1Z09A

Solution structure of km23
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynein light chain 2A, cytoplasmic
publication title Structure and Dynamics of the Homodimeric Dynein Light Chain km23.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 15
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1z09A00
3CHWP 1J3WA 3NECA 4D60A 1FILA 5FEGA 1SZVA 2V8CA 2PAVP 1VEUB 1G5UA 1VEUA 3KYEA 2JKGA 1SKOB 2ZL1B 3LEQA 2ZL1A 1Z09A 4X1LA 5EM1A 5FDSA 5EVEA 3NULA 1FIKA 1K0KA 1VETA 3MS6A 3LGOA 3L9KA 2E8JA 1SKOA 3D9YA 3T1SA 2VK3A 4X1MA 1PNEA 2PRFA 4ESPA 1PFLA 3T1XA 4FTXA 4QWOA 1D1JA 1CF0A 3CPTB 3CPTA 4X25A 3U4LP 3T1RA 2B95A 1HLUP 1AWIA 2HZ5A 2ACGA 5EV0A 3MSHA 2V8FA 1YPRA 4FUWA 5FEFA 2BTFP 5EM0A 3L7HA 3DAVA 1CJFA 1CQAA 1PRQA 3UB5P 2JKFA 1ACFA 1Y4OA 2PBDP 3T12B 3T1QB 1F2KA 1A0KA 1VETB
chains in the Genus database with same CATH superfamily
2HDSA 3V5MA 1N9NA 5HDSA 2XF3A 2O0YA 1GSWA 4R70A 2PAVP 1BZAA 4P6BA 4EV4A 2R78A 1PWGA 1MWTA 1DJCA 4DJ3A 5CXWA 2W3HA 4IEDA 4E04A 4X1LA 2Y2PA 3BRMA 3RJUA 4Q0HA 3UE3A 1KDSA 2QWSA 1VETA 5G4ZA 3LR0A 3V3SA 3BWLA 4JGPA 3IF6B 2ZC7A 3H7WA 4IHQA 3IXBA 1MBLA 2PD8A 5FI6A 4ZAMA 4FH4A 4ZTKA 3WRZA 2Z2LB 4ID4A 1EWZA 4JF6A 2QPNA 4DMZA 2QZ6A 2Q0OA 3LIBA 4QWOA 4N9LA 4FD8A 3GR2A 5HARA 4WZ5A 2XH9A 2O9CA 3CPTA 5CGSA 2DCFA 5I5LA 2P08A 5FATA 1CEGA 4PAUA 4DRTA 5E2HA 1ZHHB 1OMEA 3M2KA 4MN7A 3MZDA 2BLSA 2K31A 5TGFA 2RCXA 1HZOA 4HJ4A 4E3NA 5EECA 5AQ7A 1NY0A 3A3JA 4F3LA 1RGYA 3C8CA 1ONHA 1Y28A 4HHDA 4X55A 5CGWA 1IYSA 3PBTA 4OOYA 1W63Q 4LFUA 3R4KA 1KVMA 3U2AA 3UB6A 3BJNA 1J3WA 1T18A 3LYXA 3VOYA 4L9GA 2AVXA 1RGZA 2Q9NA 4QB8A 5FQ9A 5F83A 1TS0A 3IF6C 1XA7A 5FDSA 1S6RA 2EX2A 3IBRA 2G2UA 1WE4A 4JLFA 4R3JA 4X6TA 3LI8A 4JKTA 4WN5A 3OLOA 2Y2HA 3MJQA 4C75A 3LR4A 4GB7A 3HLBA 1Q2PA 4MN5A 2I72A 4EU0A 5CERA 4R6LA 5DF9A 1K55A 2JKTI 1TS8A 2JKRI 5G18A 3VSLA 4A5RA 3S7OA 3UPOA 2A24A 1NZUA 2C5WB 3ZNYA 2HDUA 3BM6A 2GX5A 4LCMA 1L0GA 4L9EA 2P7JA 2Y8HA 3GVBA 4Z9QA 3VP4A 2HZ5A 2Y2LA 3UNWA 3GECA 2QJ7A 3Q7ZA 4OOMA 5TR7A 1H8YA 3HUMA 3S22A 2OWHA 4G3KA 2RL3A 3ZHHA 1U60A 4DDSA 3V67A 3IXDA 1OT6A 4QD4A 4CJNA 2QMIA 3F1OA 4HY8A 4BJPA 5IU1A 4KZ7A 1BUEA 1LL8A 5TBMA 4P85A 4R3AA 4NETA 5GHZA 3KSIA 2PHYA 1KE4A 2W1RA 1BLPA 1GHPA 1UWPX 1G6AA 1VHMA 4EUZA 3PHYA 4I3IA 3CMZA 1Z09A 2BASA 4NKPA 5HAQA 1PIOA 3Q7VB 1K0KA 2PR6A 3NHQA 5GHYA 4EW7A 2EXAA 3BQ8A 4GS9A 2Q9MA 1BSGA 5CECA 3UDIA 4Y17A 3VP0A 3AGFA 3O5YA 4IBRA 2IWCA 5HPIA 1KGGA 3KSGA 3PBSA 5DF8A 5FI2A 4X1MA 3MR0A 2ZC4B 5AQAA 4OPZA 1HVBA 3ZNTA 3EGDC 3MKFA 4MCWA 3TW8A 1N4OA 2V0UA 1L0FA 4BENA 1XA1A 4DE0A 4GD8A 5CHMA 4LENA 4F94A 2JBFA 5GHXA 3MXSA 4CLCD 5F68A 2V1ZA 2L1MA 5FQMA 2XFSA 1XP4A 5FASA 1TF1A 3G32A 5EM0A 2KX6A 5FAOA 5GL9A 1MY8A 4BD1A 5L2FA 4KG2A 2LB9A 4HEFA 3RH8B 3GRJA 1YT4A 3RTYA 3MBZA 2XDMA 1BT5A 4EBLA 3PTEA 1FSYA 1GSVA 1XFNA 3CAXA 5IHVA 4CLCA 3G31A 5HD3A 4E6WA 4UQIM 1VEUB 2DMWA 2WK0A 4KG5A 3KYEA 3A0RA 3M2JA 4PM9A 3ZDJA 2XGNA 2ZMVA 3UDFA 2PT7A 3ZQ5A 3UB7A 1OTDA 1T1BA 2XLNA 3LO7A 4DKIA 4R38A 4JGRA 5GLAA 4I5SA 3L9KA 3HLWA 1BTLA 3FPVA 2WGIA 4PHTA 2Z2MB 4EETB 3EQVA 2OWJA 1PI4A 3G35A 3SZTA 3WS5A 4ARZB 3LICA 4EEUA 4KQRA 1P97A 4GDBA 4KZAA 3BY9A 3ULFA 4KUOA 2WGWA 2B95A 3NIAA 5CTMA 1P0ZA 5K5BA 3HREA 2UV0E 2OOLA 3IS2B 1YAXA 4OPRA 4I39A 1UWNX 3MQQA 4GN2A 3OOVA 2VV6A 2JE5A 3DTEA 4K0WA 4B4XA 4UHUA 1CQAA 4KG6A 1FCOA 4WLAA 2WGVA 3KX0X 3LIDA 4Y0TA 1KE3A 4E3JA 3P98A 1VETB 3AGEA 4EXOA 5AVEA 4S2KA 3H7WB 4JGQA 4GNUA 5EPHA 1I5QA 1MWRA 2XSSA 2VA0A 1K56D 1E4DA 3W8KA 3P7NA 2WAFA 5HWWA 3OZHA 3UPNA 