3E0YA

The crystal structure of a conserved domain from a protein of geobacter sulfurreducens pca
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
164
structure length
155
Chain Sequence
b'HLEIISLEEISMLVSSDFDLPEVLQHVTAKVATQLKVSVCNIYLREGDEVVLAATHGFDPAFIGKIRIKIGDGITGSVARDGQYISLSRASQDPRYKYNSMLSFPIGDKKEVYGVINLNTTSIRSFHEDEIYFVSIIANLILTAIKLRQQVASSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved domain protein
publication title The crystal structure of a conserved domain from a protein of Geobacter sulfurreducens PCA
rcsb
source organism Geobacter sulfurreducens
molecule tags Structural genomics, unknown function
total genus 40
structure length 155
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3e0yA00
4Y3IA 1MC0A 2B18A 3R4KA 4ME4A 4YNRA 3VV4A 4LRZE 2VKSA 2W3GA 1ZTUA 4EU0A 3NOUC 3MMHA 4DMZA 4RQ9A 3CITA 1YKDA 2OOLA 4LRXC 4DN0A 3C2WA 2VZWA 4R6LA 5DFYA 2VJWA 2O99A 2O9CA 2KLIA 2Y79A 3MF0A 4O0PA 3KO6A 2Y8HA 4Y5FA 4IUHA 2W1TA 3NOPC 4FOFA 2W3DA 4IUKA 4O8GA 4EUVA 4ZRRA 3TRCA 2XSSA 3DBAA 4G3VA 3LFVA 5HL6A 3S7OA 2W1RA 4Q0IA 2KOIA 3W2ZA 4Q0JA 4GLQA 3RFBA 5L8MA 4ETZA 1YSPA 3E98A 4LRYC 4Q0HA 4MMNA 2O9AA 2M7VA 2W3EA 3O5YA 5AJGA 3S7NA 3D3OA 2O0YA 5HSQA 2QYBA 2W3FA 3S7QA 5HPFA 2W1TB 4E04A 2LB5A 2K31A 2VEAA 1STZA 5HPIA 3OOVA 5LBRA 3OBFA 3BJNA 2G7UA 2XROA 4CQHA 3CI6A 3KSHA 3ZQ5A 2XRNA 1YSQA 5DFXA 1F5MA 1MKMA 3G6OA 4MN7A 4ETXA 3NHQA 1VHMA 3IBJA 2K2NA 3KSFA 2LB9A 4QPRA 3EEAA 3S7PA 2O9BA 3NOTC 2GX5A 3IBRA 4Z1WA 3HCYA 2HGVA 4R70A 3MQ0A 4YOFA 4G3WA 4MCWA 1TF1A 2W3HA 2M7UA 5TJJA 4GW9A 2IA2A 4PAUA 5I5LA 4Y2FA 4O01A 3KSIA 3KSGA 5K5BA 3E0YA 4MDZA 4IJGA 1TD5A 3K2NA 4BWIA 4G3KA 2ZMFA 5C5KA
chains in the Genus database with same CATH superfamily
3GV9A 3S1YA 2VX8A 2VKSA 5EVIB 3ZNTA 1ZTUA 3Q7VA 5FEGA 5FAPA 4RQ9A 4E3OA 3CWFA 1YT4A 4E3IA 4HBTA 1YLPA 3MF0A 4LENA 3TSGA 5DF7A 2J80A 4BENA 4Y15A 4HH3A 1H5XA 1L0FA 3DWKA 3T1XA 4ARZA 4I38A 5FQ9A 1LSVA 5HDDA 3RFBA 1XKZA 4FH2A 3OPPA 4KG6A 2JKTM 3HUNA 4GHIB 2J3TD 3OCNA 2W3EA 1E3UA 2O0YA 2W3FA 1NWZA 3R7WA 3GDIA 4WZ5C 4KZBA 1NLYA 1ESIA 3ZNYA 5CHUA 3PAGA 4S2KA 2ZQ9A 3JYIA 3KSHA 3ZG7B 2GJ3A 5EE8A 3MZEA 5I94A 4II7A 2XGNA 4HY8A 2V8CA 2WAFA 4BBTA 3NOTC 3IBRA 1PIOA 3QP8A 4KQDA 5FQKA 1NY0A 5HD3A 4MBFA 2A2LA 4WUJA 3BEBA 3OPLA 4RX2A 3H7WB 4F3LB 3ZVTA 2VGKA 4NETA 5HAQA 2PHYA 1YMSA 3ZVWA 3T1QB 4XT2B 2Z6DA 4NK3A 4GCZA 3G2ZA 4E3NA 2OAQ1 2V1AA 2PU4A 2DRWA 4QD4A 4UA7A 3CITA 4JLFA 3G31A 2P9VA 4WYYA 3UMDA 4NXFA 1KE4A 1K38A 3G32A 4GN2A 1SDEA 5DKLA 4S2PA 5A90A 3LFVA 4K08A 4KQRA 3T4OA 1SKOA 3IXDA 5L8MA 3BYDA 4PKYG 3IF6A 3HLGA 1PFLA 4MN5A 3O5YA 3SS4A 3D3OA 1CI8A 3HBRA 4BQMA 1XFNA 1GSWA 2LB5A 2YKFA 2VGJA 1S1YA 1IYOA 3LGOA 1JTGA 3UB6A 2DNSA 1YPRA 3ZQ5A 3T4TA 2H0TA 4OOLA 1W63M 3IH9A 3EQUA 4S2LA 1OT6A 1LL5A 4EBPA 1V9YA 4PM7A 1TDLA 5GLCA 4R70A 3NBLA 1KVLA 4QJGA 3MBZA 5M19A 4GW9A 5FQQA 3KSGA 3RTYA 4B4ZA 3VP3A 3T4JA 1XGJA 5E2EA 3IXBA 1L0GA 3VV4A 4UQIS 3ZG0A 2EA9A 1ES2A 4MEZA 3LEQA 4OQ0A 4DJ3A 2EWVA 4JXGA 4I3AA 3PBRA 5EFWA 2XK1A 5DFYA 2VGLS 3C38A 4DDSA 1W79A 4WF0A 3GRJA 4XUXA 2V0WA 4JGQA 4BL3A 4EUVA 1GCEA 4EQIA 2ZLYA 4S2MA 3L9KA 3L7HA 2W1RA 2KOIA 1GHMA 1K54C 3KYEA 4BLMA 4EQ1A 3PYPA 2VV6A 2GNXA 3UO9A 5F68A 3B42A 5HPFA 1NRFA 3FPWA 1BLPA 1C3BA 3OC2A 3T1SA 3NIAA 4M3KA 5LBRA 2IWDA 1GA0A 2R9WA 4GJ4A 4DDYA 3DAVA 4I39A 1CEFA 5DFXA 4JGPA 4PKYA 2VA0A 3D9YA 5EM1A 2JKGA 4MBKA 4QPRA 4DKIA 2WKPA 3ISGA 3H82B 5F1FA 4JF5A 3AGFA 3SH9A 1ONGA 2A24B 4IHQA 2XDMA 3T4QA 1Q2QA 4U0XA 1UWNX 5F6AA 3HJKA 4BWIA 2WAEA 2ZMFA 5E2FA 2Y91A 1I2WA 3R4KA 3A0RA 4OVDA 4HP4A 4Y0TA 2JKTI 4QU3A 4LLOB 1G68A 3IX8A 4P85A 2ZQCA 3IXHA 4ESPA 5FQIA 4DMZA 1TS0A 2ZQ8A 2KDKA 4QHCA 3BLSA 3LEZA 3F1OA 4FCFA 5A93A 1T18A 2QZ6A 2PDRA 2HDRA 3V5MA 2ZOIA 3HLBA 3CZDA 4IUKA 1CI9A 5EOEA 5CX7A 3PR6A 2XSSA 1HTZA 3N8LA 3Q7VB 3MXQA 3TE8A 1FCMA 5MC7A 3RXXA 3UB5P 1X0OA 3UDFA 4Y0UA 5HSQA 3FKVA 2FH5A 3JVUA 4Y17A 1STZA 3E4QA 1OTEA 4ARZB 1JVJA 5CXWA 4GDBA 5F69A 2EXBA 1K0KA 4XUZA 1PZOA 2Y2PA 1VHMA 3R7WB 4QB8A 2OWHA 2HP9A 1BTLA 2LB9A 4FSFA 3PBQA 3S7PA 3ZGAB 4WM9A 1OJGA 4GD8A 3ZG5A 2ZM8A 5L2FA 3MQ0A 4YOFA 5L07A 2V20A 4MCWA 4ID4A 3LICA 1YLZA 2VV8A 1BUEA 1TS7A 3BFFA 1Q2PA 4OLGA 5FATA 1QMEA 3C30A 3IF6C 2H0YA 5FASA 1GSXA 1RGYA 1PI5A 2MJ6A 4OP8A 3UE0A 1XFQA 3PTEA 4P6ZM 4BBUA 2Q9MA 3MKFA 2VK3A 1TS8A 4H6JA 3NI9A 3IXGA 3EGDC 3UNWA 2WADA 5EVID 4UA6A 2W0NA 5DVAA 5GLDA 5M1AA 5GHXA 1FOFA 1DY6A 2P9VB 5KZHA 5D3OA 4E3LA 3BFCA 1PWCA 1PW8A 2L4RA 2QJ5A 4NEED 3UDXA 2Y2HA 1BLCA 4MNRA 5DJUA 3SZTA 4L0LA 2XF3A 1XJ6A 2PRFA 3P01A 1OPXA 3LUQA 4R4RA 5EOOA 4KG2A 3EOIA 4EBNA 2HF6A 4P0MA 5CTMA 3BJNA 1SKOB 2I72A 3IF6B 3MSHA 3P98A 3MXRA 4LV3A 1KE0A 4I3JA 4X6TA 2XQZA 3MFDA 1T1BA 1PI4A 4HNBA 5DF9A 1KE3A 5HWWA 2GX5A 5GLAA 5DJTA 