2K2NA

Solution structure of a cyanobacterial phytochrome gaf domain in the red light-absorbing ground state
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
172
structure length
172
Chain Sequence
LDQILRATVEEVRAFLGTDRVKVYRFDPEGHGTVVAEARGGERLPSLLGLTFPAGDIPEEARRLFRLAQVRVIVDVEAQSRSISQPESWGLSARVPLGEPLQRPVDPCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHAEPRPYSQEELQVVQLLADQVSIAIAQAELSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title Solution structure of a cyanobacterial phytochrome GAF domain in the red-light-absorbing ground state.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Transferase
total genus 31
structure length 172
sequence length 172
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2k2nA00
2IA2A 2Y8HA 4E04A 3KSIA 3NHQA 4Y2FA 2O99A 2Y79A 2GX5A 4Y3IA 2W3DA 2W1TA 2XRNA 4QPRA 2VKSA 3O5YA 4MN7A 3HCYA 4DMZA 3S7NA 1YKDA 2O0YA 4IUHA 5LBRA 1VHMA 2VJWA 3G6OA 3KSGA 3MF0A 4RQ9A 3E0YA 3RFBA 2M7VA 3NOPC 2W1RA 3KSFA 2ZMFA 3DBAA 3KSHA 2LB5A 3R4KA 4EU0A 3MMHA 4ETXA 3S7OA 4MDZA 5K5BA 3NOUC 4CQHA 3TRCA 5DFXA 5AJGA 3VV4A 3S7QA 2QYBA 2W1TB 4G3VA 4GW9A 5HPFA 2W3HA 3D3OA 3OOVA 4IUKA 2W3FA 2XSSA 3S7PA 3IBRA 1TD5A 3KO6A 2O9CA 3NOTC 5HPIA 3W2ZA 4YNRA 4MCWA 1ZTUA 3CITA 2LB9A 3BJNA 4G3WA 2VZWA 4G3KA 5I5LA 2HGVA 4O8GA 2O9BA 4YOFA 1MKMA 4GLQA 4LRXC 4R6LA 4Y5FA 3ZQ5A 4R70A 3C2WA 4EUVA 1MC0A 4BWIA 1F5MA 2W3EA 4Q0HA 4FOFA 4DN0A 2O9AA 5HSQA 4PAUA 1STZA 3LFVA 2G7UA 5TJJA 2XROA 2OOLA 3OBFA 4LRZE 4O0PA 2K2NA 5DFYA 4IJGA 3EEAA 1YSPA 2K31A 2B18A 4ETZA 4Q0IA 5L8MA 3IBJA 3CI6A 3E98A 3K2NA 2M7UA 5C5KA 2KOIA 4MMNA 4Z1WA 5HL6A 2W3GA 2VEAA 4ZRRA 4O01A 2KLIA 1TF1A 4Q0JA 4ME4A 3MQ0A 1YSQA 4LRYC
chains in the Genus database with same CATH superfamily
4N9KA 1FR6A 5CECA 4U3TA 4U0TA 3HLBA 4S2MA 3LO7A 4K0WA 4KG6A 1HLUP 2O0YA 3UE0A 1ZKJA 4JGRA 5LBRA 2ZL1A 2YKFA 3F1PA 3C5AA 3ITAA 2XK1A 4UA9A 2Y2HA 1FIKA 5GLBA 1NRFA 1K57C 4KZ7A 5DVAA 2EXBA 4GS9B 3ZDJA 3NBLA 5L2FA 3S4XA 1BLCA 3MZDA 1PWDA 3A3DA 3MKEA 1P0ZA 5EVID 2P9VA 1IYQA 1BUEA 2YKHA 1FQGA 1S0WA 3WRZA 1ESIA 3T1SA 4GHIA 5DF9A 4S2JA 4WEKA 1P97A 2Z2LB 3T4QA 1FSYA 4LRXC 1KDWA 2V1AA 3UB6A 4DJ3A 1WA9A 4P0MA 3A3JA 2Y2PA 4A5RA 5CRFA 1FR1A 2PBYA 3HLCA 2B18A 1SKOA 3CI6A 3ISGA 1CEGA 3O87A 1P9RA 4OQGA 5CEBA 4R4RA 3PBQA 4HBTA 4HJ6A 2Y8HA 3KSIA 2ZM2A 3BQ8A 3HBRA 3MZEA 1WE4A 5FQMA 2NUTC 2ZBBA 2GDNA 1BLSA 2I72A 1XP4A 2VGJA 1XJ4A 2V20A 2ZOHA 1ES5A 1PFLA 5FQKA 2V9AA 3T4KA 1UWNX 3IHAA 1PWCA 3QP5A 4WMCD 4LGWA 2ZL1B 2L1MA 4IUKA 4JGPA 4B9OA 4HJ4A 3F1PB 2WKQA 4X1MA 2B95A 3NOTC 1DJBA 3ZHHA 1G5UA 2J9OA 3WS1A 3ZCZA 1J9MA 3QNCA 3BFEA 3IX3A 3S22A 2XF3A 3EWKA 1I2WA 3O3VA 5HSQA 1K55C 1RCJA 5AQ9A 3ZFZA 4Y0UA 4R0QA 1BZAA 3MFDA 4E3JA 3LFVA 1GSVA 2Y2NA 5TJJA 2ZQCA 5DFYA 2P9VB 1JNUA 3A0VA 3NC8A 3JVVA 4X55A 5CHUA 2QKPA 4R38A 2H0TA 4GHIB 5GL9A 2Y55A 4JXVA 1W63Q 4KZAA 4WZ4A 5F6AA 2J80A 5KZHA 2WGIA 4WLAA 4R3BA 4ME4A 4QJGA 1BSGA 3NHQA 2Y2QA 1LI9A 4EWFA 1MKIA 1MWTA 1W79A 3N6IA 2ZD8A 3QP2A 3FWLA 1K25A 3OPPA 1SKOB 2VJWA 3KSGA 2EXAA 2WKHA 2JCHA 1IOUA 5HWTA 1LLBA 2W1RA 4MBKA 3JPUA 2VLGA 1SDEA 4MDZA 3WS5A 5F68A 2GJ3A 3FC7A 1MZUA 1MWUA 3T4LA 1EI5A 1E3UD 3FPWA 3W4PA 5FQQA 3IWQA 3ZYTA 1L0DA 3CG5A 5EM0A 1PW1A 3C30A 4K0XA 3UE1A 4DRTA 3CUEA 3ZVWA 3O88A 4OOYA 2WAFA 4KUOA 3PBSA 3HUMA 3F1NA 3VP4A 1CF0A 4PAUA 5DF7A 5EOOA 2JKRM 2HPBA 4LRZE 2K2NA 5TBMA 2G2UA 3EEAA 4HHDA 2DCFA 2ZLYA 2J9PA 5FI6A 3M6BA 5M18A 2VGLM 2JHEA 3SW1A 2H10A 5CGXA 2H5SA 1YSQA 3IXDA 3IX4A 3ZNTA 1YT4A 3LUQA 2OWJA 4QPRA 2EWVA 3OPRA 3IWIA 3K3CA 4X69A 3B47A 1MBLA 4KG2A 4FD8A 2VV6A 3E0YA 4OQIA 3O86A 3T1QB 3ZG0A 4BD1A 4P6ZS 2WKRA 4EBPA 3UPPA 2ZM0A 1WYBA 3IQAA 3UDXA 3C7UA 1K38A 2VV7A 2ZQDA 5DF8A 1IYOA 1DY6A 3QP4A 3KX0X 4GNUA 2QYBA 3SH8A 1M40A 3FKWA 1KVMA 2Y59A 1YLYA 4JXWA 3UDIA 1NRJA 2BASA 3RTYA 5EUAA 2XD5A 1ZHHB 3TG9A 2IWDA 4DJ2A 2P74A 5KIZA 4Y7PA 2LB9A 3MQOA 3ZNYA 3SH7A 2O9BA 3LIBA 3V67A 3DW0A 4OP5A 3C2WA 1GA0A 3LYXA 1W8YA 4R4SA 4MN6A 4MN5A 1GCEA 1NLYA 3N8LA 4ZAMA 4JF4A 5FI7A 3T1XA 3NY4A 1NJ4A 3FV7A 3HL9A 3KYQA 4O0PA 4IJGA 4EQ1A 2PR5A 5AQ7A 3LGOA 2M7UA 2HV1A 4OPZA 1PI5A 2EFXA 2VEAA 4Y13A 3F1NB 1IKGA 2VX8A 3E2KA 3JYIA 1MPLA 4WL9A 2J7VA 2W3DA 2XH9A 5TBMB 2HP6A 3VP3A 4DMZA 3KYZA 4KZ9A 4JF5A 4EESA 3MF0A 3V39A 2WGWA 2M1CA 3UE3A 1YQSA 1SKFA 3WS4A 1OTDA 3IF5A 3BRMA 5EM1A 3B3XA 4BL2A 1PW8A 2G2WA 3PTEA 3VOYA 3FKVA 2KX6A 2WADA 4ZTKA 3IBRA 2ZQAA 2PR6A 4KZ5A 1K0KA 2DMWA 1L0GA 4BENA 4LPZA 2L4RA 1VEUA 2FH5A 3W8KA 1JWZA 4CLCE 1LT0A 2H0YA 4GKUA 5MC7A 3GR2A 2OAQ1 4E3LA 1YLTA 4Y5FA 2ZQ9A 3OCLA 3BFCA 4FOFA 3IWOA 3VP2A 1O07A 4EEUA 3HLEA 4PKYG 4KENB 4DXCA 2G7UA 3PBTA 3DTIA 4MEZA 1XXMA 1YAXA 2WAEA 2HJEA 4U0XA 2PAVP 1BT5A 2PDRA 4L9GA 1YMXA 3IT9A 1UGUA 4PM8A 4ZJ1A 5F1FA 1OJGA 4NXFA 5EVEA 