1Z09A

Solution structure of km23
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynein light chain 2A, cytoplasmic
publication title Structure and Dynamics of the Homodimeric Dynein Light Chain km23.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 15
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1z09A00
1D1JA 1PFLA 2HZ5A 3L9KA 2BTFP 3DAVA 2E8JA 1CF0A 2PBDP 2ZL1B 2V8FA 4X1LA 4FTXA 3T1RA 1J3WA 3MSHA 1A0KA 4FUWA 3L7HA 5EVEA 4X1MA 5FEGA 5EM1A 3T1SA 1AWIA 2VK3A 1F2KA 5FEFA 3MS6A 2JKGA 4D60A 1FIKA 1SKOA 1Z09A 1K0KA 2B95A 2PRFA 1YPRA 4X25A 3LGOA 1SZVA 3U4LP 1VETA 2V8CA 1PRQA 3KYEA 1VEUA 1HLUP 3D9YA 2PAVP 3T1QB 3NULA 2JKFA 3T1XA 2ZL1A 1CQAA 5EM0A 1FILA 1SKOB 1G5UA 3CHWP 3UB5P 3CPTA 5EV0A 4QWOA 3T12B 3NECA 5FDSA 1PNEA 1Y4OA 1VETB 3CPTB 1VEUB 3LEQA 1ACFA 4ESPA 2ACGA 1CJFA
chains in the Genus database with same CATH superfamily
3Q81A 1V9YA 2BTFP 3DAVA 1IEMA 1XGJA 2HF6A 5DF8A 2OLUA 3EGXC 3E4OA 3LIEA 4EBLA 2A49A 5GLCA 1S1YA 3UE3A 2A3UA 3KSHA 1PIOA 3QNCA 4FUWA 4I39A 3IF6B 2A24A 1W63Q 3UB8A 3OPHA 3MKEA 3NCKA 5AQ9A 5EM1A 3G2ZA 1OTBA 3MS6A 4JXSA 4D60A 2O9AA 2FFYA 2QJ7A 2ZC3B 3N8RA 3IQAA 1K57C 3FC7A 5I5LA 4KZAA 3RXXA 2IWDA 3SOIA 2HP9A 2O9CA 4WF0A 3NI9A 2J9OA 1HLUP 4D2OA 4WLAA 4ZJ3A 4GHIB 1BLPA 2Y2QA 4RX2A 3O88A 1YLJA 2R9XA 5TJJA 5L09A 3UB7A 3MBZA 2WKHA 3HUNA 1PI5A 4RYEA 3S7QA 1ZKJA 3CPTA 3B33A 4DE0A 3IH8A 1ESIA 5FQJA 1Y4OA 1K57A 3SH7A 2Q9MA 4OPRA 1HTZA 3LEQA 2VA0A 3KO6A 4G3WA 2HZ5A 3L9KA 1RGZA 2Y8HA 2W3EA 5GLAA 3BJNA 3HUOA 3LIAA 4JGQA 1ES3A 3GMWA 1MKIA 3LR0A 2UWXA 4G3VA 2V8FA 3LCEA 4P87A 1OT6A 4IVIA 3K3CA 4BBUA 4X6TA 5HD3A 2WGWA 4LGWA 2WGVA 1ES5A 1D7EA 4HI4A 4B4ZA 5HARA 1CEGA 3C5AA 4BBVA 2Y2PA 3LR5A 1LI0A 4MBKA 3ZG9B 4NXBA 4KQRA 5FAOA 3V67A 4QU3A 3EEAA 2OLVA 3ZG8B 1VB6A 2JN7A 1XP4A 3IF6C 4Z9QA 1DRMA 5HWWA 3A0RA 1JWVA 2KOIA 4HIAA 4R3JA 1WYBA 4DXCA 1BULA 4XUZA 4BLMA 2L1MA 4YINA 4GD6A 1VETA 2GZAA 1MC0A 1PWCA 2O0YA 1CEFA 2VGLM 4M3KA 2ZC4B 4HQAA 3BFGA 5A8BA 4HOIA 4FCFA 5FSRA 4EWFA 3ZVWA 5CECA 3OPRA 1G5UA 3N8SA 4R3AA 5DFXA 1Y28A 3HLEA 3M2JA 3IF6A 4RA7A 2WADA 1N9LA 1XX2A 2QMIA 3OPLA 1S6RA 3F1OB 3QP1A 2ACGA 4KUOA 4G3KA 2E8IA 1W7FA 2PR5A 3F1PB 3DBAA 1RCJA 4JXGA 5A93A 2XDMA 1L3LA 3UY6A 3BQAA 4IBXA 3NC8A 1TS0A 2QHKA 4WBGA 3VSLA 5CHMA 2XRNA 4IUHA 3BY9A 3L7HA 4X1MA 3WS5A 3MQOA 4BBTA 2XGNA 2A2LA 4ARZA 1AWIA 1F2KA 3P7NA 3IWOA 4PKYA 5C5KA 3VP4A 3ZDJA 3Q82A 1TS6A 1GHPA 1FR6A 4NXFA 3HJKA 3S4XA 1PYYA 1VQQA 1H5XA 4X53A 5HSQA 3IX4A 4MDZA 2X02A 3FKVA 1S4SA 1YT4A 2ZD8A 4WM9A 4BQMA 3B3XA 1GSXA 5HDSA 3OLOA 4OLGA 2PYPA 4HP4A 3W4PA 4E6WA 2WKQA 4KZBA 1WA9A 2H0TA 1K54C 2PD7A 3NJAA 4E3IA 1G6OA 2Z2LB 4OOMA 4ZAMA 1K4EA 3T12B 4OQGA 5G18A 2W1RA 4OOYA 5EECA 3ZNYA 4HESA 5CGWA 4P85A 4WZ5C 3QP4A 3OCLA 4PM6A 1OTDA 5F68A 5M1AA 4EQ1A 5KIZA 2K2NA 2WZZA 1NWZA 2E8JA 3A3DA 3A0VA 5FL3A 2PT7A 2Y2NA 1KDSA 3P98A 1MWUA 2IA2A 1YQSA 1LLBA 2HDSA 3RFBA 4Y0OA 4BWIA 4S2PA 1A0KA 2W0NA 3VP1A 1K54A 5DF9A 3UPOA 1UWPX 3A3IA 3HL9A 5KSHA 4CLCB 1EI5A 2VV6A 5D3OA 1FIKA 4WZ5A 4GS9B 3S7OA 1NYMA 2D02A 3CJMA 3JYIA 1LHYA 4BJPA 5HAPA 1YLYA 4BENA 1DJAA 3IHBA 2ZC6B 4GZBA 2Y2LA 1GCEA 3MKFA 3OCNA 4LV0A 1S66L 1ZTUA 4L9FA 3OOVA 1OJ5A 5IHVA 2ZM8A 4EETB 1O7EA 2EX9A 5TGFA 5L2FA 3DWKA 3P09A 1WE4A 4Y0UA 5CGXA 2OOLA 3C4PA 1K38A 3GECA 3W4OA 1BSGA 1NZOA 1JTGA 2J7VA 3BYDA 4I3IA 4P6ZS 3VE3A 1IKGA 1X0OA 2B5RA 2DNSA 3UB5P 3FPWA 2OV5A 2XEPA 2EX8A 2KLIA 3MZFA 1DJBA 3BFEA 1U60A 2HP5A 4H8RA 4P0MA 3V3RA 2W27A 2WUQA 4NXEA 2ZQCA 3T4JA 4KZ8A 3LICA 2QYBA 2WK0A 4Q8IA 1KDWA 2Y4AA 