4D2OA 3GDIA 1LSVA 5DF7A 1YLJA 4DE2A 3E98A 3TOIA 3NI9A 5HFOA 1W8YA 4HJ6A 2XEPA 4UQIS 4HI4A 3OPPA 5HDDA 2ZQ8A 1K56A 4G3VA 4F3LB 3M6HA 1S67L 2EWWA 3C5AA 5L10A 1D7EA 3JPUA 3VP2A 4OVDA 4X25A 5DKKA 3LY3A 1ZG4A 2FZ0A 1LI9A 4ETZA 3LR5A 4E3LA 3D72A 3E4OA 2ZQ9A 5DKLA 2O9BA 2GNXA 2PYPA 2BG1A 2J7VA 2EX6A 4HH3A 2IA2A 1V9ZA 1DJBA 2YKFA 3UN7A 3IHAA 1L0EA 3DTIA 2W3GA 3HUOA 5DJUA 1ONGA 3RFBA 3PAGA 5HZHA 4HIAA 4OP8A 4WYYA 3CZDA 3CHWP 2A3UA 1MPLA 3C38A 4GOGA 5L09A 2OAP1 3AGDA 2WYXA 2Y91A 2JKGA 3A0SA 1XX2A 2ZL1B 2J80A 1WA9A 2Y2GA 4CPKA 1ES2A 4WZ5C 4NXGA 5EVEA 3IXGA 2ZOIA 1CI9A 4Z1WA 3UDXA 4ZBEA 2A24B 3GTCA 4OPYA 4MNRA 2H28A 5HSQA 5F5YA 2FH5A 1ZKJA 3LGOA 1T1CA 2J3WA 4NXEA 1FR1A 5IT5A 4RA7A 3RXXA 3T4KA 5G4YA 2WAEA 5KZHA 3T4OA 1XFQA 1JWZA 5FI7A 5HX9A 3H82A 3GMWA 3C4PA 3P01A 4BQMA 4O8GA 4GZBA 3TRCA 4GLQA 1K6RA 2O99A 1TDGA 3OC2A 2I9VA 5F1FA 1K57A 1IKIA 4YWZA 3VV4A 4R1GA 1PWCA 3F1OB 3ZG0A 3BFDA 1ERMA 2GJ3A 1P9WA 5TBMB 4PKYA 2WZXA 1TEMA 4S2NA 3OPHA 2OSUA 3D4FA 1DJAA 3SS3A 3V3RA 4CLCE 1H8MA 5EVID 5FSRA 4ZDXA 3G2YA 4DN0A 1W5DA 4K08A 1OTAA 3A3FA 4GW9A 1M40A 3BFFA 2HDQA 3UB5P 5JYPA 1MWUA 5HW3A 1KVLA 4XT2A 2XQZA 1OTEA 2CMNA 4E6XA 1LHYA 4GS9B 4Q8IA 4JXGA 4JF4A 5FQJA 1K55C 1LSXA 1TDLA 3TG9A 4U0TA 3NC8A 4I3JA 1JNUA 5EVIA 4P6ZM 3SH9A 1K54A 4LV2A 3UPPA 3ZG7B 2W27A 5M1AA 1QMFA 3LFVA 2OLVA 3KYQA 1YLPA 1ESIA 2J8YA 5FL3A 5HPFA 2Y2IA 5E2FA 4H6JA 4KUKA 3P09A 4JXWA 3MXRA 3K3DA 2XRNA 3EGXC 2WKHA 4HOIA 3VE4A 3C7VA 1S0WA 3MZFA 4BBTA 4GHIB 2VGJA 1LT0A 3W4QA 1JTGA 4PMAA 2M7VA 5J8XA 2JCHA 3U4LP 3B33A 2Y2NA 4PM6A 3T1RA 1E3UD 3LEZA 4WBGA 1S4RA 3SW1A 3HJKA 5EVLA 1IYOA 4HNBA 4XUXA 3DTMA 4GDNA 3MMHA 1K6SA 2MJ6A 2WZZA 3ISGA 4KZ3A 1YLYA 4OQ0A 2K7SA 2NUPC 1L3LA 1IELA 1QMEA 2JN7A 3PBRA 3N6IA 4GD6A 4RX3A 5AJGA 5KSCA 3E4PA 1GCEA 1MKIA 1CEFA 3W4OA 1ACFA 4EQ1A 2PBDP 1FOFA 2ZQAA 3LIAA 4X53A 5DTTA 1XKZA 1E3UA 2EFUA 3NECA 3K2NA 1IKGA 2HDRA 4L0LA 5GLBA 1W79A 2JHEA 4IVIA 4NEED 4UEYA 3V50A 4MBHA 4QU3A 5EM1A 2VV7A 3NY4A 5DFXA 5LBRA 1WYCA 3LCEA 3DW0A 3MZEA 2E8IA 4I3AA 1KGFA 3PBQA 3B47A 3QP2A 4K0XA 2H0YA 4K91A 2P74A 3SH8A 3JYIA 4S2LA 1G68A 5DJTA 2KLIA 3ZVTA 2VKSA 1IOUA 3MF0A 2PRFA 4RVAA 4O7DA 3WS2A 3ZG5A 2L0WA 1RCJA 2YKHA 2CC1A 4P6ZS 1TS6A 5HWVA 3G2ZA 4NG2A 3C7UA 1D06A 2VLGA 3F1NA 5U47A 1Y54A 3IX4A 5CRFA 4UA6A 4QY6A 4CLCC 5MC7A 1YLWA 1XJ3A 3HLFA 3MFXA 2M1CA 1PI5A 3T4LA 2X01A 4YNRA 4Y13A 4JXVA 1K4FA 5F1GA 4IUHA 3CUEA 4MN6A 3Q81A 1HD8A 4OONA 1T1AA 5D3OA 3FV7A 5C5KA 4DF6A 4JXSA 2R9WA 3HLCA 2XA7S 2ZOHA 3FKVA 1OJGA 5HL6A 2ZQ7A 5A93A 2D01A 2EX9A 3N8LA 3MKEA 4JBFA 3BW6A 1S4SA 1OTIA 1PZOA 4Y7PA 5EFWA 1LI0A 1MC0A 3LEQA 3VE3A 3LUQA 3NCKA 3R7WA 2W1TB 1GHMA 1GHIA 1H5XA 3UE6A 2XR0A 4E3MA 4OLDA 2J3TD 4OOLA 4ZRRA 1I2WA 1E25A 1XGJA 1TD5A 1ZC2A 3IX3A 4C3QA 3ZG8B 5IS1A 1SKOA 3C2WA 1XJ4A 4LV3A 4HH2A 1PNEA 1FR6A 4Y0OA 2VGKA 3S7PA 2OV5A 4EEPA 3WRTA 1LSWA 5CX7A 2HF6A 4FOFA 4KZ8A 3E0YA 3IBJA 3VSKA 2HPBA 4LRYC 1NYYA 1G6OA 4ETXA 2Y4AA 3WWXA 2ACGA 3BYDA 5F82A 2L4RA 2PYRA 2QJ5A 2P04A 2V1BA 3OCNA 1KGEA 1PW8A 1OJ5A 1FSWA 3BEBA 4DXCA 2PR5A 2PU2A 1W8QA 4P87A 3PR6A 1ESUA 3WS0A 4NK3A 4PM7A 4YOFA 2ZMFA 1CJFA 3EEHA 1GSXA 3HLGA 2VGLM 2ZM8A 4U0XA 2R9XA 1F9IA 2Z6DA 1STZA 4EESA 1M6KA 3FPWA 5TJJA 2G2WA 1W7FA 3TJZC 1NXYA 3HLDA 3O88A 4BMWA 1MKMA 1ES3A 2ZQCA 1YSQA 3CLOA 2JC7A 1SDNA 3NULA 3TSGA 1FIKA 3Q7VA 1ZTUA 3W4PA 3H82B 5CEBA 5FDHA 2PU4A 3WS4A 1IYPA 4WM9A 4MDZA 3S1YA 2QYBA 2EX8A 4S2IA 4C6YA 5J3WA 3N8SA 2W3EA 3PXPA 2V20A 1XPBA 1WYBA 3SS4A 3V39A 3BFEA 4L9FA 4HJ3A 4R4SA 2W3DA 4BL2A 1YKDA 3KSFA 3QHYA 