3M2KA

Crystal structure of fluorescein-labeled class a -beta lactamase penp in complex with cefotaxime
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
256
structure length
245
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPEGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structural studies of the mechanism for biosensing antibiotics in a fluorescein-labeled beta-lactamase.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 81
structure length 245
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3m2kA00
2QMIA 1K57C 5FAQA 2OV5A 3IH9A 3M6BA 1EI5A 4EV4A 1K4EA 4KZ8A 4X68A 4FH2A 2BLSA 5CGSA 3A3IA 4UA7A 3DWKA 4S2NC 4WYYA 4ZDXA 2PU4A 3EQUA 3EQVA 5HW3A 1BULA 4B88A 3OZHA 1ES4A 2PBYA 3Q7VA 1FQGA 5CXWA 1LL9A 5M18A 4PM6A 3ZDJA 2Q9MA 3UNWA 5F83A 1KGEA 3V3RA 3N8SA 5FQKA 3ZG0A 1TVFA 3ZGAB 3C4PA 3NC8A 3SH7A 1PI4A 2WKIA 3SOIA 3LY4A 3W4QA 4RX3A 2ZC4B 2ZQ9A 3G35A 3MZFA 3GSGA 1BTLA 2EFUA 1BUEA 1DJAA 3BFEA 4QJGA 1DY6A 2EX8A 4HBTA 4HBUA 4FCFA 2C6WB 3OPHA 4KENB 5E2HA 4LCLA 3FWLA 1RCJA 3O86A 4BL2A 5HFOA 4DE1A 5FQ9A 1PWCA 2Y2GA 3HUNA 4OONA 1FCOA 3C7VA 3BEBA 3LO7A 1IKGA 3HUMA 3E2LA 1K6SA 4N92A 3ZG8B 4EQIA 1U60A 2XD1A 3LY3A 3W4PA 1K56A 5GLCA 3QNCA 1LI9A 2QZ6A 2Z2LB 4CPKA 5FI7A 5AQ7A 4LV1A 4WZ5A 2XF3A 5JYPA 2EX2A 3HL9A 2Y91A 2V2FF 3ITBA 3O88A 4GZBA 5M1AA 3Q82A 5GHYA 1KE0A 1W5DA 4GNUA 2ZC5B 4KZAA 4KZ4A 2HP5A 5HX9A 3TOIA 4JPMA 3O87A 3BFGA 5AQBA 3SH9A 3BRMA 4BL3A 1PYYA 4LV3A 5E2FA 1YT4A 5G18A 4E3KA 2WAEA 4KZ5A 4S2LA 5CRFA 3M2KA 3ZG7B 3WS4A 2XEPA 2Y2IA 3ZFZA 2WGVA 3HUOA 2X02A 1K55A 3PBOA 1YMXA 1RP5A 3NIAA 4OPYA 5EVIC 1BSGA 5EVID 1KE3A 5I94A 2HDQA 3ITAA 2P74A 3IQAA 2WYXA 3W8KA 4DE2A 5CEBA 4WM9A 3UE3A 1PWGA 2Y2OA 4PMAA 3BECA 3VP4A 1NYYA 3BFFA 2ZQ7A 1TEMA 3FKWA 4JXVA 4LV2A 4R3JA 3HLDA 5D3OA 1HZOA 1AXBA 3UN7A 1NZUA 2ZMAA 2EXBA 4WEKA 3WS0A 2RCXA 2FFFB 1CEFA 1ES3A 4KZ9A 3HLGA 2Y2HA 5CTNA 1CI8A 2IWCA 4MLLA 3BFCA 5EOOA 5GL9A 5CECA 3WRTA 2JE5A 3A3FA 1E3UA 1PZPA 3AGEA 4R4RA 4EBPA 2XDMA 3FV7A 3NI9A 3VFHA 2C5WB 3AGDA 5JYOA 3OCNA 2A49A 3BFDA 3IWQA 4L0LA 2FFYA 2Y2LA 3HVFA 4OKPA 3RJUA 2WZZA 3UDFA 1PZOA 3C7UA 3HLCA 3FKVA 4M3KA 2Y2JA 5CHUA 3V5MA 3P09A 2XK1A 3S22A 2E8IA 2H0YA 3NBLA 1ONGA 1GHMA 4WELA 5AQAA 4E3JA 3WS5A 5EECA 3B3XA 1K54A 5A90A 5KSHA 3LCEA 1YLTA 5KMWA 1QMEA 1ESUA 3O3VA 4KQRA 2XH9A 2XFTA 5FDHA 4EWFA 2G2UA 2V1ZA 1N9BA 1W8YA 3G34A 2H0TA 5TGFA 1PIOA 1Z6FA 3PAGA 4NETA 1ZKJA 3NCKA 1GHPA 3CMZA 4JXWA 3IHBA 2HPBA 4K0WA 2VGKA 2ZM2A 4WZ4A 5FATA 2X71A 3MKEA 4RYEA 3PAEA 5EPHA 2ZD8A 3GMWA 4KZ7A 4GDNA 3G4PA 1MKIA 2XGNA 4OOMA 3Q07A 3BLMA 4GOGA 4DKIA 4OPQA 4IVKA 1WYBA 3Q81A 1MBLA 3MXSA 1W79A 2WKHA 1YLJA 2Y2MA 1FR6A 1I2SA 1L0FA 2ZQAA 3M2JA 5CGWA 4DDSA 3IWOA 1HD8A 3ZVTA 4OQHA 3GV9A 1JTGA 2A3UA 2J8YA 4BD0A 4DRTA 4OP5A 4UHUA 3IT9A 2X01A 4LENA 4P87A 4OQ0A 1EROA 4ID4A 2Y4AA 4RA7A 1E4DA 4B4ZA 3WWXA 1DJCA 3UDXA 2WAFA 4QHCA 3UPNA 1I2WA 5TR7A 4K91A 3SS3A 2Y2NA 1XA7A 3VSKA 4N9LA 1JWZA 1CEGA 4U3TA 3PBTA 4K0XA 1XPBA 4WMCA 1GCEA 4GKUA 4EUZA 4PM5A 1RGYA 4S2KA 4OLDA 4WBGA 5KZHA 1NJ4A 5GHXA 3MZDA 4OOYA 1M40A 2I72A 5DTSA 4DF6A 5A93A 4S2MA 5FAPA 3VMAA 3VP3A 4N1HA 3CZDA 3G2YA 5DTKA 3ZG5A 1GHIA 4GD6A 1K56D 1MWSA 2VGJA 4QY6A 5HAIA 2WZXA 4U0XA 1ES5A 2IWDA 3IXHA 4WZ5C 1IEMA 1LLBA 4JF6A 4ZJ1A 4QU3A 1S6RA 1YQSA 2Y59A 3DTMA 1C3BA 3N4IA 1BLSA 2WKEA 5CHMA 2ZQCA 3FZCA 4XUZA 5L2FA 1NXYA 3C5AA 1CK3A 1BZAA 2WGWA 3PBSA 4E3OA 4PPRA 4JLFA 5CEDA 4QY5A 2EFXA 1G68A 2Y55A 4X56A 5BOHA 4GN2A 4YINA 4E3MA 1W7FA 4R0QA 2CC1A 5CTMA 4EBNA 3GVBA 4FSFA 1K55C 2JC7A 2DNSA 2JCHA 3JYIA 4NK3A 4OP8A 1XXMA 2HP9A 4E3LA 4KZ3A 1NRFA 1PW8A 5M19A 3OPLA 3BM6A 4O7DA 3PBNA 1SKFA 4E3NA 2HP6A 3IXGA 4E6XA 2WUQA 3MBZA 3IHAA 1ONHA 2GDNA 3S1YA 1GA0A 3OCLA 3IF6A 3D4FA 4IEDA 1DJBA 3M6HA 3QNBA 2P9VA 4MEZA 1NZOA 3I7JA 4OQIA 5DF8A 4ZBEA 5HAQA 1I5QA 3W4OA 1K6RA 5EUAA 3MFDA 4JKTA 4CJNA 4P6BA 4P0MA 4KQQA 4UA9A 2R9WA 5EVIB 5HARA 4KZBA 3UPPA 2B5RA 1PI5A 4X69A 2ZC6B 1MWTA 1SCWA 1ERQA 1IYPA 4OVDA 3WS2A 5GLDA 3A3EA 4OQGA 2WGWB 2QPNA 4LV0A 5DF9A 1KVMA 1E3UD 4JBFA 3NDEA 4IBXA 4MBFA 3UY6A 2DCFA 4HEFA 5F82A 5IHVA 4R23A 1SDNA 4S2PA 3Q7ZA 3N8LA 4R4SA 2ZQ8A 5GLAA 4QB8A 5FI2A 4D2OA 3PBRA 3PTEA 1H5XA 1S0WA 4X6TA 2ZM0A 3TSGA 1K57A 2EXAA 2OSUA 5HAPA 5GHZA 4RX2A 3RXWA 5EE8A 2J7VA 1BLHA 3IXDA 2Q9NA 3G32A 4DE3A 4FH4A 4HESA 4S2NA 5CERA 3CG5A 3AGFA 4BD1A 1W8QA 4JF5A 1IYQA 2HDRA 3HREA 1M6KA 5GLBA 1ALQA 1FR1A 1JVJA 3N7WA 4N9KA 1H8YA 3BYDA 1K54C 3IF6B 1NY0A 2P9VB 3IXBA 1E25A 3VOYA 4BENA 4DXBA 4YFMA 2ZJ9A 3DWZA 1N4OA 3NDGA 1FCMA 4H8RA 2H5SA 4DE0A 3GR2A 3UPOA 1NYMA 5F1FA 2OLVA 4LCMA 3ZNTA 1WYCA 4RVAA 3VP0A 3G2ZA 4S2IA 4ZTKA 3TG9A 1MWUA 3HLFA 3MXRA 4BLMA 4GB7A 3LEZA 1XA1A 1IYSA 4ZJ3A 2HDUA 3ISGA 4IBRA 4P85A 3UDIA 4GDBA 4JXGA 4Y7PA 5A91A 4Y0UA 3WS1A 3A3DA 1FCNA 3E2KA 3N6IA 1L2SA 1MWRA 5U47A 2DRWA 2Y2KA 2IWBA 3DW0A 3IH8A 3OPPA 2H10A 1MXOA 1Q2PA 4KG6A 2ZQDA 4C3QA 3OPRA 4E6WA 1H8ZA 4QD4A 4XXRA 1OMEA 1TDGA 5FQMA 4OH0A 4X55A 2BG1A 2RL3A 3ZCZA 5KSCA 4OLGA 4EBLA 2XR0A 3HBRA 1ZC2A 3VP1A 3Q1FA 4R3BA 1ES2A 2Y2QA 1JTDA 1TDLA 2XLNA 4JF4A 3N8RA 3RXXA 5E2GA 4DDYA 1XX2A 1IELA 2ZC7A 3MKFA 3WRZA 4WMCD 5FASA 5EVIA 5E43A 1ERMA 2UWXA 3BLSA 3ZVWA 1HTZA 3V39A 1JWVA 1K38A 2Y2PA 3Q7VB 1BLPA 4S2JA 3UE0A 1XGIA 1YLPA 4B4XA 3C4OA 1MPLA 1K25A 4FD8A 3P98A 4BQMA 2PU2A 4OOLA 4A5RA 5FAOA 1XP4A 1GA9A 4PM7A 1IKIA 4KG5A 3G31A 4X53A 4GD8A 5DTTA 3SS5A 4MNRA 3VSLA 4PM9A 4ZJ2A 3HLBA 3MZEA 1VQQA 4S2OA 3ZHHA 1L0DA 5HL1A 1VM1A 4Z9QA 3ZG9B 4E3IA 4PM8A 3A3JA 1O07A 1KVLA 2HDSA 2OLUA 3V3SA 3OC2A 1LL5A 2V20A 3IF5A 2EX6A 5FQIA 1IYOA 1PW1A 1ZG6A 4OPRA 1KDWA 2XFSA 3ZNYA 3SH8A 3CJMA 2ZM8A 4UAAA 3UE1A 1XKZA 3G30A 4U0TA 4C6YA 4KQOA 3V50A 4DXCA 3UO9A 5FI6A 3PBQA 1ZG4A 4R1GA 1JWPA 2XD5A 3GQZA 1YLZA 3NY4A 1SDEA 4IVIA 1FOFA 3GRJA 5A92A 2ZLYA 3VOZA 4KG2A 2G2WA 5FQQA 1RGZA 4JXSA 1KGFA 5EOEA 1CI9A 2ZC3B 3IWIA 1YLYA 1Q2QA 5AQ9A 1EWZA 1KGGA 3SS4A 5TFQA 4UA6A 4MBHA 1L0GA 1G6AA 4ZAMA 3VFFA 5F1GA 1FSYA 2Z2MB 3IF6C 2J9PA 1KE4A 1PWDA 2EX9A 3S4XA 3HLWA 2WK0A 4XUXA 5DF7A 2J9OA 2WADA 3VP2A 4KZ6A 1XGJA 5EVLA 1QMFA 5J8XA 2WGIA 1YM1A 1BLCA 4Y0TA 3HLEA 3QHYA 2JBFA 1O7EA 5DVAA 1Y54A 1KDSA 2XQZA 1MY8A 4Q8IA 1J9MA 4Y0OA 1YLWA 1K4FA 3FYZA 5CGXA 1LHYA 4OPZA 4N1XA 4WEJA 5FA7A 1SHVA 4BJPA 1WE4A 1HVBA 4MBKA 1YMSA 1FSWA 1LI0A 1L0EA 5E2EA 4C75A 4F94A 5FSRA 5CHJA 3GTCA 2R9XA 5FQJA 1BT5A 1ESIA
chains in the Genus database with same CATH superfamily
