2K2NA

Solution structure of a cyanobacterial phytochrome gaf domain in the red light-absorbing ground state
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
172
structure length
172
Chain Sequence
b'LDQILRATVEEVRAFLGTDRVKVYRFDPEGHGTVVAEARGGERLPSLLGLTFPAGDIPEEARRLFRLAQVRVIVDVEAQSRSISQPESWGLSARVPLGEPLQRPVDPCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHAEPRPYSQEELQVVQLLADQVSIAIAQAELSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title Solution structure of a cyanobacterial phytochrome GAF domain in the red-light-absorbing ground state.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Transferase
total genus 31
structure length 172
sequence length 172
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2k2nA00
4PAUA 1VHMA 3TRCA 1YKDA 3KSFA 3S7NA 5DFXA 3OOVA 2GX5A 2W1TB 2KOIA 3KSGA 5HPIA 3D3OA 3IBRA 3MF0A 4Y5FA 2W1TA 3O5YA 4CQHA 5AJGA 2ZMFA 3E98A 4LRXC 3EEAA 4R70A 5LBRA 4ZRRA 4EU0A 3G6OA 2O9BA 5I5LA 3VV4A 4Q0HA 2XRNA 1ZTUA 2LB5A 5HL6A 2O99A 1MC0A 3LFVA 4DN0A 3NHQA 2VJWA 3KO6A 3NOPC 2O0YA 4Y2FA 3DBAA 2Y79A 4G3KA 4DMZA 3NOUC 4QPRA 2OOLA 2VZWA 2KLIA 3W2ZA 4MN7A 4YOFA 4Z1WA 2M7VA 2K31A 3CITA 4G3VA 4LRYC 4G3WA 4ETXA 3E0YA 4IJGA 4EUVA 4Q0IA 4LRZE 4IUHA 3BJNA 2QYBA 4Q0JA 2W1RA 2HGVA 2VEAA 3KSIA 5DFYA 2O9CA 2K2NA 4E04A 2W3EA 3RFBA 2W3GA 3S7PA 2LB9A 1STZA 3NOTC 1TF1A 4MDZA 1MKMA 3HCYA 4ME4A 2W3DA 2VKSA 4R6LA 3MMHA 3IBJA 5L8MA 4YNRA 4BWIA 3S7QA 2B18A 5TJJA 4FOFA 3S7OA 3OBFA 2XSSA 3ZQ5A 4MCWA 2Y8HA 1F5MA 1TD5A 2M7UA 2IA2A 5HPFA 2G7UA 4ETZA 2W3FA 1YSPA 3KSHA 4O0PA 4GLQA 3R4KA 2O9AA 3CI6A 3K2NA 4O8GA 5C5KA 5HSQA 4RQ9A 4O01A 1YSQA 4IUKA 4GW9A 5K5BA 3C2WA 2XROA 4Y3IA 2W3HA 4MMNA 3MQ0A
chains in the Genus database with same CATH superfamily
5AQ9A 3TRCA 3F1OB 3MSHA 4S2NA 3RJUA 1PWCA 5A8BA 2BTFP 3OLOA 3WRZA 2ZM8A 3VP1A 5FEGA 3N7WA 2C6WB 2ZM0A 1ZG6A 4MBFA 5LBRA 4Q0HA 4GDNA 2EX8A 2LB5A 1S4RA 2Y2LA 2NUPC 3LFVA 4PM6A 2WGVA 2VJWA 2HF6A 2WYXA 4DDYA 1DJBA 4UQIM 1YLTA 3IXHA 2HP9A 3DBAA 4Y7PA 2GJ3A 1K56A 1VB6A 2HZ5A 4C3QA 3E4OA 3QNCA 3IF6C 4X53A 3IX4A 4NXEA 1EI5A 2YKHA 1TEMA 3FPVA 5DFYA 2W3GA 2EWVA 2OWHA 5CHMA 2IWDA 1SKOB 4MBKA 5AQBA 3RXXA 4BL3A 2PYPA 3MZEA 4KG2A 2Y2MA 2Z6CA 3BFEA 2ZC3B 1MWTA 3S22A 2V2FF 1QMEA 2V20A 1YLPA 3OPRA 1ES3A 3FKVA 4ETZA 2D01A 1L3LA 4WZ5A 2WGWB 3AGDA 3QP4A 3V39A 3VFFA 3T50A 1YLZA 1F9IA 1JNUA 5KZHA 4JF5A 5CX7A 3MF0A 1WE4A 3V50A 5FQMA 4HJ6A 1LL5A 1YLYA 1K55C 3DAVA 2WGIA 3GV9A 3F1NB 1ONHA 2P7JA 1F98A 4K0XA 3R7WB 4WLAA 4HQAA 4EESA 1RCJA 2FZ0A 2ZBBA 4MEZA 2CMNA 1HD8A 3WS1A 1UWNX 3CAXA 1NYMA 3B42A 1OT9A 3PXPA 1IYPA 4MN7A 3BFFA 2QPNA 2P74A 4HY8A 3ZVTA 1CEGA 1XPBA 1ONGA 4R4RA 5FL3A 1XGJA 3JVUA 5HZHA 5HD3A 3ZG9B 2H0YA 4BL2A 4LV0A 4LV3A 1CK3A 2GZAA 2W1RA 2VEAA 5HWTA 1FCMA 3E2KA 2R9XA 4Y0OA 3S7PA 1TF1A 3A0SA 4WEJA 1CEFA 1OJGA 4YWZA 1N9LA 4JGOA 5FAPA 4JXWA 4GHIA 1E3UA 1XJ2A 1KOUA 1ERMA 4L9FA 3KSHA 4OKPA 2JKTI 4PM5A 1Q2QA 2A24B 4X56A 5L07A 2ACGA 1H5XA 3MXSA 1G5UA 4R3JA 2GNXA 1ODVA 1RGYA 4XUXA 2VK3A 1OMEA 4EUVA 3G2YA 2JKTM 2XD1A 3VP3A 1XFQA 3U4LP 1KDWA 3JVVA 3ZDJA 3LYXA 1SHVA 5CHJA 4GS9A 4Y5FA 3LR4A 2JN7A 2W1TA 5FQQA 4X25A 3EEAA 1KGFA 4CLCD 1V9YA 2B02A 2O9BA 3BY8A 5U47A 1XXMA 4JF6A 4S2NC 1H8ZA 5CGXA 2O99A 2FFYA 3RTYA 3IX3A 4DN0A 3UMDA 3KO6A 2PR5A 2C5WB 3Q7VB 1IKIA 2OOLA 1NRJA 1I2WA 3GR2A 2L0WA 3T4SA 1TS8A 3VSKA 1KE4A 3A3EA 4OOMA 3LR0A 3LY4A 1XP4A 1Q2PA 1LHYA 4RA7A 1Y4OA 3ZCZA 4JGRA 4EETB 2HGVA 3RXWA 2Y2PA 1SDEA 3UNWA 1GHMA 3CHWP 4WBGA 5M19A 2ZQ8A 4DRTA 4BBUA 3G4PA 1ES4A 3WS2A 2XQZA 2JKRI 2L4RA 2Y2HA 2B18A 2Y91A 5HAQA 2V1ZA 1P0ZA 3QP5A 2JKRM 4GDBA 4JGQA 1FSYA 1KDSA 3L9KA 4KZ4A 4PM9A 3NC8A 2QJ7A 2XLNA 3FG8A 5E2FA 5CHUA 4HIAA 5FASA 4GLQA 4D2OA 3T4QA 5G4ZA 4PMAA 2ZMAA 3G31A 5K5BA 4HJ3A 1FSWA 1H0MA 4WF0A 4I3AA 3FZCA 3KYQA 1KE0A 4R4SA 4WZ5C 5FDSA 3C7UA 5CERA 3HLGA 5CGWA 3ZG7B 2R78A 1QMFA 5L09A 2JKGA 4KUKA 5GL9A 5I5LA 1TS7A 4BD0A 1BT5A 5DJUA 1BUEA 3UE6A 5F5YA 4X1MA 2XR0A 4JBFA 3OC2A 3Q07A 1LL9A 1FIKA 3OCLA 4B4ZA 4GN2A 4HEFA 4DMZA 3NOUC 1FCNA 4CLCA 4C75A 3DTIA 4ZJ3A 2ZMVA 4IHQA 4HI4A 4KQDA 3LCEA 3HREA 4ZTKA 5CXWA 1OPXA 4K08A 4IJGA 1IYSA 3ITBA 5FQKA 2V8FA 2WKPA 2UWXA 4QWOA 4E04A 2PU4A 3JPUA 3LIAA 2EXBA 1TVFA 2MJ6A 1KE3A 3PR6A 1XA7A 4MCWA 3PAEA 5IT5A 3N8SA 1OJ5A 5F1FA 2ZD8A 2JE5A 1UWPX 5C5KA 4HBTA 3VOYA 3HJKA 3S7NA 4N1HA 4H8RA 2QWSA 4ZDXA 4P87A 4R23A 5HPIA 1W8QA 3O5YA 2Y2NA 2XD5A 4ZJ2A 3C30A 3C5AA 3T1RA 5FI2A 1HTZA 2I72A 3M6HA 3WS0A 4QHCA 4S2IA 5EE8A 3SZTA 2A3UA 3PYPA 4IBRA 2W27A 1NLYA 4I3JA 1S66L 3A3DA 2KLIA 4X55A 3AGFA 2PHYA 4G3WA 1PW8A 3P98A 1KGGA 1KVLA 1PFLA 2I9VA 2VGJA 4S2OA 3ULFA 2EX2A 2QYBA 4XT2A 3TE8A 1GA0A 3H7WB 4UA7A 2K7SA 2DCFA 1ZG4A 2HV1A 4BD1A 1MWUA 5EVID 4E6WA 1DP6A 2Y2KA 5HARA 4DKIA 3ZNTA 4GHIB 