3E0YA

The crystal structure of a conserved domain from a protein of geobacter sulfurreducens pca
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
164
structure length
155
Chain Sequence
HLEIISLEEISMLVSSDFDLPEVLQHVTAKVATQLKVSVCNIYLREGDEVVLAATHGFDPAFIGKIRIKIGDGITGSVARDGQYISLSRASQDPRYKYNSMLSFPIGDKKEVYGVINLNTTSIRSFHEDEIYFVSIIANLILTAIKLRQQVASSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved domain protein
publication title The crystal structure of a conserved domain from a protein of Geobacter sulfurreducens PCA
rcsb
source organism Geobacter sulfurreducens
molecule tags Structural genomics, unknown function
total genus 40
structure length 155
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3e0yA00
4LRYC 2M7UA 4R70A 4G3WA 4O01A 4MN7A 4DN0A 4Y5FA 2XSSA 5I5LA 2W1TB 3NOTC 3O5YA 5HL6A 2W1TA 2Y79A 3MMHA 2O9CA 4IUHA 4IJGA 5HPFA 2LB9A 5DFXA 3E98A 3S7NA 2HGVA 3R4KA 4MDZA 4G3KA 3LFVA 3OBFA 1YSQA 2W3FA 2M7VA 4R6LA 3ZQ5A 5LBRA 5K5BA 4YOFA 5L8MA 4Q0JA 3S7OA 2O9AA 4E04A 2XROA 3S7QA 2VZWA 4Z1WA 3NHQA 4GW9A 2KOIA 4O8GA 2XRNA 3D3OA 4QPRA 5TJJA 2QYBA 1TF1A 2OOLA 4ETZA 3BJNA 4YNRA 2W3EA 3IBRA 3S7PA 4FOFA 4CQHA 4MMNA 2O99A 3CITA 4Q0HA 5HPIA 4ETXA 3CI6A 3OOVA 3KSGA 2W1RA 2B18A 4PAUA 4EU0A 2O9BA 4LRXC 3W2ZA 3KSHA 1YKDA 1MC0A 3NOUC 3K2NA 1ZTUA 3RFBA 4RQ9A 3MF0A 4BWIA 2GX5A 2KLIA 3G6OA 4GLQA 2VEAA 3KSIA 4ZRRA 2IA2A 2Y8HA 5HSQA 1STZA 5C5KA 3C2WA 5AJGA 2G7UA 4ME4A 3KSFA 3TRCA 2LB5A 3VV4A 3DBAA 4IUKA 3KO6A 5DFYA 1VHMA 1MKMA 2W3GA 2K2NA 4DMZA 4LRZE 2VKSA 1YSPA 3IBJA 1F5MA 4O0PA 4G3VA 4EUVA 4Q0IA 2ZMFA 3MQ0A 3EEAA 4Y2FA 2K31A 1TD5A 3HCYA 4Y3IA 2O0YA 3NOPC 2W3HA 3E0YA 2VJWA 4MCWA 2W3DA
chains in the Genus database with same CATH superfamily
2PDRA 1W8QA 1LLBA 1K56D 4WBGA 5KSCA 4G3WA 3A0RA 4S2JA 4QD4A 3FPWA 2WAFA 3QP8A 3I7JA 2W1TA 5E2EA 4ZAMA 4I5SA 4BD0A 5I94A 4MDZA 5TFQA 2ZQCA 4OP5A 3CWFA 1TS7A 3BLSA 3Q07A 4WL9A 4WEJA 2J3WA 2Z2LB 1TDGA 3ZG8B 1VB6A 2YKHA 3T1QB 1PI5A 1LSWA 1VM1A 4OOLA 1LI0A 1VQQA 2I9VA 3IWQA 4X55A 4WZ5A 3DAVA 2WGWB 1LSVA 2HPBA 1H3QA 2JKTI 1EW0A 4II7A 3V39A 4BL3A 1YLJA 2Y2NA 4NEED 1K38A 3RXXA 3PBRA 4E3NA 1YKDA 4PKYG 4BWIA 1ES4A 2MJ6A 4I38A 3LR3A 3BEBA 3KSIA 2VV8A 2XA7M 2L0WA 4EW7A 2R9WA 2GNXA 4LV1A 1PI4A 4DE0A 4E6WA 1TS8A 2A24A 2WKQA 3WS0A 3DWKA 3VFHA 4UHUA 3UO9A 2XDMA 1CK3A 3OCLA 1SCWA 5FQ9A 4ARZA 2XK1A 4IVIA 3BWLA 3EEAA 4QJGA 3OZHA 4Y2FA 4EXOA 2C6WB 2HP5A 3HCYA 3LYXA 3BLMA 5EVID 1K55C 5EOOA 2ZL1B 1P0ZA 1W5DA 1KE3A 1OT9A 3FC7A 4KQRA 4K08A 3DTEA 2WKRA 3Q7ZA 4EV4A 4IJGA 2OWHA 2HGVA 2D01A 5G4ZA 4Q8IA 4HOIA 3WRZA 2ZC7A 3LY3A 3LIDA 4G3KA 3HVFA 1Q2PA 2J3TD 4R6LA 3G4PA 4H6JB 3GRJA 5F1FA 2O9AA 5HX9A 3UPNA 1CI9A 2XROA 4XT2A 5TBMB 4DDYA 2M1CA 5FQJA 3SH7A 1G6AA 3T4JA 3QP1A 1YQSA 4CLCA 1YMXA 3RJUA 3HLCA 4Y0UA 2O99A 4LLOB 3PAGA 1MWSA 2OSUA 1BYWA 1NRJA 2Y2QA 5CHMA 2PD7A 3DTKA 3MF0A 5AQ9A 4BENA 2EXAA 4HH2A 1H8YA 1GSXA 3NULA 1K57A 3K3CA 3C5AA 1O07A 4JGPA 4R4SA 5KIZA 4L0LA 3T1XA 1FCOA 4GDBA 1LI9A 1HZOA 4CPKA 1XJ2A 2EA9A 3UE0A 1NLYA 1EWZA 3IS2A 4DDSA 4S2NA 2JKRI 2VV6A 5HL1A 5HW3A 1ERQA 3IQAA 3TW8A 5M18A 3C30A 5AQ7A 3U2AA 4S2PA 2JKFA 3F1NA 1OTEA 4HBUA 1LSXA 4F94A 1IOUA 2LB9A 1AXBA 4DJ3A 3IF6C 3UB8A 4B88A 3PHYA 1BLCA 3HUOA 2VK3A 3OBFA 3ICYA 1Y54A 2QPNA 1ONGA 3FZCA 3ZQ5A 2NUPC 4S2KA 3A0VA 2VX8A 4K91A 1HD8A 5DTSA 2VZWA 5EUAA 5F69A 1MBLA 3G35A 4R1GA 5HDSA 1KOUA 4O8GA 2J8YA 5EECA 1FR1A 2OOLA 3MXRA 5FI7A 2PU2A 4BBUA 1KE0A 4OVDA 4CQHA 4LV3A 1CJFA 1K6RA 4Q0HA 3D72A 4NK3A 4E6XA 3CUEC 2JKRM 3H82B 3SZTA 2J80A 1FQGA 3K2NA 3AGEA 4LCMA 3PXPA 4HJ4A 1D7EA 5KMWA 3L7HA 2Z6CA 5DF7A 4KENB 3PBNA 2XD1A 1TDLA 1IELA 4Y15A 2GJ3A 3M6HA 1F5MA 2BG1A 2Y59A 4EUVA 4L9EA 4X1MA 4QB8A 3SH9A 3B33A 1HLUP 4Y0OA 1YLPA 1V9YA 2V0UA 1JNUA 5CTNA 2Y2HA 1H8MA 1FILA 5HARA 5HDCA 5F5YA 2XR0A 2XSSA 2GZAA 4R0QA 1TVFA 4P85A 1GA0A 1QMFA 3MQQA 5GHXA 1J9MA 1DY6A 1ES5A 3V5MA 5AQAA 2K7SA 4UA9A 1VEUA 3BFCA 3W4OA 2ZLYA 4R3AA 4HI4A 4JF4A 1BZAA 1K55A 4HQAA 5FATA 5HWWA 4GHIB 4UA7A 3UB6A 5FAPA 5F82A 1UWPX 4FOFA 4Y0TA 3BFGA 3T4KA 4GDNA 4N9LA 1W8YA 3CI6A 4NXGA 2O9BA 3NOUC 1ZTUA 4I3AA 1DJBA 4HHDA 1STZA 1ONHA 1VETB 3IT9A 5CGSA 2G7UA 5AJGA 2FFYA 3G32A 1A0KA 1J3WA 2QJ7A 5FQIA 4E3KA 4KZ4A 3F1PB 5E2HA 3QP4A 4RX2A 3HUMA 2WUQA 5GHYA 4Q0IA 4DF6A 5MC7A 1PW8A 5FQQA 5DJTA 4X25A 1OJGA 1KDWA 4OONA 3EQUA 5FA7A 2D02A 4WMCA 2HP6A 3E4PA 3VP2A 5GLDA 2NUTC 4M3KA 4MEZA 3EQVA 3MZFA 3N8LA 4Y5FA 1YPRA 3HJIA 1LT0A 1MWRA 1XA1A 3JYIA 3WS5A 1IYSA 4DKIA 5EVIB 2XEPA 5EFWA 1XJ3A 3LCEA 3GTCA 1XGIA 1KVLA 3P98A 2Q9MA 3ISGA 2WYXA 1TS6A 2Y91A 1M40A 3E4QA 1KDSA 1ESIA 4PMAA 1DP9A 4KZ6A 1PRQA 2DNSA 2JKGA 1CEGA 3FV7A 3N7WA 4X1LA 2OAQ1 3VSKA 5DTKA 2Y55A 4BMWA 2EFUA 4X56A 1UWNX 2PYRA 1L3LA 4GW9A 2WZZA 1OTDA 4DE2A 1ZHHB 1SKOA 