1DJAA

Structure of beta-lactamase precursor, k73h mutant, at 298k
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
258
structure length
258
Chain Sequence
MKELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSHAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and kinetics of the beta-lactamase mutants S70A and K73H from Staphylococcus aureus PC1.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
total genus 93
structure length 258
sequence length 258
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1996-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1djaA00
2A49A 2XGNA 3DTMA 4KG2A 2J7VA 3GR2A 3V50A 4WMCA 3VP4A 4OQ0A 1BLCA 4LV0A 4WBGA 1K57C 1L0EA 3HLBA 2G2UA 4GB7A 4PM6A 5HAQA 3MZEA 1NZUA 1VQQA 2XQZA 2PU4A 3IXGA 2J9OA 4N1XA 3HUOA 5CTMA 1PYYA 3BYDA 4LENA 4MBHA 3ZVWA 4E6WA 5DF8A 5F83A 4E3OA 2H0TA 5GL9A 1S0WA 2DNSA 5FI7A 3W4PA 4N9LA 3VFHA 1KE3A 3IWOA 4R4SA 3HREA 1E25A 2EXAA 5EE8A 3ZDJA 4DE2A 4YFMA 4KG5A 3M2JA 4PPRA 4BL3A 2WAFA 4LCMA 2GDNA 1FR6A 5HFOA 2H5SA 3V5MA 5BOHA 1DJBA 3DW0A 3ITAA 2Y2PA 3IWQA 5M18A 3IWIA 5E43A 5GHYA 1GHIA 1Q2QA 1KGGA 5AQ7A 5KSHA 3BECA 1EROA 2XH9A 3OCNA 5HX9A 2H10A 4JXSA 1QMEA 4HBUA 3UN7A 3BFGA 4R1GA 5HW3A 1J9MA 5EECA 2Y2IA 3GRJA 3OPPA 2Q9NA 4ZBEA 1NJ4A 4PMAA 1BSGA 2VGJA 2RL3A 3G32A 3WS5A 4KZ7A 3G2YA 1FR1A 1BUEA 1BULA 1ZC2A 2JBFA 1IELA 5FQJA 4UHUA 5FI2A 1K38A 4WYYA 2Y2MA 5FQIA 4KZ9A 4A5RA 3FKVA 3IF5A 4DXCA 3UE0A 4FD8A 3M2KA 3VSKA 1BLPA 2WADA 1M40A 3BFFA 4Y7PA 3ZGAB 1LI9A 1PW8A 1FCOA 3V3SA 3SH7A 3N8LA 4C75A 5F82A 5FSRA 3P09A 4E6XA 3SS4A 2Y2QA 3MKEA 3ZNTA 3BFCA 4Q8IA 1HZOA 3VSLA 1DY6A 2BLSA 3G30A 3NCKA 1ONHA 4MBKA 4KQOA 4JXWA 4QHCA 3BLMA 4GZBA 4S2OA 1ZKJA 3O86A 3C5AA 2WGWB 3SOIA 3OPRA 3TG9A 2Y2KA 1ALQA 1KDWA 1DJCA 4ZJ2A 4DDYA 4HESA 1H8ZA 1YLJA 1RP5A 1YLPA 3OPLA 3HLGA 1K25A 2Y59A 2V2FF 4U0TA 3ZG7B 2Y4AA 5KSCA 5E2EA 1MKIA 3PBSA 1YLZA 1PWGA 4WZ5C 4Y0TA 4FCFA 1GHPA 3AGFA 2XR0A 5DF9A 1JWZA 4KZ6A 3VOZA 4E3IA 4EUZA 1BLHA 1E3UD 4KZBA 3Q07A 3RXXA 2R9XA 3OPHA 4DXBA 4GDBA 1O7EA 4UA6A 5U47A 2H0YA 4OP5A 2IWDA 5GHZA 1FOFA 1XGJA 4ID4A 4X56A 1L0FA 1KGEA 1PZPA 1XA1A 1OMEA 4OOLA 5M1AA 1K57A 1PW1A 3ZG0A 1PI4A 3WS2A 2Z2MB 5CHJA 1PIOA 3IT9A 3FZCA 4M3KA 1BLSA 1KVLA 3UPPA 1KDSA 3VMAA 3NIAA 2Y2HA 5FAPA 1H8YA 1XGIA 4EBLA 1ES2A 1XP4A 5FATA 2WYXA 1I2WA 4D2OA 1E4DA 3AGDA 2WGVA 1I5QA 4PM9A 5CECA 5FQMA 4H8RA 2XLNA 5TR7A 3UDXA 4OVDA 5AQAA 3UNWA 3GTCA 2XDMA 2V1ZA 2VGKA 3GMWA 3IXHA 1W8QA 1ESIA 4QY5A 3OCLA 5EVIB 4CJNA 2WKHA 3BRMA 1WE4A 4OH0A 4QB8A 3Q7VB 4X53A 4YINA 1KE4A 2Y2NA 3O87A 4L0LA 4U0XA 1XXMA 1W5DA 3FYZA 1MY8A 5FQ9A 5E2FA 2HP5A 4NETA 1TVFA 3S1YA 4S2NA 1JVJA 4N9KA 4F94A 1ES5A 4GD8A 4X6TA 2HDRA 2OLVA 3M6HA 4GD6A 4P6BA 1K6RA 1MWSA 1FCMA 2Y2LA 4S2LA 2BG1A 5CEDA 2J8YA 2ZQCA 3N7WA 4QU3A 2OLUA 4KZAA 1NYYA 4BLMA 4BL2A 4P85A 3S4XA 3JYIA 1RGYA 1GHMA 1YLWA 1S6RA 2I72A 4LV1A 1JWVA 3NI9A 5EVLA 3ZNYA 3HLFA 1Q2PA 3PBOA 4KQRA 4JPMA 4LV2A 1HTZA 1FQGA 1VM1A 1LL9A 1Y54A 5CRFA 2WZXA 2C6WB 5FQKA 4CPKA 1FSWA 3HUNA 3E2LA 3ITBA 1YMSA 2JE5A 5GLDA 2EX6A 3Q1FA 2QZ6A 3GSGA 4BJPA 2JCHA 4B88A 1I2SA 4DRTA 1HVBA 1TEMA 4GKUA 3W4QA 4DE3A 5M19A 4OKPA 4JXGA 1MBLA 3B3XA 5A93A 3W4OA 3C7UA 4OP8A 4E3LA 3WS0A 3A3EA 2IWBA 3SS5A 2G2WA 1NZOA 4S2NC 1WYCA 3LEZA 4EQIA 2ZQDA 3UE3A 5CGSA 5GLBA 2DCFA 4Z9QA 5GHXA 2HDSA 4WZ4A 3ZG8B 2WK0A 3VP3A 4JF4A 1GA9A 4C6YA 1SCWA 4IBRA 2ZQAA 1MXOA 4OOMA 3IF6A 1LLBA 1N4OA 2XD5A 5F1GA 2JC7A 3IH8A 3QNBA 4KENB 2XD1A 1L0DA 1EI5A 1K56A 2ZC5B 2FFYA 2ZLYA 3ZCZA 4JF6A 4QD4A 1ES3A 3NY4A 5CXWA 3DWKA 3N8RA 4B4XA 1RCJA 3ISGA 2ZC7A 1K4EA 2HDQA 3E2KA 4KZ8A 4PM8A 3UY6A 4GDNA 4QY6A 5TGFA 3TOIA 5JYPA 5EUAA 2ZJ9A 5F1FA 4GNUA 3I7JA 3BFEA 3M6BA 3UO9A 3PBRA 2EX2A 2OSUA 1K4FA 5FAOA 2J9PA 2P9VB 2WGIA 4K0WA 5CERA 5L2FA 2DRWA 3Q7VA 1YMXA 2ZQ7A 3IF6C 4FSFA 1PZOA 3G34A 5EVIA 2RCXA 4WEJA 5I94A 4R0QA 3GQZA 2EFUA 1TDLA 3CG5A 1K54C 4R23A 3PBQA 4E3JA 1XX2A 3UE1A 4WZ5A 1QMFA 3W8KA 3LY3A 1MWUA 1GA0A 2R9WA 3G4PA 4KG6A 3MBZA 1YLYA 3G31A 3WRTA 3RJUA 1ZG6A 3IXDA 2ZQ8A 4C3QA 2PU2A 1XPBA 1FSYA 1PWCA 1GCEA 1H5XA 3A3FA 3FKWA 1K6SA 2ZC6B 2ZD8A 4MNRA 5A92A 1LL5A 3LO7A 2Y55A 4S2KA 1ONGA 2EX9A 3A3IA 2PBYA 3PAGA 1SKFA 4EBNA 5FAQA 3HLEA 4WELA 2Y2GA 2ZC3B 1IYSA 2OV5A 4KZ4A 5DTSA 3O88A 3ZG9B 3PAEA 4IVIA 3S22A 3ZHHA 3HL9A 3UDIA 3OZHA 4XUZA 4OLGA 1K54A 3HBRA 4RA7A 1L2SA 5E2HA 4OONA 3IQAA 2Y91A 5FI6A 3ZVTA 1CK3A 4R3JA 4X69A 5KZHA 1IYQA 4S2JA 1K55C 1YM1A 3NDEA 1LHYA 1KGFA 5EPHA 3AGEA 3FV7A 4DE1A 3FWLA 4Y0UA 4N92A 2ZC4B 3VFFA 3V3RA 2WAEA 3OC2A 3MZDA 4O7DA 3TSGA 5HAPA 1BT5A 4IEDA 4DE0A 1W7FA 3PTEA 3GVBA 3NC8A 5EOOA 2E8IA 5IHVA 5CEBA 3V39A 5E2GA 1E3UA 1G6AA 3P98A 3IHAA 5D3OA 4PM5A 5CHMA 1C3BA 2Y2OA 4K91A 3ZFZA 3CJMA 1O07A 4OQIA 4OPZA 2P9VA 3MXRA 5DVAA 3CZDA 5HAIA 1L0GA 1BTLA 4U3TA 2WKEA 3WRZA 4KZ5A 4OPYA 3SS3A 3RXWA 3MKFA 2C5WB 2CC1A 1TDGA 4S2PA 4XXRA 3MZFA 1IEMA 2ZM8A 3PBTA 2Y2JA 1DJAA 3Q81A 4E3MA 4MBFA 3HLWA 4RVAA 5A91A 3HLCA 5J8XA 1RGZA 3D4FA 4LV3A 4DF6A 1IKGA 3MFDA 3Q7ZA 4LCLA 4XUXA 2XK1A 1YT4A 4R4RA 4UA7A 2Q9MA 3LCEA 1CEGA 2XEPA 3DWZA 1PWDA 4DKIA 2HPBA 2IWCA 3EQUA 4RYEA 3HUMA 3O3VA 1KE0A 5CGXA 1CI8A 4WM9A 3BLSA 2X01A 4OLDA 5HL1A 4HBTA 2WZZA 4KZ3A 4JXVA 1JWPA 3G35A 4E3KA 1MWTA 3MXSA 1IKIA 1ESUA 4IVKA 4P87A 5KMWA 3GV9A 5HARA 4IBXA 4JBFA 3SH9A 5GLAA 4E3NA 4R3BA 3BM6A 4BENA 5DF7A 3HVFA 1M6KA 4OOYA 2XFTA 4X68A 2B5RA 4B4ZA 4N1HA 4P0MA 3SH8A 5CTNA 4ZJ3A 2WUQA 4K0XA 4EV4A 2XF3A 4ZAMA 3WS1A 2WKIA 2HP9A 4S2MA 1SDEA 2QMIA 2P74A 2WGWA 2EFXA 4JKTA 4MEZA 4X55A 4BD0A 5A90A 1XA7A 4GOGA 1MWRA 2ZM2A 2A3UA 3WS4A 3N6IA 3IXBA 5DTKA 2HDUA 3G2ZA 3N4IA 4JLFA 1IYOA 3UPOA 3BFDA 1FCNA 5EVID 1LI0A 1K56D 3EQVA 1EWZA 2X02A 2ZQ9A 3NDGA 5JYOA 5CHUA 4UAAA 4HEFA 5FA7A 3QHYA 5DTTA 3VOYA 3ZG5A 3NBLA 4BQMA 3IH9A 4OPQA 3UDFA 4S2IA 2EXBA 1K55A 1HD8A 1NY0A 1SDNA 2V20A 4NK3A 4ZTKA 3WWXA 2FFFB 2ZM0A 5FQQA 4FH4A 1NYMA 4JF5A 4FH2A 1ERMA 3C7VA 4OQHA 4RX3A 4WMCD 5GLCA 3HLDA 4QJGA 1JTDA 1G68A 1W79A 3BEBA 4MLLA 1YLTA 4Y0OA 4OPRA 4RX2A 3VP0A 1PI5A 2HP6A 5TFQA 3C4PA 5FDHA 4KQQA 5EOEA 4UA9A 3PBNA 3LY4A 2EX8A 3IF6B 3VP1A 1ERQA 3A3JA 5CGWA 3VP2A 1WYBA 4DDSA 5AQ9A 2QPNA 2UWXA 2X71A 5G18A 1N9BA 3C4OA 1W8YA 1ZG4A 5EVIC 4EWFA 1Z6FA 3UPNA 1NXYA 1CEFA 1YQSA 1SHVA 1ES4A 1BZAA 3CMZA 5FASA 3IHBA 1IYPA 1MPLA 1XKZA 2XFSA 1NRFA 1JTGA 3N8SA 4OQGA 4PM7A 1U60A 4BD1A 1CI9A 4WEKA 2ZMAA 4ZDXA 3A3DA 1AXBA 4EBPA 2Z2LB 4GN2A 3QNCA 5AQBA 4ZJ1A 1KVMA 3Q82A
chains in the Genus database with same CATH superfamily
