3E0YA

The crystal structure of a conserved domain from a protein of geobacter sulfurreducens pca
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
164
structure length
155
Chain Sequence
HLEIISLEEISMLVSSDFDLPEVLQHVTAKVATQLKVSVCNIYLREGDEVVLAATHGFDPAFIGKIRIKIGDGITGSVARDGQYISLSRASQDPRYKYNSMLSFPIGDKKEVYGVINLNTTSIRSFHEDEIYFVSIIANLILTAIKLRQQVASSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Conserved domain protein
publication title The crystal structure of a conserved domain from a protein of Geobacter sulfurreducens PCA
rcsb
source organism Geobacter sulfurreducens
total genus 40
structure length 155
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3e0yA00
4ETZA 4ETXA 1MC0A 1YSQA 3K2NA 2W3HA 2W1TB 2O9BA 3NOPC 2LB9A 4ME4A 4LRXC 4DMZA 4BWIA 2G7UA 4O0PA 3NHQA 2M7UA 3VV4A 5I5LA 4YNRA 2VJWA 1YSPA 4GW9A 4IJGA 4MMNA 4RQ9A 3E98A 4EUVA 3NOUC 4PAUA 2W1TA 3TRCA 2LB5A 3BJNA 4MDZA 3G6OA 4G3WA 2K2NA 2QYBA 3KSFA 3OBFA 1TD5A 4QPRA 4O01A 2W3EA 5LBRA 4Z1WA 3KSIA 3KSGA 3ZQ5A 2M7VA 4IUKA 3W2ZA 4FOFA 3CI6A 1F5MA 3S7QA 3S7OA 2VKSA 2ZMFA 4EU0A 2O9CA 4Y2FA 4Q0IA 3S7NA 2IA2A 2XRNA 3IBJA 3MQ0A 2KLIA 4CQHA 2Y79A 5AJGA 2HGVA 3O5YA 2VEAA 4G3KA 3KSHA 2K31A 2XROA 3D3OA 5DFXA 4Y3IA 5HPFA 5L8MA 3S7PA 2XSSA 3NOTC 3E0YA 2O99A 2Y8HA 2OOLA 4LRZE 3MF0A 4Q0HA 3EEAA 4YOFA 3IBRA 5K5BA 1YKDA 5C5KA 2O0YA 4E04A 4LRYC 2O9AA 3DBAA 3KO6A 1VHMA 3C2WA 4IUHA 2VZWA 3LFVA 4Y5FA 5DFYA 3RFBA 2W3DA 2W3FA 5TJJA 4MCWA 5HSQA 4GLQA 4R6LA 2KOIA 3MMHA 4G3VA 2W3GA 5HL6A 2B18A 3R4KA 5HPIA 3CITA 4Q0JA 3HCYA 1TF1A 1ZTUA 4ZRRA 4DN0A 3OOVA 4O8GA 1MKMA 4MN7A 2GX5A 1STZA 4R70A 2W1RA
chains in the Genus database with same CATH superfamily
3LR3A 1QMFA 1MY8A 1BZAA 3E4OA 3B47A 5TBMB 1CEGA 4L9FA 5CECA 3RH8B 1OT9A 2VX8A 4L9EA 4X1LA 3WRZA 1ES2A 4EQ1A 1GSWA 4NK3A 3BFCA 4BBTA 1S67L 3WS1A 2RL3A 3C5AA 4EXOA 4NEED 1BSGA 3EQVA 4PKYG 2JKGA 2V9AA 3ZDJA 4BBUA 4Y7PA 1E25A 2WGWA 5G4YA 4QHCA 1GHMA 5AVFA 3FKWA 3KSGA 3HUOA 3CI6A 5AVEA 2VGKA 3B3XA 4ARZA 4S2KA 2HPBA 2Y2NA 5FQ9A 1LL8A 2VLGA 3HJKA 4ID4A 4S2NC 1S66L 1FILA 4KG2A 4I3IA 3ZNYA 5IU1A 3N7WA 3TOIA 4OPYA 2PBDP 4UAAA 2OOLA 4GS9A 4LFUA 2PHYA 1K38A 5J8XA 3UE0A 3PBQA 1MWSA 4MN5A 5E2GA 2H0TA 2JN7A 3ITBA 3LFVA 5F1FA 2J9OA 5CXWA 1J3WA 4R6LA 4WYYA 3IX8A 2EWWA 3MXSA 4CLCA 5FI6A 2Q0OA 3BFFA 3SS5A 1RGYA 4R0QA 1KE4A 2QZ6A 5CERA 4K0XA 2ZC7A 4DF6A 2JKFA 4NXFA 4ZJ3A 1Q2PA 3IH8A 3CWFA 1FIKA 1XFNA 3QHYA 3S4XA 4KQRA 2ZQ9A 4ME4A 3GVBA 3F1PB 1IEMA 3IS2A 1NLYA 3UDIA 4KZ5A 4N9LA 4X53A 3RXWA 3F1OA 4UA7A 5FAQA 3DAVA 2E8JA 1Z6FA 2HZ5A 5HW3A 2JKRM 3CHWP 3EQUA 1RGZA 4E3OA 1FR6A 3ZG9B 3G2YA 3RXXA 1KDSA 2HP5A 4JKTA 4EU0A 1YLWA 3IWOA 5TGFA 4GHIA 4KZ8A 4HBUA 4NXBA 4GB7A 2P04A 1PI4A 3BY8A 3VMAA 3KSHA 2EWVA 3G32A 4OOLA 4U0XA 2XLNA 2BLSA 2OLUA 3MF0A 3PAGA 5FQQA 4UA6A 1GCEA 4R4SA 3K3CA 2O9AA 1E3UD 3A3DA 1C3BA 4DKIA 2W3FA 4FH4A 2H10A 3FC7A 2KOIA 1EWZA 2ZQ8A 1HVBA 3UY6A 1GHIA 2B18A 4HEFA 3UE3A 5MC7A 2I72A 5DTSA 1LLBA 1ONHA 1LSVA 3RJUA 4O8GA 4JLFA 1D1JA 1ES3A 4F3LB 4BJPA 1H5XA 5A93A 4L0LA 1Z09A 2W27A 4WZ5A 1WE4A 2O9BA 4LRXC 4JGQA 5L07A 3H7WA 3Q81A 3CUEA 4WLAA 3VV4A 3ZYTA 2FZ0A 4JF6A 5EVIC 3TE8A 5D3OA 4EUVA 4UA9A 1WA9A 2HP6A 1PWDA 4D60A 1V9YA 1YLYA 3G6OA 3LICA 5J4EA 4B4XA 1OTIA 3BECA 3HLGA 3CPTA 3KSIA 1EROA 3G2ZA 1I5QA 4XXRA 3S7OA 2Y79A 1EW0A 5HDCA 2FFFB 4P6BA 4FUWA 3A3FA 4MBFA 4JF5A 3PAEA 4GD6A 3WS4A 5DF7A 4GCZA 4ZJ1A 2Q9MA 2EFUA 1LL5A 2Y2PA 4I3AA 1YKDA 5C5KA 1K56D 3SOIA 2HJ9C 1X0OA 5F83A 1TS0A 3MMHA 3LGOA 1N9BA 2WGIA 5DF9A 3T4TA 1JWPA 3C4PA 1ZTUA 1FCNA 1XA7A 4ZRRA 4NG2A 1JWVA 2WGVA 3QP5A 1ONGA 3GTCA 1MWTA 3NJAA 3S1YA 4ZBEA 4LV3A 4YWZA 2W3HA 4KZBA 3BEBA 4BWIA 1XFQA 5EVIB 2G7UA 1XJ6A 1KDWA 1K54A 3SH8A 4UEYA 3OCNA 4RQ9A 3ICYA 5FA7A 2Y2MA 1LSWA 3JPUA 2QPNA 2LB5A 1NZUA 2EX9A 1S6RA 2DMWA 3UE1A 4OPZA 2ZOIA 3QNCA 3FV7A 3L9KA 2ZC5B 2ZL1A 3F1NA 1ZKJA 3PBNA 1SKOB 2ZMFA 4LGWA 5AJGA 1S4RA 4DE2A 3KYEA 1CQAA 2WAFA 2ZOHA 5FQMA 2B5RA 3W8KA 1BULA 5HPFA 3M2JA 2C5WB 4PM7A 3NOTC 1L3LA 3VOLA 1S4SA 4FSFA 4NETA 3V5MA 3ZGAB 3BLMA 4IUHA 1NRFA 5KSCA 2NUPC 1FQGA 4DE1A 3BFDA 3C7VA 2OSUA 2XQZA 1VEUA 5TR7A 3C30A 1MWRA 1IFQA 3CPTB 1XKZA 1YM1A 3VP3A 2XH9A 2WK0A 3MQQA 2YKFA 4F94A 2GX5A 3P09A 4OPQA 4PMAA 2EX8A 4KG6A 2X01A 4FD8A 1ES5A 3FPVA 3LIDA 3IXDA 1ESIA 4ZAMA 4AFIA 1G28A 4HJ6A 4O0PA 2M7UA 3LY3A 2V1BA 2V20A 2Y2HA 5EOOA 4DDYA 1BTLA 2UV0E 2PRFA 3BJNA 4WELA 3PBSA 5KZHA 1IKGA 2WZXA 3Q7ZA 1KVLA 3VFHA 2WKEA 5LBRA 1LT0A 1LHYA 3MBZA 5CGWA 4Y0UA 2L1MA 3HL9A 1L0GA 4QD4A 2RCXA 1H8MA 1XGIA 3MS6A 3IHBA 1HTZA 1S1YA 2Y2OA 3T1XA 3MSHA 3LUQA 3FYZA 1N4OA 2IA2A 3MQ0A 2PYPA 3T1SA 2JCHA 2IWBA 2E8IA 3O87A 1IYSA 2HGVA 1PNEA 4DXBA 4KZ9A 3IH9A 1I2WA 4Y15A 3CLOA 1SKFA 4LENA 1OTBA 3IT9A 3E0YA 5DF8A 4I5SA 3N4IA 1H0MA 