3HLWA 4K91A 4LV3A 4WEKA 4E3JA 4LV0A 2FFYA 3BFEA 3QHYA 2WGVA 3VP3A 5IHVA 2X02A 5AQ9A 1G6AA 4WZ4A 3CZDA 1MPLA 2XH9A 4RX3A 1BSGA 3TOIA 4MBHA 3ZNYA 1HVBA 4P6BA 3O3VA 4B88A 3S4XA 4QY5A 3VOYA 4E6WA 2ZQAA 2PU4A 3WS2A 3ZFZA 1CEGA 3IQAA 1OMEA 1ZC2A 4GNUA 4QB8A 3G2YA 1IYQA 1K56A 3RXWA 1FQGA 1PWCA 1H5XA 3HBRA 5FI6A 3LCEA 2XQZA 4R3BA 2HP6A 2DNSA 4X56A 2PBYA 2XD1A 3FKVA 2J9OA 4FD8A 4ZAMA 4E3IA 1YLZA 3OPHA 4PM7A 5CGXA 5EOOA 5M19A 1YMSA 3PBOA 3VSKA 2OLUA 3VP1A 3FKWA 2J9PA 4N1XA 2ZM8A 2WKIA 5CTNA 3M2KA 5EVIB 2Y2HA 1NY0A 3BFDA 3UO9A 2OV5A 4JLFA 1AXBA 2FFFB 5AQBA 4JXVA 5EPHA 5FQKA 1PZOA 3IXGA 5EE8A 3OCLA 3G4PA 1CI8A 4U3TA 1K4FA 4PMAA 2ZMAA 1SKFA 2QMIA 3FZCA 3ZG9B 2EXAA 2HDQA 1MWRA 2JE5A 4MLLA 3SH7A 1O7EA 5A90A 4N9KA 4OKPA 4U0XA 5FASA 2WAFA 5FQMA 4IEDA 2V20A 4GDBA 1PWDA 4Q8IA 4EV4A 1JTDA 2ZC3B 4F94A 3GMWA 1PWGA 2IWDA 4LV2A 1M6KA 2X01A 4E6XA 3LO7A 2ZQCA 2EX9A 4X55A 4ZJ3A 1GCEA 1XA7A 3OC2A 3Q81A 3G34A 2A49A 2ZM0A 4IBRA 5FQQA 2WGWA 4R3JA 4WMCD 1BLHA 1KVMA 3MXSA 3UN7A
chains in the Genus database with same CATH superfamily
2CC1A 3QNCA 4QPRA 1MWTA 4HESA 2Y2JA 3KSGA 1F98A 1ESUA 1NRFA 1T1AA 1Q2PA 3M6HA 5EECA 5D3OA 1J3WA 5HFOA 3KYZA 2O9BA 3E4PA 4KG2A 4M3KA 1NXYA 1DP8A 1H3QA 2HGVA 3C38A 4HJ6A 3QP8A 3ZCZA 4OPZA 3FWLA 3CPTA 2ZC6B 5HDSA 4RYEA 4CLCA 4QWOA 2Z6CA 3LIDA 4DE1A 3LR0A 1GHIA 2BTFP 1DJCA 4FSFA 2VGKA 5EVIC 2QZ6A 1K4EA 1ZKJA 1YLTA 2JKGA 3ZQ5A 5HAIA 1K6RA 1S66L 2I72A 1TS7A 3QP4A 4Y17A 2W3GA 2V2FF 4DN0A 1P97A 1LL8A 4WM9A 4IBXA 3TW8A 3ZHHA 2XGNA 4OONA 4XUXA 3KSIA 3B33A 3FG8A 3A0RA 4S2IA 5FATA 3S7OA 1SHVA 2EFUA 3N7WA 1W63M 1FR6A 3Q7ZA 4EBLA 4LCMA 3TE8A 1K0KA 1ESIA 1PW8A 1MBLA 1LSVA 3FYZA 3M6BA 4HP4A 1ES2A 1BLSA 1MKMA 1NZOA 1CK3A 3F1NA 3BFCA 3C30A 1YLJA 1OT9A 2Y2PA 2ZD8A 4ZRRA 4KZ6A 3FPWA 4P6ZS 3OCNA 1PI4A 3SH8A 1KDWA 1XJ4A 2WAEA 4OPQA 2HDRA 4MMNA 4R70A 1EROA 3V50A 4P87A 1PIOA 4Z1WA 1K25A 3LGOA 3DTEA 1MZUA 1KE3A 4CLCD 3ZG8B 3AGDA 3PR6A 5M1AA 3V39A 3T4JA 4O0PA 4KZBA 1IFQA 1EI5A 1N4OA 1LI0A 2XROA 2JCHA 1NYYA 3PBNA 5L10A 1OPXA 2UWXA 4JGQA 2Y2OA 4CJNA 1YLPA 4Y7PA 1NJ4A 4S2MA 2QJ5A 4HP9A 3KYQA 3HL9A 4EETB 1SDNA 3VOZA 3E98A 2W3FA 2GZAA 2BASA 2X71A 2VV6A 4QD4A 3LY4A 4K0XA 4DKIA 3PBTA 5A91A 3P09A 1Y4OA 5EFWA 1XJ6A 3C7UA 4IUHA 3UPOA 3N6IA 5GHZA 3WS4A 3JYIA 2XK1A 5I5LA 4S2LA 1L0FA 4E3NA 4K0WA 2R78A 4KZAA 4JGOA 3UNWA 4EERA 3NDGA 3VOLA 5FI7A 3QNBA 4E04A 5EVIA 3Q1FA 1PFLA 2HP9A 5HAPA 2JHEA 4UAAA 2HJ9C 4ZBEA 4HH3A 1ERQA 4EBPA 4GB7A 1YAXA 2R9XA 3UB9A 4D60A 3IS2B 4I38A 3OPRA 3G32A 3PBQA 2Z2LB 3DWZA 3FPVA 4ZTKA 2NUTC 4FOFA 2JKTM 2INWA 1IYSA 3MSHA 2Z2MB 5JYOA 4GS9A 3RXXA 3UPPA 4PM9A 1NYMA 5CRFA 2Y2MA 4O7DA 3DWKA 1W8QA 3HLFA 3DW0A 1V9ZA 1TVFA 2XSSA 3IH9A 4OQ0A 2PAVP 4DXCA 3OPPA 3I7JA 3T4SA 4R4SA 1X0OA 5TGFA 3MXQA 3MR0A 3FV7A 4MEZA 5GLCA 2WKRA 4R38A 3NOTC 1K54C 3BY9A 2G2UA 4YWZA 1TF1A 3IBJA 4NXFA 4EEPA 2DCFA 3E0YA 3S1YA 5MC7A 4WL9A 3E4OA 3L7HA 4ETZA 1LLBA 3VE3A 3P98A 4EXOA 2Y8HA 5E2HA 2HV1A 2E8IA 3ZG7B 5A8BA 4LENA 3TG9A 4ME4A 4OOYA 5EOEA 3NECA 5EVID 2WZZA 4RX2A 2NUPC 2R9WA 2XRNA 5GLBA 4LV3A 1Q2QA 2WADA 1CF0A 1JVJA 3HCYA 4H6JA 2VK3A 3JVUA 5IHVA 2X02A 5AQ9A 3CZDA 1MPLA 1DP6A 2GNXA 1F9IA 3O3VA 1HLUP 4QY5A 1UWPX 4E6WA 2JKTI 2ZQAA 1CEGA 4QB8A 1F2KA 4LFUA 1PWCA 2PYPA 4R3BA 1BYWA 2HP6A 4MN6A 4PHTA 2XD1A 2J9OA 4ZAMA 4E3IA 1YLZA 3OPHA 1GSVA 3PBOA 2O99A 4BBVA 2ZM8A 5F5YA 5CX7A 2PR5A 3CHWP 3T4QA 3BFDA 3UO9A 4MCWA 5F68A 5EPHA 4M4XA 4KUOA 3ZG9B 4MLLA 5A90A 4U0XA 4OKPA 4IEDA 2V20A 1PWGA 1GCEA 3Q81A 4LGWA 1XFQA 3L9KA 1NRJA 4WMCD 3MMHA 1KVMA 3HREA 3PXPA 5F69A 4OQIA 5FQ9A 5J8XA 3LFVA 3VP0A 4BBTA 5DTTA 1CQAA 3IXHA 2GDNA 4GD8A 2XA7M 3BQAA 3CAXA 3ZVWA 4HBTA 3IX3A 4HHDA 2VEAA 1YMXA 2EX6A 4JF5A 5DF9A 4DMZA 4HBUA 2KX6A 5J3WA 5GHXA 3IX8A 4E3OA 1OTDA 1VETA 3A0VA 2B02A 4KENB 4UQIS 3HLDA 3MS6A 3MJQA 3OLOA 2A2LA 2A24A 3NOUC 3BFGA 4Y0TA 3F1PB 3HUOA 5FA7A 4EEUA 3OPLA 2WK0A 5HPIA 2ZJ9A 4X69A 1S1YA 1SCWA 3G31A 5DTSA 3T4TA 2JN7A 5U47A 3C4PA 4BL2A 1MWUA 3IF6B 4F3LA 5GHYA 1XP4A 1FOFA 1BZAA 3PYPA 1W5DA 5KMWA 1K54A 2EFXA 4NETA 5FDHA 1NLZA 1YSPA 4OPYA 1PRQA 3AGFA 4QJGA 1H8ZA 5LBRA 2Y2QA 5CXWA 2JKRM 1FILA 2AVXA 2V8CA 4KQOA 5E2EA 4OVDA 5HPFA 2HZ5A 2ZQ9A 4GLQA 1GHPA 5GL9A 4DDYA 4DXBA 4NXGA 3T1RA 2ZQ8A 1YQSA 2EX8A 2H10A 3ZDJA 3KX0X 4HJ4A 2K2NA 3D9YA 3R7WB 1TS0A 3RFBA 3BYDA 5E2GA 4GJ4A 3Q82A 1VHMA 1DP9A 3HJIA 4YINA 3NC8A 5L09A 4ARZA 1KVLA 3W8KA 3LR5A 4GZBA 5HL1A 5EVEA 3MKEA 4P6ZM 1S0WA 3EQVA 3S7NA 1IOUA 2W1TB 4LCLA 4UHUA 3NDEA 5FAOA 5FEGA 3OZHA 1ERMA 4Q0HA 1OTBA 4YFMA 2J3WA 4R23A 4B4ZA 1S4SA 3SS5A 2DRWA 4MBKA 5F1GA 2JC7A 3LR3A 2WGIA 1IKIA 1C3BA 4KZ3A 1JTGA 2JBFA 3VFHA 2HF6A 3SZTA 3T1XA 5C5KA 2OSUA 4R4RA 2MJ6A 4GN2A 1P0ZA 2XEPA 1FSWA 2QWSA 2JKRI 5L8MA 3ZG5A 3IXBA 5I94A 2Q9MA 2XF3A 4C6YA 1KOUA 2D01A 1XPBA 4WLAA 3N8RA 3MKFA 5KIZA 2GX5A 3O88A 4YOFA 1KGFA 4U0TA 4XUZA 4KUKA 3G6OA 4N9LA 4WELA 4KG5A 1JWZA 1W8YA 3UDIA 3MZDA 2L0WA 1XGIA 5F1FA 4NG2A 4XXRA 3IX4A 1YSQA 3V5MA 3A3FA 1S4RA 3H82A 2P9VA 2HPBA 1MXOA 2Y2LA 4BD1A 4FH4A 2PRFA 1Z09A 3MQ0A 4G3VA 3RJUA 3Q07A 1EWZA 3BY8A 3CJMA 2ZL1B 1BLPA 3WWXA 1H8MA 3HJKA 5IT5A 1CI9A 1VEUA 4I39A 3SW1A 3N8SA 3PTEA 4GHIB 2Y91A 3C4OA 2ZMFA 3ITAA 4ZDXA 3IWQA 3UB6A 3MBZA 1T19A 1K57C 3IHBA 3CUEC 4IVKA 4OLGA 2ZQ7A 2EXBA 2W1RA 2O0YA 2L4RA 2V0UA 4LRYC 3ZNTA 2XLNA 1E25A 4GKUA 3P01A 2H0TA 1VM1A 2WYXA 1DRMA 5HW3A 3IWOA 3PBSA 3D3OA 4N1HA 2VV7A 4BD0A 3U4LP 2PD8A 4A5RA 2OLVA 3PHYA 3Q7VB 3H7WB 3NHQA 1JWPA 4PPRA 4PM8A 2W27A 1ONGA 3LEQA 4JBFA 4BL3A 5HWWA 2J80A 1UWNX 4EQIA 5HWTA 1FIKA 4L9FA 1XA1A 3LI9A 3KSHA 3LIAA 3R4KA 1SZVA 1TEMA 3G30A 3PAEA 3IWIA 1YM1A 3W4OA 2QKPA 1D1JA 2EX2A 1BTLA 3QP6A 2G7UA 1LL5A 4Y13A 4B9OA 3H9WA 1PYYA 3BJNA 4P85A 3IHAA 3PBRA 4ZJ2A 1GSWA 1T1CA 1G5UA 2EA9A 3BECA 3QP2A 1O07A 4E3JA 3HLWA 2B18A 1XFNA 1GSXA 1G6AA 2OOLA 5EM1A 1D06A 2XH9A 1BSGA 3EEHA 1HVBA 4P6BA 4B88A 4Y5FA 1OTIA 2PU4A 2YKFA 3IQAA 5TBMA 4GNUA 1K56A 1SKOA 2ZBBA 2XQZA 1AWIA 2W3HA 4X56A 4II7A 4I3JA 2J3TC 2EWVA 5CGXA 3VSKA 1S67L 4N1XA 4XT2B 2EWWA 3LUQA 3F1OA 1G6OA 5DJTA 4JLFA 1AXBA 2FFFB 2W3DA 5EE8A 1P9WA 2Y79A 4U3TA 2ZMAA 2QMIA 1MWRA 1N9NA 3SH7A 1O7EA 5FASA 2WAFA 1UGUA 1PWDA 2ZC3B 3GMWA 3O5YA 2X01A 4BMWA 2EX9A 3G34A 3CITA 4E3KA 2XDMA 3VP4A 1JWVA 3EEAA 