3W8KA

Crystal structure of class c beta-lactamase mox-1
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
353
structure length
346
Chain Sequence
DPLRPVVDASIQPLLKEHRIPGMAVAVLKDGKAHYFNYGVANRESGASVSEQTLFEIGVSKTLTATLGAYAVVKGAMQLDDKASRHAPWLKGSVFDSITMGELATYSAGGLPLQFPEEVDSSEKMRAYYRQWAPVYSPGSHRQYSNPSIGLFGHLAASSLKQPFAQLMEQTLLPGLGMHHTYVNVPKQAMASYAYGYSKEDKPIRVGMLADEAYGIKTSSADLLAFVKANIGGVDDKALQQAISLTHKGHYSVGGMTQGLGWESYAYPVTEQTLLAGNSAKVILEANPTAAPRQVLFNKTGSSNGFGAYVAFVPARGIGIVMLANRNYPIPARVKAAHAILAQLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Crystal structure of Mox-1, a unique plasmid-mediated class C beta-lactamase with hydrolytic activity towards moxalactam
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 109
structure length 346
sequence length 353
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3w8kA00
1SCWA 1ES4A 4GZBA 4P6BA 4E6XA 4LCLA 2Y2NA 1Q2PA 4X69A 1IYOA 3ZVWA 4OOMA 2EXBA 1XP4A 3BEBA 2G2WA 3VP3A 5HL1A 1ERMA 3WS1A 3LY4A 1DY6A 3UPOA 1ES5A 2V2FF 2G2UA 1TEMA 2A49A 2ZC5B 1G6AA 4LV0A 5EOOA 4C75A 1IELA 1K56A 2ZQ7A 4OVDA 1LL9A 3Q07A 4WBGA 1LI0A 3S1YA 4DE3A 2ZQCA 2Q9NA 1ZG6A 3O3VA 5E43A 5FQQA 4KZ9A 4O7DA 4B4ZA 5AQ9A 1GA9A 3O87A 1IKIA 1M40A 3NCKA 3HUNA 2WADA 5CTNA 4WEKA 3PTEA 5TFQA 4KZAA 3HLDA 4WZ5A 1KDWA 5E2HA 3M6BA 3AGEA 3IH9A 3C4PA 5F83A 3G35A 3Q7VB 2X71A 4JLFA 4ZAMA 4KG6A 5CECA 1K55A 2JE5A 4S2KA 1NZUA 5CEDA 4WEJA 2Y2PA 3UDXA 5GL9A 1JWPA 5GLDA 1W8QA 1GHIA 1K54A 3ZGAB 1W8YA 3DTMA 5EPHA 4EUZA 3CG5A 4OKPA 4D2OA 3NY4A 2H0TA 1H8YA 3BM6A 4JKTA 1ZC2A 4N1XA 2H10A 4R23A 4WYYA 5KSCA 1XXMA 4UA6A 1YQSA 5CHMA 4OP5A 1FCOA 3DWZA 4ZBEA 4ZDXA 3BFGA 1KE3A 2XR0A 1Y54A 2P9VB 4S2LA 3HLGA 4N92A 4CJNA 4GDNA 4QHCA 5EOEA 4DDYA 4B4XA 1XGJA 1ONGA 1PZOA 4HBUA 1ERQA 3OPPA 2EX6A 1GHMA 5EVIB 2XLNA 4F94A 4KG5A 5DTTA 1L0FA 3W4OA 1FR1A 4HEFA 5HAPA 2OLUA 4IVIA 4S2NC 5FAPA 4BD1A 5JYOA 4RYEA 1I2WA 4OQGA 2XGNA 2WKHA 3GMWA 5TGFA 4KG2A 3A3JA 3VOZA 1LI9A 3A3DA 5HFOA 5D3OA 1H8ZA 3RXXA 1NJ4A 3NBLA 3IHAA 3VSLA 4L0LA 2PU2A 1XPBA 2OSUA 5EUAA 1SDEA 2WGVA 1K57C 4IEDA 2XDMA 1JTGA 3IXHA 3SH8A 5KSHA 3E2KA 1RP5A 2A3UA 3FWLA 3TOIA 3UE3A 5CGWA 3FV7A 4KZ4A 3MKFA 3C7VA 1E3UA 2R9XA 5M1AA 3BYDA 1ZG4A 3MXRA 4S2IA 3S4XA 3ZG7B 1ES3A 1LL5A 3PBTA 4RX2A 3IXBA 3OC2A 1Q2QA 5E2EA 4B88A 2ZLYA 2JCHA 1BUEA 1SKFA 3PAEA 5CTMA 2C6WB 5HAQA 4P87A 3SS5A 3UN7A 3QHYA 5FDHA 4C3QA 1DJBA 2E8IA 3MZFA 2ZM8A 3PBRA 1LLBA 1EROA 3M2KA 2Y2IA 1JVJA 4MNRA 4QY6A 4X55A 4OONA 2J9OA 1BLHA 3WS4A 1ESUA 4UA7A 3NC8A 3VOYA 4RX3A 3AGFA 1L0EA 1NZOA 3SOIA 4KZ6A 4BL2A 5GLAA 3VP4A 2ZC4B 3ZCZA 1FOFA 5F1GA 1FCNA 5FAOA 4E6WA 1E25A 4PMAA 3W8KA 3W4PA 3ZG0A 5A92A 4IBRA 4JF5A 3GRJA 3ITBA 1VQQA 1G68A 2Y59A 1XKZA 4PM8A 3RXWA 4KZ7A 5GLCA 3C5AA 3G31A 1W7FA 2ZC6B 3IQAA 1BSGA 1ZKJA 4LV2A 1E4DA 3HREA 2I72A 3MKEA 4OOLA 2QZ6A 4PM6A 1KGFA 1E3UD 2FFYA 2HP6A 3GQZA 4X6TA 3NDGA 1YM1A 2V1ZA 1FR6A 4GN2A 1PI5A 1GHPA 3FKWA 3ITAA 1IYSA 3IWOA 3PBQA 1LHYA 4N1HA 3C7UA 2ZQ9A 1HVBA 4BL3A 5GHYA 3BECA 4DKIA 1JWVA 1YLPA 3Q7VA 4FH4A 2EX8A 4OPZA 4DDSA 2DNSA 2BG1A 5CEBA 3HUMA 4QY5A 5EE8A 1L0DA 2XFSA 4ZJ3A 3OCLA 4OP8A 4OLGA 2WAFA 4LCMA 4WMCD 3N7WA 2OV5A 2CC1A 5A91A 3VP0A 1MPLA 2X02A 1XA7A 4E3IA 3V5MA 1PI4A 4E3LA 1MWUA 3VMAA 2Y91A 4HESA 4Q8IA 5FASA 1N9BA 5FA7A 5CGXA 4E3OA 4PPRA 3ZNTA 1HZOA 5I94A 4EV4A 2Y4AA 5F1FA 5HX9A 5EECA 3ZG9B 3CJMA 1MWSA 4JPMA 3P98A 1BLSA 3LEZA 2J8YA 3G34A 1K4FA 4OLDA 1KGEA 4Y7PA 3VSKA 2HDQA 3AGDA 1ESIA 3HLFA 1S6RA 2HPBA 4OH0A 2VGJA 5U47A 3G2ZA 3IHBA 3VP1A 3IWIA 4KENB 4JBFA 4LENA 4DXBA 4MEZA 1K38A 1XGIA 2UWXA 3WS2A 5EVIA 4JXVA 1K56D 2ZM2A 2XEPA 2C5WB 2B5RA 1M6KA 4EBNA 1BZAA 2OLVA 2ZJ9A 4P0MA 2RCXA 2Y2HA 2EX2A 1FQGA 2WKEA 3HUOA 3Q1FA 4DRTA 5KZHA 3ZDJA 5M18A 4R3BA 4U0TA 3FYZA 4QJGA 1NYMA 4E3NA 2WAEA 4GKUA 4PM9A 1K4EA 2IWCA 3A3FA 5FI6A 1JWZA 3V3SA 5IHVA 3Q81A 1MWTA 2XH9A 4NETA 4UAAA 4WELA 2XQZA 3IF5A 1MXOA 1I2SA 1NRFA 4S2JA 1L0GA 1FCMA 4WZ5C 4KQRA 3IF6A 3BFCA 5EVLA 4S2OA 1OMEA 2Y2MA 1K55C 3V39A 1KDSA 4RVAA 3MBZA 1IEMA 4ZTKA 4DE0A 4EBLA 2WZXA 3UNWA 4S2PA 1FSYA 3B3XA 5E2FA 3WRZA 5DF9A 3HBRA 1GA0A 4P85A 1IYQA 1SHVA 4ZJ2A 1K54C 3UE1A 3M6HA 1WYBA 2V20A 1W5DA 5FATA 3ZNYA 4X56A 1BLCA 4RA7A 2RL3A 3UPNA 5EVID 4H8RA 3IXGA 3A3EA 3ZHHA 4KZ5A 4M3KA 5CGSA 4EQIA 1YLYA 2WKIA 3PBSA 3NIAA 1YLZA 1U60A 4Y0OA 4EWFA 4OPQA 3Q7ZA 3ZVTA 1YLTA 3SS3A 3SH9A 3UPPA 1MY8A 3HL9A 1PWCA 1J9MA 4R4SA 4DXCA 4R1GA 1PW8A 2H5SA 3WS0A 1YMSA 3BLMA 5CHUA 3HLCA 1PWGA 5DVAA 4DE1A 5HW3A 4QB8A 4KQQA 4Y0UA 1BT5A 4N9KA 3ZFZA 3BRMA 5F82A 3S22A 1DJAA 5DF7A 1CI8A 2R9WA 5J8XA 1I5QA 3V3RA 5AQBA 4OPYA 3HLBA 3C4OA 1BTLA 4WM9A 2XF3A 1O7EA 2FFFB 3EQUA 1KE4A 1QMEA 2WGWB 5CRFA 3VFHA 1PW1A 4C6YA 4PM7A 3BLSA 5TR7A 3MXSA 5BOHA 1HTZA 1YMXA 4XUZA 3E2LA 3VP2A 1N4OA 4MLLA 2Z2LB 5FQIA 1AXBA 3GR2A 4A5RA 4OPRA 1WYCA 1O07A 4GNUA 3MZDA 4GB7A 3NDEA 4OQHA 1BULA 2XD1A 2Q9MA 4DF6A 1ES2A 2EX9A 2HP5A 4GOGA 1FSWA 1NXYA 2EXAA 1NYYA 1NY0A 4DE2A 2EFUA 1CEFA 5FAQA 4S2NA 2Y2KA 1K6SA 1TDGA 3PBNA 3ISGA 2IWDA 1Z6FA 4OQ0A 2HDSA 2Y2LA 2ZQAA 1PYYA 4KZ3A 5GLBA 3V50A 1VM1A 2QMIA 3UY6A 4S2MA 2WYXA 4BLMA 3Q82A 4PM5A 3O88A 2HP9A 2PBYA 3LCEA 3LO7A 2P9VA 2IWBA 4U0XA 3IXDA 4YFMA 1K57A 4CPKA 2PU4A 4GD8A 4U3TA 4FCFA 2ZQDA 5CHJA 3HVFA 4X53A 3N8SA 1GCEA 2J9PA 1K25A 5GHZA 3N6IA 4FD8A 4R0QA 4GD6A 5CXWA 4ZJ1A 3FZCA 2X01A 3HLEA 3GV9A 4JF4A 3A3IA 3N8LA 5DF8A 1JTDA 3I7JA 3GTCA 1CK3A 3IT9A 2WZZA 3O86A 1H5XA 5M19A 2Y2QA 1SDNA 1YLJA 2ZM0A 5HARA 4K91A 4Y0TA 2XFTA 3CZDA 3ZG5A 2ZC3B 3WS5A 1TDLA 3HLWA 5FQKA 1PZPA 2XD5A 2DRWA 3BFEA 4Z9QA 5KMWA 1EWZA 1C3BA 4E3MA 1ONHA 2P74A 3G2YA 5G18A 1MBLA 1PWDA 2Z2MB 4JXSA 5DTKA 4R4RA 5HAIA 2ZMAA 3UDFA 3TG9A 4NK3A 5GHXA 4KZ8A 2WGIA 2Y2GA 1MWRA 3OPLA 4MBFA 1L2SA 2ZC7A 3NI9A 3WWXA 3DWKA 4MBKA 1IKGA 4FSFA 4BENA 4MBHA 3SH7A 5AQAA 3OCNA 1W79A 1BLPA 4E3KA 2WK0A 3MZEA 3OZHA 4OQIA 3SS4A 2HDRA 5FQJA 3UDIA 4YINA 1RGZA 2ZD8A 3G4PA 3P09A 1EI5A 3ZG8B 4XUXA 1K6RA 1XX2A 1DJCA 3M2JA 3TSGA 3IH8A 3LY3A 4XXRA 2GDNA 3QNCA 3WRTA 3D4FA 2ZQ8A 1KVLA 3GSGA 1ALQA 2JC7A 5DTSA 2JBFA 2EFXA 2HDUA 5FI2A 4QU3A 5JYPA 3RJUA 4JXWA 5AQ7A 5L2FA 3GVBA 1S0WA 4EBPA 3BFFA 4N9LA 1KE0A 3EQVA 3MFDA 4UHUA 4BJPA 3UE0A 5EVIC 4BQMA 2Y55A 4HBTA 4LV1A 1HD8A 4LV3A 2H0YA 3BFDA 3IF6B 3N8RA 4KQOA 4JXGA 5FQMA 1PIOA 3OPHA 2Y2OA 3N4IA 3IWQA 4FH2A 1TVFA 4BD0A 3FKVA 1QMFA 3CMZA 1RGYA 2WUQA 5FQ9A 2BLSA 3QNBA 3UO9A 2QPNA 4E3JA 4KZBA 4R3JA 5A90A 1WE4A 3JYIA 3PAGA 2WGWA 4OOYA 1XA1A 2DCFA 1CI9A 4ID4A 4WMCA 3OPRA 1CEGA 4UA9A 3PBOA 5FI7A 1MKIA 3VFFA 1KVMA 5A93A 3W4QA 1KGGA 2XK1A 2VGKA 4QD4A 3G30A 4IBXA 1YT4A 1YLWA 4WZ4A 2J7VA 3DW0A 1RCJA 4K0WA 4IVKA 2Y2JA 5CERA 4GDBA 5E2GA 4X68A 3G32A 4JF6A 5FSRA 3IF6C 1IYPA 4K0XA
chains in the Genus database with same CATH superfamily