4DF6A 1ZHHB 3BFEA 5DTKA 3VFHA 3KYQA 2KX6A 4KQOA 3VE3A 4OPZA 5CRFA 3IWQA 2E8IA 2WYXA 1S67L 4L9EA 3K2NA 1XA1A 1VETB 4ZAMA 1PWDA 3RH8B 3A0VA 2RCXA 2WK0A 3NOUC 4H8RA 4KG5A 4N92A 1H0MA 3FPVA 3W4OA 3V50A 4RYEA 1DJCA 2WZZA 1ALQA 2Y2NA 4EERA 4DJ2A 4R0QA 2Y2QA 1OTAA 2W3DA 3CAXA 3HL9A 4CLCA 1MWTA 4WL9A 2QPNA 1K56A 4KZ5A 5TBMA 3E2KA 2BTFP 3BECA 5HWTA 4LPZA 3P7NA 1DJAA 3IHAA 4C6YA 3FWLA 1DP6A 3VOLA 2JN7A 4OPYA 1ERMA 2XROA 1H3QA 4BMWA 3QHYA 5HAPA 2WGWA 3B3XA 2FFYA 2DMWA 4OQIA 1T19A 1OMEA 1YQSA 3FYZA 4WMCA 3HJIA 2ZC5B 3VFFA 2G2WA 1LSWA 1HLUP 1XGIA 4HP9A 2HZ5A 5FDSA 4Z1WA 5HW3A 2QHKA 4DE1A 4U3TA 2ZM0A 4G3WA 4EWFA 3TOIA 5TJJA 4KZ3A 4X68A 1D06A 3N8SA 4HESA 4PMAA 1O7EA 5F82A 2V0UA 4KZ7A 3QNBA 3HUMA 4DE0A 3BW6A 4CJNA 4N9LA 2B18A 3CJMA 3Q7ZA 4GDNA 3C8CA 1BSGA 4KZAA 1K4FA 1CK3A 4GB7A 3GECA 2L1MA 4IVKA 4PHTA 3HVFA 4LV1A 3VP1A 3LYXA 4ZDXA 3ZHHA 3M2JA 3KO6A 4R23A 3LY3A 3Q81A 4S2OA 4RX3A 2Y2MA 3G4PA 4OH0A 1Y54A 1XJ3A 4LCLA 3HREA 4GLQA 5FQJA 1BLHA 4JPMA 1QMFA 4LRYC 4KZ4A 4D60A 3F1OB 1SZVA 4X55A 4MBHA 5HDSA 1VM1A 3TJZC 5AQBA 4AFIA 5GL9A 4S2IA 3P09A 5JYPA 5AQAA 1P9WA 4CQHA 4KZ6A 3NECA 4EXOA 3HLDA 5TFQA 5TGFA 4N9KA 1OTDA 4P87A 1J9MA 2EFXA 3IS2B 4DRTA 1GHPA 3ZFZA 5CGWA 3CLOA 2ZBBA 4PAUA 5I5LA 2Z2LB 2ZD8A 4U0TA 3V67A 1K6SA 4JGRA 4BD1A 1Y28A 1VETA 4A5RA 1MPLA 4E6WA 4HI4A 1FIKA 2J8YA 3SH8A 1RGZA 3Q1FA 5J7EA 3LIEA 4DN0A 1W8QA 2JE5A 5GHYA 3LR5A 4O0PA 3LIFA 3A3IA 4IVIA 1NLZA 1ODVA 4JXVA 2QKPA 1KOUA 3V3RA 4GZBA 3Q82A 1FR1A 1TEMA 3G35A 4OQHA 4ETZA 3E98A 5A8BA 1XXMA 2ACGA 3QP4A 4KENB 4H6JB 3Q07A 4MN6A 5AJGA 4OLDA 3QNCA 5FI2A 1W5DA 2QYBA 3UB9A 4B9OA 3PBTA 3HLEA 5HX9A 5A92A 4HOIA 3K3CA 3UMEA 1H8ZA 3QP2A 2V2FF 5FSRA 2XLNA 1A0KA 2V1BA 4OP5A 1L3LA 3KX0X 1DP9A 2AVXA 2QMIA 3QP1A 3LI8A 2K7SA 5IS1A 3HLFA 3B47A 1Y4OA 3OZHA 5KIZA 2HDUA 1N9OA 2HJEA 1E3UD 4R3BA 2J9OA 3F1NB 3IX4A 1WA9A 2IA2A 1J3WA 2C5WB 3DTIA 2D02A 3E4PA 3LI9A 4YWZA 4CLCC 3KSIA 1ONHA 3E0YA 3FG8A 4MDZA 3IT9A 5DKKA 2J3WA 2ZMVA 5L09A 2PR6A 4YNRA 3E2LA 4QY5A 4JXSA 1DRMA 4GOGA 3D72A 4C3QA 4HH2A 4LRXC 3SS3A 5DTTA 2O9CA 4NXGA 4XXRA 2B95A 3UE1A 1LLBA 2WUQA 1LSXA 1D7EA 3NOPC 4FOFA 3TG9A 2PBDP 1G6OA 3TRCA 1YLJA 3JPUA 2Q0OA 4CPKA 2ZC6B 3B33A 2IWCA 1FR6A 2O9AA 4B88A 3ZYTA 2ZOHA 1EW0A 2JKRM 2ZC3B 5FA7A 2J7VA 5CGXA 2WKRA 5J3WA 1LL8A 1NRJA 1EI5A 2CC1A 3SW1A 4CLCB 1NYYA 2RL3A 2ZC4B 3OBFA 1OT9A 1JWZA 5L10A 5TBMB 1JTDA 1LI9A 2G7UA 4O7DA 4I3IA 4NKPA 3V3SA 5FAOA 5J4EA 3T12B 2Y2KA 3MQQA 5AQ9A 4WBGA 1TDGA 3IBJA 1IOUA 5F5YA 4PM9A 4ZJ3A 4DXBA 3IS2A 3CMZA 1WYBA 2M1CA 3MKEA 4ZJ2A 3KYZA 2HGVA 2Z6CA 3C5AA 2PU2A 2VLGA 2WGWB 3PBNA 5IHVA 3RJUA 5HD5A 3ULFA 1ERQA 3NC8A 1GHIA 1M40A 1NZOA 4ME4A 1IKGA 2EX9A 3A3FA 2R78A 4UEYA 1VB6A 1FCNA 4EU0A 1LHYA 1T1CA 2EX2A 4K0XA 4R6LA 1BLSA 4JBFA 1K6RA 1MXOA 3EQVA 2VV7A 1H8MA 2J9PA 2W1TA 3BRMA 3DBAA 5HL6A 4UQIM 2INWA 2JHEA 3G30A 3F1PA 1AWIA 3ICYA 1M6KA 5CHJA 2M7VA 5GHZA 2P08A 3VE4A 1LL9A 1DP8A 2WKHA 3WS2A 4LGWA 3UB7A 4EESA 4WELA 4OPRA 1MWSA 3LIBA 1KVMA 4KZ9A 3MFXA 3WRTA 4OOMA 5DTSA 3BQAA 3AGEA 3O3VA 1U60A 4GKUA 3U4LP 4LV0A 5G4ZA 1L0EA 4ZJ1A 1F2KA 2PAVP 2XFTA 3HCYA 2ZM2A 1PNEA 4E3JA 3GVBA 3F1NA 1YLTA 3GSGA 4PPRA 4EW7A 3WS5A 3C7VA 3FV7A 4O01A 4KZ8A 5K5BA 4FD8A 1EROA 3ITAA 4UA9A 1MZUA 1I5QA 3MQOA 2W3GA 3VOYA 3MMHA 4YFMA 3MXSA 1YKDA 2OOLA 1PWGA 3DW0A 1S1ZA 1N9NA 3QP5A 1KGGA 2VZWA 5HZHA 4BBVA 1MWUA 5HL1A 3U2AA 3ZG9B 1CEGA 4GS9B 3M6BA 2Y2LA 1H8YA 3VOZA 2B5RA 1PW1A 1JWPA 3OPHA 1TVFA 5FI6A 4HJ3A 3S7NA 5EECA 3CHWP 4WZ4A 3T4KA 4E04A 1OTBA 2WZXA 2HP5A 3JVVA 1TS6A 5CHMA 4HHDA 3VMAA 5FQMA 4RA7A 2IWBA 3UB8A 5KSHA 2XRNA 4PM6A 4IBRA 5BOHA 2A3UA 3MZFA 5HWVA 3UPPA 1XJ2A 1KDSA 4LCMA 2PT7A 1SCWA 3C4OA 3D4FA 4JKTA 4WEJA 4FTXA 1L2SA 3IQAA 2EX6A 1SHVA 1D1JA 2V8FA 1YMXA 3OCLA 3W8KA 4GNUA 1W7FA 2E8JA 5C5KA 4E3KA 3CG5A 1VEUA 4K0WA 4EETB 1FSWA 1YAXA 1G5UA 1DJBA 1RCJA 1IEMA 4X56A 4X69A 2JKFA 5CECA 2JKRI 2BG1A 2YKHA 2WGIA 3IWOA 2NUPC 3SS5A 2PBYA 2XH9A 2VJWA 5CTNA 4HIAA 3BWLA 3LIAA 4Y5FA 5AVFA 2H28A 3T1RA 4I5SA 5EVEA 4O8GA 3A3EA 2Y55A 5E43A 3LR4A 3K3DA 4LFUA 2OAP1 4OPQA 1YSPA 3NDEA 4R1GA 3WWXA 3WS0A 4S2JA 1K4EA 3DTEA 1S4SA 3UE6A 5FEFA 1CQAA 3WRZA 4N1XA 3FZCA 5CEBA 1MKIA 3C7UA 5HDCA 1JNUA 1FQGA 1E25A 3W4QA 3HUOA 4E6XA 1S66L 5E2HA 3SH7A 1ES4A 2J3TC 1YSQA 3G6OA 1NZUA 3BY9A 1YLWA 5F1GA 4ETXA 2OSUA 3KSFA 3UE3A 5KSCA 1F9IA 3IX3A 4HJ6A 4DE3A 2P7JA 3VSLA 1ESUA 4Z9QA 2FFFB 2ZJ9A 4HBUA 3O86A 2X71A 2ZL1A 3MS6A 2W3HA 3UY6A 3IH8A 3WS4A 2EXAA 1N9BA 1P9RA 1W8YA 2B02A 5EVLA 4G3KA 4Q8IA 4NXEA 3N6IA 4PM8A 4R3JA 4Y3IA 1MC0A 1G6AA 2BLSA 1V9ZA 1BYWA 4DXCA 4LRZE 1BZAA 3I7JA 4EBLA 2XFSA 1ES5A 4LV2A 4R38A 2I9VA 2Z2MB 1HVBA 3HLWA 3DTMA 3V39A 3T4LA 3A3JA 3C2WA 3N8RA 2JCHA 4OOYA 1PYYA 3BQ8A 3NULA 2Y8HA 4ZRRA 3S4XA 3CUEA 3EGXC 4GS9A 1OJ5A 1ZG4A 