3EEHA 2ZMAA 1DJAA 3OPHA 3IF6A 4HY8A 1XP4A 2W1RA 4GKUA 2P04A 3EGXC 3T4TA 3WRTA 3C4PA 5CX7A 5FI2A 1HVBA 1N9LA 2C5WB 1H0MA 3EWKA 1NXYA 2BLSA 2KDKA 2HDSA 1E25A 4GNUA 1L2SA 3CHWP 1IEMA 3DBAA 2PRFA 3AGFA 1MKMA 1PZPA 1YT4A 3CPTA 1ODVA 1IKIA 3IXDA 2I72A 2K31A 3CUEA 5HAIA 2O0YA 3S22A 3NBLA 1CI8A 4UQIM 1MKIA 2H0TA 4MBKA 1YLWA 2OLUA 5DKKA 2XQZA 5TGFA 1Z6FA 2W1TB 4DRTA 1NY0A 2L4RA 3G31A 3MMHA 3T1RA 3UDIA 3MKFA 4Z9QA 4HIAA 3P01A 3E2LA 3JVUA 2DRWA 3UMEA 3C8CA 2M7VA 4ZJ1A 2Z6DA 4YOFA 4OKPA 3N6IA 4KZBA 3MFDA 4S2IA 3LR5A 1GHIA 3FPVA 4QU3A 3NHQA 5FEGA 4QPRA 3T4SA 3ZG0A 3CLOA 2JC7A 4R38A 1WE4A 2WKPA 4JLFA 4HJ6A 4UQIS 4MN6A 1T1BA 2KX6A 3D9YA 4PAUA 3W2ZA 5IS1A 3RTYA 5CECA 1Y28A 1WA9A 1FCMA 4DXCA 3IXHA 4OLDA 1RGZA 4S2MA 2H10A 2GDNA 3IH9A 2P9VB 3ZVTA 3V50A 3UE6A 3BRMA 4PM6A 4QHCA 4JXSA 2XGNA 4DJ2A 2HDRA 3H7WA 4LCLA 4ARZB 2B02A 4E3IA 4EERA 3Q7VA 2XLNA 4WM9A 5FQKA 1SHVA 1XFQA 4O7DA 4BQMA 1N9OA 2ZD8A 5CRFA 3W4PA 3TOIA 1FCNA 5L07A 3QNCA 4X69A 4UA6A 5CXWA 3G2YA 1N4OA 3CAXA 3DWZA 5HL6A 1E3UA 3W4QA 1XKZA 4ID4A 4KUKA 4N92A 3JVVA 1P97A 3R4KA 4OQGA 4GD6A 4N1HA 4KQOA 3IH8A 2H5SA 3IHAA 4FH4A 2W3FA 2XF3A 2Q9NA 2IWBA 3BW6A 4KZ7A 2V8FA 1DRMA 2ZQAA 1FR6A 4KQDA 1K0KA 2KOIA 1IYQA 2XRNA 2ZOIA 4U0XA 5HWTA 3UE3A 3HBRA 3QHYA 3R7WA 3BFDA 3KX0X 3C7UA 2BTFP 4JGOA 4JF6A 1S1YA 2PU4A 4LFUA 3KSGA 4N1XA 4AFIA 4OLGA 3UPOA 1S1ZA 2ZC4B 1S66L 1Y4OA 3WS2A 4RYEA 2A2LA 3P7NA 3G6OA 4WLAA 1GCEA 4OOYA 4DE3A 3GV9A 3F1OA 2XD5A 3NCKA 4CJNA 3UE1A 3IX8A 3KSFA 1BTLA 3JPUA 4FTXA 3TRCA 5BOHA 4JPMA 4IUKA 3O3VA 2UWXA 3EOIA 2OWJA 3UB9A 1IYPA 1GSVA 2ZMFA 3IS2B 1EROA 1TD5A 5FDSA 3TJZC 3HREA 3E0YA 4H8RA 4LV0A 2VA0A 2W3DA 3GSGA 4LRYC 3MR0A 4X53A 3VP4A 4NG2A 2ZMVA 4OQHA 3F1NB 3HLDA 4EEUA 3QP6A 4WF0A 4QWOA 3GDIA 4A5RA 5U47A 2PR5A 1JVJA 1RP5A 3IF5A 4R23A 1F98A 4PM7A 4Z1WA 5A8BA 1K4FA 4EEPA 5HAPA 4ETZA 4B4ZA 2A49A 4MMNA 5A90A 2INWA 5IU1A 2B18A 3W8KA 3B47A 4LRXC 3OCNA 4WYYA 4U0TA 2PT7A 2GX5A 4MN5A 1BLSA 3EGDC 5EOEA 3ZVWA 4F3LA 1SDEA 4L9FA 4PM9A 4OPZA 2WKIA 3HUNA 2J3TC 4LENA 5EM1A 2HJEA 4ZBEA 2WADA 1M6KA 3CMZA 3HJKA 5CEDA 5L2FA 2VGLS 2XH9A 4CLCE 5EVLA 5CTMA 3SH8A 1SZVA 2Z2MB 4JKTA 3MKEA 2B95A 3ZG9B 4PM8A 3OPLA 4S2OA 3MBZA 1E3UD 1T1AA 5FSRA 3L9KA 3ZGAB 1KGGA 4HH3A 3SS4A 2X71A 4B9OA 4IEDA 4OOMA 5E2GA 1LL8A 1T19A 3FYZA 3S7NA 2XFSA 1NJ4A 4ZJ3A 5KZHA 3BFEA 3RH8B 1VEUB 1IYOA 1YSQA 3LIBA 2B5RA 2EFXA 3KYZA 4BBVA 1K54C 4Q0JA 3PYPA 3S7OA 1FIKA 2V9AA 2W27A 1KGEA 4DE1A 1HTZA 2FH5A 3IXGA 5D3OA 1YM1A 5DTTA 5HWVA 3HLGA 2EXBA 1OT6A 4WZ4A 4BJPA 4ZDXA 3LIEA 3LR4A 1LHYA 4EU0A 4CLCD 5DF9A 2Y2PA 1S0WA 5JYOA 4HNBA 3LY4A 4ZRRA 2HF6A 3T12B 5HSQA 2OAP1 4JGRA 4FD8A 3TE8A 1LL5A 3A3JA 2VV7A 4KZ5A 1BUEA 2OV5A 2QKPA 3LICA 4G3VA 2YKFA 1K4EA 1D06A 1K56A 5A91A 1PFLA 3GVBA 3MJQA 2G2WA 1BSGA 3DTMA 2V1BA 3V3RA 2X01A 4GJ4A 3A3FA 3LIAA 5JYPA 3BECA 4Y7PA 2PD8A 1NZUA 1S6RA 3Q82A 4KZ3A 3E98A 1SDNA 2ZM0A 4YWZA 1DJCA 3T1SA 4EBLA 2V2FF 4I3JA 2HJ9C 4E3MA 4EESA 1OJ5A 3HLWA 3P09A 2ZM2A 5LBRA 2JHEA 4D2OA 4EBPA 1KVMA 4E04A 3TSGA 3B3XA 3A0SA 5AVEA 2WGVA 2WKHA 3VSLA 1SKOB 4NXFA 3VOLA 3BJNA 2W3EA 1DP6A 3A3DA 2ZC5B 3IF6B 3MZDA 3CITA 2EWWA 1LL9A 5HPIA 5L10A 4HP4A 5GLCA 2EX2A 5EM0A 5M19A 3QP2A 4GS9A 2X02A 4JGQA 1E4DA 2ZJ9A 3VE3A 3MZEA 2Y8HA 1FSWA 2RL3A 5C5KA 5DVAA 4LPZA 5J8XA 3VV4A 2FFFB 3NDEA 3KO6A 2VGJA 1K6SA 1VHMA 1ZG4A 3SW1A 3IBJA 4E3LA 2PR6A 4EUZA 3UN7A 4XUZA 1ALQA 4B4XA 4IBXA 1L0DA 4MCWA 1PW1A 1RCJA 1T1CA 2M7UA 4O01A 3LI8A 4PKYA 2J9OA 5FL3A 4P6BA 1YLTA 2BASA 1G68A 1ACFA 2O9CA 1OPXA 2WZXA 3BY8A 1O7EA 2ZM8A 5G18A 4R3BA 3LFVA 1PNEA 1GA9A 5HD3A 1S4SA 5CHJA 2Y2IA 1FOFA 2IWDA 1ESUA 1NWZA 4GCZA 3ZNTA 2L1MA 1G28A 2DMWA 1XPBA 2JBFA 1JTDA 5CEBA 4LV2A 3T4OA 1I2WA 3QNBA 3BYDA 1TF1A 1ZKJA 4YNRA 3IBRA 5L09A 1JWZA 3AGDA 5FDHA 4EQ1A 3OOVA 2WKEA 3MSHA 1MY8A 3LUQA 4RQ9A 3QP5A 4HEFA 3N4IA 3IX3A 4GB7A 1K54A 3PBTA 5J7EA 3KYEA 2QZ6A 2LB5A 2V20A 3PAEA 4X68A 5M1AA 4BBTA 4YFMA 2Y2JA 3H7WB 1XA7A 2W3GA 4LGWA 3Q7VB 4R3JA 4LRZE 2OLVA 3VOZA 5TR7A 3PBOA 1XXMA 1KGFA 2RCXA 4FH2A 1MZUA 3ZYTA 4EQIA 2E8JA 3T4LA 1L0EA 3NOPC 2E8IA 2EX6A 4OP8A 2R9XA 2A24B 4OQ0A 4R70A 1ES3A 1NZOA 5A92A 2ZBBA 5DJUA 2Y4AA 3V67A 1FSYA 3ZHHA 4WMCD 5FASA 2AVXA 3VOYA 4EBNA 1PYYA 4WUJA 5DFXA 1W63M 5GHZA 1BLPA 3A3EA 4WN5A 2G2UA 2XFTA 3MQOA 3HL9A 1V9ZA 2QJ5A 2WK0A 1X0OA 4I39A 4IHQA 1BT5A 3S7QA 2ZQ8A 5E2FA 1H8ZA 3PTEA 1QMEA 3R7WB 4MBFA 1OTBA 2WGWA 3S7PA 3FKWA 1D1JA 4FSFA 5J3WA 1K25A 1PWCA 2P9VA 3O88A 4JBFA 3K3DA 1OMEA 2H28A 2JCHA 3KSHA 1MC0A 4QY6A 4R4RA 2Q0OA 4XT2B 2UV0E 3PBSA 1CEFA 1MWTA 2IA2A 1IKGA 3F1OB 3C2WA 4CLCB 4KG2A 3MFXA 1NLZA 2Y2MA 3ZFZA 5J4EA 2ZQDA 4JXVA 2JKTM 5HAQA 1JTGA 4KG6A 4XXRA 1YSPA 3UY6A 1NYMA 1S4RA 1UGUA 5AQBA 2XA7S 2V1AA 2JE5A 2ZQ9A 1YAXA 4C75A 3S4XA 4C3QA 4HESA 3GR2A 2ZL1A 4WEKA 