3M2KA

Crystal structure of fluorescein-labeled class a -beta lactamase penp in complex with cefotaxime
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
256
structure length
245
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPEGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Structural studies of the mechanism for biosensing antibiotics in a fluorescein-labeled beta-lactamase.
pubmed doi rcsb
source organism Bacillus licheniformis
total genus 81
structure length 245
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3m2kA00
1K38A 5M19A 4KZ6A 3AGEA 4X68A 3BRMA 5KMWA 1KGEA 1OMEA 3RJUA 4ZJ3A 3IF5A 3DWKA 2PU4A 1L0FA 5DF7A 2XH9A 4KZ9A 4BL2A 3VOZA 2ZQCA 3LY4A 1H5XA 2XF3A 2EXAA 3VSKA 1IYPA 1K6RA 4MNRA 3JYIA 5FDHA 2BLSA 3ITBA 4X53A 1BZAA 3IWIA 1BUEA 2ZLYA 5FQ9A 3VOYA 1BSGA 1KVLA 5BOHA 5DTTA 5EPHA 4C6YA 2X71A 3EQVA 5FAPA 3HLDA 1ALQA 1H8ZA 1W8YA 2ZM8A 4DKIA 1RCJA 5CEDA 4IVKA 3SH7A 4RA7A 3N7WA 4JXGA 2Y2MA 2ZM2A 4S2LA 1SDEA 5FQKA 5HX9A 1IYOA 4RVAA 3W8KA 5FI6A 5M1AA 5E2EA 1SKFA 3G32A 2C6WB 3GMWA 1YT4A 4R3JA 2H10A 1TEMA 1W5DA 1XA7A 4O7DA 4S2NA 4E3KA 4PM6A 1ERMA 4YFMA 2Y2LA 2EX6A 4OONA 3PBTA 4WZ4A 3PAEA 5JYOA 2JBFA 3FZCA 3NDEA 1LL5A 1VM1A 4KZBA 2ZM0A 4P85A 4QJGA 3ZG8B 1JTDA 2DRWA 1I2SA 4GZBA 5FASA 3IF6C 3OPLA 4S2JA 4WEJA 1FSWA 2V20A 3UDIA 3WWXA 1J9MA 1YLWA 1MKIA 1NY0A 1ZKJA 2ZC4B 3GRJA 3HLFA 3M2JA 5HAIA 1JWVA 2P74A 5HL1A 1ZG4A 4HEFA 4QY5A 2Y2HA 4R3BA 4LENA 5DVAA 2R9WA 3N4IA 1NXYA 3PBNA 4IEDA 3ZG5A 2ZQ7A 3M2KA 3A3EA 1W79A 1YMSA 4H8RA 2JE5A 2C5WB 4U0XA 5FI7A 4E3JA 2XK1A 3TG9A 4BD1A 3VP0A 5JYPA 1NYMA 3FYZA 5FSRA 4OLGA 4EBLA 2P9VB 1ES4A 1TVFA 5G18A 5GLCA 3A3IA 1IYSA 2ZC5B 4S2IA 1GCEA 2CC1A 3Q7VA 3VP3A 2WGWB 3W4PA 4K0XA 4BD0A 4LCMA 3IHAA 4BJPA 1YLYA 1Q2PA 4E3NA 4Q8IA 1K6SA 1PZPA 4K0WA 1XPBA 4FCFA 4Y7PA 1IKGA 4JXSA 5AQ9A 1E4DA 3PBRA 5GLDA 4WMCD 3HUOA 2WKIA 3UN7A 5CTNA 3Q07A 1K25A 4HBTA 4MEZA 3G4PA 4FSFA 1ESUA 3LO7A 1K54C 2X01A 5FQQA 4OPZA 1LHYA 5GLAA 3OZHA 1N9BA 4MBKA 1MWSA 2FFYA 4WELA 5FA7A 2WZXA 4JF5A 3IXBA 2WUQA 5EUAA 3HLEA 3ZDJA 3HLCA 3UE1A 4EUZA 2QZ6A 4NK3A 4BQMA 2HDUA 4EWFA 1G68A 3HLWA 5KSCA 3SS4A 3G35A 2Y2OA 3GTCA 4DE0A 4GKUA 2WK0A 4WYYA 1L0DA 4IVIA 1SCWA 1CK3A 4MBHA 2XFSA 3PBQA 4P6BA 3ZGAB 4XUZA 2H0YA 2OLVA 1K55A 4OQGA 4RYEA 3NIAA 3Q1FA 1AXBA 1O7EA 1CI9A 2Z2LB 3Q7VB 5DTSA 3UE0A 2VGKA 3UPPA 3V5MA 4E3IA 3C7UA 5J8XA 2EXBA 3WS5A 1XX2A 4BENA 3NC8A 3OCNA 4B4ZA 1NZOA 2X02A 5A91A 5EVIA 2XR0A 2OV5A 1M6KA 4OQ0A 2WYXA 2ZC7A 1FR6A 3IXHA 5EVIC 3E2KA 4UHUA 3NY4A 3Q81A 1BLSA 4X55A 1YLPA 4E3LA 4DE1A 1XGIA 1YLJA 2HP5A 1YMXA 4LV2A 4JKTA 4DXCA 1XP4A 1FSYA 5FATA 2XD5A 1GA9A 1CI8A 1DJAA 4OVDA 3S1YA 4QU3A 1MBLA 1RGZA 2J9OA 4OLDA 5GL9A 2H0TA 1PI4A 4P87A 3WS2A 1BLHA 2QMIA 4R0QA 2WZZA 2G2WA 1PZOA 1K56D 1Y54A 1MWUA 2XGNA 3G2ZA 1YM1A 2ZC6B 1QMFA 4KZ5A 3HLBA 4OOLA 4R4RA 4OQIA 4X69A 2ZC3B 1H8YA 2HP9A 3VMAA 1YLZA 2Y59A 1WE4A 3LEZA 5HARA 2Y2GA 3G31A 3VSLA 3CJMA 3FV7A 2Y2PA 3O86A 4Z9QA 5A93A 1G6AA 1W7FA 2PBYA 2R9XA 3FKWA 1E25A 4KZ3A 3VFFA 1FR1A 4JLFA 5CGSA 3IH9A 3UNWA 3NCKA 2IWDA 5FI2A 3IWQA 1ESIA 3UE3A 5EOEA 1PI5A 3UDFA 1C3BA 3D4FA 1BLPA 5AQBA 3ZG0A 4N9LA 4R4SA 3ITAA 3GV9A 2RCXA 3IF6A 1M40A 3S4XA 2G2UA 3FWLA 1EWZA 4ZJ1A 4KG5A 3P09A 3IH8A 5CGXA 3UPOA 3VP1A 4FH2A 1WYBA 3TSGA 4DE3A 2ZQ9A 1Q2QA 2B5RA 4PPRA 5HW3A 3VP2A 1ES5A 4KQRA 1HD8A 4OKPA 4S2OA 4LV0A 3Q82A 3A3FA 4R1GA 3CZDA 4XXRA 3UY6A 4KZ7A 3V3RA 2J8YA 1XXMA 2ZD8A 3O87A 1ES3A 2Y2KA 2XDMA 4GOGA 1E3UD 1PIOA 3HREA 3UDXA 4DXBA 4ZJ2A 1JWPA 1L2SA 3MXSA 1GHMA 4DDYA 3MFDA 5CHJA 5F1FA 4OPQA 2WAEA 3MZEA 3C4OA 3OPPA 1MY8A 1I2WA 5A90A 1PWGA 2Y55A 1KDWA 1L0EA 1ERQA 3NBLA 3NDGA 4KQOA 4NETA 1S0WA 1SDNA 3DWZA 1O07A 4WZ5C 3GVBA 1BULA 2XFTA 2GDNA 4KZ8A 5GHXA 4DDSA 4LV3A 2OSUA 5GHYA 1K57A 4KQQA 1XA1A 3BFCA 2FFFB 1ONGA 2Y91A 3VFHA 1SHVA 4YINA 1K54A 1YQSA 5DF9A 3N8SA 1K57C 1N4OA 4JF4A 3BECA 5EOOA 3N8RA 3PBSA 2IWBA 5E43A 4FD8A 1LI0A 5TR7A 4GN2A 2H5SA 3G30A 1KGFA 4S2KA 3ZVTA 3PBOA 1ONHA 4ID4A 1JWZA 4HESA 1DJBA 3DTMA 4N1XA 5A92A 1QMEA 1IEMA 3BFEA 2EX2A 5IHVA 5AQ7A 3ZCZA 3G2YA 4S2MA 3M6HA 4LCLA 3SS3A 4XUXA 2Z2MB 3Q7ZA 4E3MA 1YLTA 4ZAMA 2JC7A 3TOIA 2A3UA 4A5RA 4KZ4A 4IBRA 3MZDA 2ZMAA 5U47A 5CRFA 5HAQA 2OLUA 1HZOA 3N8LA 5F1GA 4GDBA 5CECA 1DJCA 3MKEA 1K4EA 4BL3A 5CEBA 1KGGA 4KZAA 3CG5A 3N6IA 3SH9A 5CGWA 2XD1A 4UAAA 1U60A 2BG1A 4E6WA 5E2HA 5EE8A 4OPYA 4GDNA 1PW1A 3EQUA 1LI9A 3PAGA 4GB7A 2EX8A 5TGFA 3HL9A 4Y0TA 3DW0A 4S2PA 5GHZA 2EFXA 4Y0OA 4Y0UA 4EV4A 3OPRA 4C75A 5CHMA 3IXDA 2VGJA 2JCHA 1NZUA 4GD8A 1XGJA 4MBFA 1LL9A 3IT9A 1CEFA 1GA0A 2Y2IA 1IKIA 1ES2A 3MXRA 4P0MA 3S22A 4DE2A 5EECA 4DRTA 2Y2QA 4JXWA 1ZC2A 3O3VA 1NRFA 2XLNA 2EX9A 5CXWA 2Y2NA 3WS4A 4RX2A 5E2GA 3GQZA 1MXOA 2ZJ9A 2EFUA 4WM9A 1TDLA 3GR2A 4FH4A 2WAFA 2XEPA 3MZFA 4PM8A 2HPBA 4R23A 2HDQA 4WMCA 3BFDA 4OP5A 3ZNTA 3IXGA 5GLBA 5CHUA 3WRTA 4GNUA 2WGVA 2V1ZA 3HVFA 3QNBA 4ZDXA 1RP5A 2ZQAA 4EBPA 2Y4AA 4WBGA 2Q9NA 5EVIB 3WS0A 3C7VA 2J9PA 4QHCA 4QY6A 3ZHHA 5I94A 5M18A 4E3OA 4PMAA 4WEKA 1IELA 4X56A 1S6RA 3SOIA 1KE3A 4K91A 4HBUA 3QHYA 3ZG9B 1PYYA 3RXWA 1NYYA 4PM7A 1NJ4A 2WADA 1HVBA 1RGYA 3LCEA 4ZTKA 4F94A 4IBXA 1JVJA 5HFOA 4CJNA 3V50A 3W4QA 2P9VA 4GD6A 3UO9A 3SH8A 3HBRA 3V39A 5FAOA 1XKZA 2RL3A 1LLBA 2WGWA 2PU2A 4JF6A 1Z6FA 1JTGA 4JBFA 4BLMA 3G34A 2Q9MA 3BEBA 4X6TA 1MWRA 2UWXA 3C5AA 3BFGA 1GHIA 2XQZA 2E8IA 3B3XA 4JPMA 4JXVA 2ZQDA 3W4OA 4S2NC 3I7JA 4D2OA 1KE4A 4B4XA 4QD4A 3QNCA 4KENB 5F82A 3ZNYA 3LY3A 3WRZA 4WZ5A 2ZQ8A 1ZG6A 4OPRA 1BTLA 4LV1A 2J7VA 2HP6A 3HUMA 4M3KA 1K4FA 5EVID 1EROA 2I72A 1VQQA 2DNSA 4PM9A 4RX3A 4OOYA 1W8QA 2Y2JA 5EVLA 3MBZA 1FOFA 1PWDA 4L0LA 3OCLA 3E2LA 3NI9A 3GSGA 3IF6B 1FCNA 3ZVWA 5HAPA 4B88A 1K56A 4ZBEA 1PWCA 5AQAA 1DY6A 3V3SA 2IWCA 1WYCA 3MKFA 2DCFA 1GHPA 3HUNA 2HDRA 3OPHA 4EQIA 3BLMA 3ISGA 5KZHA 5D3OA 4UA9A 3SS5A 5FQMA 1HTZA 1I5QA 3A3JA 3BM6A 3ZG7B 4KG2A 4OH0A 3FKVA 4U3TA 4N1HA 1L0GA 5FAQA 1MWTA 5KSHA 3OC2A 3BLSA 3BYDA 4C3QA 2WGIA 4U0TA 2WKHA 3A3DA 2WKEA 3RXXA 3IWOA 4OQHA 5FQJA 2A49A 1FCMA 4QB8A 4DF6A 3AGDA 1BT5A 1CEGA 4PM5A 3PTEA 5F83A 2HDSA 4UA7A 3O88A 3UPNA 4CPKA 4E6XA 4OP8A 1BLCA 4EBNA 1EI5A 1KDSA 3IQAA 3VP4A 3WS1A 5DF8A 5DTKA 5E2FA 5CERA 3ZFZA 1FCOA 3AGFA 3BFFA 5TFQA 1E3UA 1KVMA 3P98A 4MLLA 1TDGA 3IHBA 4N92A 2V2FF 4UA6A 1PW8A 1K55C 4KG6A 1FQGA 5FQIA 5L2FA 4N9KA 1MPLA 5CTMA 3C4PA 1KE0A 3M6BA 1IYQA 3HLGA 2QPNA 3CMZA 4OOMA
chains in the Genus database with same CATH superfamily