4Q0IA 2GZAA 3UPOA 2CMNA 5EPHA 2HPBA 1BULA 1SKFA 2H5SA 1Z09A 5FDHA 2W1TB 2XA7M 2X01A 4QWOA 3IHBA 1NJ4A 3NJAA 3PBOA 3F1PB 3ZCZA 4JF4A 3CI6A 4BL2A 4UAAA 1KGFA 3G2YA 3EEHA 2PYRA 4HQAA 1K57A 3AGDA 3NHQA 4CLCD 3VP4A 2K2NA 4EEPA 5F83A 1K56D 2JBFA 2A49A 3IF5A 2XR0A 2OWJA 3UDIA 3G34A 4WN5A 2Y4AA 3ZDJA 2ZQAA 5EVIA 1ES3A 2WKQA 4P6ZS 5AQ7A 2WGVA 1TF1A 2P04A 2H10A 3N7WA 4Y2FA 1N9LA 3UN7A 3O88A 3GR2A 5FAQA 2Q9NA 3LY4A 4FUWA 3M6HA 2QWSA 4Y0OA 4X1LA 3VP2A 4S2NA 3S22A 4Y13A 1UWPX 5E2GA 4MLLA 2UWXA 1K55A 4WMCD 5EUAA 1S4RA 4GHIA 2O99A 4GD6A 2Y79A 4EEUA 3BFDA 4HEFA 4IUHA 3CPTB 4IEDA 1ZKJA 4G3VA 2W27A 1ZG6A 3W2ZA 1MY8A 3PBSA 4L9GA 2P74A 1AXBA 3BFGA 1VQQA 3C4PA 3VP0A 1CJFA 4M4XA 1P97A 3GQZA 5CEDA 1P0ZA 3ITBA 2WKIA 4DE2A 3PAEA 1IKIA 2XD1A 1XPBA 2K31A 2VEAA 5HPIA 3NCKA 2HP6A 1CF0A 2BASA 4PM5A 3UPNA 2UV0E 3M2KA 2R9XA 1I2SA 2EFUA 3MJQA 3LIDA 1NXYA 4MN7A 3H7WA 4F3LA 1XA7A 3A0SA 3QP6A 5IT5A 5G4YA 4XT2A 3WS1A 2O9BA 1GA9A 2V9AA 2NUTC 5U47A 4UHUA 1MWRA 4X25A 2M7UA 4WZ5A 1W63Q 1K25A 3TW8A 1ZC2A 5KMWA 3GMWA 4JGOA 4IJGA 1TD5A 3BY8A 4EUZA 1IYQA 5CGSA 5M18A 2V1ZA 1IELA 3VSKA 1T1AA 1IFQA 4ZBEA 1IYSA 2HV1A 1XP4A 2ZC7A 5GLBA 3PXPA 4JF6A 1N4OA 2KLIA 2EWWA 5FI7A 2Y2JA 4R3AA 1VEUB 1FILA 2G2UA 3T50A 3EWKA 2C6WB 4QY6A 2QJ7A 2OV5A 1Z6FA 3H9WA 4Q0JA 1GSVA 3GTCA 1WYCA 3A3DA 2WKEA 2DCFA 4Q0HA 4MMNA 1HD8A 3PHYA 4BD0A 4BJPA 3BLMA 2HDSA 1G28A 5HARA 1JWVA 2PD8A 2ZQDA 5TR7A 3DTKA 4JXWA 3N4IA 5J8XA 2PYPA 3OOVA 4OKPA 3MZDA 5HFOA 4RVAA 2JC7A 4K91A 1F5MA 3MR0A 3LCEA 3SOIA 4FH4A 5G18A 1FSYA 2VGLM 2X02A 4E3MA 2PD7A 3EEAA 2Y59A 1YLYA 2Y2GA 2ZMAA 1S0WA 4OONA 1O07A 2L0WA 4X53A 1XJ4A 1KDWA 4P6BA 5IU1A 1L0DA 2OLVA 4KUOA 3CUEC 1LT0A 5JYOA 3FKWA 1PRQA 1E4DA 2OLUA 4R4SA 1HZOA 2EX8A 2GDNA 1ACFA 4EV4A 1SDNA 4KUKA 3T4SA 2ZL1B 3LR3A 3LO7A 4Y7PA 2XEPA 2HDQA 4B93A 2XD5A 1EWZA 1S6RA 2ZQ7A 2Y2IA 3HLCA 3ZG8B 5EM0A 1MBLA 3LR0A 3NDGA 4ZTKA 3CPTA 1IYPA 3S7OA 4D2OA 1LI0A 1K57C 4B4XA 4C75A 4IBXA 3OPRA 5CERA 3DWZA 4X1MA 3FC7A 1PZPA 2FZ0A 3RXWA 1YM1A 3O87A 4N1HA 3BM6A 4KQQA 4NXBA 5EVIC 3S7QA 2Y2OA 4L9FA 2PR5A 1KGEA 3H82A 3E4OA 5DF8A 4YINA 3W4PA 4CLCE 5EV0A 3NY4A 1BT5A 1MKMA 2A24A 1RP5A 4OQGA 1UGUA 4S2NC 1K54A 3OLOA 1XX2A 4F94A 1K55C 2D01A 4NG2A 2HJ9C 1WE4A 4WLAA 4HJ4A 5A91A 5FL3A 3IWIA 1F98A 1OTIA 2XA7S 5HAIA 1FCOA 1NYMA 4WEKA 5AVEA
chains in the Genus database with same CATH topology
2ZMVA 2PR6A 4Y3IA 3C30A 1MC0A 4YNRA 1V9ZA 1BYWA 2VX8A 4LRZE 1GSXA 1DRMA 2VKSA 1ZTUA 2MJ6A 4R38A 2I9VA 3D72A 1XFQA 4RQ9A 4P6ZM 4HH2A 3CWFA 4LRXC 3T4LA 4BBUA 3C2WA 1TS8A 4H6JA 3BQ8A 2O9CA 4NXGA 3MF0A 3EGDC 2Y8HA 1LSXA 2J80A 1D7EA 3NOPC 4FOFA 2W0NA 1G6OA 4ZRRA 3TRCA 3CUEA 3EGXC 4GS9A 1OJ5A 4HH3A 4Q0IA 4ARZA 2GZAA 4I38A 3B33A 1LSVA 5HDDA 2CMNA 3RFBA 2O9AA 2JKTM 4GHIB 3ZYTA 2J3TD 3OCNA 2W3EA 2ZOHA 1EW0A 2O0YA 2JKRM 2L4RA 2QJ5A 2W3FA 1NWZA 4NEED 3R7WA 5DJUA 2W1TB 2XA7M 2WKRA 5J3WA 1LL8A 1NRJA 3GDIA 4L0LA 3SW1A 4CLCB 1XJ6A 1NLYA 3NJAA 3P01A 1OPXA 3LUQA 3PBOA 3F1PB 3EOIA 3OBFA 1OT9A 2HF6A 3BJNA 5TBMB 2G7UA 4I3IA 4NKPA 3CI6A 3KSHA 2GJ3A 5J4EA 3MQQA 3EEHA 4I3JA 2PYRA 4HQAA 3NHQA 4CLCD 4II7A 3IBJA 2K2NA 1IOUA 4EEPA 5F5YA 1T1BA 4HY8A 4HNBA 2OWJA 5DF9A 3IS2A 5HWWA 2M1CA 3NOTC 4BBTA 2GX5A 3IBRA 4WN5A 5DJTA 1ZHHB 3KYZA 2HGVA 4KQDA 2Z6CA 2WKQA 4P6ZS 2VLGA 5HD3A 1TF1A 3KYQA 2A2LA 4WUJA 2KX6A 4KQOA 3PBNA 3VE3A 2P04A 4Y2FA 3H7WB 1N9LA 4F3LB 5HD5A 1S67L 4L9EA 3ULFA 3K2NA 2PHYA 4XT2B 2QWSA 4ME4A 2Z6DA 3RH8B 4GCZA 2R78A 3A0VA 4UEYA 2OAQ1 2V1AA 1VB6A 4EU0A 3NOUC 1T1CA 1UWPX 3CITA 3FPVA 3UMDA 4R6LA 1S4RA 4NXFA 4GHIA 2O99A 2Y79A 4EEUA 3EQVA 2VV7A 4EERA 4DJ2A 1H8MA 4IUHA 2W1TA 1OTAA 5DKLA 2W3DA 3CAXA 4CLCA 4G3VA 3DBAA 3LFVA 2W27A 4WL9A 5HL6A 4UQIM 2INWA 3W2ZA 4K08A 2JHEA 3F1PA 3PBSA 4L9GA 3T4OA 5L8MA 5TBMA 3ICYA 4PKYG 2M7VA 5HWTA 4LPZA 2P08A 4MN5A 3P7NA 3VE4A 3O5YA 1DP8A 4M4XA 1P97A 3D3OA 1P0ZA 3UB7A 1XFNA 1GSWA 2LB5A 2K31A 2VEAA 1DP6A 5HPIA 4EESA 4WELA 2YKFA 3VOLA 2JN7A 1S1YA 2BASA 3LIBA 2XROA 3UB6A 1H3QA 4BMWA 3ZQ5A 3MFXA 3T4TA 4OOMA 3MJQA 3LIDA 4OOLA 3BQAA 2DMWA 1W63M 1T19A 4MN7A 3H7WA 4F3LA 3EQUA 1OT6A 3A0SA 3HJIA 5G4ZA 5IT5A 5G4YA 4XT2A 1V9YA 1LSWA 2O9BA 4HP9A 2V9AA 3HCYA 4Z1WA 2NUTC 2QHKA 4R70A 4G3WA 2M7UA 5TJJA 4GW9A 1W63Q 3F1NA 4EW7A 3TW8A 1D06A 4JGOA 4O01A 3KSGA 3RTYA 5K5BA 4IJGA 1TD5A 2V0UA 3BY8A 3T4JA 3BW6A 1MZUA 2B18A 3MQOA 3VV4A 4UQIS 3C8CA 1T1AA 2EA9A 2W3GA 1IFQA 3MMHA 4DJ3A 3GECA 2L1MA 2EWVA 1YKDA 2HV1A 2OOLA 4PHTA 1S1ZA 1N9NA 3LYXA 3PBRA 4I3AA 2VZWA 3PXPA 5EFWA 5DFYA 5HZHA 2VGLS 3C38A 2KLIA 4BBVA 2EWWA 3U2AA 3KO6A 4WF0A 4R3AA 2V0WA 4JGQA 4GS9B 3T50A 3EWKA 4EUVA 2QJ7A 2W1RA 2KOIA 1XJ3A 3H9WA 4Q0JA 4GLQA 1GSVA 4EQ1A 4LRYC 4Q0HA 3F1OB 3PYPA 2VV6A 4MMNA 2GNXA 3PHYA 4HJ3A 4BJPA 5HDSA 3S7NA 3TJZC 4AFIA 5F68A 1G28A 3B42A 