2K2NA

Solution structure of a cyanobacterial phytochrome gaf domain in the red light-absorbing ground state
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
172
structure length
172
Chain Sequence
LDQILRATVEEVRAFLGTDRVKVYRFDPEGHGTVVAEARGGERLPSLLGLTFPAGDIPEEARRLFRLAQVRVIVDVEAQSRSISQPESWGLSARVPLGEPLQRPVDPCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHAEPRPYSQEELQVVQLLADQVSIAIAQAELSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sensor protein
publication title Solution structure of a cyanobacterial phytochrome GAF domain in the red-light-absorbing ground state.
pubmed doi rcsb
source organism Synechococcus sp.
total genus 31
structure length 172
sequence length 172
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2k2nA00
3G6OA 4Y3IA 5TJJA 3KSFA 3S7NA 4R70A 4QPRA 2VKSA 2IA2A 4DMZA 3S7OA 3CITA 3DBAA 2QYBA 5HPIA 3EEAA 4LRZE 3CI6A 2XRNA 3C2WA 3S7PA 2KOIA 5DFXA 1TD5A 4Z1WA 4O8GA 4EUVA 2ZMFA 4MCWA 4R6LA 2W3DA 4G3WA 2HGVA 4ZRRA 3KO6A 1TF1A 2OOLA 4MN7A 2Y79A 5LBRA 4Q0JA 2Y8HA 4EU0A 5HL6A 2M7VA 1YSQA 3NOPC 2M7UA 4LRXC 4YOFA 3OBFA 4O0PA 3S7QA 4G3KA 3W2ZA 1MKMA 2O99A 2VEAA 5AJGA 2W1TA 4FOFA 2VJWA 2O0YA 4MMNA 4Q0IA 5C5KA 3NOUC 4E04A 3HCYA 2W3HA 3O5YA 2G7UA 3E98A 4Y2FA 3ZQ5A 4Y5FA 3BJNA 3R4KA 4G3VA 4IUHA 1ZTUA 2O9AA 5HSQA 1YSPA 4IJGA 2LB5A 1F5MA 3MQ0A 2W3FA 3VV4A 2O9CA 3D3OA 4DN0A 3IBJA 5I5LA 4YNRA 4LRYC 2K2NA 2W1TB 4MDZA 3LFVA 3MMHA 5K5BA 2O9BA 2XSSA 2W3GA 3NOTC 4BWIA 5HPFA 3RFBA 4IUKA 1VHMA 1STZA 2W3EA 3IBRA 5L8MA 4ETXA 2LB9A 1YKDA 2VZWA 3KSIA 4GLQA 3TRCA 2B18A 5DFYA 4Q0HA 3NHQA 2GX5A 4O01A 4PAUA 3OOVA 2XROA 2W1RA 2KLIA 4ETZA 4CQHA 4GW9A 4ME4A 2K31A 3E0YA 3K2NA 3MF0A 3KSHA 4RQ9A 3KSGA 1MC0A
chains in the Genus database with same CATH superfamily
1Y54A 3G6OA 5HPIA 5CGXA 4LPZA 4HP4A 3UB9A 1BULA 3T4QA 1W5DA 2PT7A 1TF1A 4UHUA 2ZL1B 1K56A 3N7WA 4CJNA 5FQKA 3OBFA 3HLFA 2P9VA 3W2ZA 3A3EA 1T18A 1MKMA 1W7FA 3A0RA 1Q2QA 1XA1A 2X71A 4Q8IA 5FQJA 2O0YA 2V0UA 1MXOA 5F68A 3UDXA 4R3BA 5FQMA 1H8ZA 1OTEA 1SKFA 2L0WA 3CHWP 2XH9A 3Q81A 3ZGAB 2WKRA 1Y28A 3UN7A 3N8SA 5CERA 5G4ZA 4P85A 3SOIA 2VGKA 3QP1A 2H0YA 4CPKA 4DN0A 3BFGA 4LFUA 4CLCC 3LFVA 3E2KA 4OPRA 2B5RA 1GSWA 1O7EA 1VHMA 1TS0A 1DJBA 5MC7A 4GLQA 4LV1A 2WAFA 4QY6A 2GX5A 4WMCD 3OOVA 4ETZA 3N8LA 4HJ6A 1XJ6A 4JF4A 3P01A 4FUWA 2XFTA 1J9MA 3BFEA 4B4ZA 1PIOA 2XDMA 1PZOA 2H28A 2WZZA 4JGRA 3S7PA 4GJ4A 3U2AA 4E6XA 1NLYA 3IH8A 3MBZA 5E43A 4ZRRA 3KO6A 1K6SA 4D2OA 2QJ5A 2EX8A 3IF6B 2XR0A 4F3LA 1CF0A 3ZHHA 1RP5A 3IWIA 1MZUA 2V20A 2DRWA 3BECA 2EWWA 5DTSA 1NRFA 4S2IA 5FL3A 3PR6A 1VM1A 4JF5A 2BLSA 2ZMVA 1E25A 2O99A 4MN5A 3T4TA 5IHVA 5DF7A 1S0WA 3OLOA 4Y17A 4JXGA 2IWDA 5L09A 1K25A 1K54C 2HJ9C 1ES5A 1SKOB 1S1ZA 1KGGA 4R38A 3RXXA 3NIAA 2Y2PA 4JXWA 2J9OA 1TVFA 4B4XA 1LI0A 3VP3A 1AXBA 3PYPA 3CPTA 4NXFA 2XK1A 1WE4A 4PPRA 5EUAA 2FZ0A 3T4SA 4FCFA 3SZTA 2EX9A 1T1CA 4X25A 1XP4A 3JVVA 1N9LA 4R3JA 1DRMA 5A8BA 1MY8A 2QKPA 1YMXA 2JKRI 2V8CA 2JHEA 3NHQA 4LGWA 5CGWA 3OPHA 5GLAA 5L07A 5F69A 3KSFA 1IEMA 1XGIA 3JVUA 1H8YA 3LY3A 2H0TA 4GDNA 4WZ5C 2XD1A 5GHYA 1LL8A 2EX6A 1N9NA 2W3DA 2E8IA 3B33A 4KZ4A 1EI5A 1P9RA 3KYEA 3LR3A 4MN7A 3H82B 3BWLA 5HD3A 2WKIA 5GL9A 3B3XA 1NZOA 5HL6A 3T1XA 4ESPA 1L0EA 4YOFA 4AFIA 1D1JA 1CI8A 2XLNA 4P6ZS 2NUTC 2J3TD 3W4OA 1KOUA 2Y2JA 4WELA 3Q07A 1N4OA 3GV9A 4YWZA 3O5YA 3CLOA 1KDWA 4I38A 5FSRA 2G2WA 4RVAA 1FR6A 3GTCA 4I3JA 4CLCB 2ZOIA 2INWA 5E2EA 3FG8A 1NY0A 5KSHA 3MQ0A 4HNBA 1VETA 1OTBA 4HEFA 2O9CA 4DE2A 4LRYC 4PM9A 1JTGA 3IXBA 5DTKA 1P0ZA 5M18A 3NDEA 4KG6A 4BWIA 3QHYA 1FSYA 4MBFA 1NZUA 2ZL1A 4GDBA 4C3QA 4NKPA 4WUJA 2P9VB 3IWOA 4LCMA 2Z6CA 4RQ9A 3A3FA 2HDUA 3FPWA 2ZC7A 3C4OA 3DBAA 1E3UD 1E4DA 4CLCD 4EQ1A 1NXYA 3DWZA 4L9FA 1TS8A 2KOIA 5TFQA 4DDSA 4Z1WA 1W8QA 4EUVA 4PKYA 4R6LA 3D4FA 2WKEA 3Q7ZA 2OV5A 3LUQA 2W27A 1RGZA 4DKIA 4IEDA 1HVBA 1FCOA 3MQQA 4GD6A 3BLMA 1BYWA 4UQIS 3UB6A 3N4IA 2ZQDA 2K7SA 3AGDA 1WA9A 2OSUA 3VOZA 1K56D 2PYRA 2ZBBA 2DMWA 3LY4A 4X6TA 1FOFA 1IYSA 4F94A 4I39A 3HJKA 4GOGA 5HAPA 1GSXA 4YINA 4EEUA 3K3DA 4U0XA 2ZQ7A 5A93A 4KUKA 2WZXA 5AQBA 3M2JA 2X01A 5A92A 2Y2OA 4RA7A 3G35A 2UV0E 4P6BA 2WUQA 3WS4A 2VK3A 3FYZA 4K0XA 4WL9A 1GHIA 3MS6A 1HTZA 2WK0A 3E4PA 4F3LB 4IUKA 3VOLA 1O07A 1MWRA 1IKGA 3UO9A 4KENB 3GR2A 1XFQA 1KVMA 4QD4A 2XROA 3MR0A 3MZEA 2G2UA 3PAGA 2QMIA 3LIAA 3SH8A 3BM6A 4MNRA 4Y3IA 3IH9A 4HBTA 4FH4A 2VKSA 1OPXA 5HAIA 3UMDA 3CITA 3C5AA 4OH0A 3IX8A 5E2HA 1MWUA 4G3WA 4N1HA 2FH5A 4RYEA 1ESUA 3CPTB 4ZJ2A 3V39A 1G6OA 5DKLA 3LCEA 2A3UA 2W0NA 3N6IA 3QP4A 3BLSA 2VJWA 4M4XA 2JKTI 5F5YA 3NOUC 2IWBA 3UE3A 3ZQ5A 2C6WB 1JWZA 3IWQA 1ZTUA 1I2WA 5FEGA 4DRTA 5J7EA 1K0KA 4XT2B 3HBRA 2WYXA 4H8RA 1NJ4A 1IKIA 2OWJA 3MMHA 1LI9A 4D60A 4E3IA 4BJPA 4LV0A 2HDQA 3UB5P 4EV4A 4EBLA 3WRZA 