4D60A 1SCWA 4LCLA 4OOMA 1XP4A 1NLYA 3D72A 1TEMA 2ZC5B 2V1BA 1K56A 4DE3A 1N9OA 3Q07A 2AVXA 5FQQA 1ZG6A 3IS2A 2Q0OA 3NHQA 3ULFA 4AFIA 3V67A 1M40A 1D7EA 3NCKA 5CTNA 4WEKA 3IX8A 1LT0A 3HLDA 4WZ5A 2NUTC 4JLFA 3T1QB 3PR6A 5CEDA 4WEJA 2Y2PA 1NLZA 3ZGAB 5EPHA 4D2OA 3CLOA 2H0TA 1H8YA 4P6ZM 4WYYA 4BWIA 4UA6A 3VE4A 4ZBEA 1CJFA 4ZDXA 1S1ZA 4S2LA 2IA2A 4B4XA 1PZOA 4GHIA 1P9RA 2A24B 3ICYA 5DTTA 4BD1A 1XFNA 2VKSA 2HJEA 2XGNA 3VOZA 5TGFA 4KG2A 3A3JA 3T1SA 1LI9A 1KOUA 5D3OA 2QYBA 3NBLA 4BBUA 2OSUA 5EUAA 1SDEA 3FWLA 1RP5A 2VA0A 3UE3A 2J3WA 5AVEA 3C7VA 1S4SA 4HI4A 3BYDA 3S4XA 3ZG7B 1BUEA 5CTMA 2C6WB 3A0VA 4P87A 2XROA 1D1JA 5FDHA 1DJBA 3BW6A 1LLBA 1EROA 3UB5P 3KSGA 3MFXA 2ZC4B 5F1GA 2L0WA 5FAOA 4E6WA 3W8KA 4PMAA 3W4PA 5A92A 3QP6A 3R4KA 2XA7S 3ITBA 1VQQA 4Y15A 5L10A 1XKZA 4HQAA 3C5AA 2INWA 2O9BA 4CQHA 3G31A 4LPZA 4B93A 1KGFA 1PI5A 3IWOA 3LIBA 1LHYA 3PBQA 2PT7A 2WKRA 1HVBA 1YSQA 1JWVA 3EGXC 2DNSA 3CWFA 5CEBA 3HUMA 3DTKA 2XFSA 4ZJ3A 4LCMA 4R3AA 2ZOHA 1XA7A 4E3IA 1PI4A 2W1TB 4WL9A 5FASA 1VEUB 2HGVA 3UB6A 2Y4AA 3KSIA 3CJMA 3LEZA 3L9KA 1W63M 3VSKA 1ESIA 3HLFA 2HPBA 3IX4A 5EV0A 3IHBA 4KENB 4JBFA 4DXBA 4MEZA 1K38A 1XGIA 3CI6A 2A24A 2ZM2A 2XEPA 2B5RA 5HSQA 4EBNA 4P0MA 2Y2HA 2EX2A 2G7UA 1FQGA 3HUOA 4DRTA 5M18A 2WKQA 4U0TA 3FYZA 4PKYG 1G28A 2IWCA 3A3FA 4CLCC 1JWZA 4NETA 4S2JA 4NXGA 1T18A 1OMEA 4DN0A 2Y2MA 3UNWA 2O9AA 3HBRA 1IYQA 4IJGA 3M6HA 2V20A 3UPNA 5TJJA 3O5YA 3A3EA 4KZ5A 4M3KA 5CGSA 4IUHA 3PBSA 1OT9A 3UPPA 3HL9A 4R1GA 3LI9A 2VJWA 1OTAA 1YMSA 5CHUA 3WS0A 3HLCA 1PWGA 5HW3A 1VHMA 3ZQ5A 5F82A 3S22A 2PRFA 4OPYA 4WM9A 3C4OA 1VETB 3EQUA 1QMEA 5TR7A 5BOHA 1YMXA 3E2LA 3VP2A 4MLLA 2Z2LB 2O0YA 1AXBA 3GR2A 4OPRA 4ME4A 1VEUA 4GB7A 3NDEA 1BULA 3BY9A 1ES2A 2HP5A 2YKHA 3C8CA 4GOGA 3QP5A 1FSWA 2B18A 3DTIA 1CEFA 4S2NA 3BWLA 2ZQAA 1HLUP 3V50A 1VM1A 4PM5A 1H3QA 3LO7A 2IWBA 4LGWA 3IXDA 4GD8A 2ZQDA 4X53A 4Q0HA 3DTEA 5GHZA 5HD3A 5CXWA 3VE3A 4MDZA 3FZCA 3D3OA 4JF4A 3N8LA 4HY8A 3I7JA 3IT9A 3O86A 1SDNA 4Y0TA 3CZDA 3ZG5A 1WA9A 3HLWA 2XD5A 2DRWA 2P74A 5G18A 1MBLA 5DTKA 2Z2MB 5HDSA 4R4RA 2ZMAA 1A0KA 3UDFA 3TG9A 3RFBA 2Y2GA 2VV7A 2LB9A 1IKGA 4BENA 1BLPA 2WK0A 3OZHA 1S4RA 1YAXA 1RGZA 1XJ3A 1TF1A 2EWWA 5LBRA 2ZQ8A 3GSGA 1PFLA 5DTSA 4QU3A 3IBRA 5L2FA 3TW8A 4EBPA 1KE0A 3E0YA 3C38A 2O9CA 4LV1A 4KQOA 5J4EA 4JXGA 4F3LB 2Y2OA 3N4IA 4I3JA 1TVFA 3FKVA 1QMFA 3CMZA 5FQ9A 4E3JA 4R3JA 1WE4A 1VETA 2OWHA 3PBOA 4DJ3A 2VX8A 3VFFA 1NRJA 2EA9A 4IBXA 1YT4A 3DW0A 1MZUA 1RCJA 4HH3A 5FSRA 3BQAA 1MKMA 4HP9A 4E6XA 2Y2NA 1Y4OA 2GJ3A 3BEBA 5HL1A 2JKGA 5EM1A 3WS1A 1OJ5A 5FDSA 3LFVA 3UPOA 2G2UA 1G6AA 4LV0A 2QJ5A 3S7PA 4C75A 1IELA 2ZQ7A 2PR6A 4OVDA 3G6OA 4KUOA 4KUKA 1LI0A 3S1YA 2Q9NA 4B4ZA 4O7DA 3T1XA 4PHTA 2ZMVA 5IS1A 4ARZB 5TFQA 1KDWA 3M6BA 3IH9A 5F83A 4Z1WA 3Q7VB 4KG6A 5CECA 1K55A 5GL9A 5GLDA 1TS0A 1GHIA 1K54A 3DTMA 1DP8A 4EUZA 3LGOA 3SW1A 4UQIM 3NY4A 3T50A 3BM6A 1ZC2A 2H10A 4R23A 5CHMA 1ODVA 3H7WB 4GS9B 4I3AA 3UMDA 2XR0A 1Y54A 4N92A 4CLCD 4QHCA 4CLCE 1D06A 2D02A 2EX6A 1GHMA 5EVIB 4MN7A 4KG5A 2HZ5A 3F1PB 5FAPA 5JYOA 2D01A 3GMWA 3E4QA 3FPVA 5J3WA 3RXXA 1NJ4A 3IHAA 4L0LA 1S66L 2PU2A 5KSHA 4EQ1A 2XDMA 1JTGA 3IXHA 3SH8A 4F3LA 3TOIA 2A3UA 4B9OA 4KZ4A 3MKFA 1TS8A 1E3UA 5M1AA 1ZG4A 2R78A 5MC7A 3MF0A 3OC2A 2ZLYA 1SKFA 1XJ4A 5HAQA 3C2WA 4JGQA 2GZAA 3PBRA 4GLQA 2Y2IA 1JVJA 4MNRA 4NKPA 4X55A 2OWJA 2J9OA 1TS6A 3WS4A 3NC8A 3VOYA 4DMZA 3AGFA 3SOIA 4KZ6A 5GLAA 3VP4A 3S7NA 3ZCZA 1E25A 4HJ3A 4IBRA 5HDCA 3U4LP 3RXWA 4KZ7A 2KOIA 1W7FA 2ZC6B 3BJNA 1BSGA 1ZKJA 2JN7A 4X6TA 2KLIA 1YM1A 2V1ZA 4GN2A 3FKWA 4ARZA 4DKIA 3Q7VA 2V9AA 1T1CA 1Y28A 4DDSA 2BG1A 5EE8A 4QY5A 1L0DA 4ETZA 5FL3A 4OLGA 4HIAA 4WMCD 3N7WA 2CC1A 2KDKA 4FOFA 1F5MA 2B95A 1HZOA 4EV4A 3SZTA 5L8MA 5F1FA 5HWTA 3H7WA 1CQAA 3LR5A 4GS9A 1MWSA 4JPMA 2XRNA 3P98A 2J8YA 3G34A 1K4FA 2JKTI 4CLCB 3F1OB 4Y7PA 2HDQA 3AGDA 4O8GA 3CAXA 2UWXA 5EVIA 1DRMA 1YKDA 4JXVA 2C5WB 3F1PA 1BZAA 2OLVA 3TE8A 2WKEA 3Q1FA 3T4OA 4R3BA 3QP8A 1NYMA 4PM9A 4LRYC 4WELA 3IF5A 1I2SA 2Z6CA 2DMWA 4WZ5C 3IF6A 3KYQA 3NJAA 4S2OA 3P01A 3EOIA 3V39A 4ZTKA 4EBLA 5IT5A 3WRZA 1XFQA 4HOIA 1DP6A 1SHVA 3UE1A 3ZNYA 2CMNA 4X56A 3LI8A 1SZVA 3IXGA 3LYXA 1YLZA 4OPQA 3Q7ZA 2KX6A 1MY8A 1H0MA 1J9MA 2H5SA 3LR4A 5DKLA 4Y0UA 3ZFZA 3P7NA 3BRMA 3A0SA 1P9WA 1DJAA 1YPRA 3T4JA 5AQBA 3HLBA 1TD5A 1O7EA 5CRFA 4PM7A 1IFQA 2QHKA 4XUZA 2JKTM 4EERA 3IX3A 4A5RA 2XD1A 2Y8HA 4O01A 2EX9A 1EW0A 3FG8A 5FAQA 4Y13A 2Y2KA 3F1OA 3PBNA 4MN6A 3ISGA 1S1YA 3GDIA 4OQ0A 4KZ3A 2W1RA 3UY6A 4MCWA 2JKRI 4BLMA 3Q82A 3LCEA 2J3TC 3LR3A 4U0XA 1K57A 4CPKA 3K3CA 3CUEA 4YOFA 1F2KA 1GSWA 3VV4A 5FEFA 3N8SA 3NOPC 2W3GA 1K25A 4R0QA 4ZJ1A 4GD6A 3LICA 2QWSA 1JTDA 1H5XA 2K2NA 5M19A 2ZM0A 5HARA 3MXQA 2ZC3B 1UWNX 4L9EA 3WS5A 4EESA 4Z9QA 4FTXA 5KMWA 5HZHA 4E3MA 2ZMFA 1PWDA 3JVUA 4JXSA 2PR5A 3W2ZA 1OTEA 4NK3A 5GHXA 2WGIA 2OAP1 3EEAA 2VLGA 3DWKA 5AJGA 4MBHA 3SH7A 5AQAA 4Y5FA 4OQIA 1OTIA 5FQJA 3UDIA 5HWWA 3GECA 3KYEA 1XX2A 2PBDP 3M2JA 3LY3A 4XXRA 4Y2FA 5L07A 4GCZA 1KVLA 2JBFA 5JYPA 3NOUC 1OPXA 1GSVA 4N9LA 4MMNA 5FEGA 4BJPA 3UE0A 5DJTA 4BQMA 2Y55A 4HBTA 1PIOA 5CX7A 3UB9A 2QPNA 4KZBA 5G4ZA 4L9GA 2DCFA 1TS7A 4WMCA 3OPRA 3KSHA 4UA9A 1MKIA 5A93A 1KVMA 4UQIS 3G30A 4H6JB 2JKRM 1T19A 4GDBA 1NWZA 3G32A 4JF6A 4HBUA 4R6LA 2PYRA 4GZBA 4P6BA 1P0ZA 3LEQA 3T4LA 1IYOA 3ZVWA 2EXBA 2W1TA 2G2WA 3VP3A 4NXEA 1W63Q 1ERMA 2L4RA 4NXFA 3ZYTA 4I38A 4I39A 5EOOA 1LL9A 4HP4A 2ZQCA 3PYPA 3NOTC 2Y79A 5AQ9A 1GA9A 2WADA 4KZAA 3C30A 3K3DA 4LRZE 3QP4A 5E2HA 4WF0A 2X71A 4ZAMA 2OOLA 2JE5A 4S2KA 5J7EA 2O99A 3UDXA 1JWPA 1W8QA 3BQ8A 1W8YA 4HHDA 3CG5A 4OKPA 2ZOIA 2VV8A 1F9IA 1YQSA 1FCOA 3BFGA 2P9VB 2VEAA 3IBJA 4CJNA 4GDNA 5EOEA 4DDYA 3OLOA 1X0OA 4F94A 5L09A 3W4OA 1FR1A 4HEFA 2OLUA 4IVIA 4S2NC 3TJZC 2P04A 3KSFA 3A3DA 5HFOA 1OTBA 1H8ZA 3DAVA 4KQDA 5CGWA 3FV7A 2R9XA 1LL5A 4RX2A 3IXBA 1GSXA 1Q2QA 2E8JA 3UN7A 3QHYA 4PKYA 4C3QA 3MZFA 1ESUA 4UA7A 4RX3A 1L0EA 1NZOA 4BL2A 3MQ0A 1XJ2A 1FOFA 1FCNA 2XSSA 3ZG0A 4JF5A 3GRJA 5F6AA 1G68A 3T4KA 2Y59A 1G6OA 5GLCA 4IHQA 3KX0X 1ZHHB 4LV2A 1E4DA 4OOLA 2QZ6A 2HP6A 3GQZA 1FR6A 3FC7A 2ZQ9A 3LIEA 1XJ6A 4BL3A 5GHYA 1YLPA 4DJ2A 4FH4A 4EXOA 2EX8A 5KIZA 3OOVA 5A91A 4E3LA 5EVEA 1MWUA 5DFXA 3VMAA 2J3TD 4FUWA 5CGXA 4E3OA 3CHWP 5HX9A 5EECA 1N9NA 3ZG9B 1BLSA 4OLDA 5F5YA 4BBTA 2VGJA 3G2ZA 1G5UA 4LENA 3K2NA 3CPTB 3L7HA 2PD7A 2RCXA 2P7JA 3JPUA 5KZHA 4QJGA 4E3NA 1K4EA 5FI6A 5IHVA 2XH9A 4UAAA 3JVVA 2XQZA 1MXOA 1NRFA 3LUQA 4RQ9A 2V8CA 1MC0A 2Z6DA 4HNBA 1K55C 1KDSA 1IEMA 2WZXA 4K08A 4S2PA 1FSYA 5E2FA 5DF9A 3U2AA 1GA0A 4P85A 4ZJ2A 1K54C 4GJ4A 1WYBA 1LSXA 4Q0JA 1BLCA 4H8RA 3H9WA 3T4SA 3ZHHA 3KYZA 4WUJA 3LIFA 4Q0IA 2WKIA 4EWFA 4G3WA 2V0UA 1YLTA 2W27A 2HV1A 3SS3A 3SH9A 1PWCA 4DXCA 4YWZA 2A2LA 3BLMA 2WKPA 4DE1A 4EEPA 1S67L 2QJ7A 2QKPA 1CI8A 2R9WA 3V3RA 4E04A 3T12B 1BTLA 2XF3A 2FFFB 4Y17A 2WGWB 1JNUA 1HTZA 1N4OA 4EUVA 1SKOB 1WYCA 1O07A 4GNUA 3MZDA 4OQHA 4DF6A 3EEHA 4L9FA 3EGDC 1NY0A 4DE2A 1TDGA 4HJ4A 2IWDA 3NULA 2NUPC 2QMIA 3UB8A 3O88A 3B47A 3NECA 2HP9A 2PBYA 4YFMA 1CF0A 3CPTA 3B33A 4U3TA 4FCFA 1YSPA 1AWIA 2FH5A 3HVFA 1GCEA 2J9PA 3N6IA 4FD8A 4ETXA 2GX5A 4NXBA 3HLEA 2JKFA 3GV9A 