3NHQA 4PM7A 4UHUA 3UPNA 4L9EA 3FG8A 3VP3A 3CUEC 1VM1A 1YSQA 2G2WA 4NK3A 3VV4A 4DRTA 4DXBA 4DE3A 2KX6A 1L0DA 3ZFZA 3DWZA 2XA7M 3GR2A 5FQMA 1BZAA 3T1SA 5J3WA 5CX7A 3K2NA 1EW0A 1SDNA 4BMWA 3S1YA 1L2SA 4X68A 2PU4A 2ZMFA 3ITBA 4I3JA 3IWQA 1L0EA 2V0UA 4KQQA 2GJ3A 3O87A 4EV4A 3ZGAB 4JXWA 4R38A 1KE4A 3KYQA 1K25A 1BT5A 3CUEA 4CLCC 5KMWA 3LY3A 2C6WB 3BFCA 3C4OA 2JKFA 2ZBBA 3SS4A 4UEYA 5F5YA 3G35A 2VZWA 1OTIA 1ZG4A 1XFNA 3CWFA 5EM0A 2Z2MB 4KG2A 4OONA 4Y13A 5EV0A 3DW0A 3NECA 2V1BA 3FYZA 3IWIA 4YFMA 3SS5A 5CTMA 4KZ4A 4H6JB 1IYPA 3WS2A 2XFSA 1D1JA 4BD1A 2XR0A 1K56A 2XA7S 2R78A 4GS9A 1NLZA 4B88A 1UGUA 2ZMAA 4I38A 5DTTA 4Y3IA 3T1RA 3IBRA 2JC7A 4OQ0A 1MPLA 5F1GA 4FD8A 4JXVA 4N9KA 4OVDA 1P97A 5HL6A 5IU1A 3Q7VB 4X55A 2XSSA 5FI2A 2JKGA 2W3DA 4Y17A 4IJGA 1EROA 4PMAA 3ZG5A 5I94A 2LB9A 3GDIA 3PHYA 4O0PA 3P01A 3V39A 4WMCA 2M7VA 4BL2A 2V8CA 3F1NA 1GHIA 5KSCA 2CC1A 3UMDA 2Y2GA 5L07A 4FH2A 1F98A 4IBRA 3NDEA 1DJCA 4JF4A 4JPMA 3RTYA 5HPFA 2HV1A 3FZCA 4C6YA 3T1XA 3E4QA 4QHCA 4PPRA 4KG5A 2Q9NA 1BLCA 3QP8A 5GHXA 5A91A 2XD5A 2CMNA 4K0WA 4MEZA 3GSGA 4N1HA 3TSGA 1Q2PA 4OKPA 2ZM2A 4NXGA 2VLGA 3AGEA 3TE8A 5GHYA 1KGFA 4JBFA 4F3LA 3SW1A 4Y7PA 1MXOA 1TF1A 3BRMA 2ZQ8A 3T4KA 3T4LA 4JGPA 4DF6A 4E3OA 2IWBA 1KGEA 5HWVA 1IOUA 1WYCA 1YLPA 3D3OA 5FI6A 3CITA 1STZA 1OJGA 3WS0A 4RVAA 1K56D 4GB7A 2WGIA 3N7WA 4O01A 4JGRA 3N8LA 5IS1A 3S7PA 4R1GA 4N1XA 1VHMA 2LB5A 2V20A 2MJ6A 2O99A 3WRZA 1Y54A 3E4PA 4OQIA 4U0XA 1E3UA 4KQDA 4DN0A 5M18A 4QJGA 3LIDA 4H6JA 3HLDA 5J7EA 3T1QB 1LL5A 3HCYA 1H8YA 3ZVTA 3HLFA 3T4QA 1XJ2A 3BLSA 2J3WA 2PHYA 2OWHA 1TDGA 2WKEA 4A5RA 3BLMA 3IS2B 4NETA 1L0GA 4U3TA 4LENA 2V0WA 4HP9A 2Y91A 3HLWA 3Q7VA 4EUVA 1XA1A 2J80A 3M6HA 4ZTKA 3LO7A 3ZHHA 3C38A 4GN2A 2DCFA 4E3NA 1CF0A 3RH8B 2X71A 2VGKA 4UA6A 5FDHA 5DJTA 3BW6A 4FSFA 3MSHA 3HREA 5FA7A 2WAEA 3PBOA 1N9OA 3T4TA 4Z1WA 5HX9A 3UDFA 3MJQA 3IT9A 1MBLA 1KVMA 3IBJA 4Q0IA 2ZQAA 4MBFA 2Y79A 1I2SA 3R7WB 4KZ6A 5EVIB 4E3MA 2OAP1 4R0QA 5DFYA 5HZHA 2VKSA 2B95A 1ODVA 1CI9A 4HEFA 2XLNA 3CZDA 2QJ5A 3IXGA 3NBLA 3NDGA 5JYOA 4GHIA 2BASA 1HZOA 2V9AA 3G2YA 3DTIA 5M19A 2VGLS 3UDXA 4MN7A 2P9VB 4ZDXA 4ZRRA 3EQUA 1XA7A 3UB6A 4R3BA 3QP2A 4JF6A 2QZ6A 3OPPA 3WS4A 4C3QA 2HDQA 1NRJA 1LL9A 4E3LA 4Q0HA 2JKRI 4QWOA 3PYPA 3K3DA 4QD4A 1OPXA 3IF5A 4S2KA 3H7WB 2L0WA 5F82A 4GD8A 3NY4A 3NIAA 4MN5A 3GQZA 3QP5A 2ZL1B 3A0SA 4CLCE 1FSYA 4HBUA 3IXDA 1DY6A 5HDCA 4DDSA 4HJ4A 3E2KA 1BUEA 5A92A 1Z6FA 1XJ6A 1HVBA 3VSKA 3ZYTA 5CEDA 2JKTI 4LRXC 5FQIA 3NOUC 1OTAA 3D4FA 2W1TB 3O3VA 1KGGA 1T19A 5E2FA 4PM8A 4N92A 2B18A 4S2MA 5FEFA 4IEDA 4N9LA 1GSVA 5E2HA 1P9RA 3S7NA 3UE1A 3LYXA 1ONHA 1H8ZA 3QHYA 5A90A 3G34A 3IS2A 5L10A 1MWTA 2IWCA 3GRJA 2XD1A 4WN5A 3PBNA 3U4LP 3LR3A 2Y2OA 3TW8A 3EEHA 5G4ZA 5EVIC 4EXOA 2ZQDA 4EESA 2PBYA 2AVXA 2Y55A 3ZG0A 3KSGA 2ZOIA 3RXWA 1IYOA 4UA7A 1PI4A 4HY8A 3BWLA 3CAXA 3UPPA 1T18A 5L8MA 3CHWP 2XF3A 1W8QA 1TS7A 3F1OA 1MZUA 3LFVA 1TEMA 4WL9A 1JNUA 4XT2B 4S2JA 3F1PA 3MXRA 3U2AA 1H3QA 4S2IA 1YMSA 3BECA 1LSXA 2GX5A 3KYZA 1N4OA 2Q0OA 1K6RA 3OBFA 4NEED 3FPVA 3C7UA 3UN7A 4L0LA 5E2GA 2OAQ1 4EEUA 3M6BA 1JTDA 4F94A 2VX8A 2VJWA 1P0ZA 4KG6A 3B47A 3V5MA 3V50A 3M2KA 4X69A 3LIBA 4B9OA 2QWSA 1ESUA 3VFHA 2VK3A 2P08A 4E04A 3BFFA 2QKPA 1XXMA 4YNRA 4HNBA 3N6IA 4QB8A 4P6BA 2JKTM 2NUTC 4ETXA 4UQIM 5TFQA 2XK1A 4PKYG 2YKHA 4GCZA 4QY5A 2EFUA 2GDNA 5EOOA 3BFDA 2HGVA 4I5SA 2W3GA 2ZL1A 1NZUA 3T4OA 3VOYA 2PDRA 5AQ7A 1IFQA 1BLHA 1K4FA 4Q0JA 3BY8A 3R4KA 2GNXA 1F9IA 3LR4A 4KZ7A 1XGIA 1LT0A 2W1TA 1JWPA 2P74A 3LI9A 3CPTB 5FAPA 3AGFA 2Y2JA 3SS3A 