1I2SA 4P6BA 2OV5A 1FR1A 4KUOA 4F3LA 2Y8HA 1PIOA 1F5MA 1MBLA 2H0TA 3A3JA 1NYYA 1OT6A 3B3XA 2PBDP 3IQAA 3MFXA 1M6KA 3OCNA 4IUKA 4BJPA 3C7VA 5EM0A 4N9LA 4ZAMA 3MQ0A 1EROA 4LV1A 3SH9A 2W1TB 3M2KA 5CTNA 1L2SA 4HH2A 2PAVP 4HHDA 4ZJ1A 1P9WA 3EQUA 4GOGA 3E98A 1PYYA 4ZRRA 4OP8A 4ID4A 3DWZA 3CUEA 2Y2IA 2XRNA 4DDSA 1ZTUA 4HH3A 5DKLA 2ZL1B 1NXYA 4E3LA 5HX9A 1EWZA 2PYRA 3MQOA 4NXFA 3HBRA 3P01A 3VMAA 1L0DA 2Y2GA 4U0XA 1D1JA 1I5QA 2HDQA 4LRYC 2ZOIA 3IWQA 3F1PA 1ESUA 4LFUA 5JYOA 3BFGA 2DNSA 4EUZA 3IHBA 2WKQA 3LIEA 3SS5A 4DXCA 2WKHA 4CLCC 1LL8A 4CPKA 1G6OA 2WADA 4JXVA 3K3CA 1S1YA 2J3TD 2W3EA 4OPQA 2LB9A 2XGNA 4UA6A 3T12B 1Y28A 4P6ZS 1ES5A 4OPRA 3E2LA 3T1SA 2D02A 3QHYA 2W0NA 4B9OA 5HDDA 3OBFA 5EVEA 1LSXA 1NJ4A 3FPWA 3TJZC 5TR7A 4PHTA 5D3OA 3T4LA 3TSGA 5HL1A 1E3UD 5FQ9A 4OONA 4O0PA 5EVIA 3BWLA 5F83A 3VP4A 1VEUA 1LT0A 1W63M 4Y17A 3C8CA 2XA7S 3UB8A 4KENB 4XUZA 3HUNA 3BW6A 3C4OA 3CPTA 2GX5A 2VV7A 2KOIA 4BBTA 4IBXA 5AQAA 1JWVA 4PM8A 1LLBA 5HDCA 4R70A 3VSLA 1SKFA 3T1QB 4HP4A 5TGFA 4JLFA 3IF5A 2VGKA 3SW1A 1D7EA 4L0LA 3IXDA 4OVDA 3A0RA 4CLCB 1E4DA 3LR3A 4X1LA 3HLBA 4UEYA 3UDXA 4DE3A 2J7VA 1ALQA 3A3FA 1G68A 5A91A 5J4EA 4ETXA 4DE0A 1T1BA 4KZAA 2ZJ9A 3PBNA 3CWFA 4I39A 2XA7M 3OPHA 4KZBA 2WAFA 3FC7A 1Y54A 1STZA 3GQZA 5GHZA 1JTGA 1W7FA 4P85A 4WM9A 4LPZA 3BY9A 3NDGA 1XX2A 5HAIA 1H8YA 1K38A 3ZVWA 2M1CA 1E25A 4R0QA 1GHIA 1BZAA 5TFQA 4LCLA 4JXGA 2QMIA 3WRTA 1N4OA 2WK0A 3UDIA 4P0MA 2G2UA 4PKYG 2X02A 4PM7A 5AJGA 1VQQA 3B47A 4H6JA 2XDMA 4ARZA 3IT9A 4RVAA 1TS0A 3NHQA 3MZDA 3MS6A 1HVBA 3NOPC 2Y59A 2ZQAA 2WZXA 4R1GA 4E6XA 4HOIA 3P7NA 4OQHA 5L10A 4GNUA 4EEPA 1MZUA 3NECA 3CUEC 1S1ZA 3HUMA 3EEHA 4WEKA 4WMCA 3BQAA 3GECA 4LV2A 2Z2MB 5KIZA 1JWZA 3LEQA 4DJ2A 4XT2B 1ZKJA 3KSIA 5G18A 5J8XA 3UN7A 2Y2JA 4B4XA 2K2NA 1NY0A 1PI5A 2EA9A 1O07A 4JKTA 3HCYA 4ME4A 3O86A 4OPYA 5A92A 1PZPA 5FA7A 4II7A 2V1BA 4KQOA 3CJMA 3ZQ5A 5DF7A 1BLPA 1YQSA 2M7UA 4OQ0A 1BLHA 3MXQA 4E3MA 3GRJA 5GLAA 3FWLA 3ZG8B 5DTSA 2JHEA 4QB8A 4DF6A 4C6YA 3IXGA 4JPMA 3V67A 3LO7A 3MBZA 5DFXA 2WZZA 2XF3A 4NEED 4OQIA 4KZ8A 5CEDA 3W4QA 3GMWA 2PR6A 4EV4A 1YMSA 3PBQA 2E8JA 2V9AA 3UDFA 2OAQ1 2WAEA 2BG1A 3NDEA 3NY4A 5CTMA 2HJ9C 1VM1A 4O7DA 4X6TA 1O7EA 4IEDA 5HDSA 4OQGA 1G28A 1JVJA 1MPLA 5EUAA 1X0OA 3I7JA 1KVMA 2G2WA 2VZWA 3PTEA 1BLSA 3NULA 3F1PB 3BYDA 2ZLYA 3HLCA 3L7HA 2DRWA 2EFXA 5FQIA 4MLLA 5EVLA 2QHKA 3ZYTA 3T4TA 5TBMA 1XGIA 5GHXA 2Y55A 1JWPA 4Q0JA 3S4XA 2BASA 5F69A 3RFBA 4KZ3A 3GSGA 3KYEA 3V5MA 1W79A 4MDZA 3DTMA 2VV8A 2E8IA 4R6LA 4NXBA 1S0WA 2P04A 3G2ZA 2JC7A 3M6BA 4EBNA 4OOLA 1ZC2A 1PZOA 2RL3A 4DE1A 1P9RA 4RX3A 4E3OA 3E4QA 4NG2A 4OPZA 4FCFA 4BLMA 5L2FA 5EVIB 4E3IA 2PRFA 1VEUB 2OLVA 4FH4A 4GB7A 1YSPA 1MWSA 4UA9A 5EOOA 4YFMA 1DJCA 5HSQA 4D60A 1YSQA 3BM6A 3MZFA 3MQQA 1CI8A 3CPTB 3IF6A 5EFWA 2Y2QA 2ZQCA 4HP9A 4QJGA 2B95A 4KG6A 4GZBA 4CQHA 1YMXA 2FH5A 4LRXC 3S1YA 1FQGA 1WYBA 4MNRA 3UE3A 4GD8A 1OTEA 3G32A 3QP2A 3M2JA 5F1GA 1BTLA 2FFFB 2QZ6A 1N9OA 5IU1A 1K25A 3NCKA 5F68A 3PAGA 3ZG5A 1S4SA 5E2GA 4EQ1A 2BLSA 1XJ6A 4F94A 1T1AA 3QP6A 4G3VA 1LI0A 5DVAA 2OWJA 3UO9A 2PBYA 3HLFA 3VOZA 3NI9A 2XH9A 4WN5A 3QP1A 3UY6A 1K6SA 1ZHHB 5DTKA 1MKMA 2VA0A 2Z6DA 3UB7A 3ZNYA 3EGXC 1K55A 4BWIA 3S7QA 3LI9A 5TJJA 4M3KA 4E3NA 3HL9A 4Y13A 3A3IA 4JF4A 1S6RA 2Q0OA 2IWCA 4K0WA 5HWVA 5CEBA 2OLUA 2X71A 1V9ZA 4Z9QA 4GW9A 4RX2A 1Z09A 4Y3IA 5IHVA 1TDLA 3VE4A 4MBHA 3A0VA 2OAP1 3T4OA 5F6AA 4M4XA 1VETA 4H6JB 1SZVA 4ARZB 4EQIA 4KZ6A 4GD6A 2HJEA 1DP8A 5HL6A 2EFUA 2Q9NA 2PT7A 3H82A 4Y15A 4QU3A 3QNBA 4GS9B 4CJNA 2Y79A 3B33A 3C38A 4QPRA 4NKPA 3WS5A 1G6AA 1BLCA 5DJTA 3VP0A 5EM1A 3BEBA 1W5DA 4UQIS 5GHYA 5FDHA 3ZG0A 2ZC4B 3DW0A 4Q0IA 3LI8A 4AFIA 3VP2A 2DMWA 3T4KA 2GDNA 3PBRA 4BMWA 5AVEA 3K3DA 1HZOA 2V1AA 3P09A 3MXRA 3W8KA 2W3DA 1IYOA 3MMHA 3G35A 4E3JA 4L9EA 4BBVA 2VLGA 4YNRA 3LGOA 3IS2A 3EQVA 4DE2A 2V0UA 2XSSA 4QY5A 5J7EA 1P97A 2XFSA 2EX6A 2ZOHA 5EPHA 4A5RA 3KYZA 1M40A 1NZOA 4O8GA 4CLCE 4WL9A 1JTDA 2ZC5B 3T1XA 4I5SA 1NWZA 1YKDA 1LSVA 3O3VA 2P9VA 3UE0A 1FR6A 5FATA 3CG5A 1T19A 5DTTA 1K57A 5EECA 4X69A 4LGWA 1IYQA 1CJFA 1SCWA 5AVFA 4YINA 2Y2OA 1N9NA 2EWWA 1S67L 2ZQDA 2IWBA 2JBFA 2NUTC 1NZUA 3BRMA 1OTIA 4X68A 4QD4A 3OPPA 4HNBA 2M7VA 3W4PA 1LI9A 2RCXA 5TBMB 1T18A 3ISGA 3UPPA 1N9BA 4LRZE 4WMCD 2WKIA 1IEMA 1MWRA 4P6ZM 5CECA 4KQQA 3EGDC 4R3BA 3OZHA 4FUWA 2HDSA 2VKSA 3BQ8A 4ESPA 4EBPA 1ESIA 3HLWA 1J9MA 3SS3A 1TDGA 3Q7ZA 3LICA 4N9KA 3C4PA 2PD8A 3FKWA 1W8YA 2UV0E 2AVXA 1TD5A 4MN6A 3LIBA 3NBLA 3KX0X 3FYZA 1OTAA 3H9WA 5FQJA 3K2NA 4RQ9A 1RGZA 4O01A 3IF6B 1EW0A 2HDUA 4JGPA 5A93A 5M18A 1GCEA 3BLMA 4S2KA 1OTBA 4BQMA 2ZMFA 4Y0UA 5GLBA 1WYCA 2PDRA 4OOYA 3ZGAB 2H28A 3NJAA 4IVIA 4EU0A 5HD5A 3MKEA 1FILA 4R38A 1PW1A 4GCZA 3ZFZA 5HW3A 1HLUP 1BULA 3G30A 1DJAA 3TOIA 3H7WA 3WWXA 4PPRA 