2XGNA 3DTMA 2H28A 3GR2A 4KG2A 4WMCA 2VX8A 4GLQA 4OQ0A 1BLCA 4LV0A 1K57C 1XJ2A 1L0EA 3HLBA 4PM6A 3BWLA 1VQQA 3IXGA 3BYDA 4ETZA 4MBHA 4E3OA 2H0TA 3W4PA 3IWOA 3ZDJA 2GJ3A 4BL3A 4LCMA 3ZYTA 2GDNA 2VGLS 5MC7A 3DTEA 2WKPA 3OLOA 3BECA 2VK3A 1VHMA 2XH9A 3UB5P 3BFGA 5DFYA 5EECA 1BYWA 3S7NA 2VGJA 1D06A 5FQJA 3H82A 5FI2A 3F1OB 3FKVA 4DXCA 3R7WB 3UE0A 3A0SA 2O0YA 4HOIA 1F2KA 3JVUA 1FCOA 5F82A 3SW1A 2PD7A 4Q8IA 3VSLA 3G30A 3NCKA 4B9OA 4MBKA 3D3OA 4KQOA 3EEAA 3S7OA 4GZBA 4KQDA 3C5AA 3LIFA 2Y2KA 1ALQA 4ZJ2A 1CQAA 1RP5A 1NRJA 2Y59A 3UB8A 2JKTM 4R3AA 5HSQA 1GHPA 3AGFA 2XR0A 2VZWA 5DF9A 4E3IA 4EUZA 4KZBA 1NWZA 3OPHA 1T1BA 3CWFA 1CJFA 4NXGA 4O0PA 2H0YA 4OP5A 2IWDA 5GHZA 4BMWA 2L0WA 1L0FA 1PZPA 1XA1A 4OOLA 1OMEA 1K57A 1PI4A 4R70A 2VEAA 3IT9A 3RTYA 3FZCA 2V9AA 3UPPA 4UQIS 3KSIA 2WYXA 4YWZA 4D2OA 3K3CA 4JGOA 3IBJA 4PM9A 5CECA 5AQAA 3LI9A 4QY5A 4QPRA 1GSWA 3Q7VB 2BASA 4MN5A 1KE4A 4L0LA 3MQ0A 1TS8A 1W5DA 1VEUA 2LB9A 3H9WA 5KIZA 2PR6A 2OLVA 3ULFA 1FCMA 4HNBA 2OLUA 4KZAA 2HV1A 2PBDP 1GHMA 2I72A 4PKYA 4JPMA 3VE4A 5FQKA 5CRFA 1X0OA 3K3DA 2EX6A 4YOFA 2VKSA 2OAQ1 1TEMA 3LR4A 4GKUA 3W4QA 4CLCC 3W4OA 4ARZB 4OP8A 3WS0A 1NZOA 2D01A 3W2ZA 3UE3A 4Y5FA 3ZG8B 2A24B 1SCWA 5TBMB 1LLBA 1EI5A 3T1SA 2ZC5B 1SKOB 4QD4A 5CXWA 2O99A 3N8RA 3ISGA 3LR0A 2HZ5A 1YSQA 1ZHHB 2ZOHA 5EUAA 4EESA 4HI4A 2HF6A 3NOUC 2EWWA 2ZJ9A 2KOIA 3M6BA 3UO9A 1K4FA 2Q0OA 5FAOA 2WGIA 2DRWA 1YMXA 4R6LA 2ZQ7A 1PZOA 3UMEA 4L9FA 2RCXA 4JGPA 3GQZA 4R0QA 4HJ3A 1K54C 2PAVP 2LB5A 2JKFA 4WZ5A 3W8KA 2R9WA 3G4PA 4KG6A 3KSHA 3MBZA 3G31A 3WRTA 3IXDA 4BBVA 3A3FA 4MNRA 1K6SA 3S7PA 4S2KA 1T19A 3LO7A 5L09A 1ONGA 2OV5A 4KZ4A 3O88A 4NG2A 3S22A 5AJGA 3OZHA 3KYZA 3HBRA 4LRXC 3HJKA 4R3JA 5KZHA 4S2JA 3T1RA 1YM1A 5EPHA 5FEFA 4DE1A 1G6OA 3V3RA 4O7DA 3FC7A 3FPWA 5CEBA 4Y2FA 1E3UA 5D3OA 4K91A 1G28A 3CUEA 3ZFZA 1O07A 2P9VA 3CZDA 5HAIA 1L0GA 5K5BA 1BTLA 2WKEA 3E0YA 3WRZA 4OPYA 3MKFA 4AFIA 3T1QB 2C5WB 3LEQA 4I3IA 1IEMA 4LLOB 3HLWA 5A91A 3HLCA 1OJGA 4DF6A 3MFDA 3IX4A 2XK1A 4Y3IA 1HLUP 4UA7A 1CEGA 3L9KA 1PWDA 3EGDC 3IX8A 3O3VA 4Q0JA 5CGXA 5EFWA 3BLSA 3C2WA 3U4LP 4OLDA 4HBTA 3S7QA 2CMNA 4XT2A 4E3KA 4IVKA 5KMWA 3GV9A 3UB7A 4IBXA 4E3NA 2W0NA 4R3BA 5DF7A 5EV0A 4WUJA 4P0MA 2XF3A 5HD3A 4ZAMA 2QMIA 4BD0A 1LL8A 4X55A 4Q0IA 3FG8A 3UPOA 1F9IA 1LI0A 3EQVA 2X02A 2ZQ9A 4MMNA 5FA7A 3QHYA 3U2AA 2GX5A 4BQMA 3IH9A 4OPQA 4S2IA 2EXBA 2V20A 4NK3A 1NYMA 2DMWA 4WLAA 4RX3A 4HIAA 5GLCA 1FILA 3QP6A 1G68A 3BEBA 4MLLA 2J80A 5FDHA 1A0KA 4DDSA 2QPNA 1NXYA 2HJ9C 2VLGA 3VE3A 1CEFA 3QP4A 1JTGA 4BD1A 1U60A 5AVFA 2ZMAA 4II7A 3A3DA 2GNXA 1AXBA 2Z2LB 4Y15A 1KVMA 2A49A 3VP4A 2JKRI 5HAQA 1NZUA 2PU4A 4N1XA 3HUOA 5F83A 5C5KA 4O01A 4NEED 2GZAA 1KE3A 4HY8A 3HREA 1E25A 4DE2A 4YFMA 5HL6A 2H5SA 3DW0A 3ITAA 1T18A 3IWQA 5E43A 5GHYA 1Q2QA 3C8CA 5KSHA 2Y79A 3OCNA 1QMEA 4HBUA 3BQAA 3OPPA 2Q9NA 3F1PA 1OJ5A 2RL3A 3WS5A 2W3FA 4KZ7A 3G2YA 2JBFA 1ZC2A 4EU0A 4UHUA 2W3HA 4WYYA 4KZ9A 5J7EA 2I9VA 2V1BA 3TJZC 4FD8A 2OAP1 3VSKA 1M40A 2ZMVA 3F1OA 1PW8A 3N8LA 4E6XA 3SS4A 3BFCA 1ONHA 3BLMA 4S2OA 3P01A 3T12B 1P9WA 1DP8A 3SOIA 3TG9A 1DJCA 1YLJA 2V2FF 3UB9A 2JN7A 2Y4AA 5KSCA 5E2EA 4WZ5C 4Y0TA 1E3UD 2G7UA 2R9XA 4Q0HA 4DXBA 1O7EA 5U47A 3CLOA 1FOFA 1UWPX 1XGJA 4ID4A 3ZG0A 3WS2A 4LFUA 2Z2MB 5CHJA 4GS9A 5HZHA 1PIOA 1S1ZA 2WKQA 5A8BA 1KDSA 3NIAA 2ACGA 3AGDA 4L9EA 3H82B 2P08A 1H0MA 1LSWA 3UDXA 2PT7A 3GTCA 3T4SA 2V1ZA 3E98A 1W8QA 3IXHA 1ESIA 3CAXA 3OCLA 3F1PB 4CJNA 4QB8A 4OH0A 4F3LA 1V9ZA 3O87A 3BY9A 2PR5A 5FQ9A 4NETA 3S1YA 1OTBA 1JVJA 4F94A 2ZMFA 4GD6A 2JKTI 3NECA 3PYPA 2ZQCA 3B47A 1MKMA 4P85A 4LV1A 5EVLA 3IX3A 3MMHA 3NI9A 3PBOA 4KQRA 2A2LA 1HTZA 2C6WB 4CPKA 1FSWA 5GLDA 2JE5A 1DP9A 3MSHA 4BJPA 1HVBA 5M19A 4JXGA 3B3XA 3C7UA 1PRQA 4S2NC 3NJAA 3LEZA 1P9RA 2PDRA 5CGSA 5GLBA 2DCFA 5GHXA 5EM0A 1AWIA 4WZ4A 5HPFA 3CI6A 4C6YA 4IBRA 1MXOA 4OOMA 3IF6A 1N4OA 2XD5A 2KDKA 4KENB 1S1YA 2XD1A 4JF6A 3NY4A 1N9LA 3K2NA 3KYQA 1RCJA 1K4EA 2HDQA 5JYPA 4QY6A 1N9OA 3T4OA 4GNUA 5DJTA 3LR5A 3KSGA 4WF0A 4K0WA 3Q7VA 2ZBBA 2A24A 3G34A 4PHTA 2K31A 3P7NA 4E3JA 1XX2A 4LPZA 2XA7S 4ETXA 5AVEA 1Z09A 4IJGA 1TF1A 2M1CA 1ZG6A 2OWHA 4C3QA 1TS0A 1S4SA 1FSYA 1GCEA 3EWKA 1S4RA 2ZD8A 3IS2B 1SKFA 4EBNA 4WELA 2Y2GA 2ZC3B 5HWTA 2JKRM 3PAEA 2P7JA 3ZHHA 4RQ9A 3JVVA 3NHQA 2M7UA 4OLGA 1L2SA 5FI6A 4EEPA 2QWSA 1K55C 4DJ3A 5F6AA 3NDEA 3AGEA 1YSPA 1N9NA 3VFFA 1TD5A 2WAEA 3DTIA 3TSGA 1UWNX 1P97A 4DE0A 3NC8A 4MCWA 3V39A 1G6AA 3JPUA 5CHMA 4HP4A 3MXRA 5DVAA 4U3TA 3SS3A 2PRFA 2CC1A 1TDGA 4S2PA 3MZFA 3PBTA 1DJAA 4EXOA 4MBFA 4RVAA 1RGZA 2Q9MA 2XEPA 3DWZA 4DKIA 2IWCA 3EQUA 4RYEA 3HUMA 3SZTA 1OTAA 2VV8A 2X01A 5HL1A 4GHIA 1MWTA 4HQAA 3MXSA 2UV0E 5HARA 5GLAA 1UGUA 4BENA 1M6KA 4NXBA 4EV4A 5I5LA 2MJ6A 2AVXA 3WS1A 2HP9A 4MN7A 1SDEA 2P74A 3V67A 2EFXA 3E4PA 1XA7A 4GOGA 1MWRA 3WS4A 3G2ZA 1IYOA 1FCNA 4E04A 1EWZA 5CHUA 4UAAA 2QHKA 3UDFA 1K55A 1SDNA 3WWXA 3GDIA 2ZM0A 1VEUB 3BJNA 4OQHA 2B02A 2IA2A 1STZA 1YLTA 3LIBA 4OPRA 3VP0A 1PI5A 5TFQA 4UA9A 3LY4A 2EX8A 2EWVA 5AQ9A 5J4EA 2UWXA 1N9BA 5EVIC 4EWFA 1Z6FA 1YQSA 1ES4A 2PYRA 4HJ4A 1NRFA 1W63Q 1CI9A 4EBPA 4GN2A 4UEYA 3A0VA 4LV2A 3Q82A 1IFQA 2J7VA 4R38A 3V50A 4WBGA 2VJWA 2G2UA 3MZEA 4ZRRA 2XQZA 3RFBA 2J9OA 5CTMA 5IS1A 4KUKA 4LENA 3ZVWA 5DF8A 5HD5A 5GL9A 1S0WA 2DNSA 4N9LA 3VFHA 4R4SA 5EE8A 4KG5A 2FZ0A 1FR6A 5HFOA 5BOHA 3IBRA 4XT2B 1KGGA 5AQ7A 3LI8A 1EROA 3UN7A 1J9MA 4ZBEA 1MC0A 1TS6A 4O8GA 2HJEA 4G3KA 2V0WA 4LRZE 1FR1A 1BUEA 1BULA 1K38A 3IF5A 1BLPA 1LT0A 4Y7PA 3ZGAB 3V3SA 3SH7A 3CHWP 3P09A 2Y2QA 2WKRA 1ZTUA 3MKEA 2BLSA 4JXWA 3QP8A 2VV7A 2R78A 4CLCE 5DKKA 1ZKJA 4MN6A 3O86A 3OPRA 2K2NA 1H8ZA 1YLPA 3OPLA 3HLGA 4U0TA 4IHQA 3PBSA 3T4LA 3UB6A 2B18A 2PYPA 4X1MA 3T4TA 2YKFA 4FCFA 4KZ6A 3VOZA 1VB6A 1BLHA 2QJ5A 3RXXA 3Q07A 4GHIB 3R4KA 4Y17A 5F69A 4GDBA 4UA6A 2XSSA 4X56A 1KGEA 1ODVA 3LFVA 5HDCA 4M3KA 1H8MA 1KVLA 1XGIA 5FATA 4KUOA 1I2WA 3LYXA 2WGVA 1I5QA 4EUVA 5TR7A 5TJJA 4GCZA 2VGKA 1D1JA 3GMWA 2D02A 3HJIA 2QYBA 4NXEA 2WKHA 3BRMA 2E8JA 4X53A 4YINA 2Y2NA 4U0XA 3FYZA 5E2FA 4S2NA 1ES5A 4GD8A 4X6TA 3UE6A 4CLCD 1MZUA 3MF0A 3M6HA 4P6BA 4D60A 4Y13A 1SKOA 5CEDA 3LIAA 3N7WA 2NUTC 1JNUA 4LRYC 3JYIA 1YLWA 1S6RA 1XFNA 1XJ3A 2FH5A 2VV6A 1VM1A 1LL9A 2WZXA 3E4QA 3ITBA 3Q1FA 2QZ6A 2W3EA 3GSGA 4DRTA 2V1AA 1T1AA 3DBAA 5A93A 4E3LA 2W1RA 2IWBA 3ICYA 3SS5A 2G2WA 3EEHA 1WYCA 4EQIA 2ZQDA 3LUQA 4Z9QA 2WK0A 3VP3A 4JF4A 1GA9A 4UQIM 2ZQAA 3T4JA 5F1GA 3H7WB 4P6ZM 1K56A 4ME4A 1EW0A 4I5SA 2HGVA 2Y8HA 4PAUA 2ZLYA 1ES3A 3MXQA 4GW9A 4JGQA 2O9AA 3E2KA 4NXFA 5TGFA 4NKPA 5F1FA 3QP5A 3H7WA 3PBRA 4DN0A 2OSUA 2J9PA 5CERA 5TBMA 3IF6C 4L9GA 1F98A 5EVIA 5I94A 1TDLA 4R23A 3PBQA 2M7VA 1KOUA 4ARZA 3EOIA 3UE1A 3L7HA 1S66L 5FEGA 1CF0A 2ZQ8A 2J3TC 1XPBA 3FKWA 5A92A 1LL5A 1OTIA 3A3IA 5FAQA 3HLEA 4EETB 5DTSA 4IVIA 2P04A 3HL9A 3UDIA 4BWIA 2J3WA 1K54A 4RA7A 2Y91A 1CK3A 2O9CA 4M4XA 3OBFA 1IYQA 3BY8A 3FWLA 4Y0UA 5F5YA 4N92A 4IUKA 1DP6A 3MR0A 2V8CA 5HAPA 4IEDA 3PTEA 3GVBA 5HWWA 1OTEA 3IHAA 4F3LB 2V0UA 1C3BA 4OQIA 4GJ4A 3TRCA 3B42A 2XA7M 4KZ5A 3CPTB 1SZVA 3LGOA 3MFXA 2Y2JA 1DRMA 3Q81A 4E3MA 4LV3A 2W1TB 1IKGA 4XUXA 4LCLA 4G3VA 1YT4A 4R4RA 3LCEA 2HPBA 3LICA 2JHEA 1CI8A 2QKPA 2WZZA 1IKIA 1ESUA 4P87A 3G6OA 3E4OA 4JBFA 4K08A 3BM6A 4PKYG 4OOYA 3VV4A 2B5RA 2J3TD 3B33A 3SH8A 4ZJ3A 1LSVA 2WUQA 4I3JA 2WKIA 1Y28A 2WGWA 4JKTA 2A3UA 1OTDA 3N6IA 