3KYQA 1GHMA 4DN0A 2QMIA 3O5YA 2W0NA 3G2ZA 4EETB 4FCFA 1EI5A 4IBRA 1Z09A 3T4QA 3UDFA 4NXEA 3FKVA 4OPRA 2HDUA 2J7VA 2VLGA 2IWCA 5DF8A 3ZNYA 4QY5A 3VFFA 3NJAA 5K5BA 3UB5P 4H6JA 1GSWA 4PHTA 3DW0A 2VGKA 1F2KA 4XUXA 3BY9A 1ZG6A 5TBMA 1XFNA 4IVKA 2PYPA 1W79A 3LEQA 3BM6A 3ITAA 2ACGA 3OPPA 3IX4A 4EWFA 2DCFA 3GQZA 2VGLM 4JXWA 5CHUA 1PWGA 5EE8A 3LR0A 1T18A 4F3LB 5FAOA 2KLIA 4MLLA 1I5QA 3LGOA 3OLOA 4PM5A 5F1GA 3BFFA 4UAAA 5EVIC 3WS1A 1IFQA 1OTIA 2K2NA 4GN2A 4KZAA 1XJ4A 4E3OA 1NRFA 3FG8A 1L0GA 4Y17A 1C3BA 3RXWA 2PBYA 4KZ8A 5E43A 1DP8A 2P74A 1P9WA 3NC8A 4B93A 3E2KA 2V8CA 3C7VA 3UDXA 1KE4A 4RA7A 2QHKA 4OPQA 1BULA 3VE4A 2A3UA 3VP0A 3BQAA 4KUOA 4JXGA 3MXSA 3BQ8A 4FUWA 1CQAA 1S67L 5CGWA 5KSHA 1I2SA 3HLFA 5HD5A 1AWIA 5IHVA 3V3SA 4MNRA 3B42A 4JF5A 1N9NA 2P08A 4C6YA 2J9PA 2Y2LA 5HFOA 2HZ5A 3SS3A 2CMNA 2FZ0A 2P7JA 4ETXA 1P9RA 3S1YA 3UPPA 1PIOA 3H82A 4P6ZM 2V0WA 5CERA 4Y13A 3LO7A 3TG9A 4ME4A 3UMDA 4ZJ2A 1H5XA 3Q81A 4ESPA 5GLBA 3ZG7B 2R78A 3IWOA 5DFYA 4BL2A 4DMZA 1GHPA 3ULFA 1WYCA 3N8RA 4Y3IA 1G5UA 3NY4A 1JWVA 5CGXA 3NIAA 5F68A 3OC2A 4P87A 3NDGA 4WZ5C 4MN7A 1L0FA 3WWXA 4BD1A 5FEFA 4P0MA 1Q2QA 2Y79A 4IUHA 3LI9A 3ZDJA 5HPFA 4HP9A 4U3TA 5FAQA 4P6ZS 1YLZA 4KQQA 2JN7A 1CF0A 3M2JA 2WGIA 1WYBA 4S2LA 4UEYA 5L8MA 4GZBA 2QWSA 4K0WA 1F9IA 3G30A 3VP1A 4I3IA 3C4OA 5A93A 4GHIA 4KG5A 3D3OA 5TJJA 4OQIA 1RGYA 4NETA 3NECA 3CJMA 5AVFA 4KZ9A 1SKFA 5FI6A 1YMSA 4HBTA 2ZOHA 4GS9B 3VP3A 3IHBA 5F6AA 3NI9A 3LIFA 5EV0A 1NYYA 5HZHA 4GLQA 4E3JA 4X6TA 2VEAA 3PR6A 4OH0A 2EWVA 3ZG5A 1VETA 3CG5A 3GECA 2WAEA 2HP9A 4ZTKA 1YLYA 5EPHA 3F1PA 3ZCZA 4NXBA 3E4OA 3MQ0A 5DKLA 3U4LP 3UB7A 3O87A 2PAVP 3CZDA 5GL9A 3IWIA 3C38A 2EX8A 3ITBA 1N9BA 1OTAA 5I5LA 1ES2A 3NOTC 3CPTB 1W7FA 4CLCC 5EVIA 4PPRA 3M2KA 3DTIA 2Y2GA 4YINA 3D4FA 3HLEA 4HJ3A 1MPLA 3UNWA 4RX3A 1W63Q 4OPYA 4N9KA 4WELA 3FWLA 1TEMA 4GOGA 1G6OA 4D60A 2V1ZA 5EVEA 2Y2KA 1XX2A 1K57C 5FQMA 3M6BA 2H0YA 2QYBA 1ERMA 3LEZA 3MXQA 3PBQA 1XJ6A 3VMAA 1BLHA 2Y2OA 1PZOA 4BLMA 1MXOA 2ZQ7A 1ZC2A 3H9WA 4S2NC 4RVAA 2ZC6B 3O86A 3IXBA 5IT5A 4DXBA 4NKPA 2PBDP 3RFBA 1JWPA 4K0XA 1PWDA 1U60A 5F83A 3G34A 1TS0A 3WS4A 2CC1A 3MS6A 3SS5A 2PHYA 3T50A 5G4YA 3SOIA 3GMWA 2HV1A 3OPRA 4MBHA 3A3IA 1XGJA 4GD8A 3HLBA 2VKSA 3N8SA 5HDDA 2EX9A 4O0PA 2HDQA 2ZC3B 4L9GA 1MWUA 2W3HA 5GLAA 2VJWA 4M4XA 3Q1FA
chains in the Genus database with same CATH topology
2PDRA 3E4PA 4G3WA 2NUTC 3A0RA 3KYQA 3FPWA 3EQVA 4WEKA 4DN0A 4Y5FA 3HJIA 4HH3A 1LT0A 4B9OA 3O5YA 2W0NA 4EETB 4OOMA 2W1TA 1LL8A 5EFWA 3T4QA 1T19A 1XJ3A 4NXEA 3S7NA 4I5SA 4MDZA 3RH8B 1TS6A 2VLGA 3CWFA 1TS7A 1YSQA 3LIBA 3E4QA 4WL9A 3KYZA 4BBVA 3NJAA 4WEJA 2J3WA 5K5BA 1DP9A 4Q0JA 1VB6A 2YKHA 3PYPA 3S7OA 2V9AA 1LSWA 2W27A 4H6JA 1GSWA 4PHTA 2OAQ1 4OOLA 4BMWA 1UWNX 2FH5A 2I9VA 2PYRA 4GW9A 3BY9A 1OTDA 5TBMA 1XFNA 1LSVA 2PYPA 5HWVA 1H3QA 1ZHHB 2JKTI 1EW0A 1OT6A 3EEHA 4BJPA 4II7A 4NEED 4HY8A 3LIEA 3LR4A 2VGLM 2W1RA 3PBRA 4EU0A 4CLCD 5DF9A 3LR0A 1YKDA 1T18A 2P04A 3EGXC 3T4TA 4PKYG 5CX7A 4BWIA 2KLIA 2MJ6A 4F3LB 4I38A 3LR3A 1N9LA 2VV8A 2XA7M 2L0WA 3EWKA 3KSIA 4HNBA 4ZRRA 4EW7A 2HF6A 2GNXA 2KDKA 3OLOA 5HSQA 2OAP1 4JGRA 1TS8A 2A24A 2WKQA 3DBAA 3TE8A 2VV7A 1MKMA 3OCLA 1IFQA 2QKPA 1OTIA 2K2NA 1ODVA 3LICA 4ARZA 4G3VA 3BWLA 3EEAA 2YKFA 4Y2FA 4EXOA 1XJ4A 1D06A 2K31A 3FG8A 3CUEA 3HCYA 2O0YA 3LYXA 3MJQA 4UQIM 1P0ZA 2V1BA 5DKKA 1OT9A 3FC7A 4GJ4A 1DP8A 1P9WA 4B93A 4K08A 3LIAA 2WKRA 2W1TB 2L4RA 2PD8A 2QHKA 3MMHA 4IJGA 2OWHA 3E98A 2HGVA 2D01A 5G4ZA 4YWZA 4HIAA 3VE4A 4HOIA 3P01A 3LIDA 3BQAA 4G3KA 4KUOA 3JVUA 4I3JA 3UMEA 3C8CA 2J3TD 3BQ8A 2M7VA 2HJ9C 4R6LA 4EESA 1OJ5A 2Z6DA 1S67L 5LBRA 4YOFA 4H6JB 5KSHA 2JHEA 2O9AA 4E04A 2XROA 3LR5A 5HD5A 3FPVA 3A0SA 5AVEA 4XT2A 5TBMB 3B42A 2M1CA 3NHQA 1N9NA 2P08A 4QPRA 3T4JA 4NXFA 3T4SA 3VOLA 3BJNA 2W3EA 3CLOA 4CLCA 1DP6A 2CMNA 2O99A 4R38A 2FZ0A 2WKPA 3CITA 4LLOB 4HJ6A 2EWWA 4UQIS 5HPIA 2P7JA 4HP4A 4MN6A 4ETXA 1P9RA 1T1BA 2KX6A 4PAUA 1BYWA 1NRJA 3W2ZA 4GS9A 5IS1A 3RTYA 3H82A 4JGQA 4P6ZM 2PD7A 3MF0A 1Y28A 2V0WA 1WA9A 3VE3A 2Y8HA 4HH2A 1GSXA 3K3CA 4JGPA 5C5KA 5KIZA 4L0LA 4ME4A 3UE6A 3UMDA 4LPZA 3VV4A 2R78A 3KO6A 5DFYA 4DJ2A 1VHMA 3H7WA 1XJ2A 4ARZB 3SW1A 4DMZA 2B02A 3IBJA 4EERA 2PR6A 2EA9A 1NLYA 3ULFA 3IS2A 1XFQA 4Y3IA 2JKRI 1N9OA 4MCWA 2VV6A 5F68A 1T1CA 3OC2A 2M7UA 4O01A 3LI8A 4MN7A 4PKYA 3TW8A 5FL3A 3CAXA 3C30A 3U2AA 5HL6A 3F1NA 2BASA 1OTEA 2Y79A 1LSXA 2O9CA 3LI9A 4IUHA 5HPFA 1IOUA 1OPXA 2LB9A 4HP9A 3BY8A 4KUKA 4DJ3A 4P6ZS 3JVVA 1P97A 3R4KA 3UB8A 3PHYA 4KQOA 3LFVA 3OBFA 3ICYA 5HD3A 1S4SA 2W3FA 2JN7A 3ZQ5A 2NUPC 4UEYA 5L8MA 3BW6A 3A0VA 1NWZA 4GCZA 2L1MA 2VX8A 1DRMA 2QWSA 1G28A 2DMWA 1F9IA 2VZWA 4KQDA 5F69A 4I3IA 5HDSA 4GHIA 3T4OA 1KOUA 4O8GA 2KOIA 2XRNA 3D3OA 5TJJA 2ZOIA 5HWTA 3UE3A 1TF1A 2OOLA 3R7WA 