3UB8A 2Y2IA 1P9RA 3NY4A 1RGZA 4KZ4A 3UB7A 2B95A 3GSGA 1YLWA 2RL3A 1K57A 2WGWB 1XJ2A 3CUEA 1JNUA 1DJBA 2VGLS 4WMCA 1TDGA 2HJEA 4KQQA 1OJGA 2RCXA 4RA7A 2VGJA 3SH9A 3IT9A 2YKHA 3WS1A 1TD5A 3W4PA 1H0MA 4UQIM 2WZXA 1KDSA 1K56D 4HI4A 3IF5A 2J8YA 5FI2A 3S7PA 4LPZA 4DE0A 3CPTB 2Y2KA 5DKKA 4CLCB 1EW0A 2P74A 4MDZA 4BQMA 4IUKA 4PKYG 3ZG0A 5DJUA 1GHMA 5FEFA 4EW7A 4G3WA 3A3EA 3EQUA 3LI8A 3BW6A 1QMFA 3BEBA 4WUJA 1BUEA 1VB6A 3WS0A 3GDIA 2Q0OA 2D02A 1ES5A 3MXRA 3V3RA 4OH0A 4X6TA 3BRMA 1FCOA 1KE4A 5DFYA 3K3DA 2W3EA 3C5AA 1IELA 3GVBA 3LY3A 3QP1A 3B3XA 3T1QB 3LR4A 1ZHHB 2M7VA 3CG5A 2FZ0A 2OAQ1 4DE3A 4L9GA 1HZOA 2QPNA 2P04A 1ES3A 2BG1A 3F1NB 2WUQA 4EUZA 3T50A 4JKTA 1MWSA 3MZFA 1XJ3A 4UA9A 3HUMA 4L0LA 3WRZA 3LEZA 5BOHA 2OWHA 2ZOIA 2K31A 2B5RA 1I2SA 3VMAA 2E8JA 1VQQA 1CEFA 3N8LA 2IWBA 1ZG6A 1LL9A 2V1BA 1STZA 3B42A 2P7JA 1H8YA 4FTXA 3VP2A 3KSFA 4ESPA 1KGGA 2Y2NA 1BULA 4S2KA 3CLOA 4JXWA 4I3AA 1RGYA 4Q0JA 3C2WA 1PNEA 1LI9A 4Z9QA 5FQJA 3T12B 1A0KA 1OTEA 4PKYA 3BM6A 3HLGA 1U60A 1WYCA 2ZM2A 1ONHA 4MN7A 5HL6A 5M18A 2C5WB 2O9AA 4G3KA 1YT4A 5FQIA 4PAUA 1E3UA 4JXGA 5L2FA 1OJ5A 5E2FA 1SDEA 5DF7A 2W0NA 5HD3A 5HX9A 2QJ7A 5CECA 4ZJ1A 3V3SA 3A3IA 2XR0A 3BLMA 4NKPA 2Y59A 4GD6A 4FH2A 2V8FA 2IWCA 3UE6A 4WF0A 1YKDA 2DMWA 4HY8A 3UDXA 1FR1A 3IS2A 5TJJA 4IJGA 4RVAA 1W7FA 4H8RA 1K6SA 1MY8A 3NJAA 4BENA 5AQ7A 1QMEA 4KQDA 2J3TD 1DY6A 4X68A 4HQAA 4R1GA 1W63Q 3A3DA 3CWFA 4BWIA 2V0WA 5AVFA 4JF6A 4MBFA 3T4KA 1E4DA 4FUWA 2C6WB 5FL3A 4HEFA 4EU0A 1LHYA 1NZUA 2V1ZA 4S2OA 2V9AA 5CEDA 3O86A 3IF6C 1Y28A 2XFSA 1G28A 3UE3A 1Y54A 3E2LA 3EWKA 4R6LA 1GA0A 3NOPC 3W4QA 1I2WA 2H5SA 4PM5A 1RCJA 3O87A 4BBUA 2LB9A 2ZC7A 2HP5A 3B47A 4QY6A 4GS9B 2H0YA 2VJWA 2PU2A 4S2PA 4IHQA 4DJ3A 4WZ5C 4I3IA 3G2ZA 3BLSA 4LLOB 5G18A 4DDSA 2VX8A 5KSHA 1K55C 4X53A 3RTYA 5FSRA 3GRJA 1E3UD 3C8CA 3K3CA 5HZHA 1IYPA 4BLMA 4JPMA 2ZQDA 1I5QA 3TSGA 4DRTA 2JKFA 4WYYA 4B4XA 3NI9A 5HSQA 1ALQA 5CHUA 5G4YA 4NEED 5J7EA 3WS5A 2UV0E 4PM6A 3V67A 5DF8A 2KOIA 1F5MA 4K91A 4ETXA 2FFYA 3BFEA 2H28A 3QHYA 3VP3A 4WZ4A 2I9VA 3ZNYA 3S4XA 2PR6A 4GCZA 3VOYA 4EQ1A 1OMEA 3G2YA 1TS6A 5L07A 5HDCA 4H6JB 1H5XA 5FI6A 1S1ZA 1TS8A 3UB5P 2VV8A 1N9LA 3FKVA 4O01A 3TJZC 3LYXA 4PM7A 5EOOA 5M19A 2OLUA 2J9PA 3KO6A 2PT7A 2WKIA 5CTNA 4Y15A 1NLYA 2KDKA 2Y2HA 2ZMVA 2OV5A 5AQBA 4Y3IA 4JXVA 4LRXC 3IXGA 3G4PA 3NULA 2EXAA 2LB5A 1LSWA 2JE5A 2O9CA 4X1MA 4GDBA 4Q8IA 2IWDA 3BWLA 1M6KA 4LV2A 4E6XA 4X55A 4ZJ3A 1XA7A 3OC2A 3P7NA 2ZM0A 5FQQA 4R3JA 1BLHA 3UN7A 3DTKA 4YNRA 4JF4A 1MKIA 3AGEA 4JXSA 1OT6A 4KZ9A 4R3AA 3E2KA 1WA9A 1FCNA 4S2NC 5DKLA 3M2JA 4KZ5A 4GDNA 3GR2A 3GTCA 3F1PA 2VZWA 4Q0IA 3ZYTA 2A3UA 4OPRA 1DJAA 3HUNA 3ULFA 1M40A 2XFTA 3VSLA 4Y0UA 4Y0OA 1TDLA 3BQ8A 3IF6A 2VGLM 2P08A 5CERA 1KE0A 1OTAA 5GLAA 4E3LA 1L0GA 1N9BA 5CGSA 3MFXA 3N4IA 3LIFA 3HLCA 1VETB 5AVEA 3LIEA 4HIAA 1L3LA 5FAPA 2PDRA 3OBFA 5A93A 3EGDC 2A24B 3JVVA 2BLSA 3PAGA 1WE4A 5E43A 2WKQA 4B93A 5A92A 4WZ5A 5KSCA 4OP8A 4R0QA 3LIBA 3CMZA 1K55A 1V9YA 4ID4A 3EGXC 5HD5A 1PZPA 4CPKA 3HLBA 3VV4A 4NK3A 4F3LB 3BFFA 5F6AA 1D7EA 5EVLA 4OOMA 3D4FA 1J9MA 4E3MA 1ACFA 3NIAA 3A3JA 3R7WA 2FH5A 2PD7A 5HDDA 1CJFA 2J7VA 3LICA 1IEMA 3IH8A 4JGPA 5HWVA 2K7SA 3NBLA 3ITBA 5KZHA 1T1BA 1XKZA 4LV1A 5FDSA 3SS4A 4O8GA 1XX2A 2W1TA 2KLIA 3NCKA 2WKPA 4KZ8A 4OQGA 2VLGA 2Y4AA 4NXEA 3HLEA 5DVAA 1W79A 2ZC5B 2HDUA 4GOGA 3T1SA 5AQAA 5EUAA 4ARZB 4S2JA 1HTZA 3DTMA 4QHCA 5HARA 4EESA 5DFXA 3A0SA 5EV0A 2IA2A 5JYPA 2Y2GA 4CQHA 3T4OA 2ZC4B 3TRCA 4X25A 4UA6A 3RH8B 3UDFA 5GLDA 2CMNA 1ZG4A 1IKGA 1G68A 1FSYA 2OWJA 1PW1A 4EBNA 5TR7A 2G2WA 1LT0A 1ODVA 4MNRA 3ZGAB 4OP5A 5F82A 2PHYA 4EWFA 4S2NA 2OAP1 2V1AA 1BT5A 4C3QA 1YPRA 5CHJA 1HD8A 3DTIA 3GV9A 1IYOA 4LRZE 5CTMA 2PYRA 4QU3A 1ZTUA 2WKHA 2Q9NA 1XGJA 3C7VA 3ZVTA 3S22A 4FCFA 4NXBA 5EM0A 2ZL1A 3G35A 1KGEA 1GA9A 3CI6A 4GHIA 3UE0A 4HH2A 1L2SA 5IU1A 2ZOHA 3UE1A 3JPUA 3ICYA 2ZLYA 3H82B 2P9VB 3MZEA 3OOVA 4WN5A 4EUVA 4UA7A 2M7UA 1RP5A 3IXDA 4KQRA 3FC7A 1NWZA 4CLCE 5J4EA 4BJPA 3HVFA 1PI5A 3SS3A 3VFFA 5CEBA 3MFDA 3T4LA 1BLCA 3UMDA 1VEUB 3Q7VA 3H7WA 3UMEA 4N92A 4D2OA 4P0MA 4OQHA 1S6RA 2L1MA 2XD5A 2Y55A 4CLCC 3WRTA 4GW9A 3VE4A 5FAQA 4L9EA 2HDSA 4IVIA 3W2ZA 1Z6FA 4AFIA 5IS1A 4OLDA 2GJ3A 5CGWA 4K08A 5TFQA 5F83A 1L0DA 3GQZA 5HAQA 3SOIA 3UPNA 4OOLA 3EOIA 5DTKA 3MF0A 2ACGA 1XXMA 4WEJA 5AJGA 4KZ7A 1L0EA 1ES4A 5CHMA 3UY6A 3ISGA 1K38A 4WBGA 3QP5A 4DF6A 2PBDP 2M1CA 3S7QA 4KG6A 2VKSA 1N9OA 1WYBA 3MQOA 1MC0A 1FCMA 2QYBA 4DE2A 4HJ3A 1YLYA 4C75A 2WKEA 4WEKA 4LV0A 2WGVA 4UEYA 4RX3A 4MN5A 4DJ2A 3TOIA 4MBHA 5G4ZA 4JGRA 2Z6DA 2QHKA 3WS2A 3ZFZA 1ZC2A 4XT2A 5K5BA 1IYQA 3IBRA 3RXWA 1LSXA 1FQGA 3HBRA 3DBAA 3LCEA 2DNSA 4Y2FA 2PBYA 3KYEA 4FD8A 3DAVA 3MQQA 1YMSA 3VP1A 1T18A 3FKWA 5TBMB 3M2KA 5EVIB 1SKOB 1NY0A 3D72A 4HNBA 5FQKA 1PZOA 3OCLA 1CI8A 1K4FA 4PMAA 1SKFA 3GECA 3FZCA 2HDQA 3E4QA 4N9KA 4HOIA 3U2AA 5FQMA 3F1OB 2VA0A 4RQ9A 4EV4A 1JTDA 4F94A 3K2NA 3LO7A 2ZQCA 2XA7S 2A49A 4IBRA 2WGWA 4X1LA 3MXSA 4I5SA
chains in the Genus database with same CATH topology
4E3KA 2CC1A 4JF4A 3QNCA 3HREA 2XDMA 1MWTA 1MKIA 3AGEA 2Y2JA 4HESA 4JXSA 4KZ9A 1JWVA 4OQIA 3E2KA 5FQ9A 3VP4A 5J8XA 3VP0A 2Y2IA 5DTTA 3NY4A 3IXHA 1FCNA 4S2NC 1ESUA 1NRFA 1RGZA 2GDNA 4GD8A 3M2JA 4KZ4A 4KZ5A 1Q2PA 4GDNA 4HBTA 3ZVWA 3M6HA 3GR2A 5EECA 5D3OA 1YMXA 2EX6A 3GSGA 4JF5A 1YLWA 5DF9A 3GTCA 4HBUA 5HFOA 2RL3A 1K57A 2WGWB 2A3UA 4OPRA 1DJBA 5GHXA 4WMCA 1DJAA 3HUNA 4KG2A 4E3OA 4M3KA 1M40A 4KENB 1NXYA 1TDGA 4KQQA 2XFTA 3VSLA 4Y0UA 2RCXA 3HLDA 3ZCZA 4Y0OA 4RA7A 4OPZA 3FWLA 2VGJA 2ZC6B 3SH9A 1TDLA 3BFGA 3IF6A 3IT9A 4RYEA 3WS1A 4Y0TA 5CERA 1KE0A 5GLAA 3W4PA 4E3LA 4DE1A 1L0GA 1GHIA 1N9BA 2WZXA 5CGSA 3N4IA 3HUOA 1DJCA 4FSFA 2VGKA 3HLCA 5FA7A 5EVIC 2QZ6A 1KDSA 1K4EA 3OPLA 1K56D 1ZKJA 2WK0A 2ZJ9A 4X69A 5FAPA 1SCWA 3G31A 3IF5A 5DTSA 1YLTA 2J8YA 5FI2A 4DE0A 5HAIA 5A93A 1K6RA 2BLSA 2I72A 1WE4A 3PAGA 3C4PA 5E43A 2Y2KA 5U47A 4BL2A 1MWUA 3IF6B 5A92A 4WZ5A 2V2FF 5GHYA 1XP4A 2P74A 4OP8A 4BQMA 1FOFA 1BZAA 5KSCA 4R0QA 4WM9A 5KMWA 1W5DA 3CMZA 1K54A 1K55A 2EFXA 4IBXA 3ZG0A 4NETA 4ID4A 1GHMA 3ZHHA 5FDHA 2XGNA 3A3EA 3EQUA 4OONA 4XUXA 1PZPA 4CPKA 4OPYA 1QMFA 3HLBA 3BEBA 4S2IA 3AGFA 4NK3A 5FATA 4QJGA 1BUEA 1SHVA 2EFUA 3WS0A 1H8ZA 3N7WA 3BFFA 2Y2QA 