5M19A 3LIDA 4X68A 3BRMA 3LIAA 1KGEA 3DTIA 1GSXA 4ETZA 3UB5P 2PU4A 1L0FA 1H0MA 3LY4A 3R7WA 1H5XA 3K3CA 5FDHA 1PRQA 3IWIA 4UEYA 2ZLYA 4NXBA 4C6YA 2X71A 5FAPA 1W8YA 4DKIA 4JXGA 4LRXC 4S2LA 1Y28A 4RVAA 3W8KA 3B33A 4R3JA 1XA7A 3T4QA 4OONA 4WZ4A 3FZCA 3NDEA 4NXEA 2ZM0A 3ZG8B 4GS9B 1Z09A 2B18A 5FASA 3IF6C 4WEJA 4S2JA 1FSWA 4EESA 2V8FA 1MKIA 1ZKJA 3GRJA 5HL1A 1TS7A 2R9WA 3N4IA 2Z6CA 4I39A 3IX4A 3UMDA 3ZG5A 1W79A 2JE5A 4U0XA 4E3JA 2XK1A 4BD1A 5JYPA 1NYMA 3FYZA 5FSRA 2P9VB 1TVFA 5G18A 5GLCA 1IYSA 4S2IA 2CC1A 3VP3A 2WGWB 4K0XA 4BD0A 4E3NA 2L0WA 1XPBA 3QP4A 3T4KA 5L07A 3MS6A 4JXSA 2W1TA 3EEHA 3CHWP 5CTNA 3Q07A 4HBTA 3G4PA 1T19A 1LHYA 1YPRA 2HV1A 3HLEA 3ZDJA 5HZHA 3T4OA 4EUZA 1G68A 3F1NA 3HLWA 3SS4A 4DE0A 2Y2OA 5HPIA 1LSWA 1K55A 4RYEA 3Q1FA 3CI6A 1CI9A 2V1AA 5DTSA 4E3IA 2VGKA 3UPPA 3V5MA 3C7UA 1S4RA 1S1ZA 1XX2A 2CMNA 5A91A 2XR0A 2OV5A 3BQ8A 3IXHA 5EVIC 3E2KA 3A0RA 4Y15A 3NY4A 2HGVA 2QWSA 3H82B 3QP8A 2HP5A 1YMXA 4DXCA 1LSXA 4LPZA 1XP4A 4ZRRA 2XD5A 1CI8A 1DJAA 4OVDA 4QU3A 5J3WA 1MBLA 5TBMB 4JGPA 2J9OA 5GL9A 2H0TA 2A24A 3WS2A 2QMIA 4R0QA 2XGNA 1MWUA 1JNUA 1W63M 2ZC6B 4OOLA 2B95A 2ZC3B 4EEUA 2ZL1A 3G31A 2GNXA 4Y3IA 2E8JA 3IX8A 3O86A 4Z9QA 1G6AA 1W7FA 2PBYA 2PYPA 3VFFA 3W2ZA 2IWDA 5EOEA 4N9LA 3ITAA 4HOIA 2HJ9C 3FWLA 4LFUA 3UPOA 1WYBA 2ZQ9A 1Q2QA 2B5RA 5HW3A 3VP2A 1ES5A 4OKPA 2PRFA 1S1YA 3A3FA 2A24B 2J80A 3CZDA 4KZ7A 2J8YA 2ZD8A 1OPXA 2XDMA 3BWLA 3UDXA 1JWPA 3VE3A 3ZYTA 1L2SA 5EVEA 4OPQA 2MJ6A 2Y55A 1KDWA 1ERQA 1O07A 3E0YA 1BULA 5GHXA 2ACGA 2OSUA 1K57A 1XA1A 2FFFB 3LEQA 1K54A 2PBDP 1VETA 1N4OA 3N8RA 1T1CA 1TF1A 5E43A 3G30A 4GJ4A 3T1SA 3PBOA 3FPVA 4X25A 3IS2A 3G2YA 2Z2MB 3Q7ZA 4ZAMA 2JC7A 4FTXA 5HDDA 3H7WB 4KZ4A 2YKHA 1VB6A 4UQIS 4Z1WA 2ZMAA 5U47A 2WKQA 5HAQA 3EGDC 2W3DA 1DJCA 1KGGA 3H9WA 3CG5A 5HDCA 2XD1A 4E6WA 4NKPA 4QWOA 1LI9A 4GB7A 1PFLA 5TGFA 4S2PA 2EFXA 4Y0UA 1AWIA 4EXOA 4GD8A 1XGJA 3IT9A 4O0PA 5DKLA 4DE2A 5AJGA 4DRTA 4I3AA 2Y2QA 4JXWA 2EX9A 5CXWA 4O8GA 1P9WA 4HH3A 1TDLA 5AVFA 3MZFA 4R23A 3ZNTA 3BFDA 5GLBA 5CHUA 4GNUA 3QNBA 1RP5A 2Y4AA 2Q9NA 3C7VA 4E3OA 1IELA 2GJ3A 2PYRA 1PYYA 3R4KA 2WADA 1HVBA 1RGYA 1G28A 4CJNA 3V50A 4UQIM 3UO9A 2K7SA 4CLCA 5FAOA 1XKZA 4JF6A 4Y5FA 4BLMA 3G34A 4Y17A 2UWXA 3C5AA 1GHIA 2E8IA 4JXVA 4HNBA 3IBRA 1KE4A 2XA7S 4KENB 3WRZA 5HWWA 2VKSA 1BTLA 1EW0A 1K4FA 5EVID 1XJ3A 4OOYA 1W8QA 2EWVA 5EVLA 4Y13A 1NLZA 3V67A 3NI9A 3IF6B 4I3IA 3ZVWA 2M7UA 4B88A 1K56A 2BTFP 2PDRA 2IWCA 2DCFA 1GHPA 3HUNA 2HDRA 3OPHA 4EQIA 3BLMA 3MQOA 5D3OA 1DP9A 3SS5A 5IS1A 1HTZA 3A3JA 3BM6A 2H28A 4O01A 3ZG7B 3FKVA 1MWTA 4HJ4A 3BYDA 4U0TA 3DTEA 3MQ0A 4IUKA 3RXXA 1DRMA 4OQHA 3F1PA 1CEGA 4NXGA 2J3TD 4OP8A 4EBNA 1FIKA 1KDSA 5DFXA 3VP4A 3ZFZA 4BBVA 1DP6A 3BFFA 5TFQA 1KVMA 2XA7M 3B47A 1TDGA 5HDSA 3IHBA 5EV0A 4N92A 4UA6A 1K55C 1VHMA 4KG6A 3LYXA 2JKRM 4N9KA 3C4PA 2Z6DA 2PD8A 2AVXA 1OTAA 4ZJ3A 3DWKA 3OLOA 2XH9A 1YSQA 3A0VA 4KZ9A 3F1PB 3VOZA 2ZQCA 3S7QA 4MNRA 5I5LA 4X53A 5FQ9A 1BSGA 5DTTA 3B42A 5HWTA 3HLDA 1ALQA 2ZM8A 3SH7A 3N7WA 2Y2MA 2ZM2A 5HWVA 3P01A 2KX6A 1SKFA 2R78A 3GMWA 2I9VA 1TEMA 4E3KA 1TS0A 3PBTA 5JYOA 2LB5A 1LL5A 4BMWA 4KZBA 2DRWA 4GZBA 2K31A 3T1XA 1J9MA 3TRCA 2ZC4B 3M2JA 1JWVA 2Y2HA 1IFQA 3A3EA 1YMSA 3RH8B 2C5WB 5FI7A 1S67L 3TG9A 3VP0A 4EBLA 4MN6A 3Q7VA 3W4PA 2JKTI 3IHAA 1TS8A 2NUTC 1PZPA 4MDZA 2V0UA 1IKGA 1GSWA 4JGRA 4CLCE 1K25A 4MEZA 1ACFA 1K54C 2X01A 2QYBA 4OPZA 4WELA 5HPFA 1MWSA 2FFYA 5HSQA 2WZXA 4JF5A 3IXBA 2WUQA 4XT2B 1SZVA 3GTCA 2JN7A 4HJ6A 4IVIA 4MBHA 1T1AA 3T1RA 3PBQA 4OQGA 3OOVA 2GX5A 1AXBA 3Q7VB 4Q0IA 1SKOA 3WS5A 4B4ZA 2X02A 1OTIA 4NG2A 1M6KA 3C30A 4MMNA 2QHKA 1FR6A 4NXFA 4F3LA 4X55A 3TW8A 1YLJA 2W3GA 1GSVA 1P9RA 5IU1A 3O5YA 2QJ5A 1FSYA 3NOTC 3S1YA 4PKYG 3KO6A 1PZOA 2WZZA 1LT0A 1YM1A 4KZ5A 3HLBA 3BJNA 4DJ3A 4OQIA 3VMAA 2HP9A 1YLZA 2V0WA 2Y59A 3LEZA 1SKOB 3CJMA 5A93A 3FKWA 1G5UA 2R9XA 1E25A 3F1OA 1FR1A 2WKPA 5CGSA 3IH9A 3NCKA 2M1CA 3IWQA 5FI2A 1ESIA 3UB8A 1PI5A 1C3BA 5FL3A 4F3LB 4KG5A 3KX0X 4FH2A 4DE3A 4EUVA 3R7WB 4KQRA 4S2OA 1D06A 1BYWA 3Q82A 4R1GA 4CLCC 2VEAA 1XXMA 2ZOIA 3TJZC 4DDYA 5F1FA 3VE4A 3OPPA 1MY8A 4NETA 3NDGA 4LGWA 3MXQA 3PR6A 4KQQA 1XJ4A 3BFCA 1ONGA 4YINA 3N8SA 3BECA 3LIBA 4FD8A 3LI8A 4GN2A 1ONHA 4HESA 4N1XA 5A92A 3BFEA 2PHYA 2EX2A 5IHVA 3SS3A 4LCLA 1YLTA 3MFXA 2J3WA 3LR4A 4X1LA 3CAXA 3MZDA 3QP1A 2L4RA 4BL3A 4LLOB 3SH9A 2HJEA 5E2HA 2W1TB 5EE8A 4M4XA 3PAGA 3HL9A 3KYZA 5DKKA 5CHMA 4P6ZS 2VGJA 3BY9A 4MBFA 1LL9A 2O0YA 1OJGA 4HP9A 5EECA 3F1NB 2XLNA 4X1MA 2EFUA 3GR2A 2WAFA 2XEPA 4PM8A 2HPBA 2O9AA 3UB9A 3HVFA 2LB9A 4ZDXA 3WS0A 4QY6A 2J9PA 3MQQA 4PMAA 4X56A 1S6RA 2O9CA 4K91A 2GZAA 4HBUA 3QHYA 2DMWA 2KOIA 1NYYA 4PM7A 3LCEA 1JVJA 4YOFA 4GD6A 3HBRA 3PXPA 2RL3A 1LLBA 3EWKA 1Z6FA 1NLYA 1MKMA 5K5BA 2XQZA 4QD4A 3FC7A 3QNCA 2ZL1B 3E4OA 3NOPC 2VK3A 4LV1A 2J7VA 1WA9A 1D1JA 4P6ZM 1EROA 2I72A 2DNSA 3EGXC 2ZMVA 4HI4A 1CJFA 4RX3A 3DBAA 2Y2JA 1FOFA 4L0LA 4MN7A 2INWA 2W3EA 1WYCA 2W27A 4GHIA 1UGUA 1XJ2A 1W63Q 2VGLS 5KZHA 4BBUA 3C38A 1LSVA 4UA9A 4L9GA 2VZWA 4OH0A 4N1HA 2NUPC 5FAQA 3OC2A 4GLQA 2WKHA 3A3DA 3SW1A 3AGDA 4PM5A 3PTEA 4UA7A 3O88A 4CPKA 1BLCA 1VETB 1EI5A 3IQAA 5DTKA 3DAVA 2V2FF 1PW8A 3IX3A 5FQIA 3IS2B 1KE0A 1P97A 3ULFA 4OOMA 2ZMFA 3AGEA 5KMWA 1X0OA 1OMEA 3C2WA 5EM0A 3SZTA 3CITA 3LR3A 1ODVA 3CLOA 3MF0A 2XF3A 2EXAA 1IYPA 2VGLM 3JYIA 4HHDA 2OOLA 3S7OA 3ITBA 1BZAA 1RCJA 2V8CA 3UMEA 4RA7A 4NEED 1A0KA 5M1AA 5E2EA 3G32A 2C6WB 2EWWA 2H10A 1W5DA 3K3DA 4S2NA 4PM6A 2Y2LA 4HIAA 2EX6A 4YNRA 3S7PA 4D60A 3PAEA 2JBFA 1LL8A 1JTDA 1I2SA 3OPLA 5DFYA 2V20A 3WWXA 1NY0A 4JGOA 1ZG4A 4HEFA 4R3BA 4LENA 4IEDA 1NXYA 5FEFA 2P08A 2ZQ7A 3GECA 4IHQA 4H8RA 4OLGA 3A3IA 4CLCB 3LR0A 4YWZA 4LCMA 4BJPA 3VOLA 1YLYA 4Q8IA 1K6SA 4K0WA 5L8MA 1MZUA 2FH5A 4FCFA 3PBRA 5GLDA 4WMCD 3HUOA 3UN7A 3QP6A 5FQQA 5L09A 2VJWA 5FA7A 5EUAA 3QP2A 3HLCA 5F69A 2QZ6A 4NK3A 2HDUA 4WLAA 2KLIA 5KSCA 3K2NA 4WUJA 4H6JA 4P6BA 2H0YA 3NIAA 1O7EA 2Z2LB 2EXBA 5AVEA 3NC8A 3RTYA 5EVIA 1HLUP 1TS6A 1YKDA 4OQ0A 2WYXA 5G4ZA 1MC0A 4UHUA 3JPUA 4DE1A 4E3LA 2Y8HA 2G7UA 1XGIA 3T50A 4JKTA 5FATA 4L9EA 3CUEA 1RGZA 1YSPA 4P87A 4ARZA 1BLHA 2G2WA 3G2ZA 5FEGA 1QMFA 1NRJA 4R4RA 4X69A 1G6OA 5L10A 2VV8A 2IA2A 1T18A 3VSLA 3FV7A 3U2AA 3UNWA 3HCYA 4EETB 3UDFA 5AQBA 3ZG0A 3GV9A 1M40A 3S4XA 2G2UA 3KSHA 3P09A 3IH8A 4E04A 3VP1A 4R38A 2VLGA 4LV0A 3T4JA 1S66L 3NULA 1E3UD 1PIOA 3HREA 5TJJA 4DXBA 3MXSA 1GHMA 3MFDA 3LFVA 3C4OA 3VV4A 5A90A 1PWGA 3LR5A 3NBLA 1S0WA 1SDNA 3DWZA 4KZ8A 3JVVA 5GHYA 3D9YA 2Y91A 1SHVA 1K57C 2IWBA 1F5MA 2QJ7A 5TR7A 1UWPX 1KGFA 3ZVTA 4ID4A 3DTMA 4R6LA 1QMEA 3ZCZA 4S2MA 4XUXA 1F98A 2BASA 4DN0A 3TOIA 1ZTUA 4ME4A 5EM1A 3S7NA 1XJ6A 2XROA 5CX7A 2OLUA 4MN5A 3N8LA 5F1GA 4GDBA 3MKEA 5HL6A 2JKRI 5CEBA 5CGWA 4UAAA 4EERA 4GDNA 1PW1A 2O99A 1S4SA 2EX8A 3JVUA 4Y0TA 3IBJA 3OPRA 2JCHA 1CEFA 4KUOA 2Y2IA 1IKIA 3RFBA 2WKRA 1ZC2A 3O3VA 1OTDA 2Y2NA 3WS4A 4RX2A 5E2GA 1MXOA 4WM9A 4FH4A 4AFIA 4GS9A 4OP5A 2WGVA 2V1ZA 1YAXA 1XFNA 2JKFA 1V9ZA 4EBPA 2PR6A 3T4LA 4QHCA 2ZOHA 3P7NA 3ZHHA 4WEKA 1TD5A 3ZG9B 4DMZA 4HP4A 3EOIA 1NJ4A 4IBXA 2P9VA 5DJUA 1T1BA 3BQAA 2JKGA 2PU2A 2WGWA 1JTGA 3C8CA 4JBFA 1Y4OA 2Q9MA 4X6TA 1K0KA 3BFGA 3B3XA 4S2NC 1H8MA 3KSGA 4B4XA 4WZ5A 2ZQ8A 4OPRA 4PKYA 2HP6A 3HUMA 3T4TA 4M3KA 2L1MA 3F1OB 3MBZA 1PWDA 3QP5A 3GSGA 1FCNA 1P0ZA 3HJIA 5HAPA 5J7EA 4ETXA 3V3SA 1N9OA 2EA9A 3MKFA 3BW6A 3ISGA 3LI9A 5FQMA 