3M6BA 3JVVA 1K4EA 3A3IA 4HNBA 3DWKA 4S2NC 3EQVA 1BULA 1DP8A 2A24B 1FQGA 4PM6A 2Q9MA 3K2NA 3ZGAB 1PI4A 1A0KA 2ZC4B 5HDDA 3EGDC 2VLGA 1NLZA 3GSGA 1BUEA 1DJAA 4P6ZS 4QJGA 2EX8A 4FCFA 3NOTC 3H82A 5E2HA 3O86A 4BL2A 1FCOA 1GSVA 3HL9A 2Y91A 1CF0A 3VE4A 5A8BA 2D02A 2O9CA 5HX9A 4KZ4A 2HP5A 3CI6A 3BFGA 1YT4A 3S7QA 4E3KA 2XSSA 4S2LA 3M2KA 3WS4A 4BWIA 1K55A 2X02A 5EVID 1YMXA 1RP5A 3DTKA 1BSGA 3H82B 1H8MA 3IQAA 3W8KA 2KX6A 4WM9A 2B95A 3UE3A 4PMAA 3VP4A 1NYYA 3FKWA 1MZUA 4HH3A 1AXBA 1NZUA 3WS0A 4I3IA 3ZQ5A 3WRTA 1PZPA 3AGEA 3NECA 3H9WA 3RTYA 3VFHA 1N9LA 3JPUA 4BMWA 3BFDA 4EERA 3IWQA 3MR0A 3RJUA 2VA0A 2OWHA 3HLCA 4M3KA 3V5MA 3ICYA 1FIKA 1QMEA 1ESUA 2PD7A 3L7HA 2W3HA 2V8FA 1N9BA 3BQAA 3G34A 5TGFA 1ZKJA 4JXWA 2HPBA 2VGKA 2ZM2A 2EWVA 4RYEA 2ZD8A 3BY8A 3G4PA 1OTDA 2XGNA 3B33A 3BLMA 4DKIA 4PHTA 4OPQA 4IVKA 1WYBA 3Q81A 1W79A 4X25A 2WKHA 4I39A 4HIAA 1YLJA 1F9IA 3M2JA 4DDSA 2P7JA 2PYRA 1VEUA 1JTGA 4BD0A 4OP5A 2X01A 4LENA 4P87A 3JVUA 1EROA 2Y4AA 4B4ZA 4QHCA 1KOUA 1XA7A 4N9LA 1CEGA 1RGYA 4P6ZM 4S2KA 4PAUA 3MZDA 5DTSA 1N9NA 3NOPC 5DTKA 1GHIA 1UWPX 4GD6A 1MWSA 4QY6A 1T1AA 4HJ4A 3IXHA 3T4OA 1ODVA 3F1NA 1K0KA 2Y59A 5CHMA 1VEUB 2ZQCA 3FZCA 1PFLA 3C5AA 1BZAA 4E3OA 1LSXA 4PPRA 3T4QA 5CEDA 3G6OA 4RQ9A 4GN2A 4YINA 4R0QA 4PKYA 2WKQA 1L3LA 4FSFA 1K55C 2JC7A 2DNSA 4E3LA 5M19A 4LRZE 4E6XA 1ONHA 1Z09A 5DFXA 2GDNA 3S1YA 3OCLA 4OQIA 1OTIA 3QNBA 4MEZA 3T4LA 4FTXA 3OBFA 1TS7A 2QYBA 4P0MA 3UPPA 2B5RA 4X69A 5GLDA 5DF9A 3NDEA 3E4PA 4MBFA 3UY6A 1S67L 5F82A 4HJ6A 3PYPA 3PTEA 1XJ2A 3TSGA 4RX2A 3RXWA 3G32A 4FH4A 4HESA 3CG5A 3HREA 2EWWA 1M6KA 4WUJA 5GLBA 5C5KA 1NLYA 4DXBA 3NDGA 4H8RA 1VETA 1NYMA 2VK3A 5F1FA 1ZTUA 2OLVA 4LCMA 3MXQA 3HLFA 2K31A 4BLMA 1XA1A 3ISGA 3B42A 3UDIA 1L2SA 1XJ4A 1MWRA 2DRWA 2IWBA 3OPPA 1MXOA 3OPRA 2MJ6A 3UB8A 3QP1A 5TJJA 1OJGA 3LIBA 2XR0A 3FPVA 4R3BA 3LR0A 1VETB 5E2GA 3C2WA 2PBDP 3MKFA 1S1YA 3BLSA 1HTZA 1K38A 3Q7VB 3C4OA 1MPLA 1K25A 3P98A 1STZA 3QP8A 4BBTA 4X53A 2JKRI 1F5MA 2VGLS 4PM8A 5HDCA 3KSGA 2OLUA 3OC2A 1XJ6A 1IYOA 3MF0A 1KDWA 4LGWA 3SH8A 2ZM8A 3LGOA 3MMHA 4C6YA 2GNXA 3UO9A 4R1GA 5EM0A 1RGZA 3T4TA 1CI9A 5AQ9A 1KGGA 1L0GA 4ZAMA 3TW8A 3HLWA 2WADA 5F6AA 2HGVA 4Q0HA 1BLCA 2H28A 4Y17A 3QHYA 1NRJA 5F69A 1O7EA 4KQDA 2ZOIA 3FC7A 1MY8A 4Y0OA 1YLWA 1K4FA 3QP4A 1LHYA 4OPZA 1HVBA 4C75A 1FSWA 5E2EA 5FSRA 5CHJA 3CPTB 5FQJA 4LLOB 2OV5A 4EESA 4R6LA 4ZDXA 4WYYA 1ES4A 2B18A 2VKSA 5M18A 1V9YA 3ZDJA 1KGEA 3N8SA 2Y8HA 2ZOHA 3NC8A 3SH7A 4G3VA 3UB7A 3LY4A 2ZQ9A 3G35A 2EFUA 1DY6A 4MN5A 4HBTA 3OPHA 4LCLA 4DE1A 3HUNA 3VOLA 1UGUA 3C7VA 3HUMA 3R7WB 4N92A 3EEAA 1U60A 3EWKA 1TS8A 3QNCA 4CPKA 2QZ6A 5AQ7A 1MKMA 2EX2A 3ITBA 3O88A 4GLQA 4YNRA 2ZC5B 5HD5A 3LR4A 2D01A 3T1XA 3BRMA 5E2FA 5G18A 4HHDA 2Y2IA 3PBOA 1KE3A 2HDQA 2WYXA 4DE2A 3A0VA 2ACGA 2ZQ7A 1TEMA 4HP9A 4JXVA 4LV2A 4R3JA 3HLDA 1YKDA 5D3OA 4HQAA 2FFFB 4O0PA 1CEFA 2PYPA 1OTBA 3HLGA 5CTNA 1CI8A 4MLLA 2HF6A 3BFCA 5EOOA 5GL9A 4EW7A 5CECA 3SZTA 2JE5A 4Y13A 3BWLA 3FV7A 3NI9A 2C5WB 3OCNA 2A49A 2KLIA 5FEFA 2O0YA 2VZWA 1OJ5A 5IU1A 3UDFA 2XK1A 3S22A 3NBLA 1ONGA 1MC0A 3F1OA 5A90A 3B3XA 2VV7A 2W3DA 3NOUC 3O3VA 2W0NA 2XFTA 3KSFA 3E0YA 2V1ZA 1W8YA 1OT9A 4GHIB 1Z6FA 3PAGA 4NETA 3NCKA 1GHPA 4WLAA 2X71A 5EPHA 4KZ7A 4GDNA 4IUKA 4OOMA 4GOGA 3KSIA 2J3WA 2NUPC 1OT6A 3DAVA 3KO6A 1FR6A 5CGWA 1HD8A 3ZVTA 1DP9A 3F1OB 2A3UA 2J8YA 4HI4A 1D06A 3IT9A 4RA7A 5G4ZA 5HWWA 2WAFA 1I2WA 3VSKA 1JWZA 4EU0A 1G6OA 1XPBA 1GCEA 4GKUA 4PM5A 4I38A 4OLDA 4WBGA 3GECA 5A93A 4CLCA 4N1HA 3G2YA 5I5LA 5FEGA 2VGJA 4PKYG 5HAIA 4R38A 2IWDA 1S6RA 3DTMA 3V67A 3HJKA 1NXYA 1CK3A 2WGWA 3BW6A 1TS6A 5CX7A 2EFXA 3BQ8A 5BOHA 1W7FA 2CC1A 5CTMA 4EBNA 1IFQA 5HWVA 1IOUA 2JCHA 5L09A 2HP9A 2A2LA 4KZ3A 1NRFA 1PW8A 3KX0X 1VB6A 3BM6A 3PBNA 5IS1A 2O9BA 2WUQA 5HL6A 2KOIA 3IHAA 4CLCB 4HH2A 1T18A 1GA0A 4EEPA 4LRYC 3M6HA 3KYQA 4JKTA 3LI9A 1XFNA 5EVIB 2R9WA 5HARA 3MQOA 1EW0A 1ERQA 1IYPA 2ZL1B 3A3EA 4OQGA 3IBRA 2WGWB 2QPNA 2V8CA 3LYXA 1F98A 3F1PA 3FPWA 5IHVA 4UEYA 4D2OA 3Q7ZA 4QB8A 5FI2A 2ZM0A 4I3JA 5HAPA 5L8MA 2OSUA 3UB5P 4DE3A 3AGFA 4BD1A 4JF5A 4GCZA 1ALQA 1FR1A 3N7WA 2Y79A 4N9KA 3BYDA 4HOIA 1N4OA 2VV6A 2H5SA 4BBUA 3GR2A 3UPOA 1Y4OA 1WYCA 3IBJA 4JGRA 1T19A 1G28A 2R78A 4GB7A 2W3FA 3F1PB 4Y0UA 3E2KA 2Y2KA 3DW0A 3IH8A 2H10A 1Q2PA 4KG6A 4E6WA 4QD4A 1OMEA 1OPXA 1TF1A 4MN6A 2BG1A 4OLGA 4GJ4A 2VV8A 3RFBA 2QWSA 4JF4A 3N8RA 5DKLA 4DDYA 2ZC7A 3WRZA 2W3EA 2UWXA 3V39A 1YSPA 1JWVA 4S2JA 3UE6A 3UE0A 1P97A 5EM1A 3KYEA 2PR5A 4MDZA 4CLCC 2VEAA 4PM7A 1IKIA 4EEUA 4KG5A 1OTEA 4CQHA 3G31A 5DTTA 3SS5A 3VSLA 3TE8A 4PM9A 4S2OA 3HLBA 1VQQA 3DTIA 3A3JA 3IX4A 3CITA 1KVLA 3V3SA 1LL5A 3IF5A 5FQIA 1ZG6A 2W3GA 4OPRA 3CJMA 3LI8A 3OOVA 4B93A 1XKZA 3G30A 3LR5A 5FI6A 1ZG4A 5IT5A 4IVIA 3GRJA 2G2WA 5FQQA 2V1AA 3O5YA 3IWIA 1EWZA 4L9EA 5TFQA 4MBHA 1X0OA 1W63M 1FSYA 2PDRA 2Z2MB 4MMNA 4XUXA 4NEED 1SZVA 1QMFA 1YM1A 4DMZA 4Y0TA 3HLEA 2QJ5A 3S7OA 2JKRM 3T1SA 1Y54A 2V0WA 2XQZA 5HDSA 2OOLA 4N1XA 4WEJA 1SHVA 4BJPA 4F94A 3RH8B 5EVEA 2R9XA 3P7NA 3IH9A 1EI5A 5CGSA 2PU4A 2JKFA 2PBYA 3Q7VA 5CXWA 1LL9A 2NUTC 1LT0A 3UNWA 3ZG0A 1TVFA 3C4PA 2WKIA 3SOIA 3QP5A 4WL9A 3BFEA 5LBRA 1RCJA 5HFOA 1PWCA 2Y2GA 3BEBA 3LICA 5AJGA 2PHYA 1K6SA 3ZG8B 4EQIA 2B02A 3W4PA 2BTFP 1K56A 1GSWA 5TBMB 1LI9A 2Z2LB 3EOIA 5M1AA 3Q82A 1KE0A 1W5DA 4DN0A 4GNUA 4YOFA 4BL3A 4LV3A 2YKHA 4KZ5A 5CRFA 3BJNA 2GZAA 2FZ0A 2V0UA 3HUOA 4OPYA 3ITAA 4QPRA 1PWGA 2Y2OA 4NXGA 3PHYA 3BFFA 1HZOA 3B47A 4UQIM 3CPTA 2K2NA 4WEKA 4JGOA 2EA9A 1ES3A 2IWCA 3DBAA 3A3FA 1E3UA 4XT2B 4R4RA 4EBPA 3K3DA 5DJUA 1P9WA 2FFYA 2Y2LA 1FILA 3HVFA 2WZZA 1PZOA 3C7UA 2Y2JA 1CQAA 3P09A 2E8IA 2H0YA 1GHMA 2PD8A 4WELA 4MN7A 4E3JA 5EECA 5KSHA 5KMWA 2XRNA 4KQRA 3R7WA 3W2ZA 3E4OA 1YPRA 3CMZA 3IHBA 5FATA 4ETZA 2JN7A 3GMWA 2HJEA 1MKIA 1CJFA 4ARZA 3HCYA 3Q07A 4O01A 5DFYA 4R70A 1LSWA 4MCWA 1LL8A 4IJGA 1I2SA 4ESPA 4H6JA 4OQHA 5HSQA 2HZ5A 4DRTA 4UHUA 4ID4A 2Z6CA 3CUEA 3KYZA 1T1CA 2QHKA 3WWXA 1DJCA 3UDXA 3UPNA 5TR7A 3SS3A 3T1QB 4U3TA 3PBTA 4WMCA 4GW9A 3NULA 5KZHA 5GHXA 4ARZB 4DF6A 2XROA 3VMAA 3VP3A 4Y2FA 2V9AA 3U2AA 2WZXA 3FG8A 4U0XA 1ES5A 2ZMFA 1IEMA 4QU3A 1W63Q 1BLSA 4H6JB 2BASA 2WKEA 2PAVP 3PBSA 4Z1WA 4QY5A 1SKOA 1G68A 2Y55A 2J3TC 4E3MA 1LSVA 3GVBA 1GSXA 3CHWP 4OP8A 4GHIA 4IHQA 4NK3A 2I9VA 1XXMA 3OPLA 4O7DA 1SKFA 3IXGA 4JGPA 2Z6DA 5AVEA 2OAP1 3PR6A 4NXEA 3LIFA 1DJBA 5DF8A 2P9VA 4II7A 1NZOA 3I7JA 5EUAA 3MFDA 2HV1A 4CJNA 3MS6A 2QJ7A 3DTEA 4KQQA 4UA9A 4KZBA 2ZC6B 3D72A 2L0WA 4OVDA 3P01A 4ME4A 2J80A 1KVMA 2VX8A 3MQQA 4JBFA 1SKOB 4IBXA 2DCFA 1VHMA 4HEFA 2JHEA 1SDNA 1BYWA 1N9OA 3N8LA 2ZQ8A 3PBRA 4X6TA 1S0WA 1K57A 2EXAA 2J7VA 1BLHA 2Q9NA 5CERA 2HDRA 3LIEA 1NY0A 3C8CA 3TJZC 2P9VB 3IXBA 4BENA 3VOYA 3E4QA 3U4LP 3E98A 2O9AA 3VE3A 3IS2A 5F5YA 4DE0A 3ULFA 4KUOA 3ZNTA 2AVXA 4BBVA 4RVAA 1PNEA 5DKKA 3VP0A 4ZTKA 4GS9A 3MXRA 4ZJ3A 2HDUA 4P85A 1DRMA 4Y7PA 3WS1A 5A91A 3TRCA 2UV0E 3N6IA 4ETXA 2ZQDA 4DJ3A 1H8ZA 4XXRA 1TDGA 5FQMA 4DJ2A 4X55A 2RL3A 3ZCZA 1XJ3A 4HY8A 1ZC2A 3VP1A 3IS2B 3ZYTA 2Y2QA 1TDLA 3CUEC 2XA7M 4IUHA 5FL3A 2W1TA 1XX2A 5EVIA 2LB9A 1F2KA 4GS9B 4HJ3A 3ZVWA 2Y2PA 2ZL1A 5J3WA 1YLPA 2JKTI 4Y3IA 4FD8A 4CLCD 1H3QA 1XP4A 4X1MA 4MNRA 2LB5A 4ZJ2A 5HL1A 5EV0A 3VV4A 1VM1A 3LR3A 4Z9QA 4E3IA 4E04A 2HDSA 3UB9A 4WN5A 3MFXA 2XFSA 3ZNYA 4KUKA 4NXFA 1S66L 3UE1A 4EQ1A 4KQOA 3V50A 4DXCA 1NWZA 2XD5A 2W1TB 4G3KA 3GQZA 1SDEA 1FOFA 2ZLYA 4KG2A 