5CXWA 1FR6A 3Q7ZA 5EVLA 4OOMA 4EBLA 4LCMA 3D4FA 1J9MA 1ES5A 1ESIA 4KQOA 3MXRA 5E2EA 1PW8A 3V3RA 4E3MA 4OVDA 1MBLA 3NIAA 3A3JA 4OH0A 4X6TA 3BRMA 3FYZA 1FCOA 2ZQ9A 3M6BA 1KE4A 2J7VA 1GHPA 1ES2A 5GL9A 3C5AA 4DDYA 1IEMA 1BLSA 4DXBA 1NZOA 3IH8A 1IELA 1CK3A 2ZQ8A 3GVBA 3BFCA 3LY3A 1YLJA 1YQSA 2EX8A 2H10A 3ZDJA 3B3XA 2Y2PA 3NBLA 2ZD8A 4KZ6A 3ITBA 5KZHA 1XKZA 3CG5A 4LV1A 3SS4A 3OCNA 1PI4A 3SH8A 1XX2A 3BYDA 1KDWA 5E2GA 4DE3A 1HZOA 2WAEA 2QPNA 3Q82A 4YINA 3NCKA 3NC8A 4OPQA 2HDRA 1ES3A 2BG1A 1KVLA 3W8KA 2WUQA 4KZ8A 4GZBA 5HL1A 4EUZA 4OQGA 1EROA 3V50A 3MKEA 2Y4AA 1S0WA 4JKTA 1MWSA 3EQVA 4P87A 3MZFA 1PIOA 1K25A 3HLEA 5DVAA 4UA9A 1W79A 2ZC5B 4LCLA 4UHUA 2HDUA 3NDEA 4GOGA 1KE3A 3HUMA 4L0LA 3WRZA 3ZG8B 3LEZA 5FAOA 5BOHA 5AQAA 3OZHA 5EUAA 1ERMA 3AGDA 2B5RA 1I2SA 3VMAA 1VQQA 1CEFA 3N8LA 4S2JA 4YFMA 1HTZA 3DTMA 4QHCA 5HARA 2IWBA 4R23A 5M1AA 4B4ZA 1ZG6A 3V39A 3SS5A 1LL9A 2DRWA 4KZBA 5JYPA 2Y2GA 4MBKA 5F1GA 2JC7A 2ZC4B 1EI5A 1H8YA 2WGIA 1IKIA 1N4OA 1LI0A 3VP2A 4EWFA 1C3BA 4KZ3A 4UA6A 1JTGA 2JCHA 1NYYA 3PBNA 3UDFA 5GLDA 2JBFA 2UWXA 3VFHA 1KGGA 2Y2NA 1BULA 4S2KA 1ZG4A 1IKGA 4JXWA 1G68A 2OSUA 2Y2OA 4R4RA 1FSYA 1RGYA 1PW1A 4EBNA 4GN2A 1LI9A 4Z9QA 2XEPA 4CJNA 1YLPA 5FQJA 5TR7A 4Y7PA 1NJ4A 4S2MA 1FSWA 3HL9A 2G2WA 3ZG5A 1SDNA 4MNRA 3ZGAB 3VOZA 3IXBA 4OP5A 2Q9MA 3BM6A 3HLGA 2XF3A 5I94A 4C6YA 5F82A 1XPBA 1U60A 1WYCA 2X71A 2ZM2A 3MKFA 3N8RA 3O88A 1BT5A 4QD4A 1ONHA 4S2NA 1KGFA 4U0TA 4C3QA 3LY4A 5CHJA 2C5WB 1HD8A 4K0XA 4XUZA 5M18A 3GV9A 4N9LA 1IYOA 4WELA 5CTMA 4KG5A 4QU3A 1JWZA 1W8YA 3PBTA 3UDIA 4DKIA 1YT4A 5FQIA 5A91A 3MZDA 3P09A 2WKHA 2Q9NA 1E3UA 1XGJA 3C7UA 4JXGA 3UPOA 1XGIA 3N6IA 3C7VA 3ZVTA 5F1FA 5GHZA 3WS4A 3S22A 3JYIA 4FCFA 4XXRA 5L2FA 2XK1A 4S2LA 3G35A 1L0FA 5E2FA 1SDEA 5DF7A 3A3FA 3V5MA 1KGEA 5HX9A 4E3NA 5CECA 4K0WA 4ZJ1A 3V3SA 1GA9A 3A3IA 2XR0A 3BLMA 4KZAA 2Y59A 2P9VA 3UNWA 4GD6A 4FH2A 2HPBA 2IWCA 3NDGA 1MXOA 3UE0A 2Y2LA 4BD1A 4FH4A 5FI7A 3QNBA 3UDXA 1L2SA 3RJUA 1FR1A 3Q07A 1EWZA 5EVIA 3Q1FA 4RVAA 1W7FA 3CJMA 4H8RA 1K6SA 1MY8A 2HP9A 5HAPA 1BLPA 3WWXA 4BENA 3UE1A 4UAAA 2ZLYA 1QMEA 5AQ7A 4ZBEA 1CI9A 2P9VB 3MZEA 1ERQA 1DY6A 3N8SA 3PTEA 4EBPA 4UA7A 4X68A 1RP5A 3IXDA 4GB7A 2Y91A 2R9XA 4KQRA 4R1GA 3C4OA 3ITAA 3A3DA 4BJPA 3HVFA 1PI5A 3OPRA 3SS3A 3IWQA 3G32A 3PBQA 2Z2LB 3DWZA 4ZTKA 3VFFA 4ZDXA 3MBZA 5CEBA 3MFDA 1K57C 3IHBA 4JF6A 4MBFA 4IVKA 1BLCA 4OLGA 1E4DA 2EXBA 2ZQ7A 2C6WB 1IYSA 2Z2MB 4HEFA 3Q7VA 4N92A 1LHYA 1NZUA 2V1ZA 4S2OA 3ZNTA 2XLNA 1E25A 5JYOA 3UPPA 3RXXA 4D2OA 4P0MA 4GKUA 4OQHA 2H0TA 1S6RA 1VM1A 2WYXA 4PM9A 1NYMA 2XD5A 5CRFA 5CEDA 5HW3A 2Y2MA 3IWOA 3O86A 2Y55A 3PBSA 3IF6C 4O7DA 2XFSA 3DWKA 4N1HA 1W8QA 3UE3A 3HLFA 3WRTA 1Y54A 3DW0A 3E2LA 1GA0A 4BD0A 5FAQA 1TVFA 3W4QA 1I2WA 2H5SA 4A5RA 4PM5A 2OLVA 2HDSA 1RCJA 3IH9A 3O87A 4OQ0A 4IVIA 4DXCA 3OPPA 1Z6FA 3Q7VB 2ZC7A 3I7JA 4OLDA 1JWPA 4PPRA 5CGWA 2HP5A 4PM8A 4QY6A 5TFQA 4R4SA 2H0YA 5F83A 1L0DA 2PU2A 4S2PA 1ONGA 3GQZA 5TGFA 4WZ5C 5HAQA 3SOIA 4JBFA 3UPNA 4BL3A 3G2ZA 4OOLA 3FV7A 4MEZA 3BLSA 4EQIA 5GLCA 5G18A 4DDSA 1K54C 5KSHA 1K55C 5DTKA 1XA1A 4X53A 2G2UA 5FSRA 3GRJA 1XXMA 4WEJA 1E3UD 4KZ7A 1IYPA 4BLMA 4JPMA 2ZQDA 1I5QA 3TSGA 4DRTA 1TEMA 3G30A 2DCFA 3PAEA 3S1YA 3IWIA 1YM1A 3W4OA 1L0EA 2EX2A 1ES4A 3NI9A 1BTLA 4WYYA 4B4XA 5CHMA 1LL5A 3UY6A 3ISGA 1K38A 1LLBA 1ALQA 4WBGA 5CHUA 1PYYA 3P98A 4DF6A 5E2HA 3WS5A 4P85A 3IHAA 4KG6A 2E8IA 3PBRA 4PM6A 3ZG7B 1WYBA 4LENA 4ZJ2A 3TG9A 1FCMA 4OOYA 5EOEA 5EVID 4DE2A 2WZZA 5DF8A 4RX2A 3BECA 1YLYA 2R9WA 5GLBA 4C75A 1O07A 1Q2QA 2WADA 1JVJA 2WKEA 3HLWA 4K91A 4LV3A 4WEKA 4E3JA 4LV0A 2FFYA 3BFEA 3QHYA 2WGVA 3VP3A 5IHVA 2X02A 5AQ9A 1G6AA 4WZ4A 3CZDA 1MPLA 2XH9A 4RX3A 1BSGA 3TOIA 4MBHA 3ZNYA 1HVBA 4P6BA 3O3VA 4B88A 3S4XA 4QY5A 3VOYA 4E6WA 2ZQAA 2PU4A 3WS2A 3ZFZA 1CEGA 3IQAA 1OMEA 1ZC2A 4GNUA 4QB8A 3G2YA 1IYQA 1K56A 3RXWA 1FQGA 1PWCA 1H5XA 3HBRA 5FI6A 3LCEA 2XQZA 4R3BA 2HP6A 2DNSA 4X56A 2PBYA 2XD1A 3FKVA 2J9OA 4FD8A 4ZAMA 4E3IA 1YLZA 3OPHA 4PM7A 5CGXA 5EOOA 5M19A 1YMSA 3PBOA 3VSKA 2OLUA 3VP1A 3FKWA 2J9PA 4N1XA 2ZM8A 2WKIA 5CTNA 3M2KA 5EVIB 2Y2HA 1NY0A 3BFDA 3UO9A 2OV5A 4JLFA 1AXBA 2FFFB 5AQBA 4JXVA 5EPHA 5FQKA 1PZOA 3IXGA 5EE8A 3OCLA 3G4PA 1CI8A 4U3TA 1K4FA 4PMAA 2ZMAA 1SKFA 2QMIA 3FZCA 3ZG9B 2EXAA 2HDQA 1MWRA 2JE5A 4MLLA 3SH7A 1O7EA 5A90A 4N9KA 4OKPA 4U0XA 5FASA 2WAFA 5FQMA 4IEDA 2V20A 4GDBA 1PWDA 4Q8IA 4EV4A 1JTDA 2ZC3B 4F94A 3GMWA 1PWGA 2IWDA 4LV2A 1M6KA 2X01A 4E6XA 3LO7A 2ZQCA 2EX9A 4X55A 4ZJ3A 1GCEA 1XA7A 3OC2A 3Q81A 3G34A 2A49A 2ZM0A 4IBRA 5FQQA 2WGWA 4R3JA 4WMCD 1BLHA 1KVMA 3MXSA 3UN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E3K A;  2CC1 A;  4JF4 A;  3QNC A;  3HRE A;  2XDM A;  1MWT A;  1MKI A;  3AGE A;  2Y2J A;  4HES A;  4JXS A;  4KZ9 A;  1JWV A;  4OQI A;  3E2K A;  5FQ9 A;  3VP4 A;  5J8X A;  3VP0 A;  2Y2I A;  5DTT A;  3NY4 A;  3IXH A;  1FCN A;  4S2N C;  1ESU A;  1NRF A;  1RGZ A;  2GDN A;  4GD8 A;  3M2J A;  4KZ4 A;  4KZ5 A;  1Q2P A;  4GDN A;  4HBT A;  3ZVW A;  3M6H A;  3GR2 A;  5EEC A;  5D3O A;  1YMX A;  2EX6 A;  3GSG A;  4JF5 A;  1YLW A;  5DF9 A;  3GTC A;  4HBU A;  5HFO A;  2RL3 A;  1K57 A;  2WGW B;  2A3U A;  4OPR A;  1DJB A;  5GHX A;  4WMC A;  1DJA A;  3HUN A;  4KG2 A;  4E3O A;  4M3K A;  1M40 A;  4KEN B;  1NXY A;  1TDG A;  4KQQ A;  2XFT A;  3VSL A;  4Y0U A;  2RCX A;  3HLD A;  3ZCZ A;  4Y0O A;  4RA7 A;  4OPZ A;  3FWL A;  2VGJ A;  2ZC6 B;  3SH9 A;  1TDL A;  3BFG A;  3IF6 A;  3IT9 A;  4RYE A;  3WS1 A;  4Y0T A;  5CER A;  1KE0 A;  5GLA A;  3W4P A;  4E3L A;  4DE1 A;  1L0G A;  1GHI A;  1N9B A;  2WZX A;  5CGS A;  3N4I A;  3HUO A;  1DJC A;  4FSF A;  2VGK A;  3HLC A;  5FA7 A;  5EVI C;  2QZ6 A;  1KDS A;  1K4E A;  3OPL A;  1K56 D;  1ZKJ A;  2WK0 A;  2ZJ9 A;  4X69 A;  5FAP A;  1SCW A;  3G31 A;  3IF5 A;  5DTS A;  1YLT A;  2J8Y A;  5FI2 A;  4DE0 A;  5HAI A;  5A93 A;  1K6R A;  2BLS A;  2I72 A;  1WE4 A;  3PAG A;  3C4P A;  5E43 A;  2Y2K A;  5U47 A;  4BL2 A;  1MWU A;  3IF6 B;  5A92 A;  4WZ5 A;  2V2F F;  5GHY A;  1XP4 A;  2P74 A;  4OP8 A;  4BQM A;  1FOF A;  1BZA A;  5KSC A;  4R0Q A;  4WM9 A;  5KMW A;  1W5D A;  3CMZ A;  1K54 A;  1K55 A;  2EFX A;  4IBX A;  3ZG0 A;  4NET A;  4ID4 A;  1GHM A;  3ZHH A;  5FDH A;  