2HDRA 2XA7S 3H82A 4JF6A 3TRCA 3OPRA 1G28A 4XUXA 4ZAMA 5J8XA 3HREA 3GECA 1XPBA 3SS3A 2IWCA 1BLPA 2GDNA 3F1NB 4GCZA 1LSXA 2ACGA 1XGJA 4UA9A 1BT5A 3C2WA 3PBOA 4BD0A 2WGWA 4S2KA 2PRFA 1UGUA 4CLCA 4S2OA 2PBDP 3K3CA 2Y8HA 1VETB 2ZC6B 2Z6DA 1EW0A 4LRXC 1LSVA 4LLOB 2OAP1 3P09A 4GS9A 3QP2A 4IBRA 3MKFA 2J8YA 4EQIA 1I2SA 1U60A 3V5MA 4Y13A 2HP6A 1LL9A 2NUPC 3C8CA 3TSGA 4KZAA 2M1CA 4IUHA 3CAXA 5HWVA 1VB6A 2V9AA 4OPZA 4GHIA 4HP9A 3T1RA 1GCEA 4IBXA 1YLPA 1K4FA 4YNRA 1PWDA 3B42A 2W1TB 3ZDJA 1UWNX 4KQQA 2DCFA 2W3GA 3MSHA 2EWVA 5J4EA 3PXPA 3GDIA 1K54A 4HI4A 4Q0HA 4Y0UA 5GHZA 3AGFA 4HY8A 2D01A 1YLJA 1ZC2A 3IX4A 2EA9A 3Q7VA 4DDYA 5FI7A 1DY6A 1YLYA 3MJQA 1PYYA 5TBMA 1CI9A 3QNCA 1NWZA 1VEUA 5FEFA 5HDSA 5F82A 4L0LA 4JGQA 4KQRA 3H9WA 1MPLA 3ZYTA 3LO7A 4NXGA 2EFXA 5KMWA 5BOHA 4QY5A 4II7A 4EXOA 1L2SA 5EM1A 3BY9A 1BTLA 1J3WA 4Q0JA 4EU0A 1HLUP 3E4QA 2WAEA 3ZNYA 3SS5A 2PU4A 4N92A 2KX6A 4UA7A 2QWSA 3MXSA 4DE1A 3VSKA 4MMNA 3HLEA 1SHVA 4YFMA 2VGLM 2Y2KA 5AQ7A 5EOOA 2Y2QA 5M1AA 3OPPA 4MEZA 1L0FA 4WZ5A 3Q1FA 4BMWA 3JYIA 2Y59A 4OOYA 5E2FA 1A0KA 3G30A 3BY8A 2WGVA 3LEQA 5G18A 2PD7A 4EBPA 3PHYA 2ZM8A 4X1MA 3JPUA 5EVEA 4EUZA 1DP9A 2ZQ8A 3EEHA 3F1PA 1SZVA 4S2NA 1S4RA 3MFXA 3UPNA 2P74A 4OVDA 2Y2GA 3LEZA 5L2FA 3IBRA 2V0WA 1TS6A 5L8MA 5FQ9A 1GA0A 4KZ7A 5DTTA 2JKRM 4X69A 1DJAA 3PTEA 4XUZA 1S4SA 4Z9QA 1V9ZA 1OJGA 3EGDC 2FFFB 1GHPA 3E0YA 3NULA 1LT0A 4JXSA 4OPQA 3BFCA 4NEED 1M40A 4OOMA 3W4QA 5DKKA 2WKQA 4NETA 3T1QB 3T4OA 2A24A 1IYPA 5L10A 1DJCA 3E2LA 1PWCA 4X56A 4JLFA 4B88A 5CTMA 4XT2A 2ZM0A 2OWHA 3BW6A 2Y4AA 3CJMA 3IF5A 5KIZA 1BZAA 1MWSA 2W3HA 3VP0A 1XFNA 4BQMA 4Y5FA 1NRJA 2CMNA 1FSWA 4S2NC 5TGFA 1QMEA 2PBYA 5CHJA 5CXWA 4ID4A 3F1NA 3QP6A 1WYCA 3EQVA 4EEPA 1ES2A 4R0QA 2B95A 3I7JA 3KYZA 2WGWB 1JNUA 3NECA 5F1FA 4X53A 2CC1A 2BTFP 4L9EA 1STZA 2AVXA 4ETXA 2EX2A 3OC2A 1YMSA 3HL9A 2Y2IA 4HBUA 4NG2A 4PAUA 2R9XA 1G68A 2KLIA 3IS2A 1H8MA 4GS9B 3KSGA 4BL3A 4P87A 1OMEA 1W63M 4QPRA 2A2LA 4MBKA 1K6RA 4KZ3A 3EEAA 3CI6A 1FCNA 2ZM2A 4ZBEA 3MQOA 3ULFA 3ZG9B 3T4LA 4FSFA 2HZ5A 2PHYA 4GHIB 2QJ7A 2HF6A 3SH7A 4KQDA 1YSQA 3VP2A 4M3KA 3BRMA 3QNBA 1JVJA 3MZDA 3C38A 4S2JA 3HLCA 2VEAA 2W1TA 1T1AA 4WF0A 1BLHA 4HH3A 1PI4A 4Q0IA 4U3TA 1KDSA 1S67L 3HCYA 5G4YA 1F98A 1SCWA 4WLAA 1ES4A 1SDEA 4QB8A 4B9OA 4IJGA 2LB5A 3Q7VB 5EVIA 3VFHA 1YM1A 4KZ8A 3G4PA 5CEBA 5TBMB 1K38A 1VEUB 4X68A 5JYPA 3LIFA 4S2MA 2HP9A 1N9OA 4MDZA 1CK3A 3PAEA 5F83A 4HJ3A 1XX2A 2QHKA 1K55C 5GLCA 3N8RA 2V1AA 3IHAA 5HPFA 4Y0OA 1MKIA 2PDRA 3A3IA 3ZFZA 3HLDA 1TDLA 1YKDA 4GN2A 3NCKA 4FH2A 4DF6A 3BQ8A 3GQZA 4ZTKA 4K91A 4K0WA 2W1RA 4GZBA 2J9PA 1T1BA 2Z2MB 2K31A 3A3DA 5TJJA 5A90A 4R70A 4OLGA 2IA2A 4ARZB 4JGPA 3PBQA 1KE0A 2VGLS 3B47A 4CLCE 1TD5A 5GLBA 3NBLA 2HGVA 1OTIA 1IYOA 2HDSA 2OLVA 1XXMA 4UA6A 1N9BA 4EWFA 3NJAA 5HWTA 4IHQA 2ZMAA 5A91A 3T1SA 4BBUA 1YLTA 1L0GA 4E3JA 1PWGA 3NDGA 4G3KA 3F1PB 3O3VA 1BLCA 1IFQA 4E3NA 2VV8A 5HZHA 2JKTM 1CQAA 5C5KA 5EVIC 1P9WA 3GSGA 3ZG7B 4N9LA 3UDFA 1RGYA 2MJ6A 3C30A 4R4RA 4KQOA 3BJNA 4R1GA 5EECA 3V50A 3NY4A 2JCHA 5HDDA 5HSQA 2Q9MA 1TEMA 1FCMA 4I5SA 2Y2NA 3MKEA 3SS4A 2ZQCA 1ZG6A 2W3FA 5EM0A 1ONHA 5FA7A 2HV1A 2ZC4B 2HJEA 3IXDA 1S6RA 3VP1A 1TS7A 3LIDA 3NOTC 3OPLA 2A24B 5AQ9A 3HLGA 2J7VA 2PU2A 5DFYA 3UNWA 4HIAA 1C3BA 2WKHA 3E4OA 3GRJA 3S4XA 2E8JA 3VE3A 2ZOHA 3S1YA 5HWWA 3L7HA 1D7EA 2B02A 2P04A 1MC0A 3LI8A 3PBSA 3BQAA 5CRFA 4UAAA 3V3SA 4N1XA 4PM8A 5KSCA 3IHBA 1V9YA 2XGNA 2Y2HA 5IS1A 3WRTA 3IF6C 1W8YA 5CHMA 1S66L 4MCWA 5AQAA 3PBTA 4B93A 4LCLA 5CTNA 3HVFA 2HPBA 3VOYA 5HD5A 1HZOA 4JBFA 4EERA 3D9YA 4I3AA 1K57C 2KDKA 5I94A 1PW1A 1YPRA 1NLZA 3FV7A 5TR7A 1BUEA 4PM6A 2L1MA 5GHXA 2R9WA 1CEFA 2VLGA 3LYXA 1G6AA 2PYPA 1SDNA 4DE3A 4WEJA 3IS2B 5CEDA 1YSPA 4DJ3A 1P97A 5U47A 5IT5A 5HFOA 4E3LA 3DTKA 4WZ4A 3W8KA 1WYBA 5I5LA 4DXBA 3TG9A 4WN5A 4OLDA 2J3TC 5JYOA 2BASA 2O9BA 3CWFA 4BBVA 3LR5A 4QJGA 4HQAA 1W63Q 4MLLA 3ZG5A 2RCXA 1PFLA 4O01A 4LV3A 5FAQA 5CGSA 5DJUA 5HDCA 2JKFA 3LGOA 4R3AA 3GVBA 3IT9A 3T4KA 3M6BA 5EV0A 1FIKA 4RX3A 4C75A 1XA7A 3UDIA 3A0SA 4DMZA 1I5QA 1GA9A 4HH2A 4LRZE 5DFXA 1KE4A 1H3QA 3TE8A 5FASA 4WYYA 4KZ5A 2Q9NA 5LBRA 3DAVA 5EVIB 4BL2A 3TOIA 4EBNA 5CECA 2P08A 4OQGA 5GLDA 4A5RA 2VV6A 3P7NA 3DWKA 1OT6A 2BG1A 4UQIM 3ITAA 1IYQA 4E3OA 5DJTA 2OLUA 5FQIA 1XKZA 2PR6A 3G34A 4IVIA 5AVEA 5IU1A 4QWOA 1X0OA 2GZAA 3UB8A 3R4KA 3UY6A 4JPMA 4EETB 5E2GA 4KG5A 3ZVTA 3VE4A 3CUEA 1JWVA 1QMFA 1ERMA 2XEPA 4OP5A 4ARZA 1LLBA 1T19A 5EVID 4H6JA 1PZPA 2V1BA 3UPOA 2YKHA 4PM7A 2ZC3B 4QHCA 3RFBA 2JBFA 3S22A 1PW8A 3CG5A 2VZWA 3G32A 3TW8A 1K4EA 3R7WA 2C5WB 2QZ6A 2GJ3A 2ZC5B 1ODVA 3G2YA 1NYYA 4CQHA 3LIBA 4GW9A 4KZBA 3MF0A 4XXRA 4ZDXA 4NXEA 4PM5A 1OTDA 3S7NA 1KE3A 1ESIA 3SW1A 5EFWA 5CHUA 4BLMA 3IX3A 2QYBA 2DNSA 2VGJA 2Y55A 3H7WB 3DTMA 3FKWA 