1DJAA

Structure of beta-lactamase precursor, k73h mutant, at 298k
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
258
structure length
258
Chain Sequence
MKELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSHAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Structure and kinetics of the beta-lactamase mutants S70A and K73H from Staphylococcus aureus PC1.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 93
structure length 258
sequence length 258
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1996-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1djaA00
1GHIA 3W4OA 5A93A 4ZBEA 4LV3A 1MWUA 4DE1A 1QMEA 4RA7A 3GV9A 5DTKA 3NBLA 4BENA 3OCLA 5GHYA 3C4PA 1SKFA 3ZHHA 2ZC4B 2XDMA 5FI2A 2EX6A 3DWKA 4QU3A 4S2PA 1QMFA 4OPRA 5HAIA 4DE0A 3ZG9B 2WAEA 3SOIA 3WRTA 1FOFA 2WAFA 3FV7A 1Z6FA 3LEZA 4HESA 4GDNA 3SH9A 3IHAA 2EX8A 2FFFB 3DW0A 4DF6A 4PM7A 5CGXA 3WRZA 2G2WA 1MXOA 2EX2A 4WMCA 4FSFA 1RGZA 4KZ4A 1DY6A 5DF7A 3ZFZA 5J8XA 3HLFA 4S2JA 4KZ6A 4HBTA 2I72A 1SDNA 3HVFA 3IXGA 4KG5A 4E3NA 2ZC7A 3N4IA 3IWOA 3UE0A 4OOMA 1WYBA 1W5DA 2BLSA 3OZHA 3PTEA 2ZMAA 4JBFA 4S2OA 1FR1A 3TSGA 4E6WA 5CHMA 1PYYA 4N1HA 3IXDA 2HP9A 4FH4A 1WE4A 3O87A 4FH2A 5EVID 1MWRA 3HLGA 5E2GA 1YM1A 4BJPA 1TDLA 1L0GA 3IF6B 4OQGA 3BFCA 4F94A 5CTNA 3Q81A 3HREA 5A91A 2E8IA 1ES5A 4NETA 3HUNA 2IWBA 4CPKA 3P09A 3VSLA 1H5XA 5EOOA 1JVJA 2VGKA 3VOYA 3N8RA 4MNRA 3UO9A 3MFDA 3PBRA 5GLAA 1K57C 1G68A 3VP3A 1ERMA 2Q9NA 3NC8A 5DTSA 3LY3A 1YLWA 2EXBA 1TVFA 1ES3A 1ZG6A 3G31A 4B4ZA 3SS5A 3G30A 2GDNA 4JPMA 3SH7A 2XR0A 5F1FA 5FDHA 3ZVTA 5AQ7A 5FASA 4ZJ1A 3CZDA 2XQZA 3G32A 3M6BA 5AQ9A 3VFHA 1HZOA 2A49A 4OP5A 4QY6A 2JBFA 1YMSA 2WGWB 4PPRA 4C3QA 4D2OA 3TOIA 2V1ZA 3HLWA 1M40A 3WS4A 1MBLA 5BOHA 1YQSA 3ZG0A 1ONHA 1SDEA 1K55A 2Y91A 3ZNTA 3IXBA 4C6YA 1CK3A 3BECA 4JF6A 1TDGA 4PM6A 3ZG7B 1I5QA 3OPRA 2Y59A 3A3FA 1ESUA 3AGDA 3M6HA 3BEBA 4R3JA 4KZ5A 1NY0A 1YT4A 2JE5A 4R1GA 1XGJA 2JCHA 2V2FF 2WZXA 2FFYA 1K25A 5KSHA 1Y54A 3WS0A 5FQMA 4O7DA 2H5SA 3NDEA 5FI6A 4BQMA 3ZDJA 2ZM8A 5CERA 3M2JA 3S22A 1KE4A 1RGYA 1E25A 4GDBA 4DXBA 1H8YA 1YLZA 1K38A 3MKFA 4GZBA 3PAGA 4WZ4A 1BLCA 1YMXA 3A3JA 3MZEA 3NDGA 1ESIA 4K0WA 4X68A 4ZJ3A 4YFMA 2Z2LB 4GNUA 2WKHA 1CI8A 4KQOA 1LI0A 2J7VA 3BFFA 4FD8A 2XD5A 4OOYA 1N4OA 3LO7A 4OQIA 2EXAA 2IWCA 3FKVA 4P85A 4RX2A 2XFSA 3RXWA 1NRFA 2PBYA 4N9KA 1H8ZA 2V20A 5FAQA 4S2KA 3ZCZA 4CJNA 4GB7A 1GHPA 4Z9QA 1BT5A 2HDSA 4U0XA 3IF6A 2WADA 4ID4A 1W7FA 5EVIB 3A3DA 1ONGA 1U60A 3HL9A 4K91A 3V5MA 1RCJA 2XGNA 4OOLA 2HDQA 1GCEA 4GOGA 1HD8A 3HBRA 3ITAA 1ZC2A 5D3OA 1E3UA 1OMEA 2Y2NA 4DDSA 1LHYA 4EBNA 1MPLA 3IWIA 2Y2JA 4WEKA 4EV4A 1XKZA 1BSGA 1BULA 4M3KA 4A5RA 1N9BA 2VGJA 3BLMA 3ZVWA 1C3BA 4EWFA 4P0MA 3VFFA 4JLFA 4LV2A 2WKEA 2P9VA 4S2LA 4Y0TA 4DRTA 2UWXA 2ZC6B 4LCLA 4JXGA 3O3VA 3C7VA 2WGIA 5GL9A 5TR7A 1NYYA 4BLMA 4MLLA 3Q7VB 5FA7A 1SHVA 5FI7A 4E3KA 4OQHA 4BD0A 3ITBA 3ZG8B 3SS4A 1K56D 4IVIA 1BLSA 1BZAA 1JWZA 1L0EA 3IF5A 3MBZA 3Q82A 3V39A 4E3IA 5CTMA 1KE0A 3I7JA 3BM6A 4ZJ2A 4ZDXA 2ZC5B 3OCNA 1G6AA 1S6RA 5HW3A 4ZTKA 1NZOA 3UPNA 1KGGA 1K4FA 2Y2PA 5E43A 1MWSA 3M2KA 3QNCA 3UPOA 4XXRA 4S2IA 4OLDA 4UHUA 4B4XA 2JC7A 3C5AA 3IHBA 3OC2A 3PBSA 4OPQA 2HDRA 2HPBA 5F83A 3PBQA 4X53A 5HAQA 5KSCA 2X71A 3DTMA 3UDIA 3UPPA 5KMWA 4IVKA 4X69A 2R9WA 3N6IA 1XPBA 3Q7ZA 4JKTA 5L2FA 3VP1A 4E3OA 4QJGA 2Y2IA 3LY4A 4DXCA 1W8QA 1XGIA 5KZHA 3GTCA 5EECA 1DJBA 2WKIA 3QNBA 4KZ3A 1KVMA 3HLDA 3RJUA 2C5WB 1PI5A 3HLBA 3Q1FA 1K6SA 5I94A 3Q07A 2DNSA 4E3LA 3N8LA 1EWZA 3VP0A 3D4FA 2DCFA 3MKEA 1IYSA 4IBXA 2G2UA 2ZD8A 4QB8A 1JTDA 2J9OA 1L2SA 4DE3A 1I2SA 2Q9MA 2XK1A 3EQVA 4KG2A 2J8YA 4S2MA 1FSYA 3GR2A 1K55C 3PBNA 4KG6A 4WM9A 1EROA 5EVIA 3FKWA 3N7WA 4IBRA 5FQIA 2ZQDA 4WEJA 5A92A 3MZFA 1CEGA 5GLBA 2C6WB 5F82A 1VQQA 3OPLA 5GHXA 4JXVA 4OPZA 5A90A 1M6KA 1FQGA 2HP6A 3EQUA 3MXRA 4OKPA 1FR6A 5CRFA 4LV0A 5FQKA 5G18A 2P74A 2DRWA 4YINA 1DJCA 4QHCA 3W4PA 3G4PA 3LCEA 4KZ9A 4OONA 2OLUA 1WYCA 1NYMA 3JYIA 4WBGA 2RL3A 3BFEA 1XXMA 3C7UA 5FSRA 1IKIA 5CEBA 5AQBA 4PMAA 5TGFA 4EUZA 2Z2MB 3NIAA 1IYQA 1ZG4A 2XF3A 1BLHA 4RVAA 4EBPA 1PWCA 3G34A 4PM9A 3UY6A 5CHUA 3E2LA 3GQZA 1JWVA 3ISGA 1I2WA 3GRJA 3HLEA 2HDUA 2Y2OA 4BL2A 3NY4A 1KDWA 4OH0A 1XX2A 3ZGAB 3G2ZA 1XA1A 4KZBA 5GLDA 3CG5A 1W8YA 4OLGA 2PU2A 2B5RA 2XD1A 3GVBA 3FWLA 3IF6C 1ES2A 4E6XA 5FQ9A 3HUMA 4EBLA 4BD1A 1JTGA 3IT9A 4DKIA 5CHJA 2QMIA 2ZQCA 4WMCD 1NJ4A 2ZQAA 2Y4AA 3IH8A 4WZ5C 5E2EA 3A3EA 3S1YA 4QD4A 3O88A 1NXYA 2ZM0A 4WZ5A 5FQJA 3IWQA 3HLCA 4N92A 1PZOA 2Y55A 4KQRA 1AXBA 4UA9A 2EFXA 4H8RA 2Y2QA 4JXWA 4Y0OA 2R9XA 1K4EA 3BRMA 1LI9A 3AGEA 3GMWA 4LV1A 3VOZA 2OLVA 3IH9A 3MZDA 2Y2LA 4GD8A 4XUZA 3P98A 5DF8A 1GA9A 4KZ8A 3V50A 1K54A 2H0TA 4E3MA 2X02A 1BTLA 3UNWA 1FCNA 3BLSA 2WUQA 5EVLA 1GA0A 1KDSA 4MBFA 5DF9A 4ZAMA 1YLJA 3GSGA 2BG1A 4N9LA 2WGWA 5CGWA 1K6RA 3QHYA 3VSKA 2EFUA 2J9PA 2WGVA 4X55A 3CMZA 4RYEA 4S2NC 1YLYA 5FQQA 5DTTA 1MWTA 1EI5A 4JXSA 4PM8A 5U47A 4S2NA 3DWZA 2XEPA 4X56A 4QY5A 3W4QA 4Q8IA 4GKUA 2RCXA 4U3TA 5EPHA 2Y2HA 1Q2QA 3NCKA 1KGFA 3IXHA 4WYYA 1FCOA 2WZZA 2Y2GA 1PW8A 2ZQ7A 3PBTA 3BYDA 4OPYA 3S4XA 2A3UA 1ALQA 1KGEA 3W8KA 4PM5A 5CEDA 2WYXA 3VP4A 4WELA 1MKIA 3BFDA 5F1GA 5TFQA 5CGSA 1HVBA 5GHZA 4L0LA 3UDFA 1MY8A 5DVAA 2XFTA 3WS2A 3FYZA 4UAAA 1FCMA 5EUAA 4OP8A 1KE3A 5EE8A 5M18A 4E3JA 2H10A 4KQQA 4DE2A 1K56A 1PI4A 3O86A 4KZAA 5HX9A 1YLPA 5EVIC 1IYPA 5FATA 3OPPA 2ZC3B 4MEZA 2EX9A 3UDXA 5E2FA 2PU4A 1O07A 3UE3A 1Q2PA 1IYOA 1YLTA 2ZLYA 3G2YA 2ZM2A 3C4OA 2XLNA 3N8SA 4U0TA 4XUXA 5JYPA 2QPNA 4DDYA 3VMAA 1L0DA 4JF5A 3A3IA 5GLCA 3SH8A 3UE1A 3WS1A 1CEFA 4KZ7A 4RX3A 1K57A 4R4RA 4GN2A 2P9VB 1RP5A 3FZCA 3NI9A 1S0WA 3PBOA 3WWXA 3AGFA 1J9MA 5EOEA 1CI9A 5FAPA 5FAOA 2WK0A 4IEDA 4LENA 4X6TA 1SCWA 5E2HA 5JYOA 5M19A 1W79A 2ZQ8A 3V3SA 3E2KA 3RXXA 2ZQ9A 3VP2A 2H0YA 4Y7PA 3HUOA 1PWDA 1PW1A 4P87A 1E4DA 1IKGA 1LL9A 3Q7VA 3B3XA 3SS3A 4UA6A 2OSUA 4KENB 4MBKA 4Y0UA 1KVLA 4OQ0A 2HP5A 4B88A 1HTZA 3V3RA 3WS5A 1PZPA 3TG9A 4HEFA 2Y2KA 3PAEA 3MXSA 1O7EA 2CC1A 1E3UD 4R23A 1BLPA 4EQIA 1IELA 4UA7A 5HL1A 1LL5A 5HFOA 5CXWA 1LLBA 4R0QA 1NZUA 4MBHA 3OPHA 1DJAA 3CJMA 4HBUA 1TEMA 4NK3A 5AQAA 1ZKJA 4LCMA 4P6BA 4GD6A 4R3BA 4JF4A 2Y2MA 3ZG5A 5HARA 2X01A 1ERQA 5CECA 5IHVA 1PIOA 1VM1A 1FSWA 1GHMA 1L0FA 2ZJ9A 2QZ6A 4FCFA 4N1XA 3UN7A 3ZNYA 2IWDA 4OVDA 4BL3A 3IQAA 5M1AA 1JWPA 5HAPA 1XA7A 1XP4A 1ES4A 1IEMA 1BUEA 2OV5A 2XH9A 3BFGA 3G35A 4K0XA 1PWGA 4C75A 4R4SA 1K54C
chains in the Genus database with same CATH superfamily