1TEMA 4OOMA 1L0FA 5K5BA 3QNBA 5FL3A 4LCLA 4ZDXA 2CC1A 3HVFA 3E4QA 3W4PA 4LV1A 3ZFZA 1JVJA 2IWCA 1G6AA 2GJ3A 4R38A 3PBOA 5A8BA 4DN0A 3QP4A 1YLPA 1YLTA 1A0KA 4OQGA 1TS7A 3VSLA 3GRJA 3UPNA 2PR6A 2HDUA 1DP8A 1G6OA 1VETA 2A2LA 3GV9A 5KIZA 3SH9A 1ALQA 3LI8A 2GDNA 1QMEA 3Q7VA 4PAUA 1H8ZA 3MXQA 4OPRA 3DW0A 4DDSA 3ULFA 3NC8A 3VSKA 2VK3A 5EM1A 4I3JA 4X55A 4A5RA 2EFXA 1VEUB 1Y4OA 2WKIA 2XFSA 2P7JA 3BYDA 3AGFA 2OAQ1 1H3QA 4WN5A 1L2SA 1TS8A 3E4PA 3LY4A 3EEAA 4YOFA 1NLZA 4E04A 4R3BA 1F9IA 4LRYC 2PYRA 4OP8A 2VZWA 5F68A 2OWJA 4HP9A 3KYZA 4JXGA 1CJFA 4GN2A 4B4ZA 3QP8A 3DWZA 4Q0JA 1TF1A 3VP4A 1E3UA 5A90A 3B33A 2ZC4B 2INWA 3R7WA 4ETZA 5CTNA 1IELA 1KE0A 3K2NA 5KMWA 1KGFA 2W1TB 3VE3A 4OQ0A 2LB9A 3MR0A 4EQIA 4YFMA 1L0EA 3N6IA 3NHQA 2QMIA 3FPWA 3EWKA 4S2MA 4XT2B 5HAIA 2PD8A 1W63Q 5FAOA 2Y2LA 5DTKA 3VP0A 4OOYA 2Y4AA 4Z1WA 5AQ9A 3ZQ5A 3U2AA 3IF6A 5FATA 4GD8A 1P97A 4X6TA 3DTMA 4PM9A 3GQZA 4KZ4A 4LPZA 3LR5A 1VB6A 3VP1A 3V3SA 1BT5A 4HHDA 3O5YA 1SHVA 5CEDA 4D2OA 3D3OA 4BL3A 3UPPA 1OJ5A 1XPBA 1ODVA 2A24B 2JKTI 1DJCA 4Y0TA 2HP9A 1G68A 3ZG0A 4OP5A 4CLCC 1V9ZA 4MN6A 3C38A 3GDIA 1HZOA 3DTKA 4DJ3A 5HPIA 2WAEA 3MZDA 2QKPA 3PXPA 2BASA 1F2KA 1K56A 1PRQA 2GNXA 4HESA 3ZHHA 3BRMA 3L7HA 4R70A 4ZTKA 3RTYA 5CGXA 3H82A 4B88A 4BQMA 5CHUA 2D01A 2Q9NA 4IVKA 3G30A 3Q07A 1W63M 1GA0A 2PR5A 1L0DA 4DMZA 3W4OA 3LI9A 2WGWB 1T18A 3UB6A 3ZCZA 2CMNA 4S2JA 4CPKA 5CTMA 4GW9A 4ARZB 2J3WA 1IYPA 5EE8A 3N8SA 1KGEA 2ZC6B 3MFDA 3QP1A 4WMCD 4WUJA 2QYBA 1TD5A 2G2WA 4CLCE 4HI4A 2PU4A 3OC2A 2XR0A 2NUTC 5J7EA 1SDEA 3W2ZA 4E3NA 3SW1A 4QJGA 1J9MA 3IBJA 1NY0A 1NYMA 4GS9B 4S2IA 4B9OA 3G34A 1GHPA 4S2LA 1K6SA 2PD7A 3GECA 3LIFA 4Y0OA 5L09A 4Y3IA 4YINA 4WF0A 4BMWA 2J3TC 2QHKA 5GLCA 3C4OA 3TJZC 3W4QA 5GHZA 5F69A 4N1HA 2Y2QA 4CLCB 4OVDA 1ZHHB 3BQ8A 2VGJA 4Y13A 5FI7A 2O0YA 4OQHA 2VV8A 5AQAA 1GSXA 2QJ5A 4GDNA 4KUKA 2W3DA 3NECA 4MCWA 1K57A 5FASA 2W3GA 1WYCA 3V39A 4X68A 1NXYA 1CI8A 3PR6A 1FR1A 3UO9A 3DTIA 2VGLM 3MZFA 3IS2B 3MKFA 3PBRA 4WZ5C 2WKPA 5FQIA 1PZOA 4P6ZM 5HD5A 5GLBA 3UB5P 1O07A 4FCFA 5HZHA 3G31A 3CUEC 4R3AA 3F1OB 1JNUA 2R9XA 4HQAA 1YAXA 4LCMA 1XX2A 5EVID 5HDDA 3HBRA 4PM6A 3T12B 2VJWA 4IJGA 1TDGA 3T1QB 3O3VA 1GSVA 2ACGA 3LIEA 4MDZA 1N9OA 3D9YA 5IS1A 4GHIB 1PIOA 4QPRA 4C75A 3A0SA 3BFGA 4EEUA 2QJ7A 4Y2FA 1SDNA 3AGDA 5HFOA 1OTAA 5FAPA 5CX7A 4H6JA 5HAQA 3N8LA 1FOFA 2PDRA 1OT6A 4R1GA 1W8YA 5IT5A 5L8MA 2R78A 5HDSA 4EEPA 1DP9A 4U3TA 1JTGA 4KQQA 1K4EA 1LSXA 4E3IA 3T4SA 3OPRA 4L9GA 5E43A 1XJ3A 5HL6A 2VGLS 2XD1A 4GOGA 3HCYA 3M6BA 3AGEA 2XGNA 3GMWA 4P6ZS 1ERMA 3H7WB 2VA0A 3DTEA 5FI2A 3UDFA 3Q82A 4QY6A 1K54C 4KZ6A 2P9VA 1D7EA 4MEZA 2B95A 1BYWA 4GJ4A 2Z2LB 1IYOA 4PKYA 2EX6A 2V8CA 3A3IA 5TFQA 3E98A 2DNSA 5TBMA 1E4DA 5DKLA 2V8FA 3A3JA 1PI5A 2L0WA 1PW8A 5HWWA 5F5YA 2Y2IA 1PFLA 3H9WA 3HLBA 3O86A 4EWFA 5L10A 3IWIA 2ZC3B 4IUKA 1F5MA 3SZTA 2Y2GA 3FWLA 2Z2MB 3IQAA 2V2FF 3UNWA 3KYQA 1MZUA 2ZMVA 4BLMA 3TG9A 1M6KA 1JTDA 1YPRA 4CJNA 1ZG6A 4EUZA 3OCLA 2BTFP 4WEJA 5FDHA 2QWSA 1ZG4A 1T1BA 3HLWA 2J80A 4JF4A 4E3KA 3DBAA 3C2WA 4HJ4A 4X69A 5AQ7A 3B42A 4EV4A 4P87A 1TDLA 3FG8A 1TVFA 4U0TA 4JPMA 3T1RA 5HAPA 4NXEA 2KDKA 1W79A 5HWVA 3IX3A 3UE6A 1P9RA 4OQIA 3MXRA 2Z6CA 1RCJA 4KZ7A 1KVMA 5GLAA 3NY4A 4IHQA 2PT7A 4EETB 2EX2A 3LIAA 3OPPA 5EV0A 3BY9A 4MBHA 4KQDA 3ZVWA 5EFWA 1OTEA 3NOPC 2EXBA 2JBFA 3A0RA 3T4QA 5I5LA 2V0UA 1YSPA 2BG1A 1PWCA 2PAVP 3HLFA 1ERQA 5DJUA 2ZL1B 3F1NB 3TRCA 3IF5A 2B02A 4K08A 4JGOA 3JVUA 3F1PA 1T1CA 1UWPX 3KSFA 4HH2A 1VM1A 4N9KA 3WS5A 4FOFA 2ZBBA 4PHTA 2ZJ9A 1LI0A 3S22A 1IKIA 2FH5A 5FEFA 2XRNA 3SH7A 2ZQCA 1D06A 4S2NA 3LYXA 3NULA 4M3KA 4MNRA 1DJBA 1H8YA 4R3JA 1XJ2A 3QP2A 4I38A 2Y91A 4WM9A 3C7UA 3IBRA 3ZG8B 3HJIA 3PTEA 3BWLA 2EA9A 3UN7A 4E3LA 2JC7A 3N8RA 4KZ3A 4C3QA 3BLSA 3CJMA 4BD1A 2G2UA 4E3MA 3ZNTA 3LEQA 4MN7A 4HH3A 4R4RA 4DRTA 1STZA 3CAXA 2W1RA 5IHVA 4GKUA 2M1CA 4JBFA 5FQKA 4QWOA 4BBVA 5HWTA 5E2HA 1LI9A 4F3LA 5DKKA 4KENB 3KX0X 3OLOA 4WEKA 1M40A 3NOUC 5GHYA 4PM5A 1DP6A 3CMZA 3BW6A 1NRJA 4DXCA 1OMEA 1S1ZA 3BFEA 4Y17A 2ZLYA 3ZVTA 2WZZA 1PZPA 2WKQA 2XK1A 5DJTA 3T50A 4EW7A 4WMCA 1OJGA 5CHJA 3I7JA 5EM0A 5G4ZA 4K91A 5BOHA 1K4FA 4I39A 1MWUA 2XROA 2ZQDA 3LEZA 1LL9A 1CF0A 4Q8IA 4PPRA 3P98A 4RA7A 1YLJA 3C8CA 3VOZA 2HV1A 1ACFA 1CK3A 3T4OA 4EBPA 2JHEA 4JXSA 4ZJ2A 2JKRI 5DFYA 3V3RA 5F82A 1RP5A 3LCEA 2Y55A 4FTXA 2XEPA 2V1AA 4N1XA 3MKEA 4HBTA 4RVAA 3CITA 4BL2A 1I2SA 4JXWA 1VETB 1AXBA 3TW8A 5JYPA 4NXGA 2OLVA 3G35A 3WS2A 4JXVA 3BM6A 2UWXA 1XJ4A 3NIAA 1YMSA 1BUEA 1MC0A 3NDGA 1YSQA 3HLDA 5M19A 3Q7VB 2HJEA 1OTDA 2XF3A 2L4RA 1U60A 4ESPA 3HUNA 4P85A 4X56A 2DCFA 2ZMAA 1FCMA 4MMNA 2JKTM 1Q2QA 5EPHA 1PW1A 3IHAA 3ITAA 1MXOA 2HDSA 5EVIA 3IF6C 4G3WA 1IOUA 2HF6A 3WRTA 4QU3A 5M18A 5HX9A 4BD0A 3HREA 3LR0A 3UMEA 4EESA 2OWHA 