1ZG4A 1GHMA 1RCJA 1DP6A 3DW0A 4OONA 3MZFA 3HUMA 2M7VA 1BLSA 4FD8A 2M7UA 4JGOA 4DJ2A 4IVKA 3EQUA 2JKGA 2XQZA 5AJGA 1VQQA 2QPNA 1YLWA 2EFUA 2HP5A 1KVLA 3Q82A 3UE0A 1KGEA 4E04A 3KX0X 3WWXA 1F9IA 2ZJ9A 1XJ3A 3CUEC 1IOUA 1GSVA 5HX9A 1DP8A 3E98A 3V3RA 1ALQA 1ES3A 3D72A 4O7DA 3LR0A 2WKPA 3ISGA 5HW3A 1W79A 3BFFA 4BBTA 3G31A 2JE5A 3D3OA 3UMEA 5DVAA 2J3WA 4I3IA 4N9KA 4U0TA 3VP4A 2JN7A 5K5BA 3FWLA 1G5UA 5DF9A 4BENA 3UB7A 2EXBA 2UWXA 4OOLA 3FPVA 4UEYA 3RXWA 1Y4OA 4Y7PA 2XF3A 2WGIA 3L9KA 4C6YA 3F1OB 3ZVWA 2XA7M 5AVFA 4ME4A 5HAQA 3BFDA 5DF8A 4JXVA 3S7OA 2H5SA 4KZ9A 3FZCA 2XRNA 3A3JA 1NYMA 4LENA 1IELA 1M6KA 3FC7A 3HJIA 2Y79A 1UWPX 1K55A 3AGEA 3WS5A 3G2ZA 2J80A 1L3LA 4DXCA 2VX8A 5EE8A 1Z09A 3U4LP 4X1LA 3NOPC 5HL1A 2I9VA 3BEBA 3V67A 1JWPA 3RH8B 5D3OA 3WS2A 1YLZA 4BD1A 3ICYA 3PBNA 3ZG0A 1JTDA 1OJ5A 5F1GA 1PRQA 5FQQA 1FILA 4GKUA 3CZDA 4NK3A 3EGXC 2PAVP 5FDHA 3O86A 2XD5A 2Q0OA 2OAQ1 2Z2LB 4WMCA 1YAXA 3CMZA 2YKFA 3IXHA 3NI9A 4OQHA 3C7UA 1MBLA 2LB9A 1F2KA 1BSGA 5FAOA 2Y2LA 4L9GA 5EPHA 3HUNA 3OCNA 3OZHA 2RL3A 1Z6FA 4RX2A 2P7JA 3A0VA 3ZNTA 3BYDA 1ERQA 3LR4A 4O8GA 4Y15A 3RJUA 2X02A 5FATA 3WS0A 4QU3A 1EROA 2ZQAA 3ITBA 3VMAA 3T4JA 4E3KA 3LICA 3P98A 3VSLA 3TJZC 3S7QA 4WM9A 3UE1A 2A49A 3MFDA 4H6JB 3HUOA 1LL5A 1S1YA 4KZ6A 3NC8A 4OKPA 4E3MA 4NXBA 4PHTA 2G7UA 3R7WB 4Y2FA 4S2LA 3T50A 4HESA 4S2PA 4G3VA 5M19A 2O9AA 3IF6A 2EXAA 3IQAA 4MN6A 2VV7A 1Q2PA 4E6WA 3MXRA 3VV4A 3LI9A 3EWKA 4HJ4A 3VFFA 5EOEA 1PNEA 2H10A 2K2NA 1K57A 3UPPA 3LIEA 3O87A 1MWTA 4OQIA 1LSWA 2XSSA 1FQGA 3H7WA 4WBGA 4FTXA 5FDSA 5F6AA 3ZG8B 1HD8A 1EWZA 2D02A 3T12B 1OT9A 4EW7A 1SKOA 4K08A 5FI2A 1XJ2A 4WEKA 3EOIA 3SH9A 2I72A 2Y2MA 3C7VA 4OP8A 1OTAA 1YT4A 5FAPA 2PD8A 3HLWA 4LV2A 1ZKJA 1L0DA 3C4PA 1LHYA 1PI5A 5FI6A 4ZJ1A 4PMAA 2PR5A 1YQSA 3W4PA 3IXGA 1D06A 1ONGA 2ZMFA 3DTIA 4PKYG 2OOLA 2V2FF 2V1ZA 1XJ4A 3QP5A 4KUOA 5CX7A 3M2KA 4R4SA 5J3WA 2XFSA 5HARA 4O0PA 1TDGA 1ZHHB 4FOFA 3PBRA 2V8FA 2Y91A 2FFYA 3M6HA 4HOIA 1CEGA 1H5XA 3UE6A 4P0MA 2ZLYA 4GB7A 4ZJ3A 4GNUA 3O88A 1AWIA 2JC7A 2L4RA 4OPYA 1CJFA 3F1OA 1H0MA 3QP8A 1F5MA 2VA0A 4HHDA 5KZHA 3OCLA 3IBJA 4P6ZM 3FKVA 1ACFA 3ZCZA 4OQ0A 4DE0A 1KGFA 3HLBA 4R23A 4X55A 4GD8A 3RTYA 3MXQA 2W3EA 3KYQA 4JKTA 2ZQ9A 1FR1A 3KSIA 5EVLA 3DTEA 4KG2A 4Y0TA 2B18A 2GNXA 2WADA 4EESA 3WS1A 1E3UA 3GMWA 4MBHA 3K2NA 2ZD8A 3KSHA 2R78A
chains in the Genus database with same CATH topology
3G6OA 4Y3IA 1OTDA 3S7NA 1W63M 3SW1A 4QPRA 2VKSA 2A2LA 1OPXA 5EFWA 3UMDA 3CITA 2QYBA 5HPIA 4LPZA 3EEAA 3CI6A 4HP4A 3UB9A 3MQOA 3T4QA 3H7WB 3ULFA 2PT7A 4G3WA 1TF1A 2FH5A 3T4LA 1G6OA 1DP6A 4FSFA 5DKLA 2PHYA 4GHIB 2QJ7A 2HF6A 2M7VA 4KQDA 2W0NA 1YSQA 2M7UA 4JGOA 4DJ2A 3OBFA 3C38A 3EQUA 3W2ZA 1T18A 1MKMA 3A0RA 2VEAA 5AJGA 2W1TA 1T1AA 4WF0A 2VJWA 4HH3A 2JKTI 4M4XA 2O0YA 4Q0IA 2V0UA 5F5YA 3NOUC 4E04A 3KX0X 1S67L 1F9IA 3UE3A 3HCYA 5F68A 5G4YA 1F98A 1XJ3A 3CUEC 1IOUA 1GSVA 1OTEA 1DP8A 3E98A 2L0WA 3ZQ5A 4WLAA 1ZTUA 2WKRA 3D72A 1Y28A 4B9OA 3LR0A 2LB5A 2WKPA 4IJGA 5G4ZA 4BBTA 5J7EA 3D3OA 4XT2B 4DN0A 5TBMB 3UMEA 2J3WA 4I3IA 3LIFA 1N9OA 4MDZA 4CLCC 3LFVA 2OWJA 3MMHA 2JN7A 4HJ3A 5K5BA 2QHKA 5DF9A 1GSWA 3UB7A 4BJPA 2V1AA 5HPFA 4OOLA 1VHMA 3FPVA 2PDRA 1TS0A 4UEYA 2XA7S 1YKDA 3H82A 5MC7A 4GLQA 3TRCA 3BQ8A 1G28A 2GX5A 3OOVA 3F1OB 2W1RA 2XA7M 4ETZA 5AVFA 1T1BA 4HJ6A 4ME4A 1XJ6A 2K31A 3GECA 3P01A 5TJJA 3F1NB 4GCZA 4R70A 2IA2A 3S7OA 1LSXA 4ARZB 4JGPA 3PBQA 2H28A 4JGRA 2VGLS 3B47A 2XRNA 3C2WA 3S7PA 4CLCE 4GJ4A 3PBOA 3U2AA 1NLYA 1TD5A 2HGVA 4ZRRA 1OTIA 3FC7A 3KO6A 3HJIA 1UGUA 2QJ5A 4CLCA 2Y79A 3K3CA 4F3LA 1UWPX 2Y8HA 2J80A 3NJAA 1MZUA 5HWTA 4IHQA 2VX8A 2Z6DA 3NOPC 2EWWA 4BBUA 1EW0A 5FL3A 3PR6A 4LRXC 2I9VA 1LSVA 3V67A 4G3KA 2ZMVA 3F1PB 4LLOB 2OAP1 2O99A 3RH8B 4MN5A 3T4TA 1IFQA 4GS9A 2VV8A 3OLOA 5HZHA 2JKTM 3ICYA 3PBNA 5C5KA 1P9WA 2HJ9C 1S1ZA 1OJ5A 4R38A 2MJ6A 3C30A 3C8CA 2NUPC 4KQOA 3BJNA 2M1CA 4IUHA 3EGXC 3CAXA 5HDDA 5HWVA 3PYPA 4NXFA 5HSQA 1VB6A 2V9AA 4I5SA 4GHIA 4HP9A 2W3FA 2FZ0A 2HV1A 3T4SA 4YNRA 3B42A 2OAQ1 2W1TB 1UWNX 2HJEA 1T1CA 3JVVA 1YAXA 1N9LA 1TS7A 2W3GA 2YKFA 3LIDA 3NOTC 2A24B 1DRMA 5A8BA 2EWVA 2LB9A 5J4EA 3PXPA 2QKPA 3GDIA 4HI4A 2JKRI 5DFYA 4Q0HA 4HIAA 2JHEA 3NHQA 4HY8A 3E4OA 2D01A 3VE3A 2ZOHA 4L9GA 5HWWA 1D7EA 2EA9A 2B02A 2P04A 3OCNA 5F69A 3KSFA 1MC0A 3LI8A 3PBSA 3BQAA 3MJQA 3JVUA 5TBMA 1NWZA 2P7JA 3A0VA 5HDSA 4L0LA 4JGQA 1V9YA 3H9WA 3ZYTA 5IS1A 4NXGA 3LR4A 4O8GA 1LL8A 1S66L 1N9NA 4MCWA 2W3DA 4II7A 3PBTA 4B93A 4EXOA 3B33A 3BY9A 1P9RA 3LR3A 4MN7A 3H82B 3BWLA 5HD3A 5HD5A 4Q0JA 4EU0A 4EERA 5HL6A 4I3AA 3T4JA 2KDKA 3E4QA 1NLZA 3LICA 4YOFA 3TJZC 4AFIA 3S7QA 4P6ZS 2NUTC 2KX6A 4H6JB 2QWSA 2J3TD 1S1YA 1KOUA 4WELA 2L1MA 4MMNA 2VLGA 3LYXA 2VGLM 4YWZA 3O5YA 3CLOA 4I38A 2PYPA 4NXBA 4PHTA 2G7UA 3R7WB 4Y2FA 3T50A 