4RQ9A 5GLCA 2B18A 2Y2QA 3NJAA 4UA7A 2VJWA 4WELA 3CPTB 2V1AA 3OBFA 4G3WA 4XT2B 1N9BA 5AQ9A 5EV0A 2ZM2A 3GSGA 4GCZA 3OCLA 2EFXA 5CGXA 4WL9A 1DRMA 1GA0A 5AQBA 3BECA 3G4PA 3FWLA 5EVIB 4II7A 2OAQ1 4LRZE 4BLMA 2HJEA 4YFMA 3TE8A 1F5MA 1O7EA 2XD1A 3CJMA 4M3KA 4BBVA 3IQAA 3OPLA 2H10A 4GJ4A 1DP6A 1PWDA 3FYZA 4UAAA 5E2GA 3FZCA 1T19A 1VEUA 1GA9A 4H6JB 4GKUA 4KQDA 3F1PA 1L2SA 4PM5A 3O3VA 2ZM0A 3NBLA 5DVAA 2PD7A 4E3OA 1Z6FA 1K57C 1UGUA 4WEKA 2VGLS 2P9VA 2Z6CA 3S7NA 1PW1A 2XROA 4S2NC 1EI5A 3VFHA 1BLCA 3VP3A 2E8JA 4Y2FA 5CEDA 3IHBA 1DY6A 5CHJA 2QKPA 4QHCA 4Y15A 4EBPA 4LLOB 4ESPA 1ES5A 4N9KA 3VOZA 3N4IA 1TVFA 4XUZA 3IH9A 4ARZA 5J4EA 4MBFA 4O01A 1K38A 2VEAA 1CF0A 3EWKA 3GV9A 4JGOA 1NRJA 2HGVA 1V9YA 4N1HA 5HL1A 4DXBA 5EVIC 5JYOA 3HVFA 3IS2A 3EOIA 2EA9A 1OTBA 3SS5A 1K54C 1FQGA 3RXWA 5KSHA 2BTFP 4BBUA 4KZ5A 3L7HA 1HTZA 2HP6A 2Y55A 3E2LA 3C4OA 2K2NA 3E4QA 2EWVA 4WMCD 3BFCA 3T12B 3ZGAB 2V9AA 2V0WA 1SKFA 3FG8A 4B9OA 4R4RA 4X68A 4DE3A 3K3CA 3MQ0A 2O9AA 4BWIA 5EUAA 4AFIA 2Y2KA 2ZQDA 4FH2A 2VV8A 2EXBA 3VP1A 1OT9A 5J7EA 4WMCA 3HLEA 3LR3A 1BYWA 2ZMAA 3F1NB 1F98A 2NUTC 3ITBA 3T4QA 3W2ZA 2WUQA 3HCYA 1N9LA 2DRWA 1A0KA 2IWBA 4S2JA 1BLSA 4BL3A 4HBUA 4Y3IA 4IBXA 1VM1A 1TS7A 1SHVA 3Q07A 2ZJ9A 1YMSA 5F6AA 3D3OA 3UMDA 2Y2OA 5E2EA 3BLSA 2WKEA 5FQIA 1AWIA 2XD5A 3UB9A 2HV1A 3WS1A 2A49A 5FQQA 3DWKA 5HD5A 4JPMA 3DWZA 4XXRA 3MSHA 3BY8A 4LCLA 5M18A 2INWA 3SH7A 2XA7M 1S1YA 4LRXC 2ZLYA 2Y59A 4DDYA 3N7WA 3NDEA 2X02A 3A3DA 5FA7A 2ZC6B 1NJ4A 3R7WB 4S2MA 5FAPA 4Q0IA 4Y5FA 1PRQA 1JWPA 3UY6A 1I2SA 3Q82A 2XK1A 2PBYA 4M4XA 4KENB 4CLCB 3S7QA 1FILA 4ZJ3A 5FEGA 1SZVA 2Y79A 3IWOA 5FQKA 5TFQA 2X71A 1LLBA 5A92A 1NLYA 1SKOB 4EERA 1ZG6A 2ZL1A 4LV1A 4QY5A 2Y2MA 4PPRA 3M6BA 2XFTA 2KOIA 3ICYA 4OKPA 4EUVA 1YMXA 3O87A 3JVUA 1SDEA 2GZAA 3CUEC 3MXQA 4KQQA 1ES4A 4MMNA 5L07A 3UE1A 1MWSA 3B42A 1DP9A 1PZPA 4IJGA 1IFQA 3CWFA 4P0MA 2ZC5B 1MXOA 1D1JA 3IF6A 4LPZA 4KZ9A 5A90A 1XJ6A 2WGWB 4NXBA 1O07A 1FCMA 3KSHA 4B88A 3IF5A 1K25A 2FFFB 1IYQA 2C6WB 4FUWA 1XGIA 3QP1A 4WEJA 4MBKA 1MZUA 2H5SA 4S2PA 3MQOA 3ZFZA 3QNCA 4PM8A 3IX8A 4MEZA 3LI9A 3MFDA 1L0DA 1YLTA 2OLUA 3B3XA 3BFGA 3LIFA 3IT9A 2B5RA 3HJIA 4KZBA 5HDCA 4ZJ1A 1EW0A 1XJ2A 4EQIA 1YSPA 1PYYA 3I7JA 1YQSA 4X56A 4B93A 2J3TC 3QP8A 3UO9A 2VX8A 3A3EA 4OQHA 4R0QA 3IWIA 3T50A 2M7UA 1K4EA 1LL9A 4R23A 4X69A 1SCWA 4YINA 3UB8A 4ZJ2A 3HL9A 4E3IA 5EOEA 1LL5A 1PFLA 4LGWA 1Q2QA 4KQOA 1JVJA 4UA9A 3A0VA 2J9OA 3T1XA 1NYMA 2WKPA 3GQZA 4GHIA 5M19A 2J9PA 4OQGA 2ZBBA 5HAPA 5CTNA 5HWTA 5A8BA 1IEMA 4CQHA 4N92A 4H8RA 3QP4A 4DE1A 3PBNA 5I94A 2IWDA 5FAQA 3S4XA 3SOIA 3T4JA 1JWVA 1KDWA 3OPRA 1ODVA 3HBRA 1XXMA 3EQUA 3F1PB 2WADA 1CI8A 4OH0A 5CHUA 2JKFA 1NWZA 3T1QB 4ME4A 2WKRA 2KDKA 1H8ZA 3CITA 4IVKA 3VMAA 3FKWA 4O0PA 2P9VB 1NZOA 1G5UA 2VZWA 4Q0JA 3NOUC 1AXBA 2ZD8A 1YM1A 3BLMA 4BD0A 1VQQA 3KYZA 2B02A 1J9MA 1ALQA 1OPXA 3NOPC 4RX2A 3UMEA 4Y0UA 4OLGA 3NOTC 5F69A 3D9YA 1H3QA 2VK3A 3T1SA 4LV0A 5DTKA 2D02A 2W3FA 1ERQA 5KMWA 3LY4A 1FCNA 3JVVA 4HP9A 4U3TA 2G7UA 4MLLA 4FTXA 1EROA 5EOOA 3ZG9B 4WF0A 3UE0A 1NRFA 1BULA 2DNSA 3C30A 1HLUP 4QJGA 1C3BA 1KOUA 3IWQA 4FCFA 3CG5A 3ZCZA 1S1ZA 3QNBA 4WZ4A 4HQAA 3CI6A 4OP5A 4NXFA 2QHKA 2HP9A 4DJ2A 3ZYTA 1S66L 2ZC3B 4WUJA 4HESA 3KO6A 4HBTA 3VFFA 1JTDA 4OQIA 4OPQA 3IH8A 4FSFA 4R3BA 2UWXA 3G6OA 4D60A 3FC7A 2V8CA 5KIZA 2FFYA 4IUKA 1G28A 1KE0A 1NLZA 2WKQA 4S2OA 1BLHA 2W1TA 3H9WA 2H0TA 5BOHA 1YLZA 5DTSA 2PDRA 3HUNA 3T4TA 3MS6A 3G30A 2W0NA 2WKIA 3ZVWA 1X0OA 5A91A 5GLDA 1N9OA 3O86A 3E2KA 1P9RA 3QP5A 3T4SA 4E3KA 5HAIA 1W63M 1DP8A 3PAEA 1RP5A 3PBOA 3LIEA 3BQAA 3ITAA 4PKYG 2HJ9C 2Y2JA 3QP6A 5E43A 5AVFA 5EE8A 3NDGA 1H0MA 1CK3A 5DFYA 3VOLA 3EEAA 2V8FA 4I38A 2JKTM 1YPRA 2A2LA 2JKRM 5FEFA 4KZ4A 5L8MA 3IXHA 1VB6A 4B4ZA 2GDNA 4KZ6A 4QPRA 4RYEA 4N1XA 4EBNA 3Q1FA 3DAVA 4JF5A 4EWFA 3G34A 3PYPA 3DTKA 3A3IA 3N8RA 2V2FF 1Y4OA 2LB5A 4HP4A 2HP5A 1F2KA 3DBAA