2D02A 2KLIA 4MLLA 2Y2JA 4HJ3A 2R9WA 3A3EA 1YT4A 3K3DA 3NI9A 2K31A 4WL9A 1NZOA 2WKHA 2A49A 1SKOA 2WKRA 3VOYA 4JGPA 4DJ2A 5GL9A 4CLCD 4MBKA 1BLHA 5TJJA 1FCOA 2ZM0A 1DY6A 4IVIA 2GZAA 4G3VA 3R7WB 1NJ4A 4S2PA 2VV6A 3FZCA 1TS6A 5HL1A 3T4LA 3M6HA 5CEBA 5F6AA 3OOVA 4E6WA 1CEFA 2ZM8A 3LO7A 2ZQ7A 3VFFA 3IWQA 5CGSA 4EBLA 3JVVA 2HDQA 5U47A 4EERA 1XGJA 2EXAA 1O7EA 1YLZA 2IWDA 3IF6B 3ZG5A 1ESUA 4OONA 5CRFA 2H0YA 2PBYA 3A0VA 1PWGA 3OBFA 4IBXA 3OZHA 4O01A 2W3EA 1K6RA 5CHMA 5EUAA 2XA7M 5GHXA 3Q1FA 4RX3A 5A92A 1BLSA 2O9CA 5DVAA 3T4JA 3T4KA 1T1AA 4EBNA 5G18A 1SZVA 5FEGA 4WBGA 2J3TD 5EECA 2VEAA 4KZAA 5DFXA 3P7NA 3S7PA 3NBLA 4E6XA 2Y8HA 3OPLA 1K55A 3WS0A 1K57C 3GR2A 5E2EA 5EOEA 2X02A 2AVXA 4RYEA 3KO6A 5F1GA 2XD5A 4KUOA 3RFBA 5HSQA 3H82B 2V1ZA 4GLQA 1N9NA 3NDEA 4DE3A 3R4KA 3UMDA 2J8YA 3D4FA 1BLCA 5E2FA 3EGXC 1MKMA 4OLDA 1S0WA 1XP4A 3PBTA 2J7VA 3O88A 2ZM2A 2ZQAA 4JGRA 3M2KA 4QB8A 4ETXA 5A91A 1NYYA 1JWZA 2MJ6A 4Z9QA 5GLDA 4OLGA 4RX2A 1BLPA 4BENA 1IYQA 4GZBA 3V50A 3UB9A 2K7SA 3V67A 3MZEA 3OPHA 1HD8A 4HY8A 4YNRA 3VE4A 5J3WA 2A3UA 3TSGA 4UQIM 3IX4A 2OV5A 1DRMA 1Y28A 3GSGA 2WUQA 1F98A 2JE5A 4FH2A 1K55C 2XA7S 2K2NA 3E2LA 1UGUA 3UB7A 4H8RA 1W5DA 2H28A 2Y2KA 1NWZA 2J9PA 2VV7A 3S7QA 4X1MA 2C6WB 2VKSA 4OKPA 1XA1A 3U4LP 3EGDC 4CQHA 2P74A 3BQAA 3SS3A 2ZD8A 2X71A 5EVLA 1N9LA 1W7FA 4PM8A 3IXGA 3LR4A 3HLEA 3HUMA 5FDSA 2XSSA 1AWIA 2Z6DA 3UDXA 4Q0HA 4LLOB 1T19A 3SS4A 5I94A 3MQOA 1VHMA 3G4PA 4Y5FA 2FFYA 4XUXA 2Y59A 4M4XA 3DWKA 2WADA 3JYIA 5JYOA 5EVEA 1YQSA 4S2OA 3QP6A 3WWXA 1DJAA 4R23A 3IXHA 3PHYA 4K0WA 5KSHA 2V0WA 1HLUP 4IEDA 1OPXA 1WYBA 3FKVA 1Y54A 2HDRA 1FSWA 1ZC2A 4XUZA 4O7DA 2P08A 3MFXA 4UQIS 1EI5A 5AQBA 1FSYA 1ES4A 4HP4A 4KG5A 1MBLA 1K25A 3MJQA 4B93A 5HARA 2W1TA 4OH0A 1K0KA 3D72A 5FQJA 4LV0A 5DTTA 4QY5A 2I9VA 1KGGA 5FSRA 5M1AA 2XFTA 3VP2A 4H6JB 1SCWA 2XDMA 1CI9A 2M7VA 3CG5A 1P9WA 4HIAA 1KE3A 4X25A 4XT2A 3IXBA 3ISGA 1MKIA 4DE0A 4E3JA 4HOIA 5HD3A 4Q0IA 4IBRA 3S7NA 3ZG7B 3P01A 2DRWA 4G3KA 4II7A 1G5UA 3UB8A 3UPOA 2OAP1 2O99A 1PYYA 4N92A 4LRZE 4GDBA 1UWNX 2YKHA 3E2KA 2KX6A 3NCKA 3HLCA 4C6YA 4UHUA 4HNBA 3LIBA 4KQOA 1GA9A 2W0NA 2A24A 2PU2A 1P0ZA 3EOIA 1KOUA 4GNUA 4LV2A 1VQQA 4P0MA 2P9VB 1MPLA 3CZDA 1W8QA 4NKPA 1XXMA 3EEHA 2WYXA 3PYPA 4WZ4A 5L2FA 1YMXA 2H5SA
chains in the Genus database with same CATH topology
3LR3A 4P6ZM 5HD5A 5HZHA 3FPVA 3LIDA 1MC0A 3CUEC 3E4OA 1YSQA 3B47A 1JNUA 3F1OB 4R3AA 2HJEA 5TBMB 1OTDA 4L9FA 4HQAA 2L4RA 1YAXA 1OT9A 3RH8B 2VX8A 4L9EA 4AFIA 1G28A 4HJ6A 4O0PA 2M7UA 5HDDA 4EQ1A 2VJWA 2V1BA 4IJGA 2JKTM 4MMNA 1GSWA 4BBTA 1S67L 4EXOA 1GSVA 4NEED 3EQVA 4PKYG 3BJNA 4WELA 2V9AA 3PBSA 3LIEA 4MDZA 4BBUA 1N9OA 5IS1A 4G3WA 4GHIB 2HF6A 5G4YA 1IOUA 4QPRA 5LBRA 5AVFA 1LT0A 2L1MA 3A0SA 3KSGA 1H8MA 3CI6A 5AVEA 4ARZA 4EEUA 1S1YA 3LR0A 1LL8A 2QJ7A 3LUQA 2VLGA 4Y2FA 3HJKA 3UMEA 2IA2A 4EESA 1S66L 2D02A 2OWHA 3MQ0A 2PYPA 2KLIA 4I3IA 1OTAA 4HJ3A 2HGVA 5CX7A 4H6JA 5IU1A 3K3DA 2PDRA 1OT6A 2K31A 4WL9A 5IT5A 3CLOA 5L8MA 1OTBA 2R78A 2WKRA 3E0YA 5HDSA 4EEPA 4I5SA 1DP9A 4JGPA 4OOMA 2OOLA 4GS9A 4DJ2A 4CLCD 2PHYA 5K5BA 3PBQA 1LSXA 5FL3A 3T4SA 4MN5A 4L9GA 3LFVA 2JN7A 5TJJA 4R6LA 1XJ3A 3E4QA 2GZAA 4G3VA 3R7WB 5HL6A 2EWWA 4CLCA 2VGLS 2VV6A 3HCYA 1TS6A 2GJ3A 4R38A 3PBOA 3T4LA 4P6ZS 5A8BA 4DN0A 5F6AA 3H7WB 3OOVA 2VA0A 4NXFA 1TS7A 3CWFA 2PR6A 1XFNA 1DP8A 1G6OA 4ME4A 1D7EA 2A2LA 1BYWA 3F1PB 4GJ4A 3JVVA 3IS2A 1NLYA 5KIZA 4EERA 4PKYA 3LI8A 3E98A 3F1OA 5TBMA 4PAUA 3MXQA 5DKLA 2JKRM 3A0VA 2L0WA 3ULFA 3EQUA 5HWWA 5F5YA 3OBFA 4O01A 2W3EA 3H9WA 4I3JA 2XA7M 4IUKA 1F5MA 2P7JA 4EU0A 2O9CA 2OAQ1 3T4JA 4GHIA 3T4KA 1T1AA 1H3QA 4NXBA 3KYQA 1MZUA 2ZMVA 4WN5A 2P04A 2J3TD 3BY8A 2VEAA 3KSHA 2EWVA 5DFXA 1TS8A 3P7NA 4OOLA 3S7PA 3E4PA 2Y8HA 3OCLA 3MF0A 3EEAA 4YOFA 4WEJA 1NLZA 4E04A 2QWSA 1F9IA 3K3CA 4LRYC 2O9AA 1T1BA 2PYRA 2J80A 3DBAA 3KO6A 3C2WA 4HJ4A 2VZWA 4KUOA 3RFBA 3B42A 5HSQA 2W3FA 3FG8A 3H82B 2OWJA 4HP9A 5F68A 3FC7A 4GLQA 2KOIA 1N9NA 3KYZA 4NXEA 2KDKA 2B18A 3UE3A 3R4KA 5HWVA 3UMDA 5MC7A 4Q0JA 3UE6A 1P9RA 1TF1A 2Z6CA 1LSVA 3EGXC 4O8GA 1MKMA 2PT7A 4IHQA 4EETB 3B33A 3LIAA 3PBTA 4F3LB 4BJPA 4JGRA 3BY9A 2INWA 3R7WA 4ETZA 4ETXA 4KQDA 4L0LA 5EFWA 1OTEA 2MJ6A 2W27A 3K2NA 2W1TB 3VE3A 2O9BA 3NOPC 2LB9A 3MR0A 4LRXC 4JGQA 3A0RA 3V67A 3UB9A 2K7SA 3H7WA 3CUEA 4WLAA 3NHQA 3VV4A 3ZYTA 3T4QA 5I5LA 2V0UA 4HY8A 2FZ0A 4YNRA 3VE4A 1YSPA 5J3WA 3FPWA 4UQIM 3TE8A 4EUVA 3EWKA 1WA9A 4XT2B 1DRMA 1Y28A 5DJUA 3F1NB 3TRCA 2B02A 2PD8A 4K08A 4JGOA 1F98A 1V9YA 3JVUA 1W63Q 1T1CA 3F1PA 3G6OA 1UWPX 2XA7S 3LICA 2K2NA 3KSFA 4HH2A 5J4EA 1UGUA 4Z1WA 1OTIA 3UB7A 3KSIA 2H28A 3ZQ5A 3U2AA 1NWZA 4FOFA 2ZBBA 4PHTA 1P97A 2VV7A 3S7QA 3S7OA 2VKSA 2FH5A 4LPZA 2XRNA 3LR5A 3EGDC 4CQHA 2Y79A 3BQAA 1VB6A 1EW0A 1N9LA 5HDCA 