4BBUA 4YNRA 3IBRA 3KX0X 4CQHA 5AVFA 4JGOA 4Q0HA 4EQ1A 1S1YA 3D72A 3CUEC 3OOVA 2JKRM 2ZOHA 3KSGA 4GS9B 4AFIA 3H82B 3LUQA 1S1ZA 2J80A 5F6AA 1S66L 3K2NA 3LIFA 2A2LA 4RQ9A 5HZHA 3P7NA 3G6OA 4GLQA 4WLAA 2VEAA 3PR6A 2EWVA 3PXPA 3PBTA 5J7EA 4HJ4A 3F1OA 1D7EA 3KSFA 3TRCA 2LB5A 4BBTA 3GECA 2Z6CA 3PBNA 4IUKA 3H7WB 3EOIA 2W3GA 2OWJA 4LRZE 3UB9A 2GJ3A 3F1PA 1F5MA 1GSVA 4EUVA 3PBOA 4NXBA 2ZMFA 3E4OA 3IS2B 3MQ0A 4L9EA 5DKLA 3B33A 3UB7A 1TD5A 1MZUA 3ZYTA 3T4LA 3NOPC 3TJZC 3E0YA 1V9YA 2V0UA 2VA0A 2A24B 1JNUA 2W3DA 3C38A 4LRYC 3MR0A 4R70A 1H8MA 2ZBBA 5HDCA 5DJUA 5F5YA 3V67A 1OTAA 2ZMVA 3F1NB 2XSSA 5I5LA 2GZAA 3NOTC 4CLCC 3MQQA 4EEUA 4WUJA 5DFXA 1W63M 4WF0A 4WN5A 4HJ3A 3MQOA 3GDIA 1V9ZA 1W63Q 2K7SA 2PR5A 4WELA 2QJ5A 1G6OA 4R3AA 1X0OA 4HI4A 4I39A 4IHQA 4HQAA 1F98A 3S7QA 5HWWA 4GHIB 4Z1WA 3UB6A 5A8BA 4EEPA 3R7WB 1OTBA 2QYBA 4ETZA 3MXQA 3PBQA 3S7PA 4FSFA 5J3WA 1UWPX 1XJ6A 4FOFA 4MMNA 3K3DA 3T4KA 2INWA 3CI6A 3H9WA 5IU1A 2B18A 3B47A 4NXGA 2O9BA 2H28A 4LRXC 3KSHA 1MC0A 3NOUC 5IT5A 3OCNA 1ZTUA 4NKPA 3RFBA 4XT2B 2PT7A 2GX5A 4MN5A 3PBSA 3EGDC 4F3LA 4I3AA 2IA2A 3F1OB 4HHDA 1TS0A 1STZA 3C2WA 4CLCB 5AJGA 2G7UA 4L9FA 3MFXA 1NLZA 2PHYA 3T50A 5G4YA 2J3TC 2HV1A 2HJEA 2QJ7A 5J4EA 3HJKA 3F1PB 2JKTM 2VKSA 1YSPA 2VGLS 5HDDA 4O0PA 4CLCE 4Q0IA 1S4RA 5MC7A 1UGUA 5DJTA 4L9GA 2XA7S 2V1AA 1OJGA 2W3HA 1YAXA 1T1AA 2VJWA 3EQUA 4M4XA 2D02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LRY C;  2M7U A;  4R70 A;  4G3W A;  4O01 A;  4MN7 A;  4DN0 A;  4Y5F A;  2XSS A;  5I5L A;  2W1T B;  3NOT C;  3O5Y A;  5HL6 A;  2W1T A;  2Y79 A;  3MMH A;  2O9C A;  4IUH A;  4IJG A;  5HPF A;  2LB9 A;  5DFX A;  3E98 A;  3S7N A;  2HGV A;  3R4K A;  4MDZ A;  4G3K A;  3LFV A;  3OBF A;  1YSQ A;  2W3F A;  2M7V A;  4R6L A;  3ZQ5 A;  5LBR A;  5K5B A;  4YOF A;  5L8M A;  4Q0J A;  3S7O A;  2O9A A;  4E04 A;  2XRO A;  3S7Q A;  2VZW A;  4Z1W A;  3NHQ A;  4GW9 A;  2KOI A;  4O8G A;  2XRN A;  3D3O A;  4QPR A;  5TJJ A;  2QYB A;  1TF1 A;  2OOL A;  4ETZ A;  3BJN A;  4YNR A;  2W3E A;  3IBR A;  3S7P A;  4FOF A;  4CQH A;  4MMN A;  2O99 A;  3CIT A;  4Q0H A;  5HPI A;  4ETX A;  3CI6 A;  3OOV A;  3KSG A;  2W1R A;  2B18 A;  4PAU A;  4EU0 A;  2O9B A;  4LRX C;  3W2Z A;  3KSH A;  1YKD A;  1MC0 A;  3NOU C;  3K2N A;  1ZTU A;  3RFB A;  4RQ9 A;  3MF0 A;  4BWI A;  2GX5 A;  2KLI A;  3G6O A;  4GLQ A;  2VEA A;  3KSI A;  4ZRR A;  2IA2 A;  2Y8H A;  5HSQ A;  1STZ A;  5C5K A;  3C2W A;  5AJG A;  2G7U A;  4ME4 A;  3KSF A;  3TRC A;  2LB5 A;  3VV4 A;  3DBA A;  4IUK A;  3KO6 A;  5DFY A;  1VHM A;  1MKM A;  2W3G A;  2K2N A;  4DMZ A;  4LRZ E;  2VKS A;  1YSP A;  3IBJ A;  1F5M A;  4O0P A;  4G3V A;  4EUV A;  4Q0I A;  2ZMF A;  3MQ0 A;  3EEA A;  4Y2F A;  2K31 A;  1TD5 A;  3HCY A;  4Y3I A;  2O0Y A;  3NOP C;  2W3H A;  3E0Y A;  2VJW A;  4MCW A;  2W3D A; 
#chains in the Genus database with same CATH topology
 2PDR A;  1W8Q A;  1LLB A;  1K56 D;  4WBG A;  5KSC A;  4G3W A;  3A0R A;  4S2J A;  4QD4 A;  3FPW A;  2WAF A;  3QP8 A;  3I7J A;  2W1T A;  5E2E A;  4ZAM A;  4I5S A;  4BD0 A;  5I94 A;  4MDZ A;  5TFQ A;  2ZQC A;  4OP5 A;  3CWF A;  1TS7 A;  3BLS A;  3Q07 A;  4WL9 A;  4WEJ A;  2J3W A;  2Z2L B;  1TDG A;  3ZG8 B;  1VB6 A;  2YKH A;  3T1Q B;  1PI5 A;  1LSW A;  1VM1 A;  4OOL A;  1LI0 A;  1VQQ A;  2I9V A;  3IWQ A;  4X55 A;  4WZ5 A;  3DAV A;  2WGW B;  1LSV A;  2HPB A;  1H3Q A;  2JKT I;  1EW0 A;  4II7 A;  3V39 A;  4BL3 A;  1YLJ A;  2Y2N A;  4NEE D;  1K38 A;  3RXX A;  3PBR A;  4E3N A;  1YKD A;  4PKY G;  4BWI A;  1ES4 A;  2MJ6 A;  4I38 A;  3LR3 A;  3BEB A;  3KSI A;  2VV8 A;  2XA7 M;  2L0W A;  4EW7 A;  2R9W A;  2GNX A;  4LV1 A;  1PI4 A;  4DE0 A;  4E6W A;  1TS8 A;  2A24 A;  2WKQ A;  3WS0 A;  3DWK A;  3VFH A;  4UHU A;  3UO9 A;  2XDM A;  1CK3 A;  3OCL A;  1SCW A;  5FQ9 A;  4ARZ A;  2XK1 A;  4IVI A;  3BWL A;  3EEA A;  4QJG A;  3OZH A;  4Y2F A;  4EXO A;  2C6W B;  2HP5 A;  3HCY A;  3LYX A;  3BLM A;  5EVI D;  1K55 C;  5EOO A;  2ZL1 B;  1P0Z A;  1W5D A;  1KE3 A;  1OT9 A;  3FC7 A;  4KQR A;  4K08 A;  3DTE A;  2WKR A;  3Q7Z A;  4EV4 A;  4IJG A;  2OWH A;  2HGV A;  2D01 A;  5G4Z A;  4Q8I A;  4HOI A;  3WRZ A;  2ZC7 A;  3LY3 A;  3LID A;  4G3K A;  3HVF A;  1Q2P A;  2J3T D;  4R6L A;  3G4P A;  4H6J B;  3GRJ A;  5F1F A;  2O9A A;  5HX9 A;  3UPN A;  1CI9 A;  2XRO A;  4XT2 A;  5TBM B;  4DDY A;  2M1C A;  5FQJ A;  3SH7 A;  1G6A A;  3T4J A;  3QP1 A;  1YQS A;  4CLC A;  1YMX A;  3RJU A;  3HLC A;  4Y0U A;  2O99 A;  4LLO B;  3PAG A;  1MWS A;  2OSU A;  1BYW A;  1NRJ A;  2Y2Q A;  5CHM A;  2PD7 A;  3DTK A;  3MF0 A;  5AQ9 A;  4BEN A;  2EXA A;  4HH2 A;  1H8Y A;  1GSX A;  3NUL A;  1K57 A;  3K3C A;  3C5A A;  1O07 A;  4JGP A;  4R4S A;  5KIZ A;  4L0L A;  3T1X A;  1FCO A;  4GDB A;  