4KG2A 1FILA 4PAUA 1L0GA 4KQDA 3H82A 5G4YA 4C3QA 2WGIA 3MR0A 1J3WA 5FQJA 2YKFA 5F83A 5TBMA 4E6XA 2XRNA 3WS1A 5DF8A 4R3AA 5E2FA 1FCOA 3AGFA 3FPWA 5MC7A 2W3HA 4GCZA 2O9BA 3P98A 1D7EA 4MCWA 3LGOA 3LIEA 1FQGA 5L2FA 1MPLA 2W0NA 3M6BA 3HLGA 2QPNA 1OTBA 3T12B 1K38A 4KZ6A 3RJUA 2PAVP 3IF5A 5F68A 5DF7A 4I5SA 4BL2A 2QKPA 4K08A 4EEPA 3TE8A 3VSKA 4FOFA 1K6RA 4IUHA 2BLSA 4CQHA 1BUEA 3CUEC 3HJKA 3EEAA 3VOYA 1KVLA 5BOHA 5EPHA 3EQVA 1H8ZA 5CEDA 4IVKA 1CF0A 1L3LA 1SDEA 5FQKA 1H3QA 5HX9A 2OWJA 1IYOA 2OAQ1 4RQ9A 5FI6A 3KSFA 2PD7A 1YT4A 4LRZE 4B93A 4O7DA 1ERMA 4YFMA 1VM1A 1N9LA 4P85A 4QJGA 2J3TC 3UDIA 2KDKA 1YLWA 2Y79A 3GDIA 3HLFA 4HY8A 5HAIA 2P74A 5HD5A 4QY5A 5DVAA 3PBNA 3M2KA 3NECA 3LICA 4EQ1A 3H7WA 4JGQA 1ES4A 2ZC5B 4EW7A 1GCEA 4HQAA 1DP8A 3MMHA 1Q2PA 4Y7PA 2VV6A 5AQ9A 1E4DA 2HF6A 4WN5A 1N9NA 2WKIA 4FSFA 1ESUA 3LO7A 4BBTA 5GLAA 3OZHA 4HJ3A 1N9BA 4MBKA 4ESPA 3UE1A 5FDSA 4BQMA 4EWFA 3G35A 4GKUA 2WK0A 4WYYA 1L0DA 5HD3A 1SCWA 1CK3A 4WL9A 2XFSA 4CLCD 3ZGAB 4XUZA 2OLVA 4GHIB 4HH2A 3UE0A 5EFWA 5J8XA 2UV0E 1V9YA 4BENA 5LBRA 3OCNA 4PHTA 1NZOA 2FZ0A 2ZC7A 2W3FA 3Q81A 1BLSA 3BY8A 1YLPA 4LV2A 5F6AA 5J4EA 3KSIA 1GA9A 3UB7A 2OAP1 4OLDA 1PI4A 3E4PA 3LIFA 1Y54A 1K56D 2VA0A 3E98A 1H8YA 3T1QB 1WE4A 1XFQA 5HARA 2Y2GA 3PHYA 1OT6A 2Y2PA 5DJTA 4KZ3A 4JLFA 3UE3A 3D4FA 1BLPA 5F5YA 1VEUA 4R4SA 3UE6A 2RCXA 3IF6A 1EWZA 4ZJ1A 5CGXA 2D01A 3TSGA 3KYQA 4PPRA 3L9KA 1HD8A 3CPTA 4XXRA 3UY6A 3V3RA 3O87A 1ES3A 2Y2KA 3UB6A 4GOGA 4G3WA 3MJQA 4ZJ2A 1OT9A 5CHJA 2WAEA 3MZEA 3MSHA 2P04A 1I2WA 1OTEA 1L0EA 4KQOA 4WZ5C 3DTKA 3GVBA 2XFTA 2GDNA 4DDSA 4LV3A 3D3OA 5A8BA 3VFHA 1VEUB 1YQSA 5DF9A 4IJGA 3D72A 3ICYA 4JF4A 5EOOA 4Y2FA 3PBSA 1IOUA 3E4QA 1LI0A 2H5SA 2HZ5A 4S2KA 1JWZA 1DJBA 2JKTM 3CPTB 4BWIA 5IT5A 1CQAA 1IEMA 2P7JA 3LUQA 1OJ5A 5AQ7A 3M6HA 4E3MA 4GW9A 3CWFA 2A3UA 4WF0A 4LRYC 4A5RA 4IBRA 1ZHHB 4G3VA 5CRFA 2PT7A 1HZOA 5CECA 1K4EA 4KZAA 3N6IA 1U60A 2BG1A 2W1RA 4OPYA 3EQUA 3DW0A 3A0SA 5GHZA 2OWHA 1UWNX 4Y0OA 4EV4A 4C75A 3IXDA 1NZUA 2VV7A 1GA0A 3NJAA 4P0MA 1ES2A 3MXRA 3S22A 3T4SA 2XSSA 1KOUA 2VX8A 1NRFA 4DJ2A 3GQZA 4H6JB 2ZJ9A 1F2KA 4G3KA 2HDQA 4WMCA 3IXGA 3WRTA 2ZQAA 4WBGA 5EVIB 5I94A 5M18A 3SOIA 1KE3A 3RXWA 4F94A 4B9OA 4ZTKA 4L9FA 5HFOA 3W4QA 3SH8A 3V39A 2M7VA 2V9AA 2D02A 3FG8A 5C5KA 4QPRA 4ARZB 3BEBA 3G6OA 1MWRA 2ZBBA 1STZA 4JPMA 2ZQDA 3W4OA 3I7JA 4D2OA 4Q0JA 2B02A 5F82A 3LY3A 3ZNYA 1ZG6A 4Q0HA 1VQQA 3KYEA 2JHEA 4I38A 1PNEA 3L7HA 3NOUC 4II7A 4PM9A 4XT2A 2A2LA 3OCLA 3E2LA 1NWZA 4ZBEA 1PWCA 5AQAA 2V1BA 1DY6A 4FUWA 4I3JA 5KIZA 2Q0OA 1I5QA 4U3TA 3U4LP 5KSHA 3BLSA 2K2NA 3PYPA 2WKEA 3OBFA 3IWOA 2A49A 1FCMA 4QB8A 4DF6A 1BT5A 2HDSA 3UPNA 3ZQ5A 5CERA 3NHQA 1E3UA 4MLLA 4EU0A 4KUKA 5CTMA 1F9IA 1IYQA 3CMZA 4R70A 2PR5A
chains in the Genus database with same CATH topology
1K38A 5M19A 4KZ6A 3AGEA 4X68A 3BRMA 5KMWA 1KGEA 1OMEA 3RJUA 4ZJ3A 3IF5A 3DWKA 2PU4A 1L0FA 5DF7A 2XH9A 4KZ9A 4BL2A 3VOZA 2ZQCA 3LY4A 1H5XA 2XF3A 2EXAA 3VSKA 1IYPA 1K6RA 4MNRA 3JYIA 5FDHA 2BLSA 3ITBA 4X53A 1BZAA 3IWIA 1BUEA 2ZLYA 5FQ9A 3VOYA 1BSGA 1KVLA 5BOHA 5DTTA 5EPHA 4C6YA 2X71A 3EQVA 5FAPA 3HLDA 1ALQA 1H8ZA 1W8YA 2ZM8A 4DKIA 1RCJA 5CEDA 4IVKA 3SH7A 4RA7A 3N7WA 4JXGA 2Y2MA 2ZM2A 4S2LA 1SDEA 5FQKA 5HX9A 1IYOA 4RVAA 3W8KA 5FI6A 5M1AA 5E2EA 1SKFA 3G32A 2C6WB 3GMWA 1YT4A 4R3JA 2H10A 1TEMA 1W5DA 1XA7A 4O7DA 4S2NA 4E3KA 4PM6A 1ERMA 4YFMA 2Y2LA 2EX6A 4OONA 3PBTA 4WZ4A 3PAEA 5JYOA 2JBFA 3FZCA 3NDEA 1LL5A 1VM1A 4KZBA 2ZM0A 4P85A 4QJGA 3ZG8B 1JTDA 2DRWA 1I2SA 4GZBA 5FASA 3IF6C 3OPLA 4S2JA 4WEJA 1FSWA 2V20A 3UDIA 3WWXA 1J9MA 1YLWA 1MKIA 1NY0A 1ZKJA 2ZC4B 3GRJA 3HLFA 3M2JA 5HAIA 1JWVA 2P74A 5HL1A 1ZG4A 4HEFA 4QY5A 2Y2HA 4R3BA 4LENA 5DVAA 2R9WA 3N4IA 1NXYA 3PBNA 4IEDA 3ZG5A 2ZQ7A 3M2KA 3A3EA 1W79A 1YMSA 4H8RA 2JE5A 2C5WB 4U0XA 5FI7A 4E3JA 2XK1A 3TG9A 4BD1A 3VP0A 5JYPA 1NYMA 3FYZA 5FSRA 4OLGA 4EBLA 2P9VB 1ES4A 1TVFA 5G18A 5GLCA 3A3IA 1IYSA 2ZC5B 4S2IA 1GCEA 2CC1A 3Q7VA 3VP3A 2WGWB 3W4PA 4K0XA 4BD0A 4LCMA 3IHAA 4BJPA 1YLYA 1Q2PA 4E3NA 4Q8IA 1K6SA 1PZPA 4K0WA 1XPBA 4FCFA 4Y7PA 1IKGA 4JXSA 5AQ9A 1E4DA 3PBRA 5GLDA 4WMCD 3HUOA 2WKIA 3UN7A 5CTNA 3Q07A 1K25A 4HBTA 4MEZA 3G4PA 4FSFA 1ESUA 3LO7A 1K54C 2X01A 5FQQA 4OPZA 1LHYA 5GLAA 3OZHA 1N9BA 4MBKA 1MWSA 2FFYA 4WELA 5FA7A 2WZXA 4JF5A 3IXBA 2WUQA 5EUAA 3HLEA 3ZDJA 3HLCA 3UE1A 4EUZA 2QZ6A 4NK3A 4BQMA 2HDUA 4EWFA 1G68A 3HLWA 5KSCA 3SS4A 3G35A 2Y2OA 3GTCA 4DE0A 4GKUA 2WK0A 4WYYA 1L0DA 4IVIA 1SCWA 1CK3A 4MBHA 2XFSA 3PBQA 4P6BA 3ZGAB 4XUZA 2H0YA 2OLVA 1K55A 4OQGA 4RYEA 3NIAA 3Q1FA 1AXBA 1O7EA 1CI9A 2Z2LB 3Q7VB 5DTSA 3UE0A 2VGKA 3UPPA 3V5MA 4E3IA 3C7UA 5J8XA 2EXBA 3WS5A 1XX2A 4BENA 3NC8A 3OCNA 4B4ZA 1NZOA 2X02A 5A91A 5EVIA 2XR0A 2OV5A 1M6KA 4OQ0A 2WYXA 2ZC7A 1FR6A 3IXHA 5EVIC 3E2KA 4UHUA 3NY4A 3Q81A 1BLSA 4X55A 1YLPA 4E3LA 4DE1A 1XGIA 1YLJA 2HP5A 1YMXA 4LV2A 4JKTA 4DXCA 1XP4A 1FSYA 5FATA 2XD5A 1GA9A 1CI8A 1DJAA 4OVDA 3S1YA 4QU3A 1MBLA 1RGZA 2J9OA 4OLDA 5GL9A 2H0TA 1PI4A 4P87A 3WS2A 1BLHA 2QMIA 4R0QA 2WZZA 2G2WA 1PZOA 1K56D 1Y54A 1MWUA 2XGNA 3G2ZA 1YM1A 2ZC6B 1QMFA 4KZ5A 3HLBA 4OOLA 4R4RA 4OQIA 4X69A 2ZC3B 1H8YA 2HP9A 3VMAA 1YLZA 2Y59A 1WE4A 3LEZA 5HARA 2Y2GA 3G31A 3VSLA 3CJMA 3FV7A 2Y2PA 3O86A 4Z9QA 5A93A 1G6AA 1W7FA 2PBYA 2R9XA 3FKWA 1E25A 4KZ3A 3VFFA 1FR1A 4JLFA 5CGSA 3IH9A 3UNWA 3NCKA 2IWDA 5FI2A 3IWQA 1ESIA 3UE3A 5EOEA 1PI5A 3UDFA 1C3BA 3D4FA 1BLPA 5AQBA 3ZG0A 4N9LA 4R4SA 3ITAA 3GV9A 2RCXA 3IF6A 1M40A 3S4XA 2G2UA 3FWLA 1EWZA 4ZJ1A 4KG5A 3P09A 3IH8A 5CGXA 3UPOA 3VP1A 4FH2A 1WYBA 3TSGA 4DE3A 2ZQ9A 1Q2QA 2B5RA 4PPRA 5HW3A 3VP2A 1ES5A 4KQRA 1HD8A 4OKPA 4S2OA 4LV0A 3Q82A 3A3FA 4R1GA 3CZDA 4XXRA 3UY6A 4KZ7A 3V3RA 2J8YA 1XXMA 2ZD8A 3O87A 1ES3A 2Y2KA 2XDMA 4GOGA 1E3UD 1PIOA 3HREA 3UDXA 4DXBA 4ZJ2A 1JWPA 1L2SA 3MXSA 1GHMA 4DDYA 3MFDA 5CHJA 5F1FA 4OPQA 2WAEA 3MZEA 3C4OA 3OPPA 1MY8A 1I2WA 5A90A 1PWGA 2Y55A 1KDWA 1L0EA 1ERQA 3NBLA 3NDGA 4KQOA 4NETA 1S0WA 1SDNA 3DWZA 1O07A 4WZ5C 3GVBA 1BULA 2XFTA 2GDNA 4KZ8A 5GHXA 4DDSA 4LV3A 2OSUA 5GHYA 1K57A 4KQQA 1XA1A 3BFCA 2FFFB 1ONGA 2Y91A 3VFHA 1SHVA 4YINA 1K54A 1YQSA 5DF9A 3N8SA 1K57C 1N4OA 4JF4A 3BECA 5EOOA 3N8RA 3PBSA 2IWBA 5E43A 4FD8A 1LI0A 5TR7A 4GN2A 2H5SA 3G30A 1KGFA 4S2KA 3ZVTA 3PBOA 1ONHA 4ID4A 1JWZA 4HESA 1DJBA 3DTMA 4N1XA 5A92A 1QMEA 1IEMA 3BFEA 2EX2A 5IHVA 5AQ7A 3ZCZA 3G2YA 4S2MA 3M6HA 4LCLA 3SS3A 4XUXA 2Z2MB 3Q7ZA 4E3MA 1YLTA 4ZAMA 2JC7A 3TOIA 2A3UA 4A5RA 4KZ4A 4IBRA 3MZDA 2ZMAA 5U47A 5CRFA 5HAQA 2OLUA 1HZOA 3N8LA 5F1GA 4GDBA 5CECA 1DJCA 3MKEA 1K4EA 4BL3A 5CEBA 1KGGA 4KZAA 3CG5A 3N6IA 3SH9A 5CGWA 2XD1A 4UAAA 1U60A 2BG1A 4E6WA 5E2HA 5EE8A 4OPYA 4GDNA 1PW1A 3EQUA 1LI9A 3PAGA 4GB7A 2EX8A 5TGFA 3HL9A 4Y0TA 3DW0A 4S2PA 5GHZA 2EFXA 4Y0OA 4Y0UA 4EV4A 3OPRA 4C75A 5CHMA 3IXDA 2VGJA 2JCHA 1NZUA 4GD8A 1XGJA 4MBFA 1LL9A 3IT9A 1CEFA 1GA0A 2Y2IA 1IKIA 1ES2A 3MXRA 4P0MA 3S22A 4DE2A 5EECA 4DRTA 2Y2QA 4JXWA 1ZC2A 3O3VA 1NRFA 