3HLDA 5HWWA 5M1AA 4K91A 3EWKA 5KSHA 4KZ9A 5G4YA 4HESA 2O9CA 3PBSA 1K54A 2WKRA 5KSCA 1YT4A 3V3SA 2Y4AA 3SH8A 4S2JA 5L8MA 1NRFA 4R3AA 3S7OA 1ERQA 3GDIA 4OLDA 3ITAA 3N4IA 4Q8IA 3UPOA 1TS6A 1AXBA 2G7UA 1K0KA 3UPNA 4U3TA 1T1CA 3R4KA 4S2PA 3HUOA 3D72A 1IOUA 2JKFA 2ZC7A 3C2WA 1WA9A 1J3WA 4F3LB 1NLZA 2ZL1A 4PKYA 3OOVA 2EXAA 3F1OA 3LEZA 1KGEA 2KDKA 3SOIA 2P08A 1VETB 2INWA 3GTCA 3LIDA 4LENA 1PNEA 1XA1A 3G6OA 3H82B 2QJ5A 5DF8A 3W4OA 1MKIA 3WS4A 1DRMA 5E43A 3IX8A 5HAPA 1H8MA 2JCHA 4N1XA 4B93A 2A2LA 2X01A 3UB5P 5EVIC 3N6IA 3G34A 1FCOA 4L9GA 4YOFA 4E3KA 3JYIA 2PD7A 2EX9A 2Q9MA 2J9PA 5A90A 1K57C 4DXBA 5FI6A 2H5SA 3VFHA 5DF9A 3BJNA 4GKUA 2QKPA 2XEPA 4XXRA 5CRFA 2ZQ9A 4DJ3A 4RYEA 3IH9A 3IXBA 3HJIA 2J9OA 3E4PA 3IS2B 4KZ5A 3MFDA 2VGLS 3PBOA 4EEUA 1SKOA 5J3WA 1IELA 4JXSA 3IWOA 1D06A 5GLDA 4EERA 2IA2A 4FD8A 2A49A 1IKGA 4I38A 3AGEA 2VX8A 3LUQA 5IS1A 3VOLA 4KQRA 3Q82A 2KX6A 2WGWA 3UE1A 2XROA 1OTDA 3O87A 2W3HA 2P9VB 4EW7A 4PAUA 1VHMA 1PI4A 1XJ4A 1CF0A 3IWIA 2J8YA 5GLCA 2WKEA 5DKKA 2CC1A 3KSGA 3D3OA 3IBRA 4LLOB 3D9YA 3TW8A 5FSRA 3UB9A 3GVBA 5BOHA 1YM1A 3FV7A 1BSGA 1MC0A 4S2LA 3F1NA 2ZM2A 2J3TC 1RP5A 4Y0TA 3SH7A 1XJ3A 3R7WA 2H10A 2VGLM 4Y2FA 3CLOA 5FEFA 1L0EA 1DY6A 2OSUA 2ZC6B 2Z2LB 3W2ZA 4Z1WA 4EWFA 1MXOA 2K31A 4B88A 1K6RA 4ZBEA 1MY8A 3ICYA 5CGSA 3EOIA 3LR5A 4IUHA 1PRQA 1K4FA 4LCMA 4EXOA 1GSXA 1CQAA 3HLEA 4I3IA 2HPBA 4WZ4A 2XFTA 3NIAA 1IFQA 2HP5A 1ES2A 1GSWA 2WUQA 1DP9A 4WELA 1Z6FA 2V8CA 3T4JA 1L0GA 4FSFA 3N8RA 3CZDA 1GSVA 3O88A 5EOEA 3MJQA 5JYPA 1K54C 2ZQ7A 5HPFA 4OH0A 5HFOA 3N8LA 4N92A 2W3FA 3DTEA 3Q1FA 3BFCA 4NK3A 1C3BA 2O9AA 1XKZA 1AWIA 3CI6A 1YLJA 5E2HA 1YLWA 1U60A 2B5RA 4KZ7A 2R9WA 2A24A 3LIFA 4EBLA 3MKFA 4MMNA 3KSFA 3HVFA 5E2EA 2J80A 5FI7A 1YPRA 4UHUA 3RH8B 2HP6A 2VV6A 2XK1A 1FOFA 1K4EA 1W63Q 1A0KA 3SS4A 3UB6A 1K56D 4FTXA 1H3QA 3LY3A 4OP5A 3VV4A 1CI9A 1GA9A 1YAXA 1LSWA 4NETA 4S2MA 3OPLA 2HDRA 4OLGA 3UMEA 3DTKA 4IVKA 2O0YA 1F2KA 4G3KA 5FAOA 3IHAA 5EV0A 3V3RA 3IH8A 3Q7VA 4HJ4A 5F82A 1SDNA 3CITA 5I94A 3PHYA 3E0YA 4FH2A 5FAQA 1PWGA 3MR0A 4NXGA 4MN5A 3PBTA 2V0WA 1UGUA 3BFDA 5AQ7A 3U2AA 3NOTC 1ACFA 2L1MA 3DWKA 3BLSA 3BECA 3VE3A 1L0FA 3IBJA 3TG9A 2J3WA 4FOFA 3CMZA 1BYWA 2YKFA 3D4FA 3Q81A 4WUJA 4HBUA 1PWDA 4BENA 3ZHHA 5MC7A 4WYYA 1XFNA 5KMWA 4QY6A 4GJ4A 1GHPA 3QP8A 4KG5A 4UAAA 4U0TA 2PU2A
chains in the Genus database with same CATH topology
3TRCA 3F1OB 2QWSA 5DFXA 5A8BA 4NEED 3OLOA 5HPIA 1OTBA 2PR6A 3O5YA 2ZMFA 2PDRA 3C30A 3PBQA 2V9AA 2H28A 3NJAA 5LBRA 4EU0A 2OAQ1 4Q0HA 5HD5A 2LB5A 1S4RA 2HJ9C 2NUPC 3LFVA 4R38A 2VJWA 4GCZA 2HF6A 3PYPA 4UQIM 3DBAA 5HDSA 1G28A 2W27A 1NLYA 4I3JA 1X0OA 1S66L 2GJ3A 1VB6A 2KLIA 2VZWA 3F1PB 3H7WA 2PHYA 4G3WA 3E4OA 5HWWA 3EWKA 2I9VA 2QHKA 4NXEA 3ULFA 3ZYTA 2YKHA 3T4TA 5TBMA 2QYBA 5KSHA 4Q0JA 4XT2A 3FPVA 5DFYA 5G4YA 3TE8A 2O9CA 2BASA 5F69A 3RFBA 2W3GA 3H7WB 3PBSA 2EWVA 2OWHA 2K7SA 4MDZA 2WKRA 2HV1A 1DP6A 2VV8A 4R6LA 2PYPA 4NXBA 2P04A 4GHIB 5L8MA 4OOLA 4R3AA 2Z6CA 3S7OA 1P9RA 3GDIA 4KUOA 3E4QA 4F3LA 2Y8HA 1F5MA 1TS6A 2G7UA 4ETZA 1YSPA 2D01A 1OT6A 1T1CA 3R4KA 3MFXA 3T50A 5HSQA 3D72A 1IOUA 3OCNA 1YSQA 4IUKA 4BJPA 3C2WA 1F9IA 3MQQA 1JNUA 1WA9A 3MQ0A 5EFWA 4F3LB 1NLZA 4PKYA 3OOVA 4HP9A 3F1OA 2W1TB 2KDKA 2P08A 4HH2A 5CX7A 2INWA 3MF0A 4HHDA 3LIDA 4CQHA 1P9WA 3EQUA 3E98A 2FH5A 4LRXC 4HJ6A 4ZRRA 3UE3A 3G6OA 1OTEA 2QJ5A 3CUEA 3F1NB 2XRNA 3H82B 1DRMA 1ZTUA 2P7JA 4HH3A 5DKLA 1F98A 1H8MA 3R7WB 4WLAA 4HQAA 1N9OA 5IU1A 4EESA 4B93A 2A2LA 2FZ0A 2ZBBA 5F68A 2CMNA 2PYRA 1S4SA 3MQOA 1UWNX 3CAXA 4NXFA 4EQ1A 3B42A 3P01A 1OT9A 3PXPA 4L9GA 4MN7A 4YOFA 1XJ6A 4HY8A 2PD7A 1T1AA 4G3VA 2ZOIA 4LRYC 3F1PA 5FL3A 2OWJA 3JVUA 5HZHA 5HD3A 5DF9A 3BJNA 2QKPA 2WKQA 4WN5A 3LIEA 2GZAA 2W1RA 4CLCC 1LL8A 2VEAA 5HWTA 1G6OA 3K3CA 1ZHHB 1S1YA 2J3TD 2W3EA 3S7PA 4DJ3A 2LB9A 1TF1A 3HJIA 1MKMA 2VA0A 1Y28A 2Z6DA 3A0SA 4WEJA 3E4PA 3IS2B 3UB7A 3EGXC 4P6ZS 2VGLS 1OJGA 3PBOA 4YWZA 4BWIA 2D02A 4EEUA 5J3WA 3S7QA 1N9LA 4JGOA 2W0NA 3LI9A 5TJJA 5HDDA 4B9OA 4GHIA 3OBFA 1LSXA 1D06A 4EERA 3FPWA 1XJ2A 1KOUA 3TJZC 4PHTA 2IA2A 3T4LA 4L9FA 4I38A 4O0PA 3KSHA 3BWLA 2JKTI 2VX8A 3LUQA 2A24B 5HWVA 5IS1A 1LT0A 3VOLA 1W63M 2KX6A 1V9ZA 2GNXA 1ODVA 3C8CA 4GW9A 2XROA 1OTDA 2XA7S 2W3HA 4Y3IA 4EUVA 3UB8A 2JKTM 4EW7A 4PAUA 1VHMA 1XJ4A 1XFQA 3VE4A 3A0VA 3BW6A 2OAP1 3JVVA 2GX5A 2VV7A 3T4OA 3LYXA 2KOIA 5DKKA 3KSGA 4BBTA 3D3OA 4GS9A 3IBRA 4Y5FA 3LR4A 2JN7A 2W1TA 5F6AA 4M4XA 4LLOB 4H6JB 5HDCA 3EEAA 4R70A 3TW8A 4ARZB 4CLCD 1V9YA 2B02A 2O9BA 3BY8A 2HJEA 3UB9A 4HP4A 1DP8A 5HL6A 3SW1A 2O99A 1MC0A 1D7EA 2PT7A 3H82A 3F1NA 4L0LA 3RTYA 4DN0A 2J3TC 3UMDA 3KO6A 1XJ3A 2PR5A 4GS9B 3A0RA 2VGLM 3LR3A 4Y2FA 3R7WA 4CLCB 2Y79A 3B33A 4UEYA 3C38A 3CLOA 4QPRA 4NKPA 2OOLA 3W2ZA 4Z1WA 1NRJA 5DJTA 2K31A 2L0WA 