5EOEA 4FTXA 1ES4A 2WK0A 1H5XA 4GDBA 3TE8A 5FA7A 1IYPA 2IA2A 5AVEA 4Y2FA 3LIEA 3VOZA 4X6TA 4GZBA 4PM9A 5CHJA 2W1TA 3V5MA 1IEMA 2Y2LA 2FZ0A 4WUJA 4MN7A 1PRQA 4KZ4A 4S2OA 1XFNA 1VHMA 1PYYA 4S2PA 3BFGA 2Z6DA 2XFTA 2Y2JA 3EGXC 4E3IA 3T4TA 5HAPA 3UO9A 5G4YA 1KGFA 1PI4A 5HL1A 4K91A 3VSLA 4Y0OA 1T1AA 1M6KA 2ZMAA 1N4OA 3TW8A 5K5BA 5E43A 4E6XA 3G30A 4HI4A 1XA1A 2ZC7A 5CERA 2EA9A 5JYOA 3LEQA 2WKIA 4UQIM 2ZC4B 5FAPA 2V2FF 3IH9A 2WGWB 1DP8A 4YOFA 2PU2A 4E3NA 4IEDA 2OWHA 4R6LA 3IXBA 2PYPA 2W3EA 2Y2OA 1IFQA 3ULFA 1S67L 5HAQA 2K7SA 2V8CA 3A3IA 4WEJA 2V8FA 1CQAA 4DKIA 1ZC2A 2J3TC 1YSPA 4D2OA 4WM9A 4ETZA 1VEUB 3E98A 5FDSA 4MMNA 4Z1WA 5M1AA 1Y28A 5GHXA 4ZRRA 1CI9A 2CMNA 1LSXA 1JTDA 4FSFA 4OLGA 1K54C 3UMDA 4NEED 1NZUA 2GX5A 2XFSA 4HQAA 3GECA 2XRNA 2JC7A 3ZG9B 1LSWA 4BLMA 1H3QA 4X68A 2RCXA 4PM7A 4UHUA 1HD8A 1FOFA 3G6OA 2JKGA 1T1BA 4QY6A 2ACGA 4II7A 1W7FA 3MQQA 3EOIA 3R4KA 2AVXA 3DTEA 3UB5P 1FSWA 3D9YA 2BTFP 1XJ2A 4RVAA 4MBHA 4NG2A 3E2LA 3T4JA 4OOMA 1ONGA 1ALQA 1LL8A 2W1TB 1ODVA 3GDIA 3GTCA 4EQIA 3P98A 5J8XA 2V1BA 4LCLA 1UWPX 1IYSA 3AGFA 2JKTM 4OQ0A 3NI9A 1E4DA 2VZWA 5FEGA 2Q0OA 2GZAA 5TR7A 4JPMA 3T1RA 1N9NA 4LV1A 5BOHA 4HESA 1OT9A 4ZBEA 3K3DA 1KE4A 3TJZC 1P9WA 1ES3A 1Q2PA 5L8MA 1V9ZA 2HF6A 1DJAA 1MY8A 3BQAA 1NWZA 1YLJA 3SH9A 4N9LA 1XKZA 5E2EA 2XLNA 2X01A 3GQZA 4H6JA 2PRFA 3MQ0A 3R7WA 3ZG7B 2JBFA 3IXHA 3Q07A 2PYRA 4CPKA 5HARA 5CGSA 5FI2A 3G4PA 2E8JA 4WYYA 3NCKA 4N1HA 3N7WA 5DJTA 1GHMA 2R78A 4RQ9A 4L9FA 2Z2MB 1L2SA 2J8YA 1CEFA 4QU3A 5TFQA 3CJMA 1YLZA 3NOPC 3U4LP 3B33A 4HIAA 3KSHA 5FAOA 5IHVA 3IS2A 3AGDA 4Z9QA 5DFXA 1FILA 2HDRA 5EVLA 5A93A 5HPFA 2FFYA 4GB7A 2XSSA 5HWVA 1YLPA 3VSKA 2XD1A 3EQVA 3CITA 1OMEA 4EBLA 4EEPA 4MNRA 2QPNA 1G6AA 1FCNA 3LR3A 2OSUA 1E25A 5J3WA 1F5MA 4B93A 5IS1A 5HD5A 3Q1FA 1U60A 4JF6A 5TGFA 5CXWA 4S2KA 3I7JA 4ARZA 1G68A 2W27A 3U2AA 4EXOA 4S2IA 4R3JA 4M4XA 3IBJA 1OPXA 1GHPA 2L0WA 3WWXA 4JBFA 2WGVA 4GN2A 2KOIA 3SZTA 1W5DA 1FCOA 4O01A 2KLIA 4Q0JA 3TSGA 1ESUA 3UN7A 1MWRA 2R9XA 4JXGA 4E04A 1AWIA 3BEBA 1EW0A 3C8CA 2Z6CA 2BLSA 5U47A 4KZ8A 3IXGA 3RFBA 1X0OA 3BFDA 4WN5A 3LR4A 3PYPA 4FH4A 1DRMA 4H6JB 3E4QA 3BECA 3R7WB 4XUZA 3LI8A 4ETXA 3S7OA 2IWBA 2EX8A 1XJ3A 3TRCA 3LY4A 5AJGA 1EROA 2FFFB 3DTMA 3VFHA 1NYYA 4QY5A 5FQ9A 1CK3A 3NJAA 4GCZA 3Q81A 3D3OA 4CLCC 5DTKA 1LHYA 3G32A 4HP9A 1H0MA 3QHYA 3VMAA 1V9YA 1K6RA 2ZMVA 3IS2B 1OTIA 2Y2IA 1PIOA 4L9EA 4IBRA 4EUVA 3CHWP 3UB8A 5KMWA 3P7NA 4E3KA 5J4EA 3C4PA 1OTAA 2OOLA 2OAP1 5F1GA 2D01A 5M19A 1TDLA 1W8QA 4UQIS 4GOGA 2WUQA 2DNSA 4BBUA 3OPLA 4BBVA 2HDSA 4ESPA 1KVLA 3GV9A 3LIFA 4M3KA 1J3WA 5FQIA 4C6YA 1LL5A 4KG5A 1AXBA 5F5YA 4ARZB 1G28A 1K54A 4N1XA 4Y17A 5GLCA 5GHZA 1S4RA 3G2YA 3OC2A 3HUNA 2W0NA 4NK3A 4FUWA 1ERMA 4CQHA 3L7HA 2JE5A 2BG1A 4MLLA 5CTNA 3UPOA 4DE0A 1QMFA 2QZ6A 4HJ3A 3H82B 4I3JA 3S7PA 3BW6A 1WYCA 2VGKA 1TS8A 3M6HA 5EFWA 4UA6A 3TOIA 4E3MA 5HDDA 4OOLA 3QP1A 3VE3A 1ZG6A 5JYPA 3V3RA 4DXBA 4RX3A 4S2LA 3VFFA 1C3BA 2VV8A 3NULA 1BTLA 1SZVA 3GRJA 1PNEA 1G6OA 1ERQA 2O9AA 3DWZA 2PT7A 2Y91A 2QJ5A 2ZC3B 4S2NC 2ZJ9A 5A8BA 1PZOA 4F3LA 1OTBA 3M2KA 4DE2A 3C4OA 4LENA 3ICYA 2PU4A 4KQDA 3IF6B 2PD8A 5C5KA 3VP0A 2X71A 3A3EA 2ZOIA 2EFUA 1KOUA 2WYXA 5L09A 4X53A 3HCYA 2ZC5B 5AVFA 1NYMA 1F9IA 2QJ7A 2UV0E 2EX9A 4UAAA 5L10A 4NXGA 1MWSA 1QMEA 3MJQA 4GD6A 1D7EA 5E2FA 1TEMA 2LB5A 3GVBA 3T50A 1OT6A 3WS2A 4ZDXA 4X56A 3Q7ZA 1S1ZA 3VV4A 3NIAA 4PMAA 2D02A 4WF0A 4RYEA 2JKRI 2WZZA 2V0WA 4P87A 4RX2A 1HTZA 1TD5A 5DTSA 1D06A 5EECA 1XJ6A 4EUZA 1TS6A 4XT2A 4KUKA 1K56A 1MKMA 2A49A 4HOIA 5CEDA 3PBRA 3CWFA 4P6ZM 1VM1A 2WKEA 3C7VA 5KSCA 1RGZA 4DDSA 3MR0A 3IF6C 1Z09A 1I2SA 2K31A 1LSVA 1L3LA 3K2NA 2XA7M 1ZG4A 3LICA 4HNBA 3E4PA 5AQAA 2XR0A 3OZHA 4LCMA 1TF1A 2I9VA 4QWOA 5FATA 1NXYA 2GNXA 3M2JA 4R1GA 4Y15A 4BL3A 5D3OA 1E3UA 3CPTA 2J3TD 1KE3A 4F3LB 3UDFA 3E4OA 5CTMA 5A90A 3PXPA 3HJIA 4RA7A 3QNBA 1H8ZA 4KQQA 1T18A 3UPNA 3MKFA 4OQHA 1GSXA 1DP6A 3A3FA 3G31A 1KGGA 5EVIC 2M7VA 1FCMA 1JWPA 3KYEA 5A91A 5FASA 2A3UA 3WRTA 1ONHA 4ZJ3A 3CLOA 4G3VA 3N8SA 1VETA 4HEFA 5HW3A 2HDUA 5HX9A 4OP8A 4YINA 2VGLS 1NLZA 3KO6A 4F94A 3W4OA 5G4ZA 4KZ6A 3W2ZA 4B4ZA 4YNRA 3MXQA 2J3WA 2R9WA 4CLCA 3BJNA 3ZG5A 3IHBA 2HGVA 3LY3A 4GLQA 4I3AA 4D60A 3ZQ5A 4R70A 4BWIA 4DE3A 5A92A 3SS5A 4MBFA 4Y0TA 5FQJA 1YM1A 3D72A 5I94A 1H8MA 2VK3A 4P85A 3H9WA 3N4IA 5HDCA 2XDMA 4I3IA 2EX6A 2X02A 1NY0A 2E8IA 4XT2B 3N8RA 3LI9A 4EBNA 4PKYA 4C3QA 4B4XA 5FDHA 3ZG8B 5EE8A 3A0RA 3LIDA 1HVBA 3GMWA 1NZOA 4HBUA 2P08A 2Y79A 3LR5A 2XGNA 1BYWA 3HLDA 2P04A 3ZGAB 3EGDC 3MSHA 1YKDA 3ZVTA 4NKPA 1IELA 1O7EA 4E6WA 3V50A 2PBDP 3MXRA 3LEZA 4I5SA 1S6RA 2PD7A 4IVIA 1H8YA 3FPVA 1LL9A 3CPTB 2ZM8A 4BBTA 3NOUC 3VOLA 4N92A 1L0FA 2OLUA 3RXXA 4OPYA 3VE4A 2W3FA 4HY8A 5HZHA 4O7DA 4I38A 2JN7A 5HPIA 3BY9A 1K4FA 