chains in the Genus database with same CATH topology
3CHWP 1J3WA 3NECA 4D60A 1FILA 5FEGA 1SZVA 2V8CA 2PAVP 1VEUB 1G5UA 1VEUA 3KYEA 2JKGA 1SKOB 2ZL1B 3LEQA 2ZL1A 1Z09A 4X1LA 5EM1A 5FDSA 5EVEA 3NULA 1FIKA 1K0KA 1VETA 3MS6A 3LGOA 3L9KA 2E8JA 1SKOA 3D9YA 3T1SA 2VK3A 4X1MA 1PNEA 2PRFA 4ESPA 1PFLA 3T1XA 4FTXA 4QWOA 1D1JA 1CF0A 3CPTB 3CPTA 4X25A 3U4LP 3T1RA 2B95A 1HLUP 1AWIA 2HZ5A 2ACGA 5EV0A 3MSHA 2V8FA 1YPRA 4FUWA 5FEFA 2BTFP 5EM0A 3L7HA 3DAVA 1CJFA 1CQAA 1PRQA 3UB5P 2JKFA 1ACFA 1Y4OA 2PBDP 3T12B 3T1QB 1F2KA 1A0KA 1VETB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CHW P;  1J3W A;  3NEC A;  4D60 A;  1FIL A;  5FEG A;  1SZV A;  2V8C A;  2PAV P;  1VEU B;  1G5U A;  1VEU A;  3KYE A;  2JKG A;  1SKO B;  2ZL1 B;  3LEQ A;  2ZL1 A;  1Z09 A;  4X1L A;  5EM1 A;  5FDS A;  5EVE A;  3NUL A;  1FIK A;  1K0K A;  1VET A;  3MS6 A;  3LGO A;  3L9K A;  2E8J A;  1SKO A;  3D9Y A;  3T1S A;  2VK3 A;  4X1M A;  1PNE A;  2PRF A;  4ESP A;  1PFL A;  3T1X A;  4FTX A;  4QWO A;  1D1J A;  1CF0 A;  3CPT B;  3CPT A;  4X25 A;  3U4L P;  3T1R A;  2B95 A;  1HLU P;  1AWI A;  2HZ5 A;  2ACG A;  5EV0 A;  3MSH A;  2V8F A;  1YPR A;  4FUW A;  5FEF A;  2BTF P;  5EM0 A;  3L7H A;  3DAV A;  1CJF A;  1CQA A;  1PRQ A;  3UB5 P;  2JKF A;  1ACF A;  1Y4O A;  2PBD P;  3T12 B;  3T1Q B;  1F2K A;  1A0K A;  1VET B; 
#chains in the Genus database with same CATH topology
 2HDS A;  3V5M A;  1N9N A;  5HDS A;  2XF3 A;  2O0Y A;  1GSW A;  4R70 A;  2PAV P;  1BZA A;  4P6B A;  4EV4 A;  2R78 A;  1PWG A;  1MWT A;  1DJC A;  4DJ3 A;  5CXW A;  2W3H A;  4IED A;  4E04 A;  4X1L A;  2Y2P A;  3BRM A;  3RJU A;  4Q0H A;  3UE3 A;  1KDS A;  2QWS A;  1VET A;  5G4Z A;  3LR0 A;  3V3S A;  3BWL A;  4JGP A;  3IF6 B;  2ZC7 A;  3H7W A;  4IHQ A;  3IXB A;  1MBL A;  2PD8 A;  5FI6 A;  4ZAM A;  4FH4 A;  4ZTK A;  3WRZ A;  2Z2L B;  4ID4 A;  1EWZ A;  4JF6 A;  2QPN A;  4DMZ A;  2QZ6 A;  2Q0O A;  3LIB A;  4QWO A;  4N9L A;  4FD8 A;  3GR2 A;  5HAR A;  4WZ5 A;  2XH9 A;  2O9C A;  3CPT A;  5CGS A;  2DCF A;  5I5L A;  2P08 A;  5FAT A;  1CEG A;  4PAU A;  4DRT A;  5E2H A;  1ZHH B;  1OME A;  3M2K A;  4MN7 A;  3MZD A;  2BLS A;  2K31 A;  5TGF A;  2RCX A;  1HZO A;  4HJ4 A;  4E3N A;  5EEC A;  5AQ7 A;  1NY0 A;  3A3J A;  4F3L A;  1RGY A;  3C8C A;  1ONH A;  1Y28 A;  4HHD A;  4X55 A;  5CGW A;  1IYS A;  3PBT A;  4OOY A;  1W63 Q;  4LFU A;  3R4K A;  1KVM A;  3U2A A;  3UB6 A;  3BJN A;  1J3W A;  1T18 A;  3LYX A;  3VOY A;  4L9G A;  2AVX A;  1RGZ A;  2Q9N A;  4QB8 A;  5FQ9 A;  5F83 A;  1TS0 A;  3IF6 C;  1XA7 A;  5FDS A;  1S6R A;  2EX2 A;  3IBR A;  2G2U A;  1WE4 A;  4JLF A;  4R3J A;  4X6T A;  3LI8 A;  4JKT A;  4WN5 A;  3OLO A;  2Y2H A;  3MJQ A;  4C75 A;  3LR4 A;  4GB7 A;  3HLB A;  1Q2P A;  4MN5 A;  2I72 A;  4EU0 A;  5CER A;  4R6L A;  5DF9 A;  1K55 A;  2JKT I;  1TS8 A;  2JKR I;  5G18 A;  3VSL A;  4A5R A;  3S7O A;  3UPO A;  2A24 A;  1NZU A;  2C5W B;  3ZNY A;  2HDU A;  3BM6 A;  2GX5 A;  4LCM A;  1L0G A;  4L9E A;  2P7J A;  2Y8H A;  3GVB A;  4Z9Q A;  3VP4 A;  2HZ5 A;  2Y2L A;  3UNW A;  3GEC A;  2QJ7 A;  3Q7Z A;  4OOM A;  5TR7 A;  1H8Y A;  3HUM A;  3S22 A;  2OWH A;  4G3K A;  2RL3 A;  3ZHH A;  1U60 A;  