3T4SA 1TS8A 4UQIS 4OOMA 4ETXA 5J4EA 3ICYA 3LR0A 4Q0IA 3EOIA 3LR5A 4IUHA 3LI8A 1T1BA 4JGRA 4EETB 3PBNA 4AFIA 2DMWA 2HGVA 3CWFA 3T4KA 4I39A 4EXOA 2XA7M 3PBRA 4BMWA 1GSXA 5AVEA 4I3IA 3K3DA 3FC7A 2V1AA 1IFQA 1STZA 4BBUA 1GSWA 1DP9A 4WELA 2W3DA 3MMHA 4L9EA 3T4JA 4BBVA 2JKRI 4LPZA 2VLGA 4YNRA 2L4RA 3BY9A 4FSFA 3IS2A 2B18A 3EQVA 1P0ZA 2V0UA 2XSSA 1GSVA 3MJQA 5J7EA 1P97A 2M1CA 2JKRM 4JGQA 5HPFA 2ZOHA 2W3FA 3KYZA 2QJ7A 3FG8A 4HIAA 4GLQA 2O9AA 3CI6A 3T4QA 4O8GA 4CLCE 5G4ZA 2A24A 4WL9A 3LIFA 5K5BA 4HJ3A 4MMNA 4WF0A 4I5SA 1NWZA 4I3AA 1YKDA 1LSVA 3KSFA 3KYQA 2J80A 4PKYG 3RH8B 2VV6A 5AJGA 1T19A 1W63Q 2R78A 3B47A 4KUKA 3UB6A 5I5LA 4H6JA 1H3QA 3VV4A 4ARZA 1TS7A 1YAXA 5DJUA 1LSWA 1TS0A 3UE6A 3NHQA 3UMEA 5F5YA 5AVFA 3NOPC 2O0YA 3OC2A 3OCLA 1N9NA 2EWWA 4G3KA 4DMZA 1S67L 3NOUC 2NUTC 1OTIA 4CLCA 4HOIA 2ZMVA 3P7NA 4IHQA 4EEPA 4HI4A 1MZUA 4HJ4A 4HNBA 4KQDA 2M7VA 3CUEC 1S1ZA 3EEHA 3CITA 4WEKA 3PHYA 1OPXA 3BQAA 4K08A 3E0YA 4IJGA 5TBMB 1T18A 3GECA 5KIZA 3MR0A 4LRZE 4DJ2A 4XT2B 4NXGA 2WKPA 3KSIA 3PBTA 4MN5A 4P6ZM 2V0WA 1UGUA 2K2NA 4E04A 2EA9A 3EGDC 3U2AA 3NOTC 3HCYA 4ME4A 3LIAA 2VKSA 2L1MA 3BQ8A 3VE3A 3IBJA 2MJ6A 3LICA 4II7A 2J3WA 4FOFA 2PD8A 2V1BA 4KQOA 1BYWA 3PR6A 2YKFA 3ZQ5A 4MCWA 4MN6A 1TD5A 2M7UA 4WUJA 5IT5A 3LIBA 3MXQA 5MC7A 3KX0X 1OJ5A 1XFNA 1OTAA 3H9WA 1UWPX 3K2NA 5C5KA 2JHEA 4RQ9A 4O01A 1EW0A 4GJ4A 3HJKA 3S7NA 3V67A 4JGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PAU A;  1VHM A;  3TRC A;  1YKD A;  3KSF A;  3S7N A;  5DFX A;  3OOV A;  2GX5 A;  2W1T B;  2KOI A;  3KSG A;  5HPI A;  3D3O A;  3IBR A;  3MF0 A;  4Y5F A;  2W1T A;  3O5Y A;  4CQH A;  5AJG A;  2ZMF A;  3E98 A;  4LRX C;  3EEA A;  4R70 A;  5LBR A;  4ZRR A;  4EU0 A;  3G6O A;  2O9B A;  5I5L A;  3VV4 A;  4Q0H A;  2XRN A;  1ZTU A;  2LB5 A;  5HL6 A;  2O99 A;  1MC0 A;  3LFV A;  4DN0 A;  3NHQ A;  2VJW A;  3KO6 A;  3NOP C;  2O0Y A;  4Y2F A;  3DBA A;  2Y79 A;  4G3K A;  4DMZ A;  3NOU C;  4QPR A;  2OOL A;  2VZW A;  2KLI A;  3W2Z A;  4MN7 A;  4YOF A;  4Z1W A;  2M7V A;  2K31 A;  3CIT A;  4G3V A;  4LRY C;  4G3W A;  4ETX A;  3E0Y A;  4IJG A;  4EUV A;  4Q0I A;  4LRZ E;  4IUH A;  3BJN A;  2QYB A;  4Q0J A;  2W1R A;  2HGV A;  2VEA A;  3KSI A;  5DFY A;  2O9C A;  2K2N A;  4E04 A;  2W3E A;  3RFB A;  2W3G A;  3S7P A;  2LB9 A;  1STZ A;  3NOT C;  1TF1 A;  4MDZ A;  1MKM A;  3HCY A;  4ME4 A;  2W3D A;  2VKS A;  4R6L A;  3MMH A;  3IBJ A;  5L8M A;  4YNR A;  4BWI A;  3S7Q A;  2B18 A;  5TJJ A;  4FOF A;  3S7O A;  3OBF A;  2XSS A;  3ZQ5 A;  4MCW A;  2Y8H A;  1F5M A;  1TD5 A;  2M7U A;  2IA2 A;  5HPF A;  2G7U A;  4ETZ A;  2W3F A;  1YSP A;  3KSH A;  4O0P A;  4GLQ A;  3R4K A;  2O9A A;  3CI6 A;  3K2N A;  4O8G A;  5C5K A;  5HSQ A;  4RQ9 A;  4O01 A;  1YSQ A;  4IUK A;  4GW9 A;  5K5B A;  3C2W A;  2XRO A;  4Y3I A;  2W3H A;  4MMN A;  3MQ0 A; 
#chains in the Genus database with same CATH topology
 5AQ9 A;  3TRC A;  3F1O B;  3MSH A;  4S2N A;  3RJU A;  1PWC A;  5A8B A;  2BTF P;  3OLO A;  3WRZ A;  2ZM8 A;  3VP1 A;  5FEG A;  3N7W A;  2C6W B;  2ZM0 A;  1ZG6 A;  4MBF A;  5LBR A;  4Q0H A;  4GDN A;  2EX8 A;  2LB5 A;  1S4R A;  2Y2L A;  2NUP C;  3LFV A;  4PM6 A;  2WGV A;  2VJW A;  2HF6 A;  2WYX A;  4DDY A;  1DJB A;  4UQI M;  1YLT A;  3IXH A;  2HP9 A;  3DBA A;  4Y7P A;  2GJ3 A;  1K56 A;  1VB6 A;  2HZ5 A;  4C3Q A;  3E4O A;  3QNC A;  3IF6 C;  4X53 A;  3IX4 A;  4NXE A;  1EI5 A;  2YKH A;  1TEM A;  3FPV A;  5DFY A;  2W3G A;  2EWV A;  2OWH A;  5CHM A;  2IWD A;  1SKO B;  4MBK A;  5AQB A;  3RXX A;  4BL3 A;  2PYP A;  3MZE A;  4KG2 A;  2Y2M A;  2Z6C A;  3BFE A;  2ZC3 B;  1MWT A;  3S22 A;  2V2F F;  1QME A;  2V20 A;  1YLP A;  3OPR A;  1ES3 A;  3FKV A;  4ETZ A;  2D01 A;  1L3L A;  4WZ5 A;  2WGW B;  3AGD A;  3QP4 A;  3V39 A;  3VFF A;  3T50 A;  1YLZ A;  1F9I A;  1JNU A;  5KZH A;  4JF5 A;  5CX7 A;  3MF0 A;  1WE4 A;  3V50 A;  5FQM A;  4HJ6 A;  1LL5 A;  1YLY A;  1K55 C;  3DAV A;  2WGI A;  3GV9 A;  3F1N B;  1ONH A;  2P7J A;  1F98 A;  4K0X A;  3R7W B;  4WLA A;  4HQA A;  4EES A;  1RCJ A;  2FZ0 A;  2ZBB A;  4MEZ A;  2CMN A;  1HD8 A;  3WS1 A;  1UWN X;  3CAX A;  1NYM A;  3B42 A;  1OT9 A;  3PXP A;  1IYP A;  4MN7 A;  3BFF A;  2QPN A;  2P74 A;  4HY8 A;  3ZVT A;  1CEG A;  1XPB A;  1ONG A;  4R4R A;  5FL3 A;  1XGJ A;  3JVU A;  5HZH A;  5HD3 A;  3ZG9 B;  2H0Y A;  4BL2 A;  4LV0 A;  4LV3 A;  1CK3 A;  2GZA A;  2W1R A;  2VEA A;  5HWT A;  1FCM A;  3E2K A;  2R9X A;  4Y0O A;  3S7P A;  1TF1 A;  3A0S A;  4WEJ A;  1CEF A;  1OJG A;  4YWZ A;  1N9L A;  4JGO A;  5FAP A;  4JXW A;  4GHI A;  1E3U A;  1XJ2 A;  1KOU A;  1ERM A;  4L9F A;  3KSH A;  4OKP A;  2JKT I;  4PM5 A;  1Q2Q A;  2A24 B;  4X56 A;  5L07 A;  2ACG A;  1H5X A;  3MXS A;  1G5U A;  4R3J A;  2GNX A;  1ODV A;  