4EEUA

Crystal structure of philov2.1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
109
structure length
109
Chain Sequence
FIEKSFVITDPRLPDYPIIFASDGFLELTEYSREEIMGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDRKGGLQYFIGVQLVGSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein, flavoprotein
molecule keywords Phototropin-2
publication title Structural Tuning of the Fluorescent Protein iLOV for Improved Photostability.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 34
structure length 109
sequence length 109
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4eeuA00
3LIEA 1GSVA 4EEUA 1Y28A 2QJ7A 1DP9A 3RH8B 2K7SA 2H28A 2INWA 1F98A 3VE4A 4L9EA 2R78A 4DJ2A 5DKKA 1GSWA 3RTYA 3K3CA 4HNBA 3CAXA 5HWVA 2OOLA 1KOUA 3LIBA 5G4YA 5J7EA 1BYWA 4JGQA 5HDCA 2L1MA 2PYPA 4I3AA 3LI9A 3EWKA 3FC7A 3MR0A 4I5SA 4NXGA 1OT6A 1OT9A 3ICYA 3C2WA 1LSXA 2W0NA 3PHYA 4NXEA 2VLGA 1S4SA 5IU1A 3F1PB 3OLOA 3F1PA 5DKLA 3NOTC 3MQOA 1DRMA 4I39A 3K3DA 3UMDA 3BY9A 1T1BA 1XFQA 5F5YA 3MXQA 3PYPA 3UMEA 1XJ4A 2KX6A 3SW1A 1P0ZA 3MQQA 4I3IA 2V9AA 4HH2A 4KUKA 1EW0A 5HDDA 1S1ZA 4R6LA 1V9ZA 4I38A 4M4XA 1OJ5A 2CMNA 2V0WA 4EW7A 4HJ6A 5IS1A 4LRXC 1OJGA 2I9VA 1G28A 2VV7A 4PKYG 4BBUA 5TBMB 3P7NA 1OTBA 2PD7A 3H9WA 2VV8A 4KQDA 2YKHA 3EEHA 5HDSA 2ZOIA 4GW9A 2QJ5A 3GDIA 1XJ6A 4HOIA 1S66L 4LPZA 3VOLA 1ODVA 2ZBBA 4BBTA 2M1CA 3NJAA 2W27A 3UB7A 2A24B 2A24A 4JGOA 1TS7A 3ULFA 4B9OA 2PR5A 3UB6A 4H6JB 4H6JA 3A0SA 2BASA 3GECA 4WF0A 2PDRA 3B33A 5DJTA 2Z6DA 5AVFA 1LL8A 3IS2B 3KX0X 1LT0A 3IS2A 3LIFA 3VE3A 5KIZA 3G6OA 4NXBA 5HSQA 5HD3A 1S1YA 4R3AA 3H7WB 1T1CA 3H7WA 1TS6A 2YKFA 5F68A 4WN5A 1OTDA 3D72A 5HD5A 1UWNX 4K08A 3E4QA 3NOPC 1T18A 1MZUA 4HP4A 4E04A 4EEPA 2ZOHA 4GS9B 3BY8A 1OTEA 4GS9A 4R70A 4HQAA 1S67L 1X0OA 2L0WA 4WLAA 1UWPX 1D7EA 4F3LB 3CLOA 4F3LA 3UB8A 5HWWA 1XFNA 3E4OA 2J80A 4EERA 4JGPA 4MN5A 3H82B 5J3WA 2B02A 3H82A 2D02A 2V0UA 4EXOA 2PD8A 4RQ9A 1NWZA 4HH3A 1V9YA 4WL9A 2V1BA 3A0RA 3UB9A 3NOUC 4L9GA 2OWJA 5F6AA 2OWHA 4NXFA 1D06A 3F1OB 2L4RA 3F1OA 2PHYA 2QHKA 1S4RA 1LSWA 1N9NA 2JN7A 5J4EA 1F9IA 1LSVA 4EQ1A 4GCZA 3MJQA 1P97A 3HJKA 4WUJA 5F69A 2P7JA 2WKPA 4DJ3A 4XT2B 2VV6A 4HHDA 4XT2A 1N9OA 3UE6A 1N9LA 4HJ3A 4MN6A 5HWTA 1JNUA 4KUOA 1TS8A 4HP9A 3HJIA 1OTAA 1OTIA 2HV1A 3LIAA 1XJ2A 3BWLA 2PYRA 4HIAA 2KDKA 2WKQA 1UGUA 4BBVA 3E4PA 2V1AA 3LYXA 5A8BA 1GSXA 3F1NB 4L9FA 4R38A 2VEAA 2QKPA 2PR6A 3F1NA 3LUQA 3LIDA 3LI8A 4PKYA 4GHIB 1XJ3A 4GHIA 3C8CA 5AVEA 4HJ4A 3LICA 4HI4A 1T1AA 2EA9A 3T50A 2JHEA 2WKRA 3A0VA 2QWSA 1DP8A 4EESA 1DP6A 1T19A 4LRYC 4I3JA 4LRZE 2D01A 1WA9A 3IBRA 1VB6A 3FG8A 4JGRA 3CWFA 5HZHA 4LLOB 3NHQA 3MFXA 5I5LA 5TBMA 1TS0A 4EETB 5G4ZA 5DJUA 2GJ3A 5EFWA 3ZQ5A 2Z6CA 4YWZA 4HY8A