4KZBA 2EWWA 5CHMA 1GSWA 5G18A 4AFIA 3HLGA 1JTGA 4UA7A 1BLHA 1L0EA 2KDKA 1VETB 1VQQA 1F2KA 2XROA 1K56D 2CC1A 5DKKA 3OBFA 4GDNA 4NXEA 5DKLA 2Y2GA 1JVJA 1XPBA 4S2NA 3F1OA 3PAEA 4EV4A 4OPRA 4WELA 3UNWA 4CLCB 4LV0A 2ZQ7A 5CX7A 3L9KA 3BYDA 1CJFA 2JKFA 3RH8B 4PM5A 4NXBA 4IHQA 1Y4OA 4OVDA 4GJ4A 2O99A 2C6WB 3C38A 3HREA 5HD3A 4H8RA 3S7NA 1KE0A 3DWKA 4P6BA 1DJCA 4JKTA 5EPHA 3QP6A 1YLWA 1K6SA 4GD8A 4OKPA 3H7WA 2QWSA 3LCEA 4XUXA 2OLVA 3ITBA 3DBAA 3CZDA 4EU0A 4LV2A 3MMHA 2RL3A 1OJ5A 4OONA 4QHCA 3OPHA 2MJ6A 2HJ9C 3P01A 3NDGA 2HDQA 4OH0A 5F83A 2WZXA 2W3HA 3H82A 3UB7A 1XX2A 1D1JA 3OOVA 4R3AA 4WZ5A 1XFQA 1JWVA 1OTEA 4K08A 3HVFA 1TVFA 2P7JA 3DAVA 4WBGA 2O9CA 2HP9A 4NETA 1T1CA 3PAGA 1ZTUA 3S1YA 4G3KA 4IVKA 4O8GA 2WKPA 1TS0A 5GHYA 3NDEA 3FYZA 3BWLA 2C5WB 2EX2A 2INWA 5J7EA 3MXSA 4Q0HA 3AGEA 3MZFA 3FG8A 4CLCD 2OV5A 4CJNA 1N9BA 3PHYA 1HZOA 2B02A 5E2GA 3OCNA 1K4EA 3BLMA 4DF6A 1S66L 3EEHA 4YWZA 5HWWA 1I5QA 3IF6A 3MFXA 3MS6A 3PR6A 1TDGA 5HFOA 4EW7A 3BFFA 4FCFA 4B88A 1RP5A 3HUOA 5IT5A 3BY8A 2B5RA 1BULA 1Z6FA 4R23A 3UMEA 3JVUA 1K57A 2VA0A 3F1OB 4KZ3A 1XA7A 3PBOA 3V3SA 2XA7S 1T19A 5CGWA 1Q2QA 2JKTI 2ZQ8A 4KQOA 1VB6A 3KSFA 2ZMFA 4UEYA 4YFMA 5F69A 1XGJA 3B42A 3Q7VA 5E2HA 4BD0A 5EVIA 4EETB 1CI8A 2HZ5A 2UWXA 2IWCA 2A24A 4KQRA 3G2ZA 4GW9A 4E3OA 1N9LA 1TS7A 3H7WB 4OPQA 3P09A 4OLDA 3LIAA 3LR0A 4QD4A 4PHTA 3HLWA 5I5LA 1RGYA 1W63M 3HLFA 1N9OA 1SCWA 2NUPC 5DTTA 4BJPA 3VP1A 1STZA 1YMSA 1DP9A 1KDSA 1S4SA 3BM6A 1ACFA 3NECA 4LLOB 4XXRA 4IBXA 1GA9A 2V0UA 1EWZA 4L0LA 4ZJ2A 4HH3A 2Y4AA 4HP4A 4EERA 4C75A 1PWGA 2DRWA 3UB9A 4QB8A 4X1LA 1ES2A 4PPRA 1IKIA 5GLAA 3HJKA 4LV3A 5FEFA 2Y2KA 4GS9A 1XGIA 4Y3IA 1MXOA 5GLDA 2VKSA 4DDYA 3O5YA 1SHVA 3Q82A 2XEPA 3GSGA 4IUHA 5FAQA 1LI0A 3SOIA 3RXWA 3G34A 4JXSA 3EQUA 4JLFA 3PBNA 3CAXA 4WMCA 4PM6A 3QP8A 5F82A 5L07A 1A0KA 3A0SA 3S7QA 1F98A 2H28A 2V1ZA 3UE6A 2Q9NA 3OLOA 2Q9MA 1PZPA 5KSHA 3T4OA 3CUEC 1BLPA 3SS4A 3G35A 1K55A 4I39A 4MCWA 2HP5A 3T4SA 2PHYA 4DE1A 4BMWA 4FH2A 4HH2A 4G3WA 3FZCA 1SDNA 4LFUA 4BQMA 1Y54A 3Q7VB 4WZ5C 5EVIB 3IH8A 2ZC6B 1MC0A 3WS0A 5HDSA 1GHIA 2A24B 4DN0A 3T12B 3CMZA 3SS3A 5EV0A 5FL3A 3BLSA 1KGEA 2QHKA 2QMIA 5HAIA 4ID4A 2A2LA 3MBZA 5IU1A 4Q0IA 2XQZA 4JGQA 5AQBA 3W4QA 1YPRA 3IX8A 1S1YA 5FSRA 5HL6A 4X25A 4JGOA 5DJUA 3UY6A 2Y2MA 3DTKA 3D4FA 3RJUA 4Q8IA 2W3GA 4LRYC
chains in the Genus database with same CATH topology
4E04A 2P08A 2Y79A 3LR5A 4WL9A 1BYWA 2W3DA 5TBMB 1EW0A 3C8CA 2P04A 4DMZA 3EGDC 1YKDA 2O0YA 3KYZA 4JGRA 4NKPA 5LBRA 2Z6CA 2YKFA 4EESA 3F1PA 3MF0A 3RFBA 1X0OA 4WN5A 3LR4A 3PYPA 4I5SA 2PD7A 1DRMA 4H6JB 3E4QA 2M1CA 3R7WB 3UE3A 3FPVA 3LI8A 4ETXA 3S7OA 4BBTA 3NOUC 3VOLA 1OTDA 1XJ3A 3TRCA 4GS9B 5AJGA 3VE4A 3NJAA 4GCZA 3D3OA 4CLCC 2W3FA 2KX6A 4HY8A 1P0ZA 3IBRA 5HZHA 2PR6A 4I38A 2DMWA 4HP9A 2JN7A 5HPIA 2YKHA 3BY9A 1V9YA 4LPZA 2L4RA 2EWWA 2ZMVA 4GHIA 5DF9A 3IS2B 1OTIA 2FH5A 4WEKA 4CLCE 1P97A 1GSWA 1LT0A 4L9EA 3T4QA 5MC7A 2OAQ1 4LRXC 4Y5FA 4AFIA 4EUVA 3OCLA 2V1AA 4FOFA 3UB8A 2KDKA 3UB6A 3P7NA 4EEUA 5J4EA 4DJ3A 1WA9A 4PKYG 2G7UA 3PBTA 2XROA 1OTAA 5DKKA 2OOLA 2OAP1 3OBFA 1YAXA 2HJEA 4NXEA 2D01A 5DKLA 2PDRA 4L9GA 1UGUA 4UQIS 3F1OA 2B18A 4WELA 4CLCB 1OJGA 4NXFA 5CX7A 3CI6A 1P9RA 4BBUA 4BBVA 3RH8B 3PBQA 3TE8A 4NXBA 4HJ6A 2IA2A 4IHQA 2Y8HA 3LIFA 3KSIA 5AVEA 3BQ8A 3LIEA 4GJ4A 4Y2FA 2O99A 3C38A 5F5YA 4ARZB 1G28A 2W1TA 2FZ0A 5HD3A 4WUJA 4MN7A 1XFNA 3S7NA 2NUTC 2ZBBA 1VHMA 1S4RA 2Z6DA 3H7WA 3EGXC 2QWSA 1XJ4A 3T4TA 2ZOHA 3OC2A 5G4YA 3DBAA 1T1AA 4EU0A 2W0NA 3MMHA 3TW8A 5K5BA 4CQHA 2V9AA 1OJ5A 3T4KA 1UWNX 2MJ6A 2HJ9C 3P01A 3H82A 2W3HA 3UB7A 3OOVA 4HJ3A 2L1MA 4IUKA 4JGPA 4R3AA 4B9OA 1XFQA 3H82B 3F1PB 4HI4A 1OTEA 2WKQA 4HJ4A 4I3JA 3BW6A 4K08A 3S7PA 2P7JA 1TS8A 2O9CA 2EA9A 3NOTC 5EFWA 1T1CA 5HDDA 1ZTUA 4OOLA 4UQIM 3VE3A 4G3KA 4O8GA 1DP8A 2WKPA 1TS0A 4YOFA 2OWHA 4R6LA 2VV8A 3BWLA 2PYPA 2INWA 5J7EA 1G6OA 2W3EA 3EWKA 4Q0HA 5HSQA 2O9AA 2PT7A 3FG8A 4CLCD 1IFQA 3ULFA 1S67L 2QJ5A 3LFVA 1GSVA 3PHYA 2B02A 2K7SA 5TJJA 3OCNA 5A8BA 4F3LA 5DFYA 1OTBA 4WEJA 1JNUA 2J3TC 3A0VA 3JVVA 1S66L 3ICYA 1YSPA 3EEHA 4YWZA 4ETZA 5HWWA 2QKPA 4R38A 3MFXA 4GHIB 1W63Q 3E98A 3PR6A 4KQDA 2PD8A 5C5KA 4EW7A 4MMNA 4Z1WA 1Y28A 5F6AA 4ZRRA 2CMNA 1LSXA 2J80A 4WLAA 4FSFA 4ME4A 3UMDA 4NEED 3BY8A 5IT5A 3NHQA 2ZOIA 2GX5A 4HQAA 3UMEA 1KOUA 3GECA 2XRNA 1LSWA 3HCYA 1H3QA 3JVUA 5AVFA 2VA0A 3F1OB 1F9IA 2QJ7A 3PBOA 2VJWA 2XA7S 3G6OA 3KSGA 4NXGA 1T19A 1T1BA 1IOUA 2JKTI 5HWTA 3MJQA 4KQOA 1VB6A 4II7A 2W1RA 3KSFA 2ZMFA 1D7EA 3MQQA 3EOIA 4UEYA 3T50A 2LB5A 3R4KA 2VLGA 5F69A 3B42A 1OT6A 4MDZA 1XJ2A 4EETB 3T4JA 5F68A 2GJ3A 4OOMA 1S1ZA 3VV4A 2D02A 1LL8A 2W1TB 2A24A 1ODVA 3FC7A 1MZUA 3GDIA 4WF0A 3T4LA 2JKRI 2V0WA 4GW9A 3FPWA 1N9LA 2V1BA 3ZYTA 1TS7A 1TD5A 3H7WB 1UWPX 3LIAA 1D06A 3LR0A 