4LRXC 3A3IA 5DF8A 2OAQ1 1CK3A 1T1AA 2WZZA 2Y2QA 1YLJA 4K91A 1VB6A 1LSWA 1P97A 1TDLA 1C3BA 1ONHA 1ZTUA 3G2YA 2HF6A 3QP1A 1FILA 4KZ8A 4MBFA 5F69A 1L2SA 3NI9A 3WWXA 4MBKA 2VK3A 4E3KA 4XT2B 2ZD8A 3P09A 1H8MA 1LSVA 3ZG8B 4XUXA 1K6RA 3TSGA 1DJCA 3IH8A 3UB7A 3WRTA 2JC7A 4I3IA 2HDUA 3RJUA 5AQ7A 3GVBA 4UEYA 4UHUA 3MFDA 5EVIC 2V1AA 4LV3A 2H0YA 1V9ZA 3N8RA 5FQMA 2W3EA 3OPHA 4FH2A 2K31A 3UO9A 3QNBA 4MN5A 1PRQA 3PAGA 1OTDA 2WGWA 4OOYA 1XA1A 4ID4A 1CEGA 3HJIA 5TBMB 2M7UA 2I9VA 1KGGA 3DBAA 2VGKA 1SKOA 4QD4A 2FZ0A 1YLWA 2K7SA 4WZ4A 2J7VA 4K0WA 2V0WA 2Y2JA 5E2GA 4IUKA 3E4OA 3MSHA 3IF6C 4K0XA 2J80A 1ES4A 1Q2PA 4X69A 2B02A 3LY4A 1DY6A 4R70A 1ES5A 2V2FF 3HCYA 4LLOB 2A49A 3H82B 5HPIA 4WBGA 4G3VA 4CLCA 5E43A 3O3VA 4KZ9A 3OBFA 3O87A 2PDRA 1IKIA 5DJUA 3HUNA 3PTEA 2UV0E 2MJ6A 1F98A 3UMEA 3AGEA 3C4PA 3G35A 1NZUA 4HH2A 3CITA 1UGUA 4X25A 4JKTA 4N1XA 1Z09A 4R38A 5KSCA 1STZA 1XXMA 4OP5A 3DWZA 5K5BA 1KE3A 4PAUA 2ACGA 3HLGA 4NEED 4XT2A 4BMWA 1OT6A 1XGJA 1ONGA 1ERQA 3OPPA 1IOUA 2XLNA 1L0FA 5HAPA 4LFUA 4RYEA 4QPRA 1I2WA 4OQGA 5C5KA 2WKHA 5EFWA 1DP9A 3MQQA 3UE6A 3VSLA 1XPBA 2WGVA 1K57C 4IEDA 5F68A 4JGPA 3E2KA 2LB5A 3CUEC 4S2IA 3MXRA 2YKFA 1ES3A 3PBTA 1LL8A 5E2EA 4B88A 2JCHA 3PAEA 3S7QA 3SS5A 3R7WB 2E8IA 4EU0A 2ZM8A 5TBMA 3M2KA 4QY6A 4OONA 3RTYA 1BLHA 4WN5A 1L3LA 5AVFA 4NG2A 1PNEA 4PM8A 4EETB 3H82A 4WLAA 5I5LA 1K0KA 3IQAA 3HREA 2I72A 2W3HA 3MKEA 4PM6A 1E3UD 2FFYA 4II7A 5EM0A 4EW7A 3NDGA 2P08A 1GHPA 3ITAA 1IYSA 4N1HA 3C7UA 2W3DA 3BECA 5HL6A 4OPZA 2VGLS 4BBVA 3OCLA 4OP8A 3MS6A 2WAFA 2OV5A 3VP0A 1MPLA 2X02A 3V5MA 4EEUA 2EWVA 2Y91A 4HESA 4Q8IA 1N9BA 5FA7A 3LIDA 4PPRA 3E98A 3ZNTA 5I94A 3KO6A 1T1BA 3BY8A 2BTFP 1KGEA 5U47A 3T4QA 1S6RA 4OH0A 2XA7M 3VP1A 3IWIA 2ZL1B 3QP2A 1V9YA 3WS2A 1K56D 1M6KA 2ZJ9A 3FPWA 3ZDJA 5G4YA 2WAEA 4GKUA 3VOLA 3T1RA 3D9YA 3V3SA 3MJQA 3Q81A 1MWTA 3F1NB 1L0GA 1FCMA 2VZWA 4KQRA 3BFCA 5EVLA 2PYPA 2H28A 3R7WA 4RVAA 3MBZA 4DE0A 3B3XA 2ZBBA 3EWKA 5IU1A 1W5DA 5FATA 4RA7A 2RL3A 5EVID 4G3KA 1UWPX 5HWVA 4H6JA 4EQIA 1YLYA 3NIAA 4Y0OA 1U60A 3ZVTA 3A0RA 5DKKA 4Y3IA 4R4SA 4ESPA 1PW8A 5DVAA 4QB8A 4KQQA 1BT5A 4N9KA 4JGOA 5A8BA 5DF7A 2JHEA 5J8XA 1I5QA 2GNXA 1KE4A 3VFHA 1PW1A 4C6YA 3BLSA 4P6ZS 2PD8A 3MXSA 2PHYA 4ZRRA 5FQIA 1FIKA 4I5SA 3MR0A 4HJ6A 3MQOA 3MMHA 2Q9MA 1NXYA 1NYYA 2EXAA 1N9LA 2EFUA 1K6SA 1Z6FA 2HDSA 2Y2LA 2W3FA 1PYYA 5GLBA 2ZL1A 4S2MA 2WYXA 3S7OA 2W0NA 5HD5A 2P9VA 3IS2B 1OJGA 2PAVP 2PU4A 3PHYA 5CHJA 4QWOA 4M4XA 3RH8B 2X01A 3GTCA 4X1MA 3F1NA 2VV6A 2XFTA 3T4TA 4JGRA 1J3WA 5FQKA 2M7VA 1PZPA 2VGLM 3BFEA 3TRCA 1EWZA 5HAIA 5HPFA 3B42A 1ACFA 1MWRA 3OPLA 4O0PA 2ZC7A 4FSFA 3E4PA 3OCNA 1W79A 4YNRA 5HDDA 3MZEA 3SS4A 2HDRA 4YINA 3G4PA 1EI5A 4GHIB 2HJ9C 2GDNA 3QNCA 3D4FA 1BYWA 1ALQA 2EFXA 5FI2A 4JXWA 3LR0A 1S0WA 3BFFA 3EQVA 1HD8A 3BFDA 3IF6B 3LIAA 3IWQA 4BD0A 3HJKA 1RGYA 2WUQA 2BLSA 5A90A 3JYIA 2V8FA 1CI9A 4GW9A 5FI7A 4X1LA 2BASA 3W4QA 2XK1A 2M1CA 4IVKA 5CERA 4X68A 2L1MA 1IYPA 5DFYA 3PXPA
chains in the Genus database with same CATH topology
1SCWA 1ES4A 4GZBA 4P6BA 4E6XA 4LCLA 2Y2NA 1Q2PA 4X69A 1IYOA 3ZVWA 4OOMA 2EXBA 1XP4A 3BEBA 2G2WA 3VP3A 5HL1A 1ERMA 3WS1A 3LY4A 1DY6A 3UPOA 1ES5A 2V2FF 2G2UA 1TEMA 2A49A 2ZC5B 1G6AA 4LV0A 5EOOA 4C75A 1IELA 1K56A 2ZQ7A 4OVDA 1LL9A 3Q07A 4WBGA 1LI0A 3S1YA 4DE3A 2ZQCA 2Q9NA 1ZG6A 3O3VA 5E43A 5FQQA 4KZ9A 4O7DA 4B4ZA 5AQ9A 1GA9A 3O87A 1IKIA 1M40A 3NCKA 3HUNA 2WADA 5CTNA 4WEKA 3PTEA 5TFQA 4KZAA 3HLDA 4WZ5A 1KDWA 5E2HA 3M6BA 3AGEA 3IH9A 3C4PA 5F83A 3G35A 3Q7VB 2X71A 4JLFA 4ZAMA 4KG6A 5CECA 1K55A 2JE5A 4S2KA 1NZUA 5CEDA 4WEJA 2Y2PA 3UDXA 5GL9A 1JWPA 5GLDA 1W8QA 1GHIA 1K54A 3ZGAB 1W8YA 3DTMA 5EPHA 4EUZA 3CG5A 4OKPA 4D2OA 3NY4A 2H0TA 1H8YA 3BM6A 4JKTA 1ZC2A 4N1XA 2H10A 4R23A 4WYYA 5KSCA 1XXMA 4UA6A 1YQSA 5CHMA 4OP5A 1FCOA 3DWZA 4ZBEA 4ZDXA 3BFGA 1KE3A 2XR0A 1Y54A 2P9VB 4S2LA 3HLGA 4N92A 4CJNA 4GDNA 4QHCA 5EOEA 4DDYA 4B4XA 1XGJA 1ONGA 1PZOA 4HBUA 1ERQA 3OPPA 2EX6A 1GHMA 5EVIB 2XLNA 4F94A 4KG5A 5DTTA 1L0FA 3W4OA 1FR1A 4HEFA 5HAPA 2OLUA 4IVIA 4S2NC 5FAPA 4BD1A 5JYOA 4RYEA 1I2WA 4OQGA 2XGNA 2WKHA 3GMWA 5TGFA 4KG2A 3A3JA 3VOZA 1LI9A 3A3DA 5HFOA 5D3OA 1H8ZA 3RXXA 1NJ4A 3NBLA 3IHAA 3VSLA 4L0LA 2PU2A 1XPBA 2OSUA 5EUAA 1SDEA 2WGVA 1K57C 4IEDA 2XDMA 1JTGA 3IXHA 3SH8A 5KSHA 3E2KA 1RP5A 2A3UA 3FWLA 3TOIA 3UE3A 5CGWA 3FV7A 4KZ4A 3MKFA 3C7VA 1E3UA 2R9XA 5M1AA 3BYDA 1ZG4A 3MXRA 4S2IA 3S4XA 3ZG7B 1ES3A 1LL5A 3PBTA 4RX2A 3IXBA 3OC2A 1Q2QA 5E2EA 4B88A 2ZLYA 2JCHA 1BUEA 1SKFA 3PAEA 5CTMA 2C6WB 5HAQA 4P87A 3SS5A 3UN7A 3QHYA 5FDHA 4C3QA 1DJBA 2E8IA 3MZFA 2ZM8A 3PBRA 1LLBA 1EROA 3M2KA 2Y2IA 1JVJA 4MNRA 4QY6A 4X55A 4OONA 2J9OA 1BLHA 3WS4A 1ESUA 4UA7A 3NC8A 3VOYA 4RX3A 3AGFA 1L0EA 1NZOA 3SOIA 4KZ6A 4BL2A 5GLAA 3VP4A 2ZC4B 3ZCZA 1FOFA 5F1GA 1FCNA 5FAOA 4E6WA 1E25A 4PMAA 3W8KA 3W4PA 3ZG0A 5A92A 4IBRA 4JF5A 3GRJA 3ITBA 1VQQA 1G68A 2Y59A 1XKZA 4PM8A 3RXWA 4KZ7A 5GLCA 3C5AA 3G31A 1W7FA 2ZC6B 3IQAA 1BSGA 1ZKJA 4LV2A 1E4DA 3HREA 2I72A 3MKEA 4OOLA 2QZ6A 4PM6A 1KGFA 1E3UD 2FFYA 2HP6A 3GQZA 4X6TA 3NDGA 1YM1A 2V1ZA 1FR6A 4GN2A 1PI5A 1GHPA 3FKWA 3ITAA 1IYSA 3IWOA 3PBQA 1LHYA 4N1HA 3C7UA 2ZQ9A 1HVBA 4BL3A 5GHYA 3BECA 4DKIA 1JWVA 1YLPA 3Q7VA 4FH4A 2EX8A 4OPZA 4DDSA 2DNSA 2BG1A 5CEBA 3HUMA 4QY5A 5EE8A 1L0DA 2XFSA 4ZJ3A 3OCLA 4OP8A 4OLGA 2WAFA 4LCMA 4WMCD 3N7WA 2OV5A 2CC1A 5A91A 3VP0A 1MPLA 2X02A 1XA7A 4E3IA 3V5MA 1PI4A 4E3LA 1MWUA 3VMAA 2Y91A 4HESA 4Q8IA 5FASA 1N9BA 5FA7A 5CGXA 4E3OA 4PPRA 3ZNTA 1HZOA 5I94A 4EV4A 2Y4AA 5F1FA 5HX9A 5EECA 3ZG9B 3CJMA 1MWSA 4JPMA 3P98A 1BLSA 3LEZA 2J8YA 3G34A 1K4FA 4OLDA 1KGEA 4Y7PA 3VSKA 2HDQA 3AGDA 1ESIA 3HLFA 1S6RA 2HPBA 4OH0A 2VGJA 5U47A 3G2ZA 3IHBA 3VP1A 3IWIA 4KENB 4JBFA 4LENA 4DXBA 4MEZA 1K38A 1XGIA 2UWXA 3WS2A 5EVIA 4JXVA 1K56D 2ZM2A 2XEPA 2C5WB 2B5RA 1M6KA 4EBNA 1BZAA 2OLVA 2ZJ9A 4P0MA 2RCXA 2Y2HA 2EX2A 1FQGA 2WKEA 3HUOA 3Q1FA 4DRTA 5KZHA 3ZDJA 5M18A 4R3BA 4U0TA 3FYZA 4QJGA 1NYMA 4E3NA 2WAEA 4GKUA 4PM9A 1K4EA 2IWCA 3A3FA 5FI6A 1JWZA 3V3SA 5IHVA 3Q81A 1MWTA 2XH9A 4NETA 4UAAA 4WELA 2XQZA 3IF5A 1MXOA 1I2SA 1NRFA 4S2JA 1L0GA 1FCMA 4WZ5C 4KQRA 3IF6A 3BFCA 5EVLA 4S2OA 1OMEA 2Y2MA 1K55C 3V39A 1KDSA 4RVAA 3MBZA 1IEMA 4ZTKA 4DE0A 4EBLA 2WZXA 3UNWA 4S2PA 1FSYA 3B3XA 5E2FA 3WRZA 5DF9A 3HBRA 1GA0A 4P85A 1IYQA 1SHVA 4ZJ2A 1K54C 3UE1A 3M6HA 1WYBA 2V20A 1W5DA 5FATA 3ZNYA 4X56A 1BLCA 4RA7A 2RL3A 3UPNA 5EVID 4H8RA 3IXGA 3A3EA 3ZHHA 4KZ5A 4M3KA 5CGSA 4EQIA 1YLYA 2WKIA 3PBSA 3NIAA 1YLZA 1U60A 4Y0OA 4EWFA 4OPQA 3Q7ZA 3ZVTA 1YLTA 3SS3A 3SH9A 3UPPA 1MY8A 3HL9A 1PWCA 1J9MA 4R4SA 4DXCA 4R1GA 1PW8A 2H5SA 3WS0A 1YMSA 3BLMA 5CHUA 3HLCA 1PWGA 5DVAA 4DE1A 5HW3A 4QB8A 4KQQA 4Y0UA 1BT5A 4N9KA 3ZFZA 3BRMA 5F82A 3S22A 1DJAA 5DF7A 1CI8A 2R9WA 5J8XA 1I5QA 3V3RA 5AQBA 4OPYA 3HLBA 3C4OA 1BTLA 4WM9A 2XF3A 1O7EA 2FFFB 3EQUA 1KE4A 1QMEA 2WGWB 5CRFA 3VFHA 1PW1A 4C6YA 4PM7A 3BLSA 5TR7A 3MXSA 5BOHA 1HTZA 1YMXA 4XUZA 3E2LA 3VP2A 1N4OA 4MLLA 2Z2LB 5FQIA 1AXBA 