2PD8A 5HPFA 3FPWA 3OC2A 3T4KA 4E04A 1OTBA 2PYPA 3OOVA 5LBRA 3JVVA 1P9WA 1TS6A 4HHDA 4GJ4A 4I39A 3UB8A 4CQHA 5KSHA 2XRNA 4EXOA 5DFXA 1F5MA 3MR0A 4JGPA 4PKYA 1OTDA 2VA0A 5HWVA 2VGLM 2PD7A 3IS2B 4QPRA 3EEAA 2WKPA 1XJ2A 2PT7A 3H82B 2L0WA 4WEJA 1XJ4A 5IU1A 3CLOA 2ZBBA 2A24B 4IHQA 4PAUA 4KUOA 5I5LA 3CUEC 3T4QA 1LT0A 3OCLA 1UWNX 5F6AA 3V67A 3HJKA 4JGRA 4BWIA 2ZMFA 5C5KA 1Y28A 3R4KA 4EETB 3A0RA 1YAXA 4HP4A 4HI4A 2JKTI 4LLOB 4KUKA 3T4SA 2JKRI 3LR3A 4DMZA 5J7EA 1TS0A 2YKHA 4B93A 2KDKA 3LIEA 2NUPC 4DN0A 3F1OA 1T18A 2VJWA 2PDRA 3LR5A 4O0PA 2ZOIA 4HIAA 3LIFA 3BWLA 3LR0A 3LIAA 4Y5FA 5AVFA 2H28A 1NLZA 4I5SA 1ODVA 4IUKA 4O8GA 2QKPA 5CX7A 3PR6A 1KOUA 3LR4A 2XSSA 3K3DA 3S7OA 2OAP1 3MXQA 3TE8A 4ETZA 1YSPA 3E98A 3FC7A 5A8BA 5MC7A 2FZ0A 4H6JB 1X0OA 4MN6A 5AJGA 3UE6A 1S4SA 5HSQA 2QYBA 3UB9A 4NXBA 3S7QA 4B9OA 3PBTA 2FH5A 3JVUA 4L9FA 4HOIA 5HDCA 1JNUA 2PR5A 1STZA 3E4QA 1OTEA 3K3CA 3UMEA 4ARZB 3H82A 3E4OA 4CLCE 5F69A 1S66L 2V1BA 2J3TC 1YSQA 1MKMA 3G6OA 2A24A 3BY9A 1UGUA 4ETXA 3KX0X 1DP9A 1VHMA 3R7WB 2OWHA 3KSFA 3UE3A 2LB9A 3LI8A 1F9IA 2K7SA 5IS1A 3OLOA 4FSFA 4HJ6A 3B47A 3PBQA 3S7PA 2P7JA 1OJGA 2D01A 5KIZA 2HJ9C 3MQ0A 4YOFA 1N9OA 2HJEA 4MCWA 4WLAA 3F1NB 2W3HA 3LICA 4HJ4A 1WA9A 2IA2A 2VV8A 3E4PA 1TS7A 2D02A 3LI9A 5FL3A 4YWZA 4CLCC 1F98A 3KSIA 1P9RA 3E0YA 3FG8A 4MDZA 1OTIA 2B02A 2XA7S 5DKKA 4WEKA 2J3WA 4G3KA 5AVEA 4NXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y3I A;  1MC0 A;  2B18 A;  3R4K A;  4ME4 A;  4YNR A;  3VV4 A;  4LRZ E;  2VKS A;  2W3G A;  1ZTU A;  4EU0 A;  3NOU C;  3MMH A;  4DMZ A;  4RQ9 A;  3CIT A;  1YKD A;  2OOL A;  4LRX C;  4DN0 A;  3C2W A;  2VZW A;  4R6L A;  5DFY A;  2VJW A;  2O99 A;  2O9C A;  2KLI A;  2Y79 A;  3MF0 A;  4O0P A;  3KO6 A;  2Y8H A;  4Y5F A;  4IUH A;  2W1T A;  3NOP C;  4FOF A;  2W3D A;  4IUK A;  4O8G A;  4EUV A;  4ZRR A;  3TRC A;  2XSS A;  3DBA A;  4G3V A;  3LFV A;  5HL6 A;  3S7O A;  2W1R A;  4Q0I A;  2KOI A;  3W2Z A;  4Q0J A;  4GLQ A;  3RFB A;  5L8M A;  4ETZ A;  1YSP A;  3E98 A;  4LRY C;  4Q0H A;  4MMN A;  2O9A A;  2M7V A;  2W3E A;  3O5Y A;  5AJG A;  3S7N A;  3D3O A;  2O0Y A;  5HSQ A;  2QYB A;  2W3F A;  3S7Q A;  5HPF A;  2W1T B;  4E04 A;  2LB5 A;  2K31 A;  2VEA A;  1STZ A;  5HPI A;  3OOV A;  5LBR A;  3OBF A;  3BJN A;  2G7U A;  2XRO A;  4CQH A;  3CI6 A;  3KSH A;  3ZQ5 A;  2XRN A;  1YSQ A;  5DFX A;  1F5M A;  1MKM A;  3G6O A;  4MN7 A;  4ETX A;  3NHQ A;  1VHM A;  3IBJ A;  2K2N A;  3KSF A;  2LB9 A;  4QPR A;  3EEA A;  3S7P A;  2O9B A;  3NOT C;  2GX5 A;  3IBR A;  4Z1W A;  3HCY A;  2HGV A;  4R70 A;  3MQ0 A;  4YOF A;  4G3W A;  4MCW A;  1TF1 A;  2W3H A;  2M7U A;  5TJJ A;  4GW9 A;  2IA2 A;  4PAU A;  5I5L A;  4Y2F A;  4O01 A;  3KSI A;  3KSG A;  5K5B A;  3E0Y A;  4MDZ A;  4IJG A;  1TD5 A;  3K2N A;  4BWI A;  4G3K A;  2ZMF A;  5C5K A; 
#chains in the Genus database with same CATH topology
 3GV9 A;  3S1Y A;  2VX8 A;  2VKS A;  5EVI B;  3ZNT A;  1ZTU A;  3Q7V A;  5FEG A;  5FAP A;  4RQ9 A;  4E3O A;  3CWF A;  1YT4 A;  4E3I A;  4HBT A;  1YLP A;  3MF0 A;  4LEN A;  3TSG A;  5DF7 A;  2J80 A;  4BEN A;  4Y15 A;  4HH3 A;  1H5X A;  1L0F A;  3DWK A;  3T1X A;  4ARZ A;  4I38 A;  5FQ9 A;  1LSV A;  5HDD A;  3RFB A;  1XKZ A;  4FH2 A;  3OPP A;  4KG6 A;  2JKT M;  3HUN A;  4GHI B;  2J3T D;  3OCN A;  2W3E A;  1E3U A;  2O0Y A;  2W3F A;  1NWZ A;  3R7W A;  3GDI A;  4WZ5 C;  4KZB A;  1NLY A;  1ESI A;  3ZNY A;  5CHU A;  3PAG A;  4S2K A;  2ZQ9 A;  3JYI A;  3KSH A;  3ZG7 B;  2GJ3 A;  5EE8 A;  3MZE A;  5I94 A;  4II7 A;  2XGN A;  4HY8 A;  2V8C A;  2WAF A;  4BBT A;  3NOT C;  3IBR A;  1PIO A;  3QP8 A;  4KQD A;  5FQK A;  1NY0 A;  5HD3 A;  4MBF A;  2A2L A;  4WUJ A;  3BEB A;  3OPL A;  4RX2 A;  3H7W B;  4F3L B;  3ZVT A;  2VGK A;  4NET A;  5HAQ A;  2PHY A;  1YMS A;  3ZVW A;  3T1Q B;  4XT2 B;  2Z6D A;  4NK3 A;  4GCZ A;  3G2Z A;  4E3N A;  2OAQ 1;  2V1A A;  2PU4 A;  2DRW A;  4QD4 A;  4UA7 A;  3CIT A;  4JLF A;  3G31 A;  2P9V A;  4WYY A;  3UMD A;  4NXF A;  1KE4 A;  1K38 A;  3G32 A;  4GN2 A;  1SDE A;  5DKL A;  4S2P A;  5A90 A;  3LFV A;  4K08 A;  4KQR A;  3T4O A;  1SKO A;  3IXD A;  5L8M A;  3BYD A;  4PKY G;  3IF6 A;  3HLG A;  1PFL A;  4MN5 A;  3O5Y A;  3SS4 A;  3D3O A;  1CI8 A;  3HBR A;  4BQM A;  1XFN A;  1GSW A;  2LB5 A;  2YKF A;  2VGJ A;  1S1Y A;  1IYO A;  3LGO A;  1JTG A;  3UB6 A;  2DNS A;  1YPR A;  3ZQ5 A;  3T4T A;  2H0T A;  4OOL A;  1W63 M;  3IH9 A;  3EQU A;  4S2L A;  1OT6 A;  1LL5 A;  4EBP A;  1V9Y A;  4PM7 A;  1TDL A;  5GLC A;  4R70 A;  3NBL A;  1KVL A;  4QJG A;  3MBZ A;  5M19 A;  4GW9 A;  5FQQ A;  3KSG A;  3RTY A;  4B4Z A;  3VP3 A;  3T4J A;  1XGJ A;  5E2E A;  3IXB A;  1L0G A;  3VV4 A;  4UQI S;  3ZG0 A;  2EA9 A;  1ES2 A;  4MEZ A;  3LEQ A;  4OQ0 A;  