chains in the Genus database with same CATH superfamily
3LIEA 5L09A 1HZOA 4EEUA 1Y28A 1DP9A 1RGZA 3HLFA 2JCHA 2H28A 4E3LA 1G5UA 4WEJA 4HBTA 3BM6A 2R78A 4DJ2A 3WRTA 5DKKA 2IA2A 4ZRRA 4OQGA 5EVIB 3RTYA 5EVIA 4HNBA 3VOZA 1JTGA 2B95A 5GHZA 2OOLA 4WM9A 1YLJA 5AJGA 5TR7A 2JC7A 2BG1A 1BTLA 3OZHA 2VX8A 4FTXA 3LI9A 4G3WA 4KZ7A 3MR0A 3O88A 3CG5A 1KVLA 4R3JA 1OT6A 1PZPA 3T4OA 2ACGA 1LSXA 3LR5A 3PHYA 2X71A 5CX7A 3G32A 5IU1A 1K55A 4R23A 4B88A 5KSHA 1J3WA 3W4OA 2R9WA 4I39A 3TW8A 1STZA 2OLVA 5F5YA 4UQIM 5FASA 1BLSA 1N4OA 5HAPA 1XJ4A 3LY3A 3MXSA 2K2NA 3SZTA 4I3IA 3C5AA 5DF7A 4PM7A 4LV0A 5HDDA 4R6LA 5FI7A 1PWDA 4M4XA 3NC8A 1MXOA 2CMNA 2A2LA 4DKIA 3HREA 2XR0A 2Y2OA 4ZJ3A 3VP3A 2VV7A 3D9YA 3S1YA 4PKYG 1XGIA 3QNCA 1OTBA 5GLDA 2PD7A 4WBGA 2VV8A 3VFHA 4JKTA 5HFOA 3NULA 2QJ5A 1XJ6A 2ZQ8A 5DF8A 2J3TC 1ES4A 3S4XA 1YSQA 4LPZA 4NETA 1ODVA 2ZBBA 2HPBA 4N9KA 3NJAA 3D3OA 4KZ3A 1NYMA 2A24B 1O07A 4B4ZA 2A24A 1TS7A 3ULFA 2ZC7A 3MMHA 4L0LA 2PBDP 3IF6B 4H6JB 4EBLA 3DW0A 3IF6A 3LEZA 3A0SA 3BYDA 4H6JA 2BASA 4FUWA 1FCNA 3GECA 2Q0OA 3T1QB 4JXWA 1E3UD 1KE3A 3B33A 3HLWA 5DJTA 5F1FA 2Z6DA 3FKWA 2ZM2A 2EXBA 4OQIA 2J3TD 3KX0X 3VE3A 5KIZA 4PM8A 5HD3A 3VP4A 5KMWA 3BFDA 1SDNA 3W8KA 1XA1A 5F68A 3KYQA 1NJ4A 1ERMA 4WN5A 1Z6FA 1OTDA 4GKUA 4ETXA 2Q9MA 3PBTA 3L7HA 4OP5A 3DWZA 5KSCA 3E4QA 4E3OA 2JE5A 3C4PA 5GLBA 1OPXA 3PR6A 4S2PA 4E04A 4IVKA 3M6BA 1IELA 1LI9A 1YLTA 3VP2A 5FQ9A 3DTEA 4S2KA 3BY8A 2B18A 1S67L 1SDEA 3M2JA 1KVMA 4WLAA 3NCKA 4U0XA 4JXVA 2FFYA 5HL1A 4G3KA 1D1JA 2XEPA 3ZFZA 2VGKA 2LB5A 5GHXA 4JGPA 5K5BA 5DTKA 4KQRA 1NWZA 3VP1A 3LY4A 3WS5A 4JF5A 3OCLA 2V1BA 4OLGA 4R4RA 1QMFA 2V8CA 4PAUA 2KLIA 2OWJA 4Y0TA 3K2NA 2NUPC 5F6AA 4NXFA 2HJ9C 1D06A 2W3EA 1BLCA 4OOYA 1F2KA 1GCEA 3UDIA 4UA7A 4Z1WA 5TFQA 1Z09A 2JN7A 3IH9A 4KG2A 5J4EA 2PU2A 4PHTA 4LCMA 5L10A 1LSVA 1VHMA 4S2IA 1H8ZA 3HJKA 4YOFA 5E2EA 1MWTA 2EX6A 4O8GA 3A3DA 4Y3IA 1ZG4A 3PBQA 1BT5A 4XT2B 5EVEA 4XT2A 5HPIA 5HPFA 3UE6A 2ZQ7A 5IHVA 3VP0A 1MKMA 3UDFA 1ESIA 2EWWA 5U47A 4HJ3A 4D2OA 3NDGA 4MN6A 5IT5A 1N9BA 2GNXA 3LR0A 2M7UA 3N4IA 1XXMA 3HVFA 3VMAA 3T4QA 3UY6A 4QD4A 5JYPA 3HL9A 2UV0E 3IXDA 3KSFA 3EQVA 3JYIA 1IYOA 2Z2MB 2WKQA 3LYXA 5A8BA 1EROA 5CECA 5E2HA 4R38A 3DTMA 3LUQA 5MC7A 4BJPA 2XH9A 2IWCA 5HX9A 1ES2A 3C38A 2FH5A 5AVEA 4Q0HA 1MC0A 4HI4A 4GOGA 3N7WA 5EUAA 2EA9A 4S2NC 2R9XA 3QP8A 5FAQA 1MPLA 3E0YA 1DP6A 3P01A 3T1RA 