1GHIA 1GSWA 1MKMA 2HJ9C 3W4OA 2HJEA 1TS7A 2M7UA 4O01A 3B42A 4WUJA 4JGQA 3PYPA 3C4PA 1SKFA 4HIAA 3DWKA 3MFXA 3ZYTA 4HHDA 3SH9A 4ETXA 3WRZA 2O9BA 3NJAA 1XFNA 2W0NA 3ZFZA 4S2JA 4HBTA 2I72A 4Y17A 2PBDP 4E04A 3BW6A 3IWOA 1W5DA 3OZHA 4FTXA 2XA7S 2ZMAA 4S2OA 1FR1A 5J3WA 4Y13A 3C2WA 1PYYA 3O87A 3LYXA 2J3TD 1MWRA 3HLGA 4I5SA 5E2GA 3RFBA 1TDLA 4OQGA 1T19A 2VV6A 3HREA 4NXFA 2IWBA 4ME4A 3P09A 5EOOA 4MNRA 1OJ5A 3NC8A 1YLWA 1S1YA 3G30A 3SH7A 4Y2FA 3ZVTA 2YKHA 3IS2A 3TE8A 3G32A 5AQ9A 2JBFA 2WGWB 2JKRM 3HLWA 3DTEA 1YQSA 4LFUA 1K55A 2Y91A 4C6YA 1CK3A 3UB9A 1T1CA 2JKTI 4JF6A 1W63M 3ZG7B 2VA0A 4X1LA 5AVFA 3AGDA 2V2FF 5KSHA 4BQMA 2ZM8A 3M2JA 2AVXA 1KE4A 1H8YA 3PAGA 4K0WA 4IHQA 2Z2LB 3IX8A 4EERA 4KQOA 3ZG8B 4RX2A 4OQIA 2EXAA 1NRFA 2J3WA 2V20A 4UQIS 4GB7A 4Z9QA 2ZBBA 5EVIB 3V5MA 4P6ZM 1RCJA 2XGNA 2OAP1 2W1RA 5TJJA 4KUKA 4OOLA 1XJ3A 1HD8A 2GJ3A 2VGJA 3VFFA 4LV2A 4S2LA 1VETA 1LSWA 1FIKA 1NYYA 3Q7VB 5FA7A 4PKYA 4BD0A 3PXPA 3ZQ5A 1L0EA 3MBZA 4E3IA 1G6AA 1S6RA 4Y3IA 3T12B 1NZOA 1OTIA 3UPNA 1K4FA 4LRXC 4B4XA 2JC7A 4OPQA 5KSCA 5F83A 3PBQA 2VGLS 3UPPA 5KMWA 2R9WA 1XPBA 5L2FA 2JKTM 2Y2IA 3LY4A 1CF0A 3O5YA 3JPUA 3HLDA 3Q1FA 1XJ4A 2DNSA 3RH8B 4IUKA 3H82B 1TD5A 4QB8A 1L2SA 4KG2A 1H8MA 4S2MA 4CQHA 3GR2A 1K55C 3PBNA 5EVIA 3N7WA 4IBRA 3DTIA 2VLGA 1ACFA 5J4EA 4EU0A 1VQQA 3DTKA 1BYWA 1J3WA 1FQGA 3EQUA 3MXRA 4OKPA 1FR6A 5CRFA 5FQKA 3LIAA 1DJCA 1MZUA 3LIDA 1STZA 2OLUA 3FPVA 1WYCA 3BFEA 1CQAA 3BJNA 2Z2MB 2XF3A 1BLHA 4RVAA 2G7UA 3E2LA 3GQZA 3GRJA 4BL2A 1KDWA 3G2ZA 1W8YA 4OLGA 2PU2A 1ES2A 1G28A 2PDRA 5CHJA 1NJ4A 2ZQAA 2Y4AA 1LSVA 4WZ5C 3D3OA 3S1YA 1F9IA 2O0YA 4Y0OA 3AGEA 4LV1A 3MZDA 3H7WB 4UEYA 4GD8A 4XUZA 4WLAA 1K54A 4E3MA 4PAUA 3BLSA 4NG2A 2NUPC 1NRJA 1F2KA 2BG1A 2EFUA 3CMZA 4RYEA 5FQQA 5DTTA 4O0PA 1MWTA 3U4LP 5MC7A 4X56A 4GKUA 1F5MA 2RCXA 3CI6A 2LB5A 4EQ1A 4YWZA 1KGFA 4WYYA 1FCOA 2P08A 4QWOA 1PW8A 1ALQA 2ZOIA 2VEAA 1A0KA 4DJ3A 1XJ2A 3C38A 4L0LA 2Z6DA 3IBRA 2XFTA 5EUAA 1XJ6A 4HJ6A 2INWA 4E3JA 4KQQA 1K56A 1YLPA 5EVIC 5FATA 2JKFA 2EX9A 3MS6A 3UE3A 2PU4A 1IYOA 2ZLYA 3C4OA 4NXBA 3N8SA 3VMAA 4EUVA 2VZWA 3E4QA 4KZ7A 1K57A 4R4RA 3MQOA 4GN2A 1RP5A 3FZCA 1S0WA 3WWXA 1UGUA 1CI9A 2WK0A 2A24A 1SCWA 3SW1A 5JYOA 1W79A 2OWJA 2H0YA 3HUOA 1PW1A 4P87A 3MQQA 4UA6A 4KENB 4B88A 1KVLA 2HP5A 3A0VA 1HTZA 4HH3A 3WS5A 2Y2KA 3P7NA 4F3LA 1VEUB 1IELA 1LLBA 1TEMA 4NK3A 4YNRA 4LCMA 4JF4A 2L1MA 5HARA 5IHVA 1PIOA 1VM1A 1GHMA 4FCFA 3ZNYA 2IWDA 4OVDA 4BL3A 5M1AA 5HAPA 2VV8A 1XA7A 2W1TA 3F1OB 2WKPA 3G35A 4RA7A 1PWGA 1K54C 1OTBA 4LV3A 5EFWA 4DE1A 1SZVA 4BENA 3NBLA 1LSXA 3ZHHA 2ZL1B 1FILA 2EX6A 4OPRA 5HAIA 3SOIA 1FOFA 2WAFA 1Z6FA 3L7HA 3LEZA 4HJ3A 2XA7M 3IHAA 3DW0A 3RTYA 2M7VA 4Q0JA 1D1JA 2EX2A 1P0ZA 3HLFA 4E3NA 4KG5A 3HVFA 3IXGA 3N4IA 2OAQ1 4M4XA 4ESPA 2W3DA 3TSGA 4FH4A 5HDDA 1ZHHB 4FH2A 5EVID 4WN5A 1YM1A 4BJPA 1L0GA 1T1AA 4F94A 1V9ZA 2E8IA 2KOIA 2R78A 3LEQA 4CPKA 2M1CA 3KO6A 5GLAA 1K57C 3VP3A 1VHMA 3PHYA 1WA9A 4CLCE 2Y8HA 3P01A 5HDCA 3SS5A 5FASA 4ZJ1A 4Y5FA 2XQZA 1HZOA 4QY6A 5AJGA 5IS1A 3TOIA 3KX0X 1ONHA 3BECA 1OPXA 3S7QA 1TDGA 5FEGA 2Y59A 2J80A 3C8CA 3BEBA 1NY0A 1YT4A 2FH5A 2WZXA 3CPTB 1K25A 1Y54A 5FI6A 3S22A 4UQIM 1RGYA 1K38A 4KQDA 4GZBA 4WZ4A 2PD8A 3A3JA 3NDGA 4BWIA 4GNUA 3T1RA 3KSHA 1LI0A 4FD8A 1N4OA 3LO7A 3FKVA 4P85A 4N9KA 1H8ZA 4DMZA 5EV0A 3UB6A 3ZCZA 2P04A 4U0XA 4HH2A 2GNXA 1ONGA 1S1ZA 3OBFA 4NKPA 5EM0A 4DJ2A 5LBRA 1ZC2A 3NOUC 1E3UA 4DDSA 1MPLA 2Y2JA 4WEKA 4EV4A 2PD7A 4BMWA 1N9BA 1OTDA 1OT6A 3MQ0A 1PNEA 4EWFA 4P0MA 3T50A 2P9VA 4HP4A 2ZC6B 4LCLA 3GECA 3O3VA 5TR7A 2WGIA 4BLMA 4MLLA 2EWWA 4OQHA 1K56D 4IVIA 1BZAA 1G5UA 2VGLM 3B33A 1KE0A 4ZJ2A 3A0RA 3OCNA 3TJZC 4ZTKA 1KGGA 3LIBA 4CLCB 4RQ9A 5F6AA 3OC2A 2HPBA 2CMNA 5HAQA 2Y79A 3N6IA 5IT5A 3VP1A 4E3OA 2IA2A 1W8QA 5KZHA 5EECA 1DJBA 3BWLA 3CITA 3QNBA 4GCZA 3RJUA 2C5WB 1PI5A 3N8LA 1EWZA 3D4FA 2DCFA 4BBVA 4GW9A 1JTDA 3KSFA 2Q9MA 4KG6A 3FKWA 4HJ4A 4L9EA 1UWNX 2ZQDA 5FQIA 5A92A 4XT2B 5F82A 3L9KA 5A90A 1M6KA 1D7EA 5G18A 5DFXA 3LR0A 3W4PA 4OONA 3IX4A 2RL3A 4X25A 3NIAA 1ZG4A 1V9YA 3G34A 1N9NA 5CHUA 1I2WA 2D01A 3NY4A 3ZGAB 1XX2A 1XA1A 3CG5A 3VE3A 2B5RA 1LL8A 3FWLA 5FQ9A 3FG8A 1JTGA 3MR0A 2ZQCA 3IH8A 2PT7A 1H0MA 4QD4A 2PHYA 2JN7A 1NXYA 4WZ5A 1S4SA 4UA9A 1TS8A 2Y2QA 3ULFA 1K4EA 3GMWA 2P7JA 3IH9A 3HJIA 4Q0IA 2YKFA 5DF8A 1GA9A 1BTLA 1FCNA 2WUQA 3R7WB 3GSGA 2PAVP 4N9LA 2WGWA 2WGVA 4S2NC 3UMEA 1EI5A 4PM8A 3DWZA 4U3TA 4IUHA 2Y2HA 5EPHA 3D72A 2Y2GA 3W8KA 2ZOHA 1DRMA 1PRQA 5C5KA 5CEDA 5L09A 3VP4A 3BFDA 3UB8A 5F1GA 4FUWA 5HPFA 5GHZA 2GZAA 1MY8A 5DVAA 3FYZA 3LUQA 4UAAA 1FCMA 4R3AA 2VJWA 3K3CA 2JHEA 4OP8A 2QJ7A 2VV7A 4KUOA 2EWVA 4MEZA 3UDXA 5E2FA 3G2YA 2ZM2A 5JYPA 2QPNA 4ETZA 3KYEA 4H6JB 4DDYA 4JF5A 3SH8A 2D02A 5GLCA 3UE1A 1CEFA 2ZMVA 3NI9A 2XROA 3PBOA 3U2AA 5EOEA 5FAPA 5FAOA 4IEDA 4DN0A 4X6TA 3F1NB 3RXXA 1N9OA 2QYBA 1Z09A 1N9LA 5HDSA 1IKGA 1LL9A 3Q7VA 3V3RA 4HEFA 5HPIA 1O7EA 3FPWA 2CC1A 1E3UD 4R23A 4EQIA 1LL5A 5HFOA 5CXWA 1P9RA 5DFYA 1DJAA 3CJMA 5DJTA 5AQAA 1ZKJA 4HY8A 2Y2MA 2X01A 3LI9A 4QPRA 1FSWA 2QZ6A 3BY8A 3IQAA 2V0WA 1XP4A 1ES4A 4BBTA 2OV5A 3BFGA 3K2NA 4R4SA 2O9CA 3OCLA 3HJKA 3H82A 5HZHA 2XDMA 4QU3A 3VE4A 1QMFA 4DE0A 2WAEA 5F68A 2H28A 3FV7A 4HESA 2EX8A 4H6JA 4DF6A 5CGXA 4PHTA 4WMCA 5J8XA 4KZ6A 2XSSA 5FL3A 4GJ4A 2XRNA 4OOMA 4EW7A 1WYBA 5L07A 1SKOB 4E6WA 4MDZA 4N1HA 3QP2A 1WE4A 4I3JA 4MN7A 2V9AA 3IF6B 5CTNA 3Q81A 1CJFA 4R70A 1ES5A 4NETA 2K2NA 2NUTC 3VSLA 3CHWP 3UO9A 1G68A 5DTSA 2EXBA 4HOIA 1ES3A 5K5BA 2EA9A 4MCWA 3G31A 4B4ZA 4JPMA 3KSGA 5FDHA 4EEUA 2W3EA 5AQ7A 4GHIB 5HD5A 3M6BA 2A49A 3H7WA 4OP5A 1YMSA 4PPRA 5TBMB 4C3QA 4GS9B 4D2OA 2V1ZA 2V1BA 1SDEA 3NOTC 1Y4OA 3UB7A 3ZNTA 3TW8A 1DP8A 4PM6A 4HP9A 3LR4A 2V0UA 4KZ5A 2JE5A 2WKRA 3WS0A 3EEHA 5FQMA 2H5SA 3ZDJA 5CERA 1YAXA 4GDBA 1YLZA 3MKFA 1BLCA 3MZEA 1OJGA 4YFMA 4OOYA 2J7VA 1P97A 3RXWA 4EXOA 5FAQA 4S2KA 4CJNA 1GHPA 3IF6A 1T18A 1W7FA 3A3DA 1U60A 3E4OA 4K91A 3UB5P 5HSQA 4II7A 2HDQA 4LLOB 3HBRA 3ITAA 5D3OA 4EBNA 1XKZA 2PR6A 1BSGA 1BULA 3A0SA 3NOPC 3EOIA 5G4ZA 3BLMA 2W3FA 4A5RA 3ZVWA 1C3BA 4JLFA 5AVEA 4DRTA 3JVUA 3C7VA 3T1XA 3T4KA 4AFIA 2ZMFA 5FI7A 4BBUA 3ITBA 5TBMA 3SS4A 4I3IA 3V39A 3MSHA 5CTMA 4ZDXA 3CLOA 3EWKA 4JGRA 4NEED 4WL9A 2Y2PA 5E43A 3QNCA 3UPOA 4XXRA 4S2IA 3PBSA 2HDRA 4X53A 1VEUA 1HLUP 3DTMA 3UDIA 4IVKA 3LICA 3Q7ZA 2V1AA 3D9YA 4DXCA 1XGIA 3GTCA 3HCYA 4KZ3A 1KVMA 1GSVA 3HLBA 1K6SA 2W3GA 1NWZA 3F1OA 3T4JA 4IBXA 1IYSA 2G2UA 2ZD8A 4DE3A 1NLZA 2XK1A 3EQVA 2J8YA 1AWIA 1EROA 2ZL1A 1OT9A 2C6WB 5GHXA 2JKGA 3MF0A 2HP6A 3S7PA 2K7SA 4LV0A 1XFQA 5F5YA 3G4PA 4O8GA 3LCEA 4KZ9A 3JYIA 2HZ5A 1IKIA 4NXGA 5CEBA 5AQBA 3F1PB 5FEFA 4EUZA 4EBPA 3ISGA 1JWVA 3EGDC 3HLEA 3C30A 4OH0A 1MC0A 5GLDA 3T4QA 2XD1A 3GVBA 3IF6C 4E6XA 3HUMA 4LPZA 4DKIA 2QMIA 2W3HA 4WMCD 3A3EA 2LB9A 3QP1A 3O88A 3TRCA 4R6LA 5FQJA 3HLCA 2KLIA 4N92A 4KQRA 1AXBA 1IFQA 4I39A 4G3VA 1LI9A 3VOZA 4Z1WA 4KZ8A 3V50A 1GA0A 4L9GA 5J7EA 1DP9A 5CGWA 1K6RA 2J9PA 3T4TA 4IJGA 4JXSA 5U47A 4S2NA 1OTEA 3VOLA 4QY5A 4Q8IA 1X0OA 3LR5A 2WZZA 3PBTA 3BYDA 2A3UA 5FDSA 1KGEA 3CPTA 4PM5A 3KYQA 1MKIA 3F1PA 3V67A 5TFQA 1YSPA 3UDFA 1S66L 4K08A 3KSIA 1KE3A 4R38A 5EE8A 5M18A 2H10A 4DE2A 1PI4A 2QWSA 3O86A 1TF1A 4KZAA 5HX9A 1IYPA 3OPPA 1Q2PA 1YLTA 4XUXA 4B9OA 4EETB 2PR5A 2WKQA 1VETB 5HL6A 3OOVA 3AGFA 3NHQA 4Q0HA 3VV4A 2OWHA 2KX6A 5E2HA 3E2KA 