2XLNA 2EX9A 5CXWA 2Y2NA 3WS4A 4RX2A 5E2GA 3GQZA 1MXOA 2ZJ9A 2EFUA 4WM9A 1TDLA 3GR2A 4FH4A 2WAFA 2XEPA 3MZFA 4PM8A 2HPBA 4R23A 2HDQA 4WMCA 3BFDA 4OP5A 3ZNTA 3IXGA 5GLBA 5CHUA 3WRTA 4GNUA 2WGVA 2V1ZA 3HVFA 3QNBA 4ZDXA 1RP5A 2ZQAA 4EBPA 2Y4AA 4WBGA 2Q9NA 5EVIB 3WS0A 3C7VA 2J9PA 4QHCA 4QY6A 3ZHHA 5I94A 5M18A 4E3OA 4PMAA 4WEKA 1IELA 4X56A 1S6RA 3SOIA 1KE3A 4K91A 4HBUA 3QHYA 3ZG9B 1PYYA 3RXWA 1NYYA 4PM7A 1NJ4A 2WADA 1HVBA 1RGYA 3LCEA 4ZTKA 4F94A 4IBXA 1JVJA 5HFOA 4CJNA 3V50A 3W4QA 2P9VA 4GD6A 3UO9A 3SH8A 3HBRA 3V39A 5FAOA 1XKZA 2RL3A 1LLBA 2WGWA 2PU2A 4JF6A 1Z6FA 1JTGA 4JBFA 4BLMA 3G34A 2Q9MA 3BEBA 4X6TA 1MWRA 2UWXA 3C5AA 3BFGA 1GHIA 2XQZA 2E8IA 3B3XA 4JPMA 4JXVA 2ZQDA 3W4OA 4S2NC 3I7JA 4D2OA 1KE4A 4B4XA 4QD4A 3QNCA 4KENB 5F82A 3ZNYA 3LY3A 3WRZA 4WZ5A 2ZQ8A 1ZG6A 4OPRA 1BTLA 4LV1A 2J7VA 2HP6A 3HUMA 4M3KA 1K4FA 5EVID 1EROA 2I72A 1VQQA 2DNSA 4PM9A 4RX3A 4OOYA 1W8QA 2Y2JA 5EVLA 3MBZA 1FOFA 1PWDA 4L0LA 3OCLA 3E2LA 3NI9A 3GSGA 3IF6B 1FCNA 3ZVWA 5HAPA 4B88A 1K56A 4ZBEA 1PWCA 5AQAA 1DY6A 3V3SA 2IWCA 1WYCA 3MKFA 2DCFA 1GHPA 3HUNA 2HDRA 3OPHA 4EQIA 3BLMA 3ISGA 5KZHA 5D3OA 4UA9A 3SS5A 5FQMA 1HTZA 1I5QA 3A3JA 3BM6A 3ZG7B 4KG2A 4OH0A 3FKVA 4U3TA 4N1HA 1L0GA 5FAQA 1MWTA 5KSHA 3OC2A 3BLSA 3BYDA 4C3QA 2WGIA 4U0TA 2WKHA 3A3DA 2WKEA 3RXXA 3IWOA 4OQHA 5FQJA 2A49A 1FCMA 4QB8A 4DF6A 3AGDA 1BT5A 1CEGA 4PM5A 3PTEA 5F83A 2HDSA 4UA7A 3O88A 3UPNA 4CPKA 4E6XA 4OP8A 1BLCA 4EBNA 1EI5A 1KDSA 3IQAA 3VP4A 3WS1A 5DF8A 5DTKA 5E2FA 5CERA 3ZFZA 1FCOA 3AGFA 3BFFA 5TFQA 1E3UA 1KVMA 3P98A 4MLLA 1TDGA 3IHBA 4N92A 2V2FF 4UA6A 1PW8A 1K55C 4KG6A 1FQGA 5FQIA 5L2FA 4N9KA 1MPLA 5CTMA 3C4PA 1KE0A 3M6BA 1IYQA 3HLGA 2QPNA 3CMZA 4OOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K38 A;  5M19 A;  4KZ6 A;  3AGE A;  4X68 A;  3BRM A;  5KMW A;  1KGE A;  1OME A;  3RJU A;  4ZJ3 A;  3IF5 A;  3DWK A;  2PU4 A;  1L0F A;  5DF7 A;  2XH9 A;  4KZ9 A;  4BL2 A;  3VOZ A;  2ZQC A;  3LY4 A;  1H5X A;  2XF3 A;  2EXA A;  3VSK A;  1IYP A;  1K6R A;  4MNR A;  3JYI A;  5FDH A;  2BLS A;  3ITB A;  4X53 A;  1BZA A;  3IWI A;  1BUE A;  2ZLY A;  5FQ9 A;  3VOY A;  1BSG A;  1KVL A;  5BOH A;  5DTT A;  5EPH A;  4C6Y A;  2X71 A;  3EQV A;  5FAP A;  3HLD A;  1ALQ A;  1H8Z A;  1W8Y A;  2ZM8 A;  4DKI A;  1RCJ A;  5CED A;  4IVK A;  3SH7 A;  4RA7 A;  3N7W A;  4JXG A;  2Y2M A;  2ZM2 A;  4S2L A;  1SDE A;  5FQK A;  5HX9 A;  1IYO A;  4RVA A;  3W8K A;  5FI6 A;  5M1A A;  5E2E A;  1SKF A;  3G32 A;  2C6W B;  3GMW A;  1YT4 A;  4R3J A;  2H10 A;  1TEM A;  1W5D A;  1XA7 A;  4O7D A;  4S2N A;  4E3K A;  4PM6 A;  1ERM A;  4YFM A;  2Y2L A;  2EX6 A;  4OON A;  3PBT A;  4WZ4 A;  3PAE A;  5JYO A;  2JBF A;  3FZC A;  3NDE A;  1LL5 A;  1VM1 A;  4KZB A;  2ZM0 A;  4P85 A;  4QJG A;  3ZG8 B;  1JTD A;  2DRW A;  1I2S A;  4GZB A;  5FAS A;  3IF6 C;  3OPL A;  4S2J A;  4WEJ A;  1FSW A;  2V20 A;  3UDI A;  3WWX A;  1J9M A;  1YLW A;  1MKI A;  1NY0 A;  1ZKJ A;  2ZC4 B;  3GRJ A;  3HLF A;  3M2J A;  5HAI A;  1JWV A;  2P74 A;  5HL1 A;  1ZG4 A;  4HEF A;  4QY5 A;  2Y2H A;  4R3B A;  4LEN A;  5DVA A;  2R9W A;  3N4I A;  1NXY A;  3PBN A;  4IED A;  3ZG5 A;  2ZQ7 A;  3M2K A;  3A3E A;  1W79 A;  1YMS A;  4H8R A;  2JE5 A;  2C5W B;  4U0X A;  5FI7 A;  4E3J A;  2XK1 A;  3TG9 A;  4BD1 A;  3VP0 A;  5JYP A;  1NYM A;  3FYZ A;  5FSR A;  4OLG A;  4EBL A;  2P9V B;  1ES4 A;  1TVF A;  5G18 A;  5GLC A;  3A3I A;  1IYS A;  2ZC5 B;  4S2I A;  1GCE A;  2CC1 A;  3Q7V A;  3VP3 A;  2WGW B;  3W4P A;  4K0X A;  4BD0 A;  4LCM A;  3IHA A;  4BJP A;  1YLY A;  1Q2P A;  4E3N A;  4Q8I A;  1K6S A;  1PZP A;  4K0W A;  1XPB A;  4FCF A;  4Y7P A;  1IKG A;  4JXS A;  5AQ9 A;  1E4D A;  3PBR A;  5GLD A;  4WMC D;  3HUO A;  2WKI A;  3UN7 A;  5CTN A;  3Q07 A;  1K25 A;  4HBT A;  4MEZ A;  3G4P A;  4FSF A;  1ESU A;  3LO7 A;  1K54 C;  2X01 A;  5FQQ A;  4OPZ A;  1LHY A;  5GLA A;  3OZH A;  1N9B A;  4MBK A;  1MWS A;  2FFY A;  4WEL A;  5FA7 A;  2WZX A;  4JF5 A;  3IXB A;  2WUQ A;  5EUA A;  3HLE A;  3ZDJ A;  3HLC A;  3UE1 A;  4EUZ A;  2QZ6 A;  4NK3 A;  4BQM A;  2HDU A;  4EWF A;  1G68 A;  3HLW A;  5KSC A;  3SS4 A;  3G35 A;  2Y2O A;  3GTC A;  4DE0 A;  4GKU A;  2WK0 A;  4WYY A;  1L0D A;  4IVI A;  1SCW A;  1CK3 A;  4MBH A;  2XFS A;  3PBQ A;  4P6B A;  3ZGA B;  4XUZ A;  2H0Y A;  2OLV A;  1K55 A;  4OQG A;  4RYE A;  3NIA A;  3Q1F A;  1AXB A;  1O7E A;  1CI9 A;  2Z2L B;  3Q7V B;  5DTS A;  3UE0 A;  2VGK A;  3UPP A;  3V5M A;  4E3I A;  3C7U A;  5J8X A;  2EXB A;  3WS5 A;  1XX2 A;  4BEN A;  3NC8 A;  3OCN A;  4B4Z A;  1NZO A;  2X02 A;  5A91 A;  5EVI A;  2XR0 A;  2OV5 A;  1M6K A;  4OQ0 A;  2WYX A;  2ZC7 A;  1FR6 A;  3IXH A;  5EVI C;  3E2K A;  4UHU A;  3NY4 A;  3Q81 A;  1BLS A;  4X55 A;  1YLP A;  4E3L A;  4DE1 A;  1XGI A;  1YLJ A;  2HP5 A;  1YMX A;  4LV2 A;  4JKT A;  4DXC A;  1XP4 A;  1FSY A;  5FAT A;  2XD5 A;  1GA9 A;  1CI8 A;  1DJA A;  4OVD A;  3S1Y A;  4QU3 A;  1MBL A;  1RGZ A;  2J9O A;  4OLD A;  5GL9 A;  2H0T A;  1PI4 A;  4P87 A;  3WS2 A;  1BLH A;  2QMI A;  4R0Q A;  2WZZ A;  2G2W A;  1PZO A;  1K56 D;  1Y54 A;  1MWU A;  2XGN A;  3G2Z A;  1YM1 A;  2ZC6 B;  1QMF A;  4KZ5 A;  3HLB A;  4OOL A;  4R4R A;  4OQI A;  4X69 A;  2ZC3 B;  1H8Y A;  2HP9 A;  3VMA A;  1YLZ A;  2Y59 A;  1WE4 A;  3LEZ A;  5HAR A;  2Y2G A;  3G31 A;  3VSL A;  3CJM A;  3FV7 A;  2Y2P A;  3O86 A;  4Z9Q A;  5A93 A;  1G6A A;  1W7F A;  2PBY A;  2R9X A;  3FKW A;  1E25 A;  4KZ3 A;  3VFF A;  1FR1 A;  4JLF A;  5CGS A;  3IH9 A;  3UNW A;  3NCK A;  2IWD A;  5FI2 A;  3IWQ A;  1ESI A;  3UE3 A;  5EOE A;  1PI5 A;  3UDF A;  1C3B A;  3D4F A;  1BLP A;  5AQB A;  3ZG0 A;  4N9L A;  4R4S A;  3ITA A;  3GV9 A;  2RCX A;  3IF6 A;  1M40 A;  3S4X A;  2G2U A;  3FWL A;  1EWZ A;  4ZJ1 A;  4KG5 A;  3P09 A;  3IH8 A;  5CGX A;  3UPO A;  3VP1 A;  4FH2 A;  1WYB A;  3TSG A;  4DE3 A;  2ZQ9 A;  1Q2Q A;  2B5R A;  4PPR A;  5HW3 A;  3VP2 A;  1ES5 A;  4KQR A;  1HD8 A;  4OKP A;  4S2O A;  4LV0 A;  3Q82 A;  3A3F A;  4R1G A;  3CZD A;  4XXR A;  3UY6 A;  4KZ7 A;  3V3R A;  2J8Y A;  1XXM A;  2ZD8 A;  3O87 A;  1ES3 A;  2Y2K A;  2XDM A;  4GOG A;  1E3U D;  1PIO A;  3HRE A;  3UDX A;  4DXB A;  4ZJ2 A;  1JWP A;  1L2S A;  3MXS A;  1GHM A;  4DDY A;  3MFD A;  5CHJ A;  5F1F A;  4OPQ A;  2WAE A;  3MZE A;  3C4O A;  3OPP A;  1MY8 A;  1I2W A;  5A90 A;  1PWG A;  2Y55 A;  1KDW A;  1L0E A;  1ERQ A;  3NBL A;  3NDG A;  4KQO A;  4NET A;  1S0W A;  1SDN A;  3DWZ A;  1O07 A;  4WZ5 C;  3GVB A;  1BUL A;  2XFT A;  2GDN A;  4KZ8 A;  5GHX A;  4DDS A;  4LV3 A;  2OSU A;  5GHY A;  1K57 A;  4KQQ A;  1XA1 A;  3BFC A;  2FFF B;  1ONG A;  2Y91 A;  3VFH A;  1SHV A;  4YIN A;  1K54 A;  1YQS A;  5DF9 A;  3N8S A;  1K57 C;  1N4O A;  4JF4 A;  3BEC A;  5EOO A;  3N8R A;  3PBS A;  2IWB A;  5E43 A;  4FD8 A;  1LI0 A;  5TR7 A;  4GN2 A;  2H5S A;  3G30 A;  1KGF A;  4S2K A;  3ZVT A;  3PBO A;  1ONH A;  4ID4 A;  1JWZ A;  