4LRYC 5HARA 4PM6A 4XUXA 4LRZE 4LV1A 3IBRA 1SCWA 2VKSA 2RCXA 2Y79A 3FG8A 3GSGA 5AQ7A 1MWUA 4LLOB 5FQIA 3L9KA 2G7UA 4E6XA 1GHPA 1YLZA 5TBMA 3T4KA 3FKVA 4EETB 1GHMA 2GJ3A 3E2LA 1PWGA 4ZJ2A 2A3UA 2QJ7A 1BLHA 3RH8B 1YM1A 1JWPA 3MZDA 1F98A 2X02A 4OPRA 1KOUA 3OOVA 1KGEA 1P9WA 5G4YA 1RCJA 3PXPA 4JXGA 2G2UA 3O87A 2EFXA 3KYEA 2L1MA 2PYPA 5JYOA 4I3AA 5DFXA 1H8YA 1JWVA 4YNRA 1K6RA 3HBRA 4RX3A 4DE0A 4NXGA 2JKRM 3LFVA 3V50A 3C2WA 4MNRA 2W0NA 2ZQ9A 5FI2A 3FPVA 4EBPA 3T4JA 2WKHA 4HESA 2XD5A 2Y91A 3F1PB 2VZWA 3OLOA 3F1PA 2PRFA 2O9CA 2WGWB 2WGWA 3NOTC 1NLYA 2WYXA 3T4TA 4CLCC 3ZHHA 3BFGA 3PBSA 3N8RA 5M18A 1XFQA 5HL6A 2K31A 3O5YA 3IHAA 2HP6A 3PTEA 3E2KA 3UMEA 4E3JA 3G34A 1HVBA 4HH2A 4KUKA 3D4FA 2XGNA 3GQZA 4WELA 4D60A 4R3BA 2ZM8A 1WYBA 1CEFA 1K54C 5IS1A 4FCFA 4LRXC 1M6KA 5EV0A 1XP4A 2MJ6A 1G28A 2ZC6B 5A93A 3MSHA 2C5WB 2XF3A 4P87A 5EOEA 3V3SA 3P7NA 4EV4A 4WZ5C 3H9WA 2Y2PA 2YKHA 4BD0A 5HDSA 2XRNA 5EVLA 4CQHA 1ZHHB 3TG9A 2P74A 4RVAA 1EWZA 2W3DA 4HOIA 1W7FA 4LV2A 3TE8A 1SKOB 4DDYA 2VGLS 1SKOA 3O3VA 3VOLA 4EBNA 4XUZA 1FOFA 4BBTA 4K91A 3LCEA 1ACFA 2M1CA 4OQHA 4EWFA 3DTKA 1W63M 2B5RA 1LLBA 4JGOA 4F94A 1HD8A 3T12B 4O01A 1PI5A 3TRCA 1WYCA 4DE2A 1PNEA 1Q2PA 1ZKJA 2HDRA 3DWKA 1FQGA 3MKFA 3SS4A 4LCLA 3BFCA 2OSUA 4WF0A 1TD5A 1XA7A 3SH7A 1YLPA 4S2NA 5FAPA 4JPMA 5FQMA 2VK3A 1LI0A 4GZBA 1GA0A 5CTMA 1F5MA 1PYYA 3GV9A 1DJCA 2ZC4B 3IS2B 5KZHA 2WGIA 1LT0A 3IS2A 4NXBA 1IFQA 4MMNA 1MY8A 2ZMAA 3H7WB 3H7WA 3EGDC 5L07A 1K6SA 4ESPA 2WUQA 3UE3A 1KE0A 4CPKA 3LGOA 1ZC2A 1K56D 1S0WA 2RL3A 5HD5A 3QP1A 3WS1A 1UWNX 4K08A 1DJAA 3Q07A 4GB7A 3IBJA 2V2FF 2EXAA 2XQZA 2Y2QA 4N92A 1PW1A 3ZYTA 4OPZA 3UPPA 4E3KA 4EEPA 4LFUA 3BLSA 4IUKA 4GS9B 4DE3A 4PPRA 4GS9A 4HQAA 1YMSA 4C75A 2LB9A 2EFUA 3V3RA 5HWWA 3HLCA 1VQQA 3OCNA 2Y2GA 3GTCA 4GLQA 5AQBA 2EX8A 3E4OA 4EERA 4IBXA 3H82B 4O0PA 5J3WA 1CF0A 2Y59A 3H82A 1K57A 4XXRA 4Q8IA 2PD8A 5EECA 2JKRI 3G4PA 1G6OA 4HH3A 1V9YA 3R4KA 4X53A 3A0RA 1YLWA 4X1LA 4Y15A 5FQJA 3NI9A 4MBKA 4WMCD 3NIAA 5EE8A 3SOIA 4GN2A 3JVUA 2XDMA 3Q7VB 2AVXA 4CLCB 1NLZA 3Q7VA 4CLCA 2QHKA 4P85A 1CQAA 4B4XA 4KZ5A 4QJGA 1LL9A 1MKIA 5FA7A 3ZCZA 2VJWA 4KZBA 5FEFA 4WUJA 3G30A 2P7JA 4IHQA 1H3QA 1K4FA 2XA7S 1IKIA 4QHCA 2VV6A 1CI9A 2XD1A 4X6TA 1N9OA 3DBAA 3ZG7B 1AXBA 1N9LA 3C7VA 3B42A 3VV4A 2ZJ9A 4JF6A 1TS8A 4UA6A 3KYZA 1ES3A 1FCOA 4BQMA 3BQ8A 3W4PA 4WZ5A 4NKPA 3LIAA 1XJ2A 3VSLA 2PYRA 3IX4A 4HBUA 4B93A 4KZ6A 2GDNA 1NZUA 1VETB 4BBVA 1VETA 2V1AA 4Y0OA 1W63Q 2KOIA 3BEBA 3F1NB 4QB8A 2QKPA 3F1NA 2NUTC 4KQOA 4QY5A 1H8MA 1XJ3A 2H10A 4OLDA 2WAFA 5M19A 