2XGN A;  3A3E A;  3EQU A;  4OON A;  4XUX A;  1PZP A;  4CPK A;  4OPY A;  1QMF A;  3HLB A;  3BEB A;  4S2I A;  3AGF A;  4NK3 A;  5FAT A;  4QJG A;  1BUE A;  1SHV A;  2EFU A;  3WS0 A;  1H8Z A;  3N7W A;  3BFF A;  2Y2Q A;  5CXW A;  1FR6 A;  3Q7Z A;  5EVL A;  4OOM A;  4EBL A;  4LCM A;  3D4F A;  1J9M A;  1ES5 A;  1ESI A;  4KQO A;  3MXR A;  5E2E A;  1PW8 A;  3V3R A;  4E3M A;  4OVD A;  1MBL A;  3NIA A;  3A3J A;  4OH0 A;  4X6T A;  3BRM A;  3FYZ A;  1FCO A;  2ZQ9 A;  3M6B A;  1KE4 A;  2J7V A;  1GHP A;  1ES2 A;  5GL9 A;  3C5A A;  4DDY A;  1IEM A;  1BLS A;  4DXB A;  1NZO A;  3IH8 A;  1IEL A;  1CK3 A;  2ZQ8 A;  3GVB A;  3BFC A;  3LY3 A;  1YLJ A;  1YQS A;  2EX8 A;  2H10 A;  3ZDJ A;  3B3X A;  2Y2P A;  3NBL A;  2ZD8 A;  4KZ6 A;  3ITB A;  5KZH A;  1XKZ A;  3CG5 A;  4LV1 A;  3SS4 A;  3OCN A;  1PI4 A;  3SH8 A;  1XX2 A;  3BYD A;  1KDW A;  5E2G A;  4DE3 A;  1HZO A;  2WAE A;  2QPN A;  3Q82 A;  4YIN A;  3NCK A;  3NC8 A;  4OPQ A;  2HDR A;  1ES3 A;  2BG1 A;  1KVL A;  3W8K A;  2WUQ A;  4KZ8 A;  4GZB A;  5HL1 A;  4EUZ A;  4OQG A;  1ERO A;  3V50 A;  3MKE A;  2Y4A A;  1S0W A;  4JKT A;  1MWS A;  3EQV A;  4P87 A;  3MZF A;  1PIO A;  1K25 A;  3HLE A;  5DVA A;  4UA9 A;  1W79 A;  2ZC5 B;  4LCL A;  4UHU A;  2HDU A;  3NDE A;  4GOG A;  1KE3 A;  3HUM A;  4L0L A;  3WRZ A;  3ZG8 B;  3LEZ A;  5FAO A;  5BOH A;  5AQA A;  3OZH A;  5EUA A;  1ERM A;  3AGD A;  2B5R A;  1I2S A;  3VMA A;  1VQQ A;  1CEF A;  3N8L A;  4S2J A;  4YFM A;  1HTZ A;  3DTM A;  4QHC A;  5HAR A;  2IWB A;  4R23 A;  5M1A A;  4B4Z A;  1ZG6 A;  3V39 A;  3SS5 A;  1LL9 A;  2DRW A;  4KZB A;  5JYP A;  2Y2G A;  4MBK A;  5F1G A;  2JC7 A;  2ZC4 B;  1EI5 A;  1H8Y A;  2WGI A;  1IKI A;  1N4O A;  1LI0 A;  3VP2 A;  4EWF A;  1C3B A;  4KZ3 A;  4UA6 A;  1JTG A;  2JCH A;  1NYY A;  3PBN A;  3UDF A;  5GLD A;  2JBF A;  2UWX A;  3VFH A;  1KGG A;  2Y2N A;  1BUL A;  4S2K A;  1ZG4 A;  1IKG A;  4JXW A;  1G68 A;  2OSU A;  2Y2O A;  4R4R A;  1FSY A;  1RGY A;  1PW1 A;  4EBN A;  4GN2 A;  1LI9 A;  4Z9Q A;  2XEP A;  4CJN A;  1YLP A;  5FQJ A;  5TR7 A;  4Y7P A;  1NJ4 A;  4S2M A;  1FSW A;  3HL9 A;  2G2W A;  3ZG5 A;  1SDN A;  4MNR A;  3ZGA B;  3VOZ A;  3IXB A;  4OP5 A;  2Q9M A;  3BM6 A;  3HLG A;  2XF3 A;  5I94 A;  4C6Y A;  5F82 A;  1XPB A;  1U60 A;  1WYC A;  2X71 A;  2ZM2 A;  3MKF A;  3N8R A;  3O88 A;  1BT5 A;  4QD4 A;  1ONH A;  4S2N A;  1KGF A;  4U0T A;  4C3Q A;  3LY4 A;  5CHJ A;  2C5W B;  1HD8 A;  4K0X A;  4XUZ A;  5M18 A;  3GV9 A;  4N9L A;  1IYO A;  4WEL A;  5CTM A;  4KG5 A;  4QU3 A;  1JWZ A;  1W8Y A;  3PBT A;  3UDI A;  4DKI A;  1YT4 A;  5FQI A;  5A91 A;  3MZD A;  3P09 A;  2WKH A;  2Q9N A;  1E3U A;  1XGJ A;  3C7U A;  4JXG A;  3UPO A;  1XGI A;  3N6I A;  3C7V A;  3ZVT A;  5F1F A;  5GHZ A;  3WS4 A;  3S22 A;  3JYI A;  4FCF A;  4XXR A;  5L2F A;  2XK1 A;  4S2L A;  3G35 A;  1L0F A;  5E2F A;  1SDE A;  5DF7 A;  3A3F A;  3V5M A;  1KGE A;  5HX9 A;  4E3N A;  5CEC A;  4K0W A;  4ZJ1 A;  3V3S A;  1GA9 A;  3A3I A;  2XR0 A;  3BLM A;  4KZA A;  2Y59 A;  2P9V A;  3UNW A;  4GD6 A;  4FH2 A;  2HPB A;  2IWC A;  3NDG A;  1MXO A;  3UE0 A;  2Y2L A;  4BD1 A;  4FH4 A;  5FI7 A;  3QNB A;  3UDX A;  1L2S A;  3RJU A;  1FR1 A;  3Q07 A;  1EWZ A;  5EVI A;  3Q1F A;  4RVA A;  1W7F A;  3CJM A;  4H8R A;  1K6S A;  1MY8 A;  2HP9 A;  5HAP A;  1BLP A;  3WWX A;  4BEN A;  3UE1 A;  4UAA A;  2ZLY A;  1QME A;  5AQ7 A;  4ZBE A;  1CI9 A;  2P9V B;  3MZE A;  1ERQ A;  1DY6 A;  3N8S A;  3PTE A;  4EBP A;  4UA7 A;  4X68 A;  1RP5 A;  3IXD A;  4GB7 A;  2Y91 A;  2R9X A;  4KQR A;  4R1G A;  3C4O A;  3ITA A;  3A3D A;  4BJP A;  3HVF A;  1PI5 A;  3OPR A;  3SS3 A;  3IWQ A;  3G32 A;  3PBQ A;  2Z2L B;  3DWZ A;  4ZTK A;  3VFF A;  4ZDX A;  3MBZ A;  5CEB A;  3MFD A;  1K57 C;  3IHB A;  4JF6 A;  4MBF A;  4IVK A;  1BLC A;  4OLG A;  1E4D A;  2EXB A;  2ZQ7 A;  2C6W B;  1IYS A;  2Z2M B;  4HEF A;  3Q7V A;  4N92 A;  1LHY A;  1NZU A;  2V1Z A;  4S2O A;  3ZNT A;  2XLN A;  1E25 A;  5JYO A;  3UPP A;  3RXX A;  4D2O A;  4P0M A;  4GKU A;  4OQH A;  2H0T A;  1S6R A;  1VM1 A;  2WYX A;  4PM9 A;  1NYM A;  2XD5 A;  5CRF A;  5CED A;  5HW3 A;  2Y2M A;  3IWO A;  3O86 A;  2Y55 A;  3PBS A;  3IF6 C;  4O7D A;  2XFS A;  3DWK A;  4N1H A;  1W8Q A;  3UE3 A;  3HLF A;  3WRT A;  1Y54 A;  3DW0 A;  3E2L A;  1GA0 A;  4BD0 A;  5FAQ A;  1TVF A;  3W4Q A;  1I2W A;  2H5S A;  4A5R A;  4PM5 A;  2OLV A;  2HDS A;  1RCJ A;  3IH9 A;  3O87 A;  4OQ0 A;  4IVI A;  4DXC A;  3OPP A;  1Z6F A;  3Q7V B;  2ZC7 A;  3I7J A;  4OLD A;  1JWP A;  4PPR A;  5CGW A;  2HP5 A;  4PM8 A;  4QY6 A;  5TFQ A;  4R4S A;  2H0Y A;  5F83 A;  1L0D A;  2PU2 A;  4S2P A;  1ONG A;  3GQZ A;  5TGF A;  4WZ5 C;  5HAQ A;  3SOI A;  4JBF A;  3UPN A;  4BL3 A;  3G2Z A;  4OOL A;  3FV7 A;  4MEZ A;  3BLS A;  4EQI A;  5GLC A;  5G18 A;  4DDS A;  1K54 C;  5KSH A;  1K55 C;  5DTK A;  1XA1 A;  4X53 A;  2G2U A;  5FSR A;  3GRJ A;  1XXM A;  4WEJ A;  1E3U D;  4KZ7 A;  1IYP A;  4BLM A;  4JPM A;  2ZQD A;  1I5Q A;  3TSG A;  4DRT A;  1TEM A;  3G30 A;  2DCF A;  3PAE A;  3S1Y A;  3IWI A;  1YM1 A;  3W4O A;  1L0E A;  2EX2 A;  1ES4 A;  3NI9 A;  1BTL A;  4WYY A;  4B4X A;  5CHM A;  1LL5 A;  3UY6 A;  3ISG A;  1K38 A;  1LLB A;  1ALQ A;  4WBG A;  5CHU A;  1PYY A;  3P98 A;  4DF6 A;  5E2H A;  3WS5 A;  4P85 A;  3IHA A;  4KG6 A;  2E8I A;  3PBR A;  4PM6 A;  3ZG7 B;  1WYB A;  4LEN A;  4ZJ2 A;  3TG9 A;  1FCM A;  4OOY A;  5EOE A;  5EVI D;  4DE2 A;  2WZZ A;  5DF8 A;  4RX2 A;  3BEC A;  1YLY A;  2R9W A;  5GLB A;  4C75 A;  1O07 A;  1Q2Q A;  2WAD A;  1JVJ A;  2WKE A;  3HLW A;  4K91 A;  4LV3 A;  4WEK A;  4E3J A;  4LV0 A;  2FFY A;  3BFE A;  3QHY A;  2WGV A;  3VP3 A;  5IHV A;  2X02 A;  5AQ9 A;  1G6A A;  4WZ4 A;  3CZD A;  1MPL A;  2XH9 A;  4RX3 A;  1BSG A;  3TOI A;  4MBH A;  3ZNY A;  1HVB A;  4P6B A;  3O3V A;  4B88 A;  3S4X A;  4QY5 A;  3VOY A;  4E6W A;  2ZQA A;  2PU4 A;  3WS2 A;  3ZFZ A;  1CEG A;  3IQA A;  1OME A;  1ZC2 A;  4GNU A;  4QB8 A;  3G2Y A;  1IYQ A;  1K56 A;  3RXW A;  1FQG A;  1PWC A;  1H5X A;  3HBR A;  5FI6 A;  3LCE A;  2XQZ A;  4R3B A;  2HP6 A;  2DNS A;  4X56 A;  2PBY A;  2XD1 A;  3FKV A;  2J9O A;  4FD8 A;  4ZAM A;  4E3I A;  1YLZ A;  3OPH A;  4PM7 A;  5CGX A;  5EOO A;  5M19 A;  1YMS A;  3PBO A;  3VSK A;  2OLU A;  3VP1 A;  3FKW A;  2J9P A;  4N1X A;  2ZM8 A;  2WKI A;  5CTN A;  3M2K A;  5EVI B;  2Y2H A;  1NY0 A;  3BFD A;  3UO9 A;  2OV5 A;  4JLF A;  1AXB A;  2FFF B;  5AQB A;  4JXV A;  5EPH A;  5FQK A;  1PZO A;  3IXG A;  5EE8 A;  3OCL A;  3G4P A;  1CI8 A;  4U3T A;  1K4F A;  4PMA A;  2ZMA A;  1SKF A;  2QMI A;  3FZC A;  3ZG9 B;  2EXA A;  2HDQ A;  1MWR A;  2JE5 A;  4MLL A;  3SH7 A;  1O7E A;  5A90 A;  4N9K A;  4OKP A;  4U0X A;  5FAS A;  2WAF A;  5FQM A;  4IED A;  2V20 A;  4GDB A;  1PWD A;  4Q8I A;  4EV4 A;  1JTD A;  2ZC3 B;  4F94 A;  3GMW A;  1PWG A;  2IWD A;  4LV2 A;  1M6K A;  2X01 A;  4E6X A;  3LO7 A;  2ZQC A;  2EX9 A;  4X55 A;  4ZJ3 A;  1GCE A;  1XA7 A;  3OC2 A;  3Q81 A;  3G34 A;  2A49 A;  2ZM0 A;  4IBR A;  5FQQ A;  2WGW A;  4R3J A;  4WMC D;  1BLH A;  1KVM A;  3MXS A;  3UN7 A; 