4HES A;  1DJB A;  3DTM A;  4N1X A;  5A92 A;  1QME A;  1IEM A;  3BFE A;  2EX2 A;  5IHV A;  5AQ7 A;  3ZCZ A;  3G2Y A;  4S2M A;  3M6H A;  4LCL A;  3SS3 A;  4XUX A;  2Z2M B;  3Q7Z A;  4E3M A;  1YLT A;  4ZAM A;  2JC7 A;  3TOI A;  2A3U A;  4A5R A;  4KZ4 A;  4IBR A;  3MZD A;  2ZMA A;  5U47 A;  5CRF A;  5HAQ A;  2OLU A;  1HZO A;  3N8L A;  5F1G A;  4GDB A;  5CEC A;  1DJC A;  3MKE A;  1K4E A;  4BL3 A;  5CEB A;  1KGG A;  4KZA A;  3CG5 A;  3N6I A;  3SH9 A;  5CGW A;  2XD1 A;  4UAA A;  1U60 A;  2BG1 A;  4E6W A;  5E2H A;  5EE8 A;  4OPY A;  4GDN A;  1PW1 A;  3EQU A;  1LI9 A;  3PAG A;  4GB7 A;  2EX8 A;  5TGF A;  3HL9 A;  4Y0T A;  3DW0 A;  4S2P A;  5GHZ A;  2EFX A;  4Y0O A;  4Y0U A;  4EV4 A;  3OPR A;  4C75 A;  5CHM A;  3IXD A;  2VGJ A;  2JCH A;  1NZU A;  4GD8 A;  1XGJ A;  4MBF A;  1LL9 A;  3IT9 A;  1CEF A;  1GA0 A;  2Y2I A;  1IKI A;  1ES2 A;  3MXR A;  4P0M A;  3S22 A;  4DE2 A;  5EEC A;  4DRT A;  2Y2Q A;  4JXW A;  1ZC2 A;  3O3V A;  1NRF A;  2XLN A;  2EX9 A;  5CXW A;  2Y2N A;  3WS4 A;  4RX2 A;  5E2G A;  3GQZ A;  1MXO A;  2ZJ9 A;  2EFU A;  4WM9 A;  1TDL A;  3GR2 A;  4FH4 A;  2WAF A;  2XEP A;  3MZF A;  4PM8 A;  2HPB A;  4R23 A;  2HDQ A;  4WMC A;  3BFD A;  4OP5 A;  3ZNT A;  3IXG A;  5GLB A;  5CHU A;  3WRT A;  4GNU A;  2WGV A;  2V1Z A;  3HVF A;  3QNB A;  4ZDX A;  1RP5 A;  2ZQA A;  4EBP A;  2Y4A A;  4WBG A;  2Q9N A;  5EVI B;  3WS0 A;  3C7V A;  2J9P A;  4QHC A;  4QY6 A;  3ZHH A;  5I94 A;  5M18 A;  4E3O A;  4PMA A;  4WEK A;  1IEL A;  4X56 A;  1S6R A;  3SOI A;  1KE3 A;  4K91 A;  4HBU A;  3QHY A;  3ZG9 B;  1PYY A;  3RXW A;  1NYY A;  4PM7 A;  1NJ4 A;  2WAD A;  1HVB A;  1RGY A;  3LCE A;  4ZTK A;  4F94 A;  4IBX A;  1JVJ A;  5HFO A;  4CJN A;  3V50 A;  3W4Q A;  2P9V A;  4GD6 A;  3UO9 A;  3SH8 A;  3HBR A;  3V39 A;  5FAO A;  1XKZ A;  2RL3 A;  1LLB A;  2WGW A;  2PU2 A;  4JF6 A;  1Z6F A;  1JTG A;  4JBF A;  4BLM A;  3G34 A;  2Q9M A;  3BEB A;  4X6T A;  1MWR A;  2UWX A;  3C5A A;  3BFG A;  1GHI A;  2XQZ A;  2E8I A;  3B3X A;  4JPM A;  4JXV A;  2ZQD A;  3W4O A;  4S2N C;  3I7J A;  4D2O A;  1KE4 A;  4B4X A;  4QD4 A;  3QNC A;  4KEN B;  5F82 A;  3ZNY A;  3LY3 A;  3WRZ A;  4WZ5 A;  2ZQ8 A;  1ZG6 A;  4OPR A;  1BTL A;  4LV1 A;  2J7V A;  2HP6 A;  3HUM A;  4M3K A;  1K4F A;  5EVI D;  1ERO A;  2I72 A;  1VQQ A;  2DNS A;  4PM9 A;  4RX3 A;  4OOY A;  1W8Q A;  2Y2J A;  5EVL A;  3MBZ A;  1FOF A;  1PWD A;  4L0L A;  3OCL A;  3E2L A;  3NI9 A;  3GSG A;  3IF6 B;  1FCN A;  3ZVW A;  5HAP A;  4B88 A;  1K56 A;  4ZBE A;  1PWC A;  5AQA A;  1DY6 A;  3V3S A;  2IWC A;  1WYC A;  3MKF A;  2DCF A;  1GHP A;  3HUN A;  2HDR A;  3OPH A;  4EQI A;  3BLM A;  3ISG A;  5KZH A;  5D3O A;  4UA9 A;  3SS5 A;  5FQM A;  1HTZ A;  1I5Q A;  3A3J A;  3BM6 A;  3ZG7 B;  4KG2 A;  4OH0 A;  3FKV A;  4U3T A;  4N1H A;  1L0G A;  5FAQ A;  1MWT A;  5KSH A;  3OC2 A;  3BLS A;  3BYD A;  4C3Q A;  2WGI A;  4U0T A;  2WKH A;  3A3D A;  2WKE A;  3RXX A;  3IWO A;  4OQH A;  5FQJ A;  2A49 A;  1FCM A;  4QB8 A;  4DF6 A;  3AGD A;  1BT5 A;  1CEG A;  4PM5 A;  3PTE A;  5F83 A;  2HDS A;  4UA7 A;  3O88 A;  3UPN A;  4CPK A;  4E6X A;  4OP8 A;  1BLC A;  4EBN A;  1EI5 A;  1KDS A;  3IQA A;  3VP4 A;  3WS1 A;  5DF8 A;  5DTK A;  5E2F A;  5CER A;  3ZFZ A;  1FCO A;  3AGF A;  3BFF A;  5TFQ A;  1E3U A;  1KVM A;  3P98 A;  4MLL A;  1TDG A;  3IHB A;  4N92 A;  2V2F F;  4UA6 A;  1PW8 A;  1K55 C;  4KG6 A;  1FQG A;  5FQI A;  5L2F A;  4N9K A;  1MPL A;  5CTM A;  3C4P A;  1KE0 A;  3M6B A;  1IYQ A;  3HLG A;  2QPN A;  3CMZ A;  4OOM A; 
#chains in the Genus database with same CATH topology
 5M19 A;  3LID A;  4X68 A;  3BRM A;  3LIA A;  1KGE A;  3DTI A;  1GSX A;  4ETZ A;  3UB5 P;  2PU4 A;  1L0F A;  1H0M A;  3LY4 A;  3R7W A;  1H5X A;  3K3C A;  5FDH A;  1PRQ A;  3IWI A;  4UEY A;  2ZLY A;  4NXB A;  4C6Y A;  2X71 A;  5FAP A;  1W8Y A;  4DKI A;  4JXG A;  4LRX C;  4S2L A;  1Y28 A;  4RVA A;  3W8K A;  3B33 A;  4R3J A;  1XA7 A;  3T4Q A;  4OON A;  4WZ4 A;  3FZC A;  3NDE A;  4NXE A;  2ZM0 A;  3ZG8 B;  4GS9 B;  1Z09 A;  2B18 A;  5FAS A;  3IF6 C;  4WEJ A;  4S2J A;  1FSW A;  4EES A;  2V8F A;  1MKI A;  1ZKJ A;  3GRJ A;  5HL1 A;  1TS7 A;  2R9W A;  3N4I A;  2Z6C A;  4I39 A;  3IX4 A;  3UMD A;  3ZG5 A;  1W79 A;  2JE5 A;  4U0X A;  4E3J A;  2XK1 A;  4BD1 A;  5JYP A;  1NYM A;  3FYZ A;  5FSR A;  2P9V B;  1TVF A;  5G18 A;  5GLC A;  1IYS A;  4S2I A;  2CC1 A;  3VP3 A;  2WGW B;  4K0X A;  4BD0 A;  4E3N A;  2L0W A;  1XPB A;  3QP4 A;  3T4K A;  5L07 A;  3MS6 A;  4JXS A;  2W1T A;  3EEH A;  3CHW P;  5CTN A;  3Q07 A;  4HBT A;  3G4P A;  1T19 A;  1LHY A;  1YPR A;  2HV1 A;  3HLE A;  3ZDJ A;  5HZH A;  3T4O A;  4EUZ A;  1G68 A;  3F1N A;  3HLW A;  3SS4 A;  4DE0 A;  2Y2O A;  5HPI A;  1LSW A;  1K55 A;  4RYE A;  3Q1F A;  3CI6 A;  1CI9 A;  2V1A A;  5DTS A;  4E3I A;  2VGK A;  3UPP A;  3V5M A;  3C7U A;  1S4R A;  1S1Z A;  1XX2 A;  2CMN A;  5A91 A;  2XR0 A;  2OV5 A;  3BQ8 A;  3IXH A;  5EVI C;  3E2K A;  3A0R A;  4Y15 A;  3NY4 A;  2HGV A;  2QWS A;  3H82 B;  3QP8 A;  2HP5 A;  1YMX A;  4DXC A;  1LSX A;  4LPZ A;  1XP4 A;  4ZRR A;  2XD5 A;  1CI8 A;  1DJA A;  4OVD A;  4QU3 A;  5J3W A;  1MBL A;  5TBM B;  4JGP A;  2J9O A;  5GL9 A;  2H0T A;  2A24 A;  3WS2 A;  2QMI A;  4R0Q A;  2XGN A;  1MWU A;  1JNU A;  1W63 M;  2ZC6 B;  4OOL A;  2B95 A;  2ZC3 B;  4EEU A;  2ZL1 A;  3G31 A;  2GNX A;  4Y3I A;  2E8J A;  3IX8 A;  3O86 A;  4Z9Q A;  1G6A A;  1W7F A;  2PBY A;  2PYP A;  3VFF A;  3W2Z A;  2IWD A;  5EOE A;  4N9L A;  3ITA A;  4HOI A;  2HJ9 C;  3FWL A;  4LFU A;  3UPO A;  1WYB A;  2ZQ9 A;  1Q2Q A;  2B5R A;  5HW3 A;  3VP2 A;  1ES5 A;  4OKP A;  2PRF A;  1S1Y A;  3A3F A;  2A24 B;  2J80 A;  3CZD A;  4KZ7 A;  2J8Y A;  2ZD8 A;  1OPX A;  2XDM A;  3BWL A;  3UDX A;  1JWP A;  3VE3 A;  3ZYT A;  1L2S A;  5EVE A;  4OPQ A;  2MJ6 A;  2Y55 A;  1KDW A;  1ERQ A;  1O07 A;  3E0Y A;  1BUL A;  5GHX A;  2ACG A;  2OSU A;  1K57 A;  1XA1 A;  2FFF B;  3LEQ A;  1K54 A;  2PBD P;  1VET A;  1N4O A;  3N8R A;  1T1C A;  1TF1 A;  5E43 A;  3G30 A;  4GJ4 A;  3T1S A;  3PBO A;  3FPV A;  4X25 A;  3IS2 A;  3G2Y A;  2Z2M B;  3Q7Z A;  4ZAM A;  2JC7 A;  4FTX A;  5HDD A;  3H7W B;  4KZ4 A;  2YKH A;  1VB6 A;  4UQI S;  4Z1W A;  2ZMA A;  5U47 A;  2WKQ A;  5HAQ A;  3EGD C;  2W3D A;  1DJC A;  1KGG A;  3H9W A;  3CG5 A;  5HDC A;  2XD1 A;  4E6W A;  4NKP A;  4QWO A;  1LI9 A;  4GB7 A;  1PFL A;  5TGF A;  4S2P A;  2EFX A;  4Y0U A;  1AWI A;  4EXO A;  4GD8 A;  1XGJ A;  3IT9 A;  4O0P A;  5DKL A;  4DE2 A;  5AJG A;  4DRT A;  4I3A A;  2Y2Q A;  4JXW A;  2EX9 A;  5CXW A;  4O8G A;  1P9W A;  4HH3 A;  1TDL A;  5AVF A;  3MZF A;  4R23 A;  3ZNT A;  3BFD A;  5GLB A;  5CHU A;  4GNU A;  3QNB A;  1RP5 A;  2Y4A A;  2Q9N A;  3C7V A;  4E3O A;  1IEL A;  2GJ3 A;  2PYR A;  1PYY A;  3R4K A;  2WAD A;  1HVB A;  1RGY A;  1G28 A;  4CJN A;  3V50 A;  4UQI M;  3UO9 A;  2K7S