3WWXA 4HJ4A 2X01A 2VGLM 3LICA 1Y4OA 4GD8A 3UE1A 2JHEA 3UDXA 2WKRA 3A0VA 1XGJA 1DP8A 4EESA 3QNBA 3PAEA 3MF0A 4BWIA 2FZ0A 4Y7PA 1VB6A 2A49A 5HZHA 1NY0A 1FSWA 1PW8A 3QHYA 3VSKA 1K38A 2Y2HA 3WS4A 4ZTKA 3MFXA 1E4DA 3CUEC 5DFYA 5CHUA 1JWZA 3MQ0A 5EFWA 1PWCA 2J9PA 1MBLA 3Q81A 5FEGA 3OPPA 1YQSA 2XFTA 5CHJA 2J8YA 3ZG5A 5FAOA 2W3FA 2K7SA 1AWIA 3VE4A 4E3NA 1RGYA 3CAXA 4PM5A 2OV5A 5J7EA 3UE0A 4X68A 1A0KA 3CMZA 2EX9A 2XK1A 1K0KA 4S2JA 3ZVWA 3EWKA 3FC7A 2V1ZA 1CEGA 3TJZC 3IXGA 4Y13A 2WAEA 3IT9A 2GZAA 1OT9A 2DNSA 4KZ4A 4GD6A 3ICYA 4DMZA 2V20A 5AQ9A 1E3UA 1P9RA 3KSIA 3KO6A 3RFBA 3IH8A 3LEQA 2VLGA 1OMEA 4Q0IA 5DKLA 1IOUA 2WZZA 4MEZA 3LO7A 3UMDA 2WKIA 1T1BA 1IKGA 3TSGA 5FQQA 3O86A 3IQAA 3IF5A 3MS6A 3MXQA 3PYPA 5FI6A 4U3TA 3UN7A 1GA9A 3V39A 1VM1A 2V9AA 4FH4A 1EW0A 4FOFA 4I38A 3OPLA 1XPBA 1BLPA 3ITBA 1L0FA 3MZEA 2HP5A 4UA9A 1H5XA 2WKEA 2I9VA 4C3QA 1J9MA 3WS0A 1VEUB 5TBMB 1VEUA 2XA7M 2H0YA 5A91A 4UAAA 4IEDA 3EEHA 3CI6A 3MXRA 3RXWA 4QWOA 1I2WA 1ES5A 1O7EA 4JF4A 4GW9A 2O9BA 4ARZB 4UQIS 4ARZA 3GDIA 4RX2A 1S66L 1JVJA 5EVID 1L3LA 2QYBA 5C5KA 3GR2A 1Y54A 4UHUA 5CERA 3BQAA 4OPYA 2DCFA 4ID4A 1ALQA 4N9LA 3UB7A 3CHWP 5CGSA 2I72A 3T1XA 2WGVA 1YAXA 1G6AA 5CEBA 3C30A 3UB6A 3ZG9B 2Z2LB 4P6BA 1IEMA 4IBRA 2PDRA 4FH2A 2M7VA 1ZG6A 4IVIA 4OH0A 5CGXA 5AVFA 4Z9QA 3R7WB 1LL8A 3R7WA 3S7PA 3BFEA 1HLUP 5A90A 5DTSA 5HSQA 1S1YA 4R3AA 1T1CA 2YKFA 4Y5FA 3QP6A 3CUEA 4ZDXA 3D72A 4WZ4A 3HLEA 2DRWA 4GJ4A 1T18A 2HGVA 4OQ0A 1MZUA 4HP4A 4DRTA 3BW6A 4X1MA 3SS5A 4A5RA 1G68A 1M40A 2J3WA 4R0QA 4UEYA 3UNWA 2FFFB 5CTNA 3MFDA 3A3IA 3IF6C 1D7EA 2JKTM 4R1GA 4QY6A 3PBRA 1LHYA 3CLOA 4LV3A 2E8IA 4DDSA 3G2YA 3T4SA 3B47A 5E2GA 4MN5A 3UPNA 3AGFA 4DXBA 2B02A 2ZC3B 4JXSA 5LBRA 4EXOA 1C3BA 3MZFA 2JKGA 2HDSA 3E98A 3Q7ZA 3NOUC 4KZ9A 2W3HA 4L9GA 3UB5P 4G3VA 4GDNA 3F1OB 3F1OA 4DF6A 4NEED 1PRQA 3MBZA 1W8YA 1NRFA 3M2KA 1S4RA 1LSWA 3T4LA 1KDWA 1YT4A 3IX8A 4EQ1A 3IXBA 1QMEA 4YFMA 4IUHA 1P97A 5FL3A 1L0GA 1GHIA 1L0EA 2IWBA 4BL2A 4DJ3A 4BLMA 4O7DA 4OVDA 2Y2IA 5CRFA 3OPHA 3UO9A 4MDZA 4OOMA 2PU4A 4KG6A 3U4LP 5HWTA 1JNUA 4KUOA 1KGGA 3CZDA 4MN7A 4HP9A 2V8FA 3HJIA 1OTAA 3G35A 2WK0A 1SKFA 2J7VA 5L8MA 2Y2LA 1BZAA 3BWLA 3N6IA 5GLCA 1MWSA 2KDKA 2CC1A 1YSPA 3GRJA 5TJJA 4MLLA 1W5DA 3PBNA 5D3OA 3OPRA 3E4PA 4JLFA 1GSXA 4MCWA 4L9FA 2VEAA 1TDLA 2XLNA 3LI8A 4PKYA 4GHIB 4GHIA 3FPWA 4NG2A 1DJBA 3CPTB 3CJMA 3C8CA 3CPTA 1RP5A 1T1AA 4LGWA 2ZLYA 3T50A 4R4SA 2HP9A 2PBYA 2Q9NA 3SH8A 3IHBA 2Y8HA 1FILA 1T19A 5EOOA 4I3JA 2D01A 2PAVP 2ZQDA 2QPNA 4E6WA 3NECA 3JPUA 3RJUA 3BECA 4JGRA 1K25A 