5F6AA 3H9WA 2VV7A 4GJ4A 3UO9A 1TDLA 5EUAA 1J9MA 2PBDP 4K0XA 2EFXA 1SHVA 3PAEA 3GVBA 1H8MA 2J9PA 2PU2A 4ID4A 2I9VA 5DTKA 5EVEA 3OC2A 5BOHA 2Z6DA 2WGWB 1KE3A 1W5DA 4CLCA 4UQIS 5TBMB 4UAAA 5FQQA 2EWWA 3LIFA 3MQ0A 3EGDC 2W3HA 4GW9A 4WYYA 2HDRA 1YKDA 2EWVA 2EX6A 4XXRA 2PRFA 4YWZA 4DJ3A 2G2UA 1ZC2A 2EXBA 3KSIA 5EOEA 2Y2KA 4EBPA 3PBSA 1XKZA 3JPUA 1I5QA 4OPYA 5FASA 3HLBA 3MFXA 1PZOA 3D72A 4DMZA 1S4RA 3TOIA 3W2ZA 4KZ9A 2OWJA 4DE2A 4QPRA 1CQAA 4FOFA 1W63M 4OLDA 5HFOA 2YKFA 4CJNA 4UA9A 4EU0A 4KENB 2WKRA 3G4PA 4R4SA 4LRYC 3SH8A 3SZTA 1NY0A 3VE4A 1LI9A 1HD8A 4HJ6A 2ZC7A 3NOTC 3ISGA 3O86A 1NYYA 5LBRA 4R4RA 1G28A 4ZBEA 3BM6A 1IKIA 5CERA 5K5BA 4LFUA 5CTNA 4EEPA 1C3BA 3VOZA 3ULFA 5AVFA 4B4XA 3Q7ZA 5IT5A 2PYRA 1XFQA 1MWSA 2UV0E 2M1CA 1YAXA 2B02A 4S2NC 3V3SA 4R6LA 4WEJA 4WEKA 4LV3A 1UWNX 4LCMA 3B42A 4GDNA 3LEZA 3VMAA 3FWLA 2W3FA 3HVFA 4ZJ2A 4ARZB 4K08A 3G30A 2HP6A 2INWA 1LSWA 1ALQA 4CLCD 3N4IA 1QMEA 1FOFA 1CK3A 1YPRA 3DTKA 1SZVA 5J4EA 4E3JA 2FH5A 3G32A 3IH9A 4IUKA 2VGJA 3KYEA 1XJ4A 2H10A 4B93A 2J3TC 1QMFA 4WUJA 1SKFA 1E4DA 2VEAA 3DTEA 4S2NA 3UNWA 4DE1A 1FCMA 1GA9A 2V1AA 2D01A 1SKOB 3BQ8A 4GKUA 3O5YA 4LV2A 4BL3A 5TBMA 3PAGA 5MC7A 1ERQA 1S67L 2Y2MA 4WMCD 3MMHA 4S2OA 2FFFB 2P7JA 4NKPA 3C7VA 5F83A 4X1LA 5GLDA 4E6XA 3EWKA 4Y2FA 1MKMA 1KE0A 5HWTA 1RGYA 1GHMA 2C5WB 4OH0A 4PAUA 5E2EA 1G68A 3HLCA 2JBFA 1PWGA 2EA9A 2EX2A 1E25A 2V1ZA 1L0FA 3PBQA 3MXQA 5CGSA 3C30A 1K55C 1FQGA 1YMXA 4KZ5A 3IXHA 3QP6A 2KDKA 4LRZE 3PXPA 3WRTA 4GOGA 4Y15A 3ZQ5A 1N9BA 1Z09A 4MMNA 5CHJA 2WKPA 1EWZA 3EQVA 5HW3A 1BLSA 2HDUA 4DKIA 5CEBA 3H82B 4JLFA 2XFTA 5JYPA 3W4QA 4GDBA 3TRCA 4DDYA 2WZXA 1TS8A 3E98A 2PAVP 3IX8A 1CI8A 5HDDA 1FCNA 2RCXA 4HHDA 2HPBA 1K55A 4O8GA 3QNBA 4MN6A 1NLYA 5F69A 2K7SA 3CI6A 4IVKA 4CQHA 5AJGA 3C8CA 3PTEA 3ZCZA 2ZC5B 2QPNA 2H5SA 2XH9A 2ZLYA 3BEBA 1OMEA 3RJUA 2H28A 3FKWA 1E3UD 1M6KA 4JKTA 1IELA 2JHEA 4II7A 3Q07A 2XQZA 4FTXA 1RP5A 4DJ2A 3WWXA 4R70A 4C75A 4OP8A 5FAQA 1H0MA 2PR6A 4PHTA 2J3TD 2Y2HA 1P9WA 5AQBA 3CMZA 4KUKA 1KOUA 3WS1A 2RL3A 3NOPC 1ZG6A 1S1ZA 3LI8A 5DKLA 2O9BA 4K91A 5CHUA 1D06A 4MNRA 3UB9A 4YOFA 1SKOA 4OPQA 1YM1A 5TR7A 1NJ4A 3IHAA 5AVEA 3MF0A 3OZHA 1JVJA 1M40A 3I7JA 2WAFA 1O07A 3PBRA 2EXAA 4R23A 3TG9A 1SCWA 2Y2IA 1ES2A 4LLOB 1FSWA 5CXWA 5J8XA 3D9YA 4RQ9A 3VP2A 1FCOA 4IHQA 4M4XA 4L9GA 1T1BA 3Q1FA 3CLOA 3MFDA 2M7UA 3HUMA 4LPZA 2ZQ9A 4P6ZM 1BTLA 3PR6A 2V2FF 3CG5A 1DP6A 3SH9A 4QY6A 3MR0A 5E43A 3JVUA 1Q2QA 2K31A 2Z6CA 1I2WA 2X01A 3VP0A 5FATA 3IX3A 5FI7A 3ITAA 4GLQA 1DP9A 4MLLA 1VEUB 4ESPA 5HL1A 1CJFA 3A3FA 1ZHHB 3UMEA 2HJ9C 5HPIA 4LV1A 3UDIA 5EE8A 2WYXA 5HAIA 1W79A 5HD5A 1ES4A 2P04A 5HAQA 4ZJ1A 3H82A 1KVLA 2NUPC 5DTSA 5DF7A 4XUXA 2Y59A 5GHZA 2L4RA 1NRFA 4CPKA 2FZ0A 3G6OA 3EOIA 3R7WA 2BLSA 3JVVA 1TVFA 5EVIA 4EQIA 5FEGA 2ZQ7A 3LY4A 2WKIA 3HLGA 4S2LA 2JKRM 3FV7A 1N9NA 2G7UA 3UE0A 1FR1A 1V9ZA 3A3EA 2J8YA 3E2LA 4OP5A 4WELA 3E0YA 2H0YA 1IYSA 1AXBA 1G6AA 1ERMA 2P9VA 5U47A 1LL8A 2A24B 4JF5A 3ZG7B 4U0TA 3MZEA 1ONGA 1OT9A 3NULA 1S0WA 5KZHA 4HBTA 3F1NB 1GSWA 2HJEA 4MCWA 3G31A 1YLWA 4EBNA 1YLTA 3UE6A 5EFWA 4FH4A 1PW8A 2R9WA 4I3AA 4OOLA 4HJ3A 1XJ3A 3H7WA 4E3KA 3MXSA 5GL9A 1F5MA 4EERA 4JGOA 1LSVA 1XPBA 3DTMA 4O7DA 4MBHA 2ZMVA 1NXYA 1IYQA 3KX0X 3VOLA 1PFLA 1BYWA 4RX3A 1PWDA 4F3LB 3IXBA 5CRFA 4OQHA 5DJUA 1T1AA 1YSPA 5FQ9A 4PM9A 2DRWA 4KZ3A 3T50A 1J3WA 1MWRA 5AQAA 3TJZC 4AFIA 1JWZA 1W8YA 2BG1A 1PZPA 2I72A 3C2WA 3HJIA 4BD0A 5EPHA 3GTCA 1MY8A 2ZOHA 2JE5A 3LUQA 2XROA 4GNUA 4HH3A 4OPZA 4HH2A 1T1CA 2VV8A 5DVAA 3ZNTA 1K0KA 1K6SA 4X56A 3S22A 3ICYA 2OSUA 2PD8A 5EVID 3PBTA 2DMWA 4Y5FA 5G4YA 4X25A 3LGOA 3MZDA 4ME4A 5GLBA 1TD5A 1PRQA 1GA0A 1VEUA 4KQOA 4PM5A 4ETZA 2JCHA 4NG2A 4Y0TA 2ZJ9A 2ZM0A 4EW7A 3HBRA 3W8KA 1FILA 4EUZA 3GV9A 5EVLA 4XT2A 1YLZA 3AGDA 5FQKA 1OTEA 3VFFA 1SDEA 3T4SA 5FDSA 1PNEA 5F1FA 4WZ4A 1VETB 4LCLA 3A3JA 1DP8A 3KSFA 3MQQA 1ACFA 1PW1A 5DKKA