4DJ3 A;  2EWV A;  4JXG A;  4I3A A;  3PBR A;  5EFW A;  2XK1 A;  5DFY A;  2VGL S;  3C38 A;  4DDS A;  1W79 A;  4WF0 A;  3GRJ A;  4XUX A;  2V0W A;  4JGQ A;  4BL3 A;  4EUV A;  1GCE A;  4EQI A;  2ZLY A;  4S2M A;  3L9K A;  3L7H A;  2W1R A;  2KOI A;  1GHM A;  1K54 C;  3KYE A;  4BLM A;  4EQ1 A;  3PYP A;  2VV6 A;  2GNX A;  3UO9 A;  5F68 A;  3B42 A;  5HPF A;  1NRF A;  3FPW A;  1BLP A;  1C3B A;  3OC2 A;  3T1S A;  3NIA A;  4M3K A;  5LBR A;  2IWD A;  1GA0 A;  2R9W A;  4GJ4 A;  4DDY A;  3DAV A;  4I39 A;  1CEF A;  5DFX A;  4JGP A;  4PKY A;  2VA0 A;  3D9Y A;  5EM1 A;  2JKG A;  4MBK A;  4QPR A;  4DKI A;  2WKP A;  3ISG A;  3H82 B;  5F1F A;  4JF5 A;  3AGF A;  3SH9 A;  1ONG A;  2A24 B;  4IHQ A;  2XDM A;  3T4Q A;  1Q2Q A;  4U0X A;  1UWN X;  5F6A A;  3HJK A;  4BWI A;  2WAE A;  2ZMF A;  5E2F A;  2Y91 A;  1I2W A;  3R4K A;  3A0R A;  4OVD A;  4HP4 A;  4Y0T A;  2JKT I;  4QU3 A;  4LLO B;  1G68 A;  3IX8 A;  4P85 A;  2ZQC A;  3IXH A;  4ESP A;  5FQI A;  4DMZ A;  1TS0 A;  2ZQ8 A;  2KDK A;  4QHC A;  3BLS A;  3LEZ A;  3F1O A;  4FCF A;  5A93 A;  1T18 A;  2QZ6 A;  2PDR A;  2HDR A;  3V5M A;  2ZOI A;  3HLB A;  3CZD A;  4IUK A;  1CI9 A;  5EOE A;  5CX7 A;  3PR6 A;  2XSS A;  1HTZ A;  3N8L A;  3Q7V B;  3MXQ A;  3TE8 A;  1FCM A;  5MC7 A;  3RXX A;  3UB5 P;  1X0O A;  3UDF A;  4Y0U A;  5HSQ A;  3FKV A;  2FH5 A;  3JVU A;  4Y17 A;  1STZ A;  3E4Q A;  1OTE A;  4ARZ B;  1JVJ A;  5CXW A;  4GDB A;  5F69 A;  2EXB A;  1K0K A;  4XUZ A;  1PZO A;  2Y2P A;  1VHM A;  3R7W B;  4QB8 A;  2OWH A;  2HP9 A;  1BTL A;  2LB9 A;  4FSF A;  3PBQ A;  3S7P A;  3ZGA B;  4WM9 A;  1OJG A;  4GD8 A;  3ZG5 A;  2ZM8 A;  5L2F A;  3MQ0 A;  4YOF A;  5L07 A;  2V20 A;  4MCW A;  4ID4 A;  3LIC A;  1YLZ A;  2VV8 A;  1BUE A;  1TS7 A;  3BFF A;  1Q2P A;  4OLG A;  5FAT A;  1QME A;  3C30 A;  3IF6 C;  2H0Y A;  5FAS A;  1GSX A;  1RGY A;  1PI5 A;  2MJ6 A;  4OP8 A;  3UE0 A;  1XFQ A;  3PTE A;  4P6Z M;  4BBU A;  2Q9M A;  3MKF A;  2VK3 A;  1TS8 A;  4H6J A;  3NI9 A;  3IXG A;  3EGD C;  3UNW A;  2WAD A;  5EVI D;  4UA6 A;  2W0N A;  5DVA A;  5GLD A;  5M1A A;  5GHX A;  1FOF A;  1DY6 A;  2P9V B;  5KZH A;  5D3O A;  4E3L A;  3BFC A;  1PWC A;  1PW8 A;  2L4R A;  2QJ5 A;  4NEE D;  3UDX A;  2Y2H A;  1BLC A;  4MNR A;  5DJU A;  3SZT A;  4L0L A;  2XF3 A;  1XJ6 A;  2PRF A;  3P01 A;  1OPX A;  3LUQ A;  4R4R A;  5EOO A;  4KG2 A;  3EOI A;  4EBN A;  2HF6 A;  4P0M A;  5CTM A;  3BJN A;  1SKO B;  2I72 A;  3IF6 B;  3MSH A;  3P98 A;  3MXR A;  4LV3 A;  1KE0 A;  4I3J A;  4X6T A;  2XQZ A;  3MFD A;  1T1B A;  1PI4 A;  4HNB A;  5DF9 A;  1KE3 A;  5HWW A;  2GX5 A;  5GLA A;  5DJT A;  4DF6 A;  1ZHH B;  3BFE A;  5DTK A;  3VFH A;  3KYQ A;  2KX6 A;  4KQO A;  3VE3 A;  4OPZ A;  5CRF A;  3IWQ A;  2E8I A;  2WYX A;  1S67 L;  4L9E A;  3K2N A;  1XA1 A;  1VET B;  4ZAM A;  1PWD A;  3RH8 B;  3A0V A;  2RCX A;  2WK0 A;  3NOU C;  4H8R A;  4KG5 A;  4N92 A;  1H0M A;  3FPV A;  3W4O A;  3V50 A;  4RYE A;  1DJC A;  2WZZ A;  1ALQ A;  2Y2N A;  4EER A;  4DJ2 A;  4R0Q A;  2Y2Q A;  1OTA A;  2W3D A;  3CAX A;  3HL9 A;  4CLC A;  1MWT A;  4WL9 A;  2QPN A;  1K56 A;  4KZ5 A;  5TBM A;  3E2K A;  2BTF P;  3BEC A;  5HWT A;  4LPZ A;  3P7N A;  1DJA A;  3IHA A;  4C6Y A;  3FWL A;  1DP6 A;  3VOL A;  2JN7 A;  4OPY A;  1ERM A;  2XRO A;  1H3Q A;  4BMW A;  3QHY A;  5HAP A;  2WGW A;  3B3X A;  2FFY A;  2DMW A;  4OQI A;  1T19 A;  1OME A;  1YQS A;  3FYZ A;  4WMC A;  3HJI A;  2ZC5 B;  3VFF A;  2G2W A;  1LSW A;  1HLU P;  1XGI A;  4HP9 A;  2HZ5 A;  5FDS A;  4Z1W A;  5HW3 A;  2QHK A;  4DE1 A;  4U3T A;  2ZM0 A;  4G3W A;  4EWF A;  3TOI A;  5TJJ A;  4KZ3 A;  4X68 A;  1D06 A;  3N8S A;  4HES A;  4PMA A;  1O7E A;  5F82 A;  2V0U A;  4KZ7 A;  3QNB A;  3HUM A;  4DE0 A;  3BW6 A;  4CJN A;  4N9L A;  2B18 A;  3CJM A;  3Q7Z A;  4GDN A;  3C8C A;  1BSG A;  4KZA A;  1K4F A;  1CK3 A;  4GB7 A;  3GEC A;  2L1M A;  4IVK A;  4PHT A;  3HVF A;  4LV1 A;  3VP1 A;  3LYX A;  4ZDX A;  3ZHH A;  3M2J A;  3KO6 A;  4R23 A;  3LY3 A;  3Q81 A;  4S2O A;  4RX3 A;  2Y2M A;  3G4P A;  4OH0 A;  1Y54 A;  1XJ3 A;  4LCL A;  3HRE A;  4GLQ A;  5FQJ A;  1BLH A;  4JPM A;  1QMF A;  4LRY C;  4KZ4 A;  4D60 A;  3F1O B;  1SZV A;  4X55 A;  4MBH A;  5HDS A;  1VM1 A;  3TJZ C;  5AQB A;  4AFI A;  5GL9 A;  4S2I A;  3P09 A;  5JYP A;  5AQA A;  1P9W A;  4CQH A;  4KZ6 A;  3NEC A;  4EXO A;  3HLD A;  5TFQ A;  5TGF A;  4N9K A;  1OTD A;  4P87 A;  1J9M A;  2EFX A;  3IS2 B;  4DRT A;  1GHP A;  3ZFZ A;  5CGW A;  3CLO A;  2ZBB A;  4PAU A;  5I5L A;  2Z2L B;  2ZD8 A;  4U0T A;  3V67 A;  1K6S A;  4JGR A;  4BD1 A;  1Y28 A;  1VET A;  4A5R A;  1MPL A;  4E6W A;  4HI4 A;  1FIK A;  2J8Y A;  3SH8 A;  1RGZ A;  3Q1F A;  5J7E A;  3LIE A;  4DN0 A;  1W8Q A;  2JE5 A;  5GHY A;  3LR5 