3MXQA 1G6OA 1E4DA 3B3XA 2MJ6A 3SS3A 4MBKA 4OQ0A 3QP5A 3PAEA 3GDIA 4R0QA 4MBHA 4HBUA 4R3BA 3ZG5A 3CWFA 4CLCA 2ZJ9A 1L0FA 1P9WA 4I3AA 1IEMA 1BUEA 2O99A 2XH9A 1UWPX 4D60A 5A93A 4HQAA 4ZBEA 1MWUA 1QMEA 2B02A 3GV9A 5DTKA 4B93A 5GHYA 3T1SA 1JNUA 2ZC4B 5FI2A 4S2PA 3ZG9B 3WRTA 4FOFA 3T1QB 4GDNA 2FFFB 4PM7A 5KIZA 2G2WA 1MXOA 1ODVA 4XT2A 4FSFA 1RGZA 4KZ4A 1DY6A 5DF7A 1SDNA 2Q0OA 2ZC7A 3BQAA 4LRZE 3UE0A 2DMWA 2BLSA 3PTEA 4JBFA 2BASA 1EW0A 3S7NA 5CHMA 3IXDA 2HP9A 2OOLA 3LI8A 1PFLA 2E8JA 3BFCA 5A91A 3HUNA 4Y15A 3BY9A 3SZTA 2O9AA 1H5XA 1JVJA 2VGKA 3VOYA 3N8RA 3MFDA 3PBRA 1Y28A 1ERMA 2Q9NA 3LY3A 1TVFA 1ZG6A 2GDNA 3K3DA 2XR0A 3CAXA 5F1FA 2Z6CA 1DP6A 3E4PA 4NXEA 2FZ0A 3CZDA 2PYPA 3VFHA 3WS4A 1M40A 1MBLA 5DKKA 5BOHA 4ZRRA 3ZG0A 3H9WA 3R7WA 3IXBA 2VK3A 1W63Q 1K0KA 1I5QA 3OPRA 3T4SA 3A3FA 1ESUA 3M6HA 4R3JA 4R1GA 1XGJA 2JCHA 2FFYA 4CLCC 4O7DA 3NDEA 3W2ZA 1E25A 4DXBA 1YMXA 2VKSA 1ESIA 4X68A 4ZJ3A 2QHKA 3OLOA 2WKHA 1TS6A 1CI8A 3BFFA 2XD5A 2IWCA 2XFSA 2HV1A 2PBYA 3LR3A 1OTAA 1BT5A 2HDSA 3CUEA 2WADA 3PR6A 4ID4A 3HL9A 3MJQA 4EEPA 3BQ8A 1GCEA 4GOGA 1ZTUA 3T4LA 4G3WA 2VX8A 1OMEA 2Y2NA 1LHYA 3IWIA 3EGXC 1GSXA 2A24B 4M3KA 4X1MA 2ACGA 2QKPA 2PRFA 4P6ZS 2WKEA 4Y0TA 2UWXA 4JXGA 5GL9A 3FC7A 1SHVA 5DKLA 4E3KA 3F1NA 2B95A 1BLSA 3IF5A 1JWZA 3Q82A 4F3LB 3I7JA 3BM6A 2ZC5B 3E0YA 3QP6A 5HW3A 3B47A 3NECA 3IBJA 1MWSA 3M2KA 4YOFA 3JVVA 3G6OA 4OLDA 4UHUA 3C5AA 2L0WA 3IHBA 2X71A 4X69A 4JKTA 1KOUA 2W1TB 4QJGA 2WKIA 3IX3A 1D06A 3R4KA 2GX5A 5I94A 3Q07A 4E3LA 3VP0A 2PYRA 3MKEA 3UE6A 2J9OA 1I2SA 2V8FA 4WM9A 1F98A 1FSYA 5L10A 4WEJA 3MZFA 1CEGA 4LGWA 5GLBA 2HGVA 4CLCD 5I5LA 3OPLA 2UV0E 4HI4A 4JXVA 4OPZA 4PKYG 2P74A 2DRWA 4YINA 4QHCA 1H3QA 1NYMA 4WBGA 5FSRA 1XXMA 3C7UA 3LFVA 2K31A 4PMAA 5TGFA 5DJUA 1TS0A 1IYQA 1PWCA 4PM9A 3QP8A 3UY6A 1YPRA 1SKOA 2HDUA 2Y2OA 4WF0A 5EVEA 4KZBA 4MMNA 5G4YA 3T4OA 3CUEC 4EBLA 4BD1A 3IT9A 5E2EA 2ZM0A 3IWQA 1PZOA 2Y55A 2EFXA 4H8RA 4JXWA 2R9XA 4HNBA 3BRMA 3E98A 2OLVA 2QJ5A 2Y2LA 3LIFA 3P98A 3MMHA 2H0TA 2L4RA 2X02A 3UNWA 5A8BA 3EEAA 4GHIA 5EVLA 1KDSA 4MBFA 2A2LA 5DF9A 4ZAMA 1YLJA 3QHYA 3VSKA 4X55A 4GS9A 1YLYA 1YSQA 1S67L 5HWTA 4ARZB 2XEPA 5F69A 3W4QA 5EM1A 1Q2QA 3NCKA 3IXHA 3LGOA 2BTFP 2ZQ7A 4OPYA 3S4XA 1YKDA 5L8MA 2WYXA 5HD3A 4WELA 3ICYA 4MN5A 4LRYC 4MN6A 5CGSA 1HVBA 1LT0A 3WS2A 4EESA 4G3KA 4GLQA 4I38A 5HWWA 2J3TC 3S7OA 2ZC3B 1O07A 4U0TA 2XLNA 1IOUA 1L0DA 3QP4A 2I9VA 3A3IA 3DBAA 3WS1A 4RX3A 1T1BA 2B18A 2P9VB 1J9MA 1NLYA 4LENA 5M19A 2ZQ8A 3UMDA 3V3SA 4JGOA 2ZQ9A 3VP2A 3LIEA 4Y7PA 1PWDA 1L3LA 2W27A 5CX7A 2OSUA 4Y0UA 1PZPA 2V8CA 3TG9A 3MXSA 1BLPA 4JGPA 4UA7A 5HL1A 3NULA 4ARZA 1NZUA 3OPHA 4P6BA 4GD6A 1ERQA 5CECA 2KDKA 5HWVA 2JKRI 4N1XA 3UN7A 1JWPA 3KYZA 3DAVA 3IS2B 5IU1A 1S4RA 1VB6A 4K0XA 4C75A 2HF6A 4L9FA
chains in the Genus database with same CATH topology
1GHIA 3W4OA 5A93A 4ZBEA 4LV3A 1MWUA 4DE1A 1QMEA 4RA7A 3GV9A 5DTKA 3NBLA 4BENA 3OCLA 5GHYA 3C4PA 1SKFA 3ZHHA 2ZC4B 2XDMA 5FI2A 2EX6A 3DWKA 4QU3A 4S2PA 1QMFA 4OPRA 5HAIA 4DE0A 3ZG9B 2WAEA 3SOIA 3WRTA 1FOFA 2WAFA 3FV7A 1Z6FA 3LEZA 4HESA 4GDNA 3SH9A 3IHAA 2EX8A 2FFFB 3DW0A 4DF6A 4PM7A 5CGXA 3WRZA 2G2WA 1MXOA 2EX2A 4WMCA 4FSFA 1RGZA 4KZ4A 1DY6A 5DF7A 3ZFZA 5J8XA 3HLFA 4S2JA 4KZ6A 4HBTA 2I72A 1SDNA 3HVFA 3IXGA 4KG5A 4E3NA 2ZC7A 3N4IA 3IWOA 3UE0A 4OOMA 1WYBA 1W5DA 2BLSA 3OZHA 3PTEA 2ZMAA 4JBFA 4S2OA 1FR1A 3TSGA 4E6WA 5CHMA 1PYYA 4N1HA 3IXDA 2HP9A 4FH4A 1WE4A 3O87A 4FH2A 5EVID 1MWRA 3HLGA 5E2GA 1YM1A 4BJPA 1TDLA 1L0GA 3IF6B 4OQGA 3BFCA 4F94A 5CTNA 3Q81A 3HREA 5A91A 2E8IA 1ES5A 4NETA 3HUNA 2IWBA 4CPKA 3P09A 3VSLA 1H5XA 5EOOA 1JVJA 2VGKA 3VOYA 3N8RA 4MNRA 3UO9A 3MFDA 3PBRA 5GLAA 1K57C 1G68A 3VP3A 1ERMA 2Q9NA 3NC8A 5DTSA 3LY3A 1YLWA 2EXBA 1TVFA 1ES3A 1ZG6A 3G31A 4B4ZA 3SS5A 3G30A 2GDNA 4JPMA 3SH7A 2XR0A 5F1FA 5FDHA 3ZVTA 5AQ7A 5FASA 4ZJ1A 3CZDA 2XQZA 3G32A 3M6BA 5AQ9A 3VFHA 1HZOA 2A49A 4OP5A 4QY6A 2JBFA 1YMSA 2WGWB 4PPRA 4C3QA 4D2OA 3TOIA 2V1ZA 3HLWA 1M40A 3WS4A 1MBLA 5BOHA 1YQSA 3ZG0A 1ONHA 1SDEA 1K55A 2Y91A 3ZNTA 3IXBA 4C6YA 1CK3A 3BECA 4JF6A 1TDGA 4PM6A 3ZG7B 1I5QA 3OPRA 2Y59A 3A3FA 1ESUA 3AGDA 3M6HA 3BEBA 4R3JA 4KZ5A 1NY0A 1YT4A 2JE5A 4R1GA 1XGJA 2JCHA 2V2FF 2WZXA 2FFYA 1K25A 5KSHA 1Y54A 3WS0A 5FQMA 4O7DA 2H5SA 3NDEA 5FI6A 4BQMA 3ZDJA 2ZM8A 5CERA 3M2JA 3S22A 1KE4A 1RGYA 1E25A 4GDBA 4DXBA 1H8YA 1YLZA 1K38A 3MKFA 4GZBA 3PAGA 4WZ4A 1BLCA 1YMXA 3A3JA 3MZEA 3NDGA 1ESIA 4K0WA 4X68A 4ZJ3A 4YFMA 2Z2LB 4GNUA 2WKHA 1CI8A 4KQOA 1LI0A 2J7VA 3BFFA 4FD8A 2XD5A 4OOYA 1N4OA 3LO7A 4OQIA 2EXAA 2IWCA 3FKVA 4P85A 4RX2A 2XFSA 3RXWA 1NRFA 2PBYA 4N9KA 1H8ZA 2V20A 5FAQA 4S2KA 3ZCZA 4CJNA 4GB7A 1GHPA 4Z9QA 1BT5A 2HDSA 4U0XA 3IF6A 2WADA 4ID4A 1W7FA 5EVIB 3A3DA 1ONGA 1U60A 3HL9A 4K91A 3V5MA 1RCJA 2XGNA 4OOLA 2HDQA 1GCEA 4GOGA 1HD8A 3HBRA 3ITAA 1ZC2A 5D3OA 1E3UA 1OMEA 2Y2NA 4DDSA 1LHYA 4EBNA 1MPLA 3IWIA 2Y2JA 4WEKA 4EV4A 1XKZA 1BSGA 1BULA 4M3KA 4A5RA 1N9BA 2VGJA 3BLMA 3ZVWA 1C3BA 4EWFA 4P0MA 3VFFA 4JLFA 4LV2A 2WKEA 2P9VA 4S2LA 4Y0TA 4DRTA 2UWXA 2ZC6B 4LCLA 4JXGA 3O3VA 3C7VA 2WGIA 5GL9A 5TR7A 1NYYA 4BLMA 4MLLA 3Q7VB 5FA7A 1SHVA 5FI7A 4E3KA 4OQHA 4BD0A 3ITBA 3ZG8B 3SS4A 1K56D 4IVIA 1BLSA 1BZAA 1JWZA 1L0EA 3IF5A 3MBZA 3Q82A 3V39A 4E3IA 5CTMA 1KE0A 3I7JA 3BM6A 4ZJ2A 4ZDXA 2ZC5B 3OCNA 1G6AA 1S6RA 5HW3A 4ZTKA 1NZOA 3UPNA 1KGGA 1K4FA 2Y2PA 5E43A 1MWSA 3M2KA 3QNCA 3UPOA 4XXRA 4S2IA 4OLDA 4UHUA 4B4XA 2JC7A 3C5AA 3IHBA 3OC2A 3PBSA 4OPQA 2HDRA 2HPBA 5F83A 3PBQA 4X53A 5HAQA 5KSCA 2X71A 3DTMA 3UDIA 3UPPA 5KMWA 4IVKA 4X69A 2R9WA 3N6IA 1XPBA 3Q7ZA 4JKTA 5L2FA 3VP1A 4E3OA 4QJGA 2Y2IA 3LY4A 4DXCA 1W8QA 1XGIA 5KZHA 3GTCA 5EECA 1DJBA 2WKIA 3QNBA 4KZ3A 1KVMA 3HLDA 3RJUA 2C5WB 1PI5A 3HLBA 3Q1FA 1K6SA 5I94A 3Q07A 2DNSA 4E3LA 3N8LA 1EWZA 3VP0A 3D4FA 2DCFA 3MKEA 1IYSA 4IBXA 2G2UA 2ZD8A 4QB8A 1JTDA 2J9OA 1L2SA 4DE3A 1I2SA 2Q9MA 2XK1A 3EQVA 4KG2A 2J8YA 4S2MA 1FSYA 3GR2A 1K55C 3PBNA 4KG6A 4WM9A 1EROA 5EVIA 3FKWA 3N7WA 4IBRA 5FQIA 2ZQDA 4WEJA 5A92A 3MZFA 1CEGA 5GLBA 2C6WB 5F82A 1VQQA 3OPLA 5GHXA 4JXVA 4OPZA 5A90A 1M6KA 1FQGA 2HP6A 3EQUA 3MXRA 4OKPA 1FR6A 5CRFA 4LV0A 5FQKA 5G18A 2P74A 2DRWA 4YINA 1DJCA 4QHCA 3W4PA 3G4PA 3LCEA 4KZ9A 4OONA 2OLUA 1WYCA 1NYMA 3JYIA 4WBGA 2RL3A 3BFEA 1XXMA 3C7UA 5FSRA 1IKIA 5CEBA 5AQBA 4PMAA 5TGFA 4EUZA 2Z2MB 3NIAA 1IYQA 1ZG4A 2XF3A 1BLHA 4RVAA 4EBPA 1PWCA 3G34A 4PM9A 3UY6A 5CHUA 3E2LA 3GQZA 1JWVA 3ISGA 1I2WA 3GRJA 3HLEA 2HDUA 2Y2OA 4BL2A 3NY4A 1KDWA 4OH0A 1XX2A 3ZGAB 3G2ZA 1XA1A 4KZBA 5GLDA 3CG5A 1W8YA 4OLGA 2PU2A 2B5RA 2XD1A 3GVBA 3FWLA 3IF6C 1ES2A 4E6XA 5FQ9A 3HUMA 4EBLA 4BD1A 1JTGA 3IT9A 4DKIA 5CHJA 2QMIA 2ZQCA 4WMCD 1NJ4A 2ZQAA 2Y4AA 3IH8A 4WZ5C 5E2EA 3A3EA 3S1YA 4QD4A 3O88A 1NXYA 2ZM0A 4WZ5A 5FQJA 3IWQA 3HLCA 4N92A 1PZOA 2Y55A 4KQRA 1AXBA 4UA9A 2EFXA 4H8RA 2Y2QA 4JXWA 4Y0OA 2R9XA 1K4EA 3BRMA 1LI9A 3AGEA 3GMWA 4LV1A 3VOZA 2OLVA 3IH9A 3MZDA 2Y2LA 4GD8A 4XUZA 3P98A 5DF8A 1GA9A 4KZ8A 