2JKTM 4PHTA 3C30A 2VZWA 1XJ6A 5I5LA 2GZAA 3CUEA 1TS6A 4XT2A 1W63M 4KUKA 1MKMA 4KUOA 1N9OA 3PBSA 4HOIA 3PBRA 2NUPC 1N9NA 4BJPA 3F1NA 3CWFA 4P6ZM 1OT9A 4PAUA 1STZA 1DP9A 1S4SA 3K3DA 2JKRM 3MR0A 4LLOB 4LRZE 2K2NA 3TJZC 5TBMA 2V0UA 3EEAA 4L0LA 4HHDA 2K31A 1P9WA 4HH3A 5L8MA 1LSVA 4HP4A 4EERA 3K2NA 2XA7M 1V9ZA 2HF6A 3BQAA 1NWZA 2VGLM 3LICA 4HNBA 3UB9A 3E4PA 2JHEA 1TF1A 2I9VA 2GNXA 3SW1A 4H6JA 3MQ0A 1YSQA 3R7WA 3HJKA 2J3TD 2PYRA 4GS9A 3LUQA 4F3LB 2OWJA 4Y3IA 3E4OA 4QPRA 2EWVA 3PXPA 3HJIA 2VKSA 3O5YA 3K3CA 3B47A 4IUHA 1T18A 5DJTA 1GSXA 2R78A 1DP6A 4RQ9A 2VV6A 3E0YA 4L9FA 3EQUA 4P6ZS 2WKRA 2M7VA 3PBNA 3CAXA 3NOPC 3B33A 4HIAA 3KSHA 3IS2A 2VV7A 5DFXA 3A0SA 3KX0X 3S7QA 2QYBA 1F98A 3CLOA 2H28A 4G3VA 1NRJA 3UE6A 2BASA 5HPFA 3OLOA 3RTYA 1ZHHB 2VGLS 1NLZA 2XSSA 3T4OA 5HWVA 5KSHA 3KO6A 3CUEC 4DJ2A 5G4ZA 3W2ZA 5KIZA 3EQVA 4YNRA 4I39A 4MCWA 3MXQA 3T4SA 2J3WA 2PHYA 4BMWA 3CITA 4CLCA 2LB9A 3BJNA 3MQOA 4G3WA 4HH2A 2HGVA 2O9BA 4EEPA 3LR3A 3LIBA 4GLQA 4I3AA 3V67A 3ZQ5A 4R70A 3C2WA 1MC0A 5J3WA 5HDSA 3LYXA 1F5MA 4BWIA 2A24B 4DN0A 4MN6A 4MN5A 4B93A 5IS1A 1NLYA 5HD5A 5FL3A 2QHKA 3D72A 3KYQA 4O0PA 4ARZA 4IJGA 2A2LA 1H8MA 2W27A 4EQ1A 2PR5A 3U2AA 4EXOA 3H9WA 5HDCA 4I3IA 5IU1A 4Q0IA 4M4XA 3IBJA 4JGQA 1OPXA 4XT2B 2L0WA 2M7UA 1S1YA 2HV1A 3LI9A 2KOIA 4PKYA 5HL6A 2VEAA 4JGOA 4O01A 5DJUA 2KLIA 3A0RA 3F1NB 3LIDA 4Q0JA 2VX8A 2W3GA 4LRYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IA2 A;  2Y8H A;  4E04 A;  3KSI A;  3NHQ A;  4Y2F A;  2O99 A;  2Y79 A;  2GX5 A;  4Y3I A;  2W3D A;  2W1T A;  2XRN A;  4QPR A;  2VKS A;  3O5Y A;  4MN7 A;  3HCY A;  4DMZ A;  3S7N A;  1YKD A;  2O0Y A;  4IUH A;  5LBR A;  1VHM A;  2VJW A;  3G6O A;  3KSG A;  3MF0 A;  4RQ9 A;  3E0Y A;  3RFB A;  2M7V A;  3NOP C;  2W1R A;  3KSF A;  2ZMF A;  3DBA A;  3KSH A;  2LB5 A;  3R4K A;  4EU0 A;  3MMH A;  4ETX A;  3S7O A;  4MDZ A;  5K5B A;  3NOU C;  4CQH A;  3TRC A;  5DFX A;  5AJG A;  3VV4 A;  3S7Q A;  2QYB A;  2W1T B;  4G3V A;  4GW9 A;  5HPF A;  2W3H A;  3D3O A;  3OOV A;  4IUK A;  2W3F A;  2XSS A;  3S7P A;  3IBR A;  1TD5 A;  3KO6 A;  2O9C A;  3NOT C;  5HPI A;  3W2Z A;  4YNR A;  4MCW A;  1ZTU A;  3CIT A;  2LB9 A;  3BJN A;  4G3W A;  2VZW A;  4G3K A;  5I5L A;  2HGV A;  4O8G A;  2O9B A;  4YOF A;  1MKM A;  4GLQ A;  4LRX C;  4R6L A;  4Y5F A;  3ZQ5 A;  4R70 A;  3C2W A;  4EUV A;  1MC0 A;  4BWI A;  1F5M A;  2W3E A;  4Q0H A;  4FOF A;  4DN0 A;  2O9A A;  5HSQ A;  4PAU A;  1STZ A;  3LFV A;  2G7U A;  5TJJ A;  2XRO A;  2OOL A;  3OBF A;  4LRZ E;  4O0P A;  2K2N A;  5DFY A;  4IJG A;  3EEA A;  1YSP A;  2K31 A;  2B18 A;  4ETZ A;  4Q0I A;  5L8M A;  3IBJ A;  3CI6 A;  3E98 A;  3K2N A;  2M7U A;  5C5K A;  2KOI A;  4MMN A;  4Z1W A;  5HL6 A;  2W3G A;  2VEA A;  4ZRR A;  4O01 A;  2KLI A;  1TF1 A;  4Q0J A;  4ME4 A;  3MQ0 A;  1YSQ A;  4LRY C; 
#chains in the Genus database with same CATH topology
 4N9K A;  1FR6 A;  5CEC A;  4U3T A;  4U0T A;  3HLB A;  4S2M A;  3LO7 A;  4K0W A;  4KG6 A;  1HLU P;  2O0Y A;  3UE0 A;  1ZKJ A;  4JGR A;  5LBR A;  2ZL1 A;  2YKF A;  3F1P A;  3C5A A;  3ITA A;  2XK1 A;  4UA9 A;  2Y2H A;  1FIK A;  5GLB A;  1NRF A;  1K57 C;  4KZ7 A;  5DVA A;  2EXB A;  4GS9 B;  3ZDJ A;  3NBL A;  5L2F A;  3S4X A;  1BLC A;  3MZD A;  1PWD A;  3A3D A;  3MKE A;  1P0Z A;  5EVI D;  2P9V A;  1IYQ A;  1BUE A;  2YKH A;  1FQG A;  1S0W A;  3WRZ A;  1ESI A;  3T1S A;  4GHI A;  5DF9 A;  4S2J A;  4WEK A;  1P97 A;  2Z2L B;  3T4Q A;  1FSY A;  4LRX C;  1KDW A;  2V1A A;  3UB6 A;  4DJ3 A;  1WA9 A;  4P0M A;  3A3J A;  2Y2P A;  4A5R A;  5CRF A;  1FR1 A;  2PBY A;  3HLC A;  2B18 A;  1SKO A;  3CI6 A;  3ISG A;  1CEG A;  3O87 A;  1P9R A;  4OQG A;  5CEB A;  4R4R A;  3PBQ A;  4HBT A;  4HJ6 A;  2Y8H A;  3KSI A;  2ZM2 A;  3BQ8 A;  3HBR A;  3MZE A;  1WE4 A;  5FQM A;  2NUT C;  2ZBB A;  2GDN A;  1BLS A;  2I72 A;  1XP4 A;  2VGJ A;  1XJ4 A;  2V20 A;  2ZOH A;  1ES5 A;  1PFL A;  5FQK A;  2V9A A;  3T4K A;  1UWN X;  3IHA A;  1PWC A;  3QP5 A;  4WMC D;  4LGW A;  2ZL1 B;  2L1M A;  4IUK A;  4JGP A;  4B9O A;  4HJ4 A;  3F1P B;  2WKQ A;  4X1M A;  2B95 A;  3NOT C;  1DJB A;  3ZHH A;  1G5U A;  2J9O A;  3WS1 A;  3ZCZ A;  1J9M A;  3QNC A;  3BFE A;  3IX3 A;  3S22 A;  2XF3 A;  3EWK A;  1I2W A;  3O3V A;  5HSQ A;  1K55 C;  1RCJ A;  5AQ9 A;  3ZFZ A;  4Y0U A;  4R0Q A;  1BZA A;  3MFD A;  4E3J A;  3LFV A;  1GSV A;  2Y2N A;  5TJJ A;  2ZQC A;  5DFY A;  2P9V B;  1JNU A;  3A0V A;  3NC8 A;  3JVV A;  4X55 A;  5CHU A;  2QKP A;  4R38 A;  2H0T A;  4GHI B;  5GL9 A;  2Y55 A;  4JXV A;  1W63 Q;  4KZA A;  4WZ4 A;  5F6A A;  2J80 A;  5KZH A;  2WGI A;  4WLA A;  4R3B A;  4ME4 A;  4QJG A;  1BSG A;  3NHQ A;  2Y2Q A;  1LI9 A;  4EWF A;  1MKI A;  1MWT A;  1W79 A;  3N6I A;  2ZD8 A;  3QP2 A;  