4I3JA 4CLCB 2ZOIA 4WEJA 2INWA 3FG8A 4G3VA 3IS2B 4BMWA 2O9AA 5KSHA 1YSPA 4DJ3A 1P97A 3MQ0A 4HNBA 5IT5A 4MN6A 1OTBA 2VV7A 3BY8A 3VV4A 3LI9A 2O9CA 3EWKA 4HJ4A 2PD7A 5I5LA 3PHYA 4LRYC 2K2NA 1DP9A 4WN5A 3F1PA 3EEHA 3LIEA 1S4RA 3MFXA 1P0ZA 1LSWA 2J3TC 2BASA 2O9BA 2XSSA 3H7WA 4BWIA 5F6AA 3CWFA 2D02A 3IBRA 2V0WA 1OT9A 1TS6A 5L8MA 4EW7A 4BBVA 3LR5A 4K08A 4HQAA 1W63Q 2JKRM 1XJ2A 1S4SA 4O01A 4WEKA 4NKPA 4WUJA 3EOIA 5DJUA 5HDCA 1V9ZA 1OJGA 3EGDC 1OTAA 4R3AA 2Z6CA 2PD8A 3T4KA 3E0YA 4RQ9A 1LT0A 3FPWA 2PR5A 3A0SA 4DMZA 3DBAA 4HH2A 4CLCD 4EQ1A 4NEED 4LRZE 4L9FA 4OOMA 1TS8A 2KOIA 5DFXA 5DKKA 1H3QA 1D06A 4Z1WA 3TE8A 4EUVA 2ZMFA 4PKYA 2WKQA 4R6LA 4PKYG 2OOLA 3LUQA 3T4OA 2A24A 5LBRA 1XJ4A 2W27A 3MQQA 4KUOA 5CX7A 2P08A 1BYWA 4UQIS 5J3WA 3UB6A 2VV6A 4O0PA 4XT2A 3P7NA 2K7SA 2OWHA 3BW6A 1WA9A 1OT6A 1ZHHB 4FOFA 3PBRA 4UQIM 2PYRA 2ZBBA 2DMWA 5KIZA 4HOIA 5DJTA 2W3HA 4I39A 3HJKA 3UE6A 2PR6A 5IU1A 5AVEA 1XFNA 1GSXA 4EEUA 1X0OA 3K3DA 4Y5FA 1NRJA 2CMNA 2GZAA 2L4RA 3UB8A 3R4KA 4KUKA 3F1OA 4EETB 1F5MA 2VA0A 4HHDA 3OCLA 3VE4A 3IBJA 3CUEA 3F1NA 3EQVA 4P6ZM 4EEPA 4ARZA 1T19A 3KYZA 4WL9A 4H6JA 1JNUA 2V1BA 2YKHA 3E4PA 3RFBA 3RTYA 4IUKA 3VOLA 4F3LB 3MXQA 1STZA 2W3EA 4L9EA 3KYQA 4ETXA 2VZWA 3KSIA 3OC2A 2B18A 2GNXA 3TW8A 3R7WA 4EESA 2GJ3A 1XFQA 4PAUA 2XROA 3MR0A 1ODVA 2KLIA 4CQHA 3IS2A 3LIBA 4GW9A 1H8MA 4GS9B 3LIAA 3K2NA 3MF0A 3KSHA 2R78A 3KSGA 4NXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6O A;  4Y3I A;  5TJJ A;  3KSF A;  3S7N A;  4R70 A;  4QPR A;  2VKS A;  2IA2 A;  4DMZ A;  3S7O A;  3CIT A;  3DBA A;  2QYB A;  5HPI A;  3EEA A;  4LRZ E;  3CI6 A;  2XRN A;  3C2W A;  3S7P A;  2KOI A;  5DFX A;  1TD5 A;  4Z1W A;  4O8G A;  4EUV A;  2ZMF A;  4MCW A;  4R6L A;  2W3D A;  4G3W A;  2HGV A;  4ZRR A;  3KO6 A;  1TF1 A;  2OOL A;  4MN7 A;  2Y79 A;  5LBR A;  4Q0J A;  2Y8H A;  4EU0 A;  5HL6 A;  2M7V A;  1YSQ A;  3NOP C;  2M7U A;  4LRX C;  4YOF A;  3OBF A;  4O0P A;  3S7Q A;  4G3K A;  3W2Z A;  1MKM A;  2O99 A;  2VEA A;  5AJG A;  2W1T A;  4FOF A;  2VJW A;  2O0Y A;  4MMN A;  4Q0I A;  5C5K A;  3NOU C;  4E04 A;  3HCY A;  2W3H A;  3O5Y A;  2G7U A;  3E98 A;  4Y2F A;  3ZQ5 A;  4Y5F A;  3BJN A;  3R4K A;  4G3V A;  4IUH A;  1ZTU A;  2O9A A;  5HSQ A;  1YSP A;  4IJG A;  2LB5 A;  1F5M A;  3MQ0 A;  2W3F A;  3VV4 A;  2O9C A;  3D3O A;  4DN0 A;  3IBJ A;  5I5L A;  4YNR A;  4LRY C;  2K2N A;  2W1T B;  4MDZ A;  3LFV A;  3MMH A;  5K5B A;  2O9B A;  2XSS A;  2W3G A;  3NOT C;  4BWI A;  5HPF A;  3RFB A;  4IUK A;  1VHM A;  1STZ A;  2W3E A;  3IBR A;  5L8M A;  4ETX A;  2LB9 A;  1YKD A;  2VZW A;  3KSI A;  4GLQ A;  3TRC A;  2B18 A;  5DFY A;  4Q0H A;  3NHQ A;  2GX5 A;  4O01 A;  4PAU A;  3OOV A;  2XRO A;  2W1R A;  2KLI A;  4ETZ A;  4CQH A;  4GW9 A;  4ME4 A;  2K31 A;  3E0Y A;  3K2N A;  3MF0 A;  3KSH A;  4RQ9 A;  3KSG A;  1MC0 A; 
#chains in the Genus database with same CATH topology
 1Y54 A;  3G6O A;  5HPI A;  5CGX A;  4LPZ A;  4HP4 A;  3UB9 A;  1BUL A;  3T4Q A;  1W5D A;  2PT7 A;  1TF1 A;  4UHU A;  2ZL1 B;  1K56 A;  3N7W A;  4CJN A;  5FQK A;  3OBF A;  3HLF A;  2P9V A;  3W2Z A;  3A3E A;  1T18 A;  1MKM A;  1W7F A;  3A0R A;  1Q2Q A;  1XA1 A;  2X71 A;  4Q8I A;  5FQJ A;  2O0Y A;  2V0U A;  1MXO A;  5F68 A;  3UDX A;  4R3B A;  5FQM A;  1H8Z A;  1OTE A;  1SKF A;  2L0W A;  3CHW P;  2XH9 A;  3Q81 A;  3ZGA B;  2WKR A;  1Y28 A;  3UN7 A;  3N8S A;  5CER A;  5G4Z A;  4P85 A;  3SOI A;  2VGK A;  3QP1 A;  2H0Y A;  4CPK A;  4DN0 A;  3BFG A;  4LFU A;  4CLC C;  3LFV A;  3E2K A;  4OPR A;  2B5R A;  1GSW A;  1O7E A;  1VHM A;  1TS0 A;  1DJB A;  5MC7 A;  4GLQ A;  4LV1 A;  2WAF A;  4QY6 A;  2GX5 A;  4WMC D;  3OOV A;  4ETZ A;  3N8L A;  4HJ6 A;  1XJ6 A;  4JF4 A;  3P01 A;  4FUW A;  2XFT A;  1J9M A;  3BFE A;  4B4Z A;  1PIO A;  2XDM A;  1PZO A;  2H28 A;  2WZZ A;  4JGR A;  3S7P A;  4GJ4 A;  3U2A A;  4E6X A;  1NLY A;  3IH8 A;  3MBZ A;  5E43 A;  4ZRR A;  3KO6 A;  1K6S A;  4D2O A;  2QJ5 A;  2EX8 A;  3IF6 B;  2XR0 A;  4F3L A;  1CF0 A;  3ZHH A;  1RP5 A;  3IWI A;  1MZU A;  2V20 A;  2DRW A;  3BEC A;  2EWW A;  5DTS A;  1NRF A;  4S2I A;  5FL3 A;  3PR6 A;  1VM1 A;  4JF5 A;  2BLS A;  2ZMV A;  1E25 A;  2O99 A;  4MN5 A;  3T4T A;  5IHV A;  5DF7 A;  1S0W A;  3OLO A;  4Y17 A;  4JXG A;  2IWD A;  5L09 A;  1K25 A;  1K54 C;  2HJ9 C;  1ES5 A;  1SKO B;  1S1Z A;  1KGG A;  4R38 A;  3RXX A;  3NIA A;  2Y2P A;  4JXW A;  2J9O A;  1TVF A;  4B4X A;  1LI0 A;  3VP3 A;  1AXB A;  3PYP A;  3CPT A;  4NXF A;  2XK1 A;  1WE4 A;  4PPR A;  5EUA A;  2FZ0 A;  3T4S A;  4FCF A;  3SZT A;  2EX9 A;  1T1C A;  4X25 A;  1XP4 A;  3JVV A;  1N9L A;  4R3J A;  1DRM A;  5A8B A;  1MY8 A;  2QKP A;  1YMX A;  2JKR I;  2V8C A;  2JHE A;  3NHQ A;  4LGW A;  5CGW A;  3OPH A;  5GLA A;  5L07 