chains in the Genus database with same CATH topology
1D1JA 1PFLA 2HZ5A 3L9KA 2BTFP 3DAVA 2E8JA 1CF0A 2PBDP 2ZL1B 2V8FA 4X1LA 4FTXA 3T1RA 1J3WA 3MSHA 1A0KA 4FUWA 3L7HA 5EVEA 4X1MA 5FEGA 5EM1A 3T1SA 1AWIA 2VK3A 1F2KA 5FEFA 3MS6A 2JKGA 4D60A 1FIKA 1SKOA 1Z09A 1K0KA 2B95A 2PRFA 1YPRA 4X25A 3LGOA 1SZVA 3U4LP 1VETA 2V8CA 1PRQA 3KYEA 1VEUA 1HLUP 3D9YA 2PAVP 3T1QB 3NULA 2JKFA 3T1XA 2ZL1A 1CQAA 5EM0A 1FILA 1SKOB 1G5UA 3CHWP 3UB5P 3CPTA 5EV0A 4QWOA 3T12B 3NECA 5FDSA 1PNEA 1Y4OA 1VETB 3CPTB 1VEUB 3LEQA 1ACFA 4ESPA 2ACGA 1CJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D1J A;  1PFL A;  2HZ5 A;  3L9K A;  2BTF P;  3DAV A;  2E8J A;  1CF0 A;  2PBD P;  2ZL1 B;  2V8F A;  4X1L A;  4FTX A;  3T1R A;  1J3W A;  3MSH A;  1A0K A;  4FUW A;  3L7H A;  5EVE A;  4X1M A;  5FEG A;  5EM1 A;  3T1S A;  1AWI A;  2VK3 A;  1F2K A;  5FEF A;  3MS6 A;  2JKG A;  4D60 A;  1FIK A;  1SKO A;  1Z09 A;  1K0K A;  2B95 A;  2PRF A;  1YPR A;  4X25 A;  3LGO A;  1SZV A;  3U4L P;  1VET A;  2V8C A;  1PRQ A;  3KYE A;  1VEU A;  1HLU P;  3D9Y A;  2PAV P;  3T1Q B;  3NUL A;  2JKF A;  3T1X A;  2ZL1 A;  1CQA A;  5EM0 A;  1FIL A;  1SKO B;  1G5U A;  3CHW P;  3UB5 P;  3CPT A;  5EV0 A;  4QWO A;  3T12 B;  3NEC A;  5FDS A;  1PNE A;  1Y4O A;  1VET B;  3CPT B;  1VEU B;  3LEQ A;  1ACF A;  4ESP A;  2ACG A;  1CJF A; 
#chains in the Genus database with same CATH topology
 3Q81 A;  1V9Y A;  2BTF P;  3DAV A;  1IEM A;  1XGJ A;  2HF6 A;  5DF8 A;  2OLU A;  3EGX C;  3E4O A;  3LIE A;  4EBL A;  2A49 A;  5GLC A;  1S1Y A;  3UE3 A;  2A3U A;  3KSH A;  1PIO A;  3QNC A;  4FUW A;  4I39 A;  3IF6 B;  2A24 A;  1W63 Q;  3UB8 A;  3OPH A;  3MKE A;  3NCK A;  5AQ9 A;  5EM1 A;  3G2Z A;  1OTB A;  3MS6 A;  4JXS A;  4D60 A;  2O9A A;  2FFY A;  2QJ7 A;  2ZC3 B;  3N8R A;  3IQA A;  1K57 C;  3FC7 A;  5I5L A;  4KZA A;  3RXX A;  2IWD A;  3SOI A;  2HP9 A;  2O9C A;  4WF0 A;  3NI9 A;  2J9O A;  1HLU P;  4D2O A;  4WLA A;  4ZJ3 A;  4GHI B;  1BLP A;  2Y2Q A;  4RX2 A;  3O88 A;  1YLJ A;  2R9X A;  5TJJ A;  5L09 A;  3UB7 A;  3MBZ A;  2WKH A;  3HUN A;  1PI5 A;  4RYE A;  3S7Q A;  1ZKJ A;  3CPT A;  3B33 A;  4DE0 A;  3IH8 A;  1ESI A;  5FQJ A;  1Y4O A;  1K57 A;  3SH7 A;  2Q9M A;  4OPR A;  1HTZ A;  3LEQ A;  2VA0 A;  3KO6 A;  4G3W A;  2HZ5 A;  3L9K A;  1RGZ A;  2Y8H A;  2W3E A;  5GLA A;  3BJN A;  3HUO A;  3LIA A;  4JGQ A;  1ES3 A;  3GMW A;  1MKI A;  3LR0 A;  2UWX A;  4G3V A;  2V8F A;  3LCE A;  4P87 A;  1OT6 A;  4IVI A;  3K3C A;  4BBU A;  4X6T A;  5HD3 A;  2WGW A;  4LGW A;  2WGV A;  1ES5 A;  1D7E A;  4HI4 A;  4B4Z A;  5HAR A;  1CEG A;  3C5A A;  4BBV A;  2Y2P A;  3LR5 A;  1LI0 A;  4MBK A;  3ZG9 B;  4NXB A;  4KQR A;  5FAO A;  3V67 A;  4QU3 A;  3EEA A;  2OLV A;  3ZG8 B;  1VB6 A;  2JN7 A;  1XP4 A;  3IF6 C;  4Z9Q A;  1DRM A;  5HWW A;  3A0R A;  1JWV A;  2KOI A;  4HIA A;  4R3J A;  1WYB A;  4DXC A;  1BUL A;  4XUZ A;  4BLM A;  2L1M A;  4YIN A;  4GD6 A;  1VET A;  2GZA A;  1MC0 A;  1PWC A;  2O0Y A;  1CEF A;  2VGL M;  4M3K A;  2ZC4 B;  4HQA A;  3BFG A;  5A8B A;  4HOI A;  4FCF A;  5FSR A;  4EWF A;  3ZVW A;  5CEC A;  3OPR A;  1G5U A;  3N8S A;  4R3A A;  5DFX A;  1Y28 A;  3HLE A;  3M2J A;  3IF6 A;  