3GR2A 4A5RA 4OPRA 1WYCA 1O07A 4GNUA 3MZDA 4GB7A 3NDEA 4OQHA 1BULA 2XD1A 2Q9MA 4DF6A 1ES2A 2EX9A 2HP5A 4GOGA 1FSWA 1NXYA 2EXAA 1NYYA 1NY0A 4DE2A 2EFUA 1CEFA 5FAQA 4S2NA 2Y2KA 1K6SA 1TDGA 3PBNA 3ISGA 2IWDA 1Z6FA 4OQ0A 2HDSA 2Y2LA 2ZQAA 1PYYA 4KZ3A 5GLBA 3V50A 1VM1A 2QMIA 3UY6A 4S2MA 2WYXA 4BLMA 3Q82A 4PM5A 3O88A 2HP9A 2PBYA 3LCEA 3LO7A 2P9VA 2IWBA 4U0XA 3IXDA 4YFMA 1K57A 4CPKA 2PU4A 4GD8A 4U3TA 4FCFA 2ZQDA 5CHJA 3HVFA 4X53A 3N8SA 1GCEA 2J9PA 1K25A 5GHZA 3N6IA 4FD8A 4R0QA 4GD6A 5CXWA 4ZJ1A 3FZCA 2X01A 3HLEA 3GV9A 4JF4A 3A3IA 3N8LA 5DF8A 1JTDA 3I7JA 3GTCA 1CK3A 3IT9A 2WZZA 3O86A 1H5XA 5M19A 2Y2QA 1SDNA 1YLJA 2ZM0A 5HARA 4K91A 4Y0TA 2XFTA 3CZDA 3ZG5A 2ZC3B 3WS5A 1TDLA 3HLWA 5FQKA 1PZPA 2XD5A 2DRWA 3BFEA 4Z9QA 5KMWA 1EWZA 1C3BA 4E3MA 1ONHA 2P74A 3G2YA 5G18A 1MBLA 1PWDA 2Z2MB 4JXSA 5DTKA 4R4RA 5HAIA 2ZMAA 3UDFA 3TG9A 4NK3A 5GHXA 4KZ8A 2WGIA 2Y2GA 1MWRA 3OPLA 4MBFA 1L2SA 2ZC7A 3NI9A 3WWXA 3DWKA 4MBKA 1IKGA 4FSFA 4BENA 4MBHA 3SH7A 5AQAA 3OCNA 1W79A 1BLPA 4E3KA 2WK0A 3MZEA 3OZHA 4OQIA 3SS4A 2HDRA 5FQJA 3UDIA 4YINA 1RGZA 2ZD8A 3G4PA 3P09A 1EI5A 3ZG8B 4XUXA 1K6RA 1XX2A 1DJCA 3M2JA 3TSGA 3IH8A 3LY3A 4XXRA 2GDNA 3QNCA 3WRTA 3D4FA 2ZQ8A 1KVLA 3GSGA 1ALQA 2JC7A 5DTSA 2JBFA 2EFXA 2HDUA 5FI2A 4QU3A 5JYPA 3RJUA 4JXWA 5AQ7A 5L2FA 3GVBA 1S0WA 4EBPA 3BFFA 4N9LA 1KE0A 3EQVA 3MFDA 4UHUA 4BJPA 3UE0A 5EVIC 4BQMA 2Y55A 4HBTA 4LV1A 1HD8A 4LV3A 2H0YA 3BFDA 3IF6B 3N8RA 4KQOA 4JXGA 5FQMA 1PIOA 3OPHA 2Y2OA 3N4IA 3IWQA 4FH2A 1TVFA 4BD0A 3FKVA 1QMFA 3CMZA 1RGYA 2WUQA 5FQ9A 2BLSA 3QNBA 3UO9A 2QPNA 4E3JA 4KZBA 4R3JA 5A90A 1WE4A 3JYIA 3PAGA 2WGWA 4OOYA 1XA1A 2DCFA 1CI9A 4ID4A 4WMCA 3OPRA 1CEGA 4UA9A 3PBOA 5FI7A 1MKIA 3VFFA 1KVMA 5A93A 3W4QA 1KGGA 2XK1A 2VGKA 4QD4A 3G30A 4IBXA 1YT4A 1YLWA 4WZ4A 2J7VA 3DW0A 1RCJA 4K0WA 4IVKA 2Y2JA 5CERA 4GDBA 5E2GA 4X68A 3G32A 4JF6A 5FSRA 3IF6C 1IYPA 4K0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SCW A;  1ES4 A;  4GZB A;  4P6B A;  4E6X A;  4LCL A;  2Y2N A;  1Q2P A;  4X69 A;  1IYO A;  3ZVW A;  4OOM A;  2EXB A;  1XP4 A;  3BEB A;  2G2W A;  3VP3 A;  5HL1 A;  1ERM A;  3WS1 A;  3LY4 A;  1DY6 A;  3UPO A;  1ES5 A;  2V2F F;  2G2U A;  1TEM A;  2A49 A;  2ZC5 B;  1G6A A;  4LV0 A;  5EOO A;  4C75 A;  1IEL A;  1K56 A;  2ZQ7 A;  4OVD A;  1LL9 A;  3Q07 A;  4WBG A;  1LI0 A;  3S1Y A;  4DE3 A;  2ZQC A;  2Q9N A;  1ZG6 A;  3O3V A;  5E43 A;  5FQQ A;  4KZ9 A;  4O7D A;  4B4Z A;  5AQ9 A;  1GA9 A;  3O87 A;  1IKI A;  1M40 A;  3NCK A;  3HUN A;  2WAD A;  5CTN A;  4WEK A;  3PTE A;  5TFQ A;  4KZA A;  3HLD A;  4WZ5 A;  1KDW A;  5E2H A;  3M6B A;  3AGE A;  3IH9 A;  3C4P A;  5F83 A;  3G35 A;  3Q7V B;  2X71 A;  4JLF A;  4ZAM A;  4KG6 A;  5CEC A;  1K55 A;  2JE5 A;  4S2K A;  1NZU A;  5CED A;  4WEJ A;  2Y2P A;  3UDX A;  5GL9 A;  1JWP A;  5GLD A;  1W8Q A;  1GHI A;  1K54 A;  3ZGA B;  1W8Y A;  3DTM A;  5EPH A;  4EUZ A;  3CG5 A;  4OKP A;  4D2O A;  3NY4 A;  2H0T A;  1H8Y A;  3BM6 A;  4JKT A;  1ZC2 A;  4N1X A;  2H10 A;  4R23 A;  4WYY A;  5KSC A;  1XXM A;  4UA6 A;  1YQS A;  5CHM A;  4OP5 A;  1FCO A;  3DWZ A;  4ZBE A;  4ZDX A;  3BFG A;  1KE3 A;  2XR0 A;  1Y54 A;  2P9V B;  4S2L A;  3HLG A;  4N92 A;  4CJN A;  4GDN A;  4QHC A;  5EOE A;  4DDY A;  4B4X A;  1XGJ A;  1ONG A;  1PZO A;  4HBU A;  1ERQ A;  3OPP A;  2EX6 A;  1GHM A;  5EVI B;  2XLN A;  4F94 A;  4KG5 A;  5DTT A;  1L0F A;  3W4O A;  1FR1 A;  4HEF A;  5HAP A;  2OLU A;  4IVI A;  4S2N C;  5FAP A;  4BD1 A;  5JYO A;  4RYE A;  1I2W A;  4OQG A;  2XGN A;  2WKH A;  3GMW A;  5TGF A;  4KG2 A;  3A3J A;  3VOZ A;  1LI9 A;  3A3D A;  5HFO A;  5D3O A;  1H8Z A;  3RXX A;  1NJ4 A;  3NBL A;  3IHA A;  3VSL A;  4L0L A;  2PU2 A;  1XPB A;  2OSU A;  5EUA A;  1SDE A;  2WGV A;  1K57 C;  4IED A;  2XDM A;  1JTG A;  3IXH A;  3SH8 A;  5KSH A;  3E2K A;  1RP5 A;  2A3U A;  3FWL A;  3TOI A;  3UE3 A;  5CGW A;  3FV7 A;  4KZ4 A;  3MKF A;  3C7V A;  1E3U A;  2R9X A;  5M1A A;  3BYD A;  1ZG4 A;  3MXR A;  4S2I A;  3S4X A;  3ZG7 B;  1ES3 A;  1LL5 A;  3PBT A;  4RX2 A;  3IXB A;  3OC2 A;  1Q2Q A;  5E2E A;  4B88 A;  2ZLY A;  2JCH A;  1BUE A;  1SKF A;  3PAE A;  5CTM A;  2C6W B;  5HAQ A;  4P87 A;  3SS5 A;  3UN7 A;  3QHY A;  5FDH A;  4C3Q A;  1DJB A;  2E8I A;  3MZF A;  2ZM8 A;  3PBR A;  1LLB A;  1ERO A;  3M2K A;  2Y2I A;  1JVJ A;  4MNR A;  4QY6 A;  4X55 A;  4OON A;  2J9O A;  1BLH A;  3WS4 A;  1ESU A;  4UA7 A;  3NC8 A;  3VOY A;  4RX3 A;  3AGF A;  1L0E A;  1NZO A;  3SOI A;  4KZ6 A;  4BL2 A;  5GLA A;  3VP4 A;  2ZC4 B;  3ZCZ A;  1FOF A;  5F1G A;  1FCN A;  5FAO A;  4E6W A;  1E25 A;  4PMA A;  3W8K A;  3W4P A;  3ZG0 A;  5A92 A;  4IBR A;  4JF5 A;  3GRJ A;  3ITB A;  1VQQ A;  1G68 A;  2Y59 A;  1XKZ A;  4PM8 A;  3RXW A;  4KZ7 A;  5GLC A;  3C5A A;  3G31 A;  1W7F A;  2ZC6 B;  3IQA A;  1BSG A;  1ZKJ A;  4LV2 A;  1E4D A;  3HRE A;  2I72 A;  3MKE A;  4OOL A;  2QZ6 A;  4PM6 A;  1KGF A;  1E3U D;  2FFY A;  2HP6 A;  3GQZ A;  4X6T A;  3NDG A;  1YM1 A;  2V1Z A;  1FR6 A;  4GN2 A;  1PI5 A;  1GHP A;  3FKW A;  3ITA A;  1IYS A;  3IWO A;  3PBQ A;  1LHY A;  4N1H A;  3C7U A;  2ZQ9 A;  1HVB A;  4BL3 A;  5GHY A;  3BEC A;  4DKI A;  1JWV A;  1YLP A;  3Q7V A;  4FH4 A;  2EX8 A;  4OPZ A;  4DDS A;  2DNS A;  2BG1 A;  5CEB A;  3HUM A;  4QY5 A;  5EE8 A;  1L0D A;  2XFS A;  4ZJ3 A;  3OCL A;  4OP8 A;  4OLG A;  2WAF A;  4LCM A;  4WMC D;  3N7W A;  2OV5 A;  2CC1 A;  5A91 A;  3VP0 A;  1MPL A;  2X02 A;  1XA7 A;  4E3I A;  3V5M A;  1PI4 A;  4E3L A;  1MWU A;  3VMA A;  2Y91 A;  4HES A;  4Q8I A;  5FAS A;  1N9B A;  5FA7 A;  5CGX A;  4E3O A;  4PPR A;  3ZNT A;  1HZO A;  5I94 A;  4EV4 A;  2Y4A A;  5F1F A;  5HX9 A;  5EEC A;  3ZG9 B;  3CJM A;  1MWS A;  4JPM A;  3P98 A;  1BLS A;  3LEZ A;  2J8Y A;  3G34 A;  1K4F A;  4OLD A;  1KGE A;  4Y7P A;  3VSK A;  2HDQ A;  3AGD A;  1ESI A;  3HLF A;  1S6R A;  2HPB A;  4OH0 A;  2VGJ A;  5U47 A;  3G2Z A;  3IHB A;  3VP1 A;  3IWI A;  4KEN B;  4JBF A;  4LEN A;  4DXB A;  4MEZ A;  1K38 A;  1XGI A;  2UWX A;  3WS2 A;  5EVI A;  4JXV A;  1K56 D;  2ZM2 A;  2XEP A;  2C5W B;  2B5R A;  1M6K A;  4EBN A;  1BZA A;  2OLV A;  2ZJ9 A;  4P0M A;  2RCX A;  2Y2H A;  2EX2 A;  1FQG A;  2WKE A;  3HUO A;  3Q1F A;  4DRT A;  5KZH A;  3ZDJ A;  5M18 A;  4R3B A;  4U0T A;  3FYZ A;  4QJG A;  1NYM A;  4E3N A;  2WAE A;  4GKU A;  4PM9 A;  1K4E A;  2IWC A;  3A3F A;  5FI6 A;  1JWZ A;  3V3S A;  5IHV A;  3Q81 A;  1MWT A;  2XH9 A;  4NET A;  4UAA A;  4WEL A;  2XQZ A;  3IF5 A;  1MXO A;  1I2S A;  1NRF A;  4S2J A;  1L0G A;  1FCM A;  4WZ5 C;  4KQR A;  3IF6 A;  3BFC A;  5EVL A;  4S2O A;  1OME A;  2Y2M A;  1K55 C;  3V39 A;  1KDS A;  4RVA A;  3MBZ A;  1IEM A;  4ZTK A;  4DE0 A;  4EBL A;  2WZX A;  3UNW A;  4S2P A;  1FSY A;  3B3X A;  5E2F A;  3WRZ A;  5DF9 A;  3HBR A;  1GA0 A;  4P85 A;  1IYQ A;  1SHV A;  4ZJ2 A;  1K54 C;  3UE1 A;  3M6H A;  1WYB A;  2V20 A;  1W5D A;  5FAT A;  3ZNY A;  4X56 A;  1BLC A;  4RA7 A;  2RL3 A;  