A;  5F69 A;  3KSF A;  1IEM A;  1XGI A;  3JVU A;  1H8Y A;  3LY3 A;  2H0T A;  4GDN A;  4WZ5 C;  2XD1 A;  5GHY A;  1LL8 A;  2EX6 A;  1N9N A;  2W3D A;  2E8I A;  3B33 A;  4KZ4 A;  1EI5 A;  1P9R A;  3KYE A;  3LR3 A;  4MN7 A;  3H82 B;  3BWL A;  5HD3 A;  2WKI A;  5GL9 A;  3B3X A;  1NZO A;  5HL6 A;  3T1X A;  4ESP A;  1L0E A;  4YOF A;  4AFI A;  1D1J A;  1CI8 A;  2XLN A;  4P6Z S;  2NUT C;  2J3T D;  3W4O A;  1KOU A;  2Y2J A;  4WEL A;  3Q07 A;  1N4O A;  3GV9 A;  4YWZ A;  3O5Y A;  3CLO A;  1KDW A;  4I38 A;  5FSR A;  2G2W A;  4RVA A;  1FR6 A;  3GTC A;  4I3J A;  4CLC B;  2ZOI A;  2INW A;  5E2E A;  3FG8 A;  1NY0 A;  5KSH A;  3MQ0 A;  4HNB A;  1VET A;  1OTB A;  4HEF A;  2O9C A;  4DE2 A;  4LRY C;  4PM9 A;  1JTG A;  3IXB A;  5DTK A;  1P0Z A;  5M18 A;  3NDE A;  4KG6 A;  4BWI A;  3QHY A;  1FSY A;  4MBF A;  1NZU A;  2ZL1 A;  4GDB A;  4C3Q A;  4NKP A;  4WUJ A;  2P9V B;  3IWO A;  4LCM A;  2Z6C A;  4RQ9 A;  3A3F A;  2HDU A;  3FPW A;  2ZC7 A;  3C4O A;  3DBA A;  1E3U D;  1E4D A;  4CLC D;  4EQ1 A;  1NXY A;  3DWZ A;  4L9F A;  1TS8 A;  2KOI A;  5TFQ A;  4DDS A;  4Z1W A;  1W8Q A;  4EUV A;  4PKY A;  4R6L A;  3D4F A;  2WKE A;  3Q7Z A;  2OV5 A;  3LUQ A;  2W27 A;  1RGZ A;  4DKI A;  4IED A;  1HVB A;  1FCO A;  3MQQ A;  4GD6 A;  3BLM A;  1BYW A;  4UQI S;  3UB6 A;  3N4I A;  2ZQD A;  2K7S A;  3AGD A;  1WA9 A;  2OSU A;  3VOZ A;  1K56 D;  2PYR A;  2ZBB A;  2DMW A;  3LY4 A;  4X6T A;  1FOF A;  1IYS A;  4F94 A;  4I39 A;  3HJK A;  4GOG A;  5HAP A;  1GSX A;  4YIN A;  4EEU A;  3K3D A;  4U0X A;  2ZQ7 A;  5A93 A;  4KUK A;  2WZX A;  5AQB A;  3M2J A;  2X01 A;  5A92 A;  2Y2O A;  4RA7 A;  3G35 A;  2UV0 E;  4P6B A;  2WUQ A;  3WS4 A;  2VK3 A;  3FYZ A;  4K0X A;  4WL9 A;  1GHI A;  3MS6 A;  1HTZ A;  2WK0 A;  3E4P A;  4F3L B;  4IUK A;  3VOL A;  1O07 A;  1MWR A;  1IKG A;  3UO9 A;  4KEN B;  3GR2 A;  1XFQ A;  1KVM A;  4QD4 A;  2XRO A;  3MR0 A;  3MZE A;  2G2U A;  3PAG A;  2QMI A;  3LIA A;  3SH8 A;  3BM6 A;  4MNR A;  4Y3I A;  3IH9 A;  4HBT A;  4FH4 A;  2VKS A;  1OPX A;  5HAI A;  3UMD A;  3CIT A;  3C5A A;  4OH0 A;  3IX8 A;  5E2H A;  1MWU A;  4G3W A;  4N1H A;  2FH5 A;  4RYE A;  1ESU A;  3CPT B;  4ZJ2 A;  3V39 A;  1G6O A;  5DKL A;  3LCE A;  2A3U A;  2W0N A;  3N6I A;  3QP4 A;  3BLS A;  2VJW A;  4M4X A;  2JKT I;  5F5Y A;  3NOU C;  2IWB A;  3UE3 A;  3ZQ5 A;  2C6W B;  1JWZ A;  3IWQ A;  1ZTU A;  1I2W A;  5FEG A;  4DRT A;  5J7E A;  1K0K A;  4XT2 B;  3HBR A;  2WYX A;  4H8R A;  1NJ4 A;  1IKI A;  2OWJ A;  3MMH A;  1LI9 A;  4D60 A;  4E3I A;  4BJP A;  4LV0 A;  2HDQ A;  3UB5 P;  4EV4 A;  4EBL A;  3WRZ A;  2HDR A;  2XA7 S;  3H82 A;  4JF6 A;  3TRC A;  3OPR A;  1G28 A;  4XUX A;  4ZAM A;  5J8X A;  3HRE A;  3GEC A;  1XPB A;  3SS3 A;  2IWC A;  1BLP A;  2GDN A;  3F1N B;  4GCZ A;  1LSX A;  2ACG A;  1XGJ A;  4UA9 A;  1BT5 A;  3C2W A;  3PBO A;  4BD0 A;  2WGW A;  4S2K A;  2PRF A;  1UGU A;  4CLC A;  4S2O A;  2PBD P;  3K3C A;  2Y8H A;  1VET B;  2ZC6 B;  2Z6D A;  1EW0 A;  4LRX C;  1LSV A;  4LLO B;  2OAP 1;  3P09 A;  4GS9 A;  3QP2 A;  4IBR A;  3MKF A;  2J8Y A;  4EQI A;  1I2S A;  1U60 A;  3V5M A;  4Y13 A;  2HP6 A;  1LL9 A;  2NUP C;  3C8C A;  3TSG A;  4KZA A;  2M1C A;  4IUH A;  3CAX A;  5HWV A;  1VB6 A;  2V9A A;  4OPZ A;  4GHI A;  4HP9 A;  3T1R A;  1GCE A;  4IBX A;  1YLP A;  1K4F A;  4YNR A;  1PWD A;  3B42 A;  2W1T B;  3ZDJ A;  1UWN X;  4KQQ A;  2DCF A;  2W3G A;  3MSH A;  2EWV A;  5J4E A;  3PXP A;  3GDI A;  1K54 A;  4HI4 A;  4Q0H A;  4Y0U A;  5GHZ A;  3AGF A;  4HY8 A;  2D01 A;  1YLJ A;  1ZC2 A;  3IX4 A;  2EA9 A;  3Q7V A;  4DDY A;  5FI7 A;  1DY6 A;  1YLY A;  3MJQ A;  1PYY A;  5TBM A;  1CI9 A;  3QNC A;  1NWZ A;  1VEU A;  5FEF A;  5HDS A;  5F82 A;  4L0L A;  4JGQ A;  4KQR A;  3H9W A;  1MPL A;  3ZYT A;  3LO7 A;  4NXG A;  2EFX A;  5KMW A;  5BOH A;  4QY5 A;  4II7 A;  4EXO A;  1L2S A;  5EM1 A;  3BY9 A;  1BTL A;  1J3W A;  4Q0J A;  4EU0 A;  1HLU P;  3E4Q A;  2WAE A;  3ZNY A;  3SS5 A;  2PU4 A;  4N92 A;  2KX6 A;  4UA7 A;  2QWS A;  3MXS A;  4DE1 A;  3VSK A;  4MMN A;  3HLE A;  1SHV A;  4YFM A;  2VGL M;  2Y2K A;  5AQ7 A;  5EOO A;  2Y2Q A;  5M1A A;  3OPP A;  4MEZ A;  1L0F A;  4WZ5 A;  3Q1F A;  4BMW A;  3JYI A;  2Y59 A;  4OOY A;  5E2F A;  1A0K A;  3G30 A;  3BY8 A;  2WGV A;  3LEQ A;  5G18 A;  2PD7 A;  4EBP A;  3PHY A;  2ZM8 A;  4X1M A;  3JPU A;  5EVE A;  4EUZ A;  1DP9 A;  2ZQ8 A;  3EEH A;  3F1P A;  1SZV A;  4S2N A;  1S4R A;  3MFX A;  3UPN A;  2P74 A;  4OVD A;  2Y2G A;  3LEZ A;  5L2F A;  3IBR A;  2V0W A;  1TS6 A;  5L8M A;  5FQ9 A;  1GA0 A;  4KZ7 A;  5DTT A;  2JKR M;  4X69 A;  1DJA A;  3PTE A;  4XUZ A;  1S4S A;  4Z9Q A;  1V9Z A;  1OJG A;  3EGD C;  2FFF B;  1GHP A;  3E0Y A;  3NUL A;  1LT0 A;  4JXS A;  4OPQ A;  3BFC A;  4NEE