4HHDA 3O5YA 1D06A 3LR4A 3D3OA 3LYXA 1OJ5A 2XSSA 1ODVA 2A24B 2Z6DA 4GCZA 2JKTI 1XJ2A 4Q0HA 4LLOB 4I38A 1T19A 4I3AA 3IBRA 1YKDA 5C5KA 3HJIA 3MQOA 1VHMA 4CLCC 2HJ9C 1V9ZA 3BWLA 4MN6A 4Y5FA 3C38A 2EA9A 1X0OA 1TS0A 4M4XA 3GDIA 3MMHA 5DF9A 4DJ3A 3T4TA 5HPIA 2QKPA 3PXPA 2BASA 1ZTUA 2GNXA 4ZRRA 4MN7A 4HH3A 1STZA 4R70A 3PHYA 3CAXA 3RTYA 2V0WA 3H82A 2W1RA 5KSHA 2M1CA 1OPXA 2D01A 3NJAA 4BBVA 1W63M 4YWZA 5HWTA 2W3HA 2PR5A 4DMZA 4BWIA 2P08A 3MFXA 1XFQA 4UQIS 2G7UA 1XJ6A 3LI9A 3UB6A 1T18A 4F3LA 5DKKA 2CMNA 4UEYA 4HP4A 4GW9A 3OCNA 4RQ9A 3MJQA 3ICYA 4B93A 3KX0X 3OLOA 4WEKA 3NOUC 1DP6A 4ARZB 1LSWA 2W1TA 2J3WA 3BW6A 2LB5A 3D72A 4WUJA 1NRJA 2QYBA 2DMWA 2I9VA 1TD5A 4CLCE 4HI4A 3OC2A 4H6JB 5J7EA 2NUTC 1S1ZA 2ZOIA 2M7VA 1P9WA 4HIAA 3W2ZA 4XT2A 3SW1A 3F1NA 3PBNA 2WKQA 4HOIA 2ZMFA 5HD3A 5DJTA 3T50A 4Q0IA 4EW7A 3S7NA 3IBJA 1OJGA 4GS9B 5AJGA 4B9OA 1S4RA 5G4ZA 2PD7A 4I39A 3P01A 3GECA 4G3KA 2ZOHA 3LIFA 2XROA 4II7A 4Y3IA 3UB8A 4WF0A 5HPFA 4BMWA 2J3TC 2OAP1 3NOTC 2QHKA 2O99A 3TJZC 5F69A 4CLCB 3C8CA 4LRZE 1ZHHB 3VOLA 3BQ8A 2HV1A 1S4SA 1UWNX 2O0YA 2YKHA 4FSFA 3T4OA 2KX6A 2VV8A 2JHEA 1GSXA 2QJ5A 4KUKA 2JKRI 4IUHA 5DFYA 2W3DA 4MCWA 4HNBA 2NUPC 2V1AA 3LIBA 4KQOA 2W3GA 2W0NA 2A24A 1P0ZA 3EOIA 1KOUA 3CITA 3C30A 3PR6A 1IFQA 4NKPA 2VGLM 3EEHA 3PYPA 3MQQA 2YKFA 3TW8A 2GX5A 4NXGA 3IS2B 3PBRA 1XJ4A 2WKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ETZ A;  4ETX A;  1MC0 A;  1YSQ A;  3K2N A;  2W3H A;  2W1T B;  2O9B A;  3NOP C;  2LB9 A;  4ME4 A;  4LRX C;  4DMZ A;  4BWI A;  2G7U A;  4O0P A;  3NHQ A;  2M7U A;  3VV4 A;  5I5L A;  4YNR A;  2VJW A;  1YSP A;  4GW9 A;  4IJG A;  4MMN A;  4RQ9 A;  3E98 A;  4EUV A;  3NOU C;  4PAU A;  2W1T A;  3TRC A;  2LB5 A;  3BJN A;  4MDZ A;  3G6O A;  4G3W A;  2K2N A;  2QYB A;  3KSF A;  3OBF A;  1TD5 A;  4QPR A;  4O01 A;  2W3E A;  5LBR A;  4Z1W A;  3KSI A;  3KSG A;  3ZQ5 A;  2M7V A;  4IUK A;  3W2Z A;  4FOF A;  3CI6 A;  1F5M A;  3S7Q A;  3S7O A;  2VKS A;  2ZMF A;  4EU0 A;  2O9C A;  4Y2F A;  4Q0I A;  3S7N A;  2IA2 A;  2XRN A;  3IBJ A;  3MQ0 A;  2KLI A;  4CQH A;  2Y79 A;  5AJG A;  2HGV A;  3O5Y A;  2VEA A;  4G3K A;  3KSH A;  2K31 A;  2XRO A;  3D3O A;  5DFX A;  4Y3I A;  5HPF A;  5L8M A;  3S7P A;  2XSS A;  3NOT C;  3E0Y A;  2O99 A;  2Y8H A;  2OOL A;  4LRZ E;  3MF0 A;  4Q0H A;  3EEA A;  4YOF A;  3IBR A;  5K5B A;  1YKD A;  5C5K A;  2O0Y A;  4E04 A;  4LRY C;  2O9A A;  3DBA A;  3KO6 A;  1VHM A;  3C2W A;  4IUH A;  2VZW A;  3LFV A;  4Y5F A;  5DFY A;  3RFB A;  2W3D A;  2W3F A;  5TJJ A;  4MCW A;  5HSQ A;  4GLQ A;  4R6L A;  2KOI A;  3MMH A;  4G3V A;  2W3G A;  5HL6 A;  2B18 A;  3R4K A;  5HPI A;  3CIT A;  4Q0J A;  3HCY A;  1TF1 A;  1ZTU A;  4ZRR A;  4DN0 A;  3OOV A;  4O8G A;  1MKM A;  4MN7 A;  2GX5 A;  1STZ A;  4R70 A;  2W1R A; 
#chains in the Genus database with same CATH topology
 3LR3 A;  1QMF A;  1MY8 A;  1BZA A;  3E4O A;  3B47 A;  5TBM B;  1CEG A;  4L9F A;  5CEC A;  3RH8 B;  1OT9 A;  2VX8 A;  4L9E A;  4X1L A;  3WRZ A;  1ES2 A;  4EQ1 A;  1GSW A;  4NK3 A;  3BFC A;  4BBT A;  1S67 L;  3WS1 A;  2RL3 A;  3C5A A;  4EXO A;  4NEE D;  1BSG A;  3EQV A;  4PKY G;  2JKG A;  2V9A A;  3ZDJ A;  4BBU A;  4Y7P A;  1E25 A;  2WGW A;  5G4Y A;  4QHC A;  1GHM A;  5AVF A;  3FKW A;  3KSG A;  3HUO A;  3CI6 A;  5AVE A;  2VGK A;  3B3X A;  4ARZ A;  4S2K A;  2HPB A;  2Y2N A;  5FQ9 A;  1LL8 A;  2VLG A;  3HJK A;  4ID4 A;  4S2N C;  1S66 L;  1FIL A;  4KG2 A;  4I3I A;  3ZNY A;  5IU1 A;  3N7W A;  3TOI A;  4OPY A;  2PBD P;  4UAA A;  2OOL A;  4GS9 A;  4LFU A;  2PHY A;  1K38 A;  5J8X A;  3UE0 A;  3PBQ A;  1MWS A;  4MN5 A;  5E2G A;  2H0T A;  2JN7 A;  3ITB A;  3LFV A;  5F1F A;  2J9O A;  5CXW A;  1J3W A;  4R6L A;  4WYY A;  3IX8 A;  2EWW A;  3MXS A;  4CLC A;  5FI6 A;  2Q0O A;  3BFF A;  3SS5 A;  1RGY A;  4R0Q A;  1KE4 A;  2QZ6 A;  5CER A;  4K0X A;  2ZC7 A;  4DF6 A;  2JKF A;  4NXF A;  4ZJ3 A;  1Q2P A;  3IH8 A;  3CWF A;  1FIK A;  1XFN A;  3QHY A;  3S4X A;  4KQR A;  2ZQ9 A;  4ME4 A;  3GVB A;  3F1P B;  1IEM A;  3IS2 A;  1NLY A;  3UDI A;  4KZ5 A;  4N9L A;  4X53 A;  3RXW A;  3F1O A;  4UA7 A;  5FAQ A;  3DAV A;  2E8J A;  1Z6F A;  2HZ5 A;  5HW3 A;  2JKR M;  3CHW P;  3EQU A;  1RGZ A;  4E3O A;  1FR6 A;  3ZG9 B;  3G2Y A;  3RXX A;  1KDS A;  2HP5 A;  4JKT A;  4EU0 A;  1YLW A;  3IWO A;  5TGF A;  4GHI A;  4KZ8 A;  4HBU A;  4NXB A;  4GB7 A;  2P04 A;  1PI4 A;  3BY8 A;  3VMA A;  3KSH A;  2EWV A;  3G32 A;  4OOL A;  4U0X A;  2XLN A;  2BLS A;  2OLU A;  3MF0 A;  3PAG A;  5FQQ A;  4UA6 A;  1GCE A;  4R4S A;  3K3C A;  2O9A A;  1E3U D;  3A3D A;  1C3B A;  4DKI A;  2W3F A;  4FH4 A;  2H10 A;  3FC7 A;  2KOI A;  1EWZ A;  2ZQ8 A;  1HVB A;  3UY6 A;  1GHI A;  2B18 A;  4HEF A;  3UE3 A;  5MC7 A;  2I72 