3UPN A;  5EVI D;  4H8R A;  3IXG A;  3A3E A;  3ZHH A;  4KZ5 A;  4M3K A;  5CGS A;  4EQI A;  1YLY A;  2WKI A;  3PBS A;  3NIA A;  1YLZ A;  1U60 A;  4Y0O A;  4EWF A;  4OPQ A;  3Q7Z A;  3ZVT A;  1YLT A;  3SS3 A;  3SH9 A;  3UPP A;  1MY8 A;  3HL9 A;  1PWC A;  1J9M A;  4R4S A;  4DXC A;  4R1G A;  1PW8 A;  2H5S A;  3WS0 A;  1YMS A;  3BLM A;  5CHU A;  3HLC A;  1PWG A;  5DVA A;  4DE1 A;  5HW3 A;  4QB8 A;  4KQQ A;  4Y0U A;  1BT5 A;  4N9K A;  3ZFZ A;  3BRM A;  5F82 A;  3S22 A;  1DJA A;  5DF7 A;  1CI8 A;  2R9W A;  5J8X A;  1I5Q A;  3V3R A;  5AQB A;  4OPY A;  3HLB A;  3C4O A;  1BTL A;  4WM9 A;  2XF3 A;  1O7E A;  2FFF B;  3EQU A;  1KE4 A;  1QME A;  2WGW B;  5CRF A;  3VFH A;  1PW1 A;  4C6Y A;  4PM7 A;  3BLS A;  5TR7 A;  3MXS A;  5BOH A;  1HTZ A;  1YMX A;  4XUZ A;  3E2L A;  3VP2 A;  1N4O A;  4MLL A;  2Z2L B;  5FQI A;  1AXB A;  3GR2 A;  4A5R A;  4OPR A;  1WYC A;  1O07 A;  4GNU A;  3MZD A;  4GB7 A;  3NDE A;  4OQH A;  1BUL A;  2XD1 A;  2Q9M A;  4DF6 A;  1ES2 A;  2EX9 A;  2HP5 A;  4GOG A;  1FSW A;  1NXY A;  2EXA A;  1NYY A;  1NY0 A;  4DE2 A;  2EFU A;  1CEF A;  5FAQ A;  4S2N A;  2Y2K A;  1K6S A;  1TDG A;  3PBN A;  3ISG A;  2IWD A;  1Z6F A;  4OQ0 A;  2HDS A;  2Y2L A;  2ZQA A;  1PYY A;  4KZ3 A;  5GLB A;  3V50 A;  1VM1 A;  2QMI A;  3UY6 A;  4S2M A;  2WYX A;  4BLM A;  3Q82 A;  4PM5 A;  3O88 A;  2HP9 A;  2PBY A;  3LCE A;  3LO7 A;  2P9V A;  2IWB A;  4U0X A;  3IXD A;  4YFM A;  1K57 A;  4CPK A;  2PU4 A;  4GD8 A;  4U3T A;  4FCF A;  2ZQD A;  5CHJ A;  3HVF A;  4X53 A;  3N8S A;  1GCE A;  2J9P A;  1K25 A;  5GHZ A;  3N6I A;  4FD8 A;  4R0Q A;  4GD6 A;  5CXW A;  4ZJ1 A;  3FZC A;  2X01 A;  3HLE A;  3GV9 A;  4JF4 A;  3A3I A;  3N8L A;  5DF8 A;  1JTD A;  3I7J A;  3GTC A;  1CK3 A;  3IT9 A;  2WZZ A;  3O86 A;  1H5X A;  5M19 A;  2Y2Q A;  1SDN A;  1YLJ A;  2ZM0 A;  5HAR A;  4K91 A;  4Y0T A;  2XFT A;  3CZD A;  3ZG5 A;  2ZC3 B;  3WS5 A;  1TDL A;  3HLW A;  5FQK A;  1PZP A;  2XD5 A;  2DRW A;  3BFE A;  4Z9Q A;  5KMW A;  1EWZ A;  1C3B A;  4E3M A;  1ONH A;  2P74 A;  3G2Y A;  5G18 A;  1MBL A;  1PWD A;  2Z2M B;  4JXS A;  5DTK A;  4R4R A;  5HAI A;  2ZMA A;  3UDF A;  3TG9 A;  4NK3 A;  5GHX A;  4KZ8 A;  2WGI A;  2Y2G A;  1MWR A;  3OPL A;  4MBF A;  1L2S A;  2ZC7 A;  3NI9 A;  3WWX A;  3DWK A;  4MBK A;  1IKG A;  4FSF A;  4BEN A;  4MBH A;  3SH7 A;  5AQA A;  3OCN A;  1W79 A;  1BLP A;  4E3K A;  2WK0 A;  3MZE A;  3OZH A;  4OQI A;  3SS4 A;  2HDR A;  5FQJ A;  3UDI A;  4YIN A;  1RGZ A;  2ZD8 A;  3G4P A;  3P09 A;  1EI5 A;  3ZG8 B;  4XUX A;  1K6R A;  1XX2 A;  1DJC A;  3M2J A;  3TSG A;  3IH8 A;  3LY3 A;  4XXR A;  2GDN A;  3QNC A;  3WRT A;  3D4F A;  2ZQ8 A;  1KVL A;  3GSG A;  1ALQ A;  2JC7 A;  5DTS A;  2JBF A;  2EFX A;  2HDU A;  5FI2 A;  4QU3 A;  5JYP A;  3RJU A;  4JXW A;  5AQ7 A;  5L2F A;  3GVB A;  1S0W A;  4EBP A;  3BFF A;  4N9L A;  1KE0 A;  3EQV A;  3MFD A;  4UHU A;  4BJP A;  3UE0 A;  5EVI C;  4BQM A;  2Y55 A;  4HBT A;  4LV1 A;  1HD8 A;  4LV3 A;  2H0Y A;  3BFD A;  3IF6 B;  3N8R A;  4KQO A;  4JXG A;  5FQM A;  1PIO A;  3OPH A;  2Y2O A;  3N4I A;  3IWQ A;  4FH2 A;  1TVF A;  4BD0 A;  3FKV A;  1QMF A;  3CMZ A;  1RGY A;  2WUQ A;  5FQ9 A;  2BLS A;  3QNB A;  3UO9 A;  2QPN A;  4E3J A;  4KZB A;  4R3J A;  5A90 A;  1WE4 A;  3JYI A;  3PAG A;  2WGW A;  4OOY A;  1XA1 A;  2DCF A;  1CI9 A;  4ID4 A;  4WMC A;  3OPR A;  1CEG A;  4UA9 A;  3PBO A;  5FI7 A;  1MKI A;  3VFF A;  1KVM A;  5A93 A;  3W4Q A;  1KGG A;  2XK1 A;  2VGK A;  4QD4 A;  3G30 A;  4IBX A;  1YT4 A;  1YLW A;  4WZ4 A;  2J7V A;  3DW0 A;  1RCJ A;  4K0W A;  4IVK A;  2Y2J A;  5CER A;  4GDB A;  5E2G A;  4X68 A;  3G32 A;  4JF6 A;  5FSR A;  3IF6 C;  1IYP A;  4K0X A; 
#chains in the Genus database with same CATH topology
 4D60 A;  1SCW A;  4LCL A;  4OOM A;  1XP4 A;  1NLY A;  3D72 A;  1TEM A;  2ZC5 B;  2V1B A;  1K56 A;  4DE3 A;  1N9O A;  3Q07 A;  2AVX A;  5FQQ A;  1ZG6 A;  3IS2 A;  2Q0O A;  3NHQ A;  3ULF A;  4AFI A;  3V67 A;  1M40 A;  1D7E A;  3NCK A;  5CTN A;  4WEK A;  3IX8 A;  1LT0 A;  3HLD A;  4WZ5 A;  2NUT C;  4JLF A;  3T1Q B;  3PR6 A;  5CED A;  4WEJ A;  2Y2P A;  1NLZ A;  3ZGA B;  5EPH A;  4D2O A;  3CLO A;  2H0T A;  1H8Y A;  4P6Z M;  4WYY A;  4BWI A;  4UA6 A;  3VE4 A;  4ZBE A;  1CJF A;  4ZDX A;  1S1Z A;  4S2L A;  2IA2 A;  4B4X A;  1PZO A;  4GHI A;  1P9R A;  2A24 B;  3ICY A;  5DTT A;  4BD1 A;  1XFN A;  2VKS A;  2HJE A;  2XGN A;  3VOZ A;  5TGF A;  4KG2 A;  3A3J A;  3T1S A;  1LI9 A;  1KOU A;  5D3O A;  2QYB A;  3NBL A;  4BBU A;  2OSU A;  5EUA A;  1SDE A;  3FWL A;  1RP5 A;  2VA0 A;  3UE3 A;  2J3W A;  5AVE A;  3C7V A;  1S4S A;  4HI4 A;  3BYD A;  3S4X A;  3ZG7 B;  1BUE A;  5CTM A;  2C6W B;  3A0V A;  4P87 A;  2XRO A;  1D1J A;  5FDH A;  1DJB A;  3BW6 A;  1LLB A;  1ERO A;  3UB5 P;  3KSG A;  3MFX A;  2ZC4 B;  5F1G A;  2L0W A;  5FAO A;  4E6W A;  3W8K A;  4PMA A;  3W4P A;  5A92 A;  3QP6 A;  3R4K A;  2XA7 S;  3ITB A;  1VQQ A;  4Y15 A;  5L10 A;  1XKZ A;  4HQA A;  3C5A A;  2INW A;  2O9B A;  4CQH A;  3G31 A;  4LPZ A;  4B93 A;  1KGF A;  1PI5 A;  3IWO A;  3LIB A;  1LHY A;  3PBQ A;  2PT7 A;  2WKR A;  1HVB A;  1YSQ A;  1JWV A;  3EGX C;  2DNS A;  3CWF A;  5CEB A;  3HUM A;  3DTK A;  2XFS A;  4ZJ3 A;  4LCM A;  4R3A A;  2ZOH A;  1XA7 A;  4E3I A;  1PI4 A;  2W1T B;  4WL9 A;  5FAS A;  1VEU B;  2HGV A;  3UB6 A;  2Y4A A;  3KSI A;  3CJM A;  3LEZ A;  3L9K A;  1W63 M;  3VSK A;  1ESI A;  3HLF A;  2HPB A;  3IX4 A;  5EV0 A;  3IHB A;  4KEN B;  4JBF A;  4DXB A;  4MEZ A;  1K38 A;  1XGI A;  3CI6 A;  2A24 A;  2ZM2 A;  2XEP A;  2B5R A;  5HSQ A;  4EBN A;  4P0M A;  2Y2H A;  2EX2 A;  2G7U A;  1FQG A;  3HUO A;  4DRT A;  5M18 A;  2WKQ A;  4U0T A;  3FYZ A;  4PKY G;  1G28 A;  2IWC A;  3A3F A;  4CLC C;  1JWZ A;  4NET A;  4S2J A;  4NXG A;  1T18 A;  1OME A;  4DN0 A;  2Y2M A;  3UNW A;  2O9A A;  3HBR A;  1IYQ A;  4IJG A;  3M6H A;  2V20 A;  3UPN A;  5TJJ A;  3O5Y A;  3A3E A;  4KZ5 A;  4M3K A;  5CGS A;  4IUH A;  3PBS A;  1OT9 A;  3UPP A;  3HL9 A;  4R1G A;  3LI9 A;  2VJW A;  1OTA A;  1YMS A;  5CHU A;  3WS0 A;  3HLC A;  1PWG A;  5HW3 A;  1VHM A;  3ZQ5 A;  5F82 A;  3S22 A;  2PRF A;  4OPY A;  4WM9 A;  3C4O A;  1VET B;  3EQU A;  1QME A;  5TR7 A;  5BOH A;  1YMX A;  3E2L A;  3VP2 A;  4MLL A;  2Z2L B;  2O0Y A;  1AXB A;  3GR2 A;  4OPR A;  4ME4 A;  1VEU A;  4GB7 A;  3NDE A;  1BUL A;  3BY9 A;  1ES2 A;  2HP5 A;  2YKH A;  3C8C A;  4GOG A;  3QP5 A;  1FSW A;  2B18 A;  3DTI A;  1CEF A;  4S2N A;  3BWL A;  2ZQA A;  1HLU P;  3V50 A;  1VM1 A;  4PM5 A;  1H3Q A;  3LO7 A;  2IWB A;  4LGW A;  3IXD A;  4GD8 A;  2ZQD A;  4X53 A;  4Q0H A;  3DTE A;  5GHZ A;  5HD3 A;  5CXW A;  3VE3 A;  4MDZ A;  3FZC A;  3D3O A;  4JF4 A;  3N8L A;  4HY8 A;  3I7J A;  3IT9 A;  3O86 A;  1SDN A;  4Y0T A;  3CZD A;  3ZG5 A;  1WA9 A;  3HLW A;  2XD5 A;  2DRW A;  2P74 A;  5G18 A;  1MBL A;  5DTK A;  2Z2M B;  5HDS A;  4R4R A;  2ZMA A;  1A0K A;  3UDF A;  