D;  1M40 A;  4OOM A;  3W4Q A;  5DKK A;  2WKQ A;  4NET A;  3T1Q B;  3T4O A;  2A24 A;  1IYP A;  5L10 A;  1DJC A;  3E2L A;  1PWC A;  4X56 A;  4JLF A;  4B88 A;  5CTM A;  4XT2 A;  2ZM0 A;  2OWH A;  3BW6 A;  2Y4A A;  3CJM A;  3IF5 A;  5KIZ A;  1BZA A;  1MWS A;  2W3H A;  3VP0 A;  1XFN A;  4BQM A;  4Y5F A;  1NRJ A;  2CMN A;  1FSW A;  4S2N C;  5TGF A;  1QME A;  2PBY A;  5CHJ A;  5CXW A;  4ID4 A;  3F1N A;  3QP6 A;  1WYC A;  3EQV A;  4EEP A;  1ES2 A;  4R0Q A;  2B95 A;  3I7J A;  3KYZ A;  2WGW B;  1JNU A;  3NEC A;  5F1F A;  4X53 A;  2CC1 A;  2BTF P;  4L9E A;  1STZ A;  2AVX A;  4ETX A;  2EX2 A;  3OC2 A;  1YMS A;  3HL9 A;  2Y2I A;  4HBU A;  4NG2 A;  4PAU A;  2R9X A;  1G68 A;  2KLI A;  3IS2 A;  1H8M A;  4GS9 B;  3KSG A;  4BL3 A;  4P87 A;  1OME A;  1W63 M;  4QPR A;  2A2L A;  4MBK A;  1K6R A;  4KZ3 A;  3EEA A;  3CI6 A;  1FCN A;  2ZM2 A;  4ZBE A;  3MQO A;  3ULF A;  3ZG9 B;  3T4L A;  4FSF A;  2HZ5 A;  2PHY A;  4GHI B;  2QJ7 A;  2HF6 A;  3SH7 A;  4KQD A;  1YSQ A;  3VP2 A;  4M3K A;  3BRM A;  3QNB A;  1JVJ A;  3MZD A;  3C38 A;  4S2J A;  3HLC A;  2VEA A;  2W1T A;  1T1A A;  4WF0 A;  1BLH A;  4HH3 A;  1PI4 A;  4Q0I A;  4U3T A;  1KDS A;  1S67 L;  3HCY A;  5G4Y A;  1F98 A;  1SCW A;  4WLA A;  1ES4 A;  1SDE A;  4QB8 A;  4B9O A;  4IJG A;  2LB5 A;  3Q7V B;  5EVI A;  3VFH A;  1YM1 A;  4KZ8 A;  3G4P A;  5CEB A;  5TBM B;  1K38 A;  1VEU B;  4X68 A;  5JYP A;  3LIF A;  4S2M A;  2HP9 A;  1N9O A;  4MDZ A;  1CK3 A;  3PAE A;  5F83 A;  4HJ3 A;  1XX2 A;  2QHK A;  1K55 C;  5GLC A;  3N8R A;  2V1A A;  3IHA A;  5HPF A;  4Y0O A;  1MKI A;  2PDR A;  3A3I A;  3ZFZ A;  3HLD A;  1TDL A;  1YKD A;  4GN2 A;  3NCK A;  4FH2 A;  4DF6 A;  3BQ8 A;  3GQZ A;  4ZTK A;  4K91 A;  4K0W A;  2W1R A;  4GZB A;  2J9P A;  1T1B A;  2Z2M B;  2K31 A;  3A3D A;  5TJJ A;  5A90 A;  4R70 A;  4OLG A;  2IA2 A;  4ARZ B;  4JGP A;  3PBQ A;  1KE0 A;  2VGL S;  3B47 A;  4CLC E;  1TD5 A;  5GLB A;  3NBL A;  2HGV A;  1OTI A;  1IYO A;  2HDS A;  2OLV A;  1XXM A;  4UA6 A;  1N9B A;  4EWF A;  3NJA A;  5HWT A;  4IHQ A;  2ZMA A;  5A91 A;  3T1S A;  4BBU A;  1YLT A;  1L0G A;  4E3J A;  1PWG A;  3NDG A;  4G3K A;  3F1P B;  3O3V A;  1BLC A;  1IFQ A;  4E3N A;  2VV8 A;  5HZH A;  2JKT M;  1CQA A;  5C5K A;  5EVI C;  1P9W A;  3GSG A;  3ZG7 B;  4N9L A;  3UDF A;  1RGY A;  2MJ6 A;  3C30 A;  4R4R A;  4KQO A;  3BJN A;  4R1G A;  5EEC A;  3V50 A;  3NY4 A;  2JCH A;  5HDD A;  5HSQ A;  2Q9M A;  1TEM A;  1FCM A;  4I5S A;  2Y2N A;  3MKE A;  3SS4 A;  2ZQC A;  1ZG6 A;  2W3F A;  5EM0 A;  1ONH A;  5FA7 A;  2HV1 A;  2ZC4 B;  2HJE A;  3IXD A;  1S6R A;  3VP1 A;  1TS7 A;  3LID A;  3NOT C;  3OPL A;  2A24 B;  5AQ9 A;  3HLG A;  2J7V A;  2PU2 A;  5DFY A;  3UNW A;  4HIA A;  1C3B A;  2WKH A;  3E4O A;  3GRJ A;  3S4X A;  2E8J A;  3VE3 A;  2ZOH A;  3S1Y A;  5HWW A;  3L7H A;  1D7E A;  2B02 A;  2P04 A;  1MC0 A;  3LI8 A;  3PBS A;  3BQA A;  5CRF A;  4UAA A;  3V3S A;  4N1X A;  4PM8 A;  5KSC A;  3IHB A;  1V9Y A;  2XGN A;  2Y2H A;  5IS1 A;  3WRT A;  3IF6 C;  1W8Y A;  5CHM A;  1S66 L;  4MCW A;  5AQA A;  3PBT A;  4B93 A;  4LCL A;  5CTN A;  3HVF A;  2HPB A;  3VOY A;  5HD5 A;  1HZO A;  4JBF A;  4EER A;  3D9Y A;  4I3A A;  1K57 C;  2KDK A;  5I94 A;  1PW1 A;  1YPR A;  1NLZ A;  3FV7 A;  5TR7 A;  1BUE A;  4PM6 A;  2L1M A;  5GHX A;  2R9W A;  1CEF A;  2VLG A;  3LYX A;  1G6A A;  2PYP A;  1SDN A;  4DE3 A;  4WEJ A;  3IS2 B;  5CED A;  1YSP A;  4DJ3 A;  1P97 A;  5U47 A;  5IT5 A;  5HFO A;  4E3L A;  3DTK A;  4WZ4 A;  3W8K A;  1WYB A;  5I5L A;  4DXB A;  3TG9 A;  4WN5 A;  4OLD A;  2J3T C;  5JYO A;  2BAS A;  2O9B A;  3CWF A;  4BBV A;  3LR5 A;  4QJG A;  4HQA A;  1W63 Q;  4MLL A;  3ZG5 A;  2RCX A;  1PFL A;  4O01 A;  4LV3 A;  5FAQ A;  5CGS A;  5DJU A;  5HDC A;  2JKF A;  3LGO A;  4R3A A;  3GVB A;  3IT9 A;  3T4K A;  3M6B A;  5EV0 A;  1FIK A;  4RX3 A;  4C75 A;  1XA7 A;  3UDI A;  3A0S A;  4DMZ A;  1I5Q A;  1GA9 A;  4HH2 A;  4LRZ E;  5DFX A;  1KE4 A;  1H3Q A;  3TE8 A;  5FAS A;  4WYY A;  4KZ5 A;  2Q9N A;  5LBR A;  3DAV A;  5EVI B;  4BL2 A;  3TOI A;  4EBN A;  5CEC A;  2P08 A;  4OQG A;  5GLD A;  4A5R A;  2VV6 A;  3P7N A;  3DWK A;  1OT6 A;  2BG1 A;  4UQI M;  3ITA A;  1IYQ A;  4E3O A;  5DJT A;  2OLU A;  5FQI A;  1XKZ A;  2PR6 A;  3G34 A;  4IVI A;  5AVE A;  5IU1 A;  4QWO A;  1X0O A;  2GZA A;  3UB8 A;  3R4K A;  3UY6 A;  4JPM A;  4EET B;  5E2G A;  4KG5 A;  3ZVT A;  3VE4 A;  3CUE A;  1JWV A;  1QMF A;  1ERM A;  2XEP A;  4OP5 A;  4ARZ A;  1LLB A;  1T19 A;  5EVI D;  4H6J A;  1PZP A;  2V1B A;  3UPO A;  2YKH A;  4PM7 A;  2ZC3 B;  4QHC A;  3RFB A;  2JBF A;  3S22 A;  1PW8 A;  3CG5 A;  2VZW A;  3G32 A;  3TW8 A;  1K4E A;  3R7W A;  2C5W B;  2QZ6 A;  2GJ3 A;  2ZC5 B;  1ODV A;  3G2Y A;  1NYY A;  4CQH