1RGY A;  4XUX A;  2VK3 A;  1OME A;  4EUV A;  3G2Y A;  2JKT M;  2XD1 A;  3VP3 A;  1XFQ A;  3U4L P;  1KDW A;  3JVV A;  3ZDJ A;  3LYX A;  1SHV A;  5CHJ A;  4GS9 A;  4Y5F A;  3LR4 A;  2JN7 A;  2W1T A;  5FQQ A;  4X25 A;  3EEA A;  1KGF A;  4CLC D;  1V9Y A;  2B02 A;  2O9B A;  3BY8 A;  5U47 A;  1XXM A;  4JF6 A;  4S2N C;  1H8Z A;  5CGX A;  2O99 A;  2FFY A;  3RTY A;  3IX3 A;  4DN0 A;  3UMD A;  3KO6 A;  2PR5 A;  2C5W B;  3Q7V B;  1IKI A;  2OOL A;  1NRJ A;  1I2W A;  3GR2 A;  2L0W A;  3T4S A;  1TS8 A;  3VSK A;  1KE4 A;  3A3E A;  4OOM A;  3LR0 A;  3LY4 A;  1XP4 A;  1Q2P A;  1LHY A;  4RA7 A;  1Y4O A;  3ZCZ A;  4JGR A;  4EET B;  2HGV A;  3RXW A;  2Y2P A;  1SDE A;  3UNW A;  1GHM A;  3CHW P;  4WBG A;  5M19 A;  2ZQ8 A;  4DRT A;  4BBU A;  3G4P A;  1ES4 A;  3WS2 A;  2XQZ A;  2JKR I;  2L4R A;  2Y2H A;  2B18 A;  2Y91 A;  5HAQ A;  2V1Z A;  1P0Z A;  3QP5 A;  2JKR M;  4GDB A;  4JGQ A;  1FSY A;  1KDS A;  3L9K A;  4KZ4 A;  4PM9 A;  3NC8 A;  2QJ7 A;  2XLN A;  3FG8 A;  5E2F A;  5CHU A;  4HIA A;  5FAS A;  4GLQ A;  4D2O A;  3T4Q A;  5G4Z A;  4PMA A;  2ZMA A;  3G31 A;  5K5B A;  4HJ3 A;  1FSW A;  1H0M A;  4WF0 A;  4I3A A;  3FZC A;  3KYQ A;  1KE0 A;  4R4S A;  4WZ5 C;  5FDS A;  3C7U A;  5CER A;  3HLG A;  5CGW A;  3ZG7 B;  2R78 A;  1QMF A;  5L09 A;  2JKG A;  4KUK A;  5GL9 A;  5I5L A;  1TS7 A;  4BD0 A;  1BT5 A;  5DJU A;  1BUE A;  3UE6 A;  5F5Y A;  4X1M A;  2XR0 A;  4JBF A;  3OC2 A;  3Q07 A;  1LL9 A;  1FIK A;  3OCL A;  4B4Z A;  4GN2 A;  4HEF A;  4DMZ A;  3NOU C;  1FCN A;  4CLC A;  4C75 A;  3DTI A;  4ZJ3 A;  2ZMV A;  4IHQ A;  4HI4 A;  4KQD A;  3LCE A;  3HRE A;  4ZTK A;  5CXW A;  1OPX A;  4K08 A;  4IJG A;  1IYS A;  3ITB A;  5FQK A;  2V8F A;  2WKP A;  2UWX A;  4QWO A;  4E04 A;  2PU4 A;  3JPU A;  3LIA A;  2EXB A;  1TVF A;  2MJ6 A;  1KE3 A;  3PR6 A;  1XA7 A;  4MCW A;  3PAE A;  5IT5 A;  3N8S A;  1OJ5 A;  5F1F A;  2ZD8 A;  2JE5 A;  1UWP X;  5C5K A;  4HBT A;  3VOY A;  3HJK A;  3S7N A;  4N1H A;  4H8R A;  2QWS A;  4ZDX A;  4P87 A;  4R23 A;  5HPI A;  1W8Q A;  3O5Y A;  2Y2N A;  2XD5 A;  4ZJ2 A;  3C30 A;  3C5A A;  3T1R A;  5FI2 A;  1HTZ A;  2I72 A;  3M6H A;  3WS0 A;  4QHC A;  4S2I A;  5EE8 A;  3SZT A;  2A3U A;  3PYP A;  4IBR A;  2W27 A;  1NLY A;  4I3J A;  1S66 L;  3A3D A;  2KLI A;  4X55 A;  3AGF A;  2PHY A;  4G3W A;  1PW8 A;  3P98 A;  1KGG A;  1KVL A;  1PFL A;  2I9V A;  2VGJ A;  4S2O A;  3ULF A;  2EX2 A;  2QYB A;  4XT2 A;  3TE8 A;  1GA0 A;  3H7W B;  4UA7 A;  2K7S A;  2DCF A;  1ZG4 A;  2HV1 A;  4BD1 A;  1MWU A;  5EVI D;  4E6W A;  1DP6 A;  2Y2K A;  5HAR A;  4DKI A;  3ZNT A;  4GHI B;  1I2S A;  4P6B A;  2OV5 A;  1FR1 A;  4KUO A;  4F3L A;  2Y8H A;  1PIO A;  1F5M A;  1MBL A;  2H0T A;  3A3J A;  1NYY A;  1OT6 A;  3B3X A;  2PBD P;  3IQA A;  3MFX A;  1M6K A;  3OCN A;  4IUK A;  4BJP A;  3C7V A;  5EM0 A;  4N9L A;  4ZAM A;  3MQ0 A;  1ERO A;  4LV1 A;  3SH9 A;  2W1T B;  3M2K A;  5CTN A;  1L2S A;  4HH2 A;  2PAV P;  4HHD A;  4ZJ1 A;  1P9W A;  3EQU A;  4GOG A;  3E98 A;  1PYY A;  4ZRR A;  4OP8 A;  4ID4 A;  3DWZ A;  3CUE A;  2Y2I A;  2XRN A;  4DDS A;  1ZTU A;  4HH3 A;  5DKL A;  2ZL1 B;  1NXY A;  4E3L A;  5HX9 A;  1EWZ A;  2PYR A;  3MQO A;  4NXF A;  3HBR A;  3P01 A;  3VMA A;  1L0D A;  2Y2G A;  4U0X A;  1D1J A;  1I5Q A;  2HDQ A;  4LRY C;  2ZOI A;  3IWQ A;  3F1P A;  1ESU A;  4LFU A;  5JYO A;  3BFG A;  2DNS A;  4EUZ A;  3IHB A;  2WKQ A;  3LIE A;  3SS5 A;  4DXC A;  2WKH A;  4CLC C;  1LL8 A;  4CPK A;  1G6O A;  2WAD A;  4JXV A;  3K3C A;  1S1Y A;  2J3T D;  2W3E A;  4OPQ A;  2LB9 A;  2XGN A;  4UA6 A;  3T12 B;  1Y28 A;  4P6Z S;  1ES5 A;  4OPR A;  3E2L A;  3T1S A;  2D02 A;  3QHY A;  2W0N A;  4B9O A;  5HDD A;  3OBF A;  5EVE A;  1LSX A;  1NJ4 A;  3FPW A;  3TJZ C;  5TR7 A;  4PHT A;  5D3O A;  3T4L A;  3TSG A;  5HL1 A;  1E3U D;  5FQ9 A;  4OON A;  4O0P A;  5EVI A;  3BWL A;  5F83 A;  3VP4 A;  1VEU A;  1LT0 A;  1W63 M;  4Y17 A;  3C8C A;  2XA7 S;  3UB8 A;  4KEN B;  4XUZ A;  3HUN A;  3BW6 A;  3C4O A;  3CPT A;  2GX5 A;  2VV7 A;  2KOI A;  4BBT A;  4IBX A;  5AQA A;  1JWV A;  4PM8 A;  1LLB A;  5HDC A;  4R70 A;  3VSL A;  1SKF A;  3T1Q B;  4HP4 A;  5TGF A;  4JLF A;  3IF5 A;  2VGK A;  3SW1 A;  1D7E A;  4L0L A;  3IXD A;  4OVD A;  3A0R A;  4CLC B;  1E4D A;  3LR3 A;  4X1L A;  3HLB A;  4UEY A;  3UDX A;  4DE3 A;  2J7V A;  1ALQ A;  3A3F A;  1G68 A;  5A91 A;  5J4E A;  4ETX A;  4DE0 A;  1T1B A;  4KZA A;  2ZJ9 A;  3PBN A;  3CWF A;  4I39 A;  2XA7 M;  3OPH A;  4KZB A;  2WAF A;  3FC7 A;  1Y54 A;  1STZ A;  3GQZ A;  5GHZ A;  1JTG A;  1W7F A;  4P85 A;  4WM9 A;  4LPZ A;  3BY9 A;  3NDG A;  1XX2 A;  5HAI A;  1H8Y A;  1K38 A;  3ZVW A;  2M1C A;  1E25 A;  4R0Q A;  1GHI A;  1BZA A;  5TFQ A;  4LCL A;  4JXG A;  2QMI A;  3WRT A;  