5F1GA 3NHQA 2XFSA 1NZOA 5I5LA 2HF6A 1TS0A 5J8XA 5G4ZA 4RA7A 3ZQ5A 2Z6CA 4YWZA 4HY8A 1GSVA 4OONA 5CHMA 3W2ZA 4DN0A 3A3JA 3VFFA 3IX3A 1CK3A 5GL9A 3Q1FA 2INWA 4CJNA 3QP4A 4L9EA 1L0DA 1GSWA 2E8JA 4N1XA 2P04A 3K3CA 2J9OA 3TOIA 4FSFA 5HWVA 2HZ5A 4E3IA 3LIBA 1BYWA 4JGQA 5HDCA 3S7QA 1K54A 5GHYA 5CGWA 3PBOA 5EM1A 3QP2A 4I5SA 4Q0JA 4BL3A 1W8QA 1ONGA 1WE4A 2JKTI 1ESUA 1NRJA 3UPOA 1ZTUA 4IJGA 5CXWA 1FR6A 5L2FA 4NXEA 5F83A 3ZDJA 3G2ZA 4Y0UA 1S4SA 3SH9A 4S2MA 1SHVA 4FD8A 4WEKA 4DE1A 3ZVTA 5A92A 3MQOA 3HCYA 1DRMA 3K3DA 3BY9A 2Y2MA 4K0XA 2UWXA 5DVAA 1ONHA 1I5QA 1CJFA 1K56A 1TEMA 3GVBA 3FYZA 4ZAMA 5HW3A 2JBFA 2O0YA 2KX6A 3SW1A 1P0ZA 3MQQA 3U2AA 3BLMA 3FWLA 4OP8A 4KZ8A 3JVVA 1S1ZA 4X55A 3A3FA 1H0MA 1V9ZA 4PMAA 1OJ5A 2V0WA 4EW7A 4HJ6A 1LL5A 4JBFA 4LENA 1OJGA 2ZD8A 4PM9A 3BFFA 3KSGA 4RYEA 3NDEA 4P6ZS 4BBUA 2W1RA 4BD1A 2Y2KA 4KQDA 3DTIA 2ZOIA 4KENB 4II7A 1S6RA 4GNUA 2G2WA 2EX2A 4MBHA 3ZNYA 1YKDA 2ZM0A 5FDHA 2BTFP 4X69A 3DAVA 2W27A 4U0TA 2ZQAA 4Y17A 4WMCA 4K0WA 1IYQA 4BMWA 4B9OA 2PT7A 5F82A 3EGXC 3HLGA 2PR5A 4GDBA 3P09A 2EWVA 2WADA 1MWRA 2W1TB 5EPHA 2W1TA 2ZL1B 2ZL1A 3BRMA 2IWDA 5GLAA 5E2FA 4DXCA 5G18A 3LIFA 3HUNA 4MBFA 3G6OA 1K4EA 2O9AA 3I7JA 1BUEA 2QZ6A 1TS6A 1PZOA 3IWIA 2OLUA 5DF9A 3PAGA 1YLYA 3HLDA 2O99A 4WYYA 3EOIA 1U60A 3N8LA 4X25A 3FZCA 4EUVA 1FCMA 3NOPC 4M3KA 5EVIC 4ETZA 4KG5A 1BSGA 2H0TA 2ZOHA 1FR1A 4HEFA 5FQKA 3V5MA 2C6WB 3IWQA 3QP5A 4X56A 3RXXA 1OTEA 1XX2A 4R70A 3S7NA 1X0OA 2L0WA 2OAQ1 5M1AA 1IYSA 3ZGAB 1UWPX 3S22A 1PI4A 4OKPA 4F3LB 4Y2FA 3N8SA 4F3LA 1XKZA 3NBLA 3IWOA 3UB8A 1XFNA 2P08A 5HAIA 3C7UA 1CI8A 5BOHA 3HUMA 5DTTA 3LR3A 2J80A 3V67A 3VOYA 3ZG8B 4ZJ1A 2D02A 3CITA 2Y55A 2V0UA 2HDUA 4RQ9A 1Q2QA 2DMWA 4QU3A 1K55C 1I2SA 3ZNTA 1SZVA 2ZMFA 4WL9A 4CLCE 1KE4A 4P0MA 1TF1A 3ISGA 3UB9A 3W4QA 1JTDA 4NK3A 2ZQCA 1NYYA 3NY4A 1YMXA 5AQAA 1IYPA 2OWHA 1KDSA 2L4RA 5FDSA 4BENA 2PHYA 3LR4A 1FSYA 2OAP1 5TGFA 4EQIA 3P98A 3AGEA 1W79A 3FV7A 4OOLA 1N9NA 1F9IA 3A3EA 4GCZA 1TVFA 3MJQA 4OPQA 3T1SA 4C6YA 1E25A 1DY6A 4ME4A 5F69A 3G31A 5E43A 2W3GA 2WKPA 4S2OA 2XROA 2H5SA 1L2SA 4HHDA 3C4OA 3S7OA 3WS2A 1PFLA 2BLSA 2WZXA 3M6HA 3OC2A 3GMWA 5EM0A 2VA0A 1K57C 2XSSA 1OTIA 3OBFA 4ZBEA 2HV1A 3HUOA 1TDGA 5HAQA 2Y2NA 5CEDA 3BJNA 3SS3A 1YPRA 4HIAA 3WRZA 4N1HA 3ITAA 4P6ZM 1UGUA 4E3MA 1ERQA 4H8RA 3EQUA 2PR6A 4EUZA 1BULA 1KGFA 2P9VB 4KQQA 4AFIA 2P9VA 3LIDA 2ZMVA 4KZAA 3AGDA 1HTZA 3B3XA 5FSRA 1FIKA 1NXYA 3Q82A 2QMIA 2VGJA 2JKFA 2QWSA 3HLBA 4YINA 3IXHA 5I94A 1PIOA 1WA9A 2ZC5B 3EEAA 2Y4AA 3CWFA 2HJEA 3ZG0A 4S2LA 3MKEA 4QPRA 4CLCD 4EU0A 5DJUA 1EI5A 3KSHA 5FATA 2Y2JA 2HDQA 2GX5A