A;  3LIB A;  4GW9 A;  4KZB A;  3MF0 A;  4XXR A;  4ZDX A;  4NXE A;  4PM5 A;  1OTD A;  3S7N A;  1KE3 A;  1ESI A;  3SW1 A;  5EFW A;  5CHU A;  4BLM A;  3IX3 A;  2QYB A;  2DNS A;  2VGJ A;  2Y55 A;  3H7W B;  3DTM A;  3FKW A;  1ZG4 A;  1GHM A;  1RCJ A;  1DP6 A;  3DW0 A;  4OON A;  3MZF A;  3HUM A;  2M7V A;  1BLS A;  4FD8 A;  2M7U A;  4JGO A;  4DJ2 A;  4IVK A;  3EQU A;  2JKG A;  2XQZ A;  5AJG A;  1VQQ A;  2QPN A;  1YLW A;  2EFU A;  2HP5 A;  1KVL A;  3Q82 A;  3UE0 A;  1KGE A;  4E04 A;  3KX0 X;  3WWX A;  1F9I A;  2ZJ9 A;  1XJ3 A;  3CUE C;  1IOU A;  1GSV A;  5HX9 A;  1DP8 A;  3E98 A;  3V3R A;  1ALQ A;  1ES3 A;  3D72 A;  4O7D A;  3LR0 A;  2WKP A;  3ISG A;  5HW3 A;  1W79 A;  3BFF A;  4BBT A;  3G31 A;  2JE5 A;  3D3O A;  3UME A;  5DVA A;  2J3W A;  4I3I A;  4N9K A;  4U0T A;  3VP4 A;  2JN7 A;  5K5B A;  3FWL A;  1G5U A;  5DF9 A;  4BEN A;  3UB7 A;  2EXB A;  2UWX A;  4OOL A;  3FPV A;  4UEY A;  3RXW A;  1Y4O A;  4Y7P A;  2XF3 A;  2WGI A;  3L9K A;  4C6Y A;  3F1O B;  3ZVW A;  2XA7 M;  5AVF A;  4ME4 A;  5HAQ A;  3BFD A;  5DF8 A;  4JXV A;  3S7O A;  2H5S A;  4KZ9 A;  3FZC A;  2XRN A;  3A3J A;  1NYM A;  4LEN A;  1IEL A;  1M6K A;  3FC7 A;  3HJI A;  2Y79 A;  1UWP X;  1K55 A;  3AGE A;  3WS5 A;  3G2Z A;  2J80 A;  1L3L A;  4DXC A;  2VX8 A;  5EE8 A;  1Z09 A;  3U4L P;  4X1L A;  3NOP C;  5HL1 A;  2I9V A;  3BEB A;  3V67 A;  1JWP A;  3RH8 B;  5D3O A;  3WS2 A;  1YLZ A;  4BD1 A;  3ICY A;  3PBN A;  3ZG0 A;  1JTD A;  1OJ5 A;  5F1G A;  1PRQ A;  5FQQ A;  1FIL A;  4GKU A;  3CZD A;  4NK3 A;  3EGX C;  2PAV P;  5FDH A;  3O86 A;  2XD5 A;  2Q0O A;  2OAQ 1;  2Z2L B;  4WMC A;  1YAX A;  3CMZ A;  2YKF A;  3IXH A;  3NI9 A;  4OQH A;  3C7U A;  1MBL A;  2LB9 A;  1F2K A;  1BSG A;  5FAO A;  2Y2L A;  4L9G A;  5EPH A;  3HUN A;  3OCN A;  3OZH A;  2RL3 A;  1Z6F A;  4RX2 A;  2P7J A;  3A0V A;  3ZNT A;  3BYD A;  1ERQ A;  3LR4 A;  4O8G A;  4Y15 A;  3RJU A;  2X02 A;  5FAT A;  3WS0 A;  4QU3 A;  1ERO A;  2ZQA A;  3ITB A;  3VMA A;  3T4J A;  4E3K A;  3LIC A;  3P98 A;  3VSL A;  3TJZ C;  3S7Q A;  4WM9 A;  3UE1 A;  2A49 A;  3MFD A;  4H6J B;  3HUO A;  1LL5 A;  1S1Y A;  4KZ6 A;  3NC8 A;  4OKP A;  4E3M A;  4NXB A;  4PHT A;  2G7U A;  3R7W B;  4Y2F A;  4S2L A;  3T50 A;  4HES A;  4S2P A;  4G3V A;  5M19 A;  2O9A A;  3IF6 A;  2EXA A;  3IQA A;  4MN6 A;  2VV7 A;  1Q2P A;  4E6W A;  3MXR A;  3VV4 A;  3LI9 A;  3EWK A;  4HJ4 A;  3VFF A;  5EOE A;  1PNE A;  2H10 A;  2K2N A;  1K57 A;  3UPP A;  3LIE A;  3O87 A;  1MWT A;  4OQI A;  1LSW A;  2XSS A;  1FQG A;  3H7W A;  4WBG A;  4FTX A;  5FDS A;  5F6A A;  3ZG8 B;  1HD8 A;  1EWZ A;  2D02 A;  3T12 B;  1OT9 A;  4EW7 A;  1SKO A;  4K08 A;  5FI2 A;  1XJ2 A;  4WEK A;  3EOI A;  3SH9 A;  2I72 A;  2Y2M A;  3C7V A;  4OP8 A;  1OTA A;  1YT4 A;  5FAP A;  2PD8 A;  3HLW A;  4LV2 A;  1ZKJ A;  1L0D A;  3C4P A;  1LHY A;  1PI5 A;  5FI6 A;  4ZJ1 A;  4PMA A;  2PR5 A;  1YQS A;  3W4P A;  3IXG A;  1D06 A;  1ONG A;  2ZMF A;  3DTI A;  4PKY G;  2OOL A;  2V2F F;  2V1Z A;  1XJ4 A;  3QP5 A;  4KUO A;  5CX7 A;  3M2K A;  4R4S A;  5J3W A;  2XFS A;  5HAR A;  4O0P A;  1TDG A;  1ZHH B;  4FOF A;  3PBR A;  2V8F A;  2Y91 A;  2FFY A;  3M6H A;  4HOI A;  1CEG A;  1H5X A;  3UE6 A;  4P0M A;  2ZLY A;  4GB7 A;  4ZJ3 A;  4GNU A;  3O88 A;  1AWI A;  2JC7 A;  2L4R A;  4OPY A;  1CJF A;  3F1O A;  1H0M A;  3QP8 A;  1F5M A;  2VA0 A;  4HHD A;  5KZH A;  3OCL A;  3IBJ A;  4P6Z M;  3FKV A;  1ACF A;  3ZCZ A;  4OQ0 A;  4DE0 A;  1KGF A;  3HLB A;  4R23 A;  4X55 A;  4GD8 A;  3RTY A;  3MXQ A;  2W3E A;  3KYQ A;  4JKT A;  2ZQ9 A;  1FR1 A;  3KSI A;  5EVL A;  3DTE A;  4KG2 A;  4Y0T A;  2B18 A;  2GNX A;  2WAD A;  4EES A;  3WS1 A;  1E3U A;  3GMW A;  4MBH A;  3K2N A;  2ZD8 A;  3KSH A;  2R78 A; 
#chains in the Genus database with same CATH homology
 3G6O A;  4Y3I A;  1OTD A;  3S7N A;  1W63 M;  3SW1 A;  4QPR A;  2VKS A;  2A2L A;  1OPX A;  5EFW A;  3UMD A;  3CIT A;  2QYB A;  5HPI A;  4LPZ A;  3EEA A;  3CI6 A;  4HP4 A;  3UB9 A;  3MQO A;  3T4Q A;  3H7W B;  3ULF A;  2PT7 A;  4G3W A;  1TF1 A;  2FH5 A;  3T4L A;  1G6O A;  1DP6 A;  4FSF A;  5DKL A;  2PHY A;  4GHI B;  2QJ7 A;  2HF6 A;  2M7V A;  4KQD A;  2W0N A;  1YSQ A;  2M7U A;  4JGO A;  4DJ2 A;  3OBF A;  3C38 A;  3EQU A;  3W2Z A;  1T18 A;  1MKM A;  3A0R A;  2VEA A;  5AJG A;  2W1T A;  1T1A A;  4WF0 A;  2VJW A;  4HH3 A;  2JKT I;  4M4X A;  2O0Y A;  4Q0I A;  2V0U A;  5F5Y A;  3NOU C;  4E04 A;  3KX0 X;  1S67 L;  1F9I A;  3UE3 A;  3HCY A;  5F68 A;  5G4Y A;  1F98 A;  1XJ3 A;  3CUE C;  1IOU A;  1GSV A;  1OTE A;  1DP8 A;  3E98 A;  2L0W A;  3ZQ5 A;  4WLA A;  1ZTU A;  2WKR A;  3D72 A;  1Y28 A;  4B9O A;  3LR0 A;  2LB5 A;  2WKP A;  4IJG A;  5G4Z A;  4BBT A;  5J7E A;  3D3O A;  4XT2 B;  4DN0 A;  5TBM