A;  4O0P A;  3LIF A;  3A3I A;  4IVI A;  1NLZ A;  1ODV A;  4JXV A;  2QKP A;  1KOU A;  3V3R A;  4GZB A;  3Q82 A;  1FR1 A;  1TEM A;  3G35 A;  4OQH A;  4ETZ A;  3E98 A;  5A8B A;  1XXM A;  2ACG A;  3QP4 A;  4KEN B;  4H6J B;  3Q07 A;  4MN6 A;  5AJG A;  4OLD A;  3QNC A;  5FI2 A;  1W5D A;  2QYB A;  3UB9 A;  4B9O A;  3PBT A;  3HLE A;  5HX9 A;  5A92 A;  4HOI A;  3K3C A;  3UME A;  1H8Z A;  3QP2 A;  2V2F F;  5FSR A;  2XLN A;  1A0K A;  2V1B A;  4OP5 A;  1L3L A;  3KX0 X;  1DP9 A;  2AVX A;  2QMI A;  3QP1 A;  3LI8 A;  2K7S A;  5IS1 A;  3HLF A;  3B47 A;  1Y4O A;  3OZH A;  5KIZ A;  2HDU A;  1N9O A;  2HJE A;  1E3U D;  4R3B A;  2J9O A;  3F1N B;  3IX4 A;  1WA9 A;  2IA2 A;  1J3W A;  2C5W B;  3DTI A;  2D02 A;  3E4P A;  3LI9 A;  4YWZ A;  4CLC C;  3KSI A;  1ONH A;  3E0Y A;  3FG8 A;  4MDZ A;  3IT9 A;  5DKK A;  2J3W A;  2ZMV A;  5L09 A;  2PR6 A;  4YNR A;  3E2L A;  4QY5 A;  4JXS A;  1DRM A;  4GOG A;  3D72 A;  4C3Q A;  4HH2 A;  4LRX C;  3SS3 A;  5DTT A;  2O9C A;  4NXG A;  4XXR A;  2B95 A;  3UE1 A;  1LLB A;  2WUQ A;  1LSX A;  1D7E A;  3NOP C;  4FOF A;  3TG9 A;  2PBD P;  1G6O A;  3TRC A;  1YLJ A;  3JPU A;  2Q0O A;  4CPK A;  2ZC6 B;  3B33 A;  2IWC A;  1FR6 A;  2O9A A;  4B88 A;  3ZYT A;  2ZOH A;  1EW0 A;  2JKR M;  2ZC3 B;  5FA7 A;  2J7V A;  5CGX A;  2WKR A;  5J3W A;  1LL8 A;  1NRJ A;  1EI5 A;  2CC1 A;  3SW1 A;  4CLC B;  1NYY A;  2RL3 A;  2ZC4 B;  3OBF A;  1OT9 A;  1JWZ A;  5L10 A;  5TBM B;  1JTD A;  1LI9 A;  2G7U A;  4O7D A;  4I3I A;  4NKP A;  3V3S A;  5FAO A;  5J4E A;  3T12 B;  2Y2K A;  3MQQ A;  5AQ9 A;  4WBG A;  1TDG A;  3IBJ A;  1IOU A;  5F5Y A;  4PM9 A;  4ZJ3 A;  4DXB A;  3IS2 A;  3CMZ A;  1WYB A;  2M1C A;  3MKE A;  4ZJ2 A;  3KYZ A;  2HGV A;  2Z6C A;  3C5A A;  2PU2 A;  2VLG A;  2WGW B;  3PBN A;  5IHV A;  3RJU A;  5HD5 A;  3ULF A;  1ERQ A;  3NC8 A;  1GHI A;  1M40 A;  1NZO A;  4ME4 A;  1IKG A;  2EX9 A;  3A3F A;  2R78 A;  4UEY A;  1VB6 A;  1FCN A;  4EU0 A;  1LHY A;  1T1C A;  2EX2 A;  4K0X A;  4R6L A;  1BLS A;  4JBF A;  1K6R A;  1MXO A;  3EQV A;  2VV7 A;  1H8M A;  2J9P A;  2W1T A;  3BRM A;  3DBA A;  5HL6 A;  4UQI M;  2INW A;  2JHE A;  3G30 A;  3F1P A;  1AWI A;  3ICY A;  1M6K A;  5CHJ A;  2M7V A;  5GHZ A;  2P08 A;  3VE4 A;  1LL9 A;  1DP8 A;  2WKH A;  3WS2 A;  4LGW A;  3UB7 A;  4EES A;  4WEL A;  4OPR A;  1MWS A;  3LIB A;  1KVM A;  4KZ9 A;  3MFX A;  3WRT A;  4OOM A;  5DTS A;  3BQA A;  3AGE A;  3O3V A;  1U60 A;  4GKU A;  3U4L P;  4LV0 A;  5G4Z A;  1L0E A;  4ZJ1 A;  1F2K A;  2PAV P;  2XFT A;  3HCY A;  2ZM2 A;  1PNE A;  4E3J A;  3GVB A;  3F1N A;  1YLT A;  3GSG A;  4PPR A;  4EW7 A;  3WS5 A;  3C7V A;  3FV7 A;  4O01 A;  4KZ8 A;  5K5B A;  4FD8 A;  1ERO A;  3ITA A;  4UA9 A;  1MZU A;  1I5Q A;  3MQO A;  2W3G A;  3VOY A;  3MMH A;  4YFM A;  3MXS A;  1YKD A;  2OOL A;  1PWG A;  3DW0 A;  1S1Z A;  1N9N A;  3QP5 A;  1KGG A;  2VZW A;  5HZH A;  4BBV A;  1MWU A;  5HL1 A;  3U2A A;  3ZG9 B;  1CEG A;  4GS9 B;  3M6B A;  2Y2L A;  1H8Y A;  3VOZ A;  2B5R A;  1PW1 A;  1JWP A;  3OPH A;  1TVF A;  5FI6 A;  4HJ3 A;  3S7N A;  5EEC A;  3CHW P;  4WZ4 A;  3T4K A;  4E04 A;  1OTB A;  2WZX A;  2HP5 A;  3JVV A;  1TS6 A;  5CHM A;  4HHD A;  3VMA A;  5FQM A;  4RA7 A;  2IWB A;  3UB8 A;  5KSH A;  2XRN A;  4PM6 A;  4IBR A;  5BOH A;  2A3U A;  3MZF A;  5HWV A;  3UPP A;  1XJ2 A;  1KDS A;  4LCM A;  2PT7 A;  1SCW A;  3C4O A;  3D4F A;  4JKT A;  4WEJ A;  4FTX A;  1L2S A;  3IQA A;  2EX6 A;  1SHV A;  1D1J A;  2V8F A;  1YMX A;  3OCL A;  3W8K A;  4GNU A;  1W7F A;  2E8J A;  5C5K A;  4E3K A;  3CG5 A;  1VEU A;  4K0W A;  4EET B;  1FSW A;  1YAX A;  1G5U A;  1DJB A;  1RCJ A;  1IEM A;  4X56 A;  4X69 A;  2JKF A;  5CEC A;  2JKR I;  2BG1 A;  2YKH A;  2WGI A;  3IWO A;  2NUP C;  3SS5 A;  2PBY A;  2XH9 A;  2VJW A;  5CTN A;  4HIA A;  3BWL A;  3LIA A;  4Y5F A;  5AVF A;  2H28 A;  3T1R A;  4I5S A;  5EVE A;  4O8G A;  3A3E A;  2Y55 A;  5E43 A;  3LR4 A;  3K3D A;  4LFU A;  2OAP 1;  4OPQ A;  1YSP A;  3NDE A;  4R1G A;  3WWX A;  3WS0 A;  4S2J A;  1K4E A;  3DTE A;  1S4S A;  3UE6 A;  5FEF A;  1CQA A;  3WRZ A;  4N1X A;  3FZC A;  5CEB A;  1MKI A;  3C7U A;  5HDC A;  1JNU A;  1FQG A;  1E25 A;  3W4Q A;  3HUO A;  4E6X A;  1S66 L;  5E2H A;  3SH7 A;  1ES4 A;  2J3T C;  1YSQ A;  3G6O A;  1NZU A;  3BY9 A;  1YLW A;  5F1G A;  4ETX A;  2OSU A;  3KSF A;  3UE3 A;  5KSC A;  1F9I A;  3IX3 A;  4HJ6 A;  4DE3 A;  2P7J A;  3VSL A;  1ESU A;  4Z9Q A;  2FFF B;  2ZJ9 A;  4HBU A;  3O86 A;  2X71 A;  2ZL1 A;  3MS6 A;  2W3H A;  3UY6 A;  3IH8 A;  3WS4 A;  2EXA A;  1N9B A;  1P9R A;  1W8Y A;  2B02 A;  5EVL A;  4G3K A;  4Q8I A;  4NXE A;  3N6I A;  4PM8 A;  4R3J A;  4Y3I A;  1MC0 A;  1G6A A;  2BLS A;  1V9Z A;  1BYW A;  4DXC A;  4LRZ E;  1BZA A;  3I7J A;  4EBL