3TG9 A;  3RFB A;  2Y2G A;  2VV7 A;  2LB9 A;  1IKG A;  4BEN A;  1BLP A;  2WK0 A;  3OZH A;  1S4R A;  1YAX A;  1RGZ A;  1XJ3 A;  1TF1 A;  2EWW A;  5LBR A;  2ZQ8 A;  3GSG A;  1PFL A;  5DTS A;  4QU3 A;  3IBR A;  5L2F A;  3TW8 A;  4EBP A;  1KE0 A;  3E0Y A;  3C38 A;  2O9C A;  4LV1 A;  4KQO A;  5J4E A;  4JXG A;  4F3L B;  2Y2O A;  3N4I A;  4I3J A;  1TVF A;  3FKV A;  1QMF A;  3CMZ A;  5FQ9 A;  4E3J A;  4R3J A;  1WE4 A;  1VET A;  2OWH A;  3PBO A;  4DJ3 A;  2VX8 A;  3VFF A;  1NRJ A;  2EA9 A;  4IBX A;  1YT4 A;  3DW0 A;  1MZU A;  1RCJ A;  4HH3 A;  5FSR A;  3BQA A;  1MKM A;  4HP9 A;  4E6X A;  2Y2N A;  1Y4O A;  2GJ3 A;  3BEB A;  5HL1 A;  2JKG A;  5EM1 A;  3WS1 A;  1OJ5 A;  5FDS A;  3LFV A;  3UPO A;  2G2U A;  1G6A A;  4LV0 A;  2QJ5 A;  3S7P A;  4C75 A;  1IEL A;  2ZQ7 A;  2PR6 A;  4OVD A;  3G6O A;  4KUO A;  4KUK A;  1LI0 A;  3S1Y A;  2Q9N A;  4B4Z A;  4O7D A;  3T1X A;  4PHT A;  2ZMV A;  5IS1 A;  4ARZ B;  5TFQ A;  1KDW A;  3M6B A;  3IH9 A;  5F83 A;  4Z1W A;  3Q7V B;  4KG6 A;  5CEC A;  1K55 A;  5GL9 A;  5GLD A;  1TS0 A;  1GHI A;  1K54 A;  3DTM A;  1DP8 A;  4EUZ A;  3LGO A;  3SW1 A;  4UQI M;  3NY4 A;  3T50 A;  3BM6 A;  1ZC2 A;  2H10 A;  4R23 A;  5CHM A;  1ODV A;  3H7W B;  4GS9 B;  4I3A A;  3UMD A;  2XR0 A;  1Y54 A;  4N92 A;  4CLC D;  4QHC A;  4CLC E;  1D06 A;  2D02 A;  2EX6 A;  1GHM A;  5EVI B;  4MN7 A;  4KG5 A;  2HZ5 A;  3F1P B;  5FAP A;  5JYO A;  2D01 A;  3GMW A;  3E4Q A;  3FPV A;  5J3W A;  3RXX A;  1NJ4 A;  3IHA A;  4L0L A;  1S66 L;  2PU2 A;  5KSH A;  4EQ1 A;  2XDM A;  1JTG A;  3IXH A;  3SH8 A;  4F3L A;  3TOI A;  2A3U A;  4B9O A;  4KZ4 A;  3MKF A;  1TS8 A;  1E3U A;  5M1A A;  1ZG4 A;  2R78 A;  5MC7 A;  3MF0 A;  3OC2 A;  2ZLY A;  1SKF A;  1XJ4 A;  5HAQ A;  3C2W A;  4JGQ A;  2GZA A;  3PBR A;  4GLQ A;  2Y2I A;  1JVJ A;  4MNR A;  4NKP A;  4X55 A;  2OWJ A;  2J9O A;  1TS6 A;  3WS4 A;  3NC8 A;  3VOY A;  4DMZ A;  3AGF A;  3SOI A;  4KZ6 A;  5GLA A;  3VP4 A;  3S7N A;  3ZCZ A;  1E25 A;  4HJ3 A;  4IBR A;  5HDC A;  3U4L P;  3RXW A;  4KZ7 A;  2KOI A;  1W7F A;  2ZC6 B;  3BJN A;  1BSG A;  1ZKJ A;  2JN7 A;  4X6T A;  2KLI A;  1YM1 A;  2V1Z A;  4GN2 A;  3FKW A;  4ARZ A;  4DKI A;  3Q7V A;  2V9A A;  1T1C A;  1Y28 A;  4DDS A;  2BG1 A;  5EE8 A;  4QY5 A;  1L0D A;  4ETZ A;  5FL3 A;  4OLG A;  4HIA A;  4WMC D;  3N7W A;  2CC1 A;  2KDK A;  4FOF A;  1F5M A;  2B95 A;  1HZO A;  4EV4 A;  3SZT A;  5L8M A;  5F1F A;  5HWT A;  3H7W A;  1CQA A;  3LR5 A;  4GS9 A;  1MWS A;  4JPM A;  2XRN A;  3P98 A;  2J8Y A;  3G34 A;  1K4F A;  2JKT I;  4CLC B;  3F1O B;  4Y7P A;  2HDQ A;  3AGD A;  4O8G A;  3CAX A;  2UWX A;  5EVI A;  1DRM A;  1YKD A;  4JXV A;  2C5W B;  3F1P A;  1BZA A;  2OLV A;  3TE8 A;  2WKE A;  3Q1F A;  3T4O A;  4R3B A;  3QP8 A;  1NYM A;  4PM9 A;  4LRY C;  4WEL A;  3IF5 A;  1I2S A;  2Z6C A;  2DMW A;  4WZ5 C;  3IF6 A;  3KYQ A;  3NJA A;  4S2O A;  3P01 A;  3EOI A;  3V39 A;  4ZTK A;  4EBL A;  5IT5 A;  3WRZ A;  1XFQ A;  4HOI A;  1DP6 A;  1SHV A;  3UE1 A;  3ZNY A;  2CMN A;  4X56 A;  3LI8 A;  1SZV A;  3IXG A;  3LYX A;  1YLZ A;  4OPQ A;  3Q7Z A;  2KX6 A;  1MY8 A;  1H0M A;  1J9M A;  2H5S A;  3LR4 A;  5DKL A;  4Y0U A;  3ZFZ A;  3P7N A;  3BRM A;  3A0S A;  1P9W A;  1DJA A;  1YPR A;  3T4J A;  5AQB A;  3HLB A;  1TD5 A;  1O7E A;  5CRF A;  4PM7 A;  1IFQ A;  2QHK A;  4XUZ A;  2JKT M;  4EER A;  3IX3 A;  4A5R A;  2XD1 A;  2Y8H A;  4O01 A;  2EX9 A;  1EW0 A;  3FG8 A;  5FAQ A;  4Y13 A;  2Y2K A;  3F1O A;  3PBN A;  4MN6 A;  3ISG A;  1S1Y A;  3GDI A;  4OQ0 A;  4KZ3 A;  2W1R A;  3UY6 A;  4MCW A;  2JKR I;  4BLM A;  3Q82 A;  3LCE A;  2J3T C;  3LR3 A;  4U0X A;  1K57 A;  4CPK A;  3K3C A;  3CUE A;  4YOF A;  1F2K A;  1GSW A;  3VV4 A;  5FEF A;  3N8S A;  3NOP C;  2W3G A;  1K25 A;  4R0Q A;  4ZJ1 A;  4GD6 A;  3LIC A;  2QWS A;  1JTD A;  1H5X A;  2K2N A;  5M19 A;  2ZM0 A;  5HAR A;  3MXQ A;  2ZC3 B;  1UWN X;  4L9E A;  3WS5 A;  4EES A;  4Z9Q A;  4FTX A;  5KMW A;  5HZH A;  4E3M A;  2ZMF A;  1PWD A;  3JVU A;  4JXS A;  2PR5 A;  3W2Z A;  1OTE A;  4NK3 A;  5GHX A;  2WGI A;  2OAP 1;  3EEA A;  2VLG A;  3DWK A;  5AJG A;  4MBH A;  3SH7 A;  5AQA A;  4Y5F A;  4OQI A;  1OTI A;  5FQJ A;  3UDI A;  5HWW A;  3GEC A;  3KYE A;  1XX2 A;  2PBD P;  3M2J A;  3LY3 A;  4XXR A;  4Y2F A;  5L07 A;  4GCZ A;  1KVL A;  2JBF A;  5JYP A;  3NOU C;  1OPX A;  1GSV A;  4N9L A;  4MMN A;  5FEG A;  4BJP A;  3UE0 A;  5DJT A;  4BQM A;  2Y55 A;  4HBT A;  1PIO A;  5CX7 A;  3UB9 A;  2QPN A;  4KZB A;  5G4Z A;  4L9G A;  2DCF A;  1TS7 A;  4WMC A;  3OPR A;  3KSH A;  4UA9 A;  1MKI A;  5A93 A;  1KVM A;  4UQI S;  3G30 A;  4H6J B;  2JKR M;  1T19 A;  4GDB A;  1NWZ A;  3G32 A;  4JF6 A;  4HBU A;  4R6L A;  2PYR A;  4GZB A;  4P6B A;  1P0Z A;  3LEQ A;  3T4L A;  1IYO A;  3ZVW A;  2EXB A;  2W1T A;  2G2W A;  3VP3 A;  4NXE A;  1W63 Q;  1ERM A;  2L4R A;  4NXF A;  3ZYT A;  4I38 A;  4I39 A;  5EOO A;  1LL9 A;  4HP4 A;  2ZQC A;  3PYP A;  3NOT C;  2Y79 A;  5AQ9 A;  1GA9 A;  2WAD A;  4KZA A;  3C30 A;  3K3D A;  4LRZ E;  3QP4 A;  5E2H A;  4WF0 A;  2X71 A;  4ZAM A;  2OOL A;  2JE5 A;  4S2K A;  5J7E A;  2O99 A;  3UDX A;  1JWP A;  1W8Q A;  3BQ8 A;  1W8Y A;  4HHD A;  3CG5 A;  4OKP A;  2ZOI A;  2VV8 A;  1F9I A;  1YQS A;  1FCO A;  3BFG A;  2P9V B;  2VEA A;  3IBJ A;  4CJN A;  4GDN A;  5EOE A;  4DDY A;  3OLO A;  1X0O A;  4F94 A;  5L09 A;  3W4O A;  1FR1 A;  4HEF A;  2OLU A;  4IVI A;  4S2N C;  3TJZ C;  2P04 A;  3KSF A;  3A3D A;  5HFO A;  1OTB A;  1H8Z A;  3DAV A;  4KQD A;  5CGW A;  3FV7 A;  2R9X A;  1LL5 A;  4RX2 A;  3IXB A;  1GSX A;  1Q2Q A;  2E8J A;  3UN7 A;  3QHY A;  4PKY A;  4C3Q A;  3MZF A;  1ESU A;  4UA7 A;  4RX3 A;  1L0E A;  1NZO A;  4BL2 A;  3MQ0 A;  1XJ2 A;  1FOF A;  1FCN A;  2XSS A;  3ZG0 A;  4JF5 A;  3GRJ A;  5F6A A;  1G68 A;  3T4K A;  2Y59 A;  1G6O A;  5GLC A;  4IHQ A;  3KX0 X;  1ZHH B;  4LV2 A;  1E4D A;  4OOL A;  2QZ6 A;  2HP6 A;  3GQZ A;  1FR6 A;  3FC7 A;  2ZQ9 A;  3LIE A;  1XJ6 A;  4BL3 A;  5GHY A;  1YLP A;  4DJ2 A;  4FH4 A;  4EXO A;  2EX8 A;  5KIZ A;  3OOV A;  5A91 A;  4E3L A;  5EVE A;  1MWU A;  5DFX A;  3VMA A;  2J3T D;  4FUW A;  5CGX A;  4E3O A;  3CHW P;  5HX9 A;  5EEC A;  1N9N A;  3ZG9 B;  1BLS A;  4OLD A;  5F5Y A;  4BBT A;  2VGJ A;  3G2Z A;  1G5U A;  4LEN A;  3K2N A;  3CPT B;  3L7H A;  2PD7 A;  2RCX A;  2P7J A;  3JPU A;  5KZH A;  4QJG A;  4E3N A;  1K4E A;  5FI6 A;  5IHV A;  2XH9 A;  4UAA A;  3JVV A;  2XQZ A;  1MXO A;  1NRF A;  3LUQ A;  4RQ9 A;  2V8C A;  1MC0 A;  2Z6D A;  4HNB A;  1K55 C;  1KDS A;  1IEM A;  2WZX A;  4K08 A;  4S2P A;  1FSY A;  5E2F A;  5DF9 A;  3U2A A;  1GA0 A;  4P85 A;  4ZJ2 A;  1K54 C;  4GJ4 A;  1WYB A;  1LSX A;  4Q0J A;  1BLC A;  4H8R A;  3H9W A;  3T4S A;  3ZHH A;  3KYZ A;  4WUJ A;  3LIF A;  4Q0I A;  2WKI A;  4EWF A;  4G3W A;  2V0U A;  1YLT A;  2W27 A;  2HV1 A;  3SS3 A;  3SH9 A;  1PWC A;  4DXC A;  4YWZ A;  2A2L A;  3BLM A;  2WKP A;  4DE1 A;  