3V50A 1K54A 2H0TA 4E3MA 2X02A 1BTLA 3UNWA 1FCNA 3BLSA 2WUQA 5EVLA 1GA0A 1KDSA 4MBFA 5DF9A 4ZAMA 1YLJA 3GSGA 2BG1A 4N9LA 2WGWA 5CGWA 1K6RA 3QHYA 3VSKA 2EFUA 2J9PA 2WGVA 4X55A 3CMZA 4RYEA 4S2NC 1YLYA 5FQQA 5DTTA 1MWTA 1EI5A 4JXSA 4PM8A 5U47A 4S2NA 3DWZA 2XEPA 4X56A 4QY5A 3W4QA 4Q8IA 4GKUA 2RCXA 4U3TA 5EPHA 2Y2HA 1Q2QA 3NCKA 1KGFA 3IXHA 4WYYA 1FCOA 2WZZA 2Y2GA 1PW8A 2ZQ7A 3PBTA 3BYDA 4OPYA 3S4XA 2A3UA 1ALQA 1KGEA 3W8KA 4PM5A 5CEDA 2WYXA 3VP4A 4WELA 1MKIA 3BFDA 5F1GA 5TFQA 5CGSA 1HVBA 5GHZA 4L0LA 3UDFA 1MY8A 5DVAA 2XFTA 3WS2A 3FYZA 4UAAA 1FCMA 5EUAA 4OP8A 1KE3A 5EE8A 5M18A 4E3JA 2H10A 4KQQA 4DE2A 1K56A 1PI4A 3O86A 4KZAA 5HX9A 1YLPA 5EVIC 1IYPA 5FATA 3OPPA 2ZC3B 4MEZA 2EX9A 3UDXA 5E2FA 2PU4A 1O07A 3UE3A 1Q2PA 1IYOA 1YLTA 2ZLYA 3G2YA 2ZM2A 3C4OA 2XLNA 3N8SA 4U0TA 4XUXA 5JYPA 2QPNA 4DDYA 3VMAA 1L0DA 4JF5A 3A3IA 5GLCA 3SH8A 3UE1A 3WS1A 1CEFA 4KZ7A 4RX3A 1K57A 4R4RA 4GN2A 2P9VB 1RP5A 3FZCA 3NI9A 1S0WA 3PBOA 3WWXA 3AGFA 1J9MA 5EOEA 1CI9A 5FAPA 5FAOA 2WK0A 4IEDA 4LENA 4X6TA 1SCWA 5E2HA 5JYOA 5M19A 1W79A 2ZQ8A 3V3SA 3E2KA 3RXXA 2ZQ9A 3VP2A 2H0YA 4Y7PA 3HUOA 1PWDA 1PW1A 4P87A 1E4DA 1IKGA 1LL9A 3Q7VA 3B3XA 3SS3A 4UA6A 2OSUA 4KENB 4MBKA 4Y0UA 1KVLA 4OQ0A 2HP5A 4B88A 1HTZA 3V3RA 3WS5A 1PZPA 3TG9A 4HEFA 2Y2KA 3PAEA 3MXSA 1O7EA 2CC1A 1E3UD 4R23A 1BLPA 4EQIA 1IELA 4UA7A 5HL1A 1LL5A 5HFOA 5CXWA 1LLBA 4R0QA 1NZUA 4MBHA 3OPHA 1DJAA 3CJMA 4HBUA 1TEMA 4NK3A 5AQAA 1ZKJA 4LCMA 4P6BA 4GD6A 4R3BA 4JF4A 2Y2MA 3ZG5A 5HARA 2X01A 1ERQA 5CECA 5IHVA 1PIOA 1VM1A 1FSWA 1GHMA 1L0FA 2ZJ9A 2QZ6A 4FCFA 4N1XA 3UN7A 3ZNYA 2IWDA 4OVDA 4BL3A 3IQAA 5M1AA 1JWPA 5HAPA 1XA7A 1XP4A 1ES4A 1IEMA 1BUEA 2OV5A 2XH9A 3BFGA 3G35A 4K0XA 1PWGA 4C75A 4R4SA 1K54C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GHI A;  3W4O A;  5A93 A;  4ZBE A;  4LV3 A;  1MWU A;  4DE1 A;  1QME A;  4RA7 A;  3GV9 A;  5DTK A;  3NBL A;  4BEN A;  3OCL A;  5GHY A;  3C4P A;  1SKF A;  3ZHH A;  2ZC4 B;  2XDM A;  5FI2 A;  2EX6 A;  3DWK A;  4QU3 A;  4S2P A;  1QMF A;  4OPR A;  5HAI A;  4DE0 A;  3ZG9 B;  2WAE A;  3SOI A;  3WRT A;  1FOF A;  2WAF A;  3FV7 A;  1Z6F A;  3LEZ A;  4HES A;  4GDN A;  3SH9 A;  3IHA A;  2EX8 A;  2FFF B;  3DW0 A;  4DF6 A;  4PM7 A;  5CGX A;  3WRZ A;  2G2W A;  1MXO A;  2EX2 A;  4WMC A;  4FSF A;  1RGZ A;  4KZ4 A;  1DY6 A;  5DF7 A;  3ZFZ A;  5J8X A;  3HLF A;  4S2J A;  4KZ6 A;  4HBT A;  2I72 A;  1SDN A;  3HVF A;  3IXG A;  4KG5 A;  4E3N A;  2ZC7 A;  3N4I A;  3IWO A;  3UE0 A;  4OOM A;  1WYB A;  1W5D A;  2BLS A;  3OZH A;  3PTE A;  2ZMA A;  4JBF A;  4S2O A;  1FR1 A;  3TSG A;  4E6W A;  5CHM A;  1PYY A;  4N1H A;  3IXD A;  2HP9 A;  4FH4 A;  1WE4 A;  3O87 A;  4FH2 A;  5EVI D;  1MWR A;  3HLG A;  5E2G A;  1YM1 A;  4BJP A;  1TDL A;  1L0G A;  3IF6 B;  4OQG A;  3BFC A;  4F94 A;  5CTN A;  3Q81 A;  3HRE A;  5A91 A;  2E8I A;  1ES5 A;  4NET A;  3HUN A;  2IWB A;  4CPK A;  3P09 A;  3VSL A;  1H5X A;  5EOO A;  1JVJ A;  2VGK A;  3VOY A;  3N8R A;  4MNR A;  3UO9 A;  3MFD A;  3PBR A;  5GLA A;  1K57 C;  1G68 A;  3VP3 A;  1ERM A;  2Q9N A;  3NC8 A;  5DTS A;  3LY3 A;  1YLW A;  2EXB A;  1TVF A;  1ES3 A;  1ZG6 A;  3G31 A;  4B4Z A;  3SS5 A;  3G30 A;  2GDN A;  4JPM A;  3SH7 A;  2XR0 A;  5F1F A;  5FDH A;  3ZVT A;  5AQ7 A;  5FAS A;  4ZJ1 A;  3CZD A;  2XQZ A;  3G32 A;  3M6B A;  5AQ9 A;  3VFH A;  1HZO A;  2A49 A;  4OP5 A;  4QY6 A;  2JBF A;  1YMS A;  2WGW B;  4PPR A;  4C3Q A;  4D2O A;  3TOI A;  2V1Z A;  3HLW A;  1M40 A;  3WS4 A;  1MBL A;  5BOH A;  1YQS A;  3ZG0 A;  1ONH A;  1SDE A;  1K55 A;  2Y91 A;  3ZNT A;  3IXB A;  4C6Y A;  1CK3 A;  3BEC A;  4JF6 A;  1TDG A;  4PM6 A;  3ZG7 B;  1I5Q A;  3OPR A;  2Y59 A;  3A3F A;  1ESU A;  3AGD A;  3M6H A;  3BEB A;  4R3J A;  4KZ5 A;  1NY0 A;  1YT4 A;  2JE5 A;  4R1G A;  1XGJ A;  2JCH A;  2V2F F;  2WZX A;  2FFY A;  1K25 A;  5KSH A;  1Y54 A;  3WS0 A;  5FQM A;  4O7D A;  2H5S A;  3NDE A;  5FI6 A;  4BQM A;  3ZDJ A;  2ZM8 A;  5CER A;  3M2J A;  3S22 A;  1KE4 A;  1RGY A;  1E25 A;  4GDB A;  4DXB A;  1H8Y A;  1YLZ A;  1K38 A;  3MKF A;  4GZB A;  3PAG A;  4WZ4 A;  1BLC A;  1YMX A;  3A3J A;  3MZE A;  3NDG A;  1ESI A;  4K0W A;  4X68 A;  4ZJ3 A;  4YFM A;  2Z2L B;  4GNU A;  2WKH A;  1CI8 A;  4KQO A;  1LI0 A;  2J7V A;  3BFF A;  4FD8 A;  2XD5 A;  4OOY A;  1N4O A;  3LO7 A;  4OQI A;  2EXA A;  2IWC A;  3FKV A;  4P85 A;  4RX2 A;  2XFS A;  3RXW A;  1NRF A;  2PBY A;  4N9K A;  1H8Z A;  2V20 A;  5FAQ A;  4S2K A;  3ZCZ A;  4CJN A;  4GB7 A;  1GHP A;  4Z9Q A;  1BT5 A;  2HDS A;  4U0X A;  3IF6 A;  2WAD A;  4ID4 A;  1W7F A;  5EVI B;  3A3D A;  1ONG A;  1U60 A;  3HL9 A;  4K91 A;  3V5M A;  1RCJ A;  2XGN A;  4OOL A;  2HDQ A;  1GCE A;  4GOG A;  1HD8 A;  3HBR A;  3ITA A;  1ZC2 A;  5D3O A;  1E3U A;  1OME A;  2Y2N A;  4DDS A;  1LHY A;  4EBN A;  1MPL A;  3IWI A;  2Y2J A;  4WEK A;  4EV4 A;  1XKZ A;  1BSG A;  1BUL A;  4M3K A;  4A5R A;  1N9B A;  2VGJ A;  3BLM A;  3ZVW A;  1C3B A;  4EWF A;  4P0M A;  3VFF A;  4JLF A;  4LV2 A;  2WKE A;  2P9V A;  4S2L A;  4Y0T A;  4DRT A;  2UWX A;  2ZC6 B;  4LCL A;  4JXG A;  3O3V A;  3C7V A;  2WGI A;  5GL9 A;  5TR7 A;  1NYY A;  4BLM A;  4MLL A;  3Q7V B;  5FA7 A;  1SHV A;  5FI7 A;  4E3K A;  4OQH A;  4BD0 A;  3ITB A;  3ZG8 B;  3SS4 A;  1K56 D;  4IVI A;  1BLS A;  1BZA A;  1JWZ A;  1L0E A;  3IF5 A;  3MBZ A;  3Q82 A;  3V39 A;  4E3I A;  5CTM A;  1KE0 A;  3I7J A;  3BM6 A;  4ZJ2 A;  4ZDX A;  2ZC5 B;  3OCN A;  1G6A A;  1S6R A;  5HW3 A;  4ZTK A;  1NZO A;  3UPN A;  1KGG A;  1K4F A;  2Y2P A;  5E43 A;  1MWS A;  3M2K A;  3QNC A;  3UPO A;  4XXR A;  4S2I A;  4OLD A;  4UHU A;  4B4X A;  2JC7 A;  3C5A A;  3IHB A;  3OC2 A;  3PBS A;  4OPQ A;  2HDR A;  2HPB A;  5F83 A;  3PBQ A;  4X53 A;  5HAQ A;  5KSC A;  2X71 A;  3DTM A;  3UDI A;  3UPP A;  5KMW A;  4IVK A;  4X69 A;  2R9W A;  3N6I A;  1XPB A;  3Q7Z A;  4JKT A;  5L2F A;  3VP1 A;  4E3O A;  4QJG A;  2Y2I A;  3LY4 A;  4DXC A;  1W8Q A;  1XGI A;  5KZH A;  3GTC A;  5EEC A;  1DJB A;  2WKI A;  3QNB A;  4KZ3 A;  1KVM A;  3HLD A;  3RJU A;  2C5W B;  1PI5 A;  3HLB A;  3Q1F A;  1K6S A;  5I94 A;  3Q07 A;  2DNS A;  4E3L A;  3N8L A;  1EWZ A;  3VP0 A;  3D4F A;  2DCF A;  3MKE A;  1IYS A;  4IBX A;  2G2U A;  2ZD8 A;  4QB8 A;  1JTD A;  2J9O A;  1L2S A;  4DE3 A;  1I2S A;  2Q9M A;  2XK1 A;  3EQV A;  4KG2 A;  2J8Y A;  4S2M A;  1FSY A;  3GR2 A;  1K55 C;  3PBN A;  4KG6 A;  4WM9 A;  1ERO A;  5EVI A;  3FKW A;  3N7W A;  4IBR A;  5FQI A;  2ZQD A;  4WEJ A;  5A92 A;  3MZF A;  1CEG A;  5GLB A;  2C6W B;  5F82 A;  1VQQ A;  3OPL A;  5GHX A;  4JXV A;  4OPZ A;  5A90 A;  1M6K A;  1FQG A;  2HP6 A;  3EQU A;  3MXR A;  4OKP A;  1FR6 A;  5CRF A;  4LV0 A;  5FQK A;  5G18 A;  2P74 A;  2DRW A;  4YIN A;  1DJC A;  4QHC A;  3W4P A;  3G4P A;  3LCE A;  4KZ9 A;  4OON A;  2OLU A;  1WYC A;  1NYM A;  3JYI A;  4WBG A;  2RL3 A;  3BFE A;  1XXM A;  3C7U A;  5FSR A;  1IKI A;  5CEB A;  5AQB