4RA7 A;  2WAD A;  1N9L A;  1XX2 A;  2QMI A;  3OPL A;  1S6R A;  3F1O B;  3QP1 A;  2ACG A;  4KUO A;  4G3K A;  2E8I A;  1W7F A;  2PR5 A;  3F1P B;  3DBA A;  1RCJ A;  4JXG A;  5A93 A;  2XDM A;  1L3L A;  3UY6 A;  3BQA A;  4IBX A;  3NC8 A;  1TS0 A;  2QHK A;  4WBG A;  3VSL A;  5CHM A;  2XRN A;  4IUH A;  3BY9 A;  3L7H A;  4X1M A;  3WS5 A;  3MQO A;  4BBT A;  2XGN A;  2A2L A;  4ARZ A;  1AWI A;  1F2K A;  3P7N A;  3IWO A;  4PKY A;  5C5K A;  3VP4 A;  3ZDJ A;  3Q82 A;  1TS6 A;  1GHP A;  1FR6 A;  4NXF A;  3HJK A;  3S4X A;  1PYY A;  1VQQ A;  1H5X A;  4X53 A;  5HSQ A;  3IX4 A;  4MDZ A;  2X02 A;  3FKV A;  1S4S A;  1YT4 A;  2ZD8 A;  4WM9 A;  4BQM A;  3B3X A;  1GSX A;  5HDS A;  3OLO A;  4OLG A;  2PYP A;  4HP4 A;  3W4P A;  4E6W A;  2WKQ A;  4KZB A;  1WA9 A;  2H0T A;  1K54 C;  2PD7 A;  3NJA A;  4E3I A;  1G6O A;  2Z2L B;  4OOM A;  4ZAM A;  1K4E A;  3T12 B;  4OQG A;  5G18 A;  2W1R A;  4OOY A;  5EEC A;  3ZNY A;  4HES A;  5CGW A;  4P85 A;  4WZ5 C;  3QP4 A;  3OCL A;  4PM6 A;  1OTD A;  5F68 A;  5M1A A;  4EQ1 A;  5KIZ A;  2K2N A;  2WZZ A;  1NWZ A;  2E8J A;  3A3D A;  3A0V A;  5FL3 A;  2PT7 A;  2Y2N A;  1KDS A;  3P98 A;  1MWU A;  2IA2 A;  1YQS A;  1LLB A;  2HDS A;  3RFB A;  4Y0O A;  4BWI A;  4S2P A;  1A0K A;  2W0N A;  3VP1 A;  1K54 A;  5DF9 A;  3UPO A;  1UWP X;  3A3I A;  3HL9 A;  5KSH A;  4CLC B;  1EI5 A;  2VV6 A;  5D3O A;  1FIK A;  4WZ5 A;  4GS9 B;  3S7O A;  1NYM A;  2D02 A;  3CJM A;  3JYI A;  1LHY A;  4BJP A;  5HAP A;  1YLY A;  4BEN A;  1DJA A;  3IHB A;  2ZC6 B;  4GZB A;  2Y2L A;  1GCE A;  3MKF A;  3OCN A;  4LV0 A;  1S66 L;  1ZTU A;  4L9F A;  3OOV A;  1OJ5 A;  5IHV A;  2ZM8 A;  4EET B;  1O7E A;  2EX9 A;  5TGF A;  5L2F A;  3DWK A;  3P09 A;  1WE4 A;  4Y0U A;  5CGX A;  2OOL A;  3C4P A;  1K38 A;  3GEC A;  3W4O A;  1BSG A;  1NZO A;  1JTG A;  2J7V A;  3BYD A;  4I3I A;  4P6Z S;  3VE3 A;  1IKG A;  1X0O A;  2B5R A;  2DNS A;  3UB5 P;  3FPW A;  2OV5 A;  2XEP A;  2EX8 A;  2KLI A;  3MZF A;  1DJB A;  3BFE A;  1U60 A;  2HP5 A;  4H8R A;  4P0M A;  3V3R A;  2W27 A;  2WUQ A;  4NXE A;  2ZQC A;  3T4J A;  4KZ8 A;  3LIC A;  2QYB A;  2WK0 A;  4Q8I A;  1KDW A;  2Y4A A;  3NHQ A;  4PM7 A;  4UHU A;  3UPN A;  4L9E A;  3FG8 A;  3VP3 A;  3CUE C;  1VM1 A;  1YSQ A;  2G2W A;  4NK3 A;  3VV4 A;  4DRT A;  4DXB A;  4DE3 A;  2KX6 A;  1L0D A;  3ZFZ A;  3DWZ A;  2XA7 M;  3GR2 A;  5FQM A;  1BZA A;  3T1S A;  5J3W A;  5CX7 A;  3K2N A;  1EW0 A;  1SDN A;  4BMW A;  3S1Y A;  1L2S A;  4X68 A;  2PU4 A;  2ZMF A;  3ITB A;  4I3J A;  3IWQ A;  1L0E A;  2V0U A;  4KQQ A;  2GJ3 A;  3O87 A;  4EV4 A;  3ZGA B;  4JXW A;  4R38 A;  1KE4 A;  3KYQ A;  1K25 A;  1BT5 A;  3CUE A;  4CLC C;  5KMW A;  3LY3 A;  2C6W B;  3BFC A;  3C4O A;  2JKF A;  2ZBB A;  3SS4 A;  4UEY A;  5F5Y A;  3G35 A;  2VZW A;  1OTI A;  1ZG4 A;  1XFN A;  3CWF A;  5EM0 A;  2Z2M B;  4KG2 A;  4OON A;  4Y13 A;  5EV0 A;  3DW0 A;  3NEC A;  2V1B A;  3FYZ A;  3IWI A;  4YFM A;  3SS5 A;  5CTM A;  4KZ4 A;  4H6J B;  1IYP A;  3WS2 A;  2XFS A;  1D1J A;  4BD1 A;  2XR0 A;  1K56 A;  2XA7 S;  2R78 A;  4GS9 A;  1NLZ A;  4B88 A;  1UGU A;  2ZMA A;  4I38 A;  5DTT A;  4Y3I A;  3T1R A;  3IBR A;  2JC7 A;  4OQ0 A;  1MPL A;  5F1G A;  4FD8 A;  4JXV A;  4N9K A;  4OVD A;  1P97 A;  5HL6 A;  5IU1 A;  3Q7V B;  4X55 A;  2XSS A;  5FI2 A;  2JKG A;  2W3D A;  4Y17 A;  4IJG A;  1ERO A;  4PMA A;  3ZG5 A;  5I94 A;  2LB9 A;  3GDI A;  3PHY A;  4O0P A;  3P01 A;  3V39 A;  4WMC A;  2M7V A;  4BL2 A;  2V8C A;  3F1N A;  1GHI A;  5KSC A;  2CC1 A;  3UMD A;  2Y2G A;  