1G5UA 5DTKA 2HDUA 3N4IA 5EVID 5HDSA 5L8MA 4HEFA 2NUPC 3UMDA 5DTTA 3ZG5A 3NBLA 5LBRA 1HD8A 1NY0A 4ZTKA 4WL9A 4JF5A 4FH2A 4QJGA 4WMCD 3HLDA 1JTDA 1W79A 4RX2A 3C4PA 1TS7A 4KQQA 1ERQA 5CGWA 3VP2A 1WYBA 3NOPC 2L4RA 5G18A 3C4OA 1ZG4A 3UPNA 2W3GA 2PHYA 1SHVA 5G4ZA 1BZAA 5HPIA 3CMZA 1IYPA 1XKZA 2XFSA 3N8SA 4OQGA 4WEKA 4ZDXA 3T4KA 3QNCA 1XJ6A 5FDSA 4GB7A 4I38A 4I3AA 1PYYA 4X1LA 4E6WA 1YAXA 2OWJA 5FI7A 1J3WA 2EXAA 3M2JA 4PPRA 2WAFA 1YKDA 3V5MA 1DJBA 1GSXA 2Y2PA 1D7EA 5IT5A 5M18A 3IWIA 1GHIA 1VETA 1OT9A 5HX9A 2H10A 4JXSA 3DAVA 4R1GA 5HW3A 2Y2IA 3D9YA 3GRJA 1NJ4A 4PMAA 1BSGA 4EERA 3KX0X 3G32A 2O9BA 3GECA 1IELA 3QP2A 1OT6A 5F68A 2Y2MA 5EM1A 5FQIA 4A5RA 3M2KA 2WADA 3BFFA 1LI9A 5CX7A 4C75A 5FSRA 1K0KA 5DKLA 3MS6A 3ZNTA 1HZOA 1DY6A 3D72A 4QHCA 2XRNA 3EGXC 4LGWA 3QP1A 2INWA 2OOLA 2WGWB 4DDYA 1KDWA 4HESA 3KO6A 4ESPA 1K25A 3ZG7B 1MKIA 1YLZA 1PWGA 4DJ2A 1JWZA 4FTXA 2YKHA 5M1AA 1PW1A 4HP9A 1BLSA 2L1MA 3VMAA 2Y2HA 5FAPA 1H8YA 4EBLA 3T50A 1ES2A 1XP4A 1ACFA 1E4DA 3BW6A 4EW7A 3RH8B 5FQMA 2EA9A 4H8RA 2XLNA 4OVDA 3UNWA 2XDMA 4H6JB 5EVIB 3PR6A 1WE4A 3CUEC 1PFLA 1VETB 1XXMA 1MY8A 2HP5A 1TVFA 4N9KA 5L10A 3KSFA 2HDRA 4HH2A 1K6RA 1MWSA 2Y2LA 4S2LA 2BG1A 2J8YA 3LIEA 3F1NA 4QU3A 2VGLM 4BLMA 1NYYA 4BL2A 3S4XA 1RGYA 1JWVA 3ZNYA 3HLFA 4IUHA 1Q2PA 3BQ8A 4I39A 2V8FA 1FQGA 1Y54A 3HUNA 3IS2A 3E2LA 4CLCB 1YMSA 3MQOA 5IU1A 5DJUA 2JCHA 3LR3A 4B88A 1I2SA 5G4YA 1P0ZA 4HH3A 5EVEA 4DE3A 4OKPA 1MBLA 3A3EA 2XROA 2HDSA 1LSXA 2W3DA 2PD8A 3A0RA 2JC7A 3IH8A 3QNBA 1L0DA 3F1NB 2FFYA 1PNEA 3ZCZA 3DWKA 4B4XA 2ZC7A 4KZ8A 4PM8A 3UY6A 4GDNA 3TOIA 4WN5A 2Z6CA 3TW8A 3I7JA 3BFEA 3CPTA 2EX2A 4P6ZS 2P9VB 5L2FA 4FSFA 4WEJA 4H6JA 4Z1WA 3C38A 4BBTA 2EFUA 3CG5A 1GSVA 1QMFA 2K7SA 3LY3A 1MWUA 1S67L 3OOVA 2KLIA 1GA0A 1NLYA 2ZOIA 1YLYA 3LIDA 4JGRA 1W63M 3RJUA 2PU2A 1PWCA 1H5XA 2ZL1B 3VOLA 2ZC6B 4GS9B 2Y55A 2EX9A 2PBYA 3PAGA 3C30A 1IYSA 3HCYA 3ZG9B 4QWOA 1F5MA 1H3QA 4YNRA 4XUZA 2ZL1A 5E2HA 4OONA 3IQAA 3ZVTA 2W1TA 4X69A 2B95A 1LHYA 5HWVA 1KGFA 4HJ6A 3FV7A 2ZC4B 4FOFA 3NULA 3OC2A 2JKGA 3O5YA 3ZQ5A 3MZDA 1BT5A 1W7FA 3T1XA 2QJ7A 3TE8A 5EOOA 2E8IA 5IHVA 5E2GA 5FL3A 3P98A 1XJ4A 1V9YA 4PM5A 1WA9A 2Y2OA 3CITA 1Y4OA 3CJMA 4OPZA 2Z6DA 3RXWA 2KX6A 4XXRA 2ZM8A 2W27A 3MJQA 1XFQA 3FPVA 3R7WA 4DMZA 5J8XA 3D4FA 4BBUA 5DFXA 3Q7ZA 4EQ1A 1L3LA 4G3WA 1KE0A 4WM9A 4EEUA 4X25A 4KZ3A 3KYEA 4JXVA 1JWPA 3G35A 3PXPA 3SH9A 3HVFA 4HHDA 2XFTA 2BTFP 4X68A 4B4ZA 4N1HA 5CTNA 4K0XA 4S2MA 4CLCA 4MDZA 4MEZA 1OPXA 5A90A 2ZM2A 3IXBA 1IOUA 4JLFA 3BFDA 5HDDA 3NOTC 1K56D 3MQQA 3NDGA 5JYOA 1YPRA 3VOYA 4B93A 1T1CA 3PHYA 2VA0A 2FFFB 5L07A 5FQQA 4FH4A 1ERMA 3C7VA 4Y0OA 2HP6A 5EOEA 3PBNA 3IF6B 3VP1A 3A3JA 4CQHA 2X71A 3T4QA 1W8YA 1NLZA 5FASA 3IHBA 4PM7A 1MPLA 5J3WA 3DTKA 4FUWA 1FIKA 5AQBA 4ZJ1A
chains in the Genus database with same CATH topology
2A49A 2XGNA 3DTMA 4KG2A 2J7VA 3GR2A 3V50A 4WMCA 3VP4A 4OQ0A 1BLCA 4LV0A 4WBGA 1K57C 1L0EA 3HLBA 2G2UA 4GB7A 4PM6A 5HAQA 3MZEA 1NZUA 1VQQA 2XQZA 2PU4A 3IXGA 2J9OA 4N1XA 3HUOA 5CTMA 1PYYA 3BYDA 4LENA 4MBHA 3ZVWA 4E6WA 5DF8A 5F83A 4E3OA 2H0TA 5GL9A 1S0WA 2DNSA 5FI7A 3W4PA 4N9LA 3VFHA 1KE3A 3IWOA 4R4SA 3HREA 1E25A 2EXAA 5EE8A 3ZDJA 4DE2A 4YFMA 4KG5A 3M2JA 4PPRA 4BL3A 2WAFA 4LCMA 2GDNA 1FR6A 5HFOA 2H5SA 3V5MA 5BOHA 1DJBA 3DW0A 3ITAA 2Y2PA 3IWQA 5M18A 3IWIA 5E43A 5GHYA 1GHIA 1Q2QA 1KGGA 5AQ7A 5KSHA 3BECA 1EROA 2XH9A 3OCNA 5HX9A 2H10A 4JXSA 1QMEA 4HBUA 3UN7A 3BFGA 4R1GA 5HW3A 1J9MA 5EECA 2Y2IA 3GRJA 3OPPA 2Q9NA 4ZBEA 1NJ4A 4PMAA 1BSGA 2VGJA 2RL3A 3G32A 3WS5A 4KZ7A 3G2YA 1FR1A 1BUEA 1BULA 1ZC2A 2JBFA 1IELA 5FQJA 4UHUA 5FI2A 1K38A 4WYYA 2Y2MA 5FQIA 4KZ9A 4A5RA 3FKVA 3IF5A 4DXCA 3UE0A 4FD8A 3M2KA 3VSKA 1BLPA 2WADA 1M40A 3BFFA 4Y7PA 3ZGAB 1LI9A 1PW8A 1FCOA 3V3SA 3SH7A 3N8LA 4C75A 5F82A 5FSRA 3P09A 4E6XA 3SS4A 2Y2QA 3MKEA 3ZNTA 3BFCA 4Q8IA 1HZOA 3VSLA 1DY6A 2BLSA 3G30A 3NCKA 1ONHA 4MBKA 4KQOA 4JXWA 4QHCA 3BLMA 4GZBA 4S2OA 1ZKJA 3O86A 3C5AA 2WGWB 3SOIA 3OPRA 3TG9A 2Y2KA 1ALQA 1KDWA 1DJCA 4ZJ2A 4DDYA 4HESA 1H8ZA 1YLJA 1RP5A 1YLPA 3OPLA 3HLGA 1K25A 2Y59A 2V2FF 4U0TA 3ZG7B 2Y4AA 5KSCA 5E2EA 1MKIA 3PBSA 1YLZA 1PWGA 4WZ5C 4Y0TA 4FCFA 1GHPA 3AGFA 2XR0A 5DF9A 1JWZA 4KZ6A 3VOZA 4E3IA 4EUZA 1BLHA 1E3UD 4KZBA 3Q07A 3RXXA 2R9XA 3OPHA 4DXBA 4GDBA 1O7EA 4UA6A 5U47A 2H0YA 4OP5A 2IWDA 5GHZA 1FOFA 1XGJA 4ID4A 4X56A 1L0FA 1KGEA 1PZPA 1XA1A 1OMEA 4OOLA 5M1AA 1K57A 1PW1A 3ZG0A 1PI4A 3WS2A 2Z2MB 5CHJA 1PIOA 3IT9A 3FZCA 4M3KA 1BLSA 1KVLA 3UPPA 1KDSA 3VMAA 3NIAA 2Y2HA 5FAPA 1H8YA 1XGIA 4EBLA 1ES2A 1XP4A 5FATA 2WYXA 1I2WA 4D2OA 1E4DA 3AGDA 2WGVA 1I5QA 4PM9A 5CECA 5FQMA 4H8RA 2XLNA 5TR7A 3UDXA 4OVDA 5AQAA 3UNWA 3GTCA 2XDMA 2V1ZA 2VGKA 3GMWA 3IXHA 1W8QA 1ESIA 4QY5A 3OCLA 5EVIB 4CJNA 2WKHA 3BRMA 1WE4A 4OH0A 4QB8A 3Q7VB 4X53A 4YINA 1KE4A 2Y2NA 3O87A 4L0LA 4U0XA 1XXMA 1W5DA 3FYZA 1MY8A 5FQ9A 5E2FA 2HP5A 4NETA 1TVFA 3S1YA 4S2NA 1JVJA 4N9KA 4F94A 1ES5A 4GD8A 4X6TA 2HDRA 2OLVA 3M6HA 4GD6A 4P6BA 1K6RA 1MWSA 1FCMA 2Y2LA 4S2LA 2BG1A 5CEDA 2J8YA 2ZQCA 3N7WA 4QU3A 2OLUA 4KZAA 1NYYA 4BLMA 4BL2A 4P85A 3S4XA 3JYIA 1RGYA 1GHMA 1YLWA 1S6RA 2I72A 4LV1A 1JWVA 3NI9A 5EVLA 3ZNYA 3HLFA 1Q2PA 3PBOA 4KQRA 4JPMA 4LV2A 1HTZA 1FQGA 1VM1A 1LL9A 1Y54A 5CRFA 2WZXA 2C6WB 5FQKA 4CPKA 1FSWA 3HUNA 3E2LA 3ITBA 1YMSA 2JE5A 5GLDA 2EX6A 3Q1FA 2QZ6A 3GSGA 4BJPA 2JCHA 4B88A 1I2SA 4DRTA 1HVBA 1TEMA 4GKUA 3W4QA 4DE3A 5M19A 4OKPA 4JXGA 1MBLA 3B3XA 5A93A 3W4OA 3C7UA 4OP8A 4E3LA 3WS0A 3A3EA 2IWBA 3SS5A 2G2WA 1NZOA 4S2NC 1WYCA 3LEZA 4EQIA 2ZQDA 3UE3A 5CGSA 5GLBA 2DCFA 4Z9QA 5GHXA 2HDSA 4WZ4A 3ZG8B 2WK0A 3VP3A 4JF4A 1GA9A 4C6YA 1SCWA 4IBRA 2ZQAA 1MXOA 4OOMA 3IF6A 1LLBA 1N4OA 2XD5A 5F1GA 2JC7A 3IH8A 3QNBA 4KENB 2XD1A 1L0DA 1EI5A 1K56A 2ZC5B 2FFYA 2ZLYA 3ZCZA 4JF6A 4QD4A 1ES3A 3NY4A 5CXWA 3DWKA 3N8RA 4B4XA 1RCJA 3ISGA 2ZC7A 1K4EA 2HDQA 3E2KA 4KZ8A 4PM8A 3UY6A 4GDNA 4QY6A 5TGFA 3TOIA 5JYPA 5EUAA 2ZJ9A 5F1FA 4GNUA 3I7JA 3BFEA 3M6BA 3UO9A 3PBRA 2EX2A 2OSUA 1K4FA 5FAOA 2J9PA 2P9VB 2WGIA 4K0WA 5CERA 5L2FA 2DRWA 3Q7VA 1YMXA 2ZQ7A 3IF6C 4FSFA 1PZOA 3G34A 5EVIA 2RCXA 4WEJA 5I94A 4R0QA 3GQZA 2EFUA 1TDLA 3CG5A 1K54C 4R23A 3PBQA 4E3JA 1XX2A 3UE1A 4WZ5A 1QMFA 3W8KA 3LY3A 1MWUA 1GA0A 2R9WA 3G4PA 4KG6A 3MBZA 1YLYA 3G31A 3WRTA 3RJUA 1ZG6A 3IXDA 2ZQ8A 4C3QA 2PU2A 1XPBA 1FSYA 1PWCA 1GCEA 1H5XA 3A3FA 3FKWA 1K6SA 2ZC6B 2ZD8A 4MNRA 5A92A 1LL5A 3LO7A 2Y55A 4S2KA 1ONGA 2EX9A 3A3IA 2PBYA 3PAGA 1SKFA 4EBNA 5FAQA 3HLEA 4WELA 2Y2GA 2ZC3B 1IYSA 2OV5A 4KZ4A 5DTSA 3O88A 3ZG9B 3PAEA 4IVIA 3S22A 3ZHHA 3HL9A 3UDIA 3OZHA 4XUZA 4OLGA 1K54A 3HBRA 4RA7A 1L2SA 5E2HA 4OONA 3IQAA 2Y91A 5FI6A 3ZVTA 1CK3A 4R3JA 4X69A 5KZHA 1IYQA 4S2JA 1K55C 1YM1A 3NDEA 1LHYA 1KGFA 5EPHA 3AGEA 3FV7A 4DE1A 3FWLA 4Y0UA 4N92A 2ZC4B 3VFFA 3V3RA 2WAEA 3OC2A 3MZDA 4O7DA 3TSGA 5HAPA 1BT5A 4IEDA 4DE0A 1W7FA 3PTEA 3GVBA 3NC8A 5EOOA 2E8IA 5IHVA 5CEBA 3V39A 5E2GA 1E3UA 1G6AA 3P98A 3IHAA 5D3OA 4PM5A 5CHMA 