1LI9 A;  1HZO A;  4CPK A;  1XJ2 A;  2EA9 A;  3UE0 A;  1NLY A;  1EWZ A;  3IS2 A;  4DDS A;  4S2N A;  2JKR I;  2VV6 A;  5HL1 A;  5HW3 A;  1ERQ A;  3IQA A;  3TW8 A;  5M18 A;  3C30 A;  5AQ7 A;  3U2A A;  4S2P A;  2JKF A;  3F1N A;  1OTE A;  4HBU A;  1LSX A;  4F94 A;  1IOU A;  2LB9 A;  1AXB A;  4DJ3 A;  3IF6 C;  3UB8 A;  4B88 A;  3PHY A;  1BLC A;  3HUO A;  2VK3 A;  3OBF A;  3ICY A;  1Y54 A;  2QPN A;  1ONG A;  3FZC A;  3ZQ5 A;  2NUP C;  4S2K A;  3A0V A;  2VX8 A;  4K91 A;  1HD8 A;  5DTS A;  2VZW A;  5EUA A;  5F69 A;  1MBL A;  3G35 A;  4R1G A;  5HDS A;  1KOU A;  4O8G A;  2J8Y A;  5EEC A;  1FR1 A;  2OOL A;  3MXR A;  5FI7 A;  2PU2 A;  4BBU A;  1KE0 A;  4OVD A;  4CQH A;  4LV3 A;  1CJF A;  1K6R A;  4Q0H A;  3D72 A;  4NK3 A;  4E6X A;  3CUE C;  2JKR M;  3H82 B;  3SZT A;  2J80 A;  1FQG A;  3K2N A;  3AGE A;  4LCM A;  3PXP A;  4HJ4 A;  1D7E A;  5KMW A;  3L7H A;  2Z6C A;  5DF7 A;  4KEN B;  3PBN A;  2XD1 A;  1TDL A;  1IEL A;  4Y15 A;  2GJ3 A;  3M6H A;  1F5M A;  2BG1 A;  2Y59 A;  4EUV A;  4L9E A;  4X1M A;  4QB8 A;  3SH9 A;  3B33 A;  1HLU P;  4Y0O A;  1YLP A;  1V9Y A;  2V0U A;  1JNU A;  5CTN A;  2Y2H A;  1H8M A;  1FIL A;  5HAR A;  5HDC A;  5F5Y A;  2XR0 A;  2XSS A;  2GZA A;  4R0Q A;  1TVF A;  4P85 A;  1GA0 A;  1QMF A;  3MQQ A;  5GHX A;  1J9M A;  1DY6 A;  1ES5 A;  3V5M A;  5AQA A;  2K7S A;  4UA9 A;  1VEU A;  3BFC A;  3W4O A;  2ZLY A;  4R3A A;  4HI4 A;  4JF4 A;  1BZA A;  1K55 A;  4HQA A;  5FAT A;  5HWW A;  4GHI B;  4UA7 A;  3UB6 A;  5FAP A;  5F82 A;  1UWP X;  4FOF A;  4Y0T A;  3BFG A;  3T4K A;  4GDN A;  4N9L A;  1W8Y A;  3CI6 A;  4NXG A;  2O9B A;  3NOU C;  1ZTU A;  4I3A A;  1DJB A;  4HHD A;  1STZ A;  1ONH A;  1VET B;  3IT9 A;  5CGS A;  2G7U A;  5AJG A;  2FFY A;  3G32 A;  1A0K A;  1J3W A;  2QJ7 A;  5FQI A;  4E3K A;  4KZ4 A;  3F1P B;  5E2H A;  3QP4 A;  4RX2 A;  3HUM A;  2WUQ A;  5GHY A;  4Q0I A;  4DF6 A;  5MC7 A;  1PW8 A;  5FQQ A;  5DJT A;  4X25 A;  1OJG A;  1KDW A;  4OON A;  3EQU A;  5FA7 A;  2D02 A;  4WMC A;  2HP6 A;  3E4P A;  3VP2 A;  5GLD A;  2NUT C;  4M3K A;  4MEZ A;  3EQV A;  3MZF A;  3N8L A;  4Y5F A;  1YPR A;  3HJI A;  1LT0 A;  1MWR A;  1XA1 A;  3JYI A;  3WS5 A;  1IYS A;  4DKI A;  5EVI B;  2XEP A;  5EFW A;  1XJ3 A;  3LCE A;  3GTC A;  1XGI A;  1KVL A;  3P98 A;  2Q9M A;  3ISG A;  2WYX A;  1TS6 A;  2Y91 A;  1M40 A;  3E4Q A;  1KDS A;  1ESI A;  4PMA A;  1DP9 A;  4KZ6 A;  1PRQ A;  2DNS A;  2JKG A;  1CEG A;  3FV7 A;  3N7W A;  4X1L A;  2OAQ 1;  3VSK A;  5DTK A;  2Y55 A;  4BMW A;  2EFU A;  4X56 A;  1UWN X;  2PYR A;  1L3L A;  4GW9 A;  2WZZ A;  1OTD A;  4DE2 A;  1ZHH B;  1SKO A;  3EEH A;  2ZMA A;  1DJA A;  3OPH A;  3IF6 A;  4HY8 A;  1XP4 A;  2W1R A;  4GKU A;  2P04 A;  3EGX C;  3T4T A;  3WRT A;  3C4P A;  5CX7 A;  5FI2 A;  1HVB A;  1N9L A;  2C5W B;  1H0M A;  3EWK A;  1NXY A;  2BLS A;  2KDK A;  2HDS A;  1E25 A;  4GNU A;  1L2S A;  3CHW P;  1IEM A;  3DBA A;  2PRF A;  3AGF A;  1MKM A;  1PZP A;  1YT4 A;  3CPT A;  1ODV A;  1IKI A;  3IXD A;  2I72 A;  2K31 A;  3CUE A;  5HAI A;  2O0Y A;  3S22 A;  3NBL A;  1CI8 A;  4UQI M;  1MKI A;  2H0T A;  4MBK A;  1YLW A;  2OLU A;  5DKK A;  2XQZ A;  5TGF A;  1Z6F A;  2W1T B;  4DRT A;  1NY0 A;  2L4R A;  3G31 A;  3MMH A;  3T1R A;  3UDI A;  3MKF A;  4Z9Q A;  4HIA A;  3P01 A;  3E2L A;  3JVU A;  2DRW A;  3UME A;  3C8C A;  2M7V A;  4ZJ1 A;  2Z6D A;  4YOF A;  4OKP A;  3N6I A;  4KZB A;  3MFD A;  4S2I A;  3LR5 A;  1GHI A;  3FPV A;  4QU3 A;  3NHQ A;  5FEG A;  4QPR A;  3T4S A;  3ZG0 A;  3CLO A;  2JC7 A;  4R38 A;  1WE4 A;  2WKP A;  4JLF A;  4HJ6 A;  4UQI S;  4MN6 A;  1T1B A;  2KX6 A;  3D9Y A;  4PAU A;  3W2Z A;  5IS1 A;  3RTY A;  5CEC A;  1Y28 A;  1WA9 A;  1FCM A;  4DXC A;  3IXH A;  4OLD A;  1RGZ A;  4S2M A;  2H10 A;  2GDN A;  3IH9 A;  2P9V B;  3ZVT A;  3V50 A;  3UE6 A;  3BRM A;  4PM6 A;  4QHC A;  4JXS A;  2XGN A;  4DJ2 A;  2HDR A;  3H7W A;  4LCL A;  4ARZ B;  2B02 A;  4E3I A;  4EER A;  3Q7V A;  2XLN A;  4WM9 A;  5FQK A;  1SHV A;  1XFQ A;  4O7D A;  4BQM A;  1N9O A;  2ZD8 A;  5CRF A;  3W4P A;  3TOI A;  1FCN A;  5L07 A;  3QNC A;  4X69 A;  4UA6 A;  5CXW A;  3G2Y A;  1N4O A;  3CAX A;  3DWZ A;  5HL6 A;  1E3U A;  3W4Q A;  1XKZ A;  4ID4 A;  4KUK A;  4N92 A;  3JVV A;  1P97 A;  3R4K A;  4OQG A;  4GD6 A;  4N1H A;  4KQO A;  3IH8 A;  2H5S A;  3IHA A;  4FH4 A;  2W3F A;  2XF3 A;  2Q9N A;  2IWB A;  3BW6 A;  4KZ7 A;  2V8F A;  1DRM A;  2ZQA A;  1FR6 A;  4KQD A;  1K0K A;  2KOI A;  1IYQ A;  2XRN A;  2ZOI A;  4U0X A;  5HWT A;  3UE3 A;  3HBR A;  3QHY A;  3R7W A;  3BFD A;  3KX0 X;  3C7U A;  2BTF P;  4JGO A;  4JF6 A;  1S1Y A;  2PU4 A;  4LFU A;  3KSG A;  4N1X A;  4AFI A;  4OLG A;  3UPO A;  1S1Z A;  2ZC4 B;  1S66 L;  1Y4O A;  3WS2 A;  4RYE A;  2A2L A;  