2E8JA 1YLYA 5AVFA 4FOFA 3S7PA 2J9PA 3CLOA 1KE4A 5DF7A 2J9OA 1XGJA 5HPIA 2M7UA 4I5SA 3T1RA 4WF0A 1KDSA 3LFVA 4Q8IA 1J9MA 3FYZA 3NJAA 5CGXA 5FA7A 1WE4A 4QWOA 4MBKA 1YMSA 1LI0A 1L0EA 1S4RA 5EFWA 3GTCA 1BT5A 4I3AA 1TD5A 2QMIA 1K57C 4LPZA 5FAQA 4EV4A 1WA9A 4KZ8A 4X68A 4FH2A 2M1CA 2BLSA 4UA7A 3EQUA 5HW3A 4B88A 3OZHA 2W1RA 2INWA 1S1ZA 5F83A 3V3RA 5FQKA 4NG2A 3IX8A 2V1BA 2M7VA 3W4QA 4RX3A 3MZFA 1BTLA 3SW1A 4HBUA 2C6WB 4KENB 3FWLA 1HLUP 2PR6A 5FQ9A 5HPFA 4OONA 3LO7A 1IKGA 4JGQA 3E2LA 2XD1A 3K3CA 4LFUA 3LY3A 5GLCA 1S4SA 1P0ZA 3KSHA 5FI7A 4EETB 4LV1A 4WZ5A 2XF3A 5JYPA 2JKGA 2V2FF 4GZBA 5GHYA 4KZAA 3TOIA 4JPMA 1AWIA 3O87A 5AQBA 3SH9A 1PYYA 4UQIS 3UB6A 2WAEA 3CAXA 3ZG7B 2XEPA 4R3AA 3ZFZA 2WGVA 5EVIC 3NIAA 5I94A 2WKPA 2P74A 5CEBA 3T4SA 5DJTA 3BECA 3UN7A 3HJIA 2PRFA 3PXPA 4G3WA 4EUVA 2ZMAA 2EXBA 2VJWA 4HP4A 2RCXA 4KZ9A 2Y2HA 4Q0IA 5HD3A 1Y28A 4CLCE 2OWJA 3C38A 2XDMA 5JYOA 3AGDA 4L0LA 3F1NB 4OKPA 4Y15A 3FKVA 5CHUA 5AQAA 3WS5A 1H0MA 1K54A 3LCEA 1YLTA 2XH9A 5FDHA 4EWFA 2G2UA 2H0TA 5TBMA 1PIOA 2Q0OA 1XFQA 1T1BA 2GJ3A 4K0WA 4WZ4A 3MKEA 3PAEA 5KIZA 2OAQ1 4AFIA 2ZMVA 2KDKA 1MBLA 3MXSA 5L10A 2DMWA 3LEQA 4M4XA 4L9FA 2Y2MA 1L0FA 1YSQA 2ZQAA 3IWOA 3GV9A 4Y5FA 2G7UA 4OQ0A 1E4DA 1J3WA 3LUQA 4K91A 2Y2NA 3BY9A 3UMDA 4K0XA 4K08A 2PT7A 4EUZA 4Q0JA 1NJ4A 4OOYA 1M40A 1YAXA 2I72A 4S2MA 3A0SA 4XT2A 5FAPA 3T50A 3CZDA 3GDIA 3ZG5A 1K56D 4WZ5C 1LLBA 4JF6A 4ZJ1A 1YQSA 1C3BA 3N4IA 5F68A 1D1JA 2L4RA 4XUZA 5L2FA 3T4KA 4JLFA 4X56A 5MC7A 2J3TD 3L9KA 5FDSA 4X1LA 3JYIA 4E3NA 2HP6A 3MBZA 3IF6A 4IEDA 3D4FA 4ZBEA 5HAQA 1I5QA 1G5UA 1K6RA 4NXBA 3W4OA 4EXOA 4P6BA 1PI5A 1MWTA 1SCWA 3A0RA 3WS2A 4LV0A 3T12B 1E3UD 2W27A 2L1MA 4R23A 2FH5A 3LIDA 1UWNX 4S2PA 4R4SA 5GLAA 2GX5A 1H5XA 4B9OA 4YWZA 3D3OA 5GHZA 5EE8A 5G4YA 3IXDA 4S2NA 1OTAA 1W8QA 1IYQA 4D60A 1JVJA 1H8YA 3C30A 4NKPA 1K54C 3IF6B 1E25A 3R4KA 4YFMA 2ZJ9A 3DWZA 1DP6A 1FCMA 5HZHA 3G2ZA 4S2IA 3TG9A 1MWUA 2O99A 5J4EA 5HWTA 1ACFA 3LEZA 1IYSA 4IBRA 2XA7S 4GDBA 4JXGA 2K7SA 3A3DA 4L9GA 1FCNA 1TS0A 5U47A 4C3QA 2ZBBA 3MQ0A 3MSHA 3S7NA 1D7EA 4OH0A 5KSCA 4EBLA 3HBRA 3Q1FA 1ES2A 1JTDA 2XLNA 4LRXC 2P04A 3LIAA 1P9RA 3RXXA 1IELA 4WMCD 5FASA 5E43A 1ERMA 1BLPA 3UMEA 4ZRRA 1XGIA 4B4XA 2P08A 3H7WA 2CMNA 4BQMA 2PU2A 4OOLA 4A5RA 5FAOA 1GA9A 3NHQA 2IA2A 4GD8A 3ZHHA 3OLOA 3MZEA 1L0DA 3IX3A 3ZG9B 1V9ZA 1O07A 3D9YA 4O8GA 5J7EA 2WKRA 2V20A 2EX6A 2QKPA 3CWFA 1PW1A 4F3LA 2YKFA 4UAAA 4U0TA 3PBQA 1JWPA 1YLZA 3NY4A 3T4JA 5A92A 3VOZA 2HJ9C 3EGXC 2VGLM 4JXSA 1KGFA 5EOEA 2ZC3B 1Q2QA 3H7WB 3SS4A 2A24A 4UA6A 1G6AA 3VFFA 1JNUA 5F1GA 1PRQA 2JKTM 3IF6C 5L07A 1PWDA 1ZHHB 2EX9A 3S4XA 2WK0A 3VP2A 4KZ6A 5EVLA 5J8XA 2WGIA 3MJQA 2JBFA 5DVAA 4F3LB 5K5BA 3QP6A 3EEHA 3QP2A 4FUWA 1ESIA
chains in the Genus database with same CATH topology
2QMIA 1K57C 5FAQA 2OV5A 3IH9A 3M6BA 1EI5A 4EV4A 1K4EA 4KZ8A 4X68A 4FH2A 2BLSA 5CGSA 3A3IA 4UA7A 3DWKA 4S2NC 4WYYA 4ZDXA 2PU4A 3EQUA 3EQVA 5HW3A 1BULA 4B88A 3OZHA 1ES4A 2PBYA 3Q7VA 1FQGA 5CXWA 1LL9A 5M18A 4PM6A 3ZDJA 2Q9MA 3UNWA 5F83A 1KGEA 3V3RA 3N8SA 5FQKA 3ZG0A 1TVFA 3ZGAB 3C4PA 3NC8A 3SH7A 1PI4A 2WKIA 3SOIA 3LY4A 3W4QA 4RX3A 2ZC4B 2ZQ9A 3G35A 3MZFA 3GSGA 1BTLA 2EFUA 1BUEA 1DJAA 3BFEA 4QJGA 1DY6A 2EX8A 4HBTA 4HBUA 4FCFA 2C6WB 3OPHA 4KENB 5E2HA 4LCLA 3FWLA 1RCJA 3O86A 4BL2A 5HFOA 4DE1A 5FQ9A 1PWCA 2Y2GA 3HUNA 4OONA 1FCOA 3C7VA 3BEBA 3LO7A 1IKGA 3HUMA 3E2LA 1K6SA 4N92A 3ZG8B 4EQIA 1U60A 2XD1A 3LY3A 3W4PA 1K56A 5GLCA 3QNCA 1LI9A 2QZ6A 2Z2LB 4CPKA 5FI7A 5AQ7A 4LV1A 4WZ5A 2XF3A 5JYPA 2EX2A 3HL9A 2Y91A 2V2FF 3ITBA 3O88A 4GZBA 5M1AA 3Q82A 5GHYA 1KE0A 1W5DA 4GNUA 2ZC5B 4KZAA 4KZ4A 2HP5A 5HX9A 3TOIA 4JPMA 3O87A 3BFGA 5AQBA 3SH9A 3BRMA 4BL3A 1PYYA 4LV3A 5E2FA 1YT4A 5G18A 4E3KA 2WAEA 4KZ5A 4S2LA 5CRFA 3M2KA 3ZG7B 3WS4A 2XEPA 2Y2IA 3ZFZA 2WGVA 3HUOA 2X02A 1K55A 3PBOA 1YMXA 1RP5A 3NIAA 4OPYA 5EVIC 1BSGA 5EVID 1KE3A 5I94A 2HDQA 3ITAA 2P74A 3IQAA 2WYXA 3W8KA 4DE2A 5CEBA 4WM9A 3UE3A 1PWGA 2Y2OA 4PMAA 3BECA 3VP4A 1NYYA 3BFFA 2ZQ7A 1TEMA 3FKWA 4JXVA 4LV2A 4R3JA 3HLDA 5D3OA 1HZOA 1AXBA 3UN7A 1NZUA 2ZMAA 2EXBA 4WEKA 3WS0A 2RCXA 2FFFB 1CEFA 1ES3A 4KZ9A 3HLGA 2Y2HA 5CTNA 1CI8A 2IWCA 4MLLA 3BFCA 5EOOA 5GL9A 5CECA 3WRTA 2JE5A 3A3FA 1E3UA 1PZPA 3AGEA 4R4RA 4EBPA 2XDMA 3FV7A 3NI9A 3VFHA 2C5WB 3AGDA 5JYOA 3OCNA 2A49A 3BFDA 3IWQA 4L0LA 2FFYA 2Y2LA 3HVFA 4OKPA 3RJUA 2WZZA 3UDFA 1PZOA 3C7UA 3HLCA 3FKVA 4M3KA 2Y2JA 5CHUA 3V5MA 3P09A 2XK1A 3S22A 2E8IA 2H0YA 3NBLA 1ONGA 1GHMA 4WELA 5AQAA 4E3JA 3WS5A 5EECA 3B3XA 1K54A 5A90A 5KSHA 3LCEA 1YLTA 5KMWA 1QMEA 1ESUA 3O3VA 4KQRA 2XH9A 2XFTA 5FDHA 4EWFA 2G2UA 2V1ZA 1N9BA 1W8YA 3G34A 2H0TA 5TGFA 1PIOA 1Z6FA 3PAGA 4NETA 1ZKJA 3NCKA 1GHPA 3CMZA 4JXWA 3IHBA 2HPBA 4K0WA 2VGKA 2ZM2A 4WZ4A 5FATA 2X71A 3MKEA 4RYEA 3PAEA 5EPHA 2ZD8A 3GMWA 4KZ7A 4GDNA 3G4PA 1MKIA 2XGNA 4OOMA 3Q07A 3BLMA 4GOGA 4DKIA 4OPQA 4IVKA 1WYBA 3Q81A 1MBLA 3MXSA 1W79A 2WKHA 1YLJA 2Y2MA 1FR6A 1I2SA 1L0FA 2ZQAA 3M2JA 5CGWA 4DDSA 3IWOA 1HD8A 3ZVTA 4OQHA 3GV9A 1JTGA 2A3UA 2J8YA 4BD0A 4DRTA 4OP5A 4UHUA 3IT9A 2X01A 4LENA 4P87A 4OQ0A 1EROA 4ID4A 2Y4AA 4RA7A 1E4DA 4B4ZA 3WWXA 1DJCA 3UDXA 2WAFA 4QHCA 3UPNA 1I2WA 5TR7A 4K91A 3SS3A 2Y2NA 1XA7A 3VSKA 4N9LA 1JWZA 1CEGA 4U3TA 3PBTA 4K0XA 1XPBA 4WMCA 1GCEA 4GKUA 4EUZA 4PM5A 1RGYA 4S2KA 4OLDA 4WBGA 5KZHA 1NJ4A 5GHXA 3MZDA 4OOYA 1M40A 2I72A 5DTSA 4DF6A 5A93A 4S2MA 5FAPA 3VMAA 3VP3A 4N1HA 3CZDA 3G2YA 5DTKA 3ZG5A 1GHIA 4GD6A 1K56D 1MWSA 2VGJA 4QY6A 5HAIA 2WZXA 4U0XA 1ES5A 2IWDA 3IXHA 4WZ5C 1IEMA 1LLBA 4JF6A 4ZJ1A 4QU3A 1S6RA 1YQSA 2Y59A 3DTMA 1C3BA 3N4IA 1BLSA 2WKEA 5CHMA 2ZQCA 3FZCA 4XUZA 5L2FA 1NXYA 3C5AA 1CK3A 1BZAA 2WGWA 3PBSA 4E3OA 4PPRA 4JLFA 5CEDA 4QY5A 2EFXA 1G68A 2Y55A 4X56A 5BOHA 4GN2A 4YINA 4E3MA 1W7FA 4R0QA 2CC1A 5CTMA 4EBNA 3GVBA 4FSFA 1K55C 2JC7A 2DNSA 2JCHA 3JYIA 4NK3A 4OP8A 1XXMA 2HP9A 4E3LA 4KZ3A 1NRFA 1PW8A 5M19A 3OPLA 3BM6A 4O7DA 3PBNA 1SKFA 4E3NA 2HP6A 3IXGA 4E6XA 2WUQA 3MBZA 3IHAA 1ONHA 2GDNA 3S1YA 1GA0A 3OCLA 3IF6A 3D4FA 4IEDA 1DJBA 3M6HA 3QNBA 2P9VA 4MEZA 1NZOA 3I7JA 4OQIA 5DF8A 4ZBEA 5HAQA 1I5QA 3W4OA 1K6RA 5EUAA 3MFDA 4JKTA 4CJNA 4P6BA 4P0MA 4KQQA 4UA9A 2R9WA 5EVIB 5HARA 4KZBA 3UPPA 2B5RA 1PI5A 4X69A 2ZC6B 1MWTA 1SCWA 1ERQA 1IYPA 4OVDA 3WS2A 5GLDA 3A3EA 4OQGA 2WGWB 2QPNA 4LV0A 5DF9A 1KVMA 1E3UD 4JBFA 3NDEA 4IBXA 4MBFA 3UY6A 2DCFA 4HEFA 5F82A 5IHVA 4R23A 1SDNA 4S2PA 3Q7ZA 3N8LA 4R4SA 2ZQ8A 5GLAA 4QB8A 5FI2A 4D2OA 3PBRA 3PTEA 1H5XA 1S0WA 4X6TA 2ZM0A 3TSGA 1K57A 2EXAA 2OSUA 5HAPA 5GHZA 4RX2A 3RXWA 5EE8A 2J7VA 1BLHA 3IXDA 2Q9NA 3G32A 4DE3A 4FH4A 4HESA 4S2NA 5CERA 3CG5A 3AGFA 4BD1A 1W8QA 4JF5A 1IYQA 2HDRA 3HREA 1M6KA 5GLBA 1ALQA 1FR1A 1JVJA 3N7WA 4N9KA 1H8YA 3BYDA 1K54C 3IF6B 1NY0A 2P9VB 3IXBA 1E25A 3VOYA 4BENA 4DXBA 4YFMA 2ZJ9A 3DWZA 1N4OA 3NDGA 1FCMA 4H8RA 2H5SA 4DE0A 3GR2A 3UPOA 1NYMA 5F1FA 2OLVA 4LCMA 3ZNTA 1WYCA 4RVAA 3VP0A 3G2ZA 4S2IA 4ZTKA 3TG9A 1MWUA 3HLFA 