1C3BA 2Y2OA 4K91A 3ZFZA 3CJMA 1O07A 4OQIA 4OPZA 2P9VA 3MXRA 5DVAA 3CZDA 5HAIA 1L0GA 1BTLA 4U3TA 2WKEA 3WRZA 4KZ5A 4OPYA 3SS3A 3RXWA 3MKFA 2C5WB 2CC1A 1TDGA 4S2PA 4XXRA 3MZFA 1IEMA 2ZM8A 3PBTA 2Y2JA 1DJAA 3Q81A 4E3MA 4MBFA 3HLWA 4RVAA 5A91A 3HLCA 5J8XA 1RGZA 3D4FA 4LV3A 4DF6A 1IKGA 3MFDA 3Q7ZA 4LCLA 4XUXA 2XK1A 1YT4A 4R4RA 4UA7A 2Q9MA 3LCEA 1CEGA 2XEPA 3DWZA 1PWDA 4DKIA 2HPBA 2IWCA 3EQUA 4RYEA 3HUMA 3O3VA 1KE0A 5CGXA 1CI8A 4WM9A 3BLSA 2X01A 4OLDA 5HL1A 4HBTA 2WZZA 4KZ3A 4JXVA 1JWPA 3G35A 4E3KA 1MWTA 3MXSA 1IKIA 1ESUA 4IVKA 4P87A 5KMWA 3GV9A 5HARA 4IBXA 4JBFA 3SH9A 5GLAA 4E3NA 4R3BA 3BM6A 4BENA 5DF7A 3HVFA 1M6KA 4OOYA 2XFTA 4X68A 2B5RA 4B4ZA 4N1HA 4P0MA 3SH8A 5CTNA 4ZJ3A 2WUQA 4K0XA 4EV4A 2XF3A 4ZAMA 3WS1A 2WKIA 2HP9A 4S2MA 1SDEA 2QMIA 2P74A 2WGWA 2EFXA 4JKTA 4MEZA 4X55A 4BD0A 5A90A 1XA7A 4GOGA 1MWRA 2ZM2A 2A3UA 3WS4A 3N6IA 3IXBA 5DTKA 2HDUA 3G2ZA 3N4IA 4JLFA 1IYOA 3UPOA 3BFDA 1FCNA 5EVID 1LI0A 1K56D 3EQVA 1EWZA 2X02A 2ZQ9A 3NDGA 5JYOA 5CHUA 4UAAA 4HEFA 5FA7A 3QHYA 5DTTA 3VOYA 3ZG5A 3NBLA 4BQMA 3IH9A 4OPQA 3UDFA 4S2IA 2EXBA 1K55A 1HD8A 1NY0A 1SDNA 2V20A 4NK3A 4ZTKA 3WWXA 2FFFB 2ZM0A 5FQQA 4FH4A 1NYMA 4JF5A 4FH2A 1ERMA 3C7VA 4OQHA 4RX3A 4WMCD 5GLCA 3HLDA 4QJGA 1JTDA 1G68A 1W79A 3BEBA 4MLLA 1YLTA 4Y0OA 4OPRA 4RX2A 3VP0A 1PI5A 2HP6A 5TFQA 3C4PA 5FDHA 4KQQA 5EOEA 4UA9A 3PBNA 3LY4A 2EX8A 3IF6B 3VP1A 1ERQA 3A3JA 5CGWA 3VP2A 1WYBA 4DDSA 5AQ9A 2QPNA 2UWXA 2X71A 5G18A 1N9BA 3C4OA 1W8YA 1ZG4A 5EVIC 4EWFA 1Z6FA 3UPNA 1NXYA 1CEFA 1YQSA 1SHVA 1ES4A 1BZAA 3CMZA 5FASA 3IHBA 1IYPA 1MPLA 1XKZA 2XFSA 1NRFA 1JTGA 3N8SA 4OQGA 4PM7A 1U60A 4BD1A 1CI9A 4WEKA 2ZMAA 4ZDXA 3A3DA 1AXBA 4EBPA 2Z2LB 4GN2A 3QNCA 5AQBA 4ZJ1A 1KVMA 3Q82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A49 A;  2XGN A;  3DTM A;  4KG2 A;  2J7V A;  3GR2 A;  3V50 A;  4WMC A;  3VP4 A;  4OQ0 A;  1BLC A;  4LV0 A;  4WBG A;  1K57 C;  1L0E A;  3HLB A;  2G2U A;  4GB7 A;  4PM6 A;  5HAQ A;  3MZE A;  1NZU A;  1VQQ A;  2XQZ A;  2PU4 A;  3IXG A;  2J9O A;  4N1X A;  3HUO A;  5CTM A;  1PYY A;  3BYD A;  4LEN A;  4MBH A;  3ZVW A;  4E6W A;  5DF8 A;  5F83 A;  4E3O A;  2H0T A;  5GL9 A;  1S0W A;  2DNS A;  5FI7 A;  3W4P A;  4N9L A;  3VFH A;  1KE3 A;  3IWO A;  4R4S A;  3HRE A;  1E25 A;  2EXA A;  5EE8 A;  3ZDJ A;  4DE2 A;  4YFM A;  4KG5 A;  3M2J A;  4PPR A;  4BL3 A;  2WAF A;  4LCM A;  2GDN A;  1FR6 A;  5HFO A;  2H5S A;  3V5M A;  5BOH A;  1DJB A;  3DW0 A;  3ITA A;  2Y2P A;  3IWQ A;  5M18 A;  3IWI A;  5E43 A;  5GHY A;  1GHI A;  1Q2Q A;  1KGG A;  5AQ7 A;  5KSH A;  3BEC A;  1ERO A;  2XH9 A;  3OCN A;  5HX9 A;  2H10 A;  4JXS A;  1QME A;  4HBU A;  3UN7 A;  3BFG A;  4R1G A;  5HW3 A;  1J9M A;  5EEC A;  2Y2I A;  3GRJ A;  3OPP A;  2Q9N A;  4ZBE A;  1NJ4 A;  4PMA A;  1BSG A;  2VGJ A;  2RL3 A;  3G32 A;  3WS5 A;  4KZ7 A;  3G2Y A;  1FR1 A;  1BUE A;  1BUL A;  1ZC2 A;  2JBF A;  1IEL A;  5FQJ A;  4UHU A;  5FI2 A;  1K38 A;  4WYY A;  2Y2M A;  5FQI A;  4KZ9 A;  4A5R A;  3FKV A;  3IF5 A;  4DXC A;  3UE0 A;  4FD8 A;  3M2K A;  3VSK A;  1BLP A;  2WAD A;  1M40 A;  3BFF A;  4Y7P A;  3ZGA B;  1LI9 A;  1PW8 A;  1FCO A;  3V3S A;  3SH7 A;  3N8L A;  4C75 A;  5F82 A;  5FSR A;  3P09 A;  4E6X A;  3SS4 A;  2Y2Q A;  3MKE A;  3ZNT A;  3BFC A;  4Q8I A;  1HZO A;  3VSL A;  1DY6 A;  2BLS A;  3G30 A;  3NCK A;  1ONH A;  4MBK A;  4KQO A;  4JXW A;  4QHC A;  3BLM A;  4GZB A;  4S2O A;  1ZKJ A;  3O86 A;  3C5A A;  2WGW B;  3SOI A;  3OPR A;  3TG9 A;  2Y2K A;  1ALQ A;  1KDW A;  1DJC A;  4ZJ2 A;  4DDY A;  4HES A;  1H8Z A;  1YLJ A;  1RP5 A;  1YLP A;  3OPL A;  3HLG A;  1K25 A;  2Y59 A;  2V2F F;  4U0T A;  3ZG7 B;  2Y4A A;  5KSC A;  5E2E A;  1MKI A;  3PBS A;  1YLZ A;  1PWG A;  4WZ5 C;  4Y0T A;  4FCF A;  1GHP A;  3AGF A;  2XR0 A;  5DF9 A;  1JWZ A;  4KZ6 A;  3VOZ A;  4E3I A;  4EUZ A;  1BLH A;  1E3U D;  4KZB A;  3Q07 A;  3RXX A;  2R9X A;  3OPH A;  4DXB A;  4GDB A;  1O7E A;  4UA6 A;  5U47 A;  2H0Y A;  4OP5 A;  2IWD A;  5GHZ A;  1FOF A;  1XGJ A;  4ID4 A;  4X56 A;  1L0F A;  1KGE A;  1PZP A;  1XA1 A;  1OME A;  4OOL A;  5M1A A;  1K57 A;  1PW1 A;  3ZG0 A;  1PI4 A;  3WS2 A;  2Z2M B;  5CHJ A;  1PIO A;  3IT9 A;  3FZC A;  4M3K A;  1BLS A;  1KVL A;  3UPP A;  1KDS A;  3VMA A;  3NIA A;  2Y2H A;  5FAP A;  1H8Y A;  1XGI A;  4EBL A;  1ES2 A;  1XP4 A;  5FAT A;  2WYX A;  1I2W A;  4D2O A;  1E4D A;  3AGD A;  2WGV A;  1I5Q A;  4PM9 A;  5CEC A;  5FQM A;  4H8R A;  2XLN A;  5TR7 A;  3UDX A;  4OVD A;  5AQA A;  3UNW A;  3GTC A;  2XDM A;  2V1Z A;  2VGK A;  3GMW A;  3IXH A;  1W8Q A;  1ESI A;  4QY5 A;  3OCL A;  5EVI B;  4CJN A;  2WKH A;  3BRM A;  1WE4 A;  4OH0 A;  4QB8 A;  3Q7V B;  4X53 A;  4YIN A;  1KE4 A;  2Y2N A;  3O87 A;  4L0L A;  4U0X A;  1XXM A;  1W5D A;  3FYZ A;  1MY8 A;  5FQ9 A;  5E2F A;  2HP5 A;  4NET A;  1TVF A;  3S1Y A;  4S2N A;  1JVJ A;  4N9K A;  4F94 A;  1ES5 A;  4GD8 A;  4X6T A;  2HDR A;  2OLV A;  3M6H A;  4GD6 A;  4P6B A;  1K6R A;  1MWS A;  1FCM A;  2Y2L A;  4S2L A;  2BG1 A;  5CED A;  2J8Y A;  2ZQC A;  3N7W A;  4QU3 A;  2OLU A;  4KZA A;  1NYY A;  4BLM A;  4BL2 A;  4P85 A;  3S4X A;  3JYI A;  1RGY A;  1GHM A;  1YLW A;  1S6R A;  2I72 A;  4LV1 A;  1JWV A;  3NI9 A;  5EVL A;  3ZNY A;  3HLF A;  1Q2P A;  3PBO A;  4KQR A;  4JPM A;  4LV2 A;  1HTZ A;  1FQG A;  1VM1 A;  1LL9 A;  1Y54 A;  5CRF A;  2WZX A;  2C6W B;  5FQK A;  4CPK A;  1FSW A;  3HUN A;  3E2L A;  3ITB A;  1YMS A;  2JE5 A;  5GLD A;  2EX6 A;  3Q1F A;  2QZ6 A;  3GSG A;  4BJP A;  2JCH A;  4B88 A;  1I2S A;  4DRT A;  1HVB A;  1TEM A;  4GKU A;  3W4Q A;  4DE3 A;  5M19 A;  4OKP A;  4JXG A;  1MBL A;  3B3X A;  5A93 A;  3W4O A;  3C7U A;  4OP8 A;  4E3L A;  3WS0 A;  3A3E A;  2IWB A;  3SS5 A;  2G2W A;  1NZO A;  4S2N C;  1WYC A;  3LEZ A;  4EQI A;  2ZQD A;  3UE3 A;  5CGS A;  5GLB A;  2DCF A;  4Z9Q A;  5GHX A;  2HDS A;  4WZ4 A;  3ZG8 B;  2WK0 A;  3VP3 A;  4JF4 A;  1GA9 A;  4C6Y A;  1SCW A;  4IBR A;  2ZQA A;  1MXO A;  4OOM A;  3IF6 A;  1LLB A;  1N4O A;  2XD5 A;  5F1G A;  2JC7 A;  3IH8 A;  3QNB A;  4KEN B;  2XD1 A;  1L0D A;  1EI5 A;  1K56 A;  2ZC5 B;  2FFY A;  2ZLY A;  3ZCZ A;  4JF6 A;  4QD4 A;  1ES3 A;  3NY4 A;  5CXW A;  3DWK A;  3N8R A;  4B4X A;  1RCJ A;  3ISG A;  2ZC7 A;  1K4E A;  2HDQ A;  3E2K A;  4KZ8 A;  4PM8 A;  3UY6 A;  4GDN A;  4QY6 A;  5TGF A;  3TOI A;  5JYP A;  5EUA A;  2ZJ9 A;  5F1F A;  4GNU A;  3I7J A;  3BFE A;  3M6B A;  3UO9 A;  3PBR A;  2EX2 A;  2OSU A;  1K4F A;  5FAO A;  2J9P A;  2P9V B;  2WGI A;  4K0W A;  5CER A;  5L2F A;  2DRW A;  3Q7V A;  1YMX A;  2ZQ7 A;  3IF6 C;  4FSF A;  1PZO A;  3G34 A;  5EVI A;  2RCX A;  4WEJ A;  5I94 A;  4R0Q A;  3GQZ A;  2EFU A;  1TDL A;  3CG5 A;  1K54 C;  4R23 A;  3PBQ A;  4E3J A;  1XX2 A;  3UE1 A;  4WZ5 A;  1QMF A;  3W8K A;  3LY3 A;  1MWU A;  1GA0 A;  2R9W A;  3G4P A;  4KG6 A;  3MBZ A;  1YLY A;  3G31 A;  3WRT A;  3RJU A;  1ZG6 A;  3IXD A;  2ZQ8 