1N4O A;  2WK0 A;  3UDI A;  4P0M A;  2G2U A;  4PKY G;  2X02 A;  4PM7 A;  5AJG A;  1VQQ A;  3B47 A;  4H6J A;  2XDM A;  4ARZ A;  3IT9 A;  4RVA A;  1TS0 A;  3NHQ A;  3MZD A;  3MS6 A;  1HVB A;  3NOP C;  2Y59 A;  2ZQA A;  2WZX A;  4R1G A;  4E6X A;  4HOI A;  3P7N A;  4OQH A;  5L10 A;  4GNU A;  4EEP A;  1MZU A;  3NEC A;  3CUE C;  1S1Z A;  3HUM A;  3EEH A;  4WEK A;  4WMC A;  3BQA A;  3GEC A;  4LV2 A;  2Z2M B;  5KIZ A;  1JWZ A;  3LEQ A;  4DJ2 A;  4XT2 B;  1ZKJ A;  3KSI A;  5G18 A;  5J8X A;  3UN7 A;  2Y2J A;  4B4X A;  2K2N A;  1NY0 A;  1PI5 A;  2EA9 A;  1O07 A;  4JKT A;  3HCY A;  4ME4 A;  3O86 A;  4OPY A;  5A92 A;  1PZP A;  5FA7 A;  4II7 A;  2V1B A;  4KQO A;  3CJM A;  3ZQ5 A;  5DF7 A;  1BLP A;  1YQS A;  2M7U A;  4OQ0 A;  1BLH A;  3MXQ A;  4E3M A;  3GRJ A;  5GLA A;  3FWL A;  3ZG8 B;  5DTS A;  2JHE A;  4QB8 A;  4DF6 A;  4C6Y A;  3IXG A;  4JPM A;  3V67 A;  3LO7 A;  3MBZ A;  5DFX A;  2WZZ A;  2XF3 A;  4NEE D;  4OQI A;  4KZ8 A;  5CED A;  3W4Q A;  3GMW A;  2PR6 A;  4EV4 A;  1YMS A;  3PBQ A;  2E8J A;  2V9A A;  3UDF A;  2OAQ 1;  2WAE A;  2BG1 A;  3NDE A;  3NY4 A;  5CTM A;  2HJ9 C;  1VM1 A;  4O7D A;  4X6T A;  1O7E A;  4IED A;  5HDS A;  4OQG A;  1G28 A;  1JVJ A;  1MPL A;  5EUA A;  1X0O A;  3I7J A;  1KVM A;  2G2W A;  2VZW A;  3PTE A;  1BLS A;  3NUL A;  3F1P B;  3BYD A;  2ZLY A;  3HLC A;  3L7H A;  2DRW A;  2EFX A;  5FQI A;  4MLL A;  5EVL A;  2QHK A;  3ZYT A;  3T4T A;  5TBM A;  1XGI A;  5GHX A;  2Y55 A;  1JWP A;  4Q0J A;  3S4X A;  2BAS A;  5F69 A;  3RFB A;  4KZ3 A;  3GSG A;  3KYE A;  3V5M A;  1W79 A;  4MDZ A;  3DTM A;  2VV8 A;  2E8I A;  4R6L A;  4NXB A;  1S0W A;  2P04 A;  3G2Z A;  2JC7 A;  3M6B A;  4EBN A;  4OOL A;  1ZC2 A;  1PZO A;  2RL3 A;  4DE1 A;  1P9R A;  4RX3 A;  4E3O A;  3E4Q A;  4NG2 A;  4OPZ A;  4FCF A;  4BLM A;  5L2F A;  5EVI B;  4E3I A;  2PRF A;  1VEU B;  2OLV A;  4FH4 A;  4GB7 A;  1YSP A;  1MWS A;  4UA9 A;  5EOO A;  4YFM A;  1DJC A;  5HSQ A;  4D60 A;  1YSQ A;  3BM6 A;  3MZF A;  3MQQ A;  1CI8 A;  3CPT B;  3IF6 A;  5EFW A;  2Y2Q A;  2ZQC A;  4HP9 A;  4QJG A;  2B95 A;  4KG6 A;  4GZB A;  4CQH A;  1YMX A;  2FH5 A;  4LRX C;  3S1Y A;  1FQG A;  1WYB A;  4MNR A;  3UE3 A;  4GD8 A;  1OTE A;  3G32 A;  3QP2 A;  3M2J A;  5F1G A;  1BTL A;  2FFF B;  2QZ6 A;  1N9O A;  5IU1 A;  1K25 A;  3NCK A;  5F68 A;  3PAG A;  3ZG5 A;  1S4S A;  5E2G A;  4EQ1 A;  2BLS A;  1XJ6 A;  4F94 A;  1T1A A;  3QP6 A;  4G3V A;  1LI0 A;  5DVA A;  2OWJ A;  3UO9 A;  2PBY A;  3HLF A;  3VOZ A;  3NI9 A;  2XH9 A;  4WN5 A;  3QP1 A;  3UY6 A;  1K6S A;  1ZHH B;  5DTK A;  1MKM A;  2VA0 A;  2Z6D A;  3UB7 A;  3ZNY A;  3EGX C;  1K55 A;  4BWI A;  3S7Q A;  3LI9 A;  5TJJ A;  4M3K A;  4E3N A;  3HL9 A;  4Y13 A;  3A3I A;  4JF4 A;  1S6R A;  2Q0O A;  2IWC A;  4K0W A;  5HWV A;  5CEB A;  2OLU A;  2X71 A;  1V9Z A;  4Z9Q A;  4GW9 A;  4RX2 A;  1Z09 A;  4Y3I A;  5IHV A;  1TDL A;  3VE4 A;  4MBH A;  3A0V A;  2OAP 1;  3T4O A;  5F6A A;  4M4X A;  1VET A;  4H6J B;  1SZV A;  4ARZ B;  4EQI A;  4KZ6 A;  4GD6 A;  2HJE A;  1DP8 A;  5HL6 A;  2EFU A;  2Q9N A;  2PT7 A;  3H82 A;  4Y15 A;  4QU3 A;  3QNB A;  4GS9 B;  4CJN A;  2Y79 A;  3B33 A;  3C38 A;  4QPR A;  4NKP A;  3WS5 A;  1G6A A;  1BLC A;  5DJT A;  3VP0 A;  5EM1 A;  3BEB A;  1W5D A;  4UQI S;  5GHY A;  5FDH A;  3ZG0 A;  2ZC4 B;  3DW0 A;  4Q0I A;  3LI8 A;  4AFI A;  3VP2 A;  2DMW A;  3T4K A;  2GDN A;  3PBR A;  4BMW A;  5AVE A;  3K3D A;  1HZO A;  2V1A A;  3P09 A;  3MXR A;  3W8K A;  2W3D A;  1IYO A;  3MMH A;  3G35 A;  4E3J A;  4L9E A;  4BBV A;  2VLG A;  4YNR A;  3LGO A;  3IS2 A;  3EQV A;  4DE2 A;  2V0U A;  2XSS A;  4QY5 A;  5J7E A;  1P97 A;  2XFS A;  2EX6 A;  2ZOH A;  5EPH A;  4A5R A;  3KYZ A;  1M40 A;  1NZO A;  4O8G A;  4CLC E;  4WL9 A;  1JTD A;  2ZC5 B;  3T1X A;  4I5S A;  1NWZ A;  1YKD A;  1LSV A;  3O3V A;  2P9V A;  3UE0 A;  1FR6 A;  5FAT A;  3CG5 A;  1T19 A;  5DTT A;  1K57 A;  5EEC A;  4X69 A;  4LGW A;  1IYQ A;  1CJF A;  1SCW A;  5AVF A;  4YIN A;  2Y2O A;  1N9N A;  2EWW A;  1S67 L;  2ZQD A;  2IWB A;  2JBF A;  2NUT C;  1NZU A;  3BRM A;  1OTI A;  4X68 A;  4QD4 A;  3OPP A;  4HNB A;  2M7V A;  3W4P A;  1LI9 A;  2RCX A;  5TBM B;  1T18 A;  3ISG A;  3UPP A;  1N9B A;  4LRZ E;  4WMC D;  2WKI A;  1IEM A;  1MWR A;  4P6Z M;  5CEC A;  4KQQ A;  3EGD C;  4R3B A;  3OZH A;  4FUW A;  2HDS A;  2VKS A;  3BQ8 A;  4ESP A;  4EBP A;  1ESI A;  3HLW A;  1J9M A;  3SS3 A;  1TDG A;  3Q7Z A;  3LIC A;  4N9K A;  3C4P A;  2PD8 A;  3FKW A;  1W8Y A;  2UV0 E;  2AVX A;  1TD5 A;  4MN6 A;  3LIB A;  3NBL A;  3KX0 X;  3FYZ A;  1OTA A;  3H9W A;  5FQJ A;  3K2N A;  4RQ9 A;  1RGZ A;  4O01 A;  3IF6 B;  1EW0 A;  2HDU A;  4JGP A;  5A93 A;  5M18 A;  1GCE A;  3BLM A;  4S2K A;  1OTB A;  4BQM A;  2ZMF A;  