4DDS A;  3V67 A;  3IXD A;  1OT6 A;  4QD4 A;  4CJN A;  2QMI A;  3F1O A;  4HY8 A;  4BJP A;  5IU1 A;  4KZ7 A;  1BUE A;  1LL8 A;  5TBM A;  4P85 A;  4R3A A;  4NET A;  5GHZ A;  3KSI A;  2PHY A;  1KE4 A;  2W1R A;  1BLP A;  1GHP A;  1UWP X;  1G6A A;  1VHM A;  4EUZ A;  3PHY A;  4I3I A;  3CMZ A;  1Z09 A;  2BAS A;  4NKP A;  5HAQ A;  1PIO A;  3Q7V B;  1K0K A;  2PR6 A;  3NHQ A;  5GHY A;  4EW7 A;  2EXA A;  3BQ8 A;  4GS9 A;  2Q9M A;  1BSG A;  5CEC A;  3UDI A;  4Y17 A;  3VP0 A;  3AGF A;  3O5Y A;  4IBR A;  2IWC A;  5HPI A;  1KGG A;  3KSG A;  3PBS A;  5DF8 A;  5FI2 A;  4X1M A;  3MR0 A;  2ZC4 B;  5AQA A;  4OPZ A;  1HVB A;  3ZNT A;  3EGD C;  3MKF A;  4MCW A;  3TW8 A;  1N4O A;  2V0U A;  1L0F A;  4BEN A;  1XA1 A;  4DE0 A;  4GD8 A;  5CHM A;  4LEN A;  4F94 A;  2JBF A;  5GHX A;  3MXS A;  4CLC D;  5F68 A;  2V1Z A;  2L1M A;  5FQM A;  2XFS A;  1XP4 A;  5FAS A;  1TF1 A;  3G32 A;  5EM0 A;  2KX6 A;  5FAO A;  5GL9 A;  1MY8 A;  4BD1 A;  5L2F A;  4KG2 A;  2LB9 A;  4HEF A;  3RH8 B;  3GRJ A;  1YT4 A;  3RTY A;  3MBZ A;  2XDM A;  1BT5 A;  4EBL A;  3PTE A;  1FSY A;  1GSV A;  1XFN A;  3CAX A;  5IHV A;  4CLC A;  3G31 A;  5HD3 A;  4E6W A;  4UQI M;  1VEU B;  2DMW A;  2WK0 A;  4KG5 A;  3KYE A;  3A0R A;  3M2J A;  4PM9 A;  3ZDJ A;  2XGN A;  2ZMV A;  3UDF A;  2PT7 A;  3ZQ5 A;  3UB7 A;  1OTD A;  1T1B A;  2XLN A;  3LO7 A;  4DKI A;  4R38 A;  4JGR A;  5GLA A;  4I5S A;  3L9K A;  3HLW A;  1BTL A;  3FPV A;  2WGI A;  4PHT A;  2Z2M B;  4EET B;  3EQV A;  2OWJ A;  1PI4 A;  3G35 A;  3SZT A;  3WS5 A;  4ARZ B;  3LIC A;  4EEU A;  4KQR A;  1P97 A;  4GDB A;  4KZA A;  3BY9 A;  3ULF A;  4KUO A;  2WGW A;  2B95 A;  3NIA A;  5CTM A;  1P0Z A;  5K5B A;  3HRE A;  2UV0 E;  2OOL A;  3IS2 B;  1YAX A;  4OPR A;  4I39 A;  1UWN X;  3MQQ A;  4GN2 A;  3OOV A;  2VV6 A;  2JE5 A;  3DTE A;  4K0W A;  4B4X A;  4UHU A;  1CQA A;  4KG6 A;  1FCO A;  4WLA A;  2WGV A;  3KX0 X;  3LID A;  4Y0T A;  1KE3 A;  4E3J A;  3P98 A;  1VET B;  3AGE A;  4EXO A;  5AVE A;  4S2K A;  3H7W B;  4JGQ A;  4GNU A;  5EPH A;  1I5Q A;  1MWR A;  2XSS A;  2VA0 A;  1K56 D;  1E4D A;  3W8K A;  3P7N A;  2WAF A;  5HWW A;  3OZH A;  3UPN A;  4D2O A;  3GDI A;  1LSV A;  5DF7 A;  1YLJ A;  4DE2 A;  3E98 A;  3TOI A;  3NI9 A;  5HFO A;  1W8Y A;  4HJ6 A;  2XEP A;  4UQI S;  4HI4 A;  3OPP A;  5HDD A;  2ZQ8 A;  1K56 A;  4G3V A;  4F3L B;  3M6H A;  1S67 L;  2EWW A;  3C5A A;  5L10 A;  1D7E A;  3JPU A;  3VP2 A;  4OVD A;  4X25 A;  5DKK A;  3LY3 A;  1ZG4 A;  2FZ0 A;  1LI9 A;  4ETZ A;  3LR5 A;  4E3L A;  3D72 A;  3E4O A;  2ZQ9 A;  5DKL A;  2O9B A;  2GNX A;  2PYP A;  2BG1 A;  2J7V A;  2EX6 A;  4HH3 A;  2IA2 A;  1V9Z A;  1DJB A;  2YKF A;  3UN7 A;  3IHA A;  1L0E A;  3DTI A;  2W3G A;  3HUO A;  5DJU A;  1ONG A;  3RFB A;  3PAG A;  5HZH A;  4HIA A;  4OP8 A;  4WYY A;  3CZD A;  3CHW P;  2A3U A;  1MPL A;  3C38 A;  4GOG A;  5L09 A;  2OAP 1;  3AGD A;  2WYX A;  2Y91 A;  2JKG A;  3A0S A;  1XX2 A;  2ZL1 B;  2J80 A;  1WA9 A;  2Y2G A;  4CPK A;  1ES2 A;  4WZ5 C;  4NXG A;  5EVE A;  3IXG A;  2ZOI A;  1CI9 A;  4Z1W A;  3UDX A;  4ZBE A;  2A24 B;  3GTC A;  4OPY A;  4MNR A;  2H28 A;  5HSQ A;  5F5Y A;  2FH5 A;  1ZKJ A;  3LGO A;  1T1C A;  2J3W A;  4NXE A;  1FR1 A;  5IT5 A;  4RA7 A;  3RXX A;  3T4K A;  5G4Y A;  2WAE A;  5KZH A;  3T4O A;  1XFQ A;  1JWZ A;  5FI7 A;  5HX9 A;  3H82 A;  3GMW A;  3C4P A;  3P01 A;  4BQM A;  4O8G A;  4GZB A;  3TRC A;  4GLQ A;  1K6R A;  2O99 A;  1TDG A;  3OC2 A;  2I9V A;  5F1F A;  1K57 A;  1IKI A;  4YWZ A;  3VV4 A;  4R1G A;  1PWC A;  