A;  4C3Q A;  2PU2 A;  1XPB A;  1FSY A;  1PWC A;  1GCE A;  1H5X A;  3A3F A;  3FKW A;  1K6S A;  2ZC6 B;  2ZD8 A;  4MNR A;  5A92 A;  1LL5 A;  3LO7 A;  2Y55 A;  4S2K A;  1ONG A;  2EX9 A;  3A3I A;  2PBY A;  3PAG A;  1SKF A;  4EBN A;  5FAQ A;  3HLE A;  4WEL A;  2Y2G A;  2ZC3 B;  1IYS A;  2OV5 A;  4KZ4 A;  5DTS A;  3O88 A;  3ZG9 B;  3PAE A;  4IVI A;  3S22 A;  3ZHH A;  3HL9 A;  3UDI A;  3OZH A;  4XUZ A;  4OLG A;  1K54 A;  3HBR A;  4RA7 A;  1L2S A;  5E2H A;  4OON A;  3IQA A;  2Y91 A;  5FI6 A;  3ZVT A;  1CK3 A;  4R3J A;  4X69 A;  5KZH A;  1IYQ A;  4S2J A;  1K55 C;  1YM1 A;  3NDE A;  1LHY A;  1KGF A;  5EPH A;  3AGE A;  3FV7 A;  4DE1 A;  3FWL A;  4Y0U A;  4N92 A;  2ZC4 B;  3VFF A;  3V3R A;  2WAE A;  3OC2 A;  3MZD A;  4O7D A;  3TSG A;  5HAP A;  1BT5 A;  4IED A;  4DE0 A;  1W7F A;  3PTE A;  3GVB A;  3NC8 A;  5EOO A;  2E8I A;  5IHV A;  5CEB A;  3V39 A;  5E2G A;  1E3U A;  1G6A A;  3P98 A;  3IHA A;  5D3O A;  4PM5 A;  5CHM A;  1C3B A;  2Y2O A;  4K91 A;  3ZFZ A;  3CJM A;  1O07 A;  4OQI A;  4OPZ A;  2P9V A;  3MXR A;  5DVA A;  3CZD A;  5HAI A;  1L0G A;  1BTL A;  4U3T A;  2WKE A;  3WRZ A;  4KZ5 A;  4OPY A;  3SS3 A;  3RXW A;  3MKF A;  2C5W B;  2CC1 A;  1TDG A;  4S2P A;  4XXR A;  3MZF A;  1IEM A;  2ZM8 A;  3PBT A;  2Y2J A;  1DJA A;  3Q81 A;  4E3M A;  4MBF A;  3HLW A;  4RVA A;  5A91 A;  3HLC A;  5J8X A;  1RGZ A;  3D4F A;  4LV3 A;  4DF6 A;  1IKG A;  3MFD A;  3Q7Z A;  4LCL A;  4XUX A;  2XK1 A;  1YT4 A;  4R4R A;  4UA7 A;  2Q9M A;  3LCE A;  1CEG A;  2XEP A;  3DWZ A;  1PWD A;  4DKI A;  2HPB A;  2IWC A;  3EQU A;  4RYE A;  3HUM A;  3O3V A;  1KE0 A;  5CGX A;  1CI8 A;  4WM9 A;  3BLS A;  2X01 A;  4OLD A;  5HL1 A;  4HBT A;  2WZZ A;  4KZ3 A;  4JXV A;  1JWP A;  3G35 A;  4E3K A;  1MWT A;  3MXS A;  1IKI A;  1ESU A;  4IVK A;  4P87 A;  5KMW A;  3GV9 A;  5HAR A;  4IBX A;  4JBF A;  3SH9 A;  5GLA A;  4E3N A;  4R3B A;  3BM6 A;  4BEN A;  5DF7 A;  3HVF A;  1M6K A;  4OOY A;  2XFT A;  4X68 A;  2B5R A;  4B4Z A;  4N1H A;  4P0M A;  3SH8 A;  5CTN A;  4ZJ3 A;  2WUQ A;  4K0X A;  4EV4 A;  2XF3 A;  4ZAM A;  3WS1 A;  2WKI A;  2HP9 A;  4S2M A;  1SDE A;  2QMI A;  2P74 A;  2WGW A;  2EFX A;  4JKT A;  4MEZ A;  4X55 A;  4BD0 A;  5A90 A;  1XA7 A;  4GOG A;  1MWR A;  2ZM2 A;  2A3U A;  3WS4 A;  3N6I A;  3IXB A;  5DTK A;  2HDU A;  3G2Z A;  3N4I A;  4JLF A;  1IYO A;  3UPO A;  3BFD A;  1FCN A;  5EVI D;  1LI0 A;  1K56 D;  3EQV A;  1EWZ A;  2X02 A;  2ZQ9 A;  3NDG A;  5JYO A;  5CHU A;  4UAA A;  4HEF A;  5FA7 A;  3QHY A;  5DTT A;  3VOY A;  3ZG5 A;  3NBL A;  4BQM A;  3IH9 A;  4OPQ A;  3UDF A;  4S2I A;  2EXB A;  1K55 A;  1HD8 A;  1NY0 A;  1SDN A;  2V20 A;  4NK3 A;  4ZTK A;  3WWX A;  2FFF B;  2ZM0 A;  5FQQ A;  4FH4 A;  1NYM A;  4JF5 A;  4FH2 A;  1ERM A;  3C7V A;  4OQH A;  4RX3 A;  4WMC D;  5GLC A;  3HLD A;  4QJG A;  1JTD A;  1G68 A;  1W79 A;  3BEB A;  4MLL A;  1YLT A;  4Y0O A;  4OPR A;  4RX2 A;  3VP0 A;  1PI5 A;  2HP6 A;  5TFQ A;  3C4P A;  5FDH A;  4KQQ A;  5EOE A;  4UA9 A;  3PBN A;  3LY4 A;  2EX8 A;  3IF6 B;  3VP1 A;  1ERQ A;  3A3J A;  5CGW A;  3VP2 A;  1WYB A;  4DDS A;  5AQ9 A;  2QPN A;  2UWX A;  2X71 A;  5G18 A;  1N9B A;  3C4O A;  1W8Y A;  1ZG4 A;  5EVI C;  4EWF A;  1Z6F A;  3UPN A;  1NXY A;  1CEF A;  1YQS A;  1SHV A;  1ES4 A;  1BZA A;  3CMZ A;  5FAS A;  3IHB A;  1IYP A;  1MPL A;  1XKZ A;  2XFS A;  1NRF A;  1JTG A;  3N8S A;  4OQG A;  4PM7 A;  1U60 A;  4BD1 A;  1CI9 A;  4WEK A;  2ZMA A;  4ZDX A;  3A3D A;  1AXB A;  4EBP A;  2Z2L B;  4GN2 A;  3QNC A;  5AQB A;  4ZJ1 A;  1KVM A;  3Q82 A; 
#chains in the Genus database with same CATH topology
 2XGN A;  3DTM A;  2H28 A;  3GR2 A;  4KG2 A;  4WMC A;  2VX8 A;  4GLQ A;  4OQ0 A;  1BLC A;  4LV0 A;  1K57 C;  1XJ2 A;  1L0E A;  3HLB A;  4PM6 A;  3BWL A;  1VQQ A;  3IXG A;  3BYD A;  4ETZ A;  4MBH A;  4E3O A;  2H0T A;  3W4P A;  3IWO A;  3ZDJ A;  2GJ3 A;  4BL3 A;  4LCM A;  3ZYT A;  2GDN A;  2VGL S;  5MC7 A;  3DTE A;  2WKP A;  3OLO A;  3BEC A;  2VK3 A;  1VHM A;  2XH9 A;  3UB5 P;  3BFG A;  5DFY A;  5EEC A;  1BYW A;  3S7N A;  2VGJ A;  1D06 A;  5FQJ A;  3H82 A;  5FI2 A;  3F1O B;  3FKV A;  4DXC A;  3R7W B;  3UE0 A;  3A0S A;  2O0Y A;  4HOI A;  1F2K A;  3JVU A;  1FCO A;  5F82 A;  3SW1 A;  2PD7 A;  4Q8I A;  3VSL A;  3G30 A;  3NCK A;  4B9O A;  4MBK A;  3D3O A;  4KQO A;  3EEA A;  3S7O A;  4GZB A;  4KQD A;  3C5A A;  3LIF A;  2Y2K A;  1ALQ A;  4ZJ2 A;  1CQA A;  1RP5 A;  1NRJ A;  2Y59 A;  3UB8 A;  2JKT M;  4R3A A;  5HSQ A;  1GHP A;  3AGF A;  2XR0 A;  2VZW A;  5DF9 A;  4E3I A;  4EUZ A;  4KZB A;  1NWZ A;  3OPH A;  1T1B A;  3CWF A;  1CJF A;  4NXG A;  4O0P A;  2H0Y A;  4OP5 A;  2IWD A;  5GHZ A;  4BMW A;  2L0W A;  1L0F A;  1PZP A;  1XA1 A;  4OOL A;  1OME A;  1K57 A;  1PI4 A;  4R70 A;  2VEA A;  3IT9 A;  3RTY A;  3FZC A;  2V9A A;  3UPP A;  4UQI S;  3KSI A;  2WYX A;  4YWZ A;  4D2O A;  3K3C A;  4JGO A;  3IBJ A;  4PM9 A;  5CEC A;  5AQA A;  3LI9 A;  4QY5 A;  4QPR A;  1GSW A;  3Q7V B;  2BAS A;  4MN5 A;  1KE4 A;  4L0L A;  3MQ0 A;  1TS8 A;  1W5D A;  1VEU A;  2LB9 A;  3H9W A;  5KIZ A;  2PR6 A;  2OLV A;  3ULF A;  1FCM A;  4HNB A;  2OLU A;  4KZA A;  2HV1 A;  2PBD P;  1GHM A;  2I72 A;  4PKY A;  4JPM A;  3VE4 A;  5FQK A;  5CRF A;  1X0O A;  3K3D A;  2EX6 A;  4YOF A;  2VKS A;  2OAQ 1;  1TEM A;  3LR4 A;  4GKU A;  3W4Q A;  4CLC C;  3W4O A;  4ARZ B;  4OP8 A;  3WS0 A;  1NZO A;  2D01 A;  3W2Z A;  3UE3 A;  4Y5F A;  3ZG8 B;  2A24 B;  1SCW A;  5TBM B;  1LLB A;  1EI5 A;  3T1S A;  2ZC5 B;  1SKO B;  4QD4 A;  5CXW A;  2O99 A;  3N8R A;  3ISG A;  3LR0 A;  2HZ5 A;  1YSQ A;  1ZHH B;  2ZOH A;  5EUA A;  4EES A;  4HI4 A;  2HF6 A;  3NOU C;  2EWW A;  2ZJ9 A;  2KOI A;  3M6B A;  3UO9 A;  1K4F A;  2Q0O A;  5FAO A;  2WGI A;  2DRW A;  1YMX A;  4R6L A;  2ZQ7 A;  1PZO A;  3UME A;  4L9F A;  2RCX A;  4JGP A;  3GQZ A;  4R0Q A;  4HJ3 A;  1K54 C;  2PAV P;  2LB5 A;  2JKF A;  4WZ5 A;  3W8K A;  2R9W A;  3G4P A;  4KG6 A;  3KSH A;  3MBZ A;  3G31 A;  3WRT A;  3IXD A;  4BBV A;  3A3F A;  4MNR A;  1K6S A;  3S7P A;  4S2K A;  1T19 A;  3LO7 A;  5L09 A;  1ONG A;  2OV5 A;  4KZ4 A;  3O88 A;  4NG2 A;  3S22 A;  5AJG A;  3OZH A;  3KYZ A;  3HBR A;  4LRX C;  3HJK A;  4R3J A;  5KZH A;  4S2J A;  3T1R A;  1YM1 A;  5EPH A;  5FEF A;  4DE1 A;  1G6O A;  3V3R A;  4O7D A;  3FC7 A;  3FPW A;  5CEB A;  4Y2F A;  1E3U A;  5D3O A;  4K91 A;  1G28 A;  3CUE A;  3ZFZ A;  1O07 A;  2P9V A;  3CZD A;  5HAI A;  1L0G A;  5K5B A;  1BTL A;  2WKE A;  3E0Y A;  3WRZ A;  4OPY A;  3MKF A;  4AFI A;  3T1Q B;  2C5W B;  3LEQ A;  4I3I A;  1IEM A;  4LLO B;  3HLW A;  5A91 A;  3HLC A;  1OJG A;  4DF6 A;  3MFD A;  3IX4 A;  2XK1 A;  4Y3I A;  1HLU P;  4UA7 A;  1CEG A;  3L9K A;  1PWD A;  3EGD C;  3IX8 A;  3O3V A;  4Q0J A;  5CGX A;  5EFW A;  3BLS A;  3C2W A;  3U4L P;  4OLD A;  4HBT A;  3S7Q A;  2CMN A;  4XT2 A;  4E3K A;  4IVK A;  5KMW A;  3GV9 A;  