3P7N A;  3G6O A;  4WLA A;  1GCE A;  4OOY A;  4DE3 A;  3GV9 A;  3F1O A;  2XD5 A;  3NCK A;  4CJN A;  3UE1 A;  3IX8 A;  3KSF A;  1BTL A;  3JPU A;  4FTX A;  3TRC A;  5BOH A;  4JPM A;  4IUK A;  3O3V A;  2UWX A;  3EOI A;  2OWJ A;  3UB9 A;  1IYP A;  1GSV A;  2ZMF A;  3IS2 B;  1ERO A;  1TD5 A;  5FDS A;  3TJZ C;  3HRE A;  3E0Y A;  4H8R A;  4LV0 A;  2VA0 A;  2W3D A;  3GSG A;  4LRY C;  3MR0 A;  4X53 A;  3VP4 A;  4NG2 A;  2ZMV A;  4OQH A;  3F1N B;  3HLD A;  4EEU A;  3QP6 A;  4WF0 A;  4QWO A;  3GDI A;  4A5R A;  5U47 A;  2PR5 A;  1JVJ A;  1RP5 A;  3IF5 A;  4R23 A;  1F98 A;  4PM7 A;  4Z1W A;  5A8B A;  1K4F A;  4EEP A;  5HAP A;  4ETZ A;  4B4Z A;  2A49 A;  4MMN A;  5A90 A;  2INW A;  5IU1 A;  2B18 A;  3W8K A;  3B47 A;  4LRX C;  3OCN A;  4WYY A;  4U0T A;  2PT7 A;  2GX5 A;  4MN5 A;  1BLS A;  3EGD C;  5EOE A;  3ZVW A;  4F3L A;  1SDE A;  4L9F A;  4PM9 A;  4OPZ A;  2WKI A;  3HUN A;  2J3T C;  4LEN A;  5EM1 A;  2HJE A;  4ZBE A;  2WAD A;  1M6K A;  3CMZ A;  3HJK A;  5CED A;  5L2F A;  2VGL S;  2XH9 A;  4CLC E;  5EVL A;  5CTM A;  3SH8 A;  1SZV A;  2Z2M B;  4JKT A;  3MKE A;  2B95 A;  3ZG9 B;  4PM8 A;  3OPL A;  4S2O A;  3MBZ A;  1E3U D;  1T1A A;  5FSR A;  3L9K A;  3ZGA B;  1KGG A;  4HH3 A;  3SS4 A;  2X71 A;  4B9O A;  4IED A;  4OOM A;  5E2G A;  1LL8 A;  1T19 A;  3FYZ A;  3S7N A;  2XFS A;  1NJ4 A;  4ZJ3 A;  5KZH A;  3BFE A;  3RH8 B;  1VEU B;  1IYO A;  1YSQ A;  3LIB A;  2B5R A;  2EFX A;  3KYZ A;  4BBV A;  1K54 C;  4Q0J A;  3PYP A;  3S7O A;  1FIK A;  2V9A A;  2W27 A;  1KGE A;  4DE1 A;  1HTZ A;  2FH5 A;  3IXG A;  5D3O A;  1YM1 A;  5DTT A;  5HWV A;  3HLG A;  2EXB A;  1OT6 A;  4WZ4 A;  4BJP A;  4ZDX A;  3LIE A;  3LR4 A;  1LHY A;  4EU0 A;  4CLC D;  5DF9 A;  2Y2P A;  1S0W A;  5JYO A;  4HNB A;  3LY4 A;  4ZRR A;  2HF6 A;  3T12 B;  5HSQ A;  2OAP 1;  4JGR A;  4FD8 A;  3TE8 A;  1LL5 A;  3A3J A;  2VV7 A;  4KZ5 A;  1BUE A;  2OV5 A;  2QKP A;  3LIC A;  4G3V A;  2YKF A;  1K4E A;  1D06 A;  1K56 A;  5A91 A;  1PFL A;  3GVB A;  3MJQ A;  2G2W A;  1BSG A;  3DTM A;  2V1B A;  3V3R A;  2X01 A;  4GJ4 A;  3A3F A;  3LIA A;  5JYP A;  3BEC A;  4Y7P A;  2PD8 A;  1NZU A;  1S6R A;  3Q82 A;  4KZ3 A;  3E98 A;  1SDN A;  2ZM0 A;  4YWZ A;  1DJC A;  3T1S A;  4EBL A;  2V2F F;  4I3J A;  2HJ9 C;  4E3M A;  4EES A;  1OJ5 A;  3HLW A;  3P09 A;  2ZM2 A;  5LBR A;  2JHE A;  4D2O A;  4EBP A;  1KVM A;  4E04 A;  3TSG A;  3B3X A;  3A0S A;  5AVE A;  2WGV A;  2WKH A;  3VSL A;  1SKO B;  4NXF A;  3VOL A;  3BJN A;  2W3E A;  1DP6 A;  3A3D A;  2ZC5 B;  3IF6 B;  3MZD A;  3CIT A;  2EWW A;  1LL9 A;  5HPI A;  5L10 A;  4HP4 A;  5GLC A;  2EX2 A;  5EM0 A;  5M19 A;  3QP2 A;  4GS9 A;  2X02 A;  4JGQ A;  1E4D A;  2ZJ9 A;  3VE3 A;  3MZE A;  2Y8H A;  1FSW A;  2RL3 A;  5C5K A;  5DVA A;  4LPZ A;  5J8X A;  3VV4 A;  2FFF B;  3NDE A;  3KO6 A;  2VGJ A;  1K6S A;  1VHM A;  1ZG4 A;  3SW1 A;  3IBJ A;  4E3L A;  2PR6 A;  4EUZ A;  3UN7 A;  4XUZ A;  1ALQ A;  4B4X A;  4IBX A;  1L0D A;  4MCW A;  1PW1 A;  1RCJ A;  1T1C A;  2M7U A;  4O01 A;  3LI8 A;  4PKY A;  2J9O A;  5FL3 A;  4P6B A;  1YLT A;  2BAS A;  1G68 A;  1ACF A;  2O9C A;  1OPX A;  2WZX A;  3BY8 A;  1O7E A;  2ZM8 A;  5G18 A;  4R3B A;  3LFV A;  1PNE A;  1GA9 A;  5HD3 A;  1S4S A;  5CHJ A;  2Y2I A;  1FOF A;  2IWD A;  1ESU A;  1NWZ A;  4GCZ A;  3ZNT A;  2L1M A;  1G28 A;  2DMW A;  1XPB A;  2JBF A;  1JTD A;  5CEB A;  4LV2 A;  3T4O A;  1I2W A;  3QNB A;  3BYD A;  1TF1 A;  1ZKJ A;  4YNR A;  3IBR A;  5L09 A;  1JWZ A;  3AGD A;  5FDH A;  4EQ1 A;  3OOV A;  2WKE A;  3MSH A;  1MY8 A;  3LUQ A;  4RQ9 A;  3QP5 A;  4HEF A;  3N4I A;  3IX3 A;  4GB7 A;  1K54 A;  3PBT A;  5J7E A;  3KYE A;  2QZ6 A;  2LB5 A;  2V20 A;  3PAE A;  4X68 A;  5M1A A;  4BBT A;  4YFM A;  2Y2J A;  3H7W B;  1XA7 A;  2W3G A;  4LGW A;  3Q7V B;  4R3J A;  4LRZ E;  2OLV A;  3VOZ A;  5TR7 A;  3PBO A;  1XXM A;  1KGF A;  2RCX A;  4FH2 A;  1MZU A;  3ZYT A;  4EQI A;  2E8J A;  3T4L A;  1L0E A;  3NOP C;  2E8I A;  2EX6 A;  4OP8 A;  2R9X A;  2A24 B;  4OQ0 A;  4R70 A;  1ES3 A;  1NZO A;  5A92 A;  2ZBB A;  5DJU A;  2Y4A A;  3V67 A;  1FSY A;  3ZHH A;  4WMC D;  5FAS A;  2AVX A;  3VOY A;  4EBN A;  1PYY A;  4WUJ A;  5DFX A;  1W63 M;  5GHZ A;  1BLP A;  3A3E A;  4WN5 A;  2G2U A;  2XFT A;  3MQO A;  3HL9 A;  1V9Z A;  2QJ5 A;  2WK0 A;  1X0O A;  4I39 A;  4IHQ A;  1BT5 A;  3S7Q A;  2ZQ8 A;  5E2F A;  1H8Z A;  3PTE A;  1QME A;  3R7W B;  4MBF A;  1OTB A;  2WGW A;  3S7P A;  3FKW A;  1D1J A;  4FSF A;  5J3W A;  1K25 A;  1PWC A;  2P9V A;  3O88 A;  4JBF A;  3K3D A;  1OME A;  2H28 A;  2JCH A;  3KSH A;  1MC0 A;  4QY6 A;  4R4R A;  2Q0O A;  4XT2 B;  2UV0 E;  3PBS A;  1CEF A;  1MWT A;  2IA2 A;  1IKG A;  3F1O B;  3C2W A;  4CLC B;  4KG2 A;  3MFX A;  1NLZ A;  2Y2M