A;  2XFS A;  1ES5 A;  4LV2 A;  4R38 A;  2I9V A;  2Z2M B;  1HVB A;  3HLW A;  3DTM A;  3V39 A;  3T4L A;  3A3J A;  3C2W A;  3N8R A;  2JCH A;  4OOY A;  1PYY A;  3BQ8 A;  3NUL A;  2Y8H A;  4ZRR A;  3S4X A;  3CUE A;  3EGX C;  4GS9 A;  1OJ5 A;  1ZG4 A;  4Q0I A;  2GZA A;  3UPO A;  2CMN A;  5EPH A;  2HPB A;  1BUL A;  1SKF A;  2H5S A;  1Z09 A;  5FDH A;  2W1T B;  2XA7 M;  2X01 A;  4QWO A;  3IHB A;  1NJ4 A;  3NJA A;  3PBO A;  3F1P B;  3ZCZ A;  4JF4 A;  3CI6 A;  4BL2 A;  4UAA A;  1KGF A;  3G2Y A;  3EEH A;  2PYR A;  4HQA A;  1K57 A;  3AGD A;  3NHQ A;  4CLC D;  3VP4 A;  2K2N A;  4EEP A;  5F83 A;  1K56 D;  2JBF A;  2A49 A;  3IF5 A;  2XR0 A;  2OWJ A;  3UDI A;  3G34 A;  4WN5 A;  2Y4A A;  3ZDJ A;  2ZQA A;  5EVI A;  1ES3 A;  2WKQ A;  4P6Z S;  5AQ7 A;  2WGV A;  1TF1 A;  2P04 A;  2H10 A;  3N7W A;  4Y2F A;  1N9L A;  3UN7 A;  3O88 A;  3GR2 A;  5FAQ A;  2Q9N A;  3LY4 A;  4FUW A;  3M6H A;  2QWS A;  4Y0O A;  4X1L A;  3VP2 A;  4S2N A;  3S22 A;  4Y13 A;  1UWP X;  5E2G A;  4MLL A;  2UWX A;  1K55 A;  4WMC D;  5EUA A;  1S4R A;  4GHI A;  2O99 A;  4GD6 A;  2Y79 A;  4EEU A;  3BFD A;  4HEF A;  4IUH A;  3CPT B;  4IED A;  1ZKJ A;  4G3V A;  2W27 A;  1ZG6 A;  3W2Z A;  1MY8 A;  3PBS A;  4L9G A;  2P74 A;  1AXB A;  3BFG A;  1VQQ A;  3C4P A;  3VP0 A;  1CJF A;  4M4X A;  1P97 A;  3GQZ A;  5CED A;  1P0Z A;  3ITB A;  2WKI A;  4DE2 A;  3PAE A;  1IKI A;  2XD1 A;  1XPB A;  2K31 A;  2VEA A;  5HPI A;  3NCK A;  2HP6 A;  1CF0 A;  2BAS A;  4PM5 A;  3UPN A;  2UV0 E;  3M2K A;  2R9X A;  1I2S A;  2EFU A;  3MJQ A;  3LID A;  1NXY A;  4MN7 A;  3H7W A;  4F3L A;  1XA7 A;  3A0S A;  3QP6 A;  5IT5 A;  5G4Y A;  4XT2 A;  3WS1 A;  2O9B A;  1GA9 A;  2V9A A;  2NUT C;  5U47 A;  4UHU A;  1MWR A;  4X25 A;  2M7U A;  4WZ5 A;  1W63 Q;  1K25 A;  3TW8 A;  1ZC2 A;  5KMW A;  3GMW A;  4JGO A;  4IJG A;  1TD5 A;  3BY8 A;  4EUZ A;  1IYQ A;  5CGS A;  5M18 A;  2V1Z A;  1IEL A;  3VSK A;  1T1A A;  1IFQ A;  4ZBE A;  1IYS A;  2HV1 A;  1XP4 A;  2ZC7 A;  5GLB A;  3PXP A;  4JF6 A;  1N4O A;  2KLI A;  2EWW A;  5FI7 A;  2Y2J A;  4R3A A;  1VEU B;  1FIL A;  2G2U A;  3T50 A;  3EWK A;  2C6W B;  4QY6 A;  2QJ7 A;  2OV5 A;  1Z6F A;  3H9W A;  4Q0J A;  1GSV A;  3GTC A;  1WYC A;  3A3D A;  2WKE A;  2DCF A;  4Q0H A;  4MMN A;  1HD8 A;  3PHY A;  4BD0 A;  4BJP A;  3BLM A;  2HDS A;  1G28 A;  5HAR A;  1JWV A;  2PD8 A;  2ZQD A;  5TR7 A;  3DTK A;  4JXW A;  3N4I A;  5J8X A;  2PYP A;  3OOV A;  4OKP A;  3MZD A;  5HFO A;  4RVA A;  2JC7 A;  4K91 A;  1F5M A;  3MR0 A;  3LCE A;  3SOI A;  4FH4 A;  5G18 A;  1FSY A;  2VGL M;  2X02 A;  4E3M A;  2PD7 A;  3EEA A;  2Y59 A;  1YLY A;  2Y2G A;  2ZMA A;  1S0W A;  4OON A;  1O07 A;  2L0W A;  4X53 A;  1XJ4 A;  1KDW A;  4P6B A;  5IU1 A;  1L0D A;  2OLV A;  4KUO A;  3CUE C;  1LT0 A;  5JYO A;  3FKW A;  1PRQ A;  1E4D A;  2OLU A;  4R4S A;  1HZO A;  2EX8 A;  2GDN A;  1ACF A;  4EV4 A;  1SDN A;  4KUK A;  3T4S A;  2ZL1 B;  3LR3 A;  3LO7 A;  4Y7P A;  2XEP A;  2HDQ A;  4B93 A;  2XD5 A;  1EWZ A;  1S6R A;  2ZQ7 A;  2Y2I A;  3HLC A;  3ZG8 B;  5EM0 A;  1MBL A;  3LR0 A;  3NDG A;  4ZTK A;  3CPT A;  1IYP A;  3S7O A;  4D2O A;  1LI0 A;  1K57 C;  4B4X A;  4C75 A;  4IBX A;  3OPR A;  5CER A;  3DWZ A;  4X1M A;  3FC7 A;  1PZP A;  2FZ0 A;  3RXW A;  1YM1 A;  3O87 A;  4N1H A;  3BM6 A;  4KQQ A;  4NXB A;  5EVI C;  3S7Q A;  2Y2O A;  4L9F A;  2PR5 A;  1KGE A;  3H82 A;  3E4O A;  5DF8 A;  4YIN A;  3W4P A;  4CLC E;  5EV0 A;  3NY4 A;  1BT5 A;  1MKM A;  2A24 A;  1RP5 A;  4OQG A;  1UGU A;  4S2N C;  1K54 A;  3OLO A;  1XX2 A;  4F94 A;  1K55 C;  2D01 A;  4NG2 A;  2HJ9 C;  1WE4 A;  4WLA A;  4HJ4 A;  5A91 A;  5FL3 A;  3IWI A;  1F98 A;  1OTI A;  2XA7 S;  5HAI A;  1FCO A;  1NYM A;  4WEK A;  5AVE A; 
#chains in the Genus database with same CATH homology
 2ZMV A;  2PR6 A;  4Y3I A;  3C30 A;  1MC0 A;  4YNR A;  1V9Z A;  1BYW A;  2VX8 A;  4LRZ E;  1GSX A;  1DRM A;  2VKS A;  1ZTU A;  2MJ6 A;  4R38 A;  2I9V A;  3D72 A;  1XFQ A;  4RQ9 A;  4P6Z M;  4HH2 A;  3CWF A;  4LRX C;  3T4L A;  4BBU A;  3C2W A;  1TS8 A;  4H6J A;  3BQ8 A;  2O9C A;  4NXG A;  3MF0 A;  3EGD C;  2Y8H A;  1LSX A;  2J80 A;  1D7E A;  3NOP C;  4FOF A;  2W0N A;  1G6O A;  4ZRR A;  3TRC A;  3CUE A;  3EGX C;  4GS9 A;  1OJ5 A;  4HH3 A;  4Q0I A;  4ARZ A;  2GZA A;  4I38 A;  3B33 A;  1LSV A;  5HDD A;  2CMN A;  3RFB A;  2O9A A;  2JKT M;  4GHI B;  3ZYT A;  2J3T D;  3OCN A;  2W3E A;  2ZOH A;  1EW0 A;  2O0Y A;  2JKR M;  2L4R A;  2QJ5 A;  2W3F A;  1NWZ A;  4NEE D;  3R7W A;  5DJU A;  2W1T B;  2XA7 M;  2WKR A;  5J3W A;  1LL8 A;  1NRJ A;  3GDI A;  4L0L A;  3SW1 A;  4CLC B;  1XJ6 A;  1NLY A;  3NJA A;  3P01 A;  1OPX A;  3LUQ A;  3PBO A;  3F1P B;  3EOI A;  3OBF A;  1OT9 A;  2HF6 A;  3BJN A;  5TBM B;  