3UB7 A;  4IBX A;  4E3N A;  2W0N A;  4R3B A;  5DF7 A;  5EV0 A;  4WUJ A;  4P0M A;  2XF3 A;  5HD3 A;  4ZAM A;  2QMI A;  4BD0 A;  1LL8 A;  4X55 A;  4Q0I A;  3FG8 A;  3UPO A;  1F9I A;  1LI0 A;  3EQV A;  2X02 A;  2ZQ9 A;  4MMN A;  5FA7 A;  3QHY A;  3U2A A;  2GX5 A;  4BQM A;  3IH9 A;  4OPQ A;  4S2I A;  2EXB A;  2V20 A;  4NK3 A;  1NYM A;  2DMW A;  4WLA A;  4RX3 A;  4HIA A;  5GLC A;  1FIL A;  3QP6 A;  1G68 A;  3BEB A;  4MLL A;  2J80 A;  5FDH A;  1A0K A;  4DDS A;  2QPN A;  1NXY A;  2HJ9 C;  2VLG A;  3VE3 A;  1CEF A;  3QP4 A;  1JTG A;  4BD1 A;  1U60 A;  5AVF A;  2ZMA A;  4II7 A;  3A3D A;  2GNX A;  1AXB A;  2Z2L B;  4Y15 A;  1KVM A;  2A49 A;  3VP4 A;  2JKR I;  5HAQ A;  1NZU A;  2PU4 A;  4N1X A;  3HUO A;  5F83 A;  5C5K A;  4O01 A;  4NEE D;  2GZA A;  1KE3 A;  4HY8 A;  3HRE A;  1E25 A;  4DE2 A;  4YFM A;  5HL6 A;  2H5S A;  3DW0 A;  3ITA A;  1T18 A;  3IWQ A;  5E43 A;  5GHY A;  1Q2Q A;  3C8C A;  5KSH A;  2Y79 A;  3OCN A;  1QME A;  4HBU A;  3BQA A;  3OPP A;  2Q9N A;  3F1P A;  1OJ5 A;  2RL3 A;  3WS5 A;  2W3F A;  4KZ7 A;  3G2Y A;  2JBF A;  1ZC2 A;  4EU0 A;  4UHU A;  2W3H A;  4WYY A;  4KZ9 A;  5J7E A;  2I9V A;  2V1B A;  3TJZ C;  4FD8 A;  2OAP 1;  3VSK A;  1M40 A;  2ZMV A;  3F1O A;  1PW8 A;  3N8L A;  4E6X A;  3SS4 A;  3BFC A;  1ONH A;  3BLM A;  4S2O A;  3P01 A;  3T12 B;  1P9W A;  1DP8 A;  3SOI A;  3TG9 A;  1DJC A;  1YLJ A;  2V2F F;  3UB9 A;  2JN7 A;  2Y4A A;  5KSC A;  5E2E A;  4WZ5 C;  4Y0T A;  1E3U D;  2G7U A;  2R9X A;  4Q0H A;  4DXB A;  1O7E A;  5U47 A;  3CLO A;  1FOF A;  1UWP X;  1XGJ A;  4ID4 A;  3ZG0 A;  3WS2 A;  4LFU A;  2Z2M B;  5CHJ A;  4GS9 A;  5HZH A;  1PIO A;  1S1Z A;  2WKQ A;  5A8B A;  1KDS A;  3NIA A;  2ACG A;  3AGD A;  4L9E A;  3H82 B;  2P08 A;  1H0M A;  1LSW A;  3UDX A;  2PT7 A;  3GTC A;  3T4S A;  2V1Z A;  3E98 A;  1W8Q A;  3IXH A;  1ESI A;  3CAX A;  3OCL A;  3F1P B;  4CJN A;  4QB8 A;  4OH0 A;  4F3L A;  1V9Z A;  3O87 A;  3BY9 A;  2PR5 A;  5FQ9 A;  4NET A;  3S1Y A;  1OTB A;  1JVJ A;  4F94 A;  2ZMF A;  4GD6 A;  2JKT I;  3NEC A;  3PYP A;  2ZQC A;  3B47 A;  1MKM A;  4P85 A;  4LV1 A;  5EVL A;  3IX3 A;  3MMH A;  3NI9 A;  3PBO A;  4KQR A;  2A2L A;  1HTZ A;  2C6W B;  4CPK A;  1FSW A;  5GLD A;  2JE5 A;  1DP9 A;  3MSH A;  4BJP A;  1HVB A;  5M19 A;  4JXG A;  3B3X A;  3C7U A;  1PRQ A;  4S2N C;  3NJA A;  3LEZ A;  1P9R A;  2PDR A;  5CGS A;  5GLB A;  2DCF A;  5GHX A;  5EM0 A;  1AWI A;  4WZ4 A;  5HPF A;  3CI6 A;  4C6Y A;  4IBR A;  1MXO A;  4OOM A;  3IF6 A;  1N4O A;  2XD5 A;  2KDK A;  4KEN B;  1S1Y A;  2XD1 A;  4JF6 A;  3NY4 A;  1N9L A;  3K2N A;  3KYQ A;  1RCJ A;  1K4E A;  2HDQ A;  5JYP A;  4QY6 A;  1N9O A;  3T4O A;  4GNU A;  5DJT A;  3LR5 A;  3KSG A;  4WF0 A;  4K0W A;  3Q7V A;  2ZBB A;  2A24 A;  3G34 A;  4PHT A;  2K31 A;  3P7N A;  4E3J A;  1XX2 A;  4LPZ A;  2XA7 S;  4ETX A;  5AVE A;  1Z09 A;  4IJG A;  1TF1 A;  2M1C A;  1ZG6 A;  2OWH A;  4C3Q A;  1TS0 A;  1S4S A;  1FSY A;  1GCE A;  3EWK A;  1S4R A;  2ZD8 A;  3IS2 B;  1SKF A;  4EBN A;  4WEL A;  2Y2G A;  2ZC3 B;  5HWT A;  2JKR M;  3PAE A;  2P7J A;  3ZHH A;  4RQ9 A;  3JVV A;  3NHQ A;  2M7U A;  4OLG A;  1L2S A;  5FI6 A;  4EEP A;  2QWS A;  1K55 C;  4DJ3 A;  5F6A A;  3NDE A;  3AGE A;  1YSP A;  1N9N A;  3VFF A;  1TD5 A;  2WAE A;  3DTI A;  3TSG A;  1UWN X;  1P97 A;  4DE0 A;  3NC8 A;  4MCW A;  3V39 A;  1G6A A;  3JPU A;  5CHM A;  4HP4 A;  3MXR A;  5DVA A;  4U3T A;  3SS3 A;  2PRF A;  2CC1 A;  1TDG A;  4S2P A;  3MZF A;  3PBT A;  1DJA A;  4EXO A;  4MBF A;  4RVA A;  1RGZ A;  2Q9M A;  2XEP A;  3DWZ A;  4DKI A;  2IWC A;  3EQU A;  4RYE A;  3HUM A;  3SZT A;  1OTA A;  2VV8 A;  2X01 A;  5HL1 A;  4GHI A;  1MWT A;  4HQA A;  3MXS A;  2UV0 E;  5HAR A;  5GLA A;  1UGU A;  4BEN A;  1M6K A;  4NXB A;  4EV4 A;  5I5L A;  2MJ6 A;  2AVX A;  3WS1 A;  2HP9 A;  4MN7 A;  1SDE A;  2P74 A;  3V67 A;  2EFX A;  3E4P A;  1XA7 A;  4GOG A;  1MWR A;  3WS4 A;  3G2Z A;  1IYO A;  1FCN A;  4E04 A;  1EWZ A;  5CHU A;  4UAA A;  2QHK A;  3UDF A;  1K55 A;  1SDN A;  3WWX A;  3GDI A;  2ZM0 A;  1VEU B;  3BJN A;  4OQH A;  2B02 A;  2IA2 A;  1STZ A;  1YLT A;  3LIB A;  4OPR A;  3VP0 A;  1PI5 A;  5TFQ A;  4UA9 A;  3LY4 A;  2EX8 A;  2EWV A;  5AQ9 A;  5J4E A;  2UWX A;  1N9B A;  5EVI C;  4EWF A;  1Z6F A;  1YQS A;  1ES4 A;  2PYR A;  4HJ4 A;  1NRF A;  1W63 Q;  1CI9 A;  4EBP A;  4GN2 A;  4UEY A;  3A0V A;  4LV2 A;  3Q82 A;  1IFQ A;  2J7V A;  4R38 A;  3V50 A;  4WBG A;  2VJW A;  2G2U A;  3MZE A;  4ZRR A;  2XQZ A;  3RFB A;  2J9O A;  5CTM A;  5IS1 A;  4KUK A;  4LEN A;  3ZVW A;  5DF8 A;  5HD5 A;  5GL9 A;  1S0W A;  2DNS A;  4N9L A;  3VFH A;  4R4S A;  5EE8 A;  4KG5 A;  2FZ0 A;  1FR6 A;  5HFO A;  5BOH A;  3IBR A;  4XT2 B;  1KGG A;  5AQ7 A;  3LI8 A;  1ERO A;  3UN7 A;  1J9M A;  4ZBE A;  1MC0 A;  1TS6 A;  4O8G A;  2HJE A;  4G3K A;  2V0W A;  4LRZ E;  1FR1 A;  1BUE A;  1BUL A;  1K38 A;  3IF5 A;  1BLP A;  1LT0 A;  4Y7P A;  3ZGA B;  3V3S A;  3SH7 A;  3CHW P;  3P09 A;  2Y2Q A;  2WKR A;  1ZTU A;  3MKE A;  2BLS A;  4JXW A;  3QP8 A;  2VV7 A;  2R78 A;  4CLC E;  5DKK A;  1ZKJ A;  4MN6 A;  3O86 A;  3OPR A;  2K2N A;  1H8Z A;  1YLP A;  3OPL A;  3HLG A;  4U0T A;  4IHQ A;  3PBS A;  3T4L A;  3UB6 A;  2B18 A;  2PYP A;  4X1M A;  3T4T A;  2YKF A;  4FCF A;  4KZ6 A;  3VOZ A;  1VB6 A;  1BLH A;  2QJ5 A;  3RXX A;  3Q07 A;  4GHI B;  3R4K A;  4Y17 A;  5F69 A;  4GDB A;  4UA6 A;  2XSS A;  4X56 A;  1KGE A;  1ODV A;  3LFV A;  5HDC A;  4M3K A;  1H8M A;  1KVL A;  1XGI A;  5FAT A;  4KUO A;  1I2W A;  3LYX A;  2WGV A;  1I5Q A;  4EUV A;  5TR7 A;  5TJJ A;  4GCZ A;  2VGK A;  1D1J A;  3GMW A;  2D02 A;  3HJI A;  2QYB A;  4NXE A;  2WKH A;  3BRM A;  2E8J A;  4X53 A;  4YIN A;  2Y2N A;  4U0X A;  3FYZ A;  5E2F A;  4S2N A;  1ES5 A;  4GD8 A;  4X6T A;  3UE6 A;  4CLC D;  1MZU A;  3MF0 A;  3M6H A;  4P6B A;  4D60 A;  4Y13 A;  1SKO A;  5CED A;  3LIA A;  3N7W A;  2NUT C;  1JNU A;  4LRY C;  3JYI A;  1YLW A;  1S6R A;  1XFN A;  1XJ3 A;  2FH5 A;  2VV6 A;  1VM1 A;  1LL9 A;  2WZX A;  3E4Q A;  3ITB A;  3Q1F A;  2QZ6 A;  2W3E A;  3GSG A;  4DRT A;  2V1A A;  1T1A A;  3DBA A;  5A93 A;  4E3L A;  2W1R A;  2IWB A;  3ICY A;  3SS5 A;  2G2W A;  3EEH A;  1WYC A;  4EQI A;  2ZQD A;  3LUQ A;  4Z9Q A;  2WK0 A;  3VP3 A;  4JF4 A;  1GA9 A;  4UQI M;  2ZQA A;  3T4J A;  5F1G A;  3H7W B;  4P6Z M;  1K56 A;  4ME4 A;  1EW0 A;  4I5S A;  2HGV A;  2Y8H A;  4PAU A;  2ZLY A;  1ES3 A;  3MXQ A;  4GW9 A;  4JGQ A;  2O9A A;  3E2K A;  4NXF A;  5TGF A;  4NKP A;  5F1F A;  3QP5 A;  3H7W A;  3PBR A;  4DN0 A;  2OSU A;  2J9P A;  5CER A;  5TBM A;  3IF6 C;  4L9G A;  1F98 A;  5EVI A;  5I94 A;  1TDL A;  4R23 A;  3PBQ A;  2M7V A;  1KOU A;  4ARZ A;  3EOI A;  3UE1 A;  3L7H A;  1S66 L;  5FEG A;  1CF0 A;  2ZQ8 A;  2J3T C;  1XPB A;  3FKW A;  5A92 A;  1LL5 A;  1OTI A;  3A3I A;  5FAQ A;  3HLE A;  4EET B;  5DTS A;  4IVI A;  2P04 A;  3HL9 