4EEP A;  1S67 L;  2QJ7 A;  2QKP A;  1CI8 A;  2R9W A;  3V3R A;  4E04 A;  3T12 B;  1BTL A;  2XF3 A;  2FFF B;  4Y17 A;  2WGW B;  1JNU A;  1HTZ A;  1N4O A;  4EUV A;  1SKO B;  1WYC A;  1O07 A;  4GNU A;  3MZD A;  4OQH A;  4DF6 A;  3EEH A;  4L9F A;  3EGD C;  1NY0 A;  4DE2 A;  1TDG A;  4HJ4 A;  2IWD A;  3NUL A;  2NUP C;  2QMI A;  3UB8 A;  3O88 A;  3B47 A;  3NEC A;  2HP9 A;  2PBY A;  4YFM A;  1CF0 A;  3CPT A;  3B33 A;  4U3T A;  4FCF A;  1YSP A;  1AWI A;  2FH5 A;  3HVF A;  1GCE A;  2J9P A;  3N6I A;  4FD8 A;  4ETX A;  2GX5 A;  4NXB A;  3HLE A;  2JKF A;  3GV9 A;  4LRX C;  3A3I A;  5DF8 A;  2OAQ 1;  1CK3 A;  1T1A A;  2WZZ A;  2Y2Q A;  1YLJ A;  4K91 A;  1VB6 A;  1LSW A;  1P97 A;  1TDL A;  1C3B A;  1ONH A;  1ZTU A;  3G2Y A;  2HF6 A;  3QP1 A;  1FIL A;  4KZ8 A;  4MBF A;  5F69 A;  1L2S A;  3NI9 A;  3WWX A;  4MBK A;  2VK3 A;  4E3K A;  4XT2 B;  2ZD8 A;  3P09 A;  1H8M A;  1LSV A;  3ZG8 B;  4XUX A;  1K6R A;  3TSG A;  1DJC A;  3IH8 A;  3UB7 A;  3WRT A;  2JC7 A;  4I3I A;  2HDU A;  3RJU A;  5AQ7 A;  3GVB A;  4UEY A;  4UHU A;  3MFD A;  5EVI C;  2V1A A;  4LV3 A;  2H0Y A;  1V9Z A;  3N8R A;  5FQM A;  2W3E A;  3OPH A;  4FH2 A;  2K31 A;  3UO9 A;  3QNB A;  4MN5 A;  1PRQ A;  3PAG A;  1OTD A;  2WGW A;  4OOY A;  1XA1 A;  4ID4 A;  1CEG A;  3HJI A;  5TBM B;  2M7U A;  2I9V A;  1KGG A;  3DBA A;  2VGK A;  1SKO A;  4QD4 A;  2FZ0 A;  1YLW A;  2K7S A;  4WZ4 A;  2J7V A;  4K0W A;  2V0W A;  2Y2J A;  5E2G A;  4IUK A;  3E4O A;  3MSH A;  3IF6 C;  4K0X A;  2J80 A;  1ES4 A;  1Q2P A;  4X69 A;  2B02 A;  3LY4 A;  1DY6 A;  4R70 A;  1ES5 A;  2V2F F;  3HCY A;  4LLO B;  2A49 A;  3H82 B;  5HPI A;  4WBG A;  4G3V A;  4CLC A;  5E43 A;  3O3V A;  4KZ9 A;  3OBF A;  3O87 A;  2PDR A;  1IKI A;  5DJU A;  3HUN A;  3PTE A;  2UV0 E;  2MJ6 A;  1F98 A;  3UME A;  3AGE A;  3C4P A;  3G35 A;  1NZU A;  4HH2 A;  3CIT A;  1UGU A;  4X25 A;  4JKT A;  4N1X A;  1Z09 A;  4R38 A;  5KSC A;  1STZ A;  1XXM A;  4OP5 A;  3DWZ A;  5K5B A;  1KE3 A;  4PAU A;  2ACG A;  3HLG A;  4NEE D;  4XT2 A;  4BMW A;  1OT6 A;  1XGJ A;  1ONG A;  1ERQ A;  3OPP A;  1IOU A;  2XLN A;  1L0F A;  5HAP A;  4LFU A;  4RYE A;  4QPR A;  1I2W A;  4OQG A;  5C5K A;  2WKH A;  5EFW A;  1DP9 A;  3MQQ A;  3UE6 A;  3VSL A;  1XPB A;  2WGV A;  1K57 C;  4IED A;  5F68 A;  4JGP A;  3E2K A;  2LB5 A;  3CUE C;  4S2I A;  3MXR A;  2YKF A;  1ES3 A;  3PBT A;  1LL8 A;  5E2E A;  4B88 A;  2JCH A;  3PAE A;  3S7Q A;  3SS5 A;  3R7W B;  2E8I A;  4EU0 A;  2ZM8 A;  5TBM A;  3M2K A;  4QY6 A;  4OON A;  3RTY A;  1BLH A;  4WN5 A;  1L3L A;  5AVF A;  4NG2 A;  1PNE A;  4PM8 A;  4EET B;  3H82 A;  4WLA A;  5I5L A;  1K0K A;  3IQA A;  3HRE A;  2I72 A;  2W3H A;  3MKE A;  4PM6 A;  1E3U D;  2FFY A;  4II7 A;  5EM0 A;  4EW7 A;  3NDG A;  2P08 A;  1GHP A;  3ITA A;  1IYS A;  4N1H A;  3C7U A;  2W3D A;  3BEC A;  5HL6 A;  4OPZ A;  2VGL S;  4BBV A;  3OCL A;  4OP8 A;  3MS6 A;  2WAF A;  2OV5 A;  3VP0 A;  1MPL A;  2X02 A;  3V5M A;  4EEU A;  2EWV A;  2Y91 A;  4HES A;  4Q8I A;  1N9B A;  5FA7 A;  3LID A;  4PPR A;  3E98 A;  3ZNT A;  5I94 A;  3KO6 A;  1T1B A;  3BY8 A;  2BTF P;  1KGE A;  5U47 A;  3T4Q A;  1S6R A;  4OH0 A;  2XA7 M;  3VP1 A;  3IWI A;  2ZL1 B;  3QP2 A;  1V9Y A;  3WS2 A;  1K56 D;  1M6K A;  2ZJ9 A;  3FPW A;  3ZDJ A;  5G4Y A;  2WAE A;  4GKU A;  3VOL A;  3T1R A;  3D9Y A;  3V3S A;  3MJQ A;  3Q81 A;  1MWT A;  3F1N B;  1L0G A;  1FCM A;  2VZW A;  4KQR A;  3BFC A;  5EVL A;  2PYP A;  2H28 A;  3R7W A;  4RVA A;  3MBZ A;  4DE0 A;  3B3X A;  2ZBB A;  3EWK A;  5IU1 A;  1W5D A;  5FAT A;  4RA7 A;  2RL3 A;  5EVI D;  4G3K A;  1UWP X;  5HWV A;  4H6J A;  4EQI A;  1YLY A;  3NIA A;  4Y0O A;  1U60 A;  3ZVT A;  3A0R A;  5DKK A;  4Y3I A;  4R4S A;  4ESP A;  1PW8 A;  5DVA A;  4QB8 A;  4KQQ A;  1BT5 A;  4N9K A;  4JGO A;  5A8B A;  5DF7 A;  2JHE A;  5J8X A;  1I5Q A;  2GNX A;  1KE4 A;  3VFH A;  1PW1 A;  4C6Y A;  3BLS A;  4P6Z S;  2PD8 A;  3MXS A;  2PHY A;  4ZRR A;  5FQI A;  1FIK A;  4I5S A;  3MR0 A;  4HJ6 A;  3MQO A;  3MMH A;  2Q9M A;  1NXY A;  1NYY A;  2EXA A;  1N9L A;  2EFU A;  1K6S A;  1Z6F A;  2HDS A;  2Y2L A;  2W3F A;  1PYY A;  5GLB A;  2ZL1 A;  4S2M A;  2WYX A;  3S7O A;  2W0N A;  5HD5 A;  2P9V A;  3IS2 B;  1OJG A;  2PAV P;  2PU4 A;  3PHY A;  5CHJ A;  4QWO A;  4M4X A;  3RH8 B;  2X01 A;  3GTC A;  4X1M A;  3F1N A;  2VV6 A;  2XFT A;  3T4T A;  4JGR A;  1J3W A;  5FQK A;  2M7V A;  1PZP A;  2VGL M;  3BFE A;  3TRC A;  1EWZ A;  5HAI A;  5HPF A;  3B42 A;  1ACF A;  1MWR A;  3OPL A;  4O0P A;  2ZC7 A;  4FSF A;  3E4P A;  3OCN A;  1W79 A;  4YNR A;  5HDD A;  3MZE A;  3SS4 A;  2HDR A;  4YIN A;  3G4P A;  1EI5 A;  4GHI B;  2HJ9 C;  2GDN A;  3QNC A;  3D4F A;  1BYW A;  1ALQ A;  2EFX A;  5FI2 A;  4JXW A;  3LR0 A;  1S0W A;  3BFF A;  3EQV A;  1HD8 A;  3BFD A;  3IF6 B;  3LIA A;  3IWQ A;  4BD0 A;  3HJK A;  1RGY A;  2WUQ A;  2BLS A;  5A90 A;  3JYI A;  2V8F A;  1CI9 A;  4GW9 A;  5FI7 A;  4X1L A;  2BAS A;  3W4Q A;  2XK1 A;  2M1C A;  4IVK A;  5CER A;  4X68 A;  2L1M A;  1IYP A;  5DFY A;  3PXP A; 
#chains in the Genus database with same CATH homology
 1SCW A;  1ES4 A;  4GZB A;  4P6B A;  4E6X A;  4LCL A;  2Y2N A;  1Q2P A;  4X69 A;  1IYO A;  3ZVW A;  4OOM A;  2EXB A;  1XP4 A;  3BEB A;  2G2W A;  3VP3 A;  5HL1 A;  1ERM A;  3WS1 A;  3LY4 A;  1DY6 A;  3UPO A;  1ES5 A;  2V2F F;  2G2U A;  1TEM A;  2A49 A;  2ZC5 B;  1G6A A;  4LV0 A;  5EOO A;  4C75 A;  1IEL A;  1K56 A;  2ZQ7 A;  4OVD A;  1LL9 A;  3Q07 A;  4WBG A;  1LI0 A;  3S1Y A;  4DE3 A;  2ZQC A;  2Q9N A;  1ZG6 A;  3O3V A;  5E43 A;  5FQQ A;  4KZ9 A;  4O7D A;  4B4Z A;  5AQ9 A;  1GA9 A;  3O87 A;  1IKI A;  1M40 A;  3NCK A;  3HUN A;  2WAD A;  5CTN A;  4WEK A;  3PTE A;  5TFQ A;  4KZA A;  3HLD A;  4WZ5 A;  1KDW A;  5E2H A;  3M6B A;  3AGE A;  3IH9 A;  3C4P A;  5F83 A;  3G35 A;  3Q7V B;  2X71 A;  4JLF A;  4ZAM A;  4KG6 A;  5CEC A;  1K55 A;  2JE5 A;  4S2K A;  1NZU A;  5CED A;  4WEJ A;  2Y2P A;  3UDX A;  5GL9 A;  1JWP A;  5GLD A;  1W8Q A;  1GHI A;  1K54 A;  3ZGA B;  1W8Y A;  3DTM A;  5EPH A;  4EUZ A;  3CG5 A;  4OKP A;  4D2O A;  3NY4 A;  2H0T A;  1H8Y A;  3BM6 A;  4JKT A;  1ZC2 A;  4N1X A;  2H10 A;  4R23 A;  4WYY A;  5KSC A;  1XXM A;  4UA6 A;  1YQS A;  5CHM A;  4OP5 A;  1FCO A;  3DWZ A;  4ZBE A;  4ZDX A;  3BFG A;  1KE3 A;  2XR0 A;  1Y54 A;  2P9V B;  4S2L A;  3HLG A;  4N92 A;  4CJN A;  4GDN A;  4QHC A;  5EOE A;  4DDY A;  4B4X A;  1XGJ A;  1ONG A;  1PZO A;  4HBU A;  1ERQ A;  3OPP A;  2EX6 A;  1GHM A;  5EVI B;  2XLN A;  4F94 A;  4KG5 A;  5DTT A;  1L0F A;  3W4O A;  1FR1 A;  4HEF A;  5HAP A;  2OLU A;  4IVI A;  4S2N C;  5FAP A;  4BD1 A;  5JYO A;  4RYE A;  1I2W A;  4OQG A;  2XGN A;  2WKH A;  3GMW A;  5TGF A;  4KG2 A;  3A3J A;  3VOZ A;  1LI9 A;  3A3D A;  5HFO A;  5D3O A;  1H8Z A;  3RXX A;  1NJ4 A;  3NBL A;  3IHA A;  3VSL A;  4L0L A;  2PU2 A;  1XPB A;  2OSU A;  5EUA A;  1SDE A;  2WGV A;  1K57 C;  4IED