A;  4PMA A;  5TGF A;  4EUZ A;  2Z2M B;  3NIA A;  1IYQ A;  1ZG4 A;  2XF3 A;  1BLH A;  4RVA A;  4EBP A;  1PWC A;  3G34 A;  4PM9 A;  3UY6 A;  5CHU A;  3E2L A;  3GQZ A;  1JWV A;  3ISG A;  1I2W A;  3GRJ A;  3HLE A;  2HDU A;  2Y2O A;  4BL2 A;  3NY4 A;  1KDW A;  4OH0 A;  1XX2 A;  3ZGA B;  3G2Z A;  1XA1 A;  4KZB A;  5GLD A;  3CG5 A;  1W8Y A;  4OLG A;  2PU2 A;  2B5R A;  2XD1 A;  3GVB A;  3FWL A;  3IF6 C;  1ES2 A;  4E6X A;  5FQ9 A;  3HUM A;  4EBL A;  4BD1 A;  1JTG A;  3IT9 A;  4DKI A;  5CHJ A;  2QMI A;  2ZQC A;  4WMC D;  1NJ4 A;  2ZQA A;  2Y4A A;  3IH8 A;  4WZ5 C;  5E2E A;  3A3E A;  3S1Y A;  4QD4 A;  3O88 A;  1NXY A;  2ZM0 A;  4WZ5 A;  5FQJ A;  3IWQ A;  3HLC A;  4N92 A;  1PZO A;  2Y55 A;  4KQR A;  1AXB A;  4UA9 A;  2EFX A;  4H8R A;  2Y2Q A;  4JXW A;  4Y0O A;  2R9X A;  1K4E A;  3BRM A;  1LI9 A;  3AGE A;  3GMW A;  4LV1 A;  3VOZ A;  2OLV A;  3IH9 A;  3MZD A;  2Y2L A;  4GD8 A;  4XUZ A;  3P98 A;  5DF8 A;  1GA9 A;  4KZ8 A;  3V50 A;  1K54 A;  2H0T A;  4E3M A;  2X02 A;  1BTL A;  3UNW A;  1FCN A;  3BLS A;  2WUQ A;  5EVL A;  1GA0 A;  1KDS A;  4MBF A;  5DF9 A;  4ZAM A;  1YLJ A;  3GSG A;  2BG1 A;  4N9L A;  2WGW A;  5CGW A;  1K6R A;  3QHY A;  3VSK A;  2EFU A;  2J9P A;  2WGV A;  4X55 A;  3CMZ A;  4RYE A;  4S2N C;  1YLY A;  5FQQ A;  5DTT A;  1MWT A;  1EI5 A;  4JXS A;  4PM8 A;  5U47 A;  4S2N A;  3DWZ A;  2XEP A;  4X56 A;  4QY5 A;  3W4Q A;  4Q8I A;  4GKU A;  2RCX A;  4U3T A;  5EPH A;  2Y2H A;  1Q2Q A;  3NCK A;  1KGF A;  3IXH A;  4WYY A;  1FCO A;  2WZZ A;  2Y2G A;  1PW8 A;  2ZQ7 A;  3PBT A;  3BYD A;  4OPY A;  3S4X A;  2A3U A;  1ALQ A;  1KGE A;  3W8K A;  4PM5 A;  5CED A;  2WYX A;  3VP4 A;  4WEL A;  1MKI A;  3BFD A;  5F1G A;  5TFQ A;  5CGS A;  1HVB A;  5GHZ A;  4L0L A;  3UDF A;  1MY8 A;  5DVA A;  2XFT A;  3WS2 A;  3FYZ A;  4UAA A;  1FCM A;  5EUA A;  4OP8 A;  1KE3 A;  5EE8 A;  5M18 A;  4E3J A;  2H10 A;  4KQQ A;  4DE2 A;  1K56 A;  1PI4 A;  3O86 A;  4KZA A;  5HX9 A;  1YLP A;  5EVI C;  1IYP A;  5FAT A;  3OPP A;  2ZC3 B;  4MEZ A;  2EX9 A;  3UDX A;  5E2F A;  2PU4 A;  1O07 A;  3UE3 A;  1Q2P A;  1IYO A;  1YLT A;  2ZLY A;  3G2Y A;  2ZM2 A;  3C4O A;  2XLN A;  3N8S A;  4U0T A;  4XUX A;  5JYP A;  2QPN A;  4DDY A;  3VMA A;  1L0D A;  4JF5 A;  3A3I A;  5GLC A;  3SH8 A;  3UE1 A;  3WS1 A;  1CEF A;  4KZ7 A;  4RX3 A;  1K57 A;  4R4R A;  4GN2 A;  2P9V B;  1RP5 A;  3FZC A;  3NI9 A;  1S0W A;  3PBO A;  3WWX A;  3AGF A;  1J9M A;  5EOE A;  1CI9 A;  5FAP A;  5FAO A;  2WK0 A;  4IED A;  4LEN A;  4X6T A;  1SCW A;  5E2H A;  5JYO A;  5M19 A;  1W79 A;  2ZQ8 A;  3V3S A;  3E2K A;  3RXX A;  2ZQ9 A;  3VP2 A;  2H0Y A;  4Y7P A;  3HUO A;  1PWD A;  1PW1 A;  4P87 A;  1E4D A;  1IKG A;  1LL9 A;  3Q7V A;  3B3X A;  3SS3 A;  4UA6 A;  2OSU A;  4KEN B;  4MBK A;  4Y0U A;  1KVL A;  4OQ0 A;  2HP5 A;  4B88 A;  1HTZ A;  3V3R A;  3WS5 A;  1PZP A;  3TG9 A;  4HEF A;  2Y2K A;  3PAE A;  3MXS A;  1O7E A;  2CC1 A;  1E3U D;  4R23 A;  1BLP A;  4EQI A;  1IEL A;  4UA7 A;  5HL1 A;  1LL5 A;  5HFO A;  5CXW A;  1LLB A;  4R0Q A;  1NZU A;  4MBH A;  3OPH A;  1DJA A;  3CJM A;  4HBU A;  1TEM A;  4NK3 A;  5AQA A;  1ZKJ A;  4LCM A;  4P6B A;  4GD6 A;  4R3B A;  4JF4 A;  2Y2M A;  3ZG5 A;  5HAR A;  2X01 A;  1ERQ A;  5CEC A;  5IHV A;  1PIO A;  1VM1 A;  1FSW A;  1GHM A;  1L0F A;  2ZJ9 A;  2QZ6 A;  4FCF A;  4N1X A;  3UN7 A;  3ZNY A;  2IWD A;  4OVD A;  4BL3 A;  3IQA A;  5M1A A;  1JWP A;  5HAP A;  1XA7 A;  1XP4 A;  1ES4 A;  1IEM A;  1BUE A;  2OV5 A;  2XH9 A;  3BFG A;  3G35 A;  4K0X A;  1PWG A;  4C75 A;  4R4S A;  1K54 C; 
#chains in the Genus database with same CATH topology
 1GHI A;  1GSW A;  1MKM A;  2HJ9 C;  3W4O A;  2HJE A;  1TS7 A;  2M7U A;  4O01 A;  3B42 A;  4WUJ A;  4JGQ A;  3PYP A;  3C4P A;  1SKF A;  4HIA A;  3DWK A;  3MFX A;  3ZYT A;  4HHD A;  3SH9 A;  4ETX A;  3WRZ A;  2O9B A;  3NJA A;  1XFN A;  2W0N A;  3ZFZ A;  4S2J A;  4HBT A;  2I72 A;  4Y17 A;  2PBD P;  4E04 A;  3BW6 A;  3IWO A;  1W5D A;  3OZH A;  4FTX A;  2XA7 S;  2ZMA A;  4S2O A;  1FR1 A;  5J3W A;  4Y13 A;  3C2W A;  1PYY A;  3O87 A;  3LYX A;  2J3T D;  1MWR A;  3HLG A;  4I5S A;  5E2G A;  3RFB A;  1TDL A;  4OQG A;  1T19 A;  2VV6 A;  3HRE A;  4NXF A;  2IWB A;  4ME4 A;  3P09 A;  5EOO A;  4MNR A;  1OJ5 A;  3NC8 A;  1YLW A;  1S1Y A;  3G30 A;  3SH7 A;  4Y2F A;  3ZVT A;  2YKH A;  3IS2 A;  3TE8 A;  3G32 A;  5AQ9 A;  2JBF A;  2WGW B;  2JKR M;  3HLW A;  3DTE A;  1YQS A;  4LFU A;  1K55 A;  2Y91 A;  4C6Y A;  1CK3 A;  3UB9 A;  1T1C A;  2JKT I;  4JF6 A;  1W63 M;  3ZG7 B;  2VA0 A;  4X1L A;  5AVF A;  3AGD A;  2V2F F;  5KSH A;  4BQM A;  2ZM8 A;  3M2J A;  2AVX A;  1KE4 A;  1H8Y A;  3PAG A;  4K0W A;  4IHQ A;  2Z2L B;  3IX8 A;  4EER A;  4KQO A;  3ZG8 B;  4RX2 A;  4OQI A;  2EXA A;  1NRF A;  2J3W A;  2V20 A;  4UQI S;  4GB7 A;  4Z9Q A;  2ZBB A;  5EVI B;  3V5M A;  4P6Z M;  1RCJ A;  2XGN A;  2OAP 1;  2W1R A;  5TJJ A;  4KUK A;  4OOL A;  1XJ3 A;  1HD8 A;  2GJ3 A;  2VGJ A;  3VFF A;  4LV2 A;  4S2L A;  1VET A;  1LSW A;  1FIK A;  1NYY A;  3Q7V B;  5FA7 A;  4PKY A;  4BD0 A;  3PXP A;  3ZQ5 A;  1L0E A;  3MBZ A;  4E3I A;  1G6A A;  1S6R A;  4Y3I A;  3T12 B;  1NZO A;  1OTI A;  3UPN A;  1K4F A;  4LRX C;  4B4X A;  2JC7 A;  4OPQ A;  5KSC A;  5F83 A;  3PBQ A;  2VGL S;  3UPP A;  5KMW A;  2R9W A;  1XPB A;  5L2F A;  2JKT M;  2Y2I A;  3LY4 A;  1CF0 A;  3O5Y A;  3JPU A;  3HLD A;  3Q1F A;  1XJ4 A;  2DNS A;  3RH8 B;  4IUK A;  3H82 B;  1TD5 A;  4QB8 A;  1L2S A;  4KG2 A;  1H8M A;  4S2M A;  4CQH A;  3GR2 A;  1K55 C;  3PBN A;  5EVI A;  3N7W A;  4IBR A;  3DTI A;  2VLG A;  1ACF A;  5J4E A;  4EU0 A;  1VQQ A;  3DTK A;  1BYW A;  1J3W A;  1FQG A;  3EQU A;  3MXR A;  4OKP A;  1FR6 A;  5CRF A;  5FQK A;  3LIA A;  1DJC A;  1MZU A;  3LID A;  1STZ A;  2OLU A;  3FPV A;  1WYC A;  3BFE A;  1CQA A;  3BJN A;  2Z2M B;  2XF3 A;  1BLH A;  4RVA A;  2G7U A;  3E2L A;  3GQZ A;  3GRJ A;  4BL2 A;  1KDW A;  3G2Z A;  1W8Y A;  4OLG A;  2PU2 A;  1ES2 A;  1G28 A;  2PDR A;  5CHJ A;  1NJ4 A;  2ZQA A;  2Y4A A;  1LSV A;  4WZ5 C;  3D3O A;  3S1Y A;  1F9I A;  2O0Y A;  4Y0O A;  3AGE A;  4LV1 A;  3MZD A;  3H7W B;  4UEY A;  4GD8 A;  4XUZ A;  4WLA A;  1K54 A;  4E3M A;  4PAU A;  3BLS A;  4NG2 A;  2NUP C;  1NRJ A;  1F2K A;  2BG1 A;  2EFU A;  3CMZ A;  4RYE A;  5FQQ A;  5DTT A;  4O0P A;  1MWT A;  3U4L P;  5MC7 A;  4X56 A;  4GKU A;  1F5M A;  2RCX A;  3CI6 A;  2LB5 A;  4EQ1 A;  4YWZ A;  1KGF A;  4WYY A;  1FCO A;  2P08 A;  4QWO A;  1PW8 A;  1ALQ A;  2ZOI A;  2VEA A;  1A0K A;  4DJ3 A;  1XJ2 A;  3C38 A;  4L0L A;  2Z6D A;  3IBR A;  2XFT A;  5EUA A;  1XJ6 A;  4HJ6 A;  2INW A;  4E3J A;  4KQQ A;  1K56 A;  1YLP A;  5EVI C;  5FAT A;  2JKF A;  2EX9 A;  3MS6 A;  3UE3 A;  2PU4 A;  1IYO A;  2ZLY A;  3C4O A;  4NXB A;  3N8S A;  3VMA A;  4EUV A;  2VZW A;  3E4Q A;  4KZ7 A;  1K57 A;  4R4R A;  3MQO A;  4GN2 A;  1RP5 A;  3FZC A;  1S0W A;  