A;  3ZFZ A;  5J4E A;  2ZQD A;  4JXV A;  2JKT M;  5HAQ A;  1JTG A;  4KG6 A;  4XXR A;  1YSP A;  3UY6 A;  1NYM A;  1S4R A;  1UGU A;  5AQB A;  2XA7 S;  2V1A A;  2JE5 A;  2ZQ9 A;  1YAX A;  4C75 A;  3S4X A;  4C3Q A;  4HES A;  3GR2 A;  2ZL1 A;  4WEK A;  3KYQ A;  1GHM A;  4DN0 A;  2QMI A;  3O5Y A;  2W0N A;  3G2Z A;  4EET B;  4FCF A;  1EI5 A;  4IBR A;  1Z09 A;  3T4Q A;  3UDF A;  4NXE A;  3FKV A;  4OPR A;  2HDU A;  2J7V A;  2VLG A;  2IWC A;  5DF8 A;  3ZNY A;  4QY5 A;  3VFF A;  3NJA A;  5K5B A;  3UB5 P;  4H6J A;  1GSW A;  4PHT A;  3DW0 A;  2VGK A;  1F2K A;  4XUX A;  3BY9 A;  1ZG6 A;  5TBM A;  1XFN A;  4IVK A;  2PYP A;  1W79 A;  3LEQ A;  3BM6 A;  3ITA A;  2ACG A;  3OPP A;  3IX4 A;  4EWF A;  2DCF A;  3GQZ A;  2VGL M;  4JXW A;  5CHU A;  1PWG A;  5EE8 A;  3LR0 A;  1T18 A;  4F3L B;  5FAO A;  2KLI A;  4MLL A;  1I5Q A;  3LGO A;  3OLO A;  4PM5 A;  5F1G A;  3BFF A;  4UAA A;  5EVI C;  3WS1 A;  1IFQ A;  1OTI A;  2K2N A;  4GN2 A;  4KZA A;  1XJ4 A;  4E3O A;  1NRF A;  3FG8 A;  1L0G A;  4Y17 A;  1C3B A;  3RXW A;  2PBY A;  4KZ8 A;  5E43 A;  1DP8 A;  2P74 A;  1P9W A;  3NC8 A;  4B93 A;  3E2K A;  2V8C A;  3C7V A;  3UDX A;  1KE4 A;  4RA7 A;  2QHK A;  4OPQ A;  1BUL A;  3VE4 A;  2A3U A;  3VP0 A;  3BQA A;  4KUO A;  4JXG A;  3MXS A;  3BQ8 A;  4FUW A;  1CQA A;  1S67 L;  5CGW A;  5KSH A;  1I2S A;  3HLF A;  5HD5 A;  1AWI A;  5IHV A;  3V3S A;  4MNR A;  3B42 A;  4JF5 A;  1N9N A;  2P08 A;  4C6Y A;  2J9P A;  2Y2L A;  5HFO A;  2HZ5 A;  3SS3 A;  2CMN A;  2FZ0 A;  2P7J A;  4ETX A;  1P9R A;  3S1Y A;  3UPP A;  1PIO A;  3H82 A;  4P6Z M;  2V0W A;  5CER A;  4Y13 A;  3LO7 A;  3TG9 A;  4ME4 A;  3UMD A;  4ZJ2 A;  1H5X A;  3Q81 A;  4ESP A;  5GLB A;  3ZG7 B;  2R78 A;  3IWO A;  5DFY A;  4BL2 A;  4DMZ A;  1GHP A;  3ULF A;  1WYC A;  3N8R A;  4Y3I A;  1G5U A;  3NY4 A;  1JWV A;  5CGX A;  3NIA A;  5F68 A;  3OC2 A;  4P87 A;  3NDG A;  4WZ5 C;  4MN7 A;  1L0F A;  3WWX A;  4BD1 A;  5FEF A;  4P0M A;  1Q2Q A;  2Y79 A;  4IUH A;  3LI9 A;  3ZDJ A;  5HPF A;  4HP9 A;  4U3T A;  5FAQ A;  4P6Z S;  1YLZ A;  4KQQ A;  2JN7 A;  1CF0 A;  3M2J A;  2WGI A;  1WYB A;  4S2L A;  4UEY A;  5L8M A;  4GZB A;  2QWS A;  4K0W A;  1F9I A;  3G30 A;  3VP1 A;  4I3I A;  3C4O A;  5A93 A;  4GHI A;  4KG5 A;  3D3O A;  5TJJ A;  4OQI A;  1RGY A;  4NET A;  3NEC A;  3CJM A;  5AVF A;  4KZ9 A;  1SKF A;  5FI6 A;  1YMS A;  4HBT A;  2ZOH A;  4GS9 B;  3VP3 A;  3IHB A;  5F6A A;  3NI9 A;  3LIF A;  5EV0 A;  1NYY A;  5HZH A;  4GLQ A;  4E3J A;  4X6T A;  2VEA A;  3PR6 A;  4OH0 A;  2EWV A;  3ZG5 A;  1VET A;  3CG5 A;  3GEC A;  2WAE A;  2HP9 A;  4ZTK A;  1YLY A;  5EPH A;  3F1P A;  3ZCZ A;  4NXB A;  3E4O A;  3MQ0 A;  5DKL A;  3U4L P;  3UB7 A;  3O87 A;  2PAV P;  3CZD A;  5GL9 A;  3IWI A;  3C38 A;  2EX8 A;  3ITB A;  1N9B A;  1OTA A;  5I5L A;  1ES2 A;  3NOT C;  3CPT B;  1W7F A;  4CLC C;  5EVI A;  4PPR A;  3M2K A;  3DTI A;  2Y2G A;  4YIN A;  3D4F A;  3HLE A;  4HJ3 A;  1MPL A;  3UNW A;  4RX3 A;  1W63 Q;  4OPY A;  4N9K A;  4WEL A;  3FWL A;  1TEM A;  4GOG A;  1G6O A;  4D60 A;  2V1Z A;  5EVE A;  2Y2K A;  1XX2 A;  1K57 C;  5FQM A;  3M6B A;  2H0Y A;  2QYB A;  1ERM A;  3LEZ A;  3MXQ A;  3PBQ A;  1XJ6 A;  3VMA A;  1BLH A;  2Y2O A;  1PZO A;  4BLM A;  1MXO A;  2ZQ7 A;  1ZC2 A;  3H9W A;  4S2N C;  4RVA A;  2ZC6 B;  3O86 A;  3IXB A;  5IT5 A;  4DXB A;  4NKP A;  2PBD P;  3RFB A;  1JWP A;  4K0X A;  1PWD A;  1U60 A;  5F83 A;  3G34 A;  1TS0 A;  3WS4 A;  2CC1 A;  3MS6 A;  3SS5 A;  2PHY A;  3T50 A;  5G4Y A;  3SOI A;  3GMW A;  2HV1 A;  3OPR A;  4MBH A;  3A3I A;  1XGJ A;  4GD8 A;  3HLB A;  2VKS A;  3N8S A;  5HDD A;  2EX9 A;  4O0P A;  2HDQ A;  2ZC3 B;  4L9G A;  1MWU A;  2W3H A;  5GLA A;  2VJW A;  4M4X A;  3Q1F A; 
#chains in the Genus database with same CATH homology
 2PDR A;  3E4P A;  4G3W A;  2NUT C;  3A0R A;  3KYQ A;  3FPW A;  3EQV A;  4WEK A;  4DN0 A;  4Y5F A;  3HJI A;  4HH3 A;  1LT0 A;  4B9O A;  3O5Y A;  2W0N A;  4EET B;  4OOM A;  2W1T A;  1LL8 A;  5EFW A;  3T4Q A;  1T19 A;  1XJ3 A;  4NXE A;  3S7N A;  4I5S A;  4MDZ A;  3RH8 B;  1TS6 A;  2VLG A;  3CWF A;  1TS7 A;  1YSQ A;  3LIB A;  3E4Q A;  4WL9 A;  3KYZ A;  4BBV A;  3NJA A;  4WEJ A;  2J3W A;  5K5B A;  1DP9 A;  4Q0J A;  1VB6 A;  2YKH A;  3PYP A;  3S7O A;  2V9A A;  1LSW A;  2W27 A;  4H6J A;  1GSW A;  4PHT A;  2OAQ 1;  4OOL A;  4BMW A;  1UWN X;  2FH5 A;  2I9V A;  2PYR A;  4GW9 A;  3BY9 A;  1OTD A;  5TBM A;  1XFN A;  1LSV A;  2PYP A;  5HWV A;  1H3Q A;  1ZHH B;  2JKT I;  1EW0 A;  1OT6 A;  3EEH A;  4BJP A;  4II7 A;  4NEE D;  4HY8 A;  3LIE A;  3LR4 A;  2VGL M;  2W1R A;  3PBR A;  4EU0 A;  4CLC D;  5DF9 A;  3LR0 A;  1YKD A;  1T18 A;  2P04 A;  3EGX C;  3T4T A;  4PKY G;  5CX7 A;  4BWI A;  2KLI A;  2MJ6 A;  