3FWL A;  1K25 A;  3OPP A;  1SKO B;  2VJW A;  3KSG A;  2EXA A;  2WKH A;  2JCH A;  1IOU A;  5HWT A;  1LLB A;  2W1R A;  4MBK A;  3JPU A;  2VLG A;  1SDE A;  4MDZ A;  3WS5 A;  5F68 A;  2GJ3 A;  3FC7 A;  1MZU A;  1MWU A;  3T4L A;  1EI5 A;  1E3U D;  3FPW A;  3W4P A;  5FQQ A;  3IWQ A;  3ZYT A;  1L0D A;  3CG5 A;  5EM0 A;  1PW1 A;  3C30 A;  4K0X A;  3UE1 A;  4DRT A;  3CUE A;  3ZVW A;  3O88 A;  4OOY A;  2WAF A;  4KUO A;  3PBS A;  3HUM A;  3F1N A;  3VP4 A;  1CF0 A;  4PAU A;  5DF7 A;  5EOO A;  2JKR M;  2HPB A;  4LRZ E;  2K2N A;  5TBM A;  2G2U A;  3EEA A;  4HHD A;  2DCF A;  2ZLY A;  2J9P A;  5FI6 A;  3M6B A;  5M18 A;  2VGL M;  2JHE A;  3SW1 A;  2H10 A;  5CGX A;  2H5S A;  1YSQ A;  3IXD A;  3IX4 A;  3ZNT A;  1YT4 A;  3LUQ A;  2OWJ A;  4QPR A;  2EWV A;  3OPR A;  3IWI A;  3K3C A;  4X69 A;  3B47 A;  1MBL A;  4KG2 A;  4FD8 A;  2VV6 A;  3E0Y A;  4OQI A;  3O86 A;  3T1Q B;  3ZG0 A;  4BD1 A;  4P6Z S;  2WKR A;  4EBP A;  3UPP A;  2ZM0 A;  1WYB A;  3IQA A;  3UDX A;  3C7U A;  1K38 A;  2VV7 A;  2ZQD A;  5DF8 A;  1IYO A;  1DY6 A;  3QP4 A;  3KX0 X;  4GNU A;  2QYB A;  3SH8 A;  1M40 A;  3FKW A;  1KVM A;  2Y59 A;  1YLY A;  4JXW A;  3UDI A;  1NRJ A;  2BAS A;  3RTY A;  5EUA A;  2XD5 A;  1ZHH B;  3TG9 A;  2IWD A;  4DJ2 A;  2P74 A;  5KIZ A;  4Y7P A;  2LB9 A;  3MQO A;  3ZNY A;  3SH7 A;  2O9B A;  3LIB A;  3V67 A;  3DW0 A;  4OP5 A;  3C2W A;  1GA0 A;  3LYX A;  1W8Y A;  4R4S A;  4MN6 A;  4MN5 A;  1GCE A;  1NLY A;  3N8L A;  4ZAM A;  4JF4 A;  5FI7 A;  3T1X A;  3NY4 A;  1NJ4 A;  3FV7 A;  3HL9 A;  3KYQ A;  4O0P A;  4IJG A;  4EQ1 A;  2PR5 A;  5AQ7 A;  3LGO A;  2M7U A;  2HV1 A;  4OPZ A;  1PI5 A;  2EFX A;  2VEA A;  4Y13 A;  3F1N B;  1IKG A;  2VX8 A;  3E2K A;  3JYI A;  1MPL A;  4WL9 A;  2J7V A;  2W3D A;  2XH9 A;  5TBM B;  2HP6 A;  3VP3 A;  4DMZ A;  3KYZ A;  4KZ9 A;  4JF5 A;  4EES A;  3MF0 A;  3V39 A;  2WGW A;  2M1C A;  3UE3 A;  1YQS A;  1SKF A;  3WS4 A;  1OTD A;  3IF5 A;  3BRM A;  5EM1 A;  3B3X A;  4BL2 A;  1PW8 A;  2G2W A;  3PTE A;  3VOY A;  3FKV A;  2KX6 A;  2WAD A;  4ZTK A;  3IBR A;  2ZQA A;  2PR6 A;  4KZ5 A;  1K0K A;  2DMW A;  1L0G A;  4BEN A;  4LPZ A;  2L4R A;  1VEU A;  2FH5 A;  3W8K A;  1JWZ A;  4CLC E;  1LT0 A;  2H0Y A;  4GKU A;  5MC7 A;  3GR2 A;  2OAQ 1;  4E3L A;  1YLT A;  4Y5F A;  2ZQ9 A;  3OCL A;  3BFC A;  4FOF A;  3IWO A;  3VP2 A;  1O07 A;  4EEU A;  3HLE A;  4PKY G;  4KEN B;  4DXC A;  2G7U A;  3PBT A;  3DTI A;  4MEZ A;  1XXM A;  1YAX A;  2WAE A;  2HJE A;  4U0X A;  2PAV P;  1BT5 A;  2PDR A;  4L9G A;  1YMX A;  3IT9 A;  1UGU A;  4PM8 A;  4ZJ1 A;  5F1F A;  1OJG A;  4NXF A;  5EVE A;  5EOE A;  4FTX A;  1ES4 A;  2WK0 A;  1H5X A;  4GDB A;  3TE8 A;  5FA7 A;  1IYP A;  2IA2 A;  5AVE A;  4Y2F A;  3LIE A;  3VOZ A;  4X6T A;  4GZB A;  4PM9 A;  5CHJ A;  2W1T A;  3V5M A;  1IEM A;  2Y2L A;  2FZ0 A;  4WUJ A;  4MN7 A;  1PRQ A;  4KZ4 A;  4S2O A;  1XFN A;  1VHM A;  1PYY A;  4S2P A;  3BFG A;  2Z6D A;  2XFT A;  2Y2J A;  3EGX C;  4E3I A;  3T4T A;  5HAP A;  3UO9 A;  5G4Y A;  1KGF A;  1PI4 A;  5HL1 A;  4K91 A;  3VSL A;  4Y0O A;  1T1A A;  1M6K A;  2ZMA A;  1N4O A;  3TW8 A;  5K5B A;  5E43 A;  4E6X A;  3G30 A;  4HI4 A;  1XA1 A;  2ZC7 A;  5CER A;  2EA9 A;  5JYO A;  3LEQ A;  2WKI A;  4UQI M;  2ZC4 B;  5FAP A;  2V2F F;  3IH9 A;  2WGW B;  1DP8 A;  4YOF A;  2PU2 A;  4E3N A;  4IED A;  2OWH A;  4R6L A;  3IXB A;  2PYP A;  2W3E A;  2Y2O A;  1IFQ A;  3ULF A;  1S67 L;  5HAQ A;  2K7S A;  2V8C A;  3A3I A;  4WEJ A;  2V8F A;  1CQA A;  4DKI A;  1ZC2 A;  2J3T C;  1YSP A;  4D2O A;  4WM9 A;  4ETZ A;  1VEU B;  3E98 A;  5FDS A;  4MMN A;  4Z1W A;  5M1A A;  1Y28 A;  5GHX A;  4ZRR A;  1CI9 A;  2CMN A;  1LSX A;  1JTD A;  4FSF A;  4OLG A;  1K54 C;  3UMD A;  4NEE D;  1NZU A;  2GX5 A;  2XFS A;  4HQA A;  3GEC A;  2XRN A;  2JC7 A;  3ZG9 B;  1LSW A;  4BLM A;  1H3Q A;  4X68 A;  2RCX A;  4PM7 A;  4UHU A;  1HD8 A;  1FOF A;  3G6O A;  2JKG A;  1T1B A;  4QY6 A;  2ACG A;  4II7 A;  1W7F A;  3MQQ A;  3EOI A;  3R4K A;  2AVX A;  3DTE A;  3UB5 P;  1FSW A;  3D9Y A;  2BTF P;  1XJ2 A;  4RVA A;  4MBH A;  4NG2 A;  3E2L A;  3T4J A;  4OOM A;  1ONG A;  1ALQ A;  1LL8 A;  2W1T B;  1ODV A;  3GDI A;  3GTC A;  4EQI A;  3P98 A;  5J8X A;  2V1B A;  4LCL A;  1UWP X;  1IYS A;  3AGF A;  2JKT M;  4OQ0 A;  3NI9 A;  1E4D A;  2VZW A;  5FEG A;  2Q0O A;  2GZA A;  5TR7 A;  4JPM A;  3T1R A;  1N9N A;  4LV1 A;  5BOH A;  4HES A;  1OT9 A;  4ZBE A;  3K3D A;  1KE4 A;  3TJZ C;  1P9W A;  1ES3 A;  1Q2P A;  5L8M A;  1V9Z A;  2HF6 A;  1DJA A;  1MY8 A;  3BQA A;  1NWZ A;  1YLJ A;  3SH9 A;  4N9L A;  1XKZ A;  5E2E A;  2XLN A;  2X01 A;  3GQZ A;  4H6J A;  2PRF A;  3MQ0 A;  3R7W A;  3ZG7 B;  2JBF A;  3IXH A;  3Q07 A;  2PYR A;  4CPK A;  5HAR A;  5CGS A;  5FI2 A;  