A;  3UDI A;  4BWI A;  2J3W A;  1K54 A;  4RA7 A;  2Y91 A;  1CK3 A;  2O9C A;  4M4X A;  3OBF A;  1IYQ A;  3BY8 A;  3FWL A;  4Y0U A;  5F5Y A;  4N92 A;  4IUK A;  1DP6 A;  3MR0 A;  2V8C A;  5HAP A;  4IED A;  3PTE A;  3GVB A;  5HWW A;  1OTE A;  3IHA A;  4F3L B;  2V0U A;  1C3B A;  4OQI A;  4GJ4 A;  3TRC A;  3B42 A;  2XA7 M;  4KZ5 A;  3CPT B;  1SZV A;  3LGO A;  3MFX A;  2Y2J A;  1DRM A;  3Q81 A;  4E3M A;  4LV3 A;  2W1T B;  1IKG A;  4XUX A;  4LCL A;  4G3V A;  1YT4 A;  4R4R A;  3LCE A;  2HPB A;  3LIC A;  2JHE A;  1CI8 A;  2QKP A;  2WZZ A;  1IKI A;  1ESU A;  4P87 A;  3G6O A;  3E4O A;  4JBF A;  4K08 A;  3BM6 A;  4PKY G;  4OOY A;  3VV4 A;  2B5R A;  2J3T D;  3B33 A;  3SH8 A;  4ZJ3 A;  1LSV A;  2WUQ A;  4I3J A;  2WKI A;  1Y28 A;  2WGW A;  4JKT A;  2A3U A;  1OTD A;  3N6I A;  1G5U A;  5DTK A;  2HDU A;  3N4I A;  5EVI D;  5HDS A;  5L8M A;  4HEF A;  2NUP C;  3UMD A;  5DTT A;  3ZG5 A;  3NBL A;  5LBR A;  1HD8 A;  1NY0 A;  4ZTK A;  4WL9 A;  4JF5 A;  4FH2 A;  4QJG A;  4WMC D;  3HLD A;  1JTD A;  1W79 A;  4RX2 A;  3C4P A;  1TS7 A;  4KQQ A;  1ERQ A;  5CGW A;  3VP2 A;  1WYB A;  3NOP C;  2L4R A;  5G18 A;  3C4O A;  1ZG4 A;  3UPN A;  2W3G A;  2PHY A;  1SHV A;  5G4Z A;  1BZA A;  5HPI A;  3CMZ A;  1IYP A;  1XKZ A;  2XFS A;  3N8S A;  4OQG A;  4WEK A;  4ZDX A;  3T4K A;  3QNC A;  1XJ6 A;  5FDS A;  4GB7 A;  4I38 A;  4I3A A;  1PYY A;  4X1L A;  4E6W A;  1YAX A;  2OWJ A;  5FI7 A;  1J3W A;  2EXA A;  3M2J A;  4PPR A;  2WAF A;  1YKD A;  3V5M A;  1DJB A;  1GSX A;  2Y2P A;  1D7E A;  5IT5 A;  5M18 A;  3IWI A;  1GHI A;  1VET A;  1OT9 A;  5HX9 A;  2H10 A;  4JXS A;  3DAV A;  4R1G A;  5HW3 A;  2Y2I A;  3D9Y A;  3GRJ A;  1NJ4 A;  4PMA A;  1BSG A;  4EER A;  3KX0 X;  3G32 A;  2O9B A;  3GEC A;  1IEL A;  3QP2 A;  1OT6 A;  5F68 A;  2Y2M A;  5EM1 A;  5FQI A;  4A5R A;  3M2K A;  2WAD A;  3BFF A;  1LI9 A;  5CX7 A;  4C75 A;  5FSR A;  1K0K A;  5DKL A;  3MS6 A;  3ZNT A;  1HZO A;  1DY6 A;  3D72 A;  4QHC A;  2XRN A;  3EGX C;  4LGW A;  3QP1 A;  2INW A;  2OOL A;  2WGW B;  4DDY A;  1KDW A;  4HES A;  3KO6 A;  4ESP A;  1K25 A;  3ZG7 B;  1MKI A;  1YLZ A;  1PWG A;  4DJ2 A;  1JWZ A;  4FTX A;  2YKH A;  5M1A A;  1PW1 A;  4HP9 A;  1BLS A;  2L1M A;  3VMA A;  2Y2H A;  5FAP A;  1H8Y A;  4EBL A;  3T50 A;  1ES2 A;  1XP4 A;  1ACF A;  1E4D A;  3BW6 A;  4EW7 A;  3RH8 B;  5FQM A;  2EA9 A;  4H8R A;  2XLN A;  4OVD A;  3UNW A;  2XDM A;  4H6J B;  5EVI B;  3PR6 A;  1WE4 A;  3CUE C;  1PFL A;  1VET B;  1XXM A;  1MY8 A;  2HP5 A;  1TVF A;  4N9K A;  5L10 A;  3KSF A;  2HDR A;  4HH2 A;  1K6R A;  1MWS A;  2Y2L A;  4S2L A;  2BG1 A;  2J8Y A;  3LIE A;  3F1N A;  4QU3 A;  2VGL M;  4BLM A;  1NYY A;  4BL2 A;  3S4X A;  1RGY A;  1JWV A;  3ZNY A;  3HLF A;  4IUH A;  1Q2P A;  3BQ8 A;  4I39 A;  2V8F A;  1FQG A;  1Y54 A;  3HUN A;  3IS2 A;  3E2L A;  4CLC B;  1YMS A;  3MQO A;  5IU1 A;  5DJU A;  2JCH A;  3LR3 A;  4B88 A;  1I2S A;  5G4Y A;  1P0Z A;  4HH3 A;  5EVE A;  4DE3 A;  4OKP A;  1MBL A;  3A3E A;  2XRO A;  2HDS A;  1LSX A;  2W3D A;  2PD8 A;  3A0R A;  2JC7 A;  3IH8 A;  3QNB A;  1L0D A;  3F1N B;  2FFY A;  1PNE A;  3ZCZ A;  3DWK A;  4B4X A;  2ZC7 A;  4KZ8 A;  4PM8 A;  3UY6 A;  4GDN A;  3TOI A;  4WN5 A;  2Z6C A;  3TW8 A;  3I7J A;  3BFE A;  3CPT A;  2EX2 A;  4P6Z S;  2P9V B;  5L2F A;  4FSF A;  4WEJ A;  4H6J A;  4Z1W A;  3C38 A;  4BBT A;  2EFU A;  3CG5 A;  1GSV A;  1QMF A;  2K7S A;  3LY3 A;  1MWU A;  1S67 L;  3OOV A;  2KLI A;  1GA0 A;  1NLY A;  2ZOI A;  1YLY A;  3LID A;  4JGR A;  1W63 M;  3RJU A;  2PU2 A;  1PWC A;  1H5X A;  2ZL1 B;  3VOL A;  2ZC6 B;  4GS9 B;  2Y55 A;  2EX9 A;  2PBY A;  3PAG A;  3C30 A;  1IYS A;  3HCY A;  3ZG9 B;  4QWO A;  1F5M A;  1H3Q A;  4YNR A;  4XUZ A;  2ZL1 A;  5E2H A;  4OON A;  3IQA A;  3ZVT A;  2W1T A;  4X69 A;  2B95 A;  1LHY A;  5HWV A;  1KGF A;  4HJ6 A;  3FV7 A;  2ZC4 B;  4FOF A;  3NUL A;  3OC2 A;  2JKG A;  3O5Y A;  3ZQ5 A;  3MZD A;  1BT5 A;  1W7F A;  3T1X A;  2QJ7 A;  3TE8 A;  5EOO A;  2E8I A;  5IHV A;  5E2G A;  5FL3 A;  3P98 A;  1XJ4 A;  1V9Y A;  4PM5 A;  1WA9 A;  2Y2O A;  3CIT A;  1Y4O A;  3CJM A;  4OPZ A;  2Z6D A;  3RXW A;  2KX6 A;  4XXR A;  2ZM8 A;  2W27 A;  3MJQ A;  1XFQ A;  3FPV A;  3R7W A;  4DMZ A;  5J8X A;  3D4F A;  4BBU A;  5DFX A;  3Q7Z A;  4EQ1 A;  1L3L A;  4G3W A;  1KE0 A;  4WM9 A;  4EEU A;  4X25 A;  4KZ3 A;  3KYE A;  4JXV A;  1JWP A;  3G35 A;  3PXP A;  3SH9 A;  3HVF A;  4HHD A;  2XFT A;  2BTF P;  4X68 A;  4B4Z A;  4N1H A;  5CTN A;  4K0X A;  4S2M A;  4CLC A;  4MDZ A;  4MEZ A;  1OPX A;  5A90 A;  2ZM2 A;  3IXB A;  1IOU A;  4JLF A;  3BFD A;  5HDD A;  3NOT C;  1K56 D;  3MQQ A;  3NDG A;  5JYO A;  1YPR A;  3VOY A;  4B93 A;  1T1C A;  3PHY A;  2VA0 A;  2FFF B;  5L07 A;  5FQQ A;  4FH4 A;  1ERM A;  3C7V A;  4Y0O A;  2HP6 A;  5EOE A;  3PBN A;  3IF6 B;  3VP1 A;  3A3J A;  4CQH A;  2X71 A;  3T4Q A;  1W8Y A;  1NLZ A;  5FAS A;  3IHB A;  4PM7 A;  1MPL A;  5J3W A;  3DTK A;  4FUW A;  1FIK A;  5AQB A;  4ZJ1 A; 
#chains in the Genus database with same CATH homology
 2A49 A;  2XGN A;  3DTM A;  4KG2 A;  2J7V A;  3GR2 A;  3V50 A;  4WMC A;  3VP4 A;  4OQ0 A;  1BLC A;  4LV0 A;  4WBG A;  1K57 C;  1L0E A;  3HLB A;  2G2U A;  4GB7 A;  4PM6 A;  5HAQ A;  3MZE A;  1NZU A;  1VQQ A;  2XQZ A;  2PU4 A;  3IXG A;  2J9O A;  4N1X A;  3HUO A;  5CTM A;  1PYY A;  3BYD A;  4LEN A;  4MBH A;  3ZVW A;  4E6W A;  5DF8 A;  5F83 A;  4E3O A;  2H0T A;  5GL9 A;  1S0W A;  2DNS A;  5FI7 A;  3W4P A;  4N9L A;  3VFH A;  1KE3 A;  3IWO A;  4R4S A;  3HRE A;  1E25 A;  2EXA A;  5EE8 A;  3ZDJ A;  4DE2 A;  4YFM A;  4KG5 A;  3M2J A;  4PPR A;  4BL3 A;  2WAF A;  4LCM A;  2GDN A;  1FR6 A;  5HFO A;  2H5S A;  3V5M A;  5BOH A;  1DJB A;  3DW0 A;  3ITA A;  2Y2P A;  3IWQ A;  5M18 A;  3IWI A;  5E43 A;  5GHY A;  1GHI A;  1Q2Q A;  1KGG A;  5AQ7 A;  5KSH A;  3BEC A;  1ERO A;  2XH9 A;  3OCN A;  5HX9 A;  2H10 A;  4JXS A;  1QME A;  4HBU A;  3UN7 A;  3BFG A;  4R1G A;  5HW3 A;  1J9M A;  5EEC A;  2Y2I A;  3GRJ A;  3OPP A;  2Q9N A;  4ZBE A;  1NJ4 A;  4PMA A;  1BSG A;  2VGJ A;  2RL3 A;  3G32 A;  3WS5 A;  4KZ7 A;  3G2Y A;  1FR1 A;  1BUE A;  1BUL A;  1ZC2 A;  2JBF A;  1IEL A;  5FQJ A;  4UHU A;  5FI2 A;  1K38 A;  4WYY A;  2Y2M A;  5FQI A;  4KZ9 A;  4A5R A;  3FKV A;  3IF5 A;  4DXC A;  3UE0 A;  4FD8 A;  3M2K A;  3VSK A;  1BLP A;  2WAD A;  1M40 A;  3BFF A;  4Y7P A;  3ZGA B;  1LI9 A;  1PW8 A;  1FCO A;  3V3S A;  3SH7 A;  3N8L A;  4C75 A;  5F82 A;  5FSR A;  3P09 A;  4E6X A;  3SS4 A;  2Y2Q A;  3MKE A;  3ZNT A;  3BFC A;  4Q8I A;  1HZO A;  3VSL A;  1DY6 A;  2BLS A;  3G30 A;  3NCK A;  1ONH A;  4MBK A;  4KQO A;  4JXW A;  4QHC A;  3BLM A;  4GZB A;  4S2O A;  1ZKJ A;  3O86 A;  3C5A A;  2WGW B;  3SOI A;  3OPR A;  3TG9 A;  2Y2K A;  1ALQ A;  1KDW A;  1DJC A;  4ZJ2 A;  4DDY A;  4HES A;  1H8Z A;  1YLJ A;  1RP5 A;  1YLP A;  3OPL A;  3HLG A;  1K25 A;  2Y59 A;  