3WWX A;  1UGU A;  1CI9 A;  2WK0 A;  2A24 A;  1SCW A;  3SW1 A;  5JYO A;  1W79 A;  2OWJ A;  2H0Y A;  3HUO A;  1PW1 A;  4P87 A;  3MQQ A;  4UA6 A;  4KEN B;  4B88 A;  1KVL A;  2HP5 A;  3A0V A;  1HTZ A;  4HH3 A;  3WS5 A;  2Y2K A;  3P7N A;  4F3L A;  1VEU B;  1IEL A;  1LLB A;  1TEM A;  4NK3 A;  4YNR A;  4LCM A;  4JF4 A;  2L1M A;  5HAR A;  5IHV A;  1PIO A;  1VM1 A;  1GHM A;  4FCF A;  3ZNY A;  2IWD A;  4OVD A;  4BL3 A;  5M1A A;  5HAP A;  2VV8 A;  1XA7 A;  2W1T A;  3F1O B;  2WKP A;  3G35 A;  4RA7 A;  1PWG A;  1K54 C;  1OTB A;  4LV3 A;  5EFW A;  4DE1 A;  1SZV A;  4BEN A;  3NBL A;  1LSX A;  3ZHH A;  2ZL1 B;  1FIL A;  2EX6 A;  4OPR A;  5HAI A;  3SOI A;  1FOF A;  2WAF A;  1Z6F A;  3L7H A;  3LEZ A;  4HJ3 A;  2XA7 M;  3IHA A;  3DW0 A;  3RTY A;  2M7V A;  4Q0J A;  1D1J A;  2EX2 A;  1P0Z A;  3HLF A;  4E3N A;  4KG5 A;  3HVF A;  3IXG A;  3N4I A;  2OAQ 1;  4M4X A;  4ESP A;  2W3D A;  3TSG A;  4FH4 A;  5HDD A;  1ZHH B;  4FH2 A;  5EVI D;  4WN5 A;  1YM1 A;  4BJP A;  1L0G A;  1T1A A;  4F94 A;  1V9Z A;  2E8I A;  2KOI A;  2R78 A;  3LEQ A;  4CPK A;  2M1C A;  3KO6 A;  5GLA A;  1K57 C;  3VP3 A;  1VHM A;  3PHY A;  1WA9 A;  4CLC E;  2Y8H A;  3P01 A;  5HDC A;  3SS5 A;  5FAS A;  4ZJ1 A;  4Y5F A;  2XQZ A;  1HZO A;  4QY6 A;  5AJG A;  5IS1 A;  3TOI A;  3KX0 X;  1ONH A;  3BEC A;  1OPX A;  3S7Q A;  1TDG A;  5FEG A;  2Y59 A;  2J80 A;  3C8C A;  3BEB A;  1NY0 A;  1YT4 A;  2FH5 A;  2WZX A;  3CPT B;  1K25 A;  1Y54 A;  5FI6 A;  3S22 A;  4UQI M;  1RGY A;  1K38 A;  4KQD A;  4GZB A;  4WZ4 A;  2PD8 A;  3A3J A;  3NDG A;  4BWI A;  4GNU A;  3T1R A;  3KSH A;  1LI0 A;  4FD8 A;  1N4O A;  3LO7 A;  3FKV A;  4P85 A;  4N9K A;  1H8Z A;  4DMZ A;  5EV0 A;  3UB6 A;  3ZCZ A;  2P04 A;  4U0X A;  4HH2 A;  2GNX A;  1ONG A;  1S1Z A;  3OBF A;  4NKP A;  5EM0 A;  4DJ2 A;  5LBR A;  1ZC2 A;  3NOU C;  1E3U A;  4DDS A;  1MPL A;  2Y2J A;  4WEK A;  4EV4 A;  2PD7 A;  4BMW A;  1N9B A;  1OTD A;  1OT6 A;  3MQ0 A;  1PNE A;  4EWF A;  4P0M A;  3T50 A;  2P9V A;  4HP4 A;  2ZC6 B;  4LCL A;  3GEC A;  3O3V A;  5TR7 A;  2WGI A;  4BLM A;  4MLL A;  2EWW A;  4OQH A;  1K56 D;  4IVI A;  1BZA A;  1G5U A;  2VGL M;  3B33 A;  1KE0 A;  4ZJ2 A;  3A0R A;  3OCN A;  3TJZ C;  4ZTK A;  1KGG A;  3LIB A;  4CLC B;  4RQ9 A;  5F6A A;  3OC2 A;  2HPB A;  2CMN A;  5HAQ A;  2Y79 A;  3N6I A;  5IT5 A;  3VP1 A;  4E3O A;  2IA2 A;  1W8Q A;  5KZH A;  5EEC A;  1DJB A;  3BWL A;  3CIT A;  3QNB A;  4GCZ A;  3RJU A;  2C5W B;  1PI5 A;  3N8L A;  1EWZ A;  3D4F A;  2DCF A;  4BBV A;  4GW9 A;  1JTD A;  3KSF A;  2Q9M A;  4KG6 A;  3FKW A;  4HJ4 A;  4L9E A;  1UWN X;  2ZQD A;  5FQI A;  5A92 A;  4XT2 B;  5F82 A;  3L9K A;  5A90 A;  1M6K A;  1D7E A;  5G18 A;  5DFX A;  3LR0 A;  3W4P A;  4OON A;  3IX4 A;  2RL3 A;  4X25 A;  3NIA A;  1ZG4 A;  1V9Y A;  3G34 A;  1N9N A;  5CHU A;  1I2W A;  2D01 A;  3NY4 A;  3ZGA B;  1XX2 A;  1XA1 A;  3CG5 A;  3VE3 A;  2B5R A;  1LL8 A;  3FWL A;  5FQ9 A;  3FG8 A;  1JTG A;  3MR0 A;  2ZQC A;  3IH8 A;  2PT7 A;  1H0M A;  4QD4 A;  2PHY A;  2JN7 A;  1NXY A;  4WZ5 A;  1S4S A;  4UA9 A;  1TS8 A;  2Y2Q A;  3ULF A;  1K4E A;  3GMW A;  2P7J A;  3IH9 A;  3HJI A;  4Q0I A;  2YKF A;  5DF8 A;  1GA9 A;  1BTL A;  1FCN A;  2WUQ A;  3R7W B;  3GSG A;  2PAV P;  4N9L A;  2WGW A;  2WGV A;  4S2N C;  3UME A;  1EI5 A;  4PM8 A;  3DWZ A;  4U3T A;  4IUH A;  2Y2H A;  5EPH A;  3D72 A;  2Y2G A;  3W8K A;  2ZOH A;  1DRM A;  1PRQ A;  5C5K A;  5CED A;  5L09 A;  3VP4 A;  3BFD A;  3UB8 A;  5F1G A;  4FUW A;  5HPF A;  5GHZ A;  2GZA A;  1MY8 A;  5DVA A;  3FYZ A;  3LUQ A;  4UAA A;  1FCM A;  4R3A A;  2VJW A;  3K3C A;  2JHE A;  4OP8 A;  2QJ7 A;  2VV7 A;  4KUO A;  2EWV A;  4MEZ A;  3UDX A;  5E2F A;  3G2Y A;  2ZM2 A;  5JYP A;  2QPN A;  4ETZ A;  3KYE A;  4H6J B;  4DDY A;  4JF5 A;  3SH8 A;  2D02 A;  5GLC A;  3UE1 A;  1CEF A;  2ZMV A;  3NI9 A;  2XRO A;  3PBO A;  3U2A A;  5EOE A;  5FAP A;  5FAO A;  4IED A;  4DN0 A;  4X6T A;  3F1N B;  3RXX A;  1N9O A;  2QYB A;  1Z09 A;  1N9L A;  5HDS A;  1IKG A;  1LL9 A;  3Q7V A;  3V3R A;  4HEF A;  5HPI A;  1O7E A;  3FPW A;  2CC1 A;  1E3U D;  4R23 A;  4EQI A;  1LL5 A;  5HFO A;  5CXW A;  1P9R A;  5DFY A;  1DJA A;  3CJM A;  5DJT A;  5AQA A;  1ZKJ A;  4HY8 A;  2Y2M A;  2X01 A;  3LI9 A;  4QPR A;  1FSW A;  2QZ6 A;  3BY8 A;  3IQA A;  2V0W A;  1XP4 A;  1ES4 A;  4BBT A;  2OV5 A;  3BFG A;  3K2N A;  4R4S A;  2O9C A;  3OCL A;  3HJK A;  3H82 A;  5HZH A;  2XDM A;  4QU3 A;  3VE4 A;  1QMF A;  4DE0 A;  2WAE A;  5F68 A;  2H28 A;  3FV7 A;  4HES A;  2EX8 A;  4H6J A;  4DF6 A;  5CGX A;  4PHT A;  4WMC A;  5J8X A;  4KZ6 A;  2XSS A;  5FL3 A;  4GJ4 A;  2XRN A;  4OOM A;  4EW7 A;  1WYB A;  5L07 A;  1SKO B;  4E6W A;  4MDZ A;  4N1H A;  3QP2 A;  1WE4 A;  4I3J A;  4MN7 A;  2V9A A;  3IF6 B;  5CTN A;  3Q81 A;  1CJF A;  4R70 A;  1ES5 A;  4NET A;  2K2N A;  2NUT C;  3VSL A;  3CHW P;  3UO9 A;  1G68 A;  5DTS A;  2EXB A;  4HOI A;  1ES3 A;  5K5B A;  2EA9 A;  4MCW A;  3G31 A;  4B4Z A;  4JPM A;  3KSG A;  5FDH A;  4EEU A;  2W3E A;  5AQ7 A;  4GHI B;  5HD5 A;  3M6B A;  2A49 A;  3H7W A;  4OP5 A;  1YMS A;  4PPR A;  5TBM B;  4C3Q A;  4GS9 B;  4D2O A;  2V1Z A;  2V1B A;  1SDE A;  3NOT C;  1Y4O A;  3UB7 A;  3ZNT A;  3TW8 A;  1DP8 A;  4PM6 A;  4HP9 A;  3LR4 A;  2V0U A;  4KZ5 A;  2JE5 A;  2WKR A;  3WS0 A;  3EEH A;  5FQM A;  2H5S A;  3ZDJ A;  5CER A;  1YAX A;  4GDB A;  1YLZ A;  3MKF A;  1BLC A;  3MZE A;  1OJG A;  4YFM A;  4OOY A;  2J7V A;  1P97 A;  3RXW A;  4EXO A;  5FAQ A;  4S2K A;  4CJN A;  1GHP A;  3IF6 A;  1T18 A;  1W7F A;  3A3D A;  1U60 A;  3E4O A;  4K91 A;  3UB5 P;  5HSQ A;  4II7 A;  2HDQ A;  4LLO B;  3HBR A;  3ITA A;  5D3O A;  4EBN A;  1XKZ A;  2PR6 A;  1BSG A;  1BUL A;  3A0S A;  3NOP C;  3EOI A;  5G4Z A;  3BLM A;  2W3F A;  4A5R A;  3ZVW A;  1C3B A;  4JLF A;  5AVE A;  4DRT A;  3JVU A;  3C7V A;  3T1X A;  3T4K A;  4AFI A;  2ZMF A;  5FI7 A;  4BBU A;  3ITB A;  5TBM A;  3SS4 A;  4I3I A;  3V39 A;  3MSH A;  5CTM A;  4ZDX A;  3CLO A;  3EWK A;  4JGR A;  4NEE D;  4WL9 A;  2Y2P A;  5E43 A;  3QNC A;  3UPO A;  4XXR A;  4S2I A;  3PBS A;  2HDR A;  4X53 A;  1VEU A;  1HLU P;  3DTM A;  3UDI A;  4IVK A;  3LIC A;  3Q7Z A;  2V1A A;  3D9Y A;  4DXC A;  1XGI A;  3GTC A;  3HCY A;  4KZ3 A;  1KVM A;  1GSV A;  3HLB A;  1K6S A;  2W3G A;  1NWZ A;  3F1O A;  3T4J A;  4IBX A;  1IYS A;  2G2U A;  2ZD8 A;  4DE3 A;  1NLZ A;  2XK1 A;  3EQV A;  2J8Y A;  1AWI A;  1ERO A;  2ZL1 A;  1OT9 A;  2C6W B;  5GHX A;  2JKG A;  3MF0 A;  2HP6 A;  3S7P A;  2K7S A;  4LV0 A;  1XFQ A;  5F5Y A;  3G4P A;  4O8G A;  3LCE A;  4KZ9 A;  3JYI A;  2HZ5 A;  1IKI A;  4NXG A;  5CEB A;  5AQB A;  3F1P B;  5FEF A;  4EUZ A;  4EBP A;  3ISG A;  1JWV A;  3EGD C;  3HLE A;  3C30 A;  4OH0 A;  1MC0 A;  5GLD A;  3T4Q A;  2XD1 A;  3GVB A;  3IF6 C;  4E6X A;  3HUM A;  4LPZ A;  4DKI A;  2QMI A;  2W3H A;  4WMC D;  3A3E A;  2LB9 A;  3QP1 