5L07 A;  4FH2 A;  1F98 A;  4IBR A;  3NDE A;  1DJC A;  4JF4 A;  4JPM A;  3RTY A;  5HPF A;  2HV1 A;  3FZC A;  4C6Y A;  3T1X A;  3E4Q A;  4QHC A;  4PPR A;  4KG5 A;  2Q9N A;  1BLC A;  3QP8 A;  5GHX A;  5A91 A;  2XD5 A;  2CMN A;  4K0W A;  4MEZ A;  3GSG A;  4N1H A;  3TSG A;  1Q2P A;  4OKP A;  2ZM2 A;  4NXG A;  2VLG A;  3AGE A;  3TE8 A;  5GHY A;  1KGF A;  4JBF A;  4F3L A;  3SW1 A;  4Y7P A;  1MXO A;  1TF1 A;  3BRM A;  2ZQ8 A;  3T4K A;  3T4L A;  4JGP A;  4DF6 A;  4E3O A;  2IWB A;  1KGE A;  5HWV A;  1IOU A;  1WYC A;  1YLP A;  3D3O A;  5FI6 A;  3CIT A;  1STZ A;  1OJG A;  3WS0 A;  4RVA A;  1K56 D;  4GB7 A;  2WGI A;  3N7W A;  4O01 A;  4JGR A;  3N8L A;  5IS1 A;  3S7P A;  4R1G A;  4N1X A;  1VHM A;  2LB5 A;  2V20 A;  2MJ6 A;  2O99 A;  3WRZ A;  1Y54 A;  3E4P A;  4OQI A;  4U0X A;  1E3U A;  4KQD A;  4DN0 A;  5M18 A;  4QJG A;  3LID A;  4H6J A;  3HLD A;  5J7E A;  3T1Q B;  1LL5 A;  3HCY A;  1H8Y A;  3ZVT A;  3HLF A;  3T4Q A;  1XJ2 A;  3BLS A;  2J3W A;  2PHY A;  2OWH A;  1TDG A;  2WKE A;  4A5R A;  3BLM A;  3IS2 B;  4NET A;  1L0G A;  4U3T A;  4LEN A;  2V0W A;  4HP9 A;  2Y91 A;  3HLW A;  3Q7V A;  4EUV A;  1XA1 A;  2J80 A;  3M6H A;  4ZTK A;  3LO7 A;  3ZHH A;  3C38 A;  4GN2 A;  2DCF A;  4E3N A;  1CF0 A;  3RH8 B;  2X71 A;  2VGK A;  4UA6 A;  5FDH A;  5DJT A;  3BW6 A;  4FSF A;  3MSH A;  3HRE A;  5FA7 A;  2WAE A;  3PBO A;  1N9O A;  3T4T A;  4Z1W A;  5HX9 A;  3UDF A;  3MJQ A;  3IT9 A;  1MBL A;  1KVM A;  3IBJ A;  4Q0I A;  2ZQA A;  4MBF A;  2Y79 A;  1I2S A;  3R7W B;  4KZ6 A;  5EVI B;  4E3M A;  2OAP 1;  4R0Q A;  5DFY A;  5HZH A;  2VKS A;  2B95 A;  1ODV A;  1CI9 A;  4HEF A;  2XLN A;  3CZD A;  2QJ5 A;  3IXG A;  3NBL A;  3NDG A;  5JYO A;  4GHI A;  2BAS A;  1HZO A;  2V9A A;  3G2Y A;  3DTI A;  5M19 A;  2VGL S;  3UDX A;  4MN7 A;  2P9V B;  4ZDX A;  4ZRR A;  3EQU A;  1XA7 A;  3UB6 A;  4R3B A;  3QP2 A;  4JF6 A;  2QZ6 A;  3OPP A;  3WS4 A;  4C3Q A;  2HDQ A;  1NRJ A;  1LL9 A;  4E3L A;  4Q0H A;  2JKR I;  4QWO A;  3PYP A;  3K3D A;  4QD4 A;  1OPX A;  3IF5 A;  4S2K A;  3H7W B;  2L0W A;  5F82 A;  4GD8 A;  3NY4 A;  3NIA A;  4MN5 A;  3GQZ A;  3QP5 A;  2ZL1 B;  3A0S A;  4CLC E;  1FSY A;  4HBU A;  3IXD A;  1DY6 A;  5HDC A;  4DDS A;  4HJ4 A;  3E2K A;  1BUE A;  5A92 A;  1Z6F A;  1XJ6 A;  1HVB A;  3VSK A;  3ZYT A;  5CED A;  2JKT I;  4LRX C;  5FQI A;  3NOU C;  1OTA A;  3D4F A;  2W1T B;  3O3V A;  1KGG A;  1T19 A;  5E2F A;  4PM8 A;  4N92 A;  2B18 A;  4S2M A;  5FEF A;  4IED A;  4N9L A;  1GSV A;  5E2H A;  1P9R A;  3S7N A;  3UE1 A;  3LYX A;  1ONH A;  1H8Z A;  3QHY A;  5A90 A;  3G34 A;  3IS2 A;  5L10 A;  1MWT A;  2IWC A;  3GRJ A;  2XD1 A;  4WN5 A;  3PBN A;  3U4L P;  3LR3 A;  2Y2O A;  3TW8 A;  3EEH A;  5G4Z A;  5EVI C;  4EXO A;  2ZQD A;  4EES A;  2PBY A;  2AVX A;  2Y55 A;  3ZG0 A;  3KSG A;  2ZOI A;  3RXW A;  1IYO A;  4UA7 A;  1PI4 A;  4HY8 A;  3BWL A;  3CAX A;  3UPP A;  1T18 A;  5L8M A;  3CHW P;  2XF3 A;  1W8Q A;  1TS7 A;  3F1O A;  1MZU A;  3LFV A;  1TEM A;  4WL9 A;  1JNU A;  4XT2 B;  4S2J A;  3F1P A;  3MXR A;  3U2A A;  1H3Q A;  4S2I A;  1YMS A;  3BEC A;  1LSX A;  2GX5 A;  3KYZ A;  1N4O A;  2Q0O A;  1K6R A;  3OBF A;  4NEE D;  3FPV A;  3C7U A;  3UN7 A;  4L0L A;  5E2G A;  2OAQ 1;  4EEU A;  3M6B A;  1JTD A;  4F94 A;  2VX8 A;  2VJW A;  1P0Z A;  4KG6 A;  3B47 A;  3V5M A;  3V50 A;  3M2K A;  4X69 A;  3LIB A;  4B9O A;  2QWS A;  1ESU A;  3VFH A;  2VK3 A;  2P08 A;  4E04 A;  3BFF A;  2QKP A;  1XXM A;  4YNR A;  4HNB A;  3N6I A;  4QB8 A;  4P6B A;  2JKT M;  2NUT