4Y0U A;  5GLB A;  1WYC A;  2PDR A;  4OOY A;  3ZGA B;  2H28 A;  3NJA A;  4IVI A;  4EU0 A;  5HD5 A;  3MKE A;  1FIL A;  4R38 A;  1PW1 A;  4GCZ A;  3ZFZ A;  5HW3 A;  1HLU P;  1BUL A;  3G30 A;  1DJA A;  3TOI A;  3H7W A;  3WWX A;  4PPR A;  3HLD A;  5HWW A;  5M1A A;  4K91 A;  3EWK A;  5KSH A;  4KZ9 A;  5G4Y A;  4HES A;  2O9C A;  3PBS A;  1K54 A;  2WKR A;  5KSC A;  1YT4 A;  3V3S A;  2Y4A A;  3SH8 A;  4S2J A;  5L8M A;  1NRF A;  4R3A A;  3S7O A;  1ERQ A;  3GDI A;  4OLD A;  3ITA A;  3N4I A;  4Q8I A;  3UPO A;  1TS6 A;  1AXB A;  2G7U A;  1K0K A;  3UPN A;  4U3T A;  1T1C A;  3R4K A;  4S2P A;  3HUO A;  3D72 A;  1IOU A;  2JKF A;  2ZC7 A;  3C2W A;  1WA9 A;  1J3W A;  4F3L B;  1NLZ A;  2ZL1 A;  4PKY A;  3OOV A;  2EXA A;  3F1O A;  3LEZ A;  1KGE A;  2KDK A;  3SOI A;  2P08 A;  1VET B;  2INW A;  3GTC A;  3LID A;  4LEN A;  1PNE A;  1XA1 A;  3G6O A;  3H82 B;  2QJ5 A;  5DF8 A;  3W4O A;  1MKI A;  3WS4 A;  1DRM A;  5E43 A;  3IX8 A;  5HAP A;  1H8M A;  2JCH A;  4N1X A;  4B93 A;  2A2L A;  2X01 A;  3UB5 P;  5EVI C;  3N6I A;  3G34 A;  1FCO A;  4L9G A;  4YOF A;  4E3K A;  3JYI A;  2PD7 A;  2EX9 A;  2Q9M A;  2J9P A;  5A90 A;  1K57 C;  4DXB A;  5FI6 A;  2H5S A;  3VFH A;  5DF9 A;  3BJN A;  4GKU A;  2QKP A;  2XEP A;  4XXR A;  5CRF A;  2ZQ9 A;  4DJ3 A;  4RYE A;  3IH9 A;  3IXB A;  3HJI A;  2J9O A;  3E4P A;  3IS2 B;  4KZ5 A;  3MFD A;  2VGL S;  3PBO A;  4EEU A;  1SKO A;  5J3W A;  1IEL A;  4JXS A;  3IWO A;  1D06 A;  5GLD A;  4EER A;  2IA2 A;  4FD8 A;  2A49 A;  1IKG A;  4I38 A;  3AGE A;  2VX8 A;  3LUQ A;  5IS1 A;  3VOL A;  4KQR A;  3Q82 A;  2KX6 A;  2WGW A;  3UE1 A;  2XRO A;  1OTD A;  3O87 A;  2W3H A;  2P9V B;  4EW7 A;  4PAU A;  1VHM A;  1PI4 A;  1XJ4 A;  1CF0 A;  3IWI A;  2J8Y A;  5GLC A;  2WKE A;  5DKK A;  2CC1 A;  3KSG A;  3D3O A;  3IBR A;  4LLO B;  3D9Y A;  3TW8 A;  5FSR A;  3UB9 A;  3GVB A;  5BOH A;  1YM1 A;  3FV7 A;  1BSG A;  1MC0 A;  4S2L A;  3F1N A;  2ZM2 A;  2J3T C;  1RP5 A;  4Y0T A;  3SH7 A;  1XJ3 A;  3R7W A;  2H10 A;  2VGL M;  4Y2F A;  3CLO A;  5FEF A;  1L0E A;  1DY6 A;  2OSU A;  2ZC6 B;  2Z2L B;  3W2Z A;  4Z1W A;  4EWF A;  1MXO A;  2K31 A;  4B88 A;  1K6R A;  4ZBE A;  1MY8 A;  3ICY A;  5CGS A;  3EOI A;  3LR5 A;  4IUH A;  1PRQ A;  1K4F A;  4LCM A;  4EXO A;  1GSX A;  1CQA A;  3HLE A;  4I3I A;  2HPB A;  4WZ4 A;  2XFT A;  3NIA A;  1IFQ A;  2HP5 A;  1ES2 A;  1GSW A;  2WUQ A;  1DP9 A;  4WEL A;  1Z6F A;  2V8C A;  3T4J A;  1L0G A;  4FSF A;  3N8R A;  3CZD A;  1GSV A;  3O88 A;  5EOE A;  3MJQ A;  5JYP A;  1K54 C;  2ZQ7 A;  5HPF A;  4OH0 A;  5HFO A;  3N8L A;  4N92 A;  2W3F A;  3DTE A;  3Q1F A;  3BFC A;  4NK3 A;  1C3B A;  2O9A A;  1XKZ A;  1AWI A;  3CI6 A;  1YLJ A;  5E2H A;  1YLW A;  1U60 A;  2B5R A;  4KZ7 A;  2R9W A;  2A24 A;  3LIF A;  4EBL A;  3MKF A;  4MMN A;  3KSF A;  3HVF A;  5E2E A;  2J80 A;  5FI7 A;  1YPR A;  4UHU A;  3RH8 B;  2HP6 A;  2VV6 A;  2XK1 A;  1FOF A;  1K4E A;  1W63 Q;  1A0K A;  3SS4 A;  3UB6 A;  1K56 D;  4FTX A;  1H3Q A;  3LY3 A;  4OP5 A;  3VV4 A;  1CI9 A;  1GA9 A;  1YAX A;  1LSW A;  4NET A;  4S2M A;  3OPL A;  2HDR A;  4OLG A;  3UME A;  3DTK A;  4IVK A;  2O0Y A;  1F2K A;  4G3K A;  5FAO A;  3IHA A;  5EV0 A;  3V3R A;  3IH8 A;  3Q7V A;  4HJ4 A;  5F82 A;  1SDN A;  3CIT A;  5I94 A;  3PHY A;  3E0Y A;  4FH2 A;  5FAQ A;  1PWG A;  3MR0 A;  4NXG A;  4MN5 A;  3PBT A;  2V0W A;  1UGU A;  3BFD A;  5AQ7 A;  3U2A A;  3NOT C;  1ACF A;  2L1M A;  3DWK A;  3BLS A;  3BEC A;  3VE3 A;  1L0F A;  3IBJ A;  3TG9 A;  2J3W A;  4FOF A;  3CMZ A;  1BYW A;  2YKF A;  3D4F A;  3Q81 A;  4WUJ A;  4HBU A;  1PWD A;  4BEN A;  3ZHH A;  5MC7 A;  4WYY A;  1XFN A;  5KMW A;  4QY6 A;  4GJ4 A;  1GHP A;  3QP8 A;  4KG5 A;  4UAA A;  4U0T A;  2PU2 A; 
#chains in the Genus database with same CATH homology
 3TRC A;  3F1O B;  2QWS A;  5DFX A;  5A8B A;  4NEE D;  3OLO A;  5HPI A;  1OTB A;  2PR6 A;  3O5Y A;  2ZMF A;  2PDR A;  3C30 A;  3PBQ A;  2V9A A;  2H28 A;  3NJA A;  5LBR A;  4EU0 A;  2OAQ 1;  4Q0H A;  5HD5 A;  2LB5 A;  1S4R A;  2HJ9 C;  2NUP C;  3LFV A;  4R38 A;  2VJW A;  4GCZ A;  2HF6 A;  3PYP A;  4UQI M;  3DBA A;  5HDS A;  1G28 A;  2W27 A;  1NLY A;  4I3J A;  1X0O A;  1S66 L;  2GJ3 A;  1VB6 A;  2KLI A;  2VZW A;  3F1P B;  3H7W A;  2PHY A;  4G3W A;  3E4O A;  5HWW A;  3EWK A;  2I9V A;  2QHK A;  4NXE A;  3ULF A;  3ZYT A;  2YKH A;  3T4T A;  5TBM A;  2QYB A;  5KSH A;  4Q0J A;  4XT2 A;  3FPV A;  5DFY A;  5G4Y A;  3TE8 A;  2O9C A;  2BAS A;  5F69 A;  3RFB A;  2W3G A;  3H7W B;  3PBS A;  2EWV A;  2OWH A;  2K7S A;  4MDZ A;  2WKR A;  2HV1 A;  1DP6 A;  2VV8 A;  4R6L A;  2PYP A;  4NXB A;  2P04 A;  4GHI B;  5L8M A;  4OOL A;  4R3A A;  2Z6C A;  3S7O A;  1P9R A;  3GDI A;  4KUO A;  3E4Q A;  4F3L A;  2Y8H