A;  3O88 A;  3TRC A;  4R6L A;  5FQJ A;  3HLC A;  2KLI A;  4N92 A;  4KQR A;  1AXB A;  1IFQ A;  4I39 A;  4G3V A;  1LI9 A;  3VOZ A;  4Z1W A;  4KZ8 A;  3V50 A;  1GA0 A;  4L9G A;  5J7E A;  1DP9 A;  5CGW A;  1K6R A;  2J9P A;  3T4T A;  4IJG A;  4JXS A;  5U47 A;  4S2N A;  1OTE A;  3VOL A;  4QY5 A;  4Q8I A;  1X0O A;  3LR5 A;  2WZZ A;  3PBT A;  3BYD A;  2A3U A;  5FDS A;  1KGE A;  3CPT A;  4PM5 A;  3KYQ A;  1MKI A;  3F1P A;  3V67 A;  5TFQ A;  1YSP A;  3UDF A;  1S66 L;  4K08 A;  3KSI A;  1KE3 A;  4R38 A;  5EE8 A;  5M18 A;  2H10 A;  4DE2 A;  1PI4 A;  2QWS A;  3O86 A;  1TF1 A;  4KZA A;  5HX9 A;  1IYP A;  3OPP A;  1Q2P A;  1YLT A;  4XUX A;  4B9O A;  4EET B;  2PR5 A;  2WKQ A;  1VET B;  5HL6 A;  3OOV A;  3AGF A;  3NHQ A;  4Q0H A;  3VV4 A;  2OWH A;  2KX6 A;  5E2H A;  3E2K A;  3MXQ A;  1G6O A;  1E4D A;  3B3X A;  2MJ6 A;  3SS3 A;  4MBK A;  4OQ0 A;  3QP5 A;  3PAE A;  3GDI A;  4R0Q A;  4MBH A;  4HBU A;  4R3B A;  3ZG5 A;  3CWF A;  4CLC A;  2ZJ9 A;  1L0F A;  1P9W A;  4I3A A;  1IEM A;  1BUE A;  2O99 A;  2XH9 A;  1UWP X;  4D60 A;  5A93 A;  4HQA A;  4ZBE A;  1MWU A;  1QME A;  2B02 A;  3GV9 A;  5DTK A;  4B93 A;  5GHY A;  3T1S A;  1JNU A;  2ZC4 B;  5FI2 A;  4S2P A;  3ZG9 B;  3WRT A;  4FOF A;  3T1Q B;  4GDN A;  2FFF B;  4PM7 A;  5KIZ A;  2G2W A;  1MXO A;  1ODV A;  4XT2 A;  4FSF A;  1RGZ A;  4KZ4 A;  1DY6 A;  5DF7 A;  1SDN A;  2Q0O A;  2ZC7 A;  3BQA A;  4LRZ E;  3UE0 A;  2DMW A;  2BLS A;  3PTE A;  4JBF A;  2BAS A;  1EW0 A;  3S7N A;  5CHM A;  3IXD A;  2HP9 A;  2OOL A;  3LI8 A;  1PFL A;  2E8J A;  3BFC A;  5A91 A;  3HUN A;  4Y15 A;  3BY9 A;  3SZT A;  2O9A A;  1H5X A;  1JVJ A;  2VGK A;  3VOY A;  3N8R A;  3MFD A;  3PBR A;  1Y28 A;  1ERM A;  2Q9N A;  3LY3 A;  1TVF A;  1ZG6 A;  2GDN A;  3K3D A;  2XR0 A;  3CAX A;  5F1F A;  2Z6C A;  1DP6 A;  3E4P A;  4NXE A;  2FZ0 A;  3CZD A;  2PYP A;  3VFH A;  3WS4 A;  1M40 A;  1MBL A;  5DKK A;  5BOH A;  4ZRR A;  3ZG0 A;  3H9W A;  3R7W A;  3IXB A;  2VK3 A;  1W63 Q;  1K0K A;  1I5Q A;  3OPR A;  3T4S A;  3A3F A;  1ESU A;  3M6H A;  4R3J A;  4R1G A;  1XGJ A;  2JCH A;  2FFY A;  4CLC C;  4O7D A;  3NDE A;  3W2Z A;  1E25 A;  4DXB A;  1YMX A;  2VKS A;  1ESI A;  4X68 A;  4ZJ3 A;  2QHK A;  3OLO A;  2WKH A;  1TS6 A;  1CI8 A;  3BFF A;  2XD5 A;  2IWC A;  2XFS A;  2HV1 A;  2PBY A;  3LR3 A;  1OTA A;  1BT5 A;  2HDS A;  3CUE A;  2WAD A;  3PR6 A;  4ID4 A;  3HL9 A;  3MJQ A;  4EEP A;  3BQ8 A;  1GCE A;  4GOG A;  1ZTU A;  3T4L A;  4G3W A;  2VX8 A;  1OME A;  2Y2N A;  1LHY A;  3IWI A;  3EGX C;  1GSX A;  2A24 B;  4M3K A;  4X1M A;  2ACG A;  2QKP A;  2PRF A;  4P6Z S;  2WKE A;  4Y0T A;  2UWX A;  4JXG A;  5GL9 A;  3FC7 A;  1SHV A;  5DKL A;  4E3K A;  3F1N A;  2B95 A;  1BLS A;  3IF5 A;  1JWZ A;  3Q82 A;  4F3L B;  3I7J A;  3BM6 A;  2ZC5 B;  3E0Y A;  3QP6 A;  5HW3 A;  3B47 A;  3NEC A;  3IBJ A;  1MWS A;  3M2K A;  4YOF A;  3JVV A;  3G6O A;  4OLD A;  4UHU A;  3C5A A;  2L0W A;  3IHB A;  2X71 A;  4X69 A;  4JKT A;  1KOU A;  2W1T B;  4QJG A;  2WKI A;  3IX3 A;  1D06 A;  3R4K A;  2GX5 A;  5I94 A;  3Q07 A;  4E3L A;  3VP0 A;  2PYR A;  3MKE A;  3UE6 A;  2J9O A;  1I2S A;  2V8F A;  4WM9 A;  1F98 A;  1FSY A;  5L10 A;  4WEJ A;  3MZF A;  1CEG A;  4LGW A;  5GLB A;  2HGV A;  4CLC D;  5I5L A;  3OPL A;  2UV0 E;  4HI4 A;  4JXV A;  4OPZ A;  4PKY G;  2P74 A;  2DRW A;  4YIN A;  4QHC A;  1H3Q A;  1NYM A;  4WBG A;  5FSR A;  1XXM A;  3C7U A;  3LFV A;  2K31 A;  4PMA A;  5TGF A;  5DJU A;  1TS0 A;  1IYQ A;  1PWC A;  4PM9 A;  3QP8 A;  3UY6 A;  1YPR A;  1SKO A;  2HDU A;  2Y2O A;  4WF0 A;  5EVE A;  4KZB A;  4MMN A;  5G4Y A;  3T4O A;  3CUE C;  4EBL A;  4BD1 A;  3IT9 A;  5E2E A;  2ZM0 A;  3IWQ A;  1PZO A;  2Y55 A;  2EFX A;  4H8R A;  4JXW A;  2R9X A;  4HNB A;  3BRM A;  3E98 A;  2OLV A;  2QJ5 A;  2Y2L A;  3LIF A;  3P98 A;  3MMH A;  2H0T A;  2L4R A;  2X02 A;  3UNW A;  5A8B A;  3EEA A;  4GHI A;  5EVL A;  1KDS A;  4MBF A;  2A2L A;  5DF9 A;  4ZAM A;  1YLJ A;  3QHY A;  3VSK A;  4X55 A;  4GS9 A;  1YLY A;  1YSQ A;  1S67 L;  5HWT A;  4ARZ B;  2XEP A;  5F69 A;  3W4Q A;  5EM1 A;  1Q2Q A;  3NCK A;  3IXH A;  3LGO A;  2BTF P;  2ZQ7 A;  4OPY A;  3S4X A;  1YKD A;  5L8M A;  2WYX A;  5HD3 A;  4WEL A;  3ICY A;  4MN5 A;  4LRY C;  4MN6 A;  5CGS A;  1HVB A;  1LT0 A;  3WS2 A;  4EES A;  4G3K A;  4GLQ A;  4I38 A;  5HWW A;  2J3T C;  3S7O A;  2ZC3 B;  1O07 A;  4U0T A;  2XLN A;  1IOU A;  1L0D A;  3QP4 A;  2I9V A;  3A3I A;  3DBA A;  3WS1 A;  4RX3 A;  1T1B A;  2B18 A;  2P9V B;  1J9M A;  1NLY A;  4LEN A;  5M19 A;  2ZQ8 A;  3UMD A;  3V3S A;  4JGO A;  2ZQ9 A;  3VP2 A;  3LIE A;  4Y7P A;  1PWD A;  1L3L A;  2W27 A;  5CX7 A;  2OSU A;  4Y0U A;  1PZP A;  2V8C A;  3TG9 A;  3MXS A;  1BLP A;  4JGP A;  4UA7 A;  5HL1 A;  3NUL A;  4ARZ A;  1NZU A;  3OPH A;  4P6B A;  4GD6 A;  1ERQ A;  5CEC A;  2KDK A;  5HWV A;  2JKR I;  4N1X A;  3UN7 A;  1JWP A;  3KYZ A;  3DAV A;  3IS2 B;  5IU1 A;  1S4R A;  1VB6 A;  4K0X A;  4C75 A;  2HF6 A;  4L9F A; 
#chains in the Genus database with same CATH homology
 1GHI A;  3W4O A;  5A93 A;  4ZBE A;  4LV3 A;  1MWU A;  4DE1 A;  1QME A;  4RA7 A;  3GV9 A;  5DTK A;  3NBL A;  4BEN A;  3OCL A;  5GHY A;  3C4P A;  1SKF A;  3ZHH A;  2ZC4 B;  2XDM A;  5FI2 A;  2EX6 A;  3DWK A;  4QU3 A;  4S2P A;  1QMF A;  4OPR A;  5HAI A;  4DE0 A;  3ZG9 B;  2WAE A;  3SOI A;  3WRT A;  1FOF A;  2WAF A;  3FV7 A;  1Z6F A;  3LEZ A;  4HES A;  4GDN A;  3SH9 A;  3IHA A;  2EX8 A;  2FFF B;  3DW0 A;  4DF6 A;  4PM7 A;  5CGX A;  3WRZ A;  2G2W A;  1MXO A;  2EX2 A;  4WMC A;  4FSF A;  1RGZ A;  4KZ4 A;  1DY6 A;  5DF7 A;  3ZFZ A;  5J8X A;  3HLF A;  4S2J A;  4KZ6 A;  4HBT A;  2I72 A;  1SDN A;  3HVF A;  3IXG A;  4KG5 A;  4E3N A;  2ZC7 A;  3N4I A;  3IWO A;  3UE0 A;  4OOM A;  1WYB A;  1W5D A;  2BLS A;  3OZH A;  3PTE A;  2ZMA A;  4JBF A;  4S2O A;  1FR1 A;  3TSG A;  4E6W A;  5CHM A;  1PYY A;  4N1H A;  3IXD A;  2HP9 A;  4FH4 A;  1WE4 A;  3O87 A;  4FH2 A;  5EVI D;  1MWR A;  3HLG A;  5E2G A;  1YM1 A;  4BJP A;  1TDL A;  1L0G A;  3IF6 B;  4OQG A;  3BFC A;  4F94 A;  5CTN A;  3Q81 A;  3HRE A;  5A91 A;  2E8I A;  1ES5 A;  4NET A;  3HUN A;  2IWB A;  4CPK A;  3P09 A;  3VSL A;  1H5X A;  5EOO A;  1JVJ A;  2VGK A;  3VOY A;  3N8R A;  4MNR A;  3UO9 A;  3MFD A;  3PBR A;  5GLA A;  1K57 C;  1G68 A;  3VP3 A;  1ERM A;  2Q9N A;  3NC8 A;  5DTS A;  3LY3 A;  1YLW A;  2EXB A;  1TVF A;  1ES3 A;  1ZG6 A;  3G31 A;  4B4Z A;  3SS5 A;  3G30 A;  2GDN A;  4JPM A;  3SH7 A;  2XR0 A;  5F1F A;  5FDH A;  3ZVT A;  5AQ7 A;  5FAS A;  4ZJ1 A;  3CZD A;  2XQZ A;  3G32 A;  3M6B A;  5AQ9 A;  3VFH A;  1HZO A;  2A49 A;  4OP5 A;  4QY6 A;  2JBF A;  1YMS A;  2WGW B;  4PPR A;  4C3Q A;  4D2O A;  3TOI A;  2V1Z A;  3HLW A;  1M40 A;  3WS4 A;  1MBL A;  5BOH A;  1YQS A;  3ZG0 A;  1ONH A;  1SDE A;  1K55 A;  2Y91 A;  3ZNT A;  3IXB A;  4C6Y A;  1CK3 A;  3BEC A;  4JF6 A;  1TDG A;  