chains in the Genus database with same CATH topology
3LIEA 1GSVA 3W2ZA 4DN0A 4EEUA 1Y28A 2QJ7A 1DP9A 3RH8B 2W3FA 2K7SA 2H28A 2INWA 4WEJA 1F98A 3VE4A 4L9EA 2R78A 4DJ2A 5DKKA 1GSWA 2IA2A 4ZRRA 3RTYA 2P04A 3K3CA 4HNBA 3CAXA 4FSFA 5HWVA 2OOLA 5AJGA 1KOUA 3LIBA 3OOVA 1P9WA 5G4YA 5J7EA 3PXPA 1BYWA 4JGQA 5HDCA 3S7QA 2L1MA 2PYPA 2VX8A 4I3AA 5DFXA 3LI9A 3EWKA 3PBOA 3FC7A 4G3WA 4YNRA 3TJZC 3MR0A 4I5SA 4Q0JA 2JKTI 4NXGA 2GZAA 2JKRM 3LFVA 1NRJA 1OT6A 1OT9A 3ICYA 1ZTUA 4DMZA 3C2WA 3T4OA 4IJGA 3LR5A 1LSXA 2W0NA 1P9RA 3KSIA 3PHYA 3FPVA 3KO6A 3RFBA 4NXEA 5CX7A 2VLGA 3T4JA 1S4SA 5IU1A 3F1PB 5KSHA 2VZWA 3OLOA 3F1PA 4Q0IA 2O9CA 5DKLA 4WEKA 1IOUA 3NOTC 1NLYA 3T4TA 3MQOA 3HCYA 4CLCC 1DRMA 4I39A 3K3DA 3TW8A 3BY9A 3UMDA 1T1BA 3PBSA 1STZA 1XFQA 5F5YA 4UQIM 5HL6A 3MXQA 2K31A 3PYPA 3O5YA 3UMEA 2O0YA 1XJ4A 2KX6A 3SW1A 1P0ZA 2K2NA 3MQQA 3U2AA 4I3IA 2V9AA 4HH2A 4KUKA 1EW0A 4WELA 5HDDA 3JVVA 4FOFA 1S1ZA 4R6LA 1V9ZA 4I38A 4M4XA 1OJ5A 2CMNA 2A2LA 2V0WA 4EW7A 4HJ6A 5IS1A 4LRXC 1OJGA 2I9VA 2MJ6A 1G28A 3KSGA 2VV7A 4PKYG 4P6ZS 4BBUA 5TBMB 3P7NA 2W1RA 1OTBA 2XA7M 2PD7A 3H9WA 2VV8A 4KQDA 2YKHA 3EEHA 3CI6A 5HDSA 2ZOIA 2XRNA 4CQHA 4GW9A 2O9BA 1ZHHB 2QJ5A 4ARZB 4UQIS 4II7A 4ARZA 3GDIA 1XJ6A 2W3DA 4HOIA 2J3TC 1S66L 3TE8A 2QYBA 5C5KA 1YSQA 2VGLS 4LPZA 3VOLA 1YKDA 1ODVA 2ZBBA 3BQAA 4BBTA 2M1CA 3NJAA 2W27A 1W63M 3D3OA 3UB7A 2A24B 2A24A 4JGOA 1TS7A 3ULFA 4BMWA 4B9OA 2PT7A 3EGXC 1YAXA 3MMHA 4L0LA 2PR5A 3C30A 4O01A 3TRCA 3UB6A 4H6JB 4H6JA 3A0SA 2EWVA 2BASA 2W1TB 2W1TA 3GECA 4WF0A 1TD5A 2PDRA 3B33A 2M7VA 5DJTA 2Z6DA 1F5MA 5AVFA 3R7WB 1LL8A 3R7WA 3IS2B 3S7PA 2J3TD 1LT0A 3IS2A 3KX0X 3LIFA 3VE3A 3G6OA 1IFQA 4NXBA 4MMNA 5KIZA 5HSQA 5HD3A 1S1YA 2O9AA 4R3AA 3H7WB 1T1CA 3H7WA 3EGDC 1TS6A 2YKFA 5F68A 3KYQA 4Y5FA 5DF9A 3CUEA 4WN5A 3UE3A 1OTDA 4ETXA 2O99A 3D72A 5HD5A 3EOIA 3PBTA 1UWNX 4K08A 4EUVA 4GJ4A 3E4QA 3NOPC 1T18A 2HGVA 3IBJA 4ETZA 1MZUA 4HP4A 3BW6A 1OPXA 3PR6A 4E04A 3ZYTA 4EEPA 2ZOHA 4IUKA 2J3WA 4UEYA 4GS9B 3BY8A 1OTEA 4GS9A 4R70A 3S7NA 2B18A 4HQAA 1S67L 1X0OA 2L0WA 2OAQ1 4WLAA 1UWPX 1D7EA 2JKTM 2LB9A 3PBRA 4Y2FA 4F3LB 3CLOA 4F3LA 4G3KA 3UB8A 5HWWA 3OCNA 1XFNA 2P08A 3T4SA 3B47A 4GLQA 3E4OA 3LR3A 2LB5A 2J80A 3V67A 4EERA 4JGPA 4MN5A 3H82B 4O0PA 5J3WA 5K5BA 2B02A 3H82A 2D02A 3CITA 2V0UA 5LBRA 4EXOA 2PD8A 4RQ9A 1NWZA 2DMWA 2JKRI 1G6OA 4HH3A 1V9YA 3R4KA 2ZMFA 4WL9A 3OCLA 4CLCE 2V1BA 3A0RA 1TF1A 3UB9A 3E98A 3NOUC 2W3HA 4PAUA 2KLIA 4L9GA 2OWJA 3K2NA 2NUPC 5F6AA 2OWHA 4NXFA 3JVUA 1D06A 2HJ9C 