3MXRA 4BLMA 4GB7A 3LEZA 1XA1A 1IYSA 4ZJ3A 2HDUA 3ISGA 4IBRA 4P85A 3UDIA 4GDBA 4JXGA 4Y7PA 5A91A 4Y0UA 3WS1A 3A3DA 1FCNA 3E2KA 3N6IA 1L2SA 1MWRA 5U47A 2DRWA 2Y2KA 2IWBA 3DW0A 3IH8A 3OPPA 2H10A 1MXOA 1Q2PA 4KG6A 2ZQDA 4C3QA 3OPRA 4E6WA 1H8ZA 4QD4A 4XXRA 1OMEA 1TDGA 5FQMA 4OH0A 4X55A 2BG1A 2RL3A 3ZCZA 5KSCA 4OLGA 4EBLA 2XR0A 3HBRA 1ZC2A 3VP1A 3Q1FA 4R3BA 1ES2A 2Y2QA 1JTDA 1TDLA 2XLNA 4JF4A 3N8RA 3RXXA 5E2GA 4DDYA 1XX2A 1IELA 2ZC7A 3MKFA 3WRZA 4WMCD 5FASA 5EVIA 5E43A 1ERMA 2UWXA 3BLSA 3ZVWA 1HTZA 3V39A 1JWVA 1K38A 2Y2PA 3Q7VB 1BLPA 4S2JA 3UE0A 1XGIA 1YLPA 4B4XA 3C4OA 1MPLA 1K25A 4FD8A 3P98A 4BQMA 2PU2A 4OOLA 4A5RA 5FAOA 1XP4A 1GA9A 4PM7A 1IKIA 4KG5A 3G31A 4X53A 4GD8A 5DTTA 3SS5A 4MNRA 3VSLA 4PM9A 4ZJ2A 3HLBA 3MZEA 1VQQA 4S2OA 3ZHHA 1L0DA 5HL1A 1VM1A 4Z9QA 3ZG9B 4E3IA 4PM8A 3A3JA 1O07A 1KVLA 2HDSA 2OLUA 3V3SA 3OC2A 1LL5A 2V20A 3IF5A 2EX6A 5FQIA 1IYOA 1PW1A 1ZG6A 4OPRA 1KDWA 2XFSA 3ZNYA 3SH8A 3CJMA 2ZM8A 4UAAA 3UE1A 1XKZA 3G30A 4U0TA 4C6YA 4KQOA 3V50A 4DXCA 3UO9A 5FI6A 3PBQA 1ZG4A 4R1GA 1JWPA 2XD5A 3GQZA 1YLZA 3NY4A 1SDEA 4IVIA 1FOFA 3GRJA 5A92A 2ZLYA 3VOZA 4KG2A 2G2WA 5FQQA 1RGZA 4JXSA 1KGFA 5EOEA 1CI9A 2ZC3B 3IWIA 1YLYA 1Q2QA 5AQ9A 1EWZA 1KGGA 3SS4A 5TFQA 4UA6A 4MBHA 1L0GA 1G6AA 4ZAMA 3VFFA 5F1GA 1FSYA 2Z2MB 3IF6C 2J9PA 1KE4A 1PWDA 2EX9A 3S4XA 3HLWA 2WK0A 4XUXA 5DF7A 2J9OA 2WADA 3VP2A 4KZ6A 1XGJA 5EVLA 1QMFA 5J8XA 2WGIA 1YM1A 1BLCA 4Y0TA 3HLEA 3QHYA 2JBFA 1O7EA 5DVAA 1Y54A 1KDSA 2XQZA 1MY8A 4Q8IA 1J9MA 4Y0OA 1YLWA 1K4FA 3FYZA 5CGXA 1LHYA 4OPZA 4N1XA 4WEJA 5FA7A 1SHVA 4BJPA 1WE4A 1HVBA 4MBKA 1YMSA 1FSWA 1LI0A 1L0EA 5E2EA 4C75A 4F94A 5FSRA 5CHJA 3GTCA 2R9XA 5FQJA 1BT5A 1ESIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QMI A;  1K57 C;  5FAQ A;  2OV5 A;  3IH9 A;  3M6B A;  1EI5 A;  4EV4 A;  1K4E A;  4KZ8 A;  4X68 A;  4FH2 A;  2BLS A;  5CGS A;  3A3I A;  4UA7 A;  3DWK A;  4S2N C;  4WYY A;  4ZDX A;  2PU4 A;  3EQU A;  3EQV A;  5HW3 A;  1BUL A;  4B88 A;  3OZH A;  1ES4 A;  2PBY A;  3Q7V A;  1FQG A;  5CXW A;  1LL9 A;  5M18 A;  4PM6 A;  3ZDJ A;  2Q9M A;  3UNW A;  5F83 A;  1KGE A;  3V3R A;  3N8S A;  5FQK A;  3ZG0 A;  1TVF A;  3ZGA B;  3C4P A;  3NC8 A;  3SH7 A;  1PI4 A;  2WKI A;  3SOI A;  3LY4 A;  3W4Q A;  4RX3 A;  2ZC4 B;  2ZQ9 A;  3G35 A;  3MZF A;  3GSG A;  1BTL A;  2EFU A;  1BUE A;  1DJA A;  3BFE A;  4QJG A;  1DY6 A;  2EX8 A;  4HBT A;  4HBU A;  4FCF A;  2C6W B;  3OPH A;  4KEN B;  5E2H A;  4LCL A;  3FWL A;  1RCJ A;  3O86 A;  4BL2 A;  5HFO A;  4DE1 A;  5FQ9 A;  1PWC A;  2Y2G A;  3HUN A;  4OON A;  1FCO A;  3C7V A;  3BEB A;  3LO7 A;  1IKG A;  3HUM A;  3E2L A;  1K6S A;  4N92 A;  3ZG8 B;  4EQI A;  1U60 A;  2XD1 A;  3LY3 A;  3W4P A;  1K56 A;  5GLC A;  3QNC A;  1LI9 A;  2QZ6 A;  2Z2L B;  4CPK A;  5FI7 A;  5AQ7 A;  4LV1 A;  4WZ5 A;  2XF3 A;  5JYP A;  2EX2 A;  3HL9 A;  2Y91 A;  2V2F F;  3ITB A;  3O88 A;  4GZB A;  5M1A A;  3Q82 A;  5GHY A;  1KE0 A;  1W5D A;  4GNU A;  2ZC5 B;  4KZA A;  4KZ4 A;  2HP5 A;  5HX9 A;  3TOI A;  4JPM A;  3O87 A;  3BFG A;  5AQB A;  3SH9 A;  3BRM A;  4BL3 A;  1PYY A;  4LV3 A;  5E2F A;  1YT4 A;  5G18 A;  4E3K A;  2WAE A;  4KZ5 A;  4S2L A;  5CRF A;  3M2K A;  3ZG7 B;  3WS4 A;  2XEP A;  2Y2I A;  3ZFZ A;  2WGV A;  3HUO A;  2X02 A;  1K55 A;  3PBO A;  1YMX A;  1RP5 A;  3NIA A;  4OPY A;  5EVI C;  1BSG A;  5EVI D;  1KE3 A;  5I94 A;  2HDQ A;  3ITA A;  2P74 A;  3IQA A;  2WYX A;  3W8K A;  4DE2 A;  5CEB A;  4WM9 A;  3UE3 A;  1PWG A;  2Y2O A;  4PMA A;  3BEC A;  3VP4 A;  1NYY A;  3BFF A;  2ZQ7 A;  1TEM A;  3FKW A;  4JXV A;  4LV2 A;  4R3J A;  3HLD A;  5D3O A;  1HZO A;  1AXB A;  3UN7 A;  1NZU A;  2ZMA A;  2EXB A;  4WEK A;  3WS0 A;  2RCX A;  2FFF B;  1CEF A;  1ES3 A;  4KZ9 A;  3HLG A;  2Y2H A;  5CTN A;  1CI8 A;  2IWC A;  4MLL A;  3BFC A;  5EOO A;  5GL9 A;  5CEC A;  3WRT A;  2JE5 A;  3A3F A;  1E3U A;  1PZP A;  3AGE A;  4R4R A;  4EBP A;  2XDM A;  3FV7 A;  3NI9 A;  3VFH A;  2C5W B;  3AGD A;  5JYO A;  3OCN A;  2A49 A;  3BFD A;  3IWQ A;  4L0L A;  2FFY A;  2Y2L A;  3HVF A;  4OKP A;  3RJU A;  2WZZ A;  3UDF A;  1PZO A;  3C7U A;  3HLC A;  3FKV A;  4M3K A;  2Y2J A;  5CHU A;  3V5M A;  3P09 A;  2XK1 A;  3S22 A;  2E8I A;  2H0Y A;  3NBL A;  1ONG A;  1GHM A;  4WEL A;  5AQA A;  4E3J A;  3WS5 A;  5EEC A;  3B3X A;  1K54 A;  5A90 A;  5KSH A;  3LCE A;  1YLT A;  5KMW A;  1QME A;  1ESU A;  3O3V A;  4KQR A;  2XH9 A;  2XFT A;  5FDH A;  4EWF A;  2G2U A;  2V1Z A;  1N9B A;  1W8Y A;  3G34 A;  2H0T A;  5TGF A;  1PIO A;  1Z6F A;  3PAG A;  4NET A;  1ZKJ A;  3NCK A;  1GHP A;  3CMZ A;  4JXW A;  3IHB A;  2HPB A;  4K0W A;  2VGK A;  2ZM2 A;  4WZ4 A;  5FAT A;  2X71 A;  3MKE A;  4RYE A;  3PAE A;  5EPH A;  2ZD8 A;  3GMW A;  4KZ7 A;  4GDN A;  3G4P A;  1MKI A;  2XGN A;  4OOM A;  3Q07 A;  3BLM A;  4GOG A;  4DKI A;  4OPQ A;  4IVK A;  1WYB A;  3Q81 A;  1MBL A;  3MXS A;  1W79 A;  2WKH A;  1YLJ A;  2Y2M A;  1FR6 A;  1I2S A;  1L0F A;  2ZQA A;  3M2J A;  5CGW A;  4DDS A;  3IWO A;  1HD8 A;  3ZVT A;  4OQH A;  3GV9 A;  1JTG A;  2A3U A;  2J8Y A;  4BD0 A;  4DRT A;  4OP5 A;  4UHU A;  3IT9 A;  2X01 A;  4LEN A;  4P87 A;  4OQ0 A;  1ERO A;  4ID4 A;  2Y4A A;  4RA7 A;  1E4D A;  4B4Z A;  3WWX A;  1DJC A;  3UDX A;  2WAF A;  4QHC A;  3UPN A;  1I2W A;  5TR7 A;  4K91 A;  3SS3 A;  2Y2N A;  1XA7 A;  3VSK A;  4N9L A;  1JWZ A;  1CEG A;  4U3T A;  3PBT A;  4K0X A;  1XPB A;  4WMC A;  1GCE A;  4GKU A;  4EUZ A;  4PM5 A;  1RGY A;  4S2K A;  4OLD A;  4WBG A;  5KZH A;  1NJ4 A;  5GHX A;  3MZD A;  4OOY A;  1M40 A;  2I72 A;  5DTS A;  4DF6 A;  5A93 A;  4S2M A;  5FAP A;  3VMA A;  3VP3 A;  4N1H A;  3CZD A;  3G2Y A;  5DTK A;  3ZG5 A;  1GHI A;  4GD6 A;  1K56 D;  1MWS A;  2VGJ A;  4QY6 A;  5HAI A;  2WZX A;  4U0X A;  1ES5 A;  2IWD A;  3IXH A;  4WZ5 C;  1IEM A;  1LLB A;  4JF6 A;  4ZJ1 A;  4QU3 A;  1S6R A;  1YQS A;  2Y59 A;  3DTM A;  1C3B A;  3N4I A;  1BLS A;  2WKE A;  5CHM A;  2ZQC A;  3FZC A;  4XUZ A;  5L2F A;  1NXY A;  3C5A A;  1CK3 A;  1BZA A;  2WGW A;  3PBS A;  4E3O A;  4PPR A;  4JLF A;  5CED A;  4QY5 A;  2EFX A;  1G68 A;  2Y55 A;  4X56 A;  5BOH A;  4GN2 A;  4YIN A;  4E3M A;  1W7F A;  4R0Q A;  2CC1 A;  5CTM A;  4EBN A;  3GVB A;  4FSF A;  1K55 C;  2JC7 A;  2DNS A;  2JCH A;  3JYI A;  4NK3 A;  4OP8 A;  1XXM A;  2HP9 A;  4E3L A;  4KZ3 A;  1NRF A;  1PW8 A;  5M19 A;  3OPL A;  3BM6 A;  4O7D A;  3PBN A;  1SKF A;  4E3N A;  2HP6 A;  3IXG A;  4E6X A;  2WUQ A;  3MBZ A;  3IHA A;  1ONH A;  2GDN A;  3S1Y A;  1GA0 A;  3OCL A;  3IF6 A;  3D4F A;  4IED A;  1DJB A;  3M6H A;  3QNB A;  2P9V A;  4MEZ A;  1NZO A;  3I7J A;  4OQI A;  5DF8 A;  4ZBE A;  5HAQ A;  1I5Q A;  3W4O A;  1K6R A;  5EUA A;  3MFD A;  4JKT A;  4CJN A;  4P6B A;  4P0M A;  4KQQ A;  4UA9 A;  2R9W A;  5EVI B;  5HAR A;  4KZB A;  3UPP A;  2B5R A;  1PI5 A;  4X69 A;  2ZC6 B;  1MWT A;  1SCW A;  1ERQ A;  1IYP A;  4OVD A;  3WS2 