2G7U A;  4I3I A;  4NKP A;  3CI6 A;  3KSH A;  2GJ3 A;  5J4E A;  3MQQ A;  3EEH A;  4I3J A;  2PYR A;  4HQA A;  3NHQ A;  4CLC D;  4II7 A;  3IBJ A;  2K2N A;  1IOU A;  4EEP A;  5F5Y A;  1T1B A;  4HY8 A;  4HNB A;  2OWJ A;  5DF9 A;  3IS2 A;  5HWW A;  2M1C A;  3NOT C;  4BBT A;  2GX5 A;  3IBR A;  4WN5 A;  5DJT A;  1ZHH B;  3KYZ A;  2HGV A;  4KQD A;  2Z6C A;  2WKQ A;  4P6Z S;  2VLG A;  5HD3 A;  1TF1 A;  3KYQ A;  2A2L A;  4WUJ A;  2KX6 A;  4KQO A;  3PBN A;  3VE3 A;  2P04 A;  4Y2F A;  3H7W B;  1N9L A;  4F3L B;  5HD5 A;  1S67 L;  4L9E A;  3ULF A;  3K2N A;  2PHY A;  4XT2 B;  2QWS A;  4ME4 A;  2Z6D A;  3RH8 B;  4GCZ A;  2R78 A;  3A0V A;  4UEY A;  2OAQ 1;  2V1A A;  1VB6 A;  4EU0 A;  3NOU C;  1T1C A;  1UWP X;  3CIT A;  3FPV A;  3UMD A;  4R6L A;  1S4R A;  4NXF A;  4GHI A;  2O99 A;  2Y79 A;  4EEU A;  3EQV A;  2VV7 A;  4EER A;  4DJ2 A;  1H8M A;  4IUH A;  2W1T A;  1OTA A;  5DKL A;  2W3D A;  3CAX A;  4CLC A;  4G3V A;  3DBA A;  3LFV A;  2W27 A;  4WL9 A;  5HL6 A;  4UQI M;  2INW A;  3W2Z A;  4K08 A;  2JHE A;  3F1P A;  3PBS A;  4L9G A;  3T4O A;  5L8M A;  5TBM A;  3ICY A;  4PKY G;  2M7V A;  5HWT A;  4LPZ A;  2P08 A;  4MN5 A;  3P7N A;  3VE4 A;  3O5Y A;  1DP8 A;  4M4X A;  1P97 A;  3D3O A;  1P0Z A;  3UB7 A;  1XFN A;  1GSW A;  2LB5 A;  2K31 A;  2VEA A;  1DP6 A;  5HPI A;  4EES A;  4WEL A;  2YKF A;  3VOL A;  2JN7 A;  1S1Y A;  2BAS A;  3LIB A;  2XRO A;  3UB6 A;  1H3Q A;  4BMW A;  3ZQ5 A;  3MFX A;  3T4T A;  4OOM A;  3MJQ A;  3LID A;  4OOL A;  3BQA A;  2DMW A;  1W63 M;  1T19 A;  4MN7 A;  3H7W A;  4F3L A;  3EQU A;  1OT6 A;  3A0S A;  3HJI A;  5G4Z A;  5IT5 A;  5G4Y A;  4XT2 A;  1V9Y A;  1LSW A;  2O9B A;  4HP9 A;  2V9A A;  3HCY A;  4Z1W A;  2NUT C;  2QHK A;  4R70 A;  4G3W A;  2M7U A;  5TJJ A;  4GW9 A;  1W63 Q;  3F1N A;  4EW7 A;  3TW8 A;  1D06 A;  4JGO A;  4O01 A;  3KSG A;  3RTY A;  5K5B A;  4IJG A;  1TD5 A;  2V0U A;  3BY8 A;  3T4J A;  3BW6 A;  1MZU A;  2B18 A;  3MQO A;  3VV4 A;  4UQI S;  3C8C A;  1T1A A;  2EA9 A;  2W3G A;  1IFQ A;  3MMH A;  4DJ3 A;  3GEC A;  2L1M A;  2EWV A;  1YKD A;  2HV1 A;  2OOL A;  4PHT A;  1S1Z A;  1N9N A;  3LYX A;  3PBR A;  4I3A A;  2VZW A;  3PXP A;  5EFW A;  5DFY A;  5HZH A;  2VGL S;  3C38 A;  2KLI A;  4BBV A;  2EWW A;  3U2A A;  3KO6 A;  4WF0 A;  4R3A A;  2V0W A;  4JGQ A;  4GS9 B;  3T50 A;  3EWK A;  4EUV A;  2QJ7 A;  2W1R A;  2KOI A;  1XJ3 A;  3H9W A;  4Q0J A;  4GLQ A;  1GSV A;  4EQ1 A;  4LRY C;  4Q0H A;  3F1O B;  3PYP A;  2VV6 A;  4MMN A;  2GNX A;  3PHY A;  4HJ3 A;  4BJP A;  5HDS A;  3S7N A;  3TJZ C;  4AFI A;  5F68 A;  1G28 A;  3B42 A;  2PD8 A;  5HPF A;  3FPW A;  3OC2 A;  3T4K A;  4E04 A;  1OTB A;  2PYP A;  3OOV A;  5LBR A;  3JVV A;  1P9W A;  1TS6 A;  4HHD A;  4GJ4 A;  4I39 A;  3UB8 A;  4CQH A;  5KSH A;  2XRN A;  4EXO A;  5DFX A;  1F5M A;  3MR0 A;  4JGP A;  4PKY A;  1OTD A;  2VA0 A;  5HWV A;  2VGL M;  2PD7 A;  3IS2 B;  4QPR A;  3EEA A;  2WKP A;  1XJ2 A;  2PT7 A;  3H82 B;  2L0W A;  4WEJ A;  1XJ4 A;  5IU1 A;  3CLO A;  2ZBB A;  2A24 B;  4IHQ A;  4PAU A;  4KUO A;  5I5L A;  3CUE C;  3T4Q A;  1LT0 A;  3OCL A;  1UWN X;  5F6A A;  3V67 A;  3HJK A;  4JGR A;  4BWI A;  2ZMF A;  5C5K A;  1Y28 A;  3R4K A;  4EET B;  3A0R A;  1YAX A;  4HP4 A;  4HI4 A;  2JKT I;  4LLO B;  4KUK A;  3T4S A;  2JKR I;  3LR3 A;  4DMZ A;  5J7E A;  1TS0 A;  2YKH A;  4B93 A;  2KDK A;  3LIE A;  2NUP C;  4DN0 A;  3F1O A;  1T18 A;  2VJW A;  2PDR A;  3LR5 A;  4O0P A;  2ZOI A;  4HIA A;  3LIF A;  3BWL A;  3LR0 A;  3LIA A;  4Y5F A;  5AVF A;  2H28 A;  1NLZ A;  4I5S A;  1ODV A;  4IUK A;  4O8G A;  2QKP A;  5CX7 A;  3PR6 A;  1KOU A;  3LR4 A;  2XSS A;  3K3D A;  3S7O A;  2OAP 1;  3MXQ A;  3TE8 A;  4ETZ A;  1YSP A;  3E98 A;  3FC7 A;  5A8B A;  5MC7 A;  2FZ0 A;  4H6J B;  1X0O A;  4MN6 A;  5AJG A;  3UE6 A;  1S4S A;  5HSQ A;  2QYB A;  3UB9 A;  4NXB A;  3S7Q A;  4B9O A;  3PBT A;  2FH5 A;  3JVU A;  4L9F A;  4HOI A;  5HDC A;  1JNU A;  2PR5 A;  1STZ A;  3E4Q A;  1OTE A;  3K3C A;  3UME A;  4ARZ B;  3H82 A;  3E4O A;  4CLC E;  5F69 A;  1S66 L;  2V1B A;  2J3T C;  1YSQ A;  1MKM A;  3G6O A;  2A24 A;  3BY9 A;  1UGU A;  4ETX A;  3KX0 X;  1DP9 A;  1VHM A;  3R7W B;  2OWH A;  3KSF A;  3UE3 A;  2LB9 A;  3LI8 A;  1F9I A;  2K7S A;  5IS1 A;  3OLO A;  4FSF A;  4HJ6 A;  3B47 A;  3PBQ A;  3S7P A;  2P7J A;  1OJG A;  2D01 A;  5KIZ A;  2HJ9 C;  3MQ0 A;  4YOF A;  1N9O A;  2HJE A;  4MCW A;  4WLA A;  3F1N B;  2W3H A;  3LIC A;  4HJ4 A;  1WA9 A;  2IA2 A;  2VV8 A;  3E4P A;  1TS7 A;  2D02 A;  3LI9 A;  5FL3 A;  4YWZ A;  4CLC C;  1F98 A;  3KSI A;  1P9R A;  3E0Y A;  3FG8 A;  4MDZ A;  1OTI A;  2B02 A;  2XA7 S;  5DKK A;  4WEK A;  2J3W A;  4G3K A;  5AVE A;  4NXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...