A;  4CLC A;  5FAO A;  1XKZ A;  4JF6 A;  4Y5F A;  4BLM A;  3G34 A;  4Y17 A;  2UWX A;  3C5A A;  1GHI A;  2E8I A;  4JXV A;  4HNB A;  3IBR A;  1KE4 A;  2XA7 S;  4KEN B;  3WRZ A;  5HWW A;  2VKS A;  1BTL A;  1EW0 A;  1K4F A;  5EVI D;  1XJ3 A;  4OOY A;  1W8Q A;  2EWV A;  5EVL A;  4Y13 A;  1NLZ A;  3V67 A;  3NI9 A;  3IF6 B;  4I3I A;  3ZVW A;  2M7U A;  4B88 A;  1K56 A;  2BTF P;  2PDR A;  2IWC A;  2DCF A;  1GHP A;  3HUN A;  2HDR A;  3OPH A;  4EQI A;  3BLM A;  3MQO A;  5D3O A;  1DP9 A;  3SS5 A;  5IS1 A;  1HTZ A;  3A3J A;  3BM6 A;  2H28 A;  4O01 A;  3ZG7 B;  3FKV A;  1MWT A;  4HJ4 A;  3BYD A;  4U0T A;  3DTE A;  3MQ0 A;  4IUK A;  3RXX A;  1DRM A;  4OQH A;  3F1P A;  1CEG A;  4NXG A;  2J3T D;  4OP8 A;  4EBN A;  1FIK A;  1KDS A;  5DFX A;  3VP4 A;  3ZFZ A;  4BBV A;  1DP6 A;  3BFF A;  5TFQ A;  1KVM A;  2XA7 M;  3B47 A;  1TDG A;  5HDS A;  3IHB A;  5EV0 A;  4N92 A;  4UA6 A;  1K55 C;  1VHM A;  4KG6 A;  3LYX A;  2JKR M;  4N9K A;  3C4P A;  2Z6D A;  2PD8 A;  2AVX A;  1OTA A;  4ZJ3 A;  3DWK A;  3OLO A;  2XH9 A;  1YSQ A;  3A0V A;  4KZ9 A;  3F1P B;  3VOZ A;  2ZQC A;  3S7Q A;  4MNR A;  5I5L A;  4X53 A;  5FQ9 A;  1BSG A;  5DTT A;  3B42 A;  5HWT A;  3HLD A;  1ALQ A;  2ZM8 A;  3SH7 A;  3N7W A;  2Y2M A;  2ZM2 A;  5HWV A;  3P01 A;  2KX6 A;  1SKF A;  2R78 A;  3GMW A;  2I9V A;  1TEM A;  4E3K A;  1TS0 A;  3PBT A;  5JYO A;  2LB5 A;  1LL5 A;  4BMW A;  4KZB A;  2DRW A;  4GZB A;  2K31 A;  3T1X A;  1J9M A;  3TRC A;  2ZC4 B;  3M2J A;  1JWV A;  2Y2H A;  1IFQ A;  3A3E A;  1YMS A;  3RH8 B;  2C5W B;  5FI7 A;  1S67 L;  3TG9 A;  3VP0 A;  4EBL A;  4MN6 A;  3Q7V A;  3W4P A;  2JKT I;  3IHA A;  1TS8 A;  2NUT C;  1PZP A;  4MDZ A;  2V0U A;  1IKG A;  1GSW A;  4JGR A;  4CLC E;  1K25 A;  4MEZ A;  1ACF A;  1K54 C;  2X01 A;  2QYB A;  4OPZ A;  4WEL A;  5HPF A;  1MWS A;  2FFY A;  5HSQ A;  2WZX A;  4JF5 A;  3IXB A;  2WUQ A;  4XT2 B;  1SZV A;  3GTC A;  2JN7 A;  4HJ6 A;  4IVI A;  4MBH A;  1T1A A;  3T1R A;  3PBQ A;  4OQG A;  3OOV A;  2GX5 A;  1AXB A;  3Q7V B;  4Q0I A;  1SKO A;  3WS5 A;  4B4Z A;  2X02 A;  1OTI A;  4NG2 A;  1M6K A;  3C30 A;  4MMN A;  2QHK A;  1FR6 A;  4NXF A;  4F3L A;  4X55 A;  3TW8 A;  1YLJ A;  2W3G A;  1GSV A;  1P9R A;  5IU1 A;  3O5Y A;  2QJ5 A;  1FSY A;  3NOT C;  3S1Y A;  4PKY G;  3KO6 A;  1PZO A;  2WZZ A;  1LT0 A;  1YM1 A;  4KZ5 A;  3HLB A;  3BJN A;  4DJ3 A;  4OQI A;  3VMA A;  2HP9 A;  1YLZ A;  2V0W A;  2Y59 A;  3LEZ A;  1SKO B;  3CJM A;  5A93 A;  3FKW A;  1G5U A;  2R9X A;  1E25 A;  3F1O A;  1FR1 A;  2WKP A;  5CGS A;  3IH9 A;  3NCK A;  2M1C A;  3IWQ A;  5FI2 A;  1ESI A;  3UB8 A;  1PI5 A;  1C3B A;  5FL3 A;  4F3L B;  4KG5 A;  3KX0 X;  4FH2 A;  4DE3 A;  4EUV A;  3R7W B;  4KQR A;  4S2O A;  1D06 A;  1BYW A;  3Q82 A;  4R1G A;  4CLC C;  2VEA A;  1XXM A;  2ZOI A;  3TJZ C;  4DDY A;  5F1F A;  3VE4 A;  3OPP A;  1MY8 A;  4NET A;  3NDG A;  4LGW A;  3MXQ A;  3PR6 A;  4KQQ A;  1XJ4 A;  3BFC A;  1ONG A;  4YIN A;  3N8S A;  3BEC A;  3LIB A;  4FD8 A;  3LI8 A;  4GN2 A;  1ONH A;  4HES A;  4N1X A;  5A92 A;  3BFE A;  2PHY A;  2EX2 A;  5IHV A;  3SS3 A;  4LCL A;  1YLT A;  3MFX A;  2J3W A;  3LR4 A;  4X1L A;  3CAX A;  3MZD A;  3QP1 A;  2L4R A;  4BL3 A;  4LLO B;  3SH9 A;  2HJE A;  5E2H A;  2W1T B;  5EE8 A;  4M4X A;  3PAG A;  3HL9 A;  3KYZ A;  5DKK A;  5CHM A;  4P6Z S;  2VGJ A;  3BY9 A;  4MBF A;  1LL9 A;  2O0Y A;  1OJG A;  4HP9 A;  5EEC A;  3F1N B;  2XLN A;  4X1M A;  2EFU A;  3GR2 A;  2WAF A;  2XEP A;  4PM8 A;  2HPB A;  2O9A A;  3UB9 A;  3HVF A;  2LB9 A;  4ZDX A;  3WS0 A;  4QY6 A;  2J9P A;  3MQQ A;  4PMA A;  4X56 A;  1S6R A;  2O9C A;  4K91 A;  2GZA A;  4HBU A;  3QHY A;  2DMW A;  2KOI A;  1NYY A;  4PM7 A;  3LCE A;  1JVJ A;  4YOF A;  4GD6 A;  3HBR A;  3PXP A;  2RL3 A;  1LLB A;  3EWK A;  1Z6F A;  1NLY A;  1MKM A;  5K5B A;  2XQZ A;  4QD4 A;  3FC7 A;  3QNC A;  2ZL1 B;  3E4O A;  3NOP C;  2VK3 A;  4LV1 A;  2J7V A;  1WA9 A;  1D1J A;  4P6Z M;  1ERO A;  2I72 A;  2DNS A;  3EGX C;  2ZMV A;  4HI4 A;  1CJF A;  4RX3 A;  3DBA A;  2Y2J A;  1FOF A;  4L0L A;  4MN7 A;  2INW A;  2W3E A;  1WYC A;  2W27 A;  4GHI A;  1UGU A;  1XJ2 A;  1W63 Q;  2VGL S;  5KZH A;  4BBU A;  3C38 A;  1LSV A;  4UA9 A;  4L9G A;  2VZW A;  4OH0 A;  4N1H A;  2NUP C;  5FAQ A;  3OC2 A;  4GLQ A;  2WKH A;  3A3D A;  3SW1 A;  3AGD A;  4PM5 A;  3PTE A;  4UA7 A;  3O88 A;  4CPK A;  1BLC A;  1VET B;  1EI5 A;  3IQA A;  5DTK A;  3DAV A;  2V2F F;  1PW8 A;  3IX3 A;  5FQI A;  3IS2 B;  1KE0 A;  1P97 A;  3ULF A;  4OOM A;  2ZMF A;  3AGE A;  5KMW A;  1X0O A;  1OME A;  3C2W A;  5EM0 A;  3SZT A;  3CIT A;  3LR3 A;  1ODV A;  3CLO A;  3MF0 A;  2XF3 A;  2EXA A;  1IYP A;  2VGL M;  3JYI A;  4HHD A;  2OOL A;  3S7O A;  3ITB A;  1BZA A;  1RCJ A;  2V8C A;  3UME A;  4RA7 A;  4NEE D;  1A0K A;  5M1A A;  5E2E A;  3G32 A;  2C6W B;  2EWW A;  2H10 A;  1W5D A;  3K3D A;  4S2N A;  4PM6 A;  2Y2L A;  4HIA A;  2EX6 A;  4YNR A;  3S7P A;  4D60 A;  3PAE A;  2JBF A;  1LL8 A;  1JTD A;  1I2S A;  3OPL A;  5DFY A;  2V20 A;  3WWX A;  1NY0 A;  4JGO A;  1ZG4 A;  4HEF A;  4R3B A;  4LEN A;  4IED A;  1NXY A;  5FEF A;  2P08 A;  2ZQ7 A;  3GEC A;  4IHQ A;  4H8R A;  4OLG A;  3A3I A;  4CLC B;  3LR0 A;  4YWZ A;  4LCM A;  4BJP A;  3VOL A;  1YLY A;  4Q8I A;  1K6S A;  4K0W A;  5L8M A;  1MZU A;  2FH5 A;  4FCF A;  3PBR A;  5GLD A;  4WMC D;  3HUO A;  3UN7 A;  3QP6 A;  5FQQ A;  5L09 A;  2VJW A;  5FA7 A;  5EUA A;  3QP2 A;  3HLC A;  5F69 A;  2QZ6 A;  4NK3 A;  2HDU A;  4WLA A;  2KLI A;  5KSC A;  3K2N A;  4WUJ A;  4H6J A;  4P6B A;  2H0Y A;  3NIA A;  1O7E A;  2Z2L B;  2EXB A;  5AVE A;  3NC8 A;  3RTY A;  5EVI A;  1HLU P;  1TS6 A;  1YKD A;  4OQ0 A;  2WYX A;  5G4Z A;  1MC0 A;  4UHU A;  3JPU A;  4DE1 A;  4E3L A;  2Y8H A;  2G7U A;  1XGI A;  3T50 A;  4JKT A;  5FAT A;  4L9E A;  3CUE A;  1RGZ A;  1YSP A;  4P87 A;  4ARZ A;  1BLH A;  2G2W A;  3G2Z A;  5FEG A;  1QMF A;  1NRJ A;  4R4R A;  4X69 A;  1G6O A;  5L10 A;  2VV8 A;  2IA2 A;  1T18 A;  3VSL A;  3FV7 A;  3U2A A;  3UNW A;  3HCY A;  4EET B;  3UDF A;  5AQB A;  3ZG0 A;  3GV9 A;  1M40 A;  3S4X A;  2G2U A;  3KSH A;  3P09 A;  3IH8 A;  4E04 A;  3VP1 A;  4R38 A;  2VLG A;  4LV0 A;  3T4J A;  1S66 L;  3NUL A;  1E3U D;  1PIO A;  3HRE A;  5TJJ A;  4DXB A;  3MXS A;  1GHM A;  3MFD A;  3LFV A;  3C4O A;  3VV4 A;  5A90 A;  1PWG A;  3LR5 A;  3NBL A;  1S0W A;  1SDN A;  3DWZ A;  4KZ8 A;  3JVV A;  5GHY A;  3D9Y A;  2Y91 A;  1SHV A;  1K57 C;  2IWB A;  1F5M A;  2QJ7 A;  5TR7 A;  1UWP X;  1KGF A;  3ZVT A;  4ID4 A;  3DTM A;  4R6L A;  1QME A;  3ZCZ A;  4S2M A;  4XUX A;  1F98 A;  2BAS A;  4DN0 A;  3TOI A;  1ZTU A;  4ME4 A;  5EM1 A;  3S7N A;  1XJ6 A;  2XRO A;  5CX7 A;  2OLU A;  4MN5 A;  3N8L A;  5F1G A;  4GDB A;  3MKE A;  5HL6 A;  2JKR I;  5CEB A;  5CGW A;  4UAA A;  4EER A;  4GDN A;  1PW1 A;  2O99 A;  1S4S A;  2EX8 A;  3JVU A;  4Y0T A;  3IBJ A;  3OPR