C;  4ETX A;  4UQI M;  5TFQ A;  2XK1 A;  4PKY G;  2YKH A;  4GCZ A;  4QY5 A;  2EFU A;  2GDN A;  5EOO A;  3BFD A;  2HGV A;  4I5S A;  2W3G A;  2ZL1 A;  1NZU A;  3T4O A;  3VOY A;  2PDR A;  5AQ7 A;  1IFQ A;  1BLH A;  1K4F A;  4Q0J A;  3BY8 A;  3R4K A;  2GNX A;  1F9I A;  3LR4 A;  4KZ7 A;  1XGI A;  1LT0 A;  2W1T A;  1JWP A;  2P74 A;  3LI9 A;  3CPT B;  5FAP A;  3AGF A;  2Y2J A;  3SS3 A;  5F6A A;  3H9W A;  2VV7 A;  4GJ4 A;  3UO9 A;  1TDL A;  5EUA A;  1J9M A;  2PBD P;  4K0X A;  2EFX A;  1SHV A;  3PAE A;  3GVB A;  1H8M A;  2J9P A;  2PU2 A;  4ID4 A;  2I9V A;  5DTK A;  5EVE A;  3OC2 A;  5BOH A;  2Z6D A;  2WGW B;  1KE3 A;  1W5D A;  4CLC A;  4UQI S;  5TBM B;  4UAA A;  5FQQ A;  2EWW A;  3LIF A;  3MQ0 A;  3EGD C;  2W3H A;  4GW9 A;  4WYY A;  2HDR A;  1YKD A;  2EWV A;  2EX6 A;  4XXR A;  2PRF A;  4YWZ A;  4DJ3 A;  2G2U A;  1ZC2 A;  2EXB A;  3KSI A;  5EOE A;  2Y2K A;  4EBP A;  3PBS A;  1XKZ A;  3JPU A;  1I5Q A;  4OPY A;  5FAS A;  3HLB A;  3MFX A;  1PZO A;  3D72 A;  4DMZ A;  1S4R A;  3TOI A;  3W2Z A;  4KZ9 A;  2OWJ A;  4DE2 A;  4QPR A;  1CQA A;  4FOF A;  1W63 M;  4OLD A;  5HFO A;  2YKF A;  4CJN A;  4UA9 A;  4EU0 A;  4KEN B;  2WKR A;  3G4P A;  4R4S A;  4LRY C;  3SH8 A;  3SZT A;  1NY0 A;  3VE4 A;  1LI9 A;  1HD8 A;  4HJ6 A;  2ZC7 A;  3NOT C;  3ISG A;  3O86 A;  1NYY A;  5LBR A;  4R4R A;  1G28 A;  4ZBE A;  3BM6 A;  1IKI A;  5CER A;  5K5B A;  4LFU A;  5CTN A;  4EEP A;  1C3B A;  3VOZ A;  3ULF A;  5AVF A;  4B4X A;  3Q7Z A;  5IT5 A;  2PYR A;  1XFQ A;  1MWS A;  2UV0 E;  2M1C A;  1YAX A;  2B02 A;  4S2N C;  3V3S A;  4R6L A;  4WEJ A;  4WEK A;  4LV3 A;  1UWN X;  4LCM A;  3B42 A;  4GDN A;  3LEZ A;  3VMA A;  3FWL A;  2W3F A;  3HVF A;  4ZJ2 A;  4ARZ B;  4K08 A;  3G30 A;  2HP6 A;  2INW A;  1LSW A;  1ALQ A;  4CLC D;  3N4I A;  1QME A;  1FOF A;  1CK3 A;  1YPR A;  3DTK A;  1SZV A;  5J4E A;  4E3J A;  2FH5 A;  3G32 A;  3IH9 A;  4IUK A;  2VGJ A;  3KYE A;  1XJ4 A;  2H10 A;  4B93 A;  2J3T C;  1QMF A;  4WUJ A;  1SKF A;  1E4D A;  2VEA A;  3DTE A;  4S2N A;  3UNW A;  4DE1 A;  1FCM A;  1GA9 A;  2V1A A;  2D01 A;  1SKO B;  3BQ8 A;  4GKU A;  3O5Y A;  4LV2 A;  4BL3 A;  5TBM A;  3PAG A;  5MC7 A;  1ERQ A;  1S67 L;  2Y2M A;  4WMC D;  3MMH A;  4S2O A;  2FFF B;  2P7J A;  4NKP A;  3C7V A;  5F83 A;  4X1L A;  5GLD A;  4E6X A;  3EWK A;  4Y2F A;  1MKM A;  1KE0 A;  5HWT A;  1RGY A;  1GHM A;  2C5W B;  4OH0 A;  4PAU A;  5E2E A;  1G68 A;  3HLC A;  2JBF A;  1PWG A;  2EA9 A;  2EX2 A;  1E25 A;  2V1Z A;  1L0F A;  3PBQ A;  3MXQ A;  5CGS A;  3C30 A;  1K55 C;  1FQG A;  1YMX A;  4KZ5 A;  3IXH A;  3QP6 A;  2KDK A;  4LRZ E;  3PXP A;  3WRT A;  4GOG A;  4Y15 A;  3ZQ5 A;  1N9B A;  1Z09 A;  4MMN A;  5CHJ A;  2WKP A;  1EWZ A;  3EQV A;  5HW3 A;  1BLS A;  2HDU A;  4DKI A;  5CEB A;  3H82 B;  4JLF A;  2XFT A;  5JYP A;  3W4Q A;  4GDB A;  3TRC A;  4DDY A;  2WZX A;  1TS8 A;  3E98 A;  2PAV P;  3IX8 A;  1CI8 A;  5HDD A;  1FCN A;  2RCX A;  4HHD A;  2HPB A;  1K55 A;  4O8G A;  3QNB A;  4MN6 A;  1NLY A;  5F69 A;  2K7S A;  3CI6 A;  4IVK A;  4CQH A;  5AJG A;  3C8C A;  3PTE A;  3ZCZ A;  2ZC5 B;  2QPN A;  2H5S A;  2XH9 A;  2ZLY A;  3BEB A;  1OME A;  3RJU A;  2H28 A;  3FKW A;  1E3U D;  1M6K A;  4JKT A;  1IEL A;  2JHE A;  4II7 A;  3Q07 A;  2XQZ A;  4FTX A;  1RP5 A;  4DJ2 A;  3WWX A;  4R70 A;  4C75 A;  4OP8 A;  5FAQ A;  1H0M A;  2PR6 A;  4PHT A;  2J3T D;  2Y2H A;  1P9W A;  5AQB A;  3CMZ A;  4KUK A;  1KOU A;  3WS1 A;  2RL3 A;  3NOP C;  1ZG6 A;  1S1Z A;  3LI8 A;  5DKL A;  2O9B A;  4K91 A;  