#chains in the Genus database with same CATH topology
 2CC1 A;  3QNC A;  4QPR A;  1MWT A;  4HES A;  2Y2J A;  3KSG A;  1F98 A;  1ESU A;  1NRF A;  1T1A A;  1Q2P A;  3M6H A;  5EEC A;  5D3O A;  1J3W A;  5HFO A;  3KYZ A;  2O9B A;  3E4P A;  4KG2 A;  4M3K A;  1NXY A;  1DP8 A;  1H3Q A;  2HGV A;  3C38 A;  4HJ6 A;  3QP8 A;  3ZCZ A;  4OPZ A;  3FWL A;  3CPT A;  2ZC6 B;  5HDS A;  4RYE A;  4CLC A;  4QWO A;  2Z6C A;  3LID A;  4DE1 A;  3LR0 A;  1GHI A;  2BTF P;  1DJC A;  4FSF A;  2VGK A;  5EVI C;  2QZ6 A;  1K4E A;  1ZKJ A;  1YLT A;  2JKG A;  3ZQ5 A;  5HAI A;  1K6R A;  1S66 L;  2I72 A;  1TS7 A;  3QP4 A;  4Y17 A;  2W3G A;  2V2F F;  4DN0 A;  1P97 A;  1LL8 A;  4WM9 A;  4IBX A;  3TW8 A;  3ZHH A;  2XGN A;  4OON A;  4XUX A;  3KSI A;  3B33 A;  3FG8 A;  3A0R A;  4S2I A;  5FAT A;  3S7O A;  1SHV A;  2EFU A;  3N7W A;  1W63 M;  1FR6 A;  3Q7Z A;  4EBL A;  4LCM A;  3TE8 A;  1K0K A;  1ESI A;  1PW8 A;  1MBL A;  1LSV A;  3FYZ A;  3M6B A;  4HP4 A;  1ES2 A;  1BLS A;  1MKM A;  1NZO A;  1CK3 A;  3F1N A;  3BFC A;  3C30 A;  1YLJ A;  1OT9 A;  2Y2P A;  2ZD8 A;  4ZRR A;  4KZ6 A;  3FPW A;  4P6Z S;  3OCN A;  1PI4 A;  3SH8 A;  1KDW A;  1XJ4 A;  2WAE A;  4OPQ A;  2HDR A;  4MMN A;  4R70 A;  1ERO A;  3V50 A;  4P87 A;  1PIO A;  4Z1W A;  1K25 A;  3LGO A;  3DTE A;  1MZU A;  1KE3 A;  4CLC D;  3ZG8 B;  3AGD A;  3PR6 A;  5M1A A;  3V39 A;  3T4J A;  4O0P A;  4KZB A;  1IFQ A;  1EI5 A;  1N4O A;  1LI0 A;  2XRO A;  2JCH A;  1NYY A;  3PBN A;  5L10 A;  1OPX A;  2UWX A;  4JGQ A;  2Y2O A;  4CJN A;  1YLP A;  4Y7P A;  1NJ4 A;  4S2M A;  2QJ5 A;  4HP9 A;  3KYQ A;  3HL9 A;  4EET B;  1SDN A;  3VOZ A;  3E98 A;  2W3F A;  2GZA A;  2BAS A;  2X71 A;  2VV6 A;  4QD4 A;  3LY4 A;  4K0X A;  4DKI A;  3PBT A;  5A91 A;  3P09 A;  1Y4O A;  5EFW A;  1XJ6 A;  3C7U A;  4IUH A;  3UPO A;  3N6I A;  5GHZ A;  3WS4 A;  3JYI A;  2XK1 A;  5I5L A;  4S2L A;  1L0F A;  4E3N A;  4K0W A;  2R78 A;  4KZA A;  4JGO A;  3UNW A;  4EER A;  3NDG A;  3VOL A;  5FI7 A;  3QNB A;  4E04 A;  5EVI A;  3Q1F A;  1PFL A;  2HP9 A;  5HAP A;  2JHE A;  4UAA A;  2HJ9 C;  4ZBE A;  4HH3 A;  1ERQ A;  4EBP A;  4GB7 A;  1YAX A;  2R9X A;  3UB9 A;  4D60 A;  3IS2 B;  4I38 A;  3OPR A;  3G32 A;  3PBQ A;  2Z2L B;  3DWZ A;  3FPV A;  4ZTK A;  2NUT C;  4FOF A;  2JKT M;  2INW A;  1IYS A;  3MSH A;  2Z2M B;  5JYO A;  4GS9 A;  3RXX A;  3UPP A;  4PM9 A;  1NYM A;  5CRF A;  2Y2M A;  4O7D A;  3DWK A;  1W8Q A;  3HLF A;  3DW0 A;  1V9Z A;  1TVF A;  2XSS A;  3IH9 A;  4OQ0 A;  2PAV P;  4DXC A;  3OPP A;  3I7J A;  3T4S A;  4R4S A;  1X0O A;  5TGF A;  3MXQ A;  3MR0 A;  3FV7 A;  4MEZ A;  5GLC A;  2WKR A;  4R38 A;  3NOT C;  1K54 C;  3BY9 A;  2G2U A;  4YWZ A;  1TF1 A;  3IBJ A;  4NXF A;  4EEP A;  2DCF A;  3E0Y A;  3S1Y A;  5MC7 A;  4WL9 A;  3E4O A;  3L7H A;  4ETZ A;  1LLB A;  3VE3 A;  3P98 A;  4EXO A;  2Y8H A;  5E2H A;  2HV1 A;  2E8I A;  3ZG7 B;  5A8B A;  4LEN A;  3TG9 A;  4ME4 A;  4OOY A;  5EOE A;  3NEC A;  5EVI D;  2WZZ A;  4RX2 A;  2NUP C;  2R9W A;  2XRN A;  5GLB A;  4LV3 A;  1Q2Q A;  2WAD A;  1CF0 A;  1JVJ A;  3HCY A;  4H6J A;  2VK3 A;  3JVU A;  5IHV A;  2X02 A;  5AQ9 A;  3CZD A;  1MPL A;  1DP6 A;  2GNX A;  1F9I A;  3O3V A;  1HLU P;  4QY5 A;  1UWP X;  4E6W A;  2JKT I;  2ZQA A;  1CEG A;  4QB8 A;  1F2K A;  4LFU A;  1PWC A;  2PYP A;  4R3B A;  1BYW A;  2HP6 A;  4MN6 A;  4PHT A;  2XD1 A;  2J9O A;  4ZAM A;  4E3I A;  1YLZ A;  3OPH A;  1GSV A;  3PBO A;  2O99 A;  4BBV A;  2ZM8 A;  5F5Y A;  5CX7 A;  2PR5 A;  3CHW P;  3T4Q A;  3BFD A;  3UO9 A;  4MCW A;  5F68 A;  5EPH A;  4M4X A;  4KUO A;  3ZG9 B;  4MLL A;  5A90 A;  4U0X A;  4OKP A;  4IED A;  2V20 A;  1PWG A;  1GCE A;  3Q81 A;  4LGW A;  1XFQ A;  3L9K A;  1NRJ A;  4WMC D;  3MMH A;  1KVM A;  3HRE A;  3PXP A;  5F69 A;  4OQI A;  5FQ9 A;  5J8X A;  3LFV A;  3VP0 A;  4BBT A;  5DTT A;  1CQA A;  3IXH A;  2GDN A;  4GD8 A;  2XA7 M;  3BQA A;  3CAX A;  3ZVW A;  4HBT A;  3IX3 A;  4HHD A;  2VEA A;  1YMX A;  2EX6 A;  4JF5 A;  5DF9 A;  4DMZ A;  4HBU A;  2KX6 A;  5J3W A;  5GHX A;  3IX8 A;  4E3O A;  1OTD A;  1VET A;  3A0V A;  2B02 A;  4KEN B;  4UQI S;  3HLD A;  3MS6 A;  3MJQ A;  3OLO A;  2A2L A;  2A24 A;  3NOU C;  3BFG A;  4Y0T A;  3F1P B;  3HUO A;  5FA7 A;  4EEU A;  3OPL A;  2WK0 A;  5HPI A;  2ZJ9 A;  4X69 A;  1S1Y A;  1SCW A;  3G31 A;  5DTS A;  3T4T A;  2JN7 A;  5U47 A;  3C4P A;  4BL2 A;  1MWU A;  3IF6 B;  4F3L A;  5GHY A;  1XP4 A;  1FOF A;  1BZA A;  3PYP A;  1W5D A;  5KMW A;  1K54 A;  2EFX A;  4NET A;  5FDH A;  1NLZ A;  1YSP A;  4OPY A;  1PRQ A;  3AGF A;  4QJG A;  1H8Z A;  5LBR A;  2Y2Q A;  5CXW A;  2JKR M;  1FIL A;  2AVX A;  2V8C A;  4KQO A;  5E2E A;  4OVD A;  5HPF A;  2HZ5 A;  2ZQ9 A;  4GLQ A;  1GHP A;  5GL9 A;  4DDY A;  4DXB A;  4NXG A;  3T1R A;  2ZQ8 A;  1YQS A;  2EX8 A;  2H10 A;  3ZDJ A;  3KX0 X;  4HJ4 A;  2K2N A;  3D9Y A;  3R7W B;  1TS0 A;  3RFB A;  3BYD A;  5E2G A;  4GJ4 A;  3Q82 A;  1VHM A;  1DP9 A;  3HJI A;  4YIN A;  3NC8 A;  5L09 A;  4ARZ A;  1KVL A;  3W8K A;  3LR5 A;  4GZB A;  5HL1 A;  5EVE A;  3MKE A;  4P6Z M;  1S0W A;  3EQV A;  3S7N A;  1IOU A;  2W1T B;  4LCL A;  4UHU A;  3NDE A;  5FAO A;  5FEG A;  3OZH A;  1ERM A;  4Q0H A;  1OTB A;  4YFM A;  2J3W A;  4R23 A;  4B4Z A;  1S4S A;  3SS5 A;  2DRW A;  4MBK A;  5F1G A;  2JC7 A;  3LR3 A;  2WGI A;  1IKI A;  1C3B A;  