4F3L B;  4I38 A;  3LR3 A;  1N9L A;  2VV8 A;  2XA7 M;  2L0W A;  3EWK A;  3KSI A;  4HNB A;  4ZRR A;  4EW7 A;  2HF6 A;  2GNX A;  2KDK A;  3OLO A;  5HSQ A;  2OAP 1;  4JGR A;  1TS8 A;  2A24 A;  2WKQ A;  3DBA A;  3TE8 A;  2VV7 A;  1MKM A;  3OCL A;  1IFQ A;  2QKP A;  1OTI A;  2K2N A;  1ODV A;  3LIC A;  4ARZ A;  4G3V A;  3BWL A;  3EEA A;  2YKF A;  4Y2F A;  4EXO A;  1XJ4 A;  1D06 A;  2K31 A;  3FG8 A;  3CUE A;  3HCY A;  2O0Y A;  3LYX A;  3MJQ A;  4UQI M;  1P0Z A;  2V1B A;  5DKK A;  1OT9 A;  3FC7 A;  4GJ4 A;  1DP8 A;  1P9W A;  4B93 A;  4K08 A;  3LIA A;  2WKR A;  2W1T B;  2L4R A;  2PD8 A;  2QHK A;  3MMH A;  4IJG A;  2OWH A;  3E98 A;  2HGV A;  2D01 A;  5G4Z A;  4YWZ A;  4HIA A;  3VE4 A;  4HOI A;  3P01 A;  3LID A;  3BQA A;  4G3K A;  4KUO A;  3JVU A;  4I3J A;  3UME A;  3C8C A;  2J3T D;  3BQ8 A;  2M7V A;  2HJ9 C;  4R6L A;  4EES A;  1OJ5 A;  2Z6D A;  1S67 L;  5LBR A;  4YOF A;  4H6J B;  5KSH A;  2JHE A;  2O9A A;  4E04 A;  2XRO A;  3LR5 A;  5HD5 A;  3FPV A;  3A0S A;  5AVE A;  4XT2 A;  5TBM B;  3B42 A;  2M1C A;  3NHQ A;  1N9N A;  2P08 A;  4QPR A;  3T4J A;  4NXF A;  3T4S A;  3VOL A;  3BJN A;  2W3E A;  3CLO A;  4CLC A;  1DP6 A;  2CMN A;  2O99 A;  4R38 A;  2FZ0 A;  2WKP A;  3CIT A;  4LLO B;  4HJ6 A;  2EWW A;  4UQI S;  5HPI A;  2P7J A;  4HP4 A;  4MN6 A;  4ETX A;  1P9R A;  1T1B A;  2KX6 A;  4PAU A;  1BYW A;  1NRJ A;  3W2Z A;  4GS9 A;  5IS1 A;  3RTY A;  3H82 A;  4JGQ A;  4P6Z M;  2PD7 A;  3MF0 A;  1Y28 A;  2V0W A;  1WA9 A;  3VE3 A;  2Y8H A;  4HH2 A;  1GSX A;  3K3C A;  4JGP A;  5C5K A;  5KIZ A;  4L0L A;  4ME4 A;  3UE6 A;  3UMD A;  4LPZ A;  3VV4 A;  2R78 A;  3KO6 A;  5DFY A;  4DJ2 A;  1VHM A;  3H7W A;  1XJ2 A;  4ARZ B;  3SW1 A;  4DMZ A;  2B02 A;  3IBJ A;  4EER A;  2PR6 A;  2EA9 A;  1NLY A;  3ULF A;  3IS2 A;  1XFQ A;  4Y3I A;  2JKR I;  1N9O A;  4MCW A;  2VV6 A;  5F68 A;  1T1C A;  3OC2 A;  2M7U A;  4O01 A;  3LI8 A;  4MN7 A;  4PKY A;  3TW8 A;  5FL3 A;  3CAX A;  3C30 A;  3U2A A;  5HL6 A;  3F1N A;  2BAS A;  1OTE A;  2Y79 A;  1LSX A;  2O9C A;  3LI9 A;  4IUH A;  5HPF A;  1IOU A;  1OPX A;  2LB9 A;  4HP9 A;  3BY8 A;  4KUK A;  4DJ3 A;  4P6Z S;  3JVV A;  1P97 A;  3R4K A;  3UB8 A;  3PHY A;  4KQO A;  3LFV A;  3OBF A;  3ICY A;  5HD3 A;  1S4S A;  2W3F A;  2JN7 A;  3ZQ5 A;  2NUP C;  4UEY A;  5L8M A;  3BW6 A;  3A0V A;  1NWZ A;  4GCZ A;  2L1M A;  2VX8 A;  1DRM A;  2QWS A;  1G28 A;  2DMW A;  1F9I A;  2VZW A;  4KQD A;  5F69 A;  4I3I A;  5HDS A;  4GHI A;  3T4O A;  1KOU A;  4O8G A;  2KOI A;  2XRN A;  3D3O A;  5TJJ A;  2ZOI A;  5HWT A;  3UE3 A;  1TF1 A;  2OOL A;  3R7W A;  4BBU A;  4YNR A;  3IBR A;  3KX0 X;  4CQH A;  5AVF A;  4JGO A;  4Q0H A;  4EQ1 A;  1S1Y A;  3D72 A;  3CUE C;  3OOV A;  2JKR M;  2ZOH A;  3KSG A;  4GS9 B;  4AFI A;  3H82 B;  3LUQ A;  1S1Z A;  2J80 A;  5F6A A;  1S66 L;  3K2N A;  3LIF A;  2A2L A;  4RQ9 A;  5HZH A;  3P7N A;  3G6O A;  4GLQ A;  4WLA A;  2VEA A;  3PR6 A;  2EWV A;  3PXP A;  3PBT A;  5J7E A;  4HJ4 A;  3F1O A;  1D7E A;  3KSF A;  3TRC A;  2LB5 A;  4BBT A;  3GEC A;  2Z6C A;  3PBN A;  4IUK A;  3H7W B;  3EOI A;  2W3G A;  2OWJ A;  4LRZ E;  3UB9 A;  2GJ3 A;  3F1P A;  1F5M A;  1GSV A;  4EUV A;  3PBO A;  4NXB A;  2ZMF A;  3E4O A;  3IS2 B;  3MQ0 A;  4L9E A;  5DKL A;  3B33 A;  3UB7 A;  1TD5 A;  1MZU A;  3ZYT A;  3T4L A;  3NOP C;  3TJZ C;  3E0Y A;  1V9Y A;  2V0U A;  2VA0 A;  2A24 B;  1JNU A;  2W3D A;  3C38 A;  4LRY C;  3MR0 A;  4R70 A;  1H8M A;  2ZBB A;  5HDC A;  5DJU A;  5F5Y A;  3V67 A;  1OTA A;  2ZMV A;  3F1N B;  2XSS A;  5I5L A;  2GZA A;  3NOT C;  4CLC C;  3MQQ A;  4EEU A;  4WUJ A;  5DFX A;  1W63 M;  4WF0 A;  4WN5 A;  4HJ3 A;  3MQO A;  3GDI A;  1V9Z A;  1W63 Q;  2K7S A;  2PR5 A;  4WEL A;  2QJ5 A;  1G6O A;  4R3A A;  1X0O A;  4HI4 A;  4I39 A;  4IHQ A;  4HQA A;  1F98 A;  3S7Q A;  5HWW A;  4GHI B;  4Z1W A;  3UB6 A;  5A8B A;  4EEP A;  3R7W B;  1OTB A;  2QYB A;  4ETZ A;  3MXQ A;  3PBQ A;  3S7P A;  4FSF A;  5J3W A;  1UWP X;  1XJ6 A;  4FOF A;  4MMN A;  3K3D A;  3T4K A;  2INW A;  3CI6 A;  3H9W A;  5IU1 A;  2B18 A;  3B47 A;  4NXG A;  2O9B A;  2H28 A;  4LRX C;  3KSH A;  1MC0 A;  3NOU C;  5IT5 A;  3OCN A;  1ZTU A;  4NKP A;  3RFB A;  4XT2 B;  2PT7 A;  2GX5 A;  4MN5 A;  3PBS A;  3EGD C;  4F3L A;  4I3A A;  2IA2 A;  3F1O B;  4HHD A;  1TS0 A;  1STZ A;  3C2W A;  4CLC B;  5AJG A;  2G7U A;  4L9F A;  3MFX A;  1NLZ A;  2PHY A;  3T50 A;  5G4Y A;  2J3T C;  2HV1 A;  2HJE A;  2QJ7 A;  5J4E A;  3HJK A;  3F1P B;  2JKT M;  2VKS A;  1YSP A;  2VGL S;  5HDD A;  4O0P A;  4CLC E;  4Q0I A;  1S4R A;  5MC7 A;  1UGU A;  5DJT A;  4L9G A;  2XA7 S;  2V1A A;  1OJG A;  2W3H A;  1YAX A;  1T1A A;  2VJW A;  3EQU A;  4M4X A;  2D02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...