2V2F F;  4U0T A;  3ZG7 B;  2Y4A A;  5KSC A;  5E2E A;  1MKI A;  3PBS A;  1YLZ A;  1PWG A;  4WZ5 C;  4Y0T A;  4FCF A;  1GHP A;  3AGF A;  2XR0 A;  5DF9 A;  1JWZ A;  4KZ6 A;  3VOZ A;  4E3I A;  4EUZ A;  1BLH A;  1E3U D;  4KZB A;  3Q07 A;  3RXX A;  2R9X A;  3OPH A;  4DXB A;  4GDB A;  1O7E A;  4UA6 A;  5U47 A;  2H0Y A;  4OP5 A;  2IWD A;  5GHZ A;  1FOF A;  1XGJ A;  4ID4 A;  4X56 A;  1L0F A;  1KGE A;  1PZP A;  1XA1 A;  1OME A;  4OOL A;  5M1A A;  1K57 A;  1PW1 A;  3ZG0 A;  1PI4 A;  3WS2 A;  2Z2M B;  5CHJ A;  1PIO A;  3IT9 A;  3FZC A;  4M3K A;  1BLS A;  1KVL A;  3UPP A;  1KDS A;  3VMA A;  3NIA A;  2Y2H A;  5FAP A;  1H8Y A;  1XGI A;  4EBL A;  1ES2 A;  1XP4 A;  5FAT A;  2WYX A;  1I2W A;  4D2O A;  1E4D A;  3AGD A;  2WGV A;  1I5Q A;  4PM9 A;  5CEC A;  5FQM A;  4H8R A;  2XLN A;  5TR7 A;  3UDX A;  4OVD A;  5AQA A;  3UNW A;  3GTC A;  2XDM A;  2V1Z A;  2VGK A;  3GMW A;  3IXH A;  1W8Q A;  1ESI A;  4QY5 A;  3OCL A;  5EVI B;  4CJN A;  2WKH A;  3BRM A;  1WE4 A;  4OH0 A;  4QB8 A;  3Q7V B;  4X53 A;  4YIN A;  1KE4 A;  2Y2N A;  3O87 A;  4L0L A;  4U0X A;  1XXM A;  1W5D A;  3FYZ A;  1MY8 A;  5FQ9 A;  5E2F A;  2HP5 A;  4NET A;  1TVF A;  3S1Y A;  4S2N A;  1JVJ A;  4N9K A;  4F94 A;  1ES5 A;  4GD8 A;  4X6T A;  2HDR A;  2OLV A;  3M6H A;  4GD6 A;  4P6B A;  1K6R A;  1MWS A;  1FCM A;  2Y2L A;  4S2L A;  2BG1 A;  5CED A;  2J8Y A;  2ZQC A;  3N7W A;  4QU3 A;  2OLU A;  4KZA A;  1NYY A;  4BLM A;  4BL2 A;  4P85 A;  3S4X A;  3JYI A;  1RGY A;  1GHM A;  1YLW A;  1S6R A;  2I72 A;  4LV1 A;  1JWV A;  3NI9 A;  5EVL A;  3ZNY A;  3HLF A;  1Q2P A;  3PBO A;  4KQR A;  4JPM A;  4LV2 A;  1HTZ A;  1FQG A;  1VM1 A;  1LL9 A;  1Y54 A;  5CRF A;  2WZX A;  2C6W B;  5FQK A;  4CPK A;  1FSW A;  3HUN A;  3E2L A;  3ITB A;  1YMS A;  2JE5 A;  5GLD A;  2EX6 A;  3Q1F A;  2QZ6 A;  3GSG A;  4BJP A;  2JCH A;  4B88 A;  1I2S A;  4DRT A;  1HVB A;  1TEM A;  4GKU A;  3W4Q A;  4DE3 A;  5M19 A;  4OKP A;  4JXG A;  1MBL A;  3B3X A;  5A93 A;  3W4O A;  3C7U A;  4OP8 A;  4E3L A;  3WS0 A;  3A3E A;  2IWB A;  3SS5 A;  2G2W A;  1NZO A;  4S2N C;  1WYC A;  3LEZ A;  4EQI A;  2ZQD A;  3UE3 A;  5CGS A;  5GLB A;  2DCF A;  4Z9Q A;  5GHX A;  2HDS A;  4WZ4 A;  3ZG8 B;  2WK0 A;  3VP3 A;  4JF4 A;  1GA9 A;  4C6Y A;  1SCW A;  4IBR A;  2ZQA A;  1MXO A;  4OOM A;  3IF6 A;  1LLB A;  1N4O A;  2XD5 A;  5F1G A;  2JC7 A;  3IH8 A;  3QNB A;  4KEN B;  2XD1 A;  1L0D A;  1EI5 A;  1K56 A;  2ZC5 B;  2FFY A;  2ZLY A;  3ZCZ A;  4JF6 A;  4QD4 A;  1ES3 A;  3NY4 A;  5CXW A;  3DWK A;  3N8R A;  4B4X A;  1RCJ A;  3ISG A;  2ZC7 A;  1K4E A;  2HDQ A;  3E2K A;  4KZ8 A;  4PM8 A;  3UY6 A;  4GDN A;  4QY6 A;  5TGF A;  3TOI A;  5JYP A;  5EUA A;  2ZJ9 A;  5F1F A;  4GNU A;  3I7J A;  3BFE A;  3M6B A;  3UO9 A;  3PBR A;  2EX2 A;  2OSU A;  1K4F A;  5FAO A;  2J9P A;  2P9V B;  2WGI A;  4K0W A;  5CER A;  5L2F A;  2DRW A;  3Q7V A;  1YMX A;  2ZQ7 A;  3IF6 C;  4FSF A;  1PZO A;  3G34 A;  5EVI A;  2RCX A;  4WEJ A;  5I94 A;  4R0Q A;  3GQZ A;  2EFU A;  1TDL A;  3CG5 A;  1K54 C;  4R23 A;  3PBQ A;  4E3J A;  1XX2 A;  3UE1 A;  4WZ5 A;  1QMF A;  3W8K A;  3LY3 A;  1MWU A;  1GA0 A;  2R9W A;  3G4P A;  4KG6 A;  3MBZ A;  1YLY A;  3G31 A;  3WRT A;  3RJU A;  1ZG6 A;  3IXD A;  2ZQ8 A;  4C3Q A;  2PU2 A;  1XPB A;  1FSY A;  1PWC A;  1GCE A;  1H5X A;  3A3F A;  3FKW A;  1K6S A;  2ZC6 B;  2ZD8 A;  4MNR A;  5A92 A;  1LL5 A;  3LO7 A;  2Y55 A;  4S2K A;  1ONG A;  2EX9 A;  3A3I A;  2PBY A;  3PAG A;  1SKF A;  4EBN A;  5FAQ A;  3HLE A;  4WEL A;  2Y2G A;  2ZC3 B;  1IYS A;  2OV5 A;  4KZ4 A;  5DTS A;  3O88 A;  3ZG9 B;  3PAE A;  4IVI A;  3S22 A;  3ZHH A;  3HL9 A;  3UDI A;  3OZH A;  4XUZ A;  4OLG A;  1K54 A;  3HBR A;  4RA7 A;  1L2S A;  5E2H A;  4OON A;  3IQA A;  2Y91 A;  5FI6 A;  3ZVT A;  1CK3 A;  4R3J A;  4X69 A;  5KZH A;  1IYQ A;  4S2J A;  1K55 C;  1YM1 A;  3NDE A;  1LHY A;  1KGF A;  5EPH A;  3AGE A;  3FV7 A;  4DE1 A;  3FWL A;  4Y0U A;  4N92 A;  2ZC4 B;  3VFF A;  3V3R A;  2WAE A;  3OC2 A;  3MZD A;  4O7D A;  3TSG A;  5HAP A;  1BT5 A;  4IED A;  4DE0 A;  1W7F A;  3PTE A;  3GVB A;  3NC8 A;  5EOO A;  2E8I A;  5IHV A;  5CEB A;  3V39 A;  5E2G A;  1E3U A;  1G6A A;  3P98 A;  3IHA A;  5D3O A;  4PM5 A;  5CHM A;  1C3B A;  2Y2O A;  4K91 A;  3ZFZ A;  3CJM A;  1O07 A;  4OQI A;  4OPZ A;  2P9V A;  3MXR A;  5DVA A;  3CZD A;  5HAI A;  1L0G A;  1BTL A;  4U3T A;  2WKE A;  3WRZ A;  4KZ5 A;  4OPY A;  3SS3 A;  3RXW A;  3MKF A;  2C5W B;  2CC1 A;  1TDG A;  4S2P A;  4XXR A;  3MZF A;  1IEM A;  2ZM8 A;  3PBT A;  2Y2J A;  1DJA A;  3Q81 A;  4E3M A;  4MBF A;  3HLW A;  4RVA A;  5A91 A;  3HLC A;  5J8X A;  1RGZ A;  3D4F A;  4LV3 A;  4DF6 A;  1IKG A;  3MFD A;  3Q7Z A;  4LCL A;  4XUX A;  2XK1 A;  1YT4 A;  4R4R A;  4UA7 A;  2Q9M A;  3LCE A;  1CEG A;  2XEP A;  3DWZ A;  1PWD A;  4DKI A;  2HPB A;  2IWC A;  3EQU A;  4RYE A;  3HUM A;  3O3V A;  1KE0 A;  5CGX A;  1CI8 A;  4WM9 A;  3BLS A;  2X01 A;  4OLD A;  5HL1 A;  4HBT A;  2WZZ A;  4KZ3 A;  4JXV A;  1JWP A;  3G35 A;  4E3K A;  1MWT A;  3MXS A;  1IKI A;  1ESU A;  4IVK A;  4P87 A;  5KMW A;  3GV9 A;  5HAR A;  4IBX A;  4JBF A;  3SH9 A;  5GLA A;  4E3N A;  4R3B A;  3BM6 A;  4BEN A;  5DF7 A;  3HVF A;  1M6K A;  4OOY A;  2XFT A;  4X68 A;  2B5R A;  4B4Z A;  4N1H A;  4P0M A;  3SH8 A;  5CTN A;  4ZJ3 A;  2WUQ A;  4K0X A;  4EV4 A;  2XF3 A;  4ZAM A;  3WS1 A;  2WKI A;  2HP9 A;  4S2M A;  1SDE A;  2QMI A;  2P74 A;  2WGW A;  2EFX A;  4JKT A;  4MEZ A;  4X55 A;  4BD0 A;  5A90 A;  1XA7 A;  4GOG A;  1MWR A;  2ZM2 A;  2A3U A;  3WS4 A;  3N6I A;  3IXB A;  5DTK A;  2HDU A;  3G2Z A;  3N4I A;  4JLF A;  1IYO A;  3UPO A;  3BFD A;  1FCN A;  5EVI D;  1LI0 A;  1K56 D;  3EQV A;  1EWZ A;  2X02 A;  2ZQ9 A;  3NDG A;  5JYO A;  5CHU A;  4UAA A;  4HEF A;  5FA7 A;  3QHY A;  5DTT A;  3VOY A;  3ZG5 A;  3NBL A;  4BQM A;  3IH9 A;  4OPQ A;  3UDF A;  4S2I A;  2EXB A;  1K55 A;  1HD8 A;  1NY0 A;  1SDN A;  2V20 A;  4NK3 A;  4ZTK A;  3WWX A;  2FFF B;  2ZM0 A;  5FQQ A;  4FH4 A;  1NYM A;  4JF5 A;  4FH2 A;  1ERM A;  3C7V A;  4OQH A;  4RX3 A;  4WMC D;  5GLC A;  3HLD A;  4QJG A;  1JTD A;  1G68 A;  1W79 A;  3BEB A;  4MLL A;  1YLT A;  4Y0O A;  4OPR A;  4RX2 A;  3VP0 A;  1PI5 A;  2HP6 A;  5TFQ A;  3C4P A;  5FDH A;  4KQQ A;  5EOE A;  4UA9 A;  3PBN A;  3LY4 A;  2EX8 A;  3IF6 B;  3VP1 A;  1ERQ A;  3A3J A;  5CGW A;  3VP2 A;  1WYB A;  4DDS A;  5AQ9 A;  2QPN A;  2UWX A;  2X71 A;  5G18 A;  1N9B A;  3C4O A;  1W8Y A;  1ZG4 A;  5EVI C;  4EWF A;  1Z6F A;  3UPN A;  1NXY A;  1CEF A;  1YQS A;  1SHV A;  1ES4 A;  1BZA A;  3CMZ A;  5FAS A;  3IHB A;  1IYP A;  1MPL A;  1XKZ A;  2XFS A;  1NRF A;  1JTG A;  3N8S A;  4OQG A;  4PM7 A;  1U60 A;  4BD1 A;  1CI9 A;  4WEK A;  2ZMA A;  4ZDX A;  3A3D A;  1AXB A;  4EBP A;  2Z2L B;  4GN2 A;  3QNC A;  5AQB A;  4ZJ1 A;  1KVM A;  3Q82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...