A;  2JCH A;  1CEF A;  4KUO A;  2Y2I A;  1IKI A;  3RFB A;  2WKR A;  1ZC2 A;  3O3V A;  1OTD A;  2Y2N A;  3WS4 A;  4RX2 A;  5E2G A;  1MXO A;  4WM9 A;  4FH4 A;  4AFI A;  4GS9 A;  4OP5 A;  2WGV A;  2V1Z A;  1YAX A;  1XFN A;  2JKF A;  1V9Z A;  4EBP A;  2PR6 A;  3T4L A;  4QHC A;  2ZOH A;  3P7N A;  3ZHH A;  4WEK A;  1TD5 A;  3ZG9 B;  4DMZ A;  4HP4 A;  3EOI A;  1NJ4 A;  4IBX A;  2P9V A;  5DJU A;  1T1B A;  3BQA A;  2JKG A;  2PU2 A;  2WGW A;  1JTG A;  3C8C A;  4JBF A;  1Y4O A;  2Q9M A;  4X6T A;  1K0K A;  3BFG A;  3B3X A;  4S2N C;  1H8M A;  3KSG A;  4B4X A;  4WZ5 A;  2ZQ8 A;  4OPR A;  4PKY A;  2HP6 A;  3HUM A;  3T4T A;  4M3K A;  2L1M A;  3F1O B;  3MBZ A;  1PWD A;  3QP5 A;  3GSG A;  1FCN A;  1P0Z A;  3HJI A;  5HAP A;  5J7E A;  4ETX A;  3V3S A;  1N9O A;  2EA9 A;  3MKF A;  3BW6 A;  3ISG A;  3LI9 A;  5FQM A;  4KG2 A;  1FIL A;  4PAU A;  1L0G A;  4KQD A;  3H82 A;  5G4Y A;  4C3Q A;  2WGI A;  3MR0 A;  1J3W A;  5FQJ A;  2YKF A;  5F83 A;  5TBM A;  4E6X A;  2XRN A;  3WS1 A;  5DF8 A;  4R3A A;  5E2F A;  1FCO A;  3AGF A;  3FPW A;  5MC7 A;  2W3H A;  4GCZ A;  2O9B A;  3P98 A;  1D7E A;  4MCW A;  3LGO A;  3LIE A;  1FQG A;  5L2F A;  1MPL A;  2W0N A;  3M6B A;  3HLG A;  2QPN A;  1OTB A;  3T12 B;  1K38 A;  4KZ6 A;  3RJU A;  2PAV P;  3IF5 A;  5F68 A;  5DF7 A;  4I5S A;  4BL2 A;  2QKP A;  4K08 A;  4EEP A;  3TE8 A;  3VSK A;  4FOF A;  1K6R A;  4IUH A;  2BLS A;  4CQH A;  1BUE A;  3CUE C;  3HJK A;  3EEA A;  3VOY A;  1KVL A;  5BOH A;  5EPH A;  3EQV A;  1H8Z A;  5CED A;  4IVK A;  1CF0 A;  1L3L A;  1SDE A;  5FQK A;  1H3Q A;  5HX9 A;  2OWJ A;  1IYO A;  2OAQ 1;  4RQ9 A;  5FI6 A;  3KSF A;  2PD7 A;  1YT4 A;  4LRZ E;  4B93 A;  4O7D A;  1ERM A;  4YFM A;  1VM1 A;  1N9L A;  4P85 A;  4QJG A;  2J3T C;  3UDI A;  2KDK A;  1YLW A;  2Y79 A;  3GDI A;  3HLF A;  4HY8 A;  5HAI A;  2P74 A;  5HD5 A;  4QY5 A;  5DVA A;  3PBN A;  3M2K A;  3NEC A;  3LIC A;  4EQ1 A;  3H7W A;  4JGQ A;  1ES4 A;  2ZC5 B;  4EW7 A;  1GCE A;  4HQA A;  1DP8 A;  3MMH A;  1Q2P A;  4Y7P A;  2VV6 A;  5AQ9 A;  1E4D A;  2HF6 A;  4WN5 A;  1N9N A;  2WKI A;  4FSF A;  1ESU A;  3LO7 A;  4BBT A;  5GLA A;  3OZH A;  4HJ3 A;  1N9B A;  4MBK A;  4ESP A;  3UE1 A;  5FDS A;  4BQM A;  4EWF A;  3G35 A;  4GKU A;  2WK0 A;  4WYY A;  1L0D A;  5HD3 A;  1SCW A;  1CK3 A;  4WL9 A;  2XFS A;  4CLC D;  3ZGA B;  4XUZ A;  2OLV A;  4GHI B;  4HH2 A;  3UE0 A;  5EFW A;  5J8X A;  2UV0 E;  1V9Y A;  4BEN A;  5LBR A;  3OCN A;  4PHT A;  1NZO A;  2FZ0 A;  2ZC7 A;  2W3F A;  3Q81 A;  1BLS A;  3BY8 A;  1YLP A;  4LV2 A;  5F6A A;  5J4E A;  3KSI A;  1GA9 A;  3UB7 A;  2OAP 1;  4OLD A;  1PI4 A;  3E4P A;  3LIF A;  1Y54 A;  1K56 D;  2VA0 A;  3E98 A;  1H8Y A;  3T1Q B;  1WE4 A;  1XFQ A;  5HAR A;  2Y2G A;  3PHY A;  1OT6 A;  2Y2P A;  5DJT A;  4KZ3 A;  4JLF A;  3UE3 A;  3D4F A;  1BLP A;  5F5Y A;  1VEU A;  4R4S A;  3UE6 A;  2RCX A;  3IF6 A;  1EWZ A;  4ZJ1 A;  5CGX A;  2D01 A;  3TSG A;  3KYQ A;  4PPR A;  3L9K A;  1HD8 A;  3CPT A;  4XXR A;  3UY6 A;  3V3R A;  3O87 A;  1ES3 A;  2Y2K A;  3UB6 A;  4GOG A;  4G3W A;  3MJQ A;  4ZJ2 A;  1OT9 A;  5CHJ A;  2WAE A;  3MZE A;  3MSH A;  2P04 A;  1I2W A;  1OTE A;  1L0E A;  4KQO A;  4WZ5 C;  3DTK A;  3GVB A;  2XFT A;  2GDN A;  4DDS A;  4LV3 A;  3D3O A;  5A8B A;  3VFH A;  1VEU B;  1YQS A;  5DF9 A;  4IJG A;  3D72 A;  3ICY A;  4JF4 A;  5EOO A;  4Y2F A;  3PBS A;  1IOU A;  3E4Q A;  1LI0 A;  2H5S A;  2HZ5 A;  4S2K A;  1JWZ A;  1DJB A;  2JKT M;  3CPT B;  4BWI A;  5IT5 A;  1CQA A;  1IEM A;  2P7J A;  3LUQ A;  1OJ5 A;  5AQ7 A;  3M6H A;  4E3M A;  4GW9 A;  3CWF A;  2A3U A;  4WF0 A;  4LRY C;  4A5R A;  4IBR A;  1ZHH B;  4G3V A;  5CRF A;  2PT7 A;  1HZO A;  5CEC A;  1K4E A;  4KZA A;  3N6I A;  1U60 A;  2BG1 A;  2W1R A;  4OPY A;  3EQU A;  3DW0 A;  3A0S A;  5GHZ A;  2OWH A;  1UWN X;  4Y0O A;  4EV4 A;  4C75 A;  3IXD A;  1NZU A;  2VV7 A;  1GA0 A;  3NJA A;  4P0M A;  1ES2 A;  3MXR A;  3S22 A;  3T4S A;  2XSS A;  1KOU A;  2VX8 A;  1NRF A;  4DJ2 A;  3GQZ A;  4H6J B;  2ZJ9 A;  1F2K A;  4G3K A;  2HDQ A;  4WMC A;  3IXG A;  3WRT A;  2ZQA A;  4WBG A;  5EVI B;  5I94 A;  5M18 A;  3SOI A;  1KE3 A;  3RXW A;  4F94 A;  4B9O A;  4ZTK A;  4L9F A;  5HFO A;  3W4Q A;  3SH8 A;  3V39 A;  2M7V A;  2V9A A;  2D02 A;  3FG8 A;  5C5K A;  4QPR A;  4ARZ B;  3BEB A;  3G6O A;  1MWR A;  2ZBB A;  1STZ A;  4JPM A;  2ZQD A;  3W4O A;  3I7J A;  4D2O A;  4Q0J A;  2B02 A;  5F82 A;  3LY3 A;  3ZNY A;  1ZG6 A;  4Q0H A;  1VQQ A;  3KYE A;  2JHE A;  4I38 A;  1PNE A;  3L7H A;  3NOU C;  4II7 A;  4PM9 A;  4XT2 A;  2A2L A;  3OCL A;  3E2L A;  1NWZ A;  4ZBE A;  1PWC A;  5AQA A;  2V1B A;  1DY6 A;  4FUW A;  4I3J A;  5KIZ A;  2Q0O A;  1I5Q A;  4U3T A;  3U4L P;  5KSH A;  3BLS A;  2K2N A;  3PYP A;  2WKE A;  3OBF A;  3IWO A;  2A49 A;  1FCM A;  4QB8 A;  4DF6 A;  1BT5 A;  2HDS A;  3UPN A;  3ZQ5 A;  5CER A;  3NHQ A;  1E3U A;  4MLL A;  4EU0 A;  4KUK A;  5CTM A;  1F9I A;  1IYQ A;  3CMZ A;  4R70 A;  2PR5 A; 
#chains in the Genus database with same CATH homology
 1K38 A;  5M19 A;  4KZ6 A;  3AGE A;  4X68 A;  3BRM A;  5KMW A;  1KGE A;  1OME A;  3RJU A;  4ZJ3 A;  3IF5 A;  3DWK A;  2PU4 A;  1L0F A;  5DF7 A;  2XH9 A;  4KZ9 A;  4BL2 A;  3VOZ A;  2ZQC A;  3LY4 A;  1H5X A;  2XF3 A;  2EXA A;  3VSK A;  1IYP A;  1K6R A;  4MNR A;  3JYI A;  5FDH A;  2BLS A;  3ITB A;  4X53 A;  1BZA A;  3IWI A;  1BUE A;  2ZLY A;  5FQ9 A;  3VOY A;  1BSG A;  1KVL A;  5BOH A;  5DTT A;  5EPH A;  4C6Y A;  2X71 A;  3EQV A;  5FAP A;  3HLD A;  1ALQ A;  1H8Z A;  1W8Y A;  2ZM8 A;  4DKI A;  1RCJ A;  5CED A;  4IVK A;  3SH7 A;  4RA7 A;  3N7W A;  4JXG A;  2Y2M A;  2ZM2 A;  4S2L A;  1SDE A;  5FQK A;  5HX9 A;  1IYO A;  4RVA A;  3W8K A;  5FI6 A;  5M1A A;  5E2E A;  1SKF A;  3G32 A;  2C6W B;  3GMW A;  1YT4 A;  4R3J A;  2H10 A;  1TEM A;  1W5D A;  1XA7 A;  4O7D A;  4S2N A;  4E3K A;  4PM6 A;  1ERM A;  4YFM A;  2Y2L A;  2EX6 A;  4OON A;  3PBT A;  4WZ4 A;  3PAE A;  5JYO A;  2JBF A;  3FZC A;  3NDE A;  1LL5 A;  1VM1 A;  4KZB A;  2ZM0 A;  4P85 A;  4QJG A;  3ZG8 B;  1JTD A;  2DRW A;  1I2S A;  4GZB A;  5FAS A;  3IF6 C;  3OPL A;  4S2J A;  4WEJ A;  1FSW A;  2V20 A;  3UDI A;  3WWX A;  1J9M A;  1YLW A;  1MKI A;  1NY0 A;  1ZKJ A;  2ZC4 B;  3GRJ A;  3HLF A;  3M2J A;  5HAI A;  1JWV A;  2P74 A;  5HL1 A;  1ZG4 A;  4HEF A;  4QY5 A;  2Y2H A;  4R3B A;  4LEN A;  5DVA A;  2R9W A;  3N4I A;  1NXY A;  3PBN A;  4IED A;  3ZG5 A;  2ZQ7 A;  3M2K A;  3A3E A;  1W79 A;  1YMS A;  4H8R A;  2JE5 A;  2C5W B;  4U0X A;  5FI7 A;  4E3J A;  2XK1 A;  3TG9 A;  4BD1 A;  3VP0 A;  5JYP A;  1NYM A;  3FYZ A;  5FSR A;  4OLG A;  4EBL A;  2P9V B;  1ES4 A;  1TVF A;  5G18 A;  5GLC A;  3A3I A;  1IYS A;  2ZC5 B;  4S2I A;  1GCE A;  2CC1 A;  3Q7V A;  3VP3 A;  2WGW B;  3W4P A;  4K0X A;  4BD0 A;  4LCM A;  3IHA A;  4BJP A;  1YLY A;  1Q2P A;  4E3N A;  4Q8I A;  1K6S A;  1PZP A;  4K0W