A;  1F5M A;  1TS6 A;  2G7U A;  4ETZ A;  1YSP A;  2D01 A;  1OT6 A;  1T1C A;  3R4K A;  3MFX A;  3T50 A;  5HSQ A;  3D72 A;  1IOU A;  3OCN A;  1YSQ A;  4IUK A;  4BJP A;  3C2W A;  1F9I A;  3MQQ A;  1JNU A;  1WA9 A;  3MQ0 A;  5EFW A;  4F3L B;  1NLZ A;  4PKY A;  3OOV A;  4HP9 A;  3F1O A;  2W1T B;  2KDK A;  2P08 A;  4HH2 A;  5CX7 A;  2INW A;  3MF0 A;  4HHD A;  3LID A;  4CQH A;  1P9W A;  3EQU A;  3E98 A;  2FH5 A;  4LRX C;  4HJ6 A;  4ZRR A;  3UE3 A;  3G6O A;  1OTE A;  2QJ5 A;  3CUE A;  3F1N B;  2XRN A;  3H82 B;  1DRM A;  1ZTU A;  2P7J A;  4HH3 A;  5DKL A;  1F98 A;  1H8M A;  3R7W B;  4WLA A;  4HQA A;  1N9O A;  5IU1 A;  4EES A;  4B93 A;  2A2L A;  2FZ0 A;  2ZBB A;  5F68 A;  2CMN A;  2PYR A;  1S4S A;  3MQO A;  1UWN X;  3CAX A;  4NXF A;  4EQ1 A;  3B42 A;  3P01 A;  1OT9 A;  3PXP A;  4L9G A;  4MN7 A;  4YOF A;  1XJ6 A;  4HY8 A;  2PD7 A;  1T1A A;  4G3V A;  2ZOI A;  4LRY C;  3F1P A;  5FL3 A;  2OWJ A;  3JVU A;  5HZH A;  5HD3 A;  5DF9 A;  3BJN A;  2QKP A;  2WKQ A;  4WN5 A;  3LIE A;  2GZA A;  2W1R A;  4CLC C;  1LL8 A;  2VEA A;  5HWT A;  1G6O A;  3K3C A;  1ZHH B;  1S1Y A;  2J3T D;  2W3E A;  3S7P A;  4DJ3 A;  2LB9 A;  1TF1 A;  3HJI A;  1MKM A;  2VA0 A;  1Y28 A;  2Z6D A;  3A0S A;  4WEJ A;  3E4P A;  3IS2 B;  3UB7 A;  3EGX C;  4P6Z S;  2VGL S;  1OJG A;  3PBO A;  4YWZ A;  4BWI A;  2D02 A;  4EEU A;  5J3W A;  3S7Q A;  1N9L A;  4JGO A;  2W0N A;  3LI9 A;  5TJJ A;  5HDD A;  4B9O A;  4GHI A;  3OBF A;  1LSX A;  1D06 A;  4EER A;  3FPW A;  1XJ2 A;  1KOU A;  3TJZ C;  4PHT A;  2IA2 A;  3T4L A;  4L9F A;  4I38 A;  4O0P A;  3KSH A;  3BWL A;  2JKT I;  2VX8 A;  3LUQ A;  2A24 B;  5HWV A;  5IS1 A;  1LT0 A;  3VOL A;  1W63 M;  2KX6 A;  1V9Z A;  2GNX A;  1ODV A;  3C8C A;  4GW9 A;  2XRO A;  1OTD A;  2XA7 S;  2W3H A;  4Y3I A;  4EUV A;  3UB8 A;  2JKT M;  4EW7 A;  4PAU A;  1VHM A;  1XJ4 A;  1XFQ A;  3VE4 A;  3A0V A;  3BW6 A;  2OAP 1;  3JVV A;  2GX5 A;  2VV7 A;  3T4O A;  3LYX A;  2KOI A;  5DKK A;  3KSG A;  4BBT A;  3D3O A;  4GS9 A;  3IBR A;  4Y5F A;  3LR4 A;  2JN7 A;  2W1T A;  5F6A A;  4M4X A;  4LLO B;  4H6J B;  5HDC A;  3EEA A;  4R70 A;  3TW8 A;  4ARZ B;  4CLC D;  1V9Y A;  2B02 A;  2O9B A;  3BY8 A;  2HJE A;  3UB9 A;  4HP4 A;  1DP8 A;  5HL6 A;  3SW1 A;  2O99 A;  1MC0 A;  1D7E A;  2PT7 A;  3H82 A;  3F1N A;  4L0L A;  3RTY A;  4DN0 A;  2J3T C;  3UMD A;  3KO6 A;  1XJ3 A;  2PR5 A;  4GS9 B;  3A0R A;  2VGL M;  3LR3 A;  4Y2F A;  3R7W A;  4CLC B;  2Y79 A;  3B33 A;  4UEY A;  3C38 A;  3CLO A;  4QPR A;  4NKP A;  2OOL A;  3W2Z A;  4Z1W A;  1NRJ A;  5DJT A;  2K31 A;  2L0W A;  3T4S A;  1TS8 A;  4UQI S;  4OOM A;  4ETX A;  5J4E A;  3ICY A;  3LR0 A;  4Q0I A;  3EOI A;  3LR5 A;  4IUH A;  3LI8 A;  1T1B A;  4JGR A;  4EET B;  3PBN A;  4AFI A;  2DMW A;  2HGV A;  3CWF A;  3T4K A;  4I39 A;  4EXO A;  2XA7 M;  3PBR A;  4BMW A;  1GSX A;  5AVE A;  4I3I A;  3K3D A;  3FC7 A;  2V1A A;  1IFQ A;  1STZ A;  4BBU A;  1GSW A;  1DP9 A;  4WEL A;  2W3D A;  3MMH A;  4L9E A;  3T4J A;  4BBV A;  2JKR I;  4LPZ A;  2VLG A;  4YNR A;  2L4R A;  3BY9 A;  4FSF A;  3IS2 A;  2B18 A;  3EQV A;  1P0Z A;  2V0U A;  2XSS A;  1GSV A;  3MJQ A;  5J7E A;  1P97 A;  2M1C A;  2JKR M;  4JGQ A;  5HPF A;  2ZOH A;  2W3F A;  3KYZ A;  2QJ7 A;  3FG8 A;  4HIA A;  4GLQ A;  2O9A A;  3CI6 A;  3T4Q A;  4O8G A;  4CLC E;  5G4Z A;  2A24 A;  4WL9 A;  3LIF A;  5K5B A;  4HJ3 A;  4MMN A;  4WF0 A;  4I5S A;  1NWZ A;  4I3A A;  1YKD A;  1LSV A;  3KSF A;  3KYQ A;  2J80 A;  4PKY G;  3RH8 B;  2VV6 A;  5AJG A;  1T19 A;  1W63 Q;  2R78 A;  3B47 A;  4KUK A;  3UB6 A;  5I5L A;  4H6J A;  1H3Q A;  3VV4 A;  4ARZ A;  1TS7 A;  1YAX A;  5DJU A;  1LSW A;  1TS0 A;  3UE6 A;  3NHQ A;  3UME A;  5F5Y A;  5AVF A;  3NOP C;  2O0Y A;  3OC2 A;  3OCL A;  1N9N A;  2EWW A;  4G3K A;  4DMZ A;  1S67 L;  3NOU C;  2NUT C;  1OTI A;  4CLC A;  4HOI A;  2ZMV A;  3P7N A;  4IHQ A;  4EEP A;  4HI4 A;  1MZU A;  4HJ4 A;  4HNB A;  4KQD A;  2M7V A;  3CUE C;  1S1Z A;  3EEH A;  3CIT A;  4WEK A;  3PHY A;  1OPX A;  3BQA A;  4K08 A;  3E0Y A;  4IJG A;  5TBM B;  1T18 A;  3GEC A;  5KIZ A;  3MR0 A;  4LRZ E;  4DJ2 A;  4XT2 B;  4NXG A;  2WKP A;  3KSI A;  3PBT A;  4MN5 A;  4P6Z M;  2V0W A;  1UGU A;  2K2N A;  4E04 A;  2EA9 A;  3EGD C;  3U2A A;  3NOT C;  3HCY A;  4ME4 A;  3LIA A;  2VKS A;  2L1M A;  3BQ8 A;  3VE3 A;  3IBJ A;  2MJ6 A;  3LIC A;  4II7 A;  2J3W A;  4FOF A;  2PD8 A;  2V1B A;  4KQO A;  1BYW A;  3PR6 A;  2YKF A;  3ZQ5 A;  4MCW A;  4MN6 A;  1TD5 A;  2M7U A;  4WUJ A;  5IT5 A;  3LIB A;  3MXQ A;  5MC7 A;  3KX0 X;  1OJ5 A;  1XFN A;  1OTA A;  3H9W A;  1UWP X;  3K2N A;  5C5K A;  2JHE A;  4RQ9 A;  4O01 A;  1EW0 A;  4GJ4 A;  3HJK A;  3S7N A;  3V67 A;  4JGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...