3F1O B;  3ZG0 A;  3BFD A;  1ERM A;  2GJ3 A;  1P9W A;  5TBM B;  4PKY A;  2WZX A;  1TEM A;  4S2N A;  3OPH A;  2OSU A;  3D4F A;  1DJA A;  3SS3 A;  3V3R A;  4CLC E;  1H8M A;  5EVI D;  5FSR A;  4ZDX A;  3G2Y A;  4DN0 A;  1W5D A;  4K08 A;  1OTA A;  3A3F A;  4GW9 A;  1M40 A;  3BFF A;  2HDQ A;  3UB5 P;  5JYP A;  1MWU A;  5HW3 A;  1KVL A;  4XT2 A;  2XQZ A;  1OTE A;  2CMN A;  4E6X A;  1LHY A;  4GS9 B;  4Q8I A;  4JXG A;  4JF4 A;  5FQJ A;  1K55 C;  1LSX A;  1TDL A;  3TG9 A;  4U0T A;  3NC8 A;  4I3J A;  1JNU A;  5EVI A;  4P6Z M;  3SH9 A;  1K54 A;  4LV2 A;  3UPP A;  3ZG7 B;  2W27 A;  5M1A A;  1QMF A;  3LFV A;  2OLV A;  3KYQ A;  1YLP A;  1ESI A;  2J8Y A;  5FL3 A;  5HPF A;  2Y2I A;  5E2F A;  4H6J A;  4KUK A;  3P09 A;  4JXW A;  3MXR A;  3K3D A;  2XRN A;  3EGX C;  2WKH A;  4HOI A;  3VE4 A;  3C7V A;  1S0W A;  3MZF A;  4BBT A;  4GHI B;  2VGJ A;  1LT0 A;  3W4Q A;  1JTG A;  4PMA A;  2M7V A;  5J8X A;  2JCH A;  3U4L P;  3B33 A;  2Y2N A;  4PM6 A;  3T1R A;  1E3U D;  3LEZ A;  4WBG A;  1S4R A;  3SW1 A;  3HJK A;  5EVL A;  1IYO A;  4HNB A;  4XUX A;  3DTM A;  4GDN A;  3MMH A;  1K6S A;  2MJ6 A;  2WZZ A;  3ISG A;  4KZ3 A;  1YLY A;  4OQ0 A;  2K7S A;  2NUP C;  1L3L A;  1IEL A;  1QME A;  2JN7 A;  3PBR A;  3N6I A;  4GD6 A;  4RX3 A;  5AJG A;  5KSC A;  3E4P A;  1GCE A;  1MKI A;  1CEF A;  3W4O A;  1ACF A;  4EQ1 A;  2PBD P;  1FOF A;  2ZQA A;  3LIA A;  4X53 A;  5DTT A;  1XKZ A;  1E3U A;  2EFU A;  3NEC A;  3K2N A;  1IKG A;  2HDR A;  4L0L A;  5GLB A;  1W79 A;  2JHE A;  4IVI A;  4NEE D;  4UEY A;  3V50 A;  4MBH A;  4QU3 A;  5EM1 A;  2VV7 A;  3NY4 A;  5DFX A;  5LBR A;  1WYC A;  3LCE A;  3DW0 A;  3MZE A;  2E8I A;  4I3A A;  1KGF A;  3PBQ A;  3B47 A;  3QP2 A;  4K0X A;  2H0Y A;  4K91 A;  2P74 A;  3SH8 A;  3JYI A;  4S2L A;  1G68 A;  5DJT A;  2KLI A;  3ZVT A;  2VKS A;  1IOU A;  3MF0 A;  2PRF A;  4RVA A;  4O7D A;  3WS2 A;  3ZG5 A;  2L0W A;  1RCJ A;  2YKH A;  2CC1 A;  4P6Z S;  1TS6 A;  5HWV A;  3G2Z A;  4NG2 A;  3C7U A;  1D06 A;  2VLG A;  3F1N A;  5U47 A;  1Y54 A;  3IX4 A;  5CRF A;  4UA6 A;  4QY6 A;  4CLC C;  5MC7 A;  1YLW A;  1XJ3 A;  3HLF A;  3MFX A;  2M1C A;  1PI5 A;  3T4L A;  2X01 A;  4YNR A;  4Y13 A;  4JXV A;  1K4F A;  5F1G A;  4IUH A;  3CUE A;  4MN6 A;  3Q81 A;  1HD8 A;  4OON A;  1T1A A;  5D3O A;  3FV7 A;  5C5K A;  4DF6 A;  4JXS A;  2R9W A;  3HLC A;  2XA7 S;  2ZOH A;  3FKV A;  1OJG A;  5HL6 A;  2ZQ7 A;  5A93 A;  2D01 A;  2EX9 A;  3N8L A;  3MKE A;  4JBF A;  3BW6 A;  1S4S A;  1OTI A;  1PZO A;  4Y7P A;  5EFW A;  1LI0 A;  1MC0 A;  3LEQ A;  3VE3 A;  3LUQ A;  3NCK A;  3R7W A;  2W1T B;  1GHM A;  1GHI A;  1H5X A;  3UE6 A;  2XR0 A;  4E3M A;  4OLD A;  2J3T D;  4OOL A;  4ZRR A;  1I2W A;  1E25 A;  1XGJ A;  1TD5 A;  1ZC2 A;  3IX3 A;  4C3Q A;  3ZG8 B;  5IS1 A;  1SKO A;  3C2W A;  1XJ4 A;  4LV3 A;  4HH2 A;  1PNE A;  1FR6 A;  4Y0O A;  2VGK A;  3S7P A;  2OV5 A;  4EEP A;  3WRT A;  1LSW A;  5CX7 A;  2HF6 A;  4FOF A;  4KZ8 A;  3E0Y A;  3IBJ A;  3VSK A;  2HPB A;  4LRY C;  1NYY A;  1G6O A;  4ETX A;  2Y4A A;  3WWX A;  2ACG A;  3BYD A;  5F82 A;  2L4R A;  2PYR A;  2QJ5 A;  2P04 A;  2V1B A;  3OCN A;  1KGE A;  1PW8 A;  1OJ5 A;  1FSW A;  3BEB A;  4DXC A;  2PR5 A;  2PU2 A;  1W8Q A;  4P87 A;  3PR6 A;  1ESU A;  3WS0 A;  4NK3 A;  4PM7 A;  4YOF A;  2ZMF A;  1CJF A;  3EEH A;  1GSX A;  3HLG A;  2VGL M;  2ZM8 A;  4U0X A;  2R9X A;  1F9I A;  2Z6D A;  1STZ A;  4EES A;  1M6K A;  3FPW A;  5TJJ A;  2G2W A;  1W7F A;  3TJZ C;  1NXY A;  3HLD A;  3O88 A;  4BMW A;  1MKM A;  1ES3 