A;  1XPB A;  4FCF A;  4Y7P A;  1IKG A;  4JXS A;  5AQ9 A;  1E4D A;  3PBR A;  5GLD A;  4WMC D;  3HUO A;  2WKI A;  3UN7 A;  5CTN A;  3Q07 A;  1K25 A;  4HBT A;  4MEZ A;  3G4P A;  4FSF A;  1ESU A;  3LO7 A;  1K54 C;  2X01 A;  5FQQ A;  4OPZ A;  1LHY A;  5GLA A;  3OZH A;  1N9B A;  4MBK A;  1MWS A;  2FFY A;  4WEL A;  5FA7 A;  2WZX A;  4JF5 A;  3IXB A;  2WUQ A;  5EUA A;  3HLE A;  3ZDJ A;  3HLC A;  3UE1 A;  4EUZ A;  2QZ6 A;  4NK3 A;  4BQM A;  2HDU A;  4EWF A;  1G68 A;  3HLW A;  5KSC A;  3SS4 A;  3G35 A;  2Y2O A;  3GTC A;  4DE0 A;  4GKU A;  2WK0 A;  4WYY A;  1L0D A;  4IVI A;  1SCW A;  1CK3 A;  4MBH A;  2XFS A;  3PBQ A;  4P6B A;  3ZGA B;  4XUZ A;  2H0Y A;  2OLV A;  1K55 A;  4OQG A;  4RYE A;  3NIA A;  3Q1F A;  1AXB A;  1O7E A;  1CI9 A;  2Z2L B;  3Q7V B;  5DTS A;  3UE0 A;  2VGK A;  3UPP A;  3V5M A;  4E3I A;  3C7U A;  5J8X A;  2EXB A;  3WS5 A;  1XX2 A;  4BEN A;  3NC8 A;  3OCN A;  4B4Z A;  1NZO A;  2X02 A;  5A91 A;  5EVI A;  2XR0 A;  2OV5 A;  1M6K A;  4OQ0 A;  2WYX A;  2ZC7 A;  1FR6 A;  3IXH A;  5EVI C;  3E2K A;  4UHU A;  3NY4 A;  3Q81 A;  1BLS A;  4X55 A;  1YLP A;  4E3L A;  4DE1 A;  1XGI A;  1YLJ A;  2HP5 A;  1YMX A;  4LV2 A;  4JKT A;  4DXC A;  1XP4 A;  1FSY A;  5FAT A;  2XD5 A;  1GA9 A;  1CI8 A;  1DJA A;  4OVD A;  3S1Y A;  4QU3 A;  1MBL A;  1RGZ A;  2J9O A;  4OLD A;  5GL9 A;  2H0T A;  1PI4 A;  4P87 A;  3WS2 A;  1BLH A;  2QMI A;  4R0Q A;  2WZZ A;  2G2W A;  1PZO A;  1K56 D;  1Y54 A;  1MWU A;  2XGN A;  3G2Z A;  1YM1 A;  2ZC6 B;  1QMF A;  4KZ5 A;  3HLB A;  4OOL A;  4R4R A;  4OQI A;  4X69 A;  2ZC3 B;  1H8Y A;  2HP9 A;  3VMA A;  1YLZ A;  2Y59 A;  1WE4 A;  3LEZ A;  5HAR A;  2Y2G A;  3G31 A;  3VSL A;  3CJM A;  3FV7 A;  2Y2P A;  3O86 A;  4Z9Q A;  5A93 A;  1G6A A;  1W7F A;  2PBY A;  2R9X A;  3FKW A;  1E25 A;  4KZ3 A;  3VFF A;  1FR1 A;  4JLF A;  5CGS A;  3IH9 A;  3UNW A;  3NCK A;  2IWD A;  5FI2 A;  3IWQ A;  1ESI A;  3UE3 A;  5EOE A;  1PI5 A;  3UDF A;  1C3B A;  3D4F A;  1BLP A;  5AQB A;  3ZG0 A;  4N9L A;  4R4S A;  3ITA A;  3GV9 A;  2RCX A;  3IF6 A;  1M40 A;  3S4X A;  2G2U A;  3FWL A;  1EWZ A;  4ZJ1 A;  4KG5 A;  3P09 A;  3IH8 A;  5CGX A;  3UPO A;  3VP1 A;  4FH2 A;  1WYB A;  3TSG A;  4DE3 A;  2ZQ9 A;  1Q2Q A;  2B5R A;  4PPR A;  5HW3 A;  3VP2 A;  1ES5 A;  4KQR A;  1HD8 A;  4OKP A;  4S2O A;  4LV0 A;  3Q82 A;  3A3F A;  4R1G A;  3CZD A;  4XXR A;  3UY6 A;  4KZ7 A;  3V3R A;  2J8Y A;  1XXM A;  2ZD8 A;  3O87 A;  1ES3 A;  2Y2K A;  2XDM A;  4GOG A;  1E3U D;  1PIO A;  3HRE A;  3UDX A;  4DXB A;  4ZJ2 A;  1JWP A;  1L2S A;  3MXS A;  1GHM A;  4DDY A;  3MFD A;  5CHJ A;  5F1F A;  4OPQ A;  2WAE A;  3MZE A;  3C4O A;  3OPP A;  1MY8 A;  1I2W A;  5A90 A;  1PWG A;  2Y55 A;  1KDW A;  1L0E A;  1ERQ A;  3NBL A;  3NDG A;  4KQO A;  4NET A;  1S0W A;  1SDN A;  3DWZ A;  1O07 A;  4WZ5 C;  3GVB A;  1BUL A;  2XFT A;  2GDN A;  4KZ8 A;  5GHX A;  4DDS A;  4LV3 A;  2OSU A;  5GHY A;  1K57 A;  4KQQ A;  1XA1 A;  3BFC A;  2FFF B;  1ONG A;  2Y91 A;  3VFH A;  1SHV A;  4YIN A;  1K54 A;  1YQS A;  5DF9 A;  3N8S A;  1K57 C;  1N4O A;  4JF4 A;  3BEC A;  5EOO A;  3N8R A;  3PBS A;  2IWB A;  5E43 A;  4FD8 A;  1LI0 A;  5TR7 A;  4GN2 A;  2H5S A;  3G30 A;  1KGF A;  4S2K A;  3ZVT A;  3PBO A;  1ONH A;  4ID4 A;  1JWZ A;  4HES A;  1DJB A;  3DTM A;  4N1X A;  5A92 A;  1QME A;  1IEM A;  3BFE A;  2EX2 A;  5IHV A;  5AQ7 A;  3ZCZ A;  3G2Y A;  4S2M A;  3M6H A;  4LCL A;  3SS3 A;  4XUX A;  2Z2M B;  3Q7Z A;  4E3M A;  1YLT A;  4ZAM A;  2JC7 A;  3TOI A;  2A3U A;  4A5R A;  4KZ4 A;  4IBR A;  3MZD A;  2ZMA A;  5U47 A;  5CRF A;  5HAQ A;  2OLU A;  1HZO A;  3N8L A;  5F1G A;  4GDB A;  5CEC A;  1DJC A;  3MKE A;  1K4E A;  4BL3 A;  5CEB A;  1KGG A;  4KZA A;  3CG5 A;  3N6I A;  3SH9 A;  5CGW A;  2XD1 A;  4UAA A;  1U60 A;  2BG1 A;  4E6W A;  5E2H A;  5EE8 A;  4OPY A;  4GDN A;  1PW1 A;  3EQU A;  1LI9 A;  3PAG A;  4GB7 A;  2EX8 A;  5TGF A;  3HL9 A;  4Y0T A;  3DW0 A;  4S2P A;  5GHZ A;  2EFX A;  4Y0O A;  4Y0U A;  4EV4 A;  3OPR A;  4C75 A;  5CHM A;  3IXD A;  2VGJ A;  2JCH A;  1NZU A;  4GD8 A;  1XGJ A;  4MBF A;  1LL9 A;  3IT9 A;  1CEF A;  1GA0 A;  2Y2I A;  1IKI A;  1ES2 A;  3MXR A;  4P0M A;  3S22 A;  4DE2 A;  5EEC A;  4DRT A;  2Y2Q A;  4JXW A;  1ZC2 A;  3O3V A;  1NRF A;  2XLN A;  2EX9 A;  5CXW A;  2Y2N A;  3WS4 A;  4RX2 A;  5E2G A;  3GQZ A;  1MXO A;  2ZJ9 A;  2EFU A;  4WM9 A;  1TDL A;  3GR2 A;  4FH4 A;  2WAF A;  2XEP A;  3MZF A;  4PM8 A;  2HPB A;  4R23 A;  2HDQ A;  4WMC A;  3BFD A;  4OP5 A;  3ZNT A;  3IXG A;  5GLB A;  5CHU A;  3WRT A;  4GNU A;  2WGV A;  2V1Z A;  3HVF A;  3QNB A;  4ZDX A;  1RP5 A;  2ZQA A;  4EBP A;  2Y4A A;  4WBG A;  2Q9N A;  5EVI B;  3WS0 A;  3C7V A;  2J9P A;  4QHC A;  4QY6 A;  3ZHH A;  5I94 A;  5M18 A;  4E3O A;  4PMA A;  4WEK A;  1IEL A;  4X56 A;  1S6R A;  3SOI A;  1KE3 A;  4K91 A;  4HBU A;  3QHY A;  3ZG9 B;  1PYY A;  3RXW A;  1NYY A;  4PM7 A;  1NJ4 A;  2WAD A;  1HVB A;  1RGY A;  3LCE A;  4ZTK A;  4F94 A;  4IBX A;  1JVJ A;  5HFO A;  4CJN A;  3V50 A;  3W4Q A;  2P9V A;  4GD6 A;  3UO9 A;  3SH8 A;  3HBR A;  3V39 A;  5FAO A;  1XKZ A;  2RL3 A;  1LLB A;  2WGW A;  2PU2 A;  4JF6 A;  1Z6F A;  1JTG A;  4JBF A;  4BLM A;  3G34 A;  2Q9M A;  3BEB A;  4X6T A;  1MWR A;  2UWX A;  3C5A A;  3BFG A;  1GHI A;  2XQZ A;  2E8I A;  3B3X A;  4JPM A;  4JXV A;  2ZQD A;  3W4O A;  4S2N C;  3I7J A;  4D2O A;  1KE4 A;  4B4X A;  4QD4 A;  3QNC A;  4KEN B;  5F82 A;  3ZNY A;  3LY3 A;  3WRZ A;  4WZ5 A;  2ZQ8 A;  1ZG6 A;  4OPR A;  1BTL A;  4LV1 A;  2J7V A;  2HP6 A;  3HUM A;  4M3K A;  1K4F A;  5EVI D;  1ERO A;  2I72 A;  1VQQ A;  2DNS A;  4PM9 A;  4RX3 A;  4OOY A;  1W8Q A;  2Y2J A;  5EVL A;  3MBZ A;  1FOF A;  1PWD A;  4L0L A;  3OCL A;  3E2L A;  3NI9 A;  3GSG A;  3IF6 B;  1FCN A;  3ZVW A;  5HAP A;  4B88 A;  1K56 A;  4ZBE A;  1PWC A;  5AQA A;  1DY6 A;  3V3S A;  2IWC A;  1WYC A;  3MKF A;  2DCF A;  1GHP A;  3HUN A;  2HDR A;  3OPH A;  4EQI A;  3BLM A;  3ISG A;  5KZH A;  5D3O A;  4UA9 A;  3SS5 A;  5FQM A;  1HTZ A;  1I5Q A;  3A3J A;  3BM6 A;  3ZG7 B;  4KG2 A;  4OH0 A;  3FKV A;  4U3T A;  4N1H A;  1L0G A;  5FAQ A;  1MWT A;  5KSH A;  3OC2 A;  3BLS A;  3BYD A;  4C3Q A;  2WGI A;  4U0T A;  2WKH A;  3A3D A;  2WKE A;  3RXX A;  3IWO A;  4OQH A;  5FQJ A;  2A49 A;  1FCM A;  4QB8 A;  4DF6 A;  3AGD A;  1BT5 A;  1CEG A;  4PM5 A;  3PTE A;  5F83 A;  2HDS A;  4UA7 A;  3O88 A;  3UPN A;  4CPK A;  4E6X A;  4OP8 A;  1BLC A;  4EBN A;  1EI5 A;  1KDS A;  3IQA A;  3VP4 A;  3WS1 A;  5DF8 A;  5DTK A;  5E2F A;  5CER A;  3ZFZ A;  1FCO A;  3AGF A;  3BFF A;  5TFQ A;  1E3U A;  1KVM A;  3P98 A;  4MLL A;  1TDG A;  3IHB A;  4N92 A;  2V2F F;  4UA6 A;  1PW8 A;  1K55 C;  4KG6 A;  1FQG A;  5FQI A;  5L2F A;  4N9K A;  1MPL A;  5CTM A;  3C4P A;  1KE0 A;  3M6B A;  1IYQ A;  3HLG A;  2QPN A;  3CMZ A;  4OOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...