2W3EA 3F1OB 4G3VA 2L4RA 3F1OA 4NEED 4CLCB 1NLZA 4CLCA 2PHYA 3LR4A 2OAP1 2QHKA 1S4RA 1LSWA 3T4LA 4Z1WA 4OOLA 1N9NA 2JN7A 5J4EA 1F9IA 4PHTA 1LSVA 2VJWA 4EQ1A 1VHMA 4GCZA 3MJQA 4IUHA 1P97A 3HJKA 4YOFA 5FL3A 4WUJA 4O8GA 4ME4A 5F69A 4Y3IA 2P7JA 4IHQA 1H3QA 2XA7S 2W3GA 2WKPA 2XROA 3PBQA 4DJ3A 4XT2B 2VV6A 4HHDA 4XT2A 5HPIA 3S7OA 5HPFA 1N9OA 3UE6A 3DBAA 1MKMA 1N9LA 4MDZA 3B42A 2EWWA 4OOMA 4HJ3A 3VV4A 4MN6A 3OC2A 5HWTA 1JNUA 5IT5A 4KUOA 1TS8A 4HP9A 2GNXA 3KYZA 4MN7A 2VA0A 3LR0A 3HJIA 2M7UA 2XSSA 1OTAA 1OTIA 3BQ8A 3OBFA 4NKPA 2HV1A 3T4QA 5L8MA 3LIAA 1XJ2A 3BWLA 3BJNA 2PYRA 4HIAA 2KDKA 3KSFA 4B93A 1YSPA 3EQVA 5TJJA 4P6ZM 3PBNA 2WKQA 1UGUA 4BBVA 3E4PA 2V1AA 3LYXA 5A8BA 1W63Q 1GSXA 2KOIA 4MCWA 3F1NB 4L9FA 4R38A 2VEAA 2QKPA 3EQUA 3F1NA 2PR6A 3LUQA 5MC7A 4AFIA 2NUTC 4KQOA 3LIDA 4BJPA 3LI8A 1H8MA 4GHIB 4PKYA 1XJ3A 4GHIA 3FPWA 2ZMVA 3C38A 3C8CA 2FH5A 5AVEA 4HJ4A 4Q0HA 1MC0A 2VGLM 3LICA 4HI4A 1T1AA 2EA9A 3T50A 2JHEA 2WKRA 3A0VA 2QWSA 1DP8A 4EESA 3E0YA 1DP6A 3P01A 2Y8HA 1T19A 4LRYC 4I3JA 4LRZE 2D01A 1WA9A 3IBRA 3MF0A 4BWIA 2FZ0A 1VB6A 2VKSA 2Y79A 3EEAA 3FG8A 4JGRA 3CWFA 5HZHA 2HJEA 4LLOB 3NHQA 2G7UA 3MFXA 5I5LA 3CUEC 2HF6A 5DFYA 1TS0A 5TBMA 3T4KA 4QPRA 4EETB 4CLCD 5G4ZA 4EU0A 5DJUA 2GJ3A 3MQ0A 3KSHA 5EFWA 3ZQ5A 2Z6CA 4YWZA 4HY8A 2GX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIE A;  1GSV A;  4EEU A;  1Y28 A;  2QJ7 A;  1DP9 A;  3RH8 B;  2K7S A;  2H28 A;  2INW A;  1F98 A;  3VE4 A;  4L9E A;  2R78 A;  4DJ2 A;  5DKK A;  1GSW A;  3RTY A;  3K3C A;  4HNB A;  3CAX A;  5HWV A;  2OOL A;  1KOU A;  3LIB A;  5G4Y A;  5J7E A;  1BYW A;  4JGQ A;  5HDC A;  2L1M A;  2PYP A;  4I3A A;  3LI9 A;  3EWK A;  3FC7 A;  3MR0 A;  4I5S A;  4NXG A;  1OT6 A;  1OT9 A;  3ICY A;  3C2W A;  1LSX A;  2W0N A;  3PHY A;  4NXE A;  2VLG A;  1S4S A;  5IU1 A;  3F1P B;  3OLO A;  3F1P A;  5DKL A;  3NOT C;  3MQO A;  1DRM A;  4I39 A;  3K3D A;  3UMD A;  3BY9 A;  1T1B A;  1XFQ A;  5F5Y A;  3MXQ A;  3PYP A;  3UME A;  1XJ4 A;  2KX6 A;  3SW1 A;  1P0Z A;  3MQQ A;  4I3I A;  2V9A A;  4HH2 A;  4KUK A;  1EW0 A;  5HDD A;  1S1Z A;  4R6L A;  1V9Z A;  4I38 A;  4M4X A;  1OJ5 A;  2CMN A;  2V0W A;  4EW7 A;  4HJ6 A;  5IS1 A;  4LRX C;  1OJG A;  2I9V A;  1G28 A;  2VV7 A;  4PKY G;  4BBU A;  5TBM B;  3P7N A;  1OTB A;  2PD7 A;  3H9W A;  2VV8 A;  4KQD A;  2YKH A;  3EEH A;  5HDS A;  2ZOI A;  4GW9 A;  2QJ5 A;  3GDI A;  1XJ6 A;  4HOI A;  1S66 L;  4LPZ A;  3VOL A;  1ODV A;  2ZBB A;  4BBT A;  2M1C A;  3NJA A;  2W27 A;  3UB7 A;  2A24 B;  2A24 A;  4JGO A;  1TS7 A;  3ULF