A;  2ZQC A;  1YSQ A;  3CLO A;  2JC7 A;  1SDN A;  3NUL A;  3TSG A;  1FIK A;  3Q7V A;  1ZTU A;  3W4P A;  3H82 B;  5CEB A;  5FDH A;  2PU4 A;  3WS4 A;  1IYP A;  4WM9 A;  4MDZ A;  3S1Y A;  2QYB A;  2EX8 A;  4S2I A;  4C6Y A;  5J3W A;  3N8S A;  2W3E A;  3PXP A;  2V20 A;  1XPB A;  1WYB A;  3SS4 A;  3V39 A;  3BFE A;  4L9F A;  4HJ3 A;  4R4S A;  2W3D A;  4BL2 A;  1YKD A;  3KSF A;  3QHY A;  4RQ9 A;  5GLC A;  2B18 A;  2Y2Q A;  3NJA A;  4UA7 A;  2VJW A;  4WEL A;  3CPT B;  2V1A A;  3OBF A;  4G3W A;  4XT2 B;  1N9B A;  5AQ9 A;  5EV0 A;  2ZM2 A;  3GSG A;  4GCZ A;  3OCL A;  2EFX A;  5CGX A;  4WL9 A;  1DRM A;  1GA0 A;  5AQB A;  3BEC A;  3G4P A;  3FWL A;  5EVI B;  4II7 A;  2OAQ 1;  4LRZ E;  4BLM A;  2HJE A;  4YFM A;  3TE8 A;  1F5M A;  1O7E A;  2XD1 A;  3CJM A;  4M3K A;  4BBV A;  3IQA A;  3OPL A;  2H10 A;  4GJ4 A;  1DP6 A;  1PWD A;  3FYZ A;  4UAA A;  5E2G A;  3FZC A;  1T19 A;  1VEU A;  1GA9 A;  4H6J B;  4GKU A;  4KQD A;  3F1P A;  1L2S A;  4PM5 A;  3O3V A;  2ZM0 A;  3NBL A;  5DVA A;  2PD7 A;  4E3O A;  1Z6F A;  1K57 C;  1UGU A;  4WEK A;  2VGL S;  2P9V A;  2Z6C A;  3S7N A;  1PW1 A;  2XRO A;  4S2N C;  1EI5 A;  3VFH A;  1BLC A;  3VP3 A;  2E8J A;  4Y2F A;  5CED A;  3IHB A;  1DY6 A;  5CHJ A;  2QKP A;  4QHC A;  4Y15 A;  4EBP A;  4LLO B;  4ESP A;  1ES5 A;  4N9K A;  3VOZ A;  3N4I A;  1TVF A;  4XUZ A;  3IH9 A;  4ARZ A;  5J4E A;  4MBF A;  4O01 A;  1K38 A;  2VEA A;  1CF0 A;  3EWK A;  3GV9 A;  4JGO A;  1NRJ A;  2HGV A;  1V9Y A;  4N1H A;  5HL1 A;  4DXB A;  5EVI C;  5JYO A;  3HVF A;  3IS2 A;  3EOI A;  2EA9 A;  1OTB A;  3SS5 A;  1K54 C;  1FQG A;  3RXW A;  5KSH A;  2BTF P;  4BBU A;  4KZ5 A;  3L7H A;  1HTZ A;  2HP6 A;  2Y55 A;  3E2L A;  3C4O A;  2K2N A;  3E4Q A;  2EWV A;  4WMC D;  3BFC A;  3T12 B;  3ZGA B;  2V9A A;  2V0W A;  1SKF A;  3FG8 A;  4B9O A;  4R4R A;  4X68 A;  4DE3 A;  3K3C A;  3MQ0 A;  2O9A A;  4BWI A;  5EUA A;  4AFI A;  2Y2K A;  2ZQD A;  4FH2 A;  2VV8 A;  2EXB A;  3VP1 A;  1OT9 A;  5J7E A;  4WMC A;  3HLE A;  3LR3 A;  1BYW A;  2ZMA A;  3F1N B;  1F98 A;  2NUT C;  3ITB A;  3T4Q A;  3W2Z A;  2WUQ A;  3HCY A;  1N9L A;  2DRW A;  1A0K A;  2IWB A;  4S2J A;  1BLS A;  4BL3 A;  4HBU A;  4Y3I A;  4IBX A;  1VM1 A;  1TS7 A;  1SHV A;  3Q07 A;  2ZJ9 A;  1YMS A;  5F6A A;  3D3O A;  3UMD A;  2Y2O A;  5E2E A;  3BLS A;  2WKE A;  5FQI A;  1AWI A;  2XD5 A;  3UB9 A;  2HV1 A;  3WS1 A;  2A49 A;  5FQQ A;  3DWK A;  5HD5 A;  4JPM A;  3DWZ A;  4XXR A;  3MSH A;  3BY8 A;  4LCL A;  5M18 A;  2INW A;  3SH7 A;  2XA7 M;  1S1Y A;  4LRX C;  2ZLY A;  2Y59 A;  4DDY A;  3N7W A;  3NDE A;  2X02 A;  3A3D A;  5FA7 A;  2ZC6 B;  1NJ4 A;  3R7W B;  4S2M A;  5FAP A;  4Q0I A;  4Y5F A;  1PRQ A;  1JWP A;  3UY6 A;  1I2S A;  3Q82 A;  2XK1 A;  2PBY A;  4M4X A;  4KEN B;  4CLC B;  3S7Q A;  1FIL A;  4ZJ3 A;  5FEG A;  1SZV A;  2Y79 A;  3IWO A;  5FQK A;  5TFQ A;  2X71 A;  1LLB A;  5A92 A;  1NLY A;  1SKO B;  4EER A;  1ZG6 A;  2ZL1 A;  4LV1 A;  4QY5 A;  2Y2M A;  4PPR A;  3M6B A;  2XFT A;  2KOI A;  3ICY A;  4OKP A;  4EUV A;  1YMX A;  3O87 A;  3JVU A;  1SDE A;  2GZA A;  3CUE C;  3MXQ A;  4KQQ A;  1ES4 A;  4MMN A;  5L07 A;  3UE1 A;  1MWS A;  3B42 A;  1DP9 A;  1PZP A;  4IJG A;  1IFQ A;  3CWF A;  4P0M A;  2ZC5 B;  1MXO A;  1D1J A;  3IF6 A;  4LPZ A;  4KZ9 A;  5A90 A;  1XJ6 A;  2WGW B;  4NXB A;  1O07 A;  1FCM A;  3KSH A;  4B88 A;  3IF5 A;  1K25 A;  2FFF B;  1IYQ A;  2C6W B;  4FUW A;  1XGI A;  3QP1 A;  4WEJ A;  4MBK A;  1MZU A;  2H5S A;  4S2P A;  3MQO A;  3ZFZ A;  3QNC A;  4PM8 A;  3IX8 