3G4P A;  2E8J A;  4WYY A;  3NCK A;  4N1H A;  3N7W A;  5DJT A;  1GHM A;  2R78 A;  4RQ9 A;  4L9F A;  2Z2M B;  1L2S A;  2J8Y A;  1CEF A;  4QU3 A;  5TFQ A;  3CJM A;  1YLZ A;  3NOP C;  3U4L P;  3B33 A;  4HIA A;  3KSH A;  5FAO A;  5IHV A;  3IS2 A;  3AGD A;  4Z9Q A;  5DFX A;  1FIL A;  2HDR A;  5EVL A;  5A93 A;  5HPF A;  2FFY A;  4GB7 A;  2XSS A;  5HWV A;  1YLP A;  3VSK A;  2XD1 A;  3EQV A;  3CIT A;  1OME A;  4EBL A;  4EEP A;  4MNR A;  2QPN A;  1G6A A;  1FCN A;  3LR3 A;  2OSU A;  1E25 A;  5J3W A;  1F5M A;  4B93 A;  5IS1 A;  5HD5 A;  3Q1F A;  1U60 A;  4JF6 A;  5TGF A;  5CXW A;  4S2K A;  3I7J A;  4ARZ A;  1G68 A;  2W27 A;  3U2A A;  4EXO A;  4S2I A;  4R3J A;  4M4X A;  3IBJ A;  1OPX A;  1GHP A;  2L0W A;  3WWX A;  4JBF A;  2WGV A;  4GN2 A;  2KOI A;  3SZT A;  1W5D A;  1FCO A;  4O01 A;  2KLI A;  4Q0J A;  3TSG A;  1ESU A;  3UN7 A;  1MWR A;  2R9X A;  4JXG A;  4E04 A;  1AWI A;  3BEB A;  1EW0 A;  3C8C A;  2Z6C A;  2BLS A;  5U47 A;  4KZ8 A;  3IXG A;  3RFB A;  1X0O A;  3BFD A;  4WN5 A;  3LR4 A;  3PYP A;  4FH4 A;  1DRM A;  4H6J B;  3E4Q A;  3BEC A;  3R7W B;  4XUZ A;  3LI8 A;  4ETX A;  3S7O A;  2IWB A;  2EX8 A;  1XJ3 A;  3TRC A;  3LY4 A;  5AJG A;  1ERO A;  2FFF B;  3DTM A;  3VFH A;  1NYY A;  4QY5 A;  5FQ9 A;  1CK3 A;  3NJA A;  4GCZ A;  3Q81 A;  3D3O A;  4CLC C;  5DTK A;  1LHY A;  3G32 A;  4HP9 A;  1H0M A;  3QHY A;  3VMA A;  1V9Y A;  1K6R A;  2ZMV A;  3IS2 B;  1OTI A;  2Y2I A;  1PIO A;  4L9E A;  4IBR A;  4EUV A;  3CHW P;  3UB8 A;  5KMW A;  3P7N A;  4E3K A;  5J4E A;  3C4P A;  1OTA A;  2OOL A;  2OAP 1;  5F1G A;  2D01 A;  5M19 A;  1TDL A;  1W8Q A;  4UQI S;  4GOG A;  2WUQ A;  2DNS A;  4BBU A;  3OPL A;  4BBV A;  2HDS A;  4ESP A;  1KVL A;  3GV9 A;  3LIF A;  4M3K A;  1J3W A;  5FQI A;  4C6Y A;  1LL5 A;  4KG5 A;  1AXB A;  5F5Y A;  4ARZ B;  1G28 A;  1K54 A;  4N1X A;  4Y17 A;  5GLC A;  5GHZ A;  1S4R A;  3G2Y A;  3OC2 A;  3HUN A;  2W0N A;  4NK3 A;  4FUW A;  1ERM A;  4CQH A;  3L7H A;  2JE5 A;  2BG1 A;  4MLL A;  5CTN A;  3UPO A;  4DE0 A;  1QMF A;  2QZ6 A;  4HJ3 A;  3H82 B;  4I3J A;  3S7P A;  3BW6 A;  1WYC A;  2VGK A;  1TS8 A;  3M6H A;  5EFW A;  4UA6 A;  3TOI A;  4E3M A;  5HDD A;  4OOL A;  3QP1 A;  3VE3 A;  1ZG6 A;  5JYP A;  3V3R A;  4DXB A;  4RX3 A;  4S2L A;  3VFF A;  1C3B A;  2VV8 A;  3NUL A;  1BTL A;  1SZV A;  3GRJ A;  1PNE A;  1G6O A;  1ERQ A;  2O9A A;  3DWZ A;  2PT7 A;  2Y91 A;  2QJ5 A;  2ZC3 B;  4S2N C;  2ZJ9 A;  5A8B A;  1PZO A;  4F3L A;  1OTB A;  3M2K A;  4DE2 A;  3C4O A;  4LEN A;  3ICY A;  2PU4 A;  4KQD A;  3IF6 B;  2PD8 A;  5C5K A;  3VP0 A;  2X71 A;  3A3E A;  2ZOI A;  2EFU A;  1KOU A;  2WYX A;  5L09 A;  4X53 A;  3HCY A;  2ZC5 B;  5AVF A;  1NYM A;  1F9I A;  2QJ7 A;  2UV0 E;  2EX9 A;  4UAA A;  5L10 A;  4NXG A;  1MWS A;  1QME A;  3MJQ A;  4GD6 A;  1D7E A;  5E2F A;  1TEM A;  2LB5 A;  3GVB A;  3T50 A;  1OT6 A;  3WS2 A;  4ZDX A;  4X56 A;  3Q7Z A;  1S1Z A;  3VV4 A;  3NIA A;  4PMA A;  2D02 A;  4WF0 A;  4RYE A;  2JKR I;  2WZZ A;  2V0W A;  4P87 A;  4RX2 A;  1HTZ A;  1TD5 A;  5DTS A;  1D06 A;  5EEC A;  1XJ6 A;  4EUZ A;  1TS6 A;  4XT2 A;  4KUK A;  1K56 A;  1MKM A;  2A49 A;  4HOI A;  5CED A;  3PBR A;  3CWF A;  4P6Z M;  1VM1 A;  2WKE A;  3C7V A;  5KSC A;  1RGZ A;  4DDS A;  3MR0 A;  3IF6 C;  1Z09 A;  1I2S A;  2K31 A;  1LSV A;  1L3L A;  3K2N A;  2XA7 M;  1ZG4 A;  3LIC A;  4HNB A;  3E4P A;  5AQA A;  2XR0 A;  3OZH A;  4LCM A;  1TF1 A;  2I9V A;  4QWO A;  5FAT A;  1NXY A;  2GNX A;  3M2J A;  4R1G A;  4Y15 A;  4BL3 A;  5D3O A;  1E3U A;  3CPT A;  2J3T D;  1KE3 A;  4F3L B;  3UDF A;  3E4O A;  5CTM A;  5A90 A;  3PXP A;  3HJI A;  4RA7 A;  3QNB A;  1H8Z A;  4KQQ A;  1T18 A;  3UPN A;  3MKF A;  4OQH A;  1GSX A;  1DP6 A;  3A3F A;  3G31 A;  1KGG A;  5EVI C;  2M7V A;  1FCM A;  1JWP A;  3KYE A;  5A91 A;  5FAS A;  2A3U A;  3WRT A;  1ONH A;  4ZJ3 A;  3CLO A;  4G3V A;  3N8S A;  1VET A;  4HEF A;  5HW3 A;  2HDU A;  5HX9 A;  4OP8 A;  4YIN A;  2VGL S;  1NLZ A;  3KO6 A;  4F94 A;  3W4O A;  5G4Z A;  4KZ6 A;  3W2Z A;  4B4Z A;  4YNR A;  3MXQ A;  2J3W A;  2R9W A;  4CLC A;  3BJN A;  3ZG5 A;  3IHB A;  2HGV A;  3LY3 A;  4GLQ A;  4I3A A;  4D60 A;  3ZQ5 A;  4R70 A;  4BWI A;  4DE3 A;  5A92 A;  3SS5 A;  4MBF A;  4Y0T A;  5FQJ A;  1YM1 A;  3D72 A;  5I94 A;  1H8M A;  2VK3 A;  4P85 A;  3H9W A;  3N4I A;  5HDC A;  2XDM A;  4I3I A;  2EX6 A;  2X02 A;  1NY0 A;  2E8I A;  4XT2 B;  3N8R A;  3LI9 A;  4EBN A;  4PKY A;  4C3Q A;  4B4X A;  5FDH A;  3ZG8 B;  5EE8 A;  3A0R A;  3LID A;  1HVB A;  3GMW A;  1NZO A;  4HBU A;  2P08 A;  2Y79 A;  3LR5 A;  2XGN A;  1BYW A;  3HLD A;  2P04 A;  3ZGA B;  3EGD C;  3MSH A;  1YKD A;  3ZVT A;  4NKP A;  1IEL A;  1O7E A;  4E6W A;  3V50 A;  2PBD P;  3MXR A;  3LEZ A;  4I5S A;  