A;  5GLD A;  3A3E A;  4OQG A;  2WGW B;  2QPN A;  4LV0 A;  5DF9 A;  1KVM A;  1E3U D;  4JBF A;  3NDE A;  4IBX A;  4MBF A;  3UY6 A;  2DCF A;  4HEF A;  5F82 A;  5IHV A;  4R23 A;  1SDN A;  4S2P A;  3Q7Z A;  3N8L A;  4R4S A;  2ZQ8 A;  5GLA A;  4QB8 A;  5FI2 A;  4D2O A;  3PBR A;  3PTE A;  1H5X A;  1S0W A;  4X6T A;  2ZM0 A;  3TSG A;  1K57 A;  2EXA A;  2OSU A;  5HAP A;  5GHZ A;  4RX2 A;  3RXW A;  5EE8 A;  2J7V A;  1BLH A;  3IXD A;  2Q9N A;  3G32 A;  4DE3 A;  4FH4 A;  4HES A;  4S2N A;  5CER A;  3CG5 A;  3AGF A;  4BD1 A;  1W8Q A;  4JF5 A;  1IYQ A;  2HDR A;  3HRE A;  1M6K A;  5GLB A;  1ALQ A;  1FR1 A;  1JVJ A;  3N7W A;  4N9K A;  1H8Y A;  3BYD A;  1K54 C;  3IF6 B;  1NY0 A;  2P9V B;  3IXB A;  1E25 A;  3VOY A;  4BEN A;  4DXB A;  4YFM A;  2ZJ9 A;  3DWZ A;  1N4O A;  3NDG A;  1FCM A;  4H8R A;  2H5S A;  4DE0 A;  3GR2 A;  3UPO A;  1NYM A;  5F1F A;  2OLV A;  4LCM A;  3ZNT A;  1WYC A;  4RVA A;  3VP0 A;  3G2Z A;  4S2I A;  4ZTK A;  3TG9 A;  1MWU A;  3HLF A;  3MXR A;  4BLM A;  4GB7 A;  3LEZ A;  1XA1 A;  1IYS A;  4ZJ3 A;  2HDU A;  3ISG A;  4IBR A;  4P85 A;  3UDI A;  4GDB A;  4JXG A;  4Y7P A;  5A91 A;  4Y0U A;  3WS1 A;  3A3D A;  1FCN A;  3E2K A;  3N6I A;  1L2S A;  1MWR A;  5U47 A;  2DRW A;  2Y2K A;  2IWB A;  3DW0 A;  3IH8 A;  3OPP A;  2H10 A;  1MXO A;  1Q2P A;  4KG6 A;  2ZQD A;  4C3Q A;  3OPR A;  4E6W A;  1H8Z A;  4QD4 A;  4XXR A;  1OME A;  1TDG A;  5FQM A;  4OH0 A;  4X55 A;  2BG1 A;  2RL3 A;  3ZCZ A;  5KSC A;  4OLG A;  4EBL A;  2XR0 A;  3HBR A;  1ZC2 A;  3VP1 A;  3Q1F A;  4R3B A;  1ES2 A;  2Y2Q A;  1JTD A;  1TDL A;  2XLN A;  4JF4 A;  3N8R A;  3RXX A;  5E2G A;  4DDY A;  1XX2 A;  1IEL A;  2ZC7 A;  3MKF A;  3WRZ A;  4WMC D;  5FAS A;  5EVI A;  5E43 A;  1ERM A;  2UWX A;  3BLS A;  3ZVW A;  1HTZ A;  3V39 A;  1JWV A;  1K38 A;  2Y2P A;  3Q7V B;  1BLP A;  4S2J A;  3UE0 A;  1XGI A;  1YLP A;  4B4X A;  3C4O A;  1MPL A;  1K25 A;  4FD8 A;  3P98 A;  4BQM A;  2PU2 A;  4OOL A;  4A5R A;  5FAO A;  1XP4 A;  1GA9 A;  4PM7 A;  1IKI A;  4KG5 A;  3G31 A;  4X53 A;  4GD8 A;  5DTT A;  3SS5 A;  4MNR A;  3VSL A;  4PM9 A;  4ZJ2 A;  3HLB A;  3MZE A;  1VQQ A;  4S2O A;  3ZHH A;  1L0D A;  5HL1 A;  1VM1 A;  4Z9Q A;  3ZG9 B;  4E3I A;  4PM8 A;  3A3J A;  1O07 A;  1KVL A;  2HDS A;  2OLU A;  3V3S A;  3OC2 A;  1LL5 A;  2V20 A;  3IF5 A;  2EX6 A;  5FQI A;  1IYO A;  1PW1 A;  1ZG6 A;  4OPR A;  1KDW A;  2XFS A;  3ZNY A;  3SH8 A;  3CJM A;  2ZM8 A;  4UAA A;  3UE1 A;  1XKZ A;  3G30 A;  4U0T A;  4C6Y A;  4KQO A;  3V50 A;  4DXC A;  3UO9 A;  5FI6 A;  3PBQ A;  1ZG4 A;  4R1G A;  1JWP A;  2XD5 A;  3GQZ A;  1YLZ A;  3NY4 A;  1SDE A;  4IVI A;  1FOF A;  3GRJ A;  5A92 A;  2ZLY A;  3VOZ A;  4KG2 A;  2G2W A;  5FQQ A;  1RGZ A;  4JXS A;  1KGF A;  5EOE A;  1CI9 A;  2ZC3 B;  3IWI A;  1YLY A;  1Q2Q A;  5AQ9 A;  1EWZ A;  1KGG A;  3SS4 A;  5TFQ A;  4UA6 A;  4MBH A;  1L0G A;  1G6A A;  4ZAM A;  3VFF A;  5F1G A;  1FSY A;  2Z2M B;  3IF6 C;  2J9P A;  1KE4 A;  1PWD A;  2EX9 A;  3S4X A;  3HLW A;  2WK0 A;  4XUX A;  5DF7 A;  2J9O A;  2WAD A;  3VP2 A;  4KZ6 A;  1XGJ A;  5EVL A;  1QMF A;  5J8X A;  2WGI A;  1YM1 A;  1BLC A;  4Y0T A;  3HLE A;  3QHY A;  2JBF A;  1O7E A;  5DVA A;  1Y54 A;  1KDS A;  2XQZ A;  1MY8 A;  4Q8I A;  1J9M A;  4Y0O A;  1YLW A;  1K4F A;  3FYZ A;  5CGX A;  1LHY A;  4OPZ A;  4N1X A;  4WEJ A;  5FA7 A;  1SHV A;  4BJP A;  1WE4 A;  1HVB A;  4MBK A;  1YMS A;  1FSW A;  1LI0 A;  1L0E A;  5E2E A;  4C75 A;  4F94 A;  5FSR A;  5CHJ A;  3GTC A;  2R9X A;  5FQJ A;  1BT5 A;  1ESI A; 
#chains in the Genus database with same CATH topology
 3M6B A;  3JVV A;  1K4E A;  3A3I A;  4HNB A;  3DWK A;  4S2N C;  3EQV A;  1BUL A;  1DP8 A;  2A24 B;  1FQG A;  4PM6 A;  2Q9M A;  3K2N A;  3ZGA B;  1PI4 A;  1A0K A;  2ZC4 B;  5HDD A;  3EGD C;  2VLG A;  1NLZ A;  3GSG A;  1BUE A;  1DJA A;  4P6Z S;  4QJG A;  2EX8 A;  4FCF A;  3NOT C;  3H82 A;  5E2H A;  3O86 A;  4BL2 A;  1FCO A;  1GSV A;  3HL9 A;  2Y91 A;  1CF0 A;  3VE4 A;  5A8B A;  2D02 A;  2O9C A;  5HX9 A;  4KZ4 A;  2HP5 A;  3CI6 A;  3BFG A;  1YT4 A;  3S7Q A;  4E3K A;  2XSS A;  4S2L A;  3M2K A;  3WS4 A;  4BWI A;  1K55 A;  2X02 A;  5EVI D;  1YMX A;  1RP5 A;  3DTK A;  1BSG A;  3H82 B;  1H8M A;  3IQA A;  3W8K A;  2KX6 A;  4WM9 A;  2B95 A;  3UE3 A;  4PMA A;  3VP4 A;  1NYY A;  3FKW A;  1MZU A;  4HH3 A;  1AXB A;  1NZU A;  3WS0 A;  4I3I A;  3ZQ5 A;  3WRT A;  1PZP A;  3AGE A;  3NEC A;  3H9W A;  3RTY A;  3VFH A;  1N9L A;  3JPU A;  4BMW A;  3BFD A;  4EER A;  3IWQ A;  3MR0 A;  3RJU A;  2VA0 A;  2OWH A;  3HLC A;  4M3K A;  3V5M A;  3ICY A;  1FIK A;  1QME A;  1ESU A;  2PD7 A;  3L7H A;  2W3H A;  2V8F A;  1N9B A;  3BQA A;  3G34 A;  5TGF A;  1ZKJ A;  4JXW A;  2HPB A;  2VGK A;  2ZM2 A;  2EWV A;  4RYE A;  2ZD8 A;  3BY8 A;  3G4P A;  1OTD A;  2XGN A;  3B33 A;  3BLM A;  4DKI A;  4PHT A;  4OPQ A;  4IVK A;  1WYB A;  3Q81 A;  1W79 A;  4X25 A;  2WKH A;  4I39 A;  4HIA A;  1YLJ A;  1F9I A;  3M2J A;  4DDS A;  2P7J A;  2PYR A;  1VEU A;  1JTG A;  4BD0 A;  4OP5 A;  2X01 A;  4LEN A;  4P87 A;  3JVU A;  1ERO A;  2Y4A A;  4B4Z A;  4QHC A;  1KOU A;  1XA7 A;  4N9L A;  1CEG A;  1RGY A;  4P6Z M;  4S2K A;  4PAU A;  3MZD A;  5DTS A;  1N9N A;  3NOP C;  5DTK A;  1GHI A;  1UWP X;  4GD6 A;  1MWS A;  4QY6 A;  1T1A A;  4HJ4 A;  3IXH A;  3T4O A;  1ODV A;  3F1N A;  1K0K A;  2Y59 A;  5CHM A;  1VEU B;  2ZQC A;  3FZC A;  1PFL A;  3C5A A;  1BZA A;  4E3O A;  1LSX A;  4PPR A;  3T4Q A;  5CED A;  3G6O A;  4RQ9 A;  4GN2 A;  4YIN A;  4R0Q A;  4PKY A;  2WKQ A;  1L3L A;  4FSF A;  1K55 C;  2JC7 A;  2DNS A;  4E3L A;  5M19 A;  4LRZ E;  4E6X A;  1ONH A;  1Z09 A;  5DFX A;  2GDN A;  3S1Y A;  3OCL A;  4OQI A;  1OTI A;  3QNB A;  4MEZ A;  3T4L A;  4FTX A;  3OBF A;  1TS7 A;  2QYB A;  4P0M A;  3UPP A;  2B5R A;  4X69 A;  5GLD A;  5DF9 A;  3NDE A;  3E4P A;  4MBF A;  3UY6 A;  1S67 L;  5F82 A;  4HJ6 A;  3PYP A;  3PTE A;  1XJ2 A;  3TSG A;  4RX2 A;  3RXW A;  3G32 A;  4FH4 A;  4HES A;  3CG5 A;  3HRE A;  2EWW A;  1M6K A;  4WUJ A;  5GLB A;  5C5K A;  1NLY A;  4DXB A;  3NDG A;  4H8R A;  1VET A;  1NYM A;  2VK3 A;  5F1F A;  1ZTU A;  2OLV A;  4LCM A;  3MXQ A;  3HLF A;  2K31 A;  4BLM A;  1XA1 A;  3ISG A;  3B42 A;  3UDI A;  1L2S A;  1XJ4 A;  1MWR A;  2DRW A;  2IWB A;  3OPP A;  1MXO A;  3OPR A;  2MJ6 A;  3UB8 A;  3QP1 A;  5TJJ A;  1OJG A;  3LIB A;  2XR0 A;  3FPV A;  4R3B A;  3LR0 A;  1VET B;  5E2G A;  3C2W A;  2PBD P;  3MKF A;  1S1Y A;  3BLS A;  1HTZ A;  1K38 A;  3Q7V B;  3C4O A;  1MPL A;  1K25 A;  3P98 A;  1STZ A;  3QP8 A;  4BBT A;  4X53 A;  2JKR I;  1F5M A;  2VGL S;  4PM8 A;  5HDC A;  3KSG A;  2OLU A;  3OC2 A;  1XJ6 A;  1IYO A;  3MF0 A;  1KDW A;  4LGW A;  3SH8 A;  2ZM8 A;  3LGO A;  3MMH A;  4C6Y A;  2GNX A;  3UO9 A;  4R1G A;  5EM0 A;  1RGZ A;  3T4T A;  1CI9 A;  5AQ9 A;  1KGG A;  1L0G A;  4ZAM A;  3TW8 A;  3HLW A;  2WAD A;  5F6A