A;  5DTS A;  1LLB A;  1ONH A;  1LSV A;  3RJU A;  4O8G A;  4JLF A;  1D1J A;  1ES3 A;  4F3L B;  4BJP A;  1H5X A;  5A93 A;  4L0L A;  1Z09 A;  2W27 A;  4WZ5 A;  1WE4 A;  2O9B A;  4LRX C;  4JGQ A;  5L07 A;  3H7W A;  3Q81 A;  3CUE A;  4WLA A;  3VV4 A;  3ZYT A;  2FZ0 A;  4JF6 A;  5EVI C;  3TE8 A;  5D3O A;  4EUV A;  4UA9 A;  1WA9 A;  2HP6 A;  1PWD A;  4D60 A;  1V9Y A;  1YLY A;  3G6O A;  3LIC A;  5J4E A;  4B4X A;  1OTI A;  3BEC A;  3HLG A;  3CPT A;  3KSI A;  1ERO A;  3G2Z A;  1I5Q A;  4XXR A;  3S7O A;  2Y79 A;  1EW0 A;  5HDC A;  2FFF B;  4P6B A;  4FUW A;  3A3F A;  4MBF A;  4JF5 A;  3PAE A;  4GD6 A;  3WS4 A;  5DF7 A;  4GCZ A;  4ZJ1 A;  2Q9M A;  2EFU A;  1LL5 A;  2Y2P A;  4I3A A;  1YKD A;  5C5K A;  1K56 D;  3SOI A;  2HJ9 C;  1X0O A;  5F83 A;  1TS0 A;  3MMH A;  3LGO A;  1N9B A;  2WGI A;  5DF9 A;  3T4T A;  1JWP A;  3C4P A;  1ZTU A;  1FCN A;  1XA7 A;  4ZRR A;  4NG2 A;  1JWV A;  2WGV A;  3QP5 A;  1ONG A;  3GTC A;  1MWT A;  3NJA A;  3S1Y A;  4ZBE A;  4LV3 A;  4YWZ A;  2W3H A;  4KZB A;  3BEB A;  4BWI A;  1XFQ A;  5EVI B;  2G7U A;  1XJ6 A;  1KDW A;  1K54 A;  3SH8 A;  4UEY A;  3OCN A;  4RQ9 A;  3ICY A;  5FA7 A;  2Y2M A;  1LSW A;  3JPU A;  2QPN A;  2LB5 A;  1NZU A;  2EX9 A;  1S6R A;  2DMW A;  3UE1 A;  4OPZ A;  2ZOI A;  3QNC A;  3FV7 A;  3L9K A;  2ZC5 B;  2ZL1 A;  3F1N A;  1ZKJ A;  3PBN A;  1SKO B;  2ZMF A;  4LGW A;  5AJG A;  1S4R A;  4DE2 A;  3KYE A;  1CQA A;  2WAF A;  2ZOH A;  5FQM A;  2B5R A;  3W8K A;  1BUL A;  5HPF A;  3M2J A;  2C5W B;  4PM7 A;  3NOT C;  1L3L A;  3VOL A;  1S4S A;  4FSF A;  4NET A;  3V5M A;  3ZGA B;  3BLM A;  4IUH A;  1NRF A;  5KSC A;  2NUP C;  1FQG A;  4DE1 A;  3BFD A;  3C7V A;  2OSU A;  2XQZ A;  1VEU A;  5TR7 A;  3C30 A;  1MWR A;  1IFQ A;  3CPT B;  1XKZ A;  1YM1 A;  3VP3 A;  2XH9 A;  2WK0 A;  3MQQ A;  2YKF A;  4F94 A;  2GX5 A;  3P09 A;  4OPQ A;  4PMA A;  2EX8 A;  4KG6 A;  2X01 A;  4FD8 A;  1ES5 A;  3FPV A;  3LID A;  3IXD A;  1ESI A;  4ZAM A;  4AFI A;  1G28 A;  4HJ6 A;  4O0P A;  2M7U A;  3LY3 A;  2V1B A;  2V20 A;  2Y2H A;  5EOO A;  4DDY A;  1BTL A;  2UV0 E;  2PRF A;  3BJN A;  4WEL A;  3PBS A;  5KZH A;  1IKG A;  2WZX A;  3Q7Z A;  1KVL A;  3VFH A;  2WKE A;  5LBR A;  1LT0 A;  1LHY A;  3MBZ A;  5CGW A;  4Y0U A;  2L1M A;  3HL9 A;  1L0G A;  4QD4 A;  2RCX A;  1H8M A;  1XGI A;  3MS6 A;  3IHB A;  1HTZ A;  1S1Y A;  2Y2O A;  3T1X A;  3MSH A;  3LUQ A;  3FYZ A;  1N4O A;  2IA2 A;  3MQ0 A;  2PYP A;  3T1S A;  2JCH A;  2IWB A;  2E8I A;  3O87 A;  1IYS A;  2HGV A;  1PNE A;  4DXB A;  4KZ9 A;  3IH9 A;  1I2W A;  4Y15 A;  3CLO A;  1SKF A;  4LEN A;  1OTB A;  3IT9 A;  3E0Y A;  5DF8 A;  4I5S A;  3N4I A;  1H0M A;  1TEM A;  4OOM A;  1L0F A;  5K5B A;  3QNB A;  5FL3 A;  4LCL A;  4ZDX A;  2CC1 A;  3HVF A;  3E4Q A;  3W4P A;  4LV1 A;  3ZFZ A;  1JVJ A;  2IWC A;  1G6A A;  2GJ3 A;  4R38 A;  3PBO A;  5A8B A;  4DN0 A;  3QP4 A;  1YLP A;  1YLT A;  1A0K A;  4OQG A;  1TS7 A;  3VSL A;  3GRJ A;  3UPN A;  2PR6 A;  2HDU A;  1DP8 A;  1G6O A;  1VET A;  2A2L A;  3GV9 A;  5KIZ A;  3SH9 A;  1ALQ A;  3LI8 A;  2GDN A;  1QME A;  3Q7V A;  4PAU A;  1H8Z A;  3MXQ A;  4OPR A;  3DW0 A;  4DDS A;  3ULF A;  3NC8 A;  3VSK A;  2VK3 A;  5EM1 A;  4I3J A;  4X55 A;  4A5R A;  2EFX A;  1VEU B;  1Y4O A;  2WKI A;  2XFS A;  2P7J A;  3BYD A;  3AGF A;  2OAQ 1;  1H3Q A;  4WN5 A;  1L2S A;  1TS8 A;  3E4P A;  3LY4 A;  3EEA A;  4YOF A;  1NLZ A;  4E04 A;  4R3B A;  1F9I A;  4LRY C;  2PYR A;  4OP8 A;  2VZW A;  5F68 A;  2OWJ A;  4HP9 A;  3KYZ A;  4JXG A;  1CJF A;  4GN2 A;  4B4Z A;  3QP8 A;  3DWZ A;  4Q0J A;  1TF1 A;  3VP4 A;  1E3U A;  5A90 A;  3B33 A;  2ZC4 B;  2INW A;  3R7W A;  4ETZ A;  5CTN A;  1IEL A;  1KE0 A;  3K2N A;  5KMW A;  1KGF A;  2W1T B;  3VE3 A;  4OQ0 A;  2LB9 A;  3MR0 A;  4EQI A;  4YFM A;  1L0E A;  3N6I A;  3NHQ A;  2QMI A;  3FPW A;  3EWK A;  4S2M A;  4XT2 B;  5HAI A;  2PD8 A;  1W63 Q;  5FAO A;  2Y2L A;  5DTK A;  3VP0 A;  4OOY A;  2Y4A A;  4Z1W A;  5AQ9 A;  3ZQ5 A;  3U2A A;  3IF6 A;  5FAT A;  4GD8 A;  1P97 A;  4X6T A;  3DTM A;  4PM9 A;  3GQZ A;  4KZ4 A;  4LPZ A;  3LR5 A;  1VB6 A;  3VP1 A;  3V3S A;  1BT5 A;  4HHD A;  3O5Y A;  1SHV A;  5CED A;  4D2O A;  3D3O A;  4BL3 A;  3UPP A;  1OJ5 A;  1XPB A;  1ODV A;  2A24 B;  2JKT I;  1DJC A;  4Y0T A;  2HP9 A;  1G68 A;  3ZG0 A;  4OP5 A;  4CLC C;  1V9Z A;  4MN6 A;  3C38 A;  3GDI A;  1HZO A;  3DTK A;  4DJ3 A;  5HPI A;  2WAE A;  3MZD A;  2QKP A;  3PXP A;  2BAS A;  1F2K A;  1K56 A;  1PRQ A;  2GNX A;  4HES A;  3ZHH A;  3BRM A;  3L7H A;  4R70 A;  4ZTK A;  3RTY A;  5CGX A;  3H82 A;  4B88 A;  4BQM A;  5CHU A;  2D01 A;  2Q9N A;  4IVK A;  3G30 A;  3Q07 A;  1W63 M;  1GA0 A;  2PR5 A;  1L0D A;  4DMZ A;  3W4O A;  3LI9 A;  2WGW B;  1T18 A;  3UB6 