4PM6 A;  3ZG7 B;  1I5Q A;  3OPR A;  2Y59 A;  3A3F A;  1ESU A;  3AGD A;  3M6H A;  3BEB A;  4R3J A;  4KZ5 A;  1NY0 A;  1YT4 A;  2JE5 A;  4R1G A;  1XGJ A;  2JCH A;  2V2F F;  2WZX A;  2FFY A;  1K25 A;  5KSH A;  1Y54 A;  3WS0 A;  5FQM A;  4O7D A;  2H5S A;  3NDE A;  5FI6 A;  4BQM A;  3ZDJ A;  2ZM8 A;  5CER A;  3M2J A;  3S22 A;  1KE4 A;  1RGY A;  1E25 A;  4GDB A;  4DXB A;  1H8Y A;  1YLZ A;  1K38 A;  3MKF A;  4GZB A;  3PAG A;  4WZ4 A;  1BLC A;  1YMX A;  3A3J A;  3MZE A;  3NDG A;  1ESI A;  4K0W A;  4X68 A;  4ZJ3 A;  4YFM A;  2Z2L B;  4GNU A;  2WKH A;  1CI8 A;  4KQO A;  1LI0 A;  2J7V A;  3BFF A;  4FD8 A;  2XD5 A;  4OOY A;  1N4O A;  3LO7 A;  4OQI A;  2EXA A;  2IWC A;  3FKV A;  4P85 A;  4RX2 A;  2XFS A;  3RXW A;  1NRF A;  2PBY A;  4N9K A;  1H8Z A;  2V20 A;  5FAQ A;  4S2K A;  3ZCZ A;  4CJN A;  4GB7 A;  1GHP A;  4Z9Q A;  1BT5 A;  2HDS A;  4U0X A;  3IF6 A;  2WAD A;  4ID4 A;  1W7F A;  5EVI B;  3A3D A;  1ONG A;  1U60 A;  3HL9 A;  4K91 A;  3V5M A;  1RCJ A;  2XGN A;  4OOL A;  2HDQ A;  1GCE A;  4GOG A;  1HD8 A;  3HBR A;  3ITA A;  1ZC2 A;  5D3O A;  1E3U A;  1OME A;  2Y2N A;  4DDS A;  1LHY A;  4EBN A;  1MPL A;  3IWI A;  2Y2J A;  4WEK A;  4EV4 A;  1XKZ A;  1BSG A;  1BUL A;  4M3K A;  4A5R A;  1N9B A;  2VGJ A;  3BLM A;  3ZVW A;  1C3B A;  4EWF A;  4P0M A;  3VFF A;  4JLF A;  4LV2 A;  2WKE A;  2P9V A;  4S2L A;  4Y0T A;  4DRT A;  2UWX A;  2ZC6 B;  4LCL A;  4JXG A;  3O3V A;  3C7V A;  2WGI A;  5GL9 A;  5TR7 A;  1NYY A;  4BLM A;  4MLL A;  3Q7V B;  5FA7 A;  1SHV A;  5FI7 A;  4E3K A;  4OQH A;  4BD0 A;  3ITB A;  3ZG8 B;  3SS4 A;  1K56 D;  4IVI A;  1BLS A;  1BZA A;  1JWZ A;  1L0E A;  3IF5 A;  3MBZ A;  3Q82 A;  3V39 A;  4E3I A;  5CTM A;  1KE0 A;  3I7J A;  3BM6 A;  4ZJ2 A;  4ZDX A;  2ZC5 B;  3OCN A;  1G6A A;  1S6R A;  5HW3 A;  4ZTK A;  1NZO A;  3UPN A;  1KGG A;  1K4F A;  2Y2P A;  5E43 A;  1MWS A;  3M2K A;  3QNC A;  3UPO A;  4XXR A;  4S2I A;  4OLD A;  4UHU A;  4B4X A;  2JC7 A;  3C5A A;  3IHB A;  3OC2 A;  3PBS A;  4OPQ A;  2HDR A;  2HPB A;  5F83 A;  3PBQ A;  4X53 A;  5HAQ A;  5KSC A;  2X71 A;  3DTM A;  3UDI A;  3UPP A;  5KMW A;  4IVK A;  4X69 A;  2R9W A;  3N6I A;  1XPB A;  3Q7Z A;  4JKT A;  5L2F A;  3VP1 A;  4E3O A;  4QJG A;  2Y2I A;  3LY4 A;  4DXC A;  1W8Q A;  1XGI A;  5KZH A;  3GTC A;  5EEC A;  1DJB A;  2WKI A;  3QNB A;  4KZ3 A;  1KVM A;  3HLD A;  3RJU A;  2C5W B;  1PI5 A;  3HLB A;  3Q1F A;  1K6S A;  5I94 A;  3Q07 A;  2DNS A;  4E3L A;  3N8L A;  1EWZ A;  3VP0 A;  3D4F A;  2DCF A;  3MKE A;  1IYS A;  4IBX A;  2G2U A;  2ZD8 A;  4QB8 A;  1JTD A;  2J9O A;  1L2S A;  4DE3 A;  1I2S A;  2Q9M A;  2XK1 A;  3EQV A;  4KG2 A;  2J8Y A;  4S2M A;  1FSY A;  3GR2 A;  1K55 C;  3PBN A;  4KG6 A;  4WM9 A;  1ERO A;  5EVI A;  3FKW A;  3N7W A;  4IBR A;  5FQI A;  2ZQD A;  4WEJ A;  5A92 A;  3MZF A;  1CEG A;  5GLB A;  2C6W B;  5F82 A;  1VQQ A;  3OPL A;  5GHX A;  4JXV A;  4OPZ A;  5A90 A;  1M6K A;  1FQG A;  2HP6 A;  3EQU A;  3MXR A;  4OKP A;  1FR6 A;  5CRF A;  4LV0 A;  5FQK A;  5G18 A;  2P74 A;  2DRW A;  4YIN A;  1DJC A;  4QHC A;  3W4P A;  3G4P A;  3LCE A;  4KZ9 A;  4OON A;  2OLU A;  1WYC A;  1NYM A;  3JYI A;  4WBG A;  2RL3 A;  3BFE A;  1XXM A;  3C7U A;  5FSR A;  1IKI A;  5CEB A;  5AQB A;  4PMA A;  5TGF A;  4EUZ A;  2Z2M B;  3NIA A;  1IYQ A;  1ZG4 A;  2XF3 A;  1BLH A;  4RVA A;  4EBP A;  1PWC A;  3G34 A;  4PM9 A;  3UY6 A;  5CHU A;  3E2L A;  3GQZ A;  1JWV A;  3ISG A;  1I2W A;  3GRJ A;  3HLE A;  2HDU A;  2Y2O A;  4BL2 A;  3NY4 A;  1KDW A;  4OH0 A;  1XX2 A;  3ZGA B;  3G2Z A;  1XA1 A;  4KZB A;  5GLD A;  3CG5 A;  1W8Y A;  4OLG A;  2PU2 A;  2B5R A;  2XD1 A;  3GVB A;  3FWL A;  3IF6 C;  1ES2 A;  4E6X A;  5FQ9 A;  3HUM A;  4EBL A;  4BD1 A;  1JTG A;  3IT9 A;  4DKI A;  5CHJ A;  2QMI A;  2ZQC A;  4WMC D;  1NJ4 A;  2ZQA A;  2Y4A A;  3IH8 A;  4WZ5 C;  5E2E A;  3A3E A;  3S1Y A;  4QD4 A;  3O88 A;  1NXY A;  2ZM0 A;  4WZ5 A;  5FQJ A;  3IWQ A;  3HLC A;  4N92 A;  1PZO A;  2Y55 A;  4KQR A;  1AXB A;  4UA9 A;  2EFX A;  4H8R A;  2Y2Q A;  4JXW A;  4Y0O A;  2R9X A;  1K4E A;  3BRM A;  1LI9 A;  3AGE A;  3GMW A;  4LV1 A;  3VOZ A;  2OLV A;  3IH9 A;  3MZD A;  2Y2L A;  4GD8 A;  4XUZ A;  3P98 A;  5DF8 A;  1GA9 A;  4KZ8 A;  3V50 A;  1K54 A;  2H0T A;  4E3M A;  2X02 A;  1BTL A;  3UNW A;  1FCN A;  3BLS A;  2WUQ A;  5EVL A;  1GA0 A;  1KDS A;  4MBF A;  5DF9 A;  4ZAM A;  1YLJ A;  3GSG A;  2BG1 A;  4N9L A;  2WGW A;  5CGW A;  1K6R A;  3QHY A;  3VSK A;  2EFU A;  2J9P A;  2WGV A;  4X55 A;  3CMZ A;  4RYE A;  4S2N C;  1YLY A;  5FQQ A;  5DTT A;  1MWT A;  1EI5 A;  4JXS A;  4PM8 A;  5U47 A;  4S2N A;  3DWZ A;  2XEP A;  4X56 A;  4QY5 A;  3W4Q A;  4Q8I A;  4GKU A;  2RCX A;  4U3T A;  5EPH A;  2Y2H A;  1Q2Q A;  3NCK A;  1KGF A;  3IXH A;  4WYY A;  1FCO A;  2WZZ A;  2Y2G A;  1PW8 A;  2ZQ7 A;  3PBT A;  3BYD A;  4OPY A;  3S4X A;  2A3U A;  1ALQ A;  1KGE A;  3W8K A;  4PM5 A;  5CED A;  2WYX A;  3VP4 A;  4WEL A;  1MKI A;  3BFD A;  5F1G A;  5TFQ A;  5CGS A;  1HVB A;  5GHZ A;  4L0L A;  3UDF A;  1MY8 A;  5DVA A;  2XFT A;  3WS2 A;  3FYZ A;  4UAA A;  1FCM A;  5EUA A;  4OP8 A;  1KE3 A;  5EE8 A;  5M18 A;  4E3J A;  2H10 A;  4KQQ A;  4DE2 A;  1K56 A;  1PI4 A;  3O86 A;  4KZA A;  5HX9 A;  1YLP A;  5EVI C;  1IYP A;  5FAT A;  3OPP A;  2ZC3 B;  4MEZ A;  2EX9 A;  3UDX A;  5E2F A;  2PU4 A;  1O07 A;  3UE3 A;  1Q2P A;  1IYO A;  1YLT A;  2ZLY A;  3G2Y A;  2ZM2 A;  3C4O A;  2XLN A;  3N8S A;  4U0T A;  4XUX A;  5JYP A;  2QPN A;  4DDY A;  3VMA A;  1L0D A;  4JF5 A;  3A3I A;  5GLC A;  3SH8 A;  3UE1 A;  3WS1 A;  1CEF A;  4KZ7 A;  4RX3 A;  1K57 A;  4R4R A;  4GN2 A;  2P9V B;  1RP5 A;  3FZC A;  3NI9 A;  1S0W A;  3PBO A;  3WWX A;  3AGF A;  1J9M A;  5EOE A;  1CI9 A;  5FAP A;  5FAO A;  2WK0 A;  4IED A;  4LEN A;  4X6T A;  1SCW A;  5E2H A;  5JYO A;  5M19 A;  1W79 A;  2ZQ8 A;  3V3S A;  3E2K A;  3RXX A;  2ZQ9 A;  3VP2 A;  2H0Y A;  4Y7P A;  3HUO A;  1PWD A;  1PW1 A;  4P87 A;  1E4D A;  1IKG A;  1LL9 A;  3Q7V A;  3B3X A;  3SS3 A;  4UA6 A;  2OSU A;  4KEN B;  4MBK A;  4Y0U A;  1KVL A;  4OQ0 A;  2HP5 A;  4B88 A;  1HTZ A;  3V3R A;  3WS5 A;  1PZP A;  3TG9 A;  4HEF A;  2Y2K A;  3PAE A;  3MXS A;  1O7E A;  2CC1 A;  1E3U D;  4R23 A;  1BLP A;  4EQI A;  1IEL A;  4UA7 A;  5HL1 A;  1LL5 A;  5HFO A;  5CXW A;  1LLB A;  4R0Q A;  1NZU A;  4MBH A;  3OPH A;  1DJA A;  3CJM A;  4HBU A;  1TEM A;  4NK3 A;  5AQA A;  1ZKJ A;  4LCM A;  4P6B A;  4GD6 A;  4R3B A;  4JF4 A;  2Y2M A;  3ZG5 A;  5HAR A;  2X01 A;  1ERQ A;  5CEC A;  5IHV A;  1PIO A;  1VM1 A;  1FSW A;  1GHM A;  1L0F A;  2ZJ9 A;  2QZ6 A;  4FCF A;  4N1X A;  3UN7 A;  3ZNY A;  2IWD A;  4OVD A;  4BL3 A;  3IQA A;  5M1A A;  1JWP A;  5HAP A;  1XA7 A;  1XP4 A;  1ES4 A;  1IEM A;  1BUE A;  2OV5 A;  2XH9 A;  3BFG A;  3G35 A;  4K0X A;  1PWG A;  4C75 A;  4R4S A;  1K54 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...