4KZ3 A;  1JTG A;  2JBF A;  3VFH A;  2HF6 A;  3SZT A;  3T1X A;  5C5K A;  2OSU A;  4R4R A;  2MJ6 A;  4GN2 A;  1P0Z A;  2XEP A;  1FSW A;  2QWS A;  2JKR I;  5L8M A;  3ZG5 A;  3IXB A;  5I94 A;  2Q9M A;  2XF3 A;  4C6Y A;  1KOU A;  2D01 A;  1XPB A;  4WLA A;  3N8R A;  3MKF A;  5KIZ A;  2GX5 A;  3O88 A;  4YOF A;  1KGF A;  4U0T A;  4XUZ A;  4KUK A;  3G6O A;  4N9L A;  4WEL A;  4KG5 A;  1JWZ A;  1W8Y A;  3UDI A;  3MZD A;  2L0W A;  1XGI A;  5F1F A;  4NG2 A;  4XXR A;  3IX4 A;  1YSQ A;  3V5M A;  3A3F A;  1S4R A;  3H82 A;  2P9V A;  2HPB A;  1MXO A;  2Y2L A;  4BD1 A;  4FH4 A;  2PRF A;  1Z09 A;  3MQ0 A;  4G3V A;  3RJU A;  3Q07 A;  1EWZ A;  3BY8 A;  3CJM A;  2ZL1 B;  1BLP A;  3WWX A;  1H8M A;  3HJK A;  5IT5 A;  1CI9 A;  1VEU A;  4I39 A;  3SW1 A;  3N8S A;  3PTE A;  4GHI B;  2Y91 A;  3C4O A;  2ZMF A;  3ITA A;  4ZDX A;  3IWQ A;  3UB6 A;  3MBZ A;  1T19 A;  1K57 C;  3IHB A;  3CUE C;  4IVK A;  4OLG A;  2ZQ7 A;  2EXB A;  2W1R A;  2O0Y A;  2L4R A;  2V0U A;  4LRY C;  3ZNT A;  2XLN A;  1E25 A;  4GKU A;  3P01 A;  2H0T A;  1VM1 A;  2WYX A;  1DRM A;  5HW3 A;  3IWO A;  3PBS A;  3D3O A;  4N1H A;  2VV7 A;  4BD0 A;  3U4L P;  2PD8 A;  4A5R A;  2OLV A;  3PHY A;  3Q7V B;  3H7W B;  3NHQ A;  1JWP A;  4PPR A;  4PM8 A;  2W27 A;  1ONG A;  3LEQ A;  4JBF A;  4BL3 A;  5HWW A;  2J80 A;  1UWN X;  4EQI A;  5HWT A;  1FIK A;  4L9F A;  1XA1 A;  3LI9 A;  3KSH A;  3LIA A;  3R4K A;  1SZV A;  1TEM A;  3G30 A;  3PAE A;  3IWI A;  1YM1 A;  3W4O A;  2QKP A;  1D1J A;  2EX2 A;  1BTL A;  3QP6 A;  2G7U A;  1LL5 A;  4Y13 A;  4B9O A;  3H9W A;  1PYY A;  3BJN A;  4P85 A;  3IHA A;  3PBR A;  4ZJ2 A;  1GSW A;  1T1C A;  1G5U A;  2EA9 A;  3BEC A;  3QP2 A;  1O07 A;  4E3J A;  3HLW A;  2B18 A;  1XFN A;  1GSX A;  1G6A A;  2OOL A;  5EM1 A;  1D06 A;  2XH9 A;  1BSG A;  3EEH A;  1HVB A;  4P6B A;  4B88 A;  4Y5F A;  1OTI A;  2PU4 A;  2YKF A;  3IQA A;  5TBM A;  4GNU A;  1K56 A;  1SKO A;  2ZBB A;  2XQZ A;  1AWI A;  2W3H A;  4X56 A;  4II7 A;  4I3J A;  2J3T C;  2EWV A;  5CGX A;  3VSK A;  1S67 L;  4N1X A;  4XT2 B;  2EWW A;  3LUQ A;  3F1O A;  1G6O A;  5DJT A;  4JLF A;  1AXB A;  2FFF B;  2W3D A;  5EE8 A;  1P9W A;  2Y79 A;  4U3T A;  2ZMA A;  2QMI A;  1MWR A;  1N9N A;  3SH7 A;  1O7E A;  5FAS A;  2WAF A;  1UGU A;  1PWD A;  2ZC3 B;  3GMW A;  3O5Y A;  2X01 A;  4BMW A;  2EX9 A;  3G34 A;  3CIT A;  4E3K A;  2XDM A;  3VP4 A;  1JWV A;  3EEA A;  3UB8 A;  2Y2I A;  1P9R A;  3NY4 A;  1RGZ A;  4KZ4 A;  3UB7 A;  2B95 A;  3GSG A;  1YLW A;  2RL3 A;  1K57 A;  2WGW B;  1XJ2 A;  3CUE A;  1JNU A;  1DJB A;  2VGL S;  4WMC A;  1TDG A;  2HJE A;  4KQQ A;  1OJG A;  2RCX A;  4RA7 A;  2VGJ A;  3SH9 A;  3IT9 A;  2YKH A;  3WS1 A;  1TD5 A;  3W4P A;  1H0M A;  4UQI M;  2WZX A;  1KDS A;  1K56 D;  4HI4 A;  3IF5 A;  2J8Y A;  5FI2 A;  3S7P A;  4LPZ A;  4DE0 A;  3CPT B;  2Y2K A;  5DKK A;  4CLC B;  1EW0 A;  2P74 A;  4MDZ A;  4BQM A;  4IUK A;  4PKY G;  3ZG0 A;  5DJU A;  1GHM A;  5FEF A;  4EW7 A;  4G3W A;  3A3E A;  3EQU A;  3LI8 A;  3BW6 A;  1QMF A;  3BEB A;  4WUJ A;  1BUE A;  1VB6 A;  3WS0 A;  3GDI A;  2Q0O A;  2D02 A;  1ES5 A;  3MXR A;  3V3R A;  4OH0 A;  4X6T A;  3BRM A;  1FCO A;  1KE4 A;  5DFY A;  3K3D A;  2W3E A;  3C5A A;  1IEL A;  3GVB A;  3LY3 A;  3QP1 A;  3B3X A;  3T1Q B;  3LR4 A;  1ZHH B;  2M7V A;  3CG5 A;  2FZ0 A;  2OAQ 1;  4DE3 A;  4L9G A;  1HZO A;  2QPN A;  2P04 A;  1ES3 A;  2BG1 A;  3F1N B;  2WUQ A;  4EUZ A;  3T50 A;  4JKT A;  1MWS A;  3MZF A;  1XJ3 A;  4UA9 A;  3HUM A;  4L0L A;  3WRZ A;  3LEZ A;  5BOH A;  2OWH A;  2ZOI A;  2K31 A;  2B5R A;  1I2S A;  3VMA A;  2E8J A;  1VQQ A;  1CEF A;  3N8L A;  2IWB A;  1ZG6 A;  1LL9 A;  2V1B A;  1STZ A;  3B42 A;  2P7J A;  1H8Y A;  4FTX A;  3VP2 A;  3KSF A;  4ESP A;  1KGG A;  2Y2N A;  1BUL A;  4S2K A;  3CLO A;  4JXW A;  4I3A A;  1RGY A;  4Q0J A;  3C2W A;  1PNE A;  1LI9 A;  4Z9Q A;  5FQJ A;  3T12 B;  1A0K A;  1OTE A;  4PKY A;  3BM6 A;  3HLG A;  1U60 A;  1WYC A;  2ZM2 A;  1ONH A;  4MN7 A;  5HL6 A;  5M18 A;  2C5W B;  2O9A A;  4G3K A;  1YT4 A;  5FQI A;  4PAU A;  1E3U A;  4JXG A;  5L2F A;  1OJ5 A;  5E2F A;  1SDE A;  5DF7 A;  2W0N A;  5HD3 A;  5HX9 A;  2QJ7 A;  5CEC A;  4ZJ1 A;  3V3S A;  3A3I A;  2XR0 A;  3BLM A;  4NKP A;  2Y59 A;  4GD6 A;  4FH2 A;  2V8F A;  2IWC A;  3UE6 A;  4WF0 A;  1YKD A;  2DMW A;  4HY8 A;  3UDX A;  1FR1 A;  3IS2 A;  5TJJ A;  4IJG A;  4RVA A;  1W7F A;  4H8R A;  1K6S A;  1MY8 A;  3NJA A;  4BEN A;  5AQ7 A;  1QME A;  4KQD A;  2J3T D;  1DY6 A;  4X68 A;  4HQA A;  4R1G A;  1W63 Q;  3A3D A;  3CWF A;  4BWI A;  2V0W A;  5AVF A;  4JF6 A;  4MBF A;  3T4K A;  1E4D A;  4FUW A;  2C6W B;  5FL3 A;  4HEF A;  4EU0 A;  1LHY A;  1NZU A;  2V1Z A;  4S2O A;  2V9A A;  5CED A;  3O86 A;  3IF6 C;  1Y28 A;  2XFS A;  1G28 A;  3UE3 A;  1Y54 A;  3E2L A;  3EWK A;  4R6L A;  1GA0 A;  3NOP C;  3W4Q A;  1I2W A;  2H5S A;  4PM5 A;  1RCJ A;  3O87 A;  4BBU A;  2LB9 A;  2ZC7 A;  2HP5 A;  3B47 A;  4QY6 A;  4GS9 B;  2H0Y A;  2VJW A;  2PU2 A;  4S2P A;  4IHQ A;  4DJ3 A;  4WZ5 C;  4I3I A;  3G2Z A;  3BLS A;  4LLO B;  5G18 A;  4DDS A;  2VX8 A;  5KSH A;  1K55 C;  4X53 A;  3RTY A;  5FSR A;  3GRJ A;  1E3U D;  3C8C A;  3K3C A;  5HZH A;  1IYP A;  4BLM A;  4JPM A;  2ZQD A;  1I5Q A;  3TSG A;  4DRT A;  2JKF A;  4WYY A;  4B4X A;  3NI9 A;  5HSQ A;  1ALQ A;  5CHU A;  5G4Y A;  4NEE D;  5J7E A;  3WS5 A;  2UV0 E;  4PM6 A;  3V67 A;  5DF8 A;  2KOI A;  1F5M A;  4K91 A;  4ETX A;  2FFY A;  3BFE A;  2H28 A;  3QHY A;  3VP3 A;  4WZ4 A;  2I9V A;  3ZNY A;  3S4X A;  2PR6 A;  4GCZ A;  3VOY A;  4EQ1 A;  1OME A;  3G2Y A;  1TS6 A;  5L07 A;  5HDC A;  4H6J B;  1H5X A;  5FI6 A;  1S1Z A;  1TS8 A;  3UB5 P;  2VV8 A;  1N9L A;  3FKV A;  4O01 A;  3TJZ C;  3LYX A;  4PM7 A;  5EOO A;  5M19 A;  2OLU A;  2J9P A;  3KO6 A;  2PT7 A;  2WKI A;  5CTN A;  4Y15 A;  1NLY A;  2KDK A;  2Y2H A;  2ZMV A;  2OV5 A;  5AQB A;  4Y3I A;  4JXV A;  4LRX C;  3IXG A;  3G4P A;  3NUL A;  2EXA A;  2LB5 A;  1LSW A;  2JE5 A;  2O9C A;  4X1M A;  4GDB A;  4Q8I A;  2IWD A;  3BWL A;  1M6K A;  4LV2 A;  4E6X A;  4X55 A;  4ZJ3 A;  1XA7 A;  3OC2 A;  3P7N A;  2ZM0 A;  5FQQ A;  4R3J A;  1BLH A;  3UN7 A;  3DTK A;  4YNR A;  4JF4 A;  1MKI A;  3AGE