1S6R A;  2PD7 A;  4IVI A;  1H8Y A;  3FPV A;  1LL9 A;  3CPT B;  2ZM8 A;  4BBT A;  3NOU C;  3VOL A;  4N92 A;  1L0F A;  2OLU A;  3RXX A;  4OPY A;  3VE4 A;  2W3F A;  4HY8 A;  5HZH A;  4O7D A;  4I38 A;  2JN7 A;  5HPI A;  3BY9 A;  1K4F A;  4KZB A;  2EWW A;  5CHM A;  1GSW A;  5G18 A;  4AFI A;  3HLG A;  1JTG A;  4UA7 A;  1BLH A;  1L0E A;  2KDK A;  1VET B;  1VQQ A;  1F2K A;  2XRO A;  1K56 D;  2CC1 A;  5DKK A;  3OBF A;  4GDN A;  4NXE A;  5DKL A;  2Y2G A;  1JVJ A;  1XPB A;  4S2N A;  3F1O A;  3PAE A;  4EV4 A;  4OPR A;  4WEL A;  3UNW A;  4CLC B;  4LV0 A;  2ZQ7 A;  5CX7 A;  3L9K A;  3BYD A;  1CJF A;  2JKF A;  3RH8 B;  4PM5 A;  4NXB A;  4IHQ A;  1Y4O A;  4OVD A;  4GJ4 A;  2O99 A;  2C6W B;  3C38 A;  3HRE A;  5HD3 A;  4H8R A;  3S7N A;  1KE0 A;  3DWK A;  4P6B A;  1DJC A;  4JKT A;  5EPH A;  3QP6 A;  1YLW A;  1K6S A;  4GD8 A;  4OKP A;  3H7W A;  2QWS A;  3LCE A;  4XUX A;  2OLV A;  3ITB A;  3DBA A;  3CZD A;  4EU0 A;  4LV2 A;  3MMH A;  2RL3 A;  1OJ5 A;  4OON A;  4QHC A;  3OPH A;  2MJ6 A;  2HJ9 C;  3P01 A;  3NDG A;  2HDQ A;  4OH0 A;  5F83 A;  2WZX A;  2W3H A;  3H82 A;  3UB7 A;  1XX2 A;  1D1J A;  3OOV A;  4R3A A;  4WZ5 A;  1XFQ A;  1JWV A;  1OTE A;  4K08 A;  3HVF A;  1TVF A;  2P7J A;  3DAV A;  4WBG A;  2O9C A;  2HP9 A;  4NET A;  1T1C A;  3PAG A;  1ZTU A;  3S1Y A;  4G3K A;  4IVK A;  4O8G A;  2WKP A;  1TS0 A;  5GHY A;  3NDE A;  3FYZ A;  3BWL A;  2C5W B;  2EX2 A;  2INW A;  5J7E A;  3MXS A;  4Q0H A;  3AGE A;  3MZF A;  3FG8 A;  4CLC D;  2OV5 A;  4CJN A;  1N9B A;  3PHY A;  1HZO A;  2B02 A;  5E2G A;  3OCN A;  1K4E A;  3BLM A;  4DF6 A;  1S66 L;  3EEH A;  4YWZ A;  5HWW A;  1I5Q A;  3IF6 A;  3MFX A;  3MS6 A;  3PR6 A;  1TDG A;  5HFO A;  4EW7 A;  3BFF A;  4FCF A;  4B88 A;  1RP5 A;  3HUO A;  5IT5 A;  3BY8 A;  2B5R A;  1BUL A;  1Z6F A;  4R23 A;  3UME A;  3JVU A;  1K57 A;  2VA0 A;  3F1O B;  4KZ3 A;  1XA7 A;  3PBO A;  3V3S A;  2XA7 S;  1T19 A;  5CGW A;  1Q2Q A;  2JKT I;  2ZQ8 A;  4KQO A;  1VB6 A;  3KSF A;  2ZMF A;  4UEY A;  4YFM A;  5F69 A;  1XGJ A;  3B42 A;  3Q7V A;  5E2H A;  4BD0 A;  5EVI A;  4EET B;  1CI8 A;  2HZ5 A;  2UWX A;  2IWC A;  2A24 A;  4KQR A;  3G2Z A;  4GW9 A;  4E3O A;  1N9L A;  1TS7 A;  3H7W B;  4OPQ A;  3P09 A;  4OLD A;  3LIA A;  3LR0 A;  4QD4 A;  4PHT A;  3HLW A;  5I5L A;  1RGY A;  1W63 M;  3HLF A;  1N9O A;  1SCW A;  2NUP C;  5DTT A;  4BJP A;  3VP1 A;  1STZ A;  1YMS A;  1DP9 A;  1KDS A;  1S4S A;  3BM6 A;  1ACF A;  3NEC A;  4LLO B;  4XXR A;  4IBX A;  1GA9 A;  2V0U A;  1EWZ A;  4L0L A;  4ZJ2 A;  4HH3 A;  2Y4A A;  4HP4 A;  4EER A;  4C75 A;  1PWG A;  2DRW A;  3UB9 A;  4QB8 A;  4X1L A;  1ES2 A;  4PPR A;  1IKI A;  5GLA A;  3HJK A;  4LV3 A;  5FEF A;  2Y2K A;  4GS9 A;  1XGI A;  4Y3I A;  1MXO A;  5GLD A;  2VKS A;  4DDY A;  3O5Y A;  1SHV A;  3Q82 A;  2XEP A;  3GSG A;  4IUH A;  5FAQ A;  1LI0 A;  3SOI A;  3RXW A;  3G34 A;  4JXS A;  3EQU A;  4JLF A;  3PBN A;  3CAX A;  4WMC A;  4PM6 A;  3QP8 A;  5F82 A;  5L07 A;  1A0K A;  3A0S A;  3S7Q A;  1F98 A;  2H28 A;  2V1Z A;  3UE6 A;  2Q9N A;  3OLO A;  2Q9M A;  1PZP A;  5KSH A;  3T4O A;  3CUE C;  1BLP A;  3SS4 A;  3G35 A;  1K55 A;  4I39 A;  4MCW A;  2HP5 A;  3T4S A;  2PHY A;  4DE1 A;  4BMW A;  4FH2 A;  4HH2 A;  4G3W A;  3FZC A;  1SDN A;  4LFU A;  4BQM A;  1Y54 A;  3Q7V B;  4WZ5 C;  5EVI B;  3IH8 A;  2ZC6 B;  1MC0 A;  3WS0 A;  5HDS A;  1GHI A;  2A24 B;  4DN0 A;  3T12 B;  3CMZ A;  3SS3 A;  5EV0 A;  5FL3 A;  3BLS A;  1KGE A;  2QHK A;  2QMI A;  5HAI A;  4ID4 A;  2A2L A;  3MBZ A;  5IU1 A;  4Q0I A;  2XQZ A;  4JGQ A;  5AQB A;  3W4Q A;  1YPR A;  3IX8 A;  1S1Y A;  5FSR A;  5HL6 A;  4X25 A;  4JGO A;  5DJU A;  3UY6 A;  2Y2M A;  3DTK A;  3D4F A;  3RJU A;  4Q8I A;  2W3G A;  4LRY C; 
#chains in the Genus database with same CATH homology
 4E04 A;  2P08 A;  2Y79 A;  3LR5 A;  4WL9 A;  1BYW A;  2W3D A;  5TBM B;  1EW0 A;  3C8C A;  2P04 A;  4DMZ A;  3EGD C;  1YKD A;  2O0Y A;  3KYZ A;  4JGR A;  4NKP A;  5LBR A;  2Z6C A;  2YKF A;  4EES A;  3F1P A;  3MF0 A;  3RFB A;  1X0O A;  4WN5 A;  3LR4 A;  3PYP A;  4I5S A;  2PD7 A;  1DRM A;  4H6J B;  3E4Q A;  2M1C A;  3R7W B;  3UE3 A;  3FPV A;  3LI8 A;  4ETX A;  3S7O A;  4BBT A;  3NOU C;  3VOL A;  1OTD A;  1XJ3 A;  3TRC A;  4GS9 B;  5AJG A;  3VE4 A;  3NJA A;  4GCZ A;  3D3O A;  4CLC C;  2W3F A;  2KX6 A;  4HY8 A;  1P0Z A;  3IBR A;  5HZH A;  2PR6 A;  4I38 A;  2DMW A;  4HP9 A;  2JN7 A;  5HPI A;  2YKH A;  3BY9 A;  1V9Y A;  4LPZ A;  2L4R A;  2EWW A;  2ZMV A;  4GHI A;  5DF9 A;  3IS2 B;  1OTI A;  2FH5 A;  4WEK A;  4CLC E;  1P97 A;  1GSW A;  1LT0 A;  4L9E A;  3T4Q A;  5MC7 A;  2OAQ 1;  4LRX C;  4Y5F A;  4AFI A;  4EUV A;  3OCL A;  2V1A A;  4FOF A;  3UB8 A;  2KDK A;  3UB6 A;  3P7N A;  4EEU A;  5J4E A;  