A;  2HGV A;  4Q0H A;  1BLC A;  2H28 A;  4Y17 A;  3QHY A;  1NRJ A;  5F69 A;  1O7E A;  4KQD A;  2ZOI A;  3FC7 A;  1MY8 A;  4Y0O A;  1YLW A;  1K4F A;  3QP4 A;  1LHY A;  4OPZ A;  1HVB A;  4C75 A;  1FSW A;  5E2E A;  5FSR A;  5CHJ A;  3CPT B;  5FQJ A;  4LLO B;  2OV5 A;  4EES A;  4R6L A;  4ZDX A;  4WYY A;  1ES4 A;  2B18 A;  2VKS A;  5M18 A;  1V9Y A;  3ZDJ A;  1KGE A;  3N8S A;  2Y8H A;  2ZOH A;  3NC8 A;  3SH7 A;  4G3V A;  3UB7 A;  3LY4 A;  2ZQ9 A;  3G35 A;  2EFU A;  1DY6 A;  4MN5 A;  4HBT A;  3OPH A;  4LCL A;  4DE1 A;  3HUN A;  3VOL A;  1UGU A;  3C7V A;  3HUM A;  3R7W B;  4N92 A;  3EEA A;  1U60 A;  3EWK A;  1TS8 A;  3QNC A;  4CPK A;  2QZ6 A;  5AQ7 A;  1MKM A;  2EX2 A;  3ITB A;  3O88 A;  4GLQ A;  4YNR A;  2ZC5 B;  5HD5 A;  3LR4 A;  2D01 A;  3T1X A;  3BRM A;  5E2F A;  5G18 A;  4HHD A;  2Y2I A;  3PBO A;  1KE3 A;  2HDQ A;  2WYX A;  4DE2 A;  3A0V A;  2ACG A;  2ZQ7 A;  1TEM A;  4HP9 A;  4JXV A;  4LV2 A;  4R3J A;  3HLD A;  1YKD A;  5D3O A;  4HQA A;  2FFF B;  4O0P A;  1CEF A;  2PYP A;  1OTB A;  3HLG A;  5CTN A;  1CI8 A;  4MLL A;  2HF6 A;  3BFC A;  5EOO A;  5GL9 A;  4EW7 A;  5CEC A;  3SZT A;  2JE5 A;  4Y13 A;  3BWL A;  3FV7 A;  3NI9 A;  2C5W B;  3OCN A;  2A49 A;  2KLI A;  5FEF A;  2O0Y A;  2VZW A;  1OJ5 A;  5IU1 A;  3UDF A;  2XK1 A;  3S22 A;  3NBL A;  1ONG A;  1MC0 A;  3F1O A;  5A90 A;  3B3X A;  2VV7 A;  2W3D A;  3NOU C;  3O3V A;  2W0N A;  2XFT A;  3KSF A;  3E0Y A;  2V1Z A;  1W8Y A;  1OT9 A;  4GHI B;  1Z6F A;  3PAG A;  4NET A;  3NCK A;  1GHP A;  4WLA A;  2X71 A;  5EPH A;  4KZ7 A;  4GDN A;  4IUK A;  4OOM A;  4GOG A;  3KSI A;  2J3W A;  2NUP C;  1OT6 A;  3DAV A;  3KO6 A;  1FR6 A;  5CGW A;  1HD8 A;  3ZVT A;  1DP9 A;  3F1O B;  2A3U A;  2J8Y A;  4HI4 A;  1D06 A;  3IT9 A;  4RA7 A;  5G4Z A;  5HWW A;  2WAF A;  1I2W A;  3VSK A;  1JWZ A;  4EU0 A;  1G6O A;  1XPB A;  1GCE A;  4GKU A;  4PM5 A;  4I38 A;  4OLD A;  4WBG A;  3GEC A;  5A93 A;  4CLC A;  4N1H A;  3G2Y A;  5I5L A;  5FEG A;  2VGJ A;  4PKY G;  5HAI A;  4R38 A;  2IWD A;  1S6R A;  3DTM A;  3V67 A;  3HJK A;  1NXY A;  1CK3 A;  2WGW A;  3BW6 A;  1TS6 A;  5CX7 A;  2EFX A;  3BQ8 A;  5BOH A;  1W7F A;  2CC1 A;  5CTM A;  4EBN A;  1IFQ A;  5HWV A;  1IOU A;  2JCH A;  5L09 A;  2HP9 A;  2A2L A;  4KZ3 A;  1NRF A;  1PW8 A;  3KX0 X;  1VB6 A;  3BM6 A;  3PBN A;  5IS1 A;  2O9B A;  2WUQ A;  5HL6 A;  2KOI A;  3IHA A;  4CLC B;  4HH2 A;  1T18 A;  1GA0 A;  4EEP A;  4LRY C;  3M6H A;  3KYQ A;  4JKT A;  3LI9 A;  1XFN A;  5EVI B;  2R9W A;  5HAR A;  3MQO A;  1EW0 A;  1ERQ A;  1IYP A;  2ZL1 B;  3A3E A;  4OQG A;  3IBR A;  2WGW B;  2QPN A;  2V8C A;  3LYX A;  1F98 A;  3F1P A;  3FPW A;  5IHV A;  4UEY A;  4D2O A;  3Q7Z A;  4QB8 A;  5FI2 A;  2ZM0 A;  4I3J A;  5HAP A;  5L8M A;  2OSU A;  3UB5 P;  4DE3 A;  3AGF A;  4BD1 A;  4JF5 A;  4GCZ A;  1ALQ A;  1FR1 A;  3N7W A;  2Y79 A;  4N9K A;  3BYD A;  4HOI A;  1N4O A;  2VV6 A;  2H5S A;  4BBU A;  3GR2 A;  3UPO A;  1Y4O A;  1WYC A;  3IBJ A;  4JGR A;  1T19 A;  1G28 A;  2R78 A;  4GB7 A;  2W3F A;  3F1P B;  4Y0U A;  3E2K A;  2Y2K A;  3DW0 A;  3IH8 A;  2H10 A;  1Q2P A;  4KG6 A;  4E6W A;  4QD4 A;  1OME A;  1OPX A;  1TF1 A;  4MN6 A;  2BG1 A;  4OLG A;  4GJ4 A;  2VV8 A;  3RFB A;  2QWS A;  4JF4 A;  3N8R A;  5DKL A;  4DDY A;  2ZC7 A;  3WRZ A;  2W3E A;  2UWX A;  3V39 A;  1YSP A;  1JWV A;  4S2J A;  3UE6 A;  3UE0 A;  1P97 A;  5EM1 A;  3KYE A;  2PR5 A;  4MDZ A;  4CLC C;  2VEA A;  4PM7 A;  1IKI A;  4EEU A;  4KG5 A;  1OTE A;  4CQH A;  3G31 A;  5DTT A;  3SS5 A;  3VSL A;  3TE8 A;  4PM9 A;  4S2O A;  3HLB A;  1VQQ A;  3DTI A;  3A3J A;  3IX4 A;  3CIT A;  1KVL A;  3V3S A;  1LL5 A;  3IF5 A;  5FQI A;  1ZG6 A;  2W3G A;  4OPR A;  3CJM A;  3LI8 A;  3OOV A;  4B93 A;  1XKZ A;  3G30 A;  3LR5 A;  5FI6 A;  1ZG4 A;  5IT5 A;  4IVI A;  3GRJ A;  2G2W A;  5FQQ A;  2V1A A;  3O5Y A;  3IWI A;  1EWZ A;  4L9E A;  5TFQ A;  4MBH A;  1X0O A;  1W63 M;  1FSY A;  2PDR A;  2Z2M B;  4MMN A;  4XUX A;  4NEE D;  1SZV A;  1QMF A;  1YM1 A;  4DMZ A;  4Y0T A;  3HLE A;  2QJ5 A;  3S7O A;  2JKR M;  3T1S A;  1Y54 A;  2V0W A;  2XQZ A;  5HDS A;  2OOL A;  4N1X A;  4WEJ A;  1SHV A;  4BJP A;  4F94 A;  3RH8 B;  5EVE A;  2R9X A;  3P7N A;  3IH9 A;  1EI5 A;  5CGS A;  2PU4 A;  2JKF A;  2PBY A;  3Q7V A;  5CXW A;  1LL9 A;  2NUT C;  1LT0 A;  3UNW A;  3ZG0 A;  1TVF A;  3C4P A;  2WKI A;  3SOI A;  3QP5 A;  4WL9 A;  3BFE A;  5LBR A;  1RCJ A;  5HFO A;  1PWC A;  2Y2G A;  3BEB A;  3LIC A;  5AJG A;  2PHY A;  1K6S A;  3ZG8 B;  4EQI A;  2B02 A;  3W4P A;  2BTF P;  1K56 A;  1GSW A;  5TBM B;  1LI9 A;  2Z2L B;  3EOI A;  5M1A A;  3Q82 A;  1KE0 A;  1W5D A;  4DN0 A;  4GNU A;  4YOF A;  4BL3 A;  4LV3 A;  2YKH A;  4KZ5 A;  5CRF A;  3BJN A;  2GZA A;  2FZ0 A;  2V0U A;  3HUO A;  4OPY A;  3ITA A;  4QPR A;  1PWG A;  2Y2O A;  4NXG A;  3PHY A;  3BFF A;  1HZO A;  3B47 A;  4UQI M;  3CPT A;  2K2N A;  4WEK A;  4JGO A;  2EA9 A;  1ES3 A;  2IWC A;  3DBA A;  3A3F A;  1E3U A;  4XT2 B;  4R4R A;  4EBP A;  3K3D A;  5DJU A;  1P9W A;  2FFY A;  2Y2L A;  1FIL A;  3HVF A;  2WZZ A;  1PZO A;  3C7U A;  2Y2J A;  1CQA A;  3P09 A;  2E8I A;  2H0Y A;  1GHM A;  2PD8 A;  4WEL A;  4MN7 A;  4E3J A;  5EEC A;  5KSH A;  5KMW A;  2XRN A;  4KQR A;  3R7W A;  3W2Z A;  3E4O A;  1YPR A;  3CMZ A;  3IHB A;  5FAT A;  4ETZ A;  2JN7 A;  3GMW A;  2HJE A;  1MKI A;  1CJF A;  4ARZ A;  3HCY A;  3Q07 A;  4O01 A;  5DFY A;  4R70 A;  1LSW A;  4MCW A;  1LL8 A;  4IJG A;  1I2S A;  4ESP A;  4H6J A;  4OQH A;  5HSQ A;  2HZ5 A;  4DRT A;  4UHU A;  4ID4 A;  2Z6C A;  3CUE A;  3KYZ A;  1T1C A;  2QHK A;  3WWX A;  1DJC A;  3UDX A;  3UPN A;  5TR7 A;  3SS3 A;  3T1Q B;  4U3T A;  3PBT A;  4WMC A;  4GW9 A;  3NUL A;  5KZH A;  5GHX A;  4ARZ B;  4DF6 A;  2XRO A;  3VMA A;  3VP3 A;  4Y2F A;  2V9A A;  3U2A A;  2WZX A;  3FG8 A;  4U0X A;  1ES5 A;  2ZMF A;  1IEM A;  4QU3 A;  1W63 Q;  1BLS A;  4H6J B;  2BAS A;  2WKE A;  2PAV P;  3PBS A;  4Z1W A;  4QY5 A;  1SKO A;  1G68 A;  2Y55 A;  2J3T C;  4E3M A;  1LSV A;  3GVB A;  1GSX A;  3CHW P;  4OP8 A;  4GHI A;  4IHQ A;  4NK3 A;  2I9V A;  1XXM A;  3OPL A;  4O7D A;  1SKF A;  3IXG A;  4JGP A;  2Z6D A;  5AVE A;  2OAP 1;  3PR6 A;  4NXE A;  3LIF A;  1DJB A;  5DF8 A;  2P9V A;  4II7 A;  1NZO A;  3I7J A;  5EUA A;  3MFD A;  2HV1 A;  4CJN A;  3MS6 A;  2QJ7 A;  3DTE A;  4KQQ A;  4UA9 A;  4KZB A;  2ZC6 B;  3D72 A;  2L0W A;  4OVD A;  3P01 A;  4ME4 A;  2J80 A;  1KVM A;  2VX8 A;  3MQQ A;  4JBF A;  1SKO B;  4IBX A;  2DCF A;  1VHM A;  4HEF A;  2JHE A;  1SDN A;  1BYW A;  1N9O A;  3N8L A;  2ZQ8 A;  3PBR A;  4X6T A;  1S0W A;  1K57 A;  2EXA A;  2J7V A;  1BLH A;  2Q9N A;  5CER A;  2HDR A;  3LIE A;  1NY0 A;  3C8C A;  3TJZ C;  2P9V B;  3IXB A;  4BEN A;  3VOY A;  3E4Q A;  3U4L P;  3E98 A;  2O9A A;  3VE3 A;  3IS2 A;  5F5Y A;  4DE0 A;  3ULF A;  4KUO A;  3ZNT A;  2AVX A;  4BBV A;  4RVA A;  1PNE A;  