A;  4JXS A;  1OT6 A;  4KZ9 A;  4R3A A;  3E2K A;  1WA9 A;  1FCN A;  4S2N C;  5DKL A;  3M2J A;  4KZ5 A;  4GDN A;  3GR2 A;  3GTC A;  3F1P A;  2VZW A;  4Q0I A;  3ZYT A;  2A3U A;  4OPR A;  1DJA A;  3HUN A;  3ULF A;  1M40 A;  2XFT A;  3VSL A;  4Y0U A;  4Y0O A;  1TDL A;  3BQ8 A;  3IF6 A;  2VGL M;  2P08 A;  5CER A;  1KE0 A;  1OTA A;  5GLA A;  4E3L A;  1L0G A;  1N9B A;  5CGS A;  3MFX A;  3N4I A;  3LIF A;  3HLC A;  1VET B;  5AVE A;  3LIE A;  4HIA A;  1L3L A;  5FAP A;  2PDR A;  3OBF A;  5A93 A;  3EGD C;  2A24 B;  3JVV A;  2BLS A;  3PAG A;  1WE4 A;  5E43 A;  2WKQ A;  4B93 A;  5A92 A;  4WZ5 A;  5KSC A;  4OP8 A;  4R0Q A;  3LIB A;  3CMZ A;  1K55 A;  1V9Y A;  4ID4 A;  3EGX C;  5HD5 A;  1PZP A;  4CPK A;  3HLB A;  3VV4 A;  4NK3 A;  4F3L B;  3BFF A;  5F6A A;  1D7E A;  5EVL A;  4OOM A;  3D4F A;  1J9M A;  4E3M A;  1ACF A;  3NIA A;  3A3J A;  3R7W A;  2FH5 A;  2PD7 A;  5HDD A;  1CJF A;  2J7V A;  3LIC A;  1IEM A;  3IH8 A;  4JGP A;  5HWV A;  2K7S A;  3NBL A;  3ITB A;  5KZH A;  1T1B A;  1XKZ A;  4LV1 A;  5FDS A;  3SS4 A;  4O8G A;  1XX2 A;  2W1T A;  2KLI A;  3NCK A;  2WKP A;  4KZ8 A;  4OQG A;  2VLG A;  2Y4A A;  4NXE A;  3HLE A;  5DVA A;  1W79 A;  2ZC5 B;  2HDU A;  4GOG A;  3T1S A;  5AQA A;  5EUA A;  4ARZ B;  4S2J A;  1HTZ A;  3DTM A;  4QHC A;  5HAR A;  4EES A;  5DFX A;  3A0S A;  5EV0 A;  2IA2 A;  5JYP A;  2Y2G A;  4CQH A;  3T4O A;  2ZC4 B;  3TRC A;  4X25 A;  4UA6 A;  3RH8 B;  3UDF A;  5GLD A;  2CMN A;  1ZG4 A;  1IKG A;  1G68 A;  1FSY A;  2OWJ A;  1PW1 A;  4EBN A;  5TR7 A;  2G2W A;  1LT0 A;  1ODV A;  4MNR A;  3ZGA B;  4OP5 A;  5F82 A;  2PHY A;  4EWF A;  4S2N A;  2OAP 1;  2V1A A;  1BT5 A;  4C3Q A;  1YPR A;  5CHJ A;  1HD8 A;  3DTI A;  3GV9 A;  1IYO A;  4LRZ E;  5CTM A;  2PYR A;  4QU3 A;  1ZTU A;  2WKH A;  2Q9N A;  1XGJ A;  3C7V A;  3ZVT A;  3S22 A;  4FCF A;  4NXB A;  5EM0 A;  2ZL1 A;  3G35 A;  1KGE A;  1GA9 A;  3CI6 A;  4GHI A;  3UE0 A;  4HH2 A;  1L2S A;  5IU1 A;  2ZOH A;  3UE1 A;  3JPU A;  3ICY A;  2ZLY A;  3H82 B;  2P9V B;  3MZE A;  3OOV A;  4WN5 A;  4EUV A;  4UA7 A;  2M7U A;  1RP5 A;  3IXD A;  4KQR A;  3FC7 A;  1NWZ A;  4CLC E;  5J4E A;  4BJP A;  3HVF A;  1PI5 A;  3SS3 A;  3VFF A;  5CEB A;  3MFD A;  3T4L A;  1BLC A;  3UMD A;  1VEU B;  3Q7V A;  3H7W A;  3UME A;  4N92 A;  4D2O A;  4P0M A;  4OQH A;  1S6R A;  2L1M A;  2XD5 A;  2Y55 A;  4CLC C;  3WRT A;  4GW9 A;  3VE4 A;  5FAQ A;  4L9E A;  2HDS A;  4IVI A;  3W2Z A;  1Z6F A;  4AFI A;  5IS1 A;  4OLD A;  2GJ3 A;  5CGW A;  4K08 A;  5TFQ A;  5F83 A;  1L0D A;  3GQZ A;  5HAQ A;  3SOI A;  3UPN A;  4OOL A;  3EOI A;  5DTK A;  3MF0 A;  2ACG A;  1XXM A;  4WEJ A;  5AJG A;  4KZ7 A;  1L0E A;  1ES4 A;  5CHM A;  3UY6 A;  3ISG A;  1K38 A;  4WBG A;  3QP5 A;  4DF6 A;  2PBD P;  2M1C A;  3S7Q A;  4KG6 A;  2VKS A;  1N9O A;  1WYB A;  3MQO A;  1MC0 A;  1FCM A;  2QYB A;  4DE2 A;  4HJ3 A;  1YLY A;  4C75 A;  2WKE A;  4WEK A;  4LV0 A;  2WGV A;  4UEY A;  4RX3 A;  4MN5 A;  4DJ2 A;  3TOI A;  4MBH A;  5G4Z A;  4JGR A;  2Z6D A;  2QHK A;  3WS2 A;  3ZFZ A;  1ZC2 A;  4XT2 A;  5K5B A;  1IYQ A;  3IBR A;  3RXW A;  1LSX A;  1FQG A;  3HBR A;  3DBA A;  3LCE A;  2DNS A;  4Y2F A;  2PBY A;  3KYE A;  4FD8 A;  3DAV A;  3MQQ A;  1YMS A;  3VP1 A;  1T18 A;  3FKW A;  5TBM B;  3M2K A;  5EVI B;  1SKO B;  1NY0 A;  3D72 A;  4HNB A;  5FQK A;  1PZO A;  3OCL A;  1CI8 A;  1K4F A;  4PMA A;  1SKF A;  3GEC A;  3FZC A;  2HDQ A;  3E4Q A;  4N9K A;  4HOI A;  3U2A A;  5FQM A;  3F1O B;  2VA0 A;  4RQ9 A;  4EV4 A;  1JTD A;  4F94 A;  3K2N A;  3LO7 A;  2ZQC A;  2XA7 S;  2A49 A;  4IBR A;  2WGW A;  4X1L A;  3MXS A;  4I5S A; 
#chains in the Genus database with same CATH homology
 4E3K A;  2CC1 A;  4JF4 A;  3QNC A;  3HRE A;  2XDM A;  1MWT A;  1MKI A;  3AGE A;  2Y2J A;  4HES A;  4JXS A;  4KZ9 A;  1JWV A;  4OQI A;  3E2K A;  5FQ9 A;  3VP4 A;  5J8X A;  3VP0 A;  2Y2I A;  5DTT A;  3NY4 A;  3IXH A;  1FCN A;  4S2N C;  1ESU A;  1NRF A;  1RGZ A;  2GDN A;  4GD8 A;  3M2J A;  4KZ4 A;  4KZ5 A;  1Q2P A;  4GDN A;  4HBT A;  3ZVW A;  3M6H A;  3GR2 A;  5EEC A;  5D3O A;  1YMX A;  2EX6 A;  3GSG A;  4JF5 A;  1YLW A;  5DF9 A;  3GTC A;  4HBU A;  5HFO A;  2RL3 A;  1K57 A;  2WGW B;  2A3U A;  4OPR A;  1DJB A;  5GHX A;  4WMC A;  1DJA A;  3HUN A;  4KG2 A;  4E3O A;  4M3K A;  1M40 A;  4KEN B;  1NXY A;  1TDG A;  4KQQ A;  2XFT A;  3VSL A;  4Y0U A;  2RCX A;  3HLD A;  3ZCZ A;  4Y0O A;  4RA7 A;  4OPZ A;  3FWL A;  2VGJ A;  2ZC6 B;  3SH9 A;  1TDL A;  3BFG A;  3IF6 A;  3IT9 A;  4RYE A;  3WS1 A;  4Y0T A;  5CER A;  1KE0 A;  5GLA A;  3W4P A;  4E3L A;  4DE1 A;  1L0G A;  1GHI A;  1N9B A;  2WZX A;  5CGS A;  3N4I A;  3HUO A;  1DJC A;  4FSF A;  2VGK A;  3HLC A;  5FA7 A;  5EVI C;  2QZ6 A;  1KDS A;  1K4E A;  3OPL A;  1K56 D;  1ZKJ A;  2WK0 A;  2ZJ9 A;  4X69 A;  5FAP A;  1SCW A;  3G31 A;  3IF5 A;  5DTS A;  1YLT A;  2J8Y A;  5FI2 A;  4DE0 A;  5HAI A;  5A93 A;  1K6R A;  2BLS A;  2I72 A;  1WE4 A;  3PAG A;  3C4P A;  5E43 A;  2Y2K A;  5U47 A;  4BL2 A;  1MWU A;  3IF6 B;  5A92 A;  4WZ5 A;  2V2F F;  5GHY A;  1XP4 A;  2P74 A;  4OP8 A;  4BQM A;  1FOF A;  1BZA A;  5KSC A;  4R0Q A;  4WM9 A;  5KMW A;  1W5D A;  3CMZ A;  1K54 A;  1K55 A;  2EFX A;  4IBX A;  3ZG0 A;  4NET A;  4ID4 A;  1GHM A;  3ZHH A;  5FDH A;  2XGN A;  3A3E A;  3EQU A;  4OON A;  4XUX A;  1PZP A;  4CPK A;  4OPY A;  1QMF A;  3HLB A;  3BEB A;  4S2I A;  3AGF A;  4NK3 A;  5FAT A;  4QJG A;  1BUE A;  1SHV A;  2EFU A;  3WS0 A;  1H8Z A;  3N7W A;  3BFF A;  2Y2Q A;  5CXW A;  1FR6 A;  3Q7Z A;  5EVL A;  4OOM A;  4EBL A;  4LCM A;  3D4F A;  1J9M A;  1ES5 A;  1ESI A;  4KQO A;  3MXR A;  5E2E A;  1PW8 A;  3V3R A;  4E3M A;  4OVD A;  1MBL A;  3NIA A;  3A3J A;  4OH0 A;  4X6T A;  3BRM A;  3FYZ A;  1FCO A;  2ZQ9 A;  3M6B A;  1KE4 A;  2J7V A;  1GHP A;  1ES2 A;  5GL9 A;  3C5A A;  4DDY A;  1IEM A;  1BLS A;  4DXB A;  1NZO A;  3IH8 A;  1IEL A;  1CK3 A;  2ZQ8 A;  3GVB A;  3BFC A;  3LY3 A;  1YLJ A;  1YQS A;  2EX8 A;  2H10 A;  3ZDJ A;  3B3X A;  2Y2P A;  3NBL A;  2ZD8 A;  4KZ6 A;  3ITB A;  5KZH A;  1XKZ A;  3CG5 A;  4LV1 A;  3SS4 A;  3OCN A;  1PI4 A;  3SH8 A;  1XX2 A;  3BYD A;  1KDW A;  5E2G A;  4DE3 A;  1HZO A;  2WAE A;  2QPN A;  3Q82 