A;  4MEZ A;  3LI9 A;  3MFD A;  1L0D A;  1YLT A;  2OLU A;  3B3X A;  3BFG A;  3LIF A;  3IT9 A;  2B5R A;  3HJI A;  4KZB A;  5HDC A;  4ZJ1 A;  1EW0 A;  1XJ2 A;  4EQI A;  1YSP A;  1PYY A;  3I7J A;  1YQS A;  4X56 A;  4B93 A;  2J3T C;  3QP8 A;  3UO9 A;  2VX8 A;  3A3E A;  4OQH A;  4R0Q A;  3IWI A;  3T50 A;  2M7U A;  1K4E A;  1LL9 A;  4R23 A;  4X69 A;  1SCW A;  4YIN A;  3UB8 A;  4ZJ2 A;  3HL9 A;  4E3I A;  5EOE A;  1LL5 A;  1PFL A;  4LGW A;  1Q2Q A;  4KQO A;  1JVJ A;  4UA9 A;  3A0V A;  2J9O A;  3T1X A;  1NYM A;  2WKP A;  3GQZ A;  4GHI A;  5M19 A;  2J9P A;  4OQG A;  2ZBB A;  5HAP A;  5CTN A;  5HWT A;  5A8B A;  1IEM A;  4CQH A;  4N92 A;  4H8R A;  3QP4 A;  4DE1 A;  3PBN A;  5I94 A;  2IWD A;  5FAQ A;  3S4X A;  3SOI A;  3T4J A;  1JWV A;  1KDW A;  3OPR A;  1ODV A;  3HBR A;  1XXM A;  3EQU A;  3F1P B;  2WAD A;  1CI8 A;  4OH0 A;  5CHU A;  2JKF A;  1NWZ A;  3T1Q B;  4ME4 A;  2WKR A;  2KDK A;  1H8Z A;  3CIT A;  4IVK A;  3VMA A;  3FKW A;  4O0P A;  2P9V B;  1NZO A;  1G5U A;  2VZW A;  4Q0J A;  3NOU C;  1AXB A;  2ZD8 A;  1YM1 A;  3BLM A;  4BD0 A;  1VQQ A;  3KYZ A;  2B02 A;  1J9M A;  1ALQ A;  1OPX A;  3NOP C;  4RX2 A;  3UME A;  4Y0U A;  4OLG A;  3NOT C;  5F69 A;  3D9Y A;  1H3Q A;  2VK3 A;  3T1S A;  4LV0 A;  5DTK A;  2D02 A;  2W3F A;  1ERQ A;  5KMW A;  3LY4 A;  1FCN A;  3JVV A;  4HP9 A;  4U3T A;  2G7U A;  4MLL A;  4FTX A;  1ERO A;  5EOO A;  3ZG9 B;  4WF0 A;  3UE0 A;  1NRF A;  1BUL A;  2DNS A;  3C30 A;  1HLU P;  4QJG A;  1C3B A;  1KOU A;  3IWQ A;  4FCF A;  3CG5 A;  3ZCZ A;  1S1Z A;  3QNB A;  4WZ4 A;  4HQA A;  3CI6 A;  4OP5 A;  4NXF A;  2QHK A;  2HP9 A;  4DJ2 A;  3ZYT A;  1S66 L;  2ZC3 B;  4WUJ A;  4HES A;  3KO6 A;  4HBT A;  3VFF A;  1JTD A;  4OQI A;  4OPQ A;  3IH8 A;  4FSF A;  4R3B A;  2UWX A;  3G6O A;  4D60 A;  3FC7 A;  2V8C A;  5KIZ A;  2FFY A;  4IUK A;  1G28 A;  1KE0 A;  1NLZ A;  2WKQ A;  4S2O A;  1BLH A;  2W1T A;  3H9W A;  2H0T A;  5BOH A;  1YLZ A;  5DTS A;  2PDR A;  3HUN A;  3T4T A;  3MS6 A;  3G30 A;  2W0N A;  2WKI A;  3ZVW A;  1X0O A;  5A91 A;  5GLD A;  1N9O A;  3O86 A;  3E2K A;  1P9R A;  3QP5 A;  3T4S A;  4E3K A;  5HAI A;  1W63 M;  1DP8 A;  3PAE A;  1RP5 A;  3PBO A;  3LIE A;  3BQA A;  3ITA A;  4PKY G;  2HJ9 C;  2Y2J A;  3QP6 A;  5E43 A;  5AVF A;  5EE8 A;  3NDG A;  1H0M A;  1CK3 A;  5DFY A;  3VOL A;  3EEA A;  2V8F A;  4I38 A;  2JKT M;  1YPR A;  2A2L A;  2JKR M;  5FEF A;  4KZ4 A;  5L8M A;  3IXH A;  1VB6 A;  4B4Z A;  2GDN A;  4KZ6 A;  4QPR A;  4RYE A;  4N1X A;  4EBN A;  3Q1F A;  3DAV A;  4JF5 A;  4EWF A;  3G34 A;  3PYP A;  3DTK A;  3A3I A;  3N8R A;  2V2F F;  1Y4O A;  2LB5 A;  4HP4 A;  2HP5 A;  1F2K A;  3DBA A; 
#chains in the Genus database with same CATH homology
 3CHW P;  1J3W A;  3NEC A;  4D60 A;  1FIL A;  5FEG A;  1SZV A;  2V8C A;  2PAV P;  1VEU B;  1G5U A;  1VEU A;  3KYE A;  2JKG A;  1SKO B;  2ZL1 B;  3LEQ A;  2ZL1 A;  1Z09 A;  4X1L A;  5EM1 A;  5FDS A;  5EVE A;  3NUL A;  1FIK A;  1K0K A;  1VET A;  3MS6 A;  3LGO A;  3L9K A;  2E8J A;  1SKO A;  3D9Y A;  3T1S A;  2VK3 A;  4X1M A;  1PNE A;  2PRF A;  4ESP A;  1PFL A;  3T1X A;  4FTX A;  4QWO A;  1D1J A;  1CF0 A;  3CPT B;  3CPT A;  4X25 A;  3U4L P;  3T1R A;  2B95 A;  1HLU P;  1AWI A;  2HZ5 A;  2ACG A;  5EV0 A;  3MSH A;  2V8F A;  1YPR A;  4FUW A;  5FEF A;  2BTF P;  5EM0 A;  3L7H A;  3DAV A;  1CJF A;  1CQA A;  1PRQ A;  3UB5 P;  2JKF A;  1ACF A;  1Y4O A;  2PBD P;  3T12 B;  3T1Q B;  1F2K A;  1A0K A;  1VET B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...