A;  2XDM A;  1JTG A;  3IXH A;  3SH8 A;  5KSH A;  3E2K A;  1RP5 A;  2A3U A;  3FWL A;  3TOI A;  3UE3 A;  5CGW A;  3FV7 A;  4KZ4 A;  3MKF A;  3C7V A;  1E3U A;  2R9X A;  5M1A A;  3BYD A;  1ZG4 A;  3MXR A;  4S2I A;  3S4X A;  3ZG7 B;  1ES3 A;  1LL5 A;  3PBT A;  4RX2 A;  3IXB A;  3OC2 A;  1Q2Q A;  5E2E A;  4B88 A;  2ZLY A;  2JCH A;  1BUE A;  1SKF A;  3PAE A;  5CTM A;  2C6W B;  5HAQ A;  4P87 A;  3SS5 A;  3UN7 A;  3QHY A;  5FDH A;  4C3Q A;  1DJB A;  2E8I A;  3MZF A;  2ZM8 A;  3PBR A;  1LLB A;  1ERO A;  3M2K A;  2Y2I A;  1JVJ A;  4MNR A;  4QY6 A;  4X55 A;  4OON A;  2J9O A;  1BLH A;  3WS4 A;  1ESU A;  4UA7 A;  3NC8 A;  3VOY A;  4RX3 A;  3AGF A;  1L0E A;  1NZO A;  3SOI A;  4KZ6 A;  4BL2 A;  5GLA A;  3VP4 A;  2ZC4 B;  3ZCZ A;  1FOF A;  5F1G A;  1FCN A;  5FAO A;  4E6W A;  1E25 A;  4PMA A;  3W8K A;  3W4P A;  3ZG0 A;  5A92 A;  4IBR A;  4JF5 A;  3GRJ A;  3ITB A;  1VQQ A;  1G68 A;  2Y59 A;  1XKZ A;  4PM8 A;  3RXW A;  4KZ7 A;  5GLC A;  3C5A A;  3G31 A;  1W7F A;  2ZC6 B;  3IQA A;  1BSG A;  1ZKJ A;  4LV2 A;  1E4D A;  3HRE A;  2I72 A;  3MKE A;  4OOL A;  2QZ6 A;  4PM6 A;  1KGF A;  1E3U D;  2FFY A;  2HP6 A;  3GQZ A;  4X6T A;  3NDG A;  1YM1 A;  2V1Z A;  1FR6 A;  4GN2 A;  1PI5 A;  1GHP A;  3FKW A;  3ITA A;  1IYS A;  3IWO A;  3PBQ A;  1LHY A;  4N1H A;  3C7U A;  2ZQ9 A;  1HVB A;  4BL3 A;  5GHY A;  3BEC A;  4DKI A;  1JWV A;  1YLP A;  3Q7V A;  4FH4 A;  2EX8 A;  4OPZ A;  4DDS A;  2DNS A;  2BG1 A;  5CEB A;  3HUM A;  4QY5 A;  5EE8 A;  1L0D A;  2XFS A;  4ZJ3 A;  3OCL A;  4OP8 A;  4OLG A;  2WAF A;  4LCM A;  4WMC D;  3N7W A;  2OV5 A;  2CC1 A;  5A91 A;  3VP0 A;  1MPL A;  2X02 A;  1XA7 A;  4E3I A;  3V5M A;  1PI4 A;  4E3L A;  1MWU A;  3VMA A;  2Y91 A;  4HES A;  4Q8I A;  5FAS A;  1N9B A;  5FA7 A;  5CGX A;  4E3O A;  4PPR A;  3ZNT A;  1HZO A;  5I94 A;  4EV4 A;  2Y4A A;  5F1F A;  5HX9 A;  5EEC A;  3ZG9 B;  3CJM A;  1MWS A;  4JPM A;  3P98 A;  1BLS A;  3LEZ A;  2J8Y A;  3G34 A;  1K4F A;  4OLD A;  1KGE A;  4Y7P A;  3VSK A;  2HDQ A;  3AGD A;  1ESI A;  3HLF A;  1S6R A;  2HPB A;  4OH0 A;  2VGJ A;  5U47 A;  3G2Z A;  3IHB A;  3VP1 A;  3IWI A;  4KEN B;  4JBF A;  4LEN A;  4DXB A;  4MEZ A;  1K38 A;  1XGI A;  2UWX A;  3WS2 A;  5EVI A;  4JXV A;  1K56 D;  2ZM2 A;  2XEP A;  2C5W B;  2B5R A;  1M6K A;  4EBN A;  1BZA A;  2OLV A;  2ZJ9 A;  4P0M A;  2RCX A;  2Y2H A;  2EX2 A;  1FQG A;  2WKE A;  3HUO A;  3Q1F A;  4DRT A;  5KZH A;  3ZDJ A;  5M18 A;  4R3B A;  4U0T A;  3FYZ A;  4QJG A;  1NYM A;  4E3N A;  2WAE A;  4GKU A;  4PM9 A;  1K4E A;  2IWC A;  3A3F A;  5FI6 A;  1JWZ A;  3V3S A;  5IHV A;  3Q81 A;  1MWT A;  2XH9 A;  4NET A;  4UAA A;  4WEL A;  2XQZ A;  3IF5 A;  1MXO A;  1I2S A;  1NRF A;  4S2J A;  1L0G A;  1FCM A;  4WZ5 C;  4KQR A;  3IF6 A;  3BFC A;  5EVL A;  4S2O A;  1OME A;  2Y2M A;  1K55 C;  3V39 A;  1KDS A;  4RVA A;  3MBZ A;  1IEM A;  4ZTK A;  4DE0 A;  4EBL A;  2WZX A;  3UNW A;  4S2P A;  1FSY A;  3B3X A;  5E2F A;  3WRZ A;  5DF9 A;  3HBR A;  1GA0 A;  4P85 A;  1IYQ A;  1SHV A;  4ZJ2 A;  1K54 C;  3UE1 A;  3M6H A;  1WYB A;  2V20 A;  1W5D A;  5FAT A;  3ZNY A;  4X56 A;  1BLC A;  4RA7 A;  2RL3 A;  3UPN A;  5EVI D;  4H8R A;  3IXG A;  3A3E A;  3ZHH A;  4KZ5 A;  4M3K A;  5CGS A;  4EQI A;  1YLY A;  2WKI A;  3PBS A;  3NIA A;  1YLZ A;  1U60 A;  4Y0O A;  4EWF A;  4OPQ A;  3Q7Z A;  3ZVT A;  1YLT A;  3SS3 A;  3SH9 A;  3UPP A;  1MY8 A;  3HL9 A;  1PWC A;  1J9M A;  4R4S A;  4DXC A;  4R1G A;  1PW8 A;  2H5S A;  3WS0 A;  1YMS A;  3BLM A;  5CHU A;  3HLC A;  1PWG A;  5DVA A;  4DE1 A;  5HW3 A;  4QB8 A;  4KQQ A;  4Y0U A;  1BT5 A;  4N9K A;  3ZFZ A;  3BRM A;  5F82 A;  3S22 A;  1DJA A;  5DF7 A;  1CI8 A;  2R9W A;  5J8X A;  1I5Q A;  3V3R A;  5AQB A;  4OPY A;  3HLB A;  3C4O A;  1BTL A;  4WM9 A;  2XF3 A;  1O7E A;  2FFF B;  3EQU A;  1KE4 A;  1QME A;  2WGW B;  5CRF A;  3VFH A;  1PW1 A;  4C6Y A;  4PM7 A;  3BLS A;  5TR7 A;  3MXS A;  5BOH A;  1HTZ A;  1YMX A;  4XUZ A;  3E2L A;  3VP2 A;  1N4O A;  4MLL A;  2Z2L B;  5FQI A;  1AXB A;  3GR2 A;  4A5R A;  4OPR A;  1WYC A;  1O07 A;  4GNU A;  3MZD A;  4GB7 A;  3NDE A;  4OQH A;  1BUL A;  2XD1 A;  2Q9M A;  4DF6 A;  1ES2 A;  2EX9 A;  2HP5 A;  4GOG A;  1FSW A;  1NXY A;  2EXA A;  1NYY A;  1NY0 A;  4DE2 A;  2EFU A;  1CEF A;  5FAQ A;  4S2N A;  2Y2K A;  1K6S A;  1TDG A;  3PBN A;  3ISG A;  2IWD A;  1Z6F A;  4OQ0 A;  2HDS A;  2Y2L A;  2ZQA A;  1PYY A;  4KZ3 A;  5GLB A;  3V50 A;  1VM1 A;  2QMI A;  3UY6 A;  4S2M A;  2WYX A;  4BLM A;  3Q82 A;  4PM5 A;  3O88 A;  2HP9 A;  2PBY A;  3LCE A;  3LO7 A;  2P9V A;  2IWB A;  4U0X A;  3IXD A;  4YFM A;  1K57 A;  4CPK A;  2PU4 A;  4GD8 A;  4U3T A;  4FCF A;  2ZQD A;  5CHJ A;  3HVF A;  4X53 A;  3N8S A;  1GCE A;  2J9P A;  1K25 A;  5GHZ A;  3N6I A;  4FD8 A;  4R0Q A;  4GD6 A;  5CXW A;  4ZJ1 A;  3FZC A;  2X01 A;  3HLE A;  3GV9 A;  4JF4 A;  3A3I A;  3N8L A;  5DF8 A;  1JTD A;  3I7J A;  3GTC A;  1CK3 A;  3IT9 A;  2WZZ A;  3O86 A;  1H5X A;  5M19 A;  2Y2Q A;  1SDN A;  1YLJ A;  2ZM0 A;  5HAR A;  4K91 A;  4Y0T A;  2XFT A;  3CZD A;  3ZG5 A;  2ZC3 B;  3WS5 A;  1TDL A;  3HLW A;  5FQK A;  1PZP A;  2XD5 A;  2DRW A;  3BFE A;  4Z9Q A;  5KMW A;  1EWZ A;  1C3B A;  4E3M A;  1ONH A;  2P74 A;  3G2Y A;  5G18 A;  1MBL A;  1PWD A;  2Z2M B;  4JXS A;  5DTK A;  4R4R A;  5HAI A;  2ZMA A;  3UDF A;  3TG9 A;  4NK3 A;  5GHX A;  4KZ8 A;  2WGI A;  2Y2G A;  1MWR A;  3OPL A;  4MBF A;  1L2S A;  2ZC7 A;  3NI9 A;  3WWX A;  3DWK A;  4MBK A;  1IKG A;  4FSF A;  4BEN A;  4MBH A;  3SH7 A;  5AQA A;  3OCN A;  1W79 A;  1BLP A;  4E3K A;  2WK0 A;  3MZE A;  3OZH A;  4OQI A;  3SS4 A;  2HDR A;  5FQJ A;  3UDI A;  4YIN A;  1RGZ A;  2ZD8 A;  3G4P A;  3P09 A;  1EI5 A;  3ZG8 B;  4XUX A;  1K6R A;  1XX2 A;  1DJC A;  3M2J A;  3TSG A;  3IH8 A;  3LY3 A;  4XXR A;  2GDN A;  3QNC A;  3WRT A;  3D4F A;  2ZQ8 A;  1KVL A;  3GSG A;  1ALQ A;  2JC7 A;  5DTS A;  2JBF A;  2EFX A;  2HDU A;  5FI2 A;  4QU3 A;  5JYP A;  3RJU A;  4JXW A;  5AQ7 A;  5L2F A;  3GVB A;  1S0W A;  4EBP A;  3BFF A;  4N9L A;  1KE0 A;  3EQV A;  3MFD A;  4UHU A;  4BJP A;  3UE0 A;  5EVI C;  4BQM A;  2Y55 A;  4HBT A;  4LV1 A;  1HD8 A;  4LV3 A;  2H0Y A;  3BFD A;  3IF6 B;  3N8R A;  4KQO A;  4JXG A;  5FQM A;  1PIO A;  3OPH A;  2Y2O A;  3N4I A;  3IWQ A;  4FH2 A;  1TVF A;  4BD0 A;  3FKV A;  1QMF A;  3CMZ A;  1RGY A;  2WUQ A;  5FQ9 A;  2BLS A;  3QNB A;  3UO9 A;  2QPN A;  4E3J A;  4KZB A;  4R3J A;  5A90 A;  1WE4 A;  3JYI A;  3PAG A;  2WGW A;  4OOY A;  1XA1 A;  2DCF A;  1CI9 A;  4ID4 A;  4WMC A;  3OPR A;  1CEG A;  4UA9 A;  3PBO A;  5FI7 A;  1MKI A;  3VFF A;  1KVM A;  5A93 A;  3W4Q A;  1KGG A;  2XK1 A;  2VGK A;  4QD4 A;  3G30 A;  4IBX A;  1YT4 A;  1YLW A;  4WZ4 A;  2J7V A;  3DW0 A;  1RCJ A;  4K0W A;  4IVK A;  2Y2J A;  5CER A;  4GDB A;  5E2G A;  4X68 A;  3G32 A;  4JF6 A;  5FSR A;  3IF6 C;  1IYP A;  4K0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...