5DKK A;  3VP0 A;  4ZTK A;  4GS9 A;  3MXR A;  4ZJ3 A;  2HDU A;  4P85 A;  1DRM A;  4Y7P A;  3WS1 A;  5A91 A;  3TRC A;  2UV0 E;  3N6I A;  4ETX A;  2ZQD A;  4DJ3 A;  1H8Z A;  4XXR A;  1TDG A;  5FQM A;  4DJ2 A;  4X55 A;  2RL3 A;  3ZCZ A;  1XJ3 A;  4HY8 A;  1ZC2 A;  3VP1 A;  3IS2 B;  3ZYT A;  2Y2Q A;  1TDL A;  3CUE C;  2XA7 M;  4IUH A;  5FL3 A;  2W1T A;  1XX2 A;  5EVI A;  2LB9 A;  1F2K A;  4GS9 B;  4HJ3 A;  3ZVW A;  2Y2P A;  2ZL1 A;  5J3W A;  1YLP A;  2JKT I;  4Y3I A;  4FD8 A;  4CLC D;  1H3Q A;  1XP4 A;  4X1M A;  4MNR A;  2LB5 A;  4ZJ2 A;  5HL1 A;  5EV0 A;  3VV4 A;  1VM1 A;  3LR3 A;  4Z9Q A;  4E3I A;  4E04 A;  2HDS A;  3UB9 A;  4WN5 A;  3MFX A;  2XFS A;  3ZNY A;  4KUK A;  4NXF A;  1S66 L;  3UE1 A;  4EQ1 A;  4KQO A;  3V50 A;  4DXC A;  1NWZ A;  2XD5 A;  2W1T B;  4G3K A;  3GQZ A;  1SDE A;  1FOF A;  2ZLY A;  4KG2 A;  2E8J A;  1YLY A;  5AVF A;  4FOF A;  3S7P A;  2J9P A;  3CLO A;  1KE4 A;  5DF7 A;  2J9O A;  1XGJ A;  5HPI A;  2M7U A;  4I5S A;  3T1R A;  4WF0 A;  1KDS A;  3LFV A;  4Q8I A;  1J9M A;  3FYZ A;  3NJA A;  5CGX A;  5FA7 A;  1WE4 A;  4QWO A;  4MBK A;  1YMS A;  1LI0 A;  1L0E A;  1S4R A;  5EFW A;  3GTC A;  1BT5 A;  4I3A A;  1TD5 A;  2QMI A;  1K57 C;  4LPZ A;  5FAQ A;  4EV4 A;  1WA9 A;  4KZ8 A;  4X68 A;  4FH2 A;  2M1C A;  2BLS A;  4UA7 A;  3EQU A;  5HW3 A;  4B88 A;  3OZH A;  2W1R A;  2INW A;  1S1Z A;  5F83 A;  3V3R A;  5FQK A;  4NG2 A;  3IX8 A;  2V1B A;  2M7V A;  3W4Q A;  4RX3 A;  3MZF A;  1BTL A;  3SW1 A;  4HBU A;  2C6W B;  4KEN B;  3FWL A;  1HLU P;  2PR6 A;  5FQ9 A;  5HPF A;  4OON A;  3LO7 A;  1IKG A;  4JGQ A;  3E2L A;  2XD1 A;  3K3C A;  4LFU A;  3LY3 A;  5GLC A;  1S4S A;  1P0Z A;  3KSH A;  5FI7 A;  4EET B;  4LV1 A;  4WZ5 A;  2XF3 A;  5JYP A;  2JKG A;  2V2F F;  4GZB A;  5GHY A;  4KZA A;  3TOI A;  4JPM A;  1AWI A;  3O87 A;  5AQB A;  3SH9 A;  1PYY A;  4UQI S;  3UB6 A;  2WAE A;  3CAX A;  3ZG7 B;  2XEP A;  4R3A A;  3ZFZ A;  2WGV A;  5EVI C;  3NIA A;  5I94 A;  2WKP A;  2P74 A;  5CEB A;  3T4S A;  5DJT A;  3BEC A;  3UN7 A;  3HJI A;  2PRF A;  3PXP A;  4G3W A;  4EUV A;  2ZMA A;  2EXB A;  2VJW A;  4HP4 A;  2RCX A;  4KZ9 A;  2Y2H A;  4Q0I A;  5HD3 A;  1Y28 A;  4CLC E;  2OWJ A;  3C38 A;  2XDM A;  5JYO A;  3AGD A;  4L0L A;  3F1N B;  4OKP A;  4Y15 A;  3FKV A;  5CHU A;  5AQA A;  3WS5 A;  1H0M A;  1K54 A;  3LCE A;  1YLT A;  2XH9 A;  5FDH A;  4EWF A;  2G2U A;  2H0T A;  5TBM A;  1PIO A;  2Q0O A;  1XFQ A;  1T1B A;  2GJ3 A;  4K0W A;  4WZ4 A;  3MKE A;  3PAE A;  5KIZ A;  2OAQ 1;  4AFI A;  2ZMV A;  2KDK A;  1MBL A;  3MXS A;  5L10 A;  2DMW A;  3LEQ A;  4M4X A;  4L9F A;  2Y2M A;  1L0F A;  1YSQ A;  2ZQA A;  3IWO A;  3GV9 A;  4Y5F A;  2G7U A;  4OQ0 A;  1E4D A;  1J3W A;  3LUQ A;  4K91 A;  2Y2N A;  3BY9 A;  3UMD A;  4K0X A;  4K08 A;  2PT7 A;  4EUZ A;  4Q0J A;  1NJ4 A;  4OOY A;  1M40 A;  1YAX A;  2I72 A;  4S2M A;  3A0S A;  4XT2 A;  5FAP A;  3T50 A;  3CZD A;  3GDI A;  3ZG5 A;  1K56 D;  4WZ5 C;  1LLB A;  4JF6 A;  4ZJ1 A;  1YQS A;  1C3B A;  3N4I A;  5F68 A;  1D1J A;  2L4R A;  4XUZ A;  5L2F A;  3T4K A;  4JLF A;  4X56 A;  5MC7 A;  2J3T D;  3L9K A;  5FDS A;  4X1L A;  3JYI A;  4E3N A;  2HP6 A;  3MBZ A;  3IF6 A;  4IED A;  3D4F A;  4ZBE A;  5HAQ A;  1I5Q A;  1G5U A;  1K6R A;  4NXB A;  3W4O A;  4EXO A;  4P6B A;  1PI5 A;  1MWT A;  1SCW A;  3A0R A;  3WS2 A;  4LV0 A;  3T12 B;  1E3U D;  2W27 A;  2L1M A;  4R23 A;  2FH5 A;  3LID A;  1UWN X;  4S2P A;  4R4S A;  5GLA A;  2GX5 A;  1H5X A;  4B9O A;  4YWZ A;  3D3O A;  5GHZ A;  5EE8 A;  5G4Y A;  3IXD A;  4S2N A;  1OTA A;  1W8Q A;  1IYQ A;  4D60 A;  1JVJ A;  1H8Y A;  3C30 A;  4NKP A;  1K54 C;  3IF6 B;  1E25 A;  3R4K A;  4YFM A;  2ZJ9 A;  3DWZ A;  1DP6 A;  1FCM A;  5HZH A;  3G2Z A;  4S2I A;  3TG9 A;  1MWU A;  2O99 A;  5J4E A;  5HWT A;  1ACF A;  3LEZ A;  1IYS A;  4IBR A;  2XA7 S;  4GDB A;  4JXG A;  2K7S A;  3A3D A;  4L9G A;  1FCN A;  1TS0 A;  5U47 A;  4C3Q A;  2ZBB A;  3MQ0 A;  3MSH A;  3S7N A;  1D7E A;  4OH0 A;  5KSC A;  4EBL A;  3HBR A;  3Q1F A;  1ES2 A;  1JTD A;  2XLN A;  4LRX C;  2P04 A;  3LIA A;  1P9R A;  3RXX A;  1IEL A;  4WMC D;  5FAS A;  5E43 A;  1ERM A;  1BLP A;  3UME A;  4ZRR A;  1XGI A;  4B4X A;  2P08 A;  3H7W A;  2CMN A;  4BQM A;  2PU2 A;  4OOL A;  4A5R A;  5FAO A;  1GA9 A;  3NHQ A;  2IA2 A;  4GD8 A;  3ZHH A;  3OLO A;  3MZE A;  1L0D A;  3IX3 A;  3ZG9 B;  1V9Z A;  1O07 A;  3D9Y A;  4O8G A;  5J7E A;  2WKR A;  2V20 A;  2EX6 A;  2QKP A;  3CWF A;  1PW1 A;  4F3L A;  2YKF A;  4UAA A;  4U0T A;  3PBQ A;  1JWP A;  1YLZ A;  3NY4 A;  3T4J A;  5A92 A;  3VOZ A;  2HJ9 C;  3EGX C;  2VGL M;  4JXS A;  1KGF A;  5EOE A;  2ZC3 B;  1Q2Q A;  3H7W B;  3SS4 A;  2A24 A;  4UA6 A;  1G6A A;  3VFF A;  1JNU A;  5F1G A;  1PRQ A;  2JKT M;  3IF6 C;  5L07 A;  1PWD A;  1ZHH B;  2EX9 A;  3S4X A;  2WK0 A;  3VP2 A;  4KZ6 A;  5EVL A;  5J8X A;  2WGI A;  3MJQ A;  2JBF A;  5DVA A;  4F3L B;  5K5B A;  3QP6 A;  3EEH A;  3QP2 A;  4FUW A;  1ESI A; 
#chains in the Genus database with same CATH homology
 2QMI A;  1K57 C;  5FAQ A;  2OV5 A;  3IH9 A;  3M6B A;  1EI5 A;  4EV4 A;  1K4E A;  4KZ8 A;  4X68 A;  4FH2 A;  2BLS A;  5CGS A;  3A3I A;  4UA7 A;  3DWK A;  4S2N C;  4WYY A;  4ZDX A;  2PU4 A;  3EQU A;  3EQV A;  5HW3 A;  1BUL A;  4B88 A;  3OZH A;  1ES4 A;  2PBY A;  3Q7V A;  1FQG A;  5CXW A;  1LL9 A;  5M18 A;  4PM6 A;  3ZDJ A;  2Q9M A;  3UNW A;  5F83 A;  1KGE A;  3V3R A;  3N8S A;  5FQK A;  3ZG0 A;  1TVF A;  3ZGA B;  3C4P A;  3NC8 A;  3SH7 A;  1PI4 A;  2WKI A;  3SOI A;  3LY4 A;  3W4Q A;  4RX3 A;  2ZC4 B;  2ZQ9 A;  3G35 A;  3MZF A;  3GSG A;  1BTL A;  2EFU A;  1BUE A;  1DJA A;  3BFE A;  4QJG A;  1DY6 A;  2EX8 A;  4HBT A;  4HBU A;  4FCF A;  2C6W B;  3OPH A;  4KEN B;  5E2H A;  4LCL A;  3FWL A;  1RCJ A;  3O86 A;  4BL2 A;  5HFO A;  4DE1 A;  5FQ9 A;  1PWC A;  2Y2G A;  3HUN A;  4OON A;  1FCO A;  3C7V A;  3BEB A;  3LO7 A;  1IKG A;  3HUM A;  3E2L A;  1K6S A;  4N92 A;  3ZG8 B;  4EQI A;  1U60 A;  2XD1 A;  3LY3 A;  3W4P A;  1K56 A;  5GLC A;  3QNC A;  1LI9 A;  2QZ6 A;  2Z2L B;  4CPK A;  5FI7 A;  5AQ7 A;  4LV1 A;  4WZ5 A;  2XF3 A;  5JYP A;  2EX2 A;  3HL9 A;  2Y91 A;  2V2F F;  3ITB A;  3O88 A;  4GZB A;  5M1A A;  3Q82 A;  5GHY A;  1KE0 A;  1W5D A;  4GNU A;  2ZC5 B;  4KZA A;  4KZ4 A;  2HP5 A;  5HX9 A;  3TOI A;  4JPM A;  3O87 A;  3BFG A;  5AQB A;  3SH9 A;  3BRM A;  4BL3 A;  1PYY A;  4LV3 A;  5E2F A;  1YT4 A;  5G18 A;  4E3K A;  2WAE A;  4KZ5 A;  4S2L A;  5CRF A;  3M2K A;  3ZG7 B;  3WS4 A;  2XEP A;  2Y2I A;  3ZFZ A;  2WGV A;  3HUO A;  2X02 A;  1K55 A;  3PBO A;  1YMX A;  1RP5 A;  3NIA A;  4OPY A;  5EVI C;  1BSG A;  5EVI D;  1KE3 A;  5I94 A;  2HDQ A;  3ITA A;  2P74 A;  3IQA A;  2WYX A;  3W8K A;  4DE2 A;  5CEB A;  4WM9 A;  3UE3 A;  1PWG A;  2Y2O A;  4PMA A;  3BEC A;  3VP4 A;  1NYY A;  3BFF A;  2ZQ7 A;  1TEM A;  3FKW A;  4JXV A;  4LV2 A;  4R3J A;  