5CHU A;  1D06 A;  4MNR A;  3UB9 A;  4YOF A;  1SKO A;  4OPQ A;  1YM1 A;  5TR7 A;  1NJ4 A;  3IHA A;  5AVE A;  3MF0 A;  3OZH A;  1JVJ A;  1M40 A;  3I7J A;  2WAF A;  1O07 A;  3PBR A;  2EXA A;  4R23 A;  3TG9 A;  1SCW A;  2Y2I A;  1ES2 A;  4LLO B;  1FSW A;  5CXW A;  5J8X A;  3D9Y A;  4RQ9 A;  3VP2 A;  1FCO A;  4IHQ A;  4M4X A;  4L9G A;  1T1B A;  3Q1F A;  3CLO A;  3MFD A;  2M7U A;  3HUM A;  4LPZ A;  2ZQ9 A;  4P6Z M;  1BTL A;  3PR6 A;  2V2F F;  3CG5 A;  1DP6 A;  3SH9 A;  4QY6 A;  3MR0 A;  5E43 A;  3JVU A;  1Q2Q A;  2K31 A;  2Z6C A;  1I2W A;  2X01 A;  3VP0 A;  5FAT A;  3IX3 A;  5FI7 A;  3ITA A;  4GLQ A;  1DP9 A;  4MLL A;  1VEU B;  4ESP A;  5HL1 A;  1CJF A;  3A3F A;  1ZHH B;  3UME A;  2HJ9 C;  5HPI A;  4LV1 A;  3UDI A;  5EE8 A;  2WYX A;  5HAI A;  1W79 A;  5HD5 A;  1ES4 A;  2P04 A;  5HAQ A;  4ZJ1 A;  3H82 A;  1KVL A;  2NUP C;  5DTS A;  5DF7 A;  4XUX A;  2Y59 A;  5GHZ A;  2L4R A;  1NRF A;  4CPK A;  2FZ0 A;  3G6O A;  3EOI A;  3R7W A;  2BLS A;  3JVV A;  1TVF A;  5EVI A;  4EQI A;  5FEG A;  2ZQ7 A;  3LY4 A;  2WKI A;  3HLG A;  4S2L A;  2JKR M;  3FV7 A;  1N9N A;  2G7U A;  3UE0 A;  1FR1 A;  1V9Z A;  3A3E A;  2J8Y A;  3E2L A;  4OP5 A;  4WEL A;  3E0Y A;  2H0Y A;  1IYS A;  1AXB A;  1G6A A;  1ERM A;  2P9V A;  5U47 A;  1LL8 A;  2A24 B;  4JF5 A;  3ZG7 B;  4U0T A;  3MZE A;  1ONG A;  1OT9 A;  3NUL A;  1S0W A;  5KZH A;  4HBT A;  3F1N B;  1GSW A;  2HJE A;  4MCW A;  3G31 A;  1YLW A;  4EBN A;  1YLT A;  3UE6 A;  5EFW A;  4FH4 A;  1PW8 A;  2R9W A;  4I3A A;  4OOL A;  4HJ3 A;  1XJ3 A;  3H7W A;  4E3K A;  3MXS A;  5GL9 A;  1F5M A;  4EER A;  4JGO A;  1LSV A;  1XPB A;  3DTM A;  4O7D A;  4MBH A;  2ZMV A;  1NXY A;  1IYQ A;  3KX0 X;  3VOL A;  1PFL A;  1BYW A;  4RX3 A;  1PWD A;  4F3L B;  3IXB A;  5CRF A;  4OQH A;  5DJU A;  1T1A A;  1YSP A;  5FQ9 A;  4PM9 A;  2DRW A;  4KZ3 A;  3T50 A;  1J3W A;  1MWR A;  5AQA A;  3TJZ C;  4AFI A;  1JWZ A;  1W8Y A;  2BG1 A;  1PZP A;  2I72 A;  3C2W A;  3HJI A;  4BD0 A;  5EPH A;  3GTC A;  1MY8 A;  2ZOH A;  2JE5 A;  3LUQ A;  2XRO A;  4GNU A;  4HH3 A;  4OPZ A;  4HH2 A;  1T1C A;  2VV8 A;  5DVA A;  3ZNT A;  1K0K A;  1K6S A;  4X56 A;  3S22 A;  3ICY A;  2OSU A;  2PD8 A;  5EVI D;  3PBT A;  2DMW A;  4Y5F A;  5G4Y A;  4X25 A;  3LGO A;  3MZD A;  4ME4 A;  5GLB A;  1TD5 A;  1PRQ A;  1GA0 A;  1VEU A;  4KQO A;  4PM5 A;  4ETZ A;  2JCH A;  4NG2 A;  4Y0T A;  2ZJ9 A;  2ZM0 A;  4EW7 A;  3HBR A;  3W8K A;  1FIL A;  4EUZ A;  3GV9 A;  5EVL A;  4XT2 A;  1YLZ A;  3AGD A;  5FQK A;  1OTE A;  3VFF A;  1SDE A;  3T4S A;  5FDS A;  1PNE A;  5F1F A;  4WZ4 A;  1VET B;  4LCL A;  3A3J A;  1DP8 A;  3KSF A;  3MQQ A;  1ACF A;  1PW1 A;  5DKK A; 
#chains in the Genus database with same CATH homology
 1D1J A;  1PFL A;  2HZ5 A;  3L9K A;  2BTF P;  3DAV A;  2E8J A;  1CF0 A;  2PBD P;  2ZL1 B;  2V8F A;  4X1L A;  4FTX A;  3T1R A;  1J3W A;  3MSH A;  1A0K A;  4FUW A;  3L7H A;  5EVE A;  4X1M A;  5FEG A;  5EM1 A;  3T1S A;  1AWI A;  2VK3 A;  1F2K A;  5FEF A;  3MS6 A;  2JKG A;  4D60 A;  1FIK A;  1SKO A;  1Z09 A;  1K0K A;  2B95 A;  2PRF A;  1YPR A;  4X25 A;  3LGO A;  1SZV A;  3U4L P;  1VET A;  2V8C A;  1PRQ A;  3KYE A;  1VEU A;  1HLU P;  3D9Y A;  2PAV P;  3T1Q B;  3NUL A;  2JKF A;  3T1X A;  2ZL1 A;  1CQA A;  5EM0 A;  1FIL A;  1SKO B;  1G5U A;  3CHW P;  3UB5 P;  3CPT A;  5EV0 A;  4QWO A;  3T12 B;  3NEC A;  5FDS A;  1PNE A;  1Y4O A;  1VET B;  3CPT B;  1VEU B;  3LEQ A;  1ACF A;  4ESP A;  2ACG A;  1CJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...