A;  4YIN A;  3NCK A;  3NC8 A;  4OPQ A;  2HDR A;  1ES3 A;  2BG1 A;  1KVL A;  3W8K A;  2WUQ A;  4KZ8 A;  4GZB A;  5HL1 A;  4EUZ A;  4OQG A;  1ERO A;  3V50 A;  3MKE A;  2Y4A A;  1S0W A;  4JKT A;  1MWS A;  3EQV A;  4P87 A;  3MZF A;  1PIO A;  1K25 A;  3HLE A;  5DVA A;  4UA9 A;  1W79 A;  2ZC5 B;  4LCL A;  4UHU A;  2HDU A;  3NDE A;  4GOG A;  1KE3 A;  3HUM A;  4L0L A;  3WRZ A;  3ZG8 B;  3LEZ A;  5FAO A;  5BOH A;  5AQA A;  3OZH A;  5EUA A;  1ERM A;  3AGD A;  2B5R A;  1I2S A;  3VMA A;  1VQQ A;  1CEF A;  3N8L A;  4S2J A;  4YFM A;  1HTZ A;  3DTM A;  4QHC A;  5HAR A;  2IWB A;  4R23 A;  5M1A A;  4B4Z A;  1ZG6 A;  3V39 A;  3SS5 A;  1LL9 A;  2DRW A;  4KZB A;  5JYP A;  2Y2G A;  4MBK A;  5F1G A;  2JC7 A;  2ZC4 B;  1EI5 A;  1H8Y A;  2WGI A;  1IKI A;  1N4O A;  1LI0 A;  3VP2 A;  4EWF A;  1C3B A;  4KZ3 A;  4UA6 A;  1JTG A;  2JCH A;  1NYY A;  3PBN A;  3UDF A;  5GLD A;  2JBF A;  2UWX A;  3VFH A;  1KGG A;  2Y2N A;  1BUL A;  4S2K A;  1ZG4 A;  1IKG A;  4JXW A;  1G68 A;  2OSU A;  2Y2O A;  4R4R A;  1FSY A;  1RGY A;  1PW1 A;  4EBN A;  4GN2 A;  1LI9 A;  4Z9Q A;  2XEP A;  4CJN A;  1YLP A;  5FQJ A;  5TR7 A;  4Y7P A;  1NJ4 A;  4S2M A;  1FSW A;  3HL9 A;  2G2W A;  3ZG5 A;  1SDN A;  4MNR A;  3ZGA B;  3VOZ A;  3IXB A;  4OP5 A;  2Q9M A;  3BM6 A;  3HLG A;  2XF3 A;  5I94 A;  4C6Y A;  5F82 A;  1XPB A;  1U60 A;  1WYC A;  2X71 A;  2ZM2 A;  3MKF A;  3N8R A;  3O88 A;  1BT5 A;  4QD4 A;  1ONH A;  4S2N A;  1KGF A;  4U0T A;  4C3Q A;  3LY4 A;  5CHJ A;  2C5W B;  1HD8 A;  4K0X A;  4XUZ A;  5M18 A;  3GV9 A;  4N9L A;  1IYO A;  4WEL A;  5CTM A;  4KG5 A;  4QU3 A;  1JWZ A;  1W8Y A;  3PBT A;  3UDI A;  4DKI A;  1YT4 A;  5FQI A;  5A91 A;  3MZD A;  3P09 A;  2WKH A;  2Q9N A;  1E3U A;  1XGJ A;  3C7U A;  4JXG A;  3UPO A;  1XGI A;  3N6I A;  3C7V A;  3ZVT A;  5F1F A;  5GHZ A;  3WS4 A;  3S22 A;  3JYI A;  4FCF A;  4XXR A;  5L2F A;  2XK1 A;  4S2L A;  3G35 A;  1L0F A;  5E2F A;  1SDE A;  5DF7 A;  3A3F A;  3V5M A;  1KGE A;  5HX9 A;  4E3N A;  5CEC A;  4K0W A;  4ZJ1 A;  3V3S A;  1GA9 A;  3A3I A;  2XR0 A;  3BLM A;  4KZA A;  2Y59 A;  2P9V A;  3UNW A;  4GD6 A;  4FH2 A;  2HPB A;  2IWC A;  3NDG A;  1MXO A;  3UE0 A;  2Y2L A;  4BD1 A;  4FH4 A;  5FI7 A;  3QNB A;  3UDX A;  1L2S A;  3RJU A;  1FR1 A;  3Q07 A;  1EWZ A;  5EVI A;  3Q1F A;  4RVA A;  1W7F A;  3CJM A;  4H8R A;  1K6S A;  1MY8 A;  2HP9 A;  5HAP A;  1BLP A;  3WWX A;  4BEN A;  3UE1 A;  4UAA A;  2ZLY A;  1QME A;  5AQ7 A;  4ZBE A;  1CI9 A;  2P9V B;  3MZE A;  1ERQ A;  1DY6 A;  3N8S A;  3PTE A;  4EBP A;  4UA7 A;  4X68 A;  1RP5 A;  3IXD A;  4GB7 A;  2Y91 A;  2R9X A;  4KQR A;  4R1G A;  3C4O A;  3ITA A;  3A3D A;  4BJP A;  3HVF A;  1PI5 A;  3OPR A;  3SS3 A;  3IWQ A;  3G32 A;  3PBQ A;  2Z2L B;  3DWZ A;  4ZTK A;  3VFF A;  4ZDX A;  3MBZ A;  5CEB A;  3MFD A;  1K57 C;  3IHB A;  4JF6 A;  4MBF A;  4IVK A;  1BLC A;  4OLG A;  1E4D A;  2EXB A;  2ZQ7 A;  2C6W B;  1IYS A;  2Z2M B;  4HEF A;  3Q7V A;  4N92 A;  1LHY A;  1NZU A;  2V1Z A;  4S2O A;  3ZNT A;  2XLN A;  1E25 A;  5JYO A;  3UPP A;  3RXX A;  4D2O A;  4P0M A;  4GKU A;  4OQH A;  2H0T A;  1S6R A;  1VM1 A;  2WYX A;  4PM9 A;  1NYM A;  2XD5 A;  5CRF A;  5CED A;  5HW3 A;  2Y2M A;  3IWO A;  3O86 A;  2Y55 A;  3PBS A;  3IF6 C;  4O7D A;  2XFS A;  3DWK A;  4N1H A;  1W8Q A;  3UE3 A;  3HLF A;  3WRT A;  1Y54 A;  3DW0 A;  3E2L A;  1GA0 A;  4BD0 A;  5FAQ A;  1TVF A;  3W4Q A;  1I2W A;  2H5S A;  4A5R A;  4PM5 A;  2OLV A;  2HDS A;  1RCJ A;  3IH9 A;  3O87 A;  4OQ0 A;  4IVI A;  4DXC A;  3OPP A;  1Z6F A;  3Q7V B;  2ZC7 A;  3I7J A;  4OLD A;  1JWP A;  4PPR A;  5CGW A;  2HP5 A;  4PM8 A;  4QY6 A;  5TFQ A;  4R4S A;  2H0Y A;  5F83 A;  1L0D A;  2PU2 A;  4S2P A;  1ONG A;  3GQZ A;  5TGF A;  4WZ5 C;  5HAQ A;  3SOI A;  4JBF A;  3UPN A;  4BL3 A;  3G2Z A;  4OOL A;  3FV7 A;  4MEZ A;  3BLS A;  4EQI A;  5GLC A;  5G18 A;  4DDS A;  1K54 C;  5KSH A;  1K55 C;  5DTK A;  1XA1 A;  4X53 A;  2G2U A;  5FSR A;  3GRJ A;  1XXM A;  4WEJ A;  1E3U D;  4KZ7 A;  1IYP A;  4BLM A;  4JPM A;  2ZQD A;  1I5Q A;  3TSG A;  4DRT A;  1TEM A;  3G30 A;  2DCF A;  3PAE A;  3S1Y A;  3IWI A;  1YM1 A;  3W4O A;  1L0E A;  2EX2 A;  1ES4 A;  3NI9 A;  1BTL A;  4WYY A;  4B4X A;  5CHM A;  1LL5 A;  3UY6 A;  3ISG A;  1K38 A;  1LLB A;  1ALQ A;  4WBG A;  5CHU A;  1PYY A;  3P98 A;  4DF6 A;  5E2H A;  3WS5 A;  4P85 A;  3IHA A;  4KG6 A;  2E8I A;  3PBR A;  4PM6 A;  3ZG7 B;  1WYB A;  4LEN A;  4ZJ2 A;  3TG9 A;  1FCM A;  4OOY A;  5EOE A;  5EVI D;  4DE2 A;  2WZZ A;  5DF8 A;  4RX2 A;  3BEC A;  1YLY A;  2R9W A;  5GLB A;  4C75 A;  1O07 A;  1Q2Q A;  2WAD A;  1JVJ A;  2WKE A;  3HLW A;  4K91 A;  4LV3 A;  4WEK A;  4E3J A;  4LV0 A;  2FFY A;  3BFE A;  3QHY A;  2WGV A;  3VP3 A;  5IHV A;  2X02 A;  5AQ9 A;  1G6A A;  4WZ4 A;  3CZD A;  1MPL A;  2XH9 A;  4RX3 A;  1BSG A;  3TOI A;  4MBH A;  3ZNY A;  1HVB A;  4P6B A;  3O3V A;  4B88 A;  3S4X A;  4QY5 A;  3VOY A;  4E6W A;  2ZQA A;  2PU4 A;  3WS2 A;  3ZFZ A;  1CEG A;  3IQA A;  1OME A;  1ZC2 A;  4GNU A;  4QB8 A;  3G2Y A;  1IYQ A;  1K56 A;  3RXW A;  1FQG A;  1PWC A;  1H5X A;  3HBR A;  5FI6 A;  3LCE A;  2XQZ A;  4R3B A;  2HP6 A;  2DNS A;  4X56 A;  2PBY A;  2XD1 A;  3FKV A;  2J9O A;  4FD8 A;  4ZAM A;  4E3I A;  1YLZ A;  3OPH A;  4PM7 A;  5CGX A;  5EOO A;  5M19 A;  1YMS A;  3PBO A;  3VSK A;  2OLU A;  3VP1 A;  3FKW A;  2J9P A;  4N1X A;  2ZM8 A;  2WKI A;  5CTN A;  3M2K A;  5EVI B;  2Y2H A;  1NY0 A;  3BFD A;  3UO9 A;  2OV5 A;  4JLF A;  1AXB A;  2FFF B;  5AQB A;  4JXV A;  5EPH A;  5FQK A;  1PZO A;  3IXG A;  5EE8 A;  3OCL A;  3G4P A;  1CI8 A;  4U3T A;  1K4F A;  4PMA A;  2ZMA A;  1SKF A;  2QMI A;  3FZC A;  3ZG9 B;  2EXA A;  2HDQ A;  1MWR A;  2JE5 A;  4MLL A;  3SH7 A;  1O7E A;  5A90 A;  4N9K A;  4OKP A;  4U0X A;  5FAS A;  2WAF A;  5FQM A;  4IED A;  2V20 A;  4GDB A;  1PWD A;  4Q8I A;  4EV4 A;  1JTD A;  2ZC3 B;  4F94 A;  3GMW A;  1PWG A;  2IWD A;  4LV2 A;  1M6K A;  2X01 A;  4E6X A;  3LO7 A;  2ZQC A;  2EX9 A;  4X55 A;  4ZJ3 A;  1GCE A;  1XA7 A;  3OC2 A;  3Q81 A;  3G34 A;  2A49 A;  2ZM0 A;  4IBR A;  5FQQ A;  2WGW A;  4R3J A;  4WMC D;  1BLH A;  1KVM A;  3MXS A;  3UN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...