3HLD A;  5D3O A;  1HZO A;  1AXB A;  3UN7 A;  1NZU A;  2ZMA A;  2EXB A;  4WEK A;  3WS0 A;  2RCX A;  2FFF B;  1CEF A;  1ES3 A;  4KZ9 A;  3HLG A;  2Y2H A;  5CTN A;  1CI8 A;  2IWC A;  4MLL A;  3BFC A;  5EOO A;  5GL9 A;  5CEC A;  3WRT A;  2JE5 A;  3A3F A;  1E3U A;  1PZP A;  3AGE A;  4R4R A;  4EBP A;  2XDM A;  3FV7 A;  3NI9 A;  3VFH A;  2C5W B;  3AGD A;  5JYO A;  3OCN A;  2A49 A;  3BFD A;  3IWQ A;  4L0L A;  2FFY A;  2Y2L A;  3HVF A;  4OKP A;  3RJU A;  2WZZ A;  3UDF A;  1PZO A;  3C7U A;  3HLC A;  3FKV A;  4M3K A;  2Y2J A;  5CHU A;  3V5M A;  3P09 A;  2XK1 A;  3S22 A;  2E8I A;  2H0Y A;  3NBL A;  1ONG A;  1GHM A;  4WEL A;  5AQA A;  4E3J A;  3WS5 A;  5EEC A;  3B3X A;  1K54 A;  5A90 A;  5KSH A;  3LCE A;  1YLT A;  5KMW A;  1QME A;  1ESU A;  3O3V A;  4KQR A;  2XH9 A;  2XFT A;  5FDH A;  4EWF A;  2G2U A;  2V1Z A;  1N9B A;  1W8Y A;  3G34 A;  2H0T A;  5TGF A;  1PIO A;  1Z6F A;  3PAG A;  4NET A;  1ZKJ A;  3NCK A;  1GHP A;  3CMZ A;  4JXW A;  3IHB A;  2HPB A;  4K0W A;  2VGK A;  2ZM2 A;  4WZ4 A;  5FAT A;  2X71 A;  3MKE A;  4RYE A;  3PAE A;  5EPH A;  2ZD8 A;  3GMW A;  4KZ7 A;  4GDN A;  3G4P A;  1MKI A;  2XGN A;  4OOM A;  3Q07 A;  3BLM A;  4GOG A;  4DKI A;  4OPQ A;  4IVK A;  1WYB A;  3Q81 A;  1MBL A;  3MXS A;  1W79 A;  2WKH A;  1YLJ A;  2Y2M A;  1FR6 A;  1I2S A;  1L0F A;  2ZQA A;  3M2J A;  5CGW A;  4DDS A;  3IWO A;  1HD8 A;  3ZVT A;  4OQH A;  3GV9 A;  1JTG A;  2A3U A;  2J8Y A;  4BD0 A;  4DRT A;  4OP5 A;  4UHU A;  3IT9 A;  2X01 A;  4LEN A;  4P87 A;  4OQ0 A;  1ERO A;  4ID4 A;  2Y4A A;  4RA7 A;  1E4D A;  4B4Z A;  3WWX A;  1DJC A;  3UDX A;  2WAF A;  4QHC A;  3UPN A;  1I2W A;  5TR7 A;  4K91 A;  3SS3 A;  2Y2N A;  1XA7 A;  3VSK A;  4N9L A;  1JWZ A;  1CEG A;  4U3T A;  3PBT A;  4K0X A;  1XPB A;  4WMC A;  1GCE A;  4GKU A;  4EUZ A;  4PM5 A;  1RGY A;  4S2K A;  4OLD A;  4WBG A;  5KZH A;  1NJ4 A;  5GHX A;  3MZD A;  4OOY A;  1M40 A;  2I72 A;  5DTS A;  4DF6 A;  5A93 A;  4S2M A;  5FAP A;  3VMA A;  3VP3 A;  4N1H A;  3CZD A;  3G2Y A;  5DTK A;  3ZG5 A;  1GHI A;  4GD6 A;  1K56 D;  1MWS A;  2VGJ A;  4QY6 A;  5HAI A;  2WZX A;  4U0X A;  1ES5 A;  2IWD A;  3IXH A;  4WZ5 C;  1IEM A;  1LLB A;  4JF6 A;  4ZJ1 A;  4QU3 A;  1S6R A;  1YQS A;  2Y59 A;  3DTM A;  1C3B A;  3N4I A;  1BLS A;  2WKE A;  5CHM A;  2ZQC A;  3FZC A;  4XUZ A;  5L2F A;  1NXY A;  3C5A A;  1CK3 A;  1BZA A;  2WGW A;  3PBS A;  4E3O A;  4PPR A;  4JLF A;  5CED A;  4QY5 A;  2EFX A;  1G68 A;  2Y55 A;  4X56 A;  5BOH A;  4GN2 A;  4YIN A;  4E3M A;  1W7F A;  4R0Q A;  2CC1 A;  5CTM A;  4EBN A;  3GVB A;  4FSF A;  1K55 C;  2JC7 A;  2DNS A;  2JCH A;  3JYI A;  4NK3 A;  4OP8 A;  1XXM A;  2HP9 A;  4E3L A;  4KZ3 A;  1NRF A;  1PW8 A;  5M19 A;  3OPL A;  3BM6 A;  4O7D A;  3PBN A;  1SKF A;  4E3N A;  2HP6 A;  3IXG A;  4E6X A;  2WUQ A;  3MBZ A;  3IHA A;  1ONH A;  2GDN A;  3S1Y A;  1GA0 A;  3OCL A;  3IF6 A;  3D4F A;  4IED A;  1DJB A;  3M6H A;  3QNB A;  2P9V A;  4MEZ A;  1NZO A;  3I7J A;  4OQI A;  5DF8 A;  4ZBE A;  5HAQ A;  1I5Q A;  3W4O A;  1K6R A;  5EUA A;  3MFD A;  4JKT A;  4CJN A;  4P6B A;  4P0M A;  4KQQ A;  4UA9 A;  2R9W A;  5EVI B;  5HAR A;  4KZB A;  3UPP A;  2B5R A;  1PI5 A;  4X69 A;  2ZC6 B;  1MWT A;  1SCW A;  1ERQ A;  1IYP A;  4OVD A;  3WS2 A;  5GLD A;  3A3E A;  4OQG A;  2WGW B;  2QPN A;  4LV0 A;  5DF9 A;  1KVM A;  1E3U D;  4JBF A;  3NDE A;  4IBX A;  4MBF A;  3UY6 A;  2DCF A;  4HEF A;  5F82 A;  5IHV A;  4R23 A;  1SDN A;  4S2P A;  3Q7Z A;  3N8L A;  4R4S A;  2ZQ8 A;  5GLA A;  4QB8 A;  5FI2 A;  4D2O A;  3PBR A;  3PTE A;  1H5X A;  1S0W A;  4X6T A;  2ZM0 A;  3TSG A;  1K57 A;  2EXA A;  2OSU A;  5HAP A;  5GHZ A;  4RX2 A;  3RXW A;  5EE8 A;  2J7V A;  1BLH A;  3IXD A;  2Q9N A;  3G32 A;  4DE3 A;  4FH4 A;  4HES A;  4S2N A;  5CER A;  3CG5 A;  3AGF A;  4BD1 A;  1W8Q A;  4JF5 A;  1IYQ A;  2HDR A;  3HRE A;  1M6K A;  5GLB A;  1ALQ A;  1FR1 A;  1JVJ A;  3N7W A;  4N9K A;  1H8Y A;  3BYD A;  1K54 C;  3IF6 B;  1NY0 A;  2P9V B;  3IXB A;  1E25 A;  3VOY A;  4BEN A;  4DXB A;  4YFM A;  2ZJ9 A;  3DWZ A;  1N4O A;  3NDG A;  1FCM A;  4H8R A;  2H5S A;  4DE0 A;  3GR2 A;  3UPO A;  1NYM A;  5F1F A;  2OLV A;  4LCM A;  3ZNT A;  1WYC A;  4RVA A;  3VP0 A;  3G2Z A;  4S2I A;  4ZTK A;  3TG9 A;  1MWU A;  3HLF A;  3MXR A;  4BLM A;  4GB7 A;  3LEZ A;  1XA1 A;  1IYS A;  4ZJ3 A;  2HDU A;  3ISG A;  4IBR A;  4P85 A;  3UDI A;  4GDB A;  4JXG A;  4Y7P A;  5A91 A;  4Y0U A;  3WS1 A;  3A3D A;  1FCN A;  3E2K A;  3N6I A;  1L2S A;  1MWR A;  5U47 A;  2DRW A;  2Y2K A;  2IWB A;  3DW0 A;  3IH8 A;  3OPP A;  2H10 A;  1MXO A;  1Q2P A;  4KG6 A;  2ZQD A;  4C3Q A;  3OPR A;  4E6W A;  1H8Z A;  4QD4 A;  4XXR A;  1OME A;  1TDG A;  5FQM A;  4OH0 A;  4X55 A;  2BG1 A;  2RL3 A;  3ZCZ A;  5KSC A;  4OLG A;  4EBL A;  2XR0 A;  3HBR A;  1ZC2 A;  3VP1 A;  3Q1F A;  4R3B A;  1ES2 A;  2Y2Q A;  1JTD A;  1TDL A;  2XLN A;  4JF4 A;  3N8R A;  3RXX A;  5E2G A;  4DDY A;  1XX2 A;  1IEL A;  2ZC7 A;  3MKF A;  3WRZ A;  4WMC D;  5FAS A;  5EVI A;  5E43 A;  1ERM A;  2UWX A;  3BLS A;  3ZVW A;  1HTZ A;  3V39 A;  1JWV A;  1K38 A;  2Y2P A;  3Q7V B;  1BLP A;  4S2J A;  3UE0 A;  1XGI A;  1YLP A;  4B4X A;  3C4O A;  1MPL A;  1K25 A;  4FD8 A;  3P98 A;  4BQM A;  2PU2 A;  4OOL A;  4A5R A;  5FAO A;  1XP4 A;  1GA9 A;  4PM7 A;  1IKI A;  4KG5 A;  3G31 A;  4X53 A;  4GD8 A;  5DTT A;  3SS5 A;  4MNR A;  3VSL A;  4PM9 A;  4ZJ2 A;  3HLB A;  3MZE A;  1VQQ A;  4S2O A;  3ZHH A;  1L0D A;  5HL1 A;  1VM1 A;  4Z9Q A;  3ZG9 B;  4E3I A;  4PM8 A;  3A3J A;  1O07 A;  1KVL A;  2HDS A;  2OLU A;  3V3S A;  3OC2 A;  1LL5 A;  2V20 A;  3IF5 A;  2EX6 A;  5FQI A;  1IYO A;  1PW1 A;  1ZG6 A;  4OPR A;  1KDW A;  2XFS A;  3ZNY A;  3SH8 A;  3CJM A;  2ZM8 A;  4UAA A;  3UE1 A;  1XKZ A;  3G30 A;  4U0T A;  4C6Y A;  4KQO A;  3V50 A;  4DXC A;  3UO9 A;  5FI6 A;  3PBQ A;  1ZG4 A;  4R1G A;  1JWP A;  2XD5 A;  3GQZ A;  1YLZ A;  3NY4 A;  1SDE A;  4IVI A;  1FOF A;  3GRJ A;  5A92 A;  2ZLY A;  3VOZ A;  4KG2 A;  2G2W A;  5FQQ A;  1RGZ A;  4JXS A;  1KGF A;  5EOE A;  1CI9 A;  2ZC3 B;  3IWI A;  1YLY A;  1Q2Q A;  5AQ9 A;  1EWZ A;  1KGG A;  3SS4 A;  5TFQ A;  4UA6 A;  4MBH A;  1L0G A;  1G6A A;  4ZAM A;  3VFF A;  5F1G A;  1FSY A;  2Z2M B;  3IF6 C;  2J9P A;  1KE4 A;  1PWD A;  2EX9 A;  3S4X A;  3HLW A;  2WK0 A;  4XUX A;  5DF7 A;  2J9O A;  2WAD A;  3VP2 A;  4KZ6 A;  1XGJ A;  5EVL A;  1QMF A;  5J8X A;  2WGI A;  1YM1 A;  1BLC A;  4Y0T A;  3HLE A;  3QHY A;  2JBF A;  1O7E A;  5DVA A;  1Y54 A;  1KDS A;  2XQZ A;  1MY8 A;  4Q8I A;  1J9M A;  4Y0O A;  1YLW A;  1K4F A;  3FYZ A;  5CGX A;  1LHY A;  4OPZ A;  4N1X A;  4WEJ A;  5FA7 A;  1SHV A;  4BJP A;  1WE4 A;  1HVB A;  4MBK A;  1YMS A;  1FSW A;  1LI0 A;  1L0E A;  5E2E A;  4C75 A;  4F94 A;  5FSR A;  5CHJ A;  3GTC A;  2R9X A;  5FQJ A;  1BT5 A;  1ESI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...