B;  3UME A;  2J3W A;  4I3I A;  3LIF A;  1N9O A;  4MDZ A;  4CLC C;  3LFV A;  2OWJ A;  3MMH A;  2JN7 A;  4HJ3 A;  5K5B A;  2QHK A;  5DF9 A;  1GSW A;  3UB7 A;  4BJP A;  2V1A A;  5HPF A;  4OOL A;  1VHM A;  3FPV A;  2PDR A;  1TS0 A;  4UEY A;  2XA7 S;  1YKD A;  3H82 A;  5MC7 A;  4GLQ A;  3TRC A;  3BQ8 A;  1G28 A;  2GX5 A;  3OOV A;  3F1O B;  2W1R A;  2XA7 M;  4ETZ A;  5AVF A;  1T1B A;  4HJ6 A;  4ME4 A;  1XJ6 A;  2K31 A;  3GEC A;  3P01 A;  5TJJ A;  3F1N B;  4GCZ A;  4R70 A;  2IA2 A;  3S7O A;  1LSX A;  4ARZ B;  4JGP A;  3PBQ A;  2H28 A;  4JGR A;  2VGL S;  3B47 A;  2XRN A;  3C2W A;  3S7P A;  4CLC E;  4GJ4 A;  3PBO A;  3U2A A;  1NLY A;  1TD5 A;  2HGV A;  4ZRR A;  1OTI A;  3FC7 A;  3KO6 A;  3HJI A;  1UGU A;  2QJ5 A;  4CLC A;  2Y79 A;  3K3C A;  4F3L A;  1UWP X;  2Y8H A;  2J80 A;  3NJA A;  1MZU A;  5HWT A;  4IHQ A;  2VX8 A;  2Z6D A;  3NOP C;  2EWW A;  4BBU A;  1EW0 A;  5FL3 A;  3PR6 A;  4LRX C;  2I9V A;  1LSV A;  3V67 A;  4G3K A;  2ZMV A;  3F1P B;  4LLO B;  2OAP 1;  2O99 A;  3RH8 B;  4MN5 A;  3T4T A;  1IFQ A;  4GS9 A;  2VV8 A;  3OLO A;  5HZH A;  2JKT M;  3ICY A;  3PBN A;  5C5K A;  1P9W A;  2HJ9 C;  1S1Z A;  1OJ5 A;  4R38 A;  2MJ6 A;  3C30 A;  3C8C A;  2NUP C;  4KQO A;  3BJN A;  2M1C A;  4IUH A;  3EGX C;  3CAX A;  5HDD A;  5HWV A;  3PYP A;  4NXF A;  5HSQ A;  1VB6 A;  2V9A A;  4I5S A;  4GHI A;  4HP9 A;  2W3F A;  2FZ0 A;  2HV1 A;  3T4S A;  4YNR A;  3B42 A;  2OAQ 1;  2W1T B;  1UWN X;  2HJE A;  1T1C A;  3JVV A;  1YAX A;  1N9L A;  1TS7 A;  2W3G A;  2YKF A;  3LID A;  3NOT C;  2A24 B;  1DRM A;  5A8B A;  2EWV A;  2LB9 A;  5J4E A;  3PXP A;  2QKP A;  3GDI A;  4HI4 A;  2JKR I;  5DFY A;  4Q0H A;  4HIA A;  2JHE A;  3NHQ A;  4HY8 A;  3E4O A;  2D01 A;  3VE3 A;  2ZOH A;  4L9G A;  5HWW A;  1D7E A;  2EA9 A;  2B02 A;  2P04 A;  3OCN A;  5F69 A;  3KSF A;  1MC0 A;  3LI8 A;  3PBS A;  3BQA A;  3MJQ A;  3JVU A;  5TBM A;  1NWZ A;  2P7J A;  3A0V A;  5HDS A;  4L0L A;  4JGQ A;  1V9Y A;  3H9W A;  3ZYT A;  5IS1 A;  4NXG A;  3LR4 A;  4O8G A;  1LL8 A;  1S66 L;  1N9N A;  4MCW A;  2W3D A;  4II7 A;  3PBT A;  4B93 A;  4EXO A;  3B33 A;  3BY9 A;  1P9R A;  3LR3 A;  4MN7 A;  3H82 B;  3BWL A;  5HD3 A;  5HD5 A;  4Q0J A;  4EU0 A;  4EER A;  5HL6 A;  4I3A A;  3T4J A;  2KDK A;  3E4Q A;  1NLZ A;  3LIC A;  4YOF A;  3TJZ C;  4AFI A;  3S7Q A;  4P6Z S;  2NUT C;  2KX6 A;  4H6J B;  2QWS A;  2J3T D;  1S1Y A;  1KOU A;  4WEL A;  2L1M A;  4MMN A;  2VLG A;  3LYX A;  2VGL M;  4YWZ A;  3O5Y A;  3CLO A;  4I38 A;  2PYP A;  4NXB A;  4PHT A;  2G7U A;  3R7W B;  4Y2F A;  3T50 A;  4I3J A;  4CLC B;  2ZOI A;  4WEJ A;  2INW A;  3FG8 A;  4G3V A;  3IS2 B;  4BMW A;  2O9A A;  5KSH A;  1YSP A;  4DJ3 A;  1P97 A;  3MQ0 A;  4HNB A;  5IT5 A;  4MN6 A;  1OTB A;  2VV7 A;  3BY8 A;  3VV4 A;  3LI9 A;  2O9C A;  3EWK A;  4HJ4 A;  2PD7 A;  5I5L A;  3PHY A;  4LRY C;  2K2N A;  1DP9 A;  4WN5 A;  3F1P A;  3EEH A;  3LIE A;  1S4R A;  3MFX A;  1P0Z A;  1LSW A;  2J3T C;  2BAS A;  2O9B A;  2XSS A;  3H7W A;  4BWI A;  5F6A A;  3CWF A;  2D02 A;  3IBR A;  2V0W A;  1OT9 A;  1TS6 A;  5L8M A;  4EW7 A;  4BBV A;  3LR5 A;  4K08 A;  4HQA A;  1W63 Q;  2JKR M;  1XJ2 A;  1S4S A;  4O01 A;  4WEK A;  4NKP A;  4WUJ A;  3EOI A;  5DJU A;  5HDC A;  1V9Z A;  1OJG A;  3EGD C;  1OTA A;  4R3A A;  2Z6C A;  2PD8 A;  3T4K A;  3E0Y A;  4RQ9 A;  1LT0 A;  3FPW A;  2PR5 A;  3A0S A;  4DMZ A;  3DBA A;  4HH2 A;  4CLC D;  4EQ1 A;  4NEE D;  4LRZ E;  4L9F A;  4OOM A;  1TS8 A;  2KOI A;  5DFX A;  5DKK A;  1H3Q A;  1D06 A;  4Z1W A;  3TE8 A;  4EUV A;  2ZMF A;  4PKY A;  2WKQ A;  4R6L A;  4PKY G;  2OOL A;  3LUQ A;  3T4O A;  2A24 A;  5LBR A;  1XJ4 A;  2W27 A;  3MQQ A;  4KUO A;  5CX7 A;  2P08 A;  1BYW A;  4UQI S;  5J3W A;  3UB6 A;  2VV6 A;  4O0P A;  4XT2 A;  3P7N A;  2K7S A;  2OWH A;  3BW6 A;  1WA9 A;  1OT6 A;  1ZHH B;  4FOF A;  3PBR A;  4UQI M;  2PYR A;  2ZBB A;  2DMW A;  5KIZ A;  4HOI A;  5DJT A;  2W3H A;  4I39 A;  3HJK A;  3UE6 A;  2PR6 A;  5IU1 A;  5AVE A;  1XFN A;  1GSX A;  4EEU A;  1X0O A;  3K3D A;  4Y5F A;  1NRJ A;  2CMN A;  2GZA A;  2L4R A;  3UB8 A;  3R4K A;  4KUK A;  3F1O A;  4EET B;  1F5M A;  2VA0 A;  4HHD A;  3OCL A;  3VE4 A;  3IBJ A;  3CUE A;  3F1N A;  3EQV A;  4P6Z M;  4EEP A;  4ARZ A;  1T19 A;  3KYZ A;  4WL9 A;  4H6J A;  1JNU A;  2V1B A;  2YKH A;  3E4P A;  3RFB A;  3RTY A;  4IUK A;  3VOL A;  4F3L B;  3MXQ A;  1STZ A;  2W3E A;  4L9E A;  3KYQ A;  4ETX A;  2VZW A;  3KSI A;  3OC2 A;  2B18 A;  2GNX A;  3TW8 A;  3R7W A;  4EES A;  2GJ3 A;  1XFQ A;  4PAU A;  2XRO A;  3MR0 A;  1ODV A;  2KLI A;  4CQH A;  3IS2 A;  3LIB A;  4GW9 A;  1H8M A;  4GS9 B;  3LIA A;  3K2N A;  3MF0 A;  3KSH A;  2R78 A;  3KSG A;  4NXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...