A;  3ZCZ A;  2CMN A;  4S2J A;  4CPK A;  5CTM A;  4GW9 A;  4ARZ B;  2J3W A;  1IYP A;  5EE8 A;  3N8S A;  1KGE A;  2ZC6 B;  3MFD A;  3QP1 A;  4WMC D;  4WUJ A;  2QYB A;  1TD5 A;  2G2W A;  4CLC E;  4HI4 A;  2PU4 A;  3OC2 A;  2XR0 A;  2NUT C;  5J7E A;  1SDE A;  3W2Z A;  4E3N A;  3SW1 A;  4QJG A;  1J9M A;  3IBJ A;  1NY0 A;  1NYM A;  4GS9 B;  4S2I A;  4B9O A;  3G34 A;  1GHP A;  4S2L A;  1K6S A;  2PD7 A;  3GEC A;  3LIF A;  4Y0O A;  5L09 A;  4Y3I A;  4YIN A;  4WF0 A;  4BMW A;  2J3T C;  2QHK A;  5GLC A;  3C4O A;  3TJZ C;  3W4Q A;  5GHZ A;  5F69 A;  4N1H A;  2Y2Q A;  4CLC B;  4OVD A;  1ZHH B;  3BQ8 A;  2VGJ A;  4Y13 A;  5FI7 A;  2O0Y A;  4OQH A;  2VV8 A;  5AQA A;  1GSX A;  2QJ5 A;  4GDN A;  4KUK A;  2W3D A;  3NEC A;  4MCW A;  1K57 A;  5FAS A;  2W3G A;  1WYC A;  3V39 A;  4X68 A;  1NXY A;  1CI8 A;  3PR6 A;  1FR1 A;  3UO9 A;  3DTI A;  2VGL M;  3MZF A;  3IS2 B;  3MKF A;  3PBR A;  4WZ5 C;  2WKP A;  5FQI A;  1PZO A;  4P6Z M;  5HD5 A;  5GLB A;  3UB5 P;  1O07 A;  4FCF A;  5HZH A;  3G31 A;  3CUE C;  4R3A A;  3F1O B;  1JNU A;  2R9X A;  4HQA A;  1YAX A;  4LCM A;  1XX2 A;  5EVI D;  5HDD A;  3HBR A;  4PM6 A;  3T12 B;  2VJW A;  4IJG A;  1TDG A;  3T1Q B;  3O3V A;  1GSV A;  2ACG A;  3LIE A;  4MDZ A;  1N9O A;  3D9Y A;  5IS1 A;  4GHI B;  1PIO A;  4QPR A;  4C75 A;  3A0S A;  3BFG A;  4EEU A;  2QJ7 A;  4Y2F A;  1SDN A;  3AGD A;  5HFO A;  1OTA A;  5FAP A;  5CX7 A;  4H6J A;  5HAQ A;  3N8L A;  1FOF A;  2PDR A;  1OT6 A;  4R1G A;  1W8Y A;  5IT5 A;  5L8M A;  2R78 A;  5HDS A;  4EEP A;  1DP9 A;  4U3T A;  1JTG A;  4KQQ A;  1K4E A;  1LSX A;  4E3I A;  3T4S A;  3OPR A;  4L9G A;  5E43 A;  1XJ3 A;  5HL6 A;  2VGL S;  2XD1 A;  4GOG A;  3HCY A;  3M6B A;  3AGE A;  2XGN A;  3GMW A;  4P6Z S;  1ERM A;  3H7W B;  2VA0 A;  3DTE A;  5FI2 A;  3UDF A;  3Q82 A;  4QY6 A;  1K54 C;  4KZ6 A;  2P9V A;  1D7E A;  4MEZ A;  2B95 A;  1BYW A;  4GJ4 A;  2Z2L B;  1IYO A;  4PKY A;  2EX6 A;  2V8C A;  3A3I A;  5TFQ A;  3E98 A;  2DNS A;  5TBM A;  1E4D A;  5DKL A;  2V8F A;  3A3J A;  1PI5 A;  2L0W A;  1PW8 A;  5HWW A;  5F5Y A;  2Y2I A;  1PFL A;  3H9W A;  3HLB A;  3O86 A;  4EWF A;  5L10 A;  3IWI A;  2ZC3 B;  4IUK A;  1F5M A;  3SZT A;  2Y2G A;  3FWL A;  2Z2M B;  3IQA A;  2V2F F;  3UNW A;  3KYQ A;  1MZU A;  2ZMV A;  4BLM A;  3TG9 A;  1M6K A;  1JTD A;  1YPR A;  4CJN A;  1ZG6 A;  4EUZ A;  3OCL A;  2BTF P;  4WEJ A;  5FDH A;  2QWS A;  1ZG4 A;  1T1B A;  3HLW A;  2J80 A;  4JF4 A;  4E3K A;  3DBA A;  3C2W A;  4HJ4 A;  4X69 A;  5AQ7 A;  3B42 A;  4EV4 A;  4P87 A;  1TDL A;  3FG8 A;  1TVF A;  4U0T A;  4JPM A;  3T1R A;  5HAP A;  4NXE A;  2KDK A;  1W79 A;  5HWV A;  3IX3 A;  3UE6 A;  1P9R A;  4OQI A;  3MXR A;  2Z6C A;  1RCJ A;  4KZ7 A;  1KVM A;  5GLA A;  3NY4 A;  4IHQ A;  2PT7 A;  4EET B;  2EX2 A;  3LIA A;  3OPP A;  5EV0 A;  3BY9 A;  4MBH A;  4KQD A;  3ZVW A;  5EFW A;  1OTE A;  3NOP C;  2EXB A;  2JBF A;  3A0R A;  3T4Q A;  5I5L A;  2V0U A;  1YSP A;  2BG1 A;  1PWC A;  2PAV P;  3HLF A;  1ERQ A;  5DJU A;  2ZL1 B;  3F1N B;  3TRC A;  3IF5 A;  2B02 A;  4K08 A;  4JGO A;  3JVU A;  3F1P A;  1T1C A;  1UWP X;  3KSF A;  4HH2 A;  1VM1 A;  4N9K A;  3WS5 A;  4FOF A;  2ZBB A;  4PHT A;  2ZJ9 A;  1LI0 A;  3S22 A;  1IKI A;  2FH5 A;  5FEF A;  2XRN A;  3SH7 A;  2ZQC A;  1D06 A;  4S2N A;  3LYX A;  3NUL A;  4M3K A;  4MNR A;  1DJB A;  1H8Y A;  4R3J A;  1XJ2 A;  3QP2 A;  4I38 A;  2Y91 A;  4WM9 A;  3C7U A;  3IBR A;  3ZG8 B;  3HJI A;  3PTE A;  3BWL A;  2EA9 A;  3UN7 A;  4E3L A;  2JC7 A;  3N8R A;  4KZ3 A;  4C3Q A;  3BLS A;  3CJM A;  4BD1 A;  2G2U A;  4E3M A;  3ZNT A;  3LEQ A;  4MN7 A;  4HH3 A;  4R4R A;  4DRT A;  1STZ A;  3CAX A;  2W1R A;  5IHV A;  4GKU A;  2M1C A;  4JBF A;  5FQK A;  4QWO A;  4BBV A;  5HWT A;  5E2H A;  1LI9 A;  4F3L A;  5DKK A;  4KEN B;  3KX0 X;  3OLO A;  4WEK A;  1M40 A;  3NOU C;  5GHY A;  4PM5 A;  1DP6 A;  3CMZ A;  3BW6 A;  1NRJ A;  4DXC A;  1OME A;  1S1Z A;  3BFE A;  4Y17 A;  2ZLY A;  3ZVT A;  2WZZ A;  1PZP A;  2WKQ A;  2XK1 A;  5DJT A;  3T50 A;  4EW7 A;  4WMC A;  1OJG A;  5CHJ A;  3I7J A;  5EM0 A;  5G4Z A;  4K91 A;  5BOH A;  1K4F A;  4I39 A;  1MWU A;  2XRO A;  2ZQD A;  3LEZ A;  1LL9 A;  1CF0 A;  4Q8I A;  4PPR A;  3P98 A;  4RA7 A;  1YLJ A;  3C8C A;  3VOZ A;  2HV1 A;  1ACF A;  1CK3 A;  3T4O A;  4EBP A;  2JHE A;  4JXS A;  4ZJ2 A;  2JKR I;  5DFY A;  3V3R A;  5F82 A;  1RP5 A;  3LCE A;  2Y55 A;  4FTX A;  2XEP A;  2V1A A;  4N1X A;  3MKE A;  4HBT A;  4RVA A;  3CIT A;  4BL2 A;  1I2S A;  4JXW A;  1VET B;  1AXB A;  3TW8 A;  5JYP A;  4NXG A;  2OLV A;  3G35 A;  3WS2 A;  4JXV A;  3BM6 A;  2UWX A;  1XJ4 A;  3NIA A;  1YMS A;  1BUE A;  1MC0 A;  3NDG A;  1YSQ A;  3HLD A;  5M19 A;  3Q7V B;  2HJE A;  1OTD A;  2XF3 A;  2L4R