4DJ3 A;  1WA9 A;  4PKY G;  2G7U A;  3PBT A;  2XRO A;  1OTA A;  5DKK A;  2OOL A;  2OAP 1;  3OBF A;  1YAX A;  2HJE A;  4NXE A;  2D01 A;  5DKL A;  2PDR A;  4L9G A;  1UGU A;  4UQI S;  3F1O A;  2B18 A;  4WEL A;  4CLC B;  1OJG A;  4NXF A;  5CX7 A;  3CI6 A;  1P9R A;  4BBU A;  4BBV A;  3RH8 B;  3PBQ A;  3TE8 A;  4NXB A;  4HJ6 A;  2IA2 A;  4IHQ A;  2Y8H A;  3LIF A;  3KSI A;  5AVE A;  3BQ8 A;  3LIE A;  4GJ4 A;  4Y2F A;  2O99 A;  3C38 A;  5F5Y A;  4ARZ B;  1G28 A;  2W1T A;  2FZ0 A;  5HD3 A;  4WUJ A;  4MN7 A;  1XFN A;  3S7N A;  2NUT C;  2ZBB A;  1VHM A;  1S4R A;  2Z6D A;  3H7W A;  3EGX C;  2QWS A;  1XJ4 A;  3T4T A;  2ZOH A;  3OC2 A;  5G4Y A;  3DBA A;  1T1A A;  4EU0 A;  2W0N A;  3MMH A;  3TW8 A;  5K5B A;  4CQH A;  2V9A A;  1OJ5 A;  3T4K A;  1UWN X;  2MJ6 A;  2HJ9 C;  3P01 A;  3H82 A;  2W3H A;  3UB7 A;  3OOV A;  4HJ3 A;  2L1M A;  4IUK A;  4JGP A;  4R3A A;  4B9O A;  1XFQ A;  3H82 B;  3F1P B;  4HI4 A;  1OTE A;  2WKQ A;  4HJ4 A;  4I3J A;  3BW6 A;  4K08 A;  3S7P A;  2P7J A;  1TS8 A;  2O9C A;  2EA9 A;  3NOT C;  5EFW A;  1T1C A;  5HDD A;  1ZTU A;  4OOL A;  4UQI M;  3VE3 A;  4G3K A;  4O8G A;  1DP8 A;  2WKP A;  1TS0 A;  4YOF A;  2OWH A;  4R6L A;  2VV8 A;  3BWL A;  2PYP A;  2INW A;  5J7E A;  1G6O A;  2W3E A;  3EWK A;  4Q0H A;  5HSQ A;  2O9A A;  2PT7 A;  3FG8 A;  4CLC D;  1IFQ A;  3ULF A;  1S67 L;  2QJ5 A;  3LFV A;  1GSV A;  3PHY A;  2B02 A;  2K7S A;  5TJJ A;  3OCN A;  5A8B A;  4F3L A;  5DFY A;  1OTB A;  4WEJ A;  1JNU A;  2J3T C;  3A0V A;  3JVV A;  1S66 L;  3ICY A;  1YSP A;  3EEH A;  4YWZ A;  4ETZ A;  5HWW A;  2QKP A;  4R38 A;  3MFX A;  4GHI B;  1W63 Q;  3E98 A;  3PR6 A;  4KQD A;  2PD8 A;  5C5K A;  4EW7 A;  4MMN A;  4Z1W A;  1Y28 A;  5F6A A;  4ZRR A;  2CMN A;  1LSX A;  2J80 A;  4WLA A;  4FSF A;  4ME4 A;  3UMD A;  4NEE D;  3BY8 A;  5IT5 A;  3NHQ A;  2ZOI A;  2GX5 A;  4HQA A;  3UME A;  1KOU A;  3GEC A;  2XRN A;  1LSW A;  3HCY A;  1H3Q A;  3JVU A;  5AVF A;  2VA0 A;  3F1O B;  1F9I A;  2QJ7 A;  3PBO A;  2VJW A;  2XA7 S;  3G6O A;  3KSG A;  4NXG A;  1T19 A;  1T1B A;  1IOU A;  2JKT I;  5HWT A;  3MJQ A;  4KQO A;  1VB6 A;  4II7 A;  2W1R A;  3KSF A;  2ZMF A;  1D7E A;  3MQQ A;  3EOI A;  4UEY A;  3T50 A;  2LB5 A;  3R4K A;  2VLG A;  5F69 A;  3B42 A;  1OT6 A;  4MDZ A;  1XJ2 A;  4EET B;  3T4J A;  5F68 A;  2GJ3 A;  4OOM A;  1S1Z A;  3VV4 A;  2D02 A;  1LL8 A;  2W1T B;  2A24 A;  1ODV A;  3FC7 A;  1MZU A;  3GDI A;  4WF0 A;  3T4L A;  2JKR I;  2V0W A;  4GW9 A;  3FPW A;  1N9L A;  2V1B A;  3ZYT A;  1TS7 A;  1TD5 A;  3H7W B;  1UWP X;  3LIA A;  1D06 A;  3LR0 A;  2JKT M;  4PHT A;  3C30 A;  2VZW A;  1XJ6 A;  5I5L A;  2GZA A;  3CUE A;  1TS6 A;  4XT2 A;  1W63 M;  4KUK A;  1MKM A;  4KUO A;  1N9O A;  3PBS A;  4HOI A;  3PBR A;  2NUP C;  1N9N A;  4BJP A;  3F1N A;  3CWF A;  4P6Z M;  1OT9 A;  4PAU A;  1STZ A;  1DP9 A;  1S4S A;  3K3D A;  2JKR M;  3MR0 A;  4LLO B;  4LRZ E;  2K2N A;  3TJZ C;  5TBM A;  2V0U A;  3EEA A;  4L0L A;  4HHD A;  2K31 A;  1P9W A;  4HH3 A;  5L8M A;  1LSV A;  4HP4 A;  4EER A;  3K2N A;  2XA7 M;  1V9Z A;  2HF6 A;  3BQA A;  1NWZ A;  2VGL M;  3LIC A;  4HNB A;  3UB9 A;  3E4P A;  2JHE A;  1TF1 A;  2I9V A;  2GNX A;  3SW1 A;  4H6J A;  3MQ0 A;  1YSQ A;  3R7W A;  3HJK A;  2J3T D;  2PYR A;  4GS9 A;  3LUQ A;  4F3L B;  2OWJ A;  4Y3I A;  3E4O A;  4QPR A;  2EWV A;  3PXP A;  3HJI A;  2VKS A;  3O5Y A;  3K3C A;  3B47 A;  4IUH A;  1T18 A;  5DJT A;  1GSX A;  2R78 A;  1DP6 A;  4RQ9 A;  2VV6 A;  3E0Y A;  4L9F A;  3EQU A;  4P6Z S;  2WKR A;  2M7V A;  3PBN A;  3CAX A;  3NOP C;  3B33 A;  4HIA A;  3KSH A;  3IS2 A;  2VV7 A;  5DFX A;  3A0S A;  3KX0 X;  3S7Q A;  2QYB A;  1F98 A;  3CLO A;  2H28 A;  4G3V A;  1NRJ A;  3UE6 A;  2BAS A;  5HPF A;  3OLO A;  3RTY A;  1ZHH B;  2VGL S;  1NLZ A;  2XSS A;  3T4O A;  5HWV A;  5KSH A;  3KO6 A;  3CUE C;  4DJ2 A;  5G4Z A;  3W2Z A;  5KIZ A;  3EQV A;  4YNR A;  4I39 A;  4MCW A;  3MXQ A;  3T4S A;  2J3W A;  2PHY A;  4BMW A;  3CIT A;  4CLC A;  2LB9 A;  3BJN A;  3MQO A;  4G3W A;  4HH2 A;  2HGV A;  2O9B A;  4EEP A;  3LR3 A;  3LIB A;  4GLQ A;  4I3A A;  3V67 A;  3ZQ5 A;  4R70 A;  3C2W A;  1MC0 A;  5J3W A;  5HDS A;  3LYX A;  1F5M A;  4BWI A;  2A24 B;  4DN0 A;  4MN6 A;  4MN5 A;  4B93 A;  5IS1 A;  1NLY A;  5HD5 A;  5FL3 A;  2QHK A;  3D72 A;  3KYQ A;  4O0P A;  4ARZ A;  4IJG A;  2A2L A;  1H8M A;  2W27 A;  4EQ1 A;  2PR5 A;  3U2A A;  4EXO A;  3H9W A;  5HDC A;  4I3I A;  5IU1 A;  4Q0I A;  4M4X A;  3IBJ A;  4JGQ A;  1OPX A;  4XT2 B;  2L0W A;  2M7U A;  1S1Y A;  2HV1 A;  3LI9 A;  2KOI A;  4PKY A;  5HL6 A;  2VEA A;  4JGO A;  4O01 A;  5DJU A;  2KLI A;  3A0R A;  3F1N B;  3LID A;  4Q0J A;  2VX8 A;  2W3G A;  4LRY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...