A;  1U60 A;  4ESP A;  3HUN A;  4P85 A;  4X56 A;  2DCF A;  2ZMA A;  1FCM A;  4MMN A;  2JKT M;  1Q2Q A;  5EPH A;  1PW1 A;  3IHA A;  3ITA A;  1MXO A;  2HDS A;  5EVI A;  3IF6 C;  4G3W A;  1IOU A;  2HF6 A;  3WRT A;  4QU3 A;  5M18 A;  5HX9 A;  4BD0 A;  3HRE A;  3LR0 A;  3UME A;  4EES A;  2OWH A;  2D02 A;  2KLI A;  4MLL A;  2Y2J A;  4HJ3 A;  2R9W A;  3A3E A;  1YT4 A;  3K3D A;  3NI9 A;  2K31 A;  4WL9 A;  1NZO A;  2WKH A;  2A49 A;  1SKO A;  2WKR A;  3VOY A;  4JGP A;  4DJ2 A;  5GL9 A;  4CLC D;  4MBK A;  1BLH A;  5TJJ A;  1FCO A;  2ZM0 A;  1DY6 A;  4IVI A;  2GZA A;  4G3V A;  3R7W B;  1NJ4 A;  4S2P A;  2VV6 A;  3FZC A;  1TS6 A;  5HL1 A;  3T4L A;  3M6H A;  5CEB A;  5F6A A;  3OOV A;  4E6W A;  1CEF A;  2ZM8 A;  3LO7 A;  2ZQ7 A;  3VFF A;  3IWQ A;  5CGS A;  4EBL A;  3JVV A;  2HDQ A;  5U47 A;  4EER A;  1XGJ A;  2EXA A;  1O7E A;  1YLZ A;  2IWD A;  3IF6 B;  3ZG5 A;  1ESU A;  4OON A;  5CRF A;  2H0Y A;  2PBY A;  3A0V A;  1PWG A;  3OBF A;  4IBX A;  3OZH A;  4O01 A;  2W3E A;  1K6R A;  5CHM A;  5EUA A;  2XA7 M;  5GHX A;  3Q1F A;  4RX3 A;  5A92 A;  1BLS A;  2O9C A;  5DVA A;  3T4J A;  3T4K A;  1T1A A;  4EBN A;  5G18 A;  1SZV A;  5FEG A;  4WBG A;  2J3T D;  5EEC A;  2VEA A;  4KZA A;  5DFX A;  3P7N A;  3S7P A;  3NBL A;  4E6X A;  2Y8H A;  3OPL A;  1K55 A;  3WS0 A;  1K57 C;  3GR2 A;  5E2E A;  5EOE A;  2X02 A;  2AVX A;  4RYE A;  3KO6 A;  5F1G A;  2XD5 A;  4KUO A;  3RFB A;  5HSQ A;  3H82 B;  2V1Z A;  4GLQ A;  1N9N A;  3NDE A;  4DE3 A;  3R4K A;  3UMD A;  2J8Y A;  3D4F A;  1BLC A;  5E2F A;  3EGX C;  1MKM A;  4OLD A;  1S0W A;  1XP4 A;  3PBT A;  2J7V A;  3O88 A;  2ZM2 A;  2ZQA A;  4JGR A;  3M2K A;  4QB8 A;  4ETX A;  5A91 A;  1NYY A;  1JWZ A;  2MJ6 A;  4Z9Q A;  5GLD A;  4OLG A;  4RX2 A;  1BLP A;  4BEN A;  1IYQ A;  4GZB A;  3V50 A;  3UB9 A;  2K7S A;  3V67 A;  3MZE A;  3OPH A;  1HD8 A;  4HY8 A;  4YNR A;  3VE4 A;  5J3W A;  2A3U A;  3TSG A;  4UQI M;  3IX4 A;  2OV5 A;  1DRM A;  1Y28 A;  3GSG A;  2WUQ A;  1F98 A;  2JE5 A;  4FH2 A;  1K55 C;  2XA7 S;  2K2N A;  3E2L A;  1UGU A;  3UB7 A;  4H8R A;  1W5D A;  2H28 A;  2Y2K A;  1NWZ A;  2J9P A;  2VV7 A;  3S7Q A;  4X1M A;  2C6W B;  2VKS A;  4OKP A;  1XA1 A;  3U4L P;  3EGD C;  4CQH A;  2P74 A;  3BQA A;  3SS3 A;  2ZD8 A;  2X71 A;  5EVL A;  1N9L A;  1W7F A;  4PM8 A;  3IXG A;  3LR4 A;  3HLE A;  3HUM A;  5FDS A;  2XSS A;  1AWI A;  2Z6D A;  3UDX A;  4Q0H A;  4LLO B;  1T19 A;  3SS4 A;  5I94 A;  3MQO A;  1VHM A;  3G4P A;  4Y5F A;  2FFY A;  4XUX A;  2Y59 A;  4M4X A;  3DWK A;  2WAD A;  3JYI A;  5JYO A;  5EVE A;  1YQS A;  4S2O A;  3QP6 A;  3WWX A;  1DJA A;  4R23 A;  3IXH A;  3PHY A;  4K0W A;  5KSH A;  2V0W A;  1HLU P;  4IED A;  1OPX A;  1WYB A;  3FKV A;  1Y54 A;  2HDR A;  1FSW A;  1ZC2 A;  4XUZ A;  4O7D A;  2P08 A;  3MFX A;  4UQI S;  1EI5 A;  5AQB A;  1FSY A;  1ES4 A;  4HP4 A;  4KG5 A;  1MBL A;  1K25 A;  3MJQ A;  4B93 A;  5HAR A;  2W1T A;  4OH0 A;  1K0K A;  3D72 A;  5FQJ A;  4LV0 A;  5DTT A;  4QY5 A;  2I9V A;  1KGG A;  5FSR A;  5M1A A;  2XFT A;  3VP2 A;  4H6J B;  1SCW A;  2XDM A;  1CI9 A;  2M7V A;  3CG5 A;  1P9W A;  4HIA A;  1KE3 A;  4X25 A;  4XT2 A;  3IXB A;  3ISG A;  1MKI A;  4DE0 A;  4E3J A;  4HOI A;  5HD3 A;  4Q0I A;  4IBR A;  3S7N A;  3ZG7 B;  3P01 A;  2DRW A;  4G3K A;  4II7 A;  1G5U A;  3UB8 A;  3UPO A;  2OAP 1;  2O99 A;  1PYY A;  4N92 A;  4LRZ E;  4GDB A;  1UWN X;  2YKH A;  3E2K A;  2KX6 A;  3NCK A;  3HLC A;  4C6Y A;  4UHU A;  4HNB A;  3LIB A;  4KQO A;  1GA9 A;  2W0N A;  2A24 A;  2PU2 A;  1P0Z A;  3EOI A;  1KOU A;  4GNU A;  4LV2 A;  1VQQ A;  4P0M A;  2P9V B;  1MPL A;  3CZD A;  1W8Q A;  4NKP A;  1XXM A;  3EEH A;  2WYX A;  3PYP A;  4WZ4 A;  5L2F A;  1YMX A;  2H5S A; 
#chains in the Genus database with same CATH homology
 3LR3 A;  4P6Z M;  5HD5 A;  5HZH A;  3FPV A;  3LID A;  1MC0 A;  3CUE C;  3E4O A;  1YSQ A;  3B47 A;  1JNU A;  3F1O B;  4R3A A;  2HJE A;  5TBM B;  1OTD A;  4L9F A;  4HQA A;  2L4R A;  1YAX A;  1OT9 A;  3RH8 B;  2VX8 A;  4L9E A;  4AFI A;  1G28 A;  4HJ6 A;  4O0P A;  2M7U A;  5HDD A;  4EQ1 A;  2VJW A;  2V1B A;  4IJG A;  2JKT M;  4MMN A;  1GSW A;  4BBT A;  1S67 L;  4EXO A;  1GSV A;  4NEE D;  3EQV A;  4PKY G;  3BJN A;  4WEL A;  2V9A A;  3PBS A;  3LIE A;  4MDZ A;  4BBU A;  1N9O A;  5IS1 A;  4G3W A;  4GHI B;  2HF6 A;  5G4Y A;  1IOU A;  4QPR A;  5LBR A;  5AVF A;  1LT0 A;  2L1M A;  3A0S A;  3KSG A;  1H8M A;  3CI6 A;  5AVE A;  4ARZ A;  4EEU A;  1S1Y A;  3LR0 A;  1LL8 A;  2QJ7 A;  3LUQ A;  2VLG A;  4Y2F A;  3HJK A;  3UME A;  2IA2 A;  4EES A;  1S66 L;  2D02 A;  2OWH A;  3MQ0 A;  2PYP A;  2KLI A;  4I3I A;  1OTA A;  4HJ3 A;  2HGV A;  5CX7 A;  4H6J A;  5IU1 A;  3K3D A;  2PDR A;  1OT6 A;  2K31 A;  4WL9 A;  5IT5 A;  3CLO A;  5L8M A;  1OTB A;  2R78 A;  2WKR A;  3E0Y A;  5HDS A;  4EEP A;  4I5S A;  1DP9 A;  4JGP A;  4OOM A;  2OOL A;  4GS9 A;  4DJ2 A;  4CLC D;  2PHY A;  5K5B A;  3PBQ A;  1LSX A;  5FL3 A;  3T4S A;  4MN5 A;  4L9G A;  3LFV A;  2JN7 A;  5TJJ A;  4R6L A;  1XJ3 A;  3E4Q A;  2GZA A;  4G3V A;  3R7W B;  5HL6 A;  2EWW A;  4CLC A;  2VGL S;  2VV6 A;  3HCY A;  1TS6 A;  2GJ3 A;  4R38 A;  3PBO A;  3T4L A;  4P6Z S;  5A8B A;  4DN0 A;  5F6A A;  3H7W B;  3OOV A;  2VA0 A;  4NXF A;  1TS7 A;  3CWF A;  2PR6 A;  1XFN A;  1DP8 A;  1G6O A;  4ME4 A;  1D7E A;  2A2L A;  1BYW A;  3F1P B;  4GJ4 A;  3JVV A;  3IS2 A;  1NLY A;  5KIZ A;  4EER A;  4PKY A;  3LI8 A;  3E98 A;  3F1O A;  5TBM A;  4PAU A;  3MXQ A;  5DKL A;  2JKR M;  3A0V A;  2L0W A;  3ULF A;  3EQU A;  5HWW A;  5F5Y A;  3OBF A;  4O01 A;  2W3E A;  3H9W A;  4I3J A;  2XA7 M;  4IUK A;  1F5M A;  2P7J A;  4EU0 A;  2O9C A;  2OAQ 1;  3T4J A;  4GHI A;  3T4K A;  1T1A A;  1H3Q A;  4NXB A;  3KYQ A;  1MZU A;  2ZMV A;  4WN5 A;  2P04 A;  2J3T D;  3BY8 A;  2VEA A;  3KSH A;  2EWV A;  5DFX A;  1TS8 A;  3P7N A;  4OOL A;  3S7P A;  3E4P A;  2Y8H A;  3OCL A;  3MF0 A;  3EEA A;  4YOF A;  4WEJ A;  1NLZ A;  4E04 A;  2QWS A;  1F9I A;  3K3C A;  4LRY C;  2O9A A;  1T1B A;  2PYR A;  2J80 A;  3DBA A;  3KO6 A;  3C2W A;  4HJ4 A;  2VZW A;  4KUO A;  3RFB A;  3B42 A;  5HSQ A;  2W3F A;  3FG8 A;  3H82 B;  2OWJ A;  4HP9 A;  5F68 A;  3FC7 A;  4GLQ A;  2KOI A;  1N9N A;  3KYZ A;  4NXE A;  2KDK A;  2B18 A;  3UE3 A;  3R4K A;  5HWV A;  3UMD A;  5MC7 A;  4Q0J A;  3UE6 A;  1P9R A;  1TF1 A;  2Z6C A;  1LSV A;  3EGX C;  4O8G A;  1MKM A;  2PT7 A;  4IHQ A;  4EET B;  3B33 A;  3LIA A;  3PBT A;  4F3L B;  4BJP A;  4JGR A;  3BY9 A;  2INW A;  3R7W A;  4ETZ A;  4ETX A;  4KQD A;  4L0L A;  5EFW A;  1OTE A;  2MJ6 A;  2W27 A;  3K2N A;  2W1T B;  3VE3 A;  2O9B A;  3NOP C;  2LB9 A;  3MR0 A;  4LRX C;  4JGQ A;  3A0R A;  3V67 A;  3UB9 A;  2K7S A;  3H7W A;  3CUE A;  4WLA A;  3NHQ A;  3VV4 A;  3ZYT A;  3T4Q A;  5I5L A;  2V0U A;  4HY8 A;  2FZ0 A;  4YNR A;  3VE4 A;  1YSP A;  5J3W A;  3FPW A;  4UQI M;  3TE8 A;  4EUV A;  3EWK A;  1WA9 A;  4XT2 B;  1DRM A;  1Y28 A;  5DJU A;  3F1N B;  3TRC A;  2B02 A;  2PD8 A;  4K08 A;  4JGO A;  1F98 A;  1V9Y A;  3JVU A;  1W63 Q;  1T1C A;  3F1P A;  3G6O A;  1UWP X;  2XA7 S;  3LIC A;  2K2N A;  3KSF A;  4HH2 A;  5J4E A;  1UGU A;  4Z1W A;  1OTI A;  3UB7 A;  3KSI A;  2H28 A;  3ZQ5 A;  3U2A A;  1NWZ A;  4FOF A;  2ZBB A;  4PHT A;  1P97 A;  2VV7 A;  3S7Q A;  3S7O A;  2VKS A;  2FH5 A;  4LPZ A;  2XRN A;  3LR5 A;  3EGD C;  4CQH A;  2Y79 A;  3BQA A;  1VB6 A;  1EW0 A;  1N9L A;  5HDC A;  4HHD A;  3O5Y A;  1D06 A;  3LR4 A;  3D3O A;  3LYX A;  1OJ5 A;  2XSS A;  1ODV A;  2A24 B;  2Z6D A;  4GCZ A;  2JKT I;  1XJ2 A;  4Q0H A;  4LLO B;  4I38 A;  1T19 A;  4I3A A;  3IBR A;  1YKD A;  5C5K A;  3HJI A;  3MQO A;  1VHM A;  4CLC C;  2HJ9 C;  1V9Z A;  3BWL A;  4MN6 A;  4Y5F A;  3C38 A;  2EA9 A;  1X0O A;  1TS0 A;  4M4X A;  3GDI A;  3MMH A;  5DF9 A;  4DJ3 A;  3T4T A;  5HPI A;  2QKP A;  3PXP A;  2BAS A;  1ZTU A;  2GNX A;  4ZRR A;  4MN7 A;  4HH3 A;  1STZ A;  4R70 A;  3PHY A;  3CAX A;  3RTY A;  2V0W A;  3H82 A;  2W1R A;  5KSH A;  2M1C A;  1OPX A;  2D01 A;  3NJA A;  4BBV A;  1W63 M;  4YWZ A;  5HWT A;  2W3H A;  2PR5 A;  4DMZ A;  4BWI A;  2P08 A;  3MFX A;  1XFQ A;  4UQI S;  2G7U A;  1XJ6 A;  3LI9 A;  3UB6 A;  1T18 A;  4F3L A;  5DKK A;  2CMN A;  4UEY A;  4HP4 A;  4GW9 A;  3OCN A;  4RQ9 A;  3MJQ A;  3ICY A;  4B93 A;  3KX0 X;  3OLO A;  4WEK A;  3NOU C;  1DP6 A;  4ARZ B;  1LSW A;  2W1T A;  2J3W A;  3BW6 A;  2LB5 A;  3D72 A;  4WUJ A;  1NRJ A;  2QYB A;  2DMW A;  2I9V A;  1TD5 A;  4CLC E;  4HI4 A;  3OC2 A;  4H6J B;  5J7E A;  2NUT C;  1S1Z A;  2ZOI A;  2M7V A;  1P9W A;  4HIA A;  3W2Z A;  4XT2 A;  3SW1 A;  3F1N A;  3PBN A;  2WKQ A;  4HOI A;  2ZMF A;  5HD3 A;  5DJT A;  3T50 A;  4Q0I A;  4EW7 A;  3S7N A;  3IBJ A;  1OJG A;  4GS9 B;  5AJG A;  4B9O A;  1S4R A;  5G4Z A;  2PD7 A;  4I39 A;  3P01 A;  3GEC A;  4G3K A;  2ZOH A;  3LIF A;  2XRO A;  4II7 A;  4Y3I A;  3UB8 A;  4WF0 A;  5HPF A;  4BMW A;  2J3T C;  2OAP 1;  3NOT C;  2QHK A;  2O99 A;  3TJZ C;  5F69 A;  4CLC B;  3C8C A;  4LRZ E;  1ZHH B;  3VOL A;  3BQ8 A;  2HV1 A;  1S4S A;  1UWN X;  2O0Y A;  2YKH A;  4FSF A;  3T4O A;  2KX6 A;  2VV8 A;  2JHE A;  1GSX A;  2QJ5 A;  4KUK A;  2JKR I;  4IUH A;  5DFY A;  2W3D A;  4MCW A;  4HNB A;  2NUP C;  2V1A A;  3LIB A;  4KQO A;  2W3G A;  2W0N A;  2A24 A;  1P0Z A;  3EOI A;  1KOU A;  3CIT A;  3C30 A;  3PR6 A;  1IFQ A;  4NKP A;  2VGL M;  3EEH A;  3PYP A;  3MQQ A;  2YKF A;  3TW8 A;  2GX5 A;  4NXG A;  3IS2 B;  3PBR A;  1XJ4 A;  2WKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...