A;  4B9O A;  2PR5 A;  3UB6 A;  4H6J B;  4H6J A;  3A0S A;  2BAS A;  3GEC A;  4WF0 A;  2PDR A;  3B33 A;  5DJT A;  2Z6D A;  5AVF A;  1LL8 A;  3IS2 B;  3KX0 X;  1LT0 A;  3IS2 A;  3LIF A;  3VE3 A;  5KIZ A;  3G6O A;  4NXB A;  5HSQ A;  5HD3 A;  1S1Y A;  4R3A A;  3H7W B;  1T1C A;  3H7W A;  1TS6 A;  2YKF A;  5F68 A;  4WN5 A;  1OTD A;  3D72 A;  5HD5 A;  1UWN X;  4K08 A;  3E4Q A;  3NOP C;  1T18 A;  1MZU A;  4HP4 A;  4E04 A;  4EEP A;  2ZOH A;  4GS9 B;  3BY8 A;  1OTE A;  4GS9 A;  4R70 A;  4HQA A;  1S67 L;  1X0O A;  2L0W A;  4WLA A;  1UWP X;  1D7E A;  4F3L B;  3CLO A;  4F3L A;  3UB8 A;  5HWW A;  1XFN A;  3E4O A;  2J80 A;  4EER A;  4JGP A;  4MN5 A;  3H82 B;  5J3W A;  2B02 A;  3H82 A;  2D02 A;  2V0U A;  4EXO A;  2PD8 A;  4RQ9 A;  1NWZ A;  4HH3 A;  1V9Y A;  4WL9 A;  2V1B A;  3A0R A;  3UB9 A;  3NOU C;  4L9G A;  2OWJ A;  5F6A A;  2OWH A;  4NXF A;  1D06 A;  3F1O B;  2L4R A;  3F1O A;  2PHY A;  2QHK A;  1S4R A;  1LSW A;  1N9N A;  2JN7 A;  5J4E A;  1F9I A;  1LSV A;  4EQ1 A;  4GCZ A;  3MJQ A;  1P97 A;  3HJK A;  4WUJ A;  5F69 A;  2P7J A;  2WKP A;  4DJ3 A;  4XT2 B;  2VV6 A;  4HHD A;  4XT2 A;  1N9O A;  3UE6 A;  1N9L A;  4HJ3 A;  4MN6 A;  5HWT A;  1JNU A;  4KUO A;  1TS8 A;  4HP9 A;  3HJI A;  1OTA A;  1OTI A;  2HV1 A;  3LIA A;  1XJ2 A;  3BWL A;  2PYR A;  4HIA A;  2KDK A;  2WKQ A;  1UGU A;  4BBV A;  3E4P A;  2V1A A;  3LYX A;  5A8B A;  1GSX A;  3F1N B;  4L9F A;  4R38 A;  2VEA A;  2QKP A;  2PR6 A;  3F1N A;  3LUQ A;  3LID A;  3LI8 A;  4PKY A;  4GHI B;  1XJ3 A;  4GHI A;  3C8C A;  5AVE A;  4HJ4 A;  3LIC A;  4HI4 A;  1T1A A;  2EA9 A;  3T50 A;  2JHE A;  2WKR A;  3A0V A;  2QWS A;  1DP8 A;  4EES A;  1DP6 A;  1T19 A;  4LRY C;  4I3J A;  4LRZ E;  2D01 A;  1WA9 A;  3IBR A;  1VB6 A;  3FG8 A;  4JGR A;  3CWF A;  5HZH A;  4LLO B;  3NHQ A;  3MFX A;  5I5L A;  5TBM A;  1TS0 A;  4EET B;  5G4Z A;  5DJU A;  2GJ3 A;  5EFW A;  3ZQ5 A;  2Z6C A;  4YWZ A;  4HY8 A; 
#chains in the Genus database with same CATH topology
 3LIE A;  5L09 A;  1HZO A;  4EEU A;  1Y28 A;  1DP9 A;  1RGZ A;  3HLF A;  2JCH A;  2H28 A;  4E3L A;  1G5U A;  4WEJ A;  4HBT A;  3BM6 A;  2R78 A;  4DJ2 A;  3WRT A;  5DKK A;  2IA2 A;  4ZRR A;  4OQG A;  5EVI B;  3RTY A;  5EVI A;  4HNB A;  3VOZ A;  1JTG A;  2B95 A;  5GHZ A;  2OOL A;  4WM9 A;  1YLJ A;  5AJG A;  5TR7 A;  2JC7 A;  2BG1 A;  1BTL A;  3OZH A;  2VX8 A;  4FTX A;  3LI9 A;  4G3W A;  4KZ7 A;  3MR0 A;  3O88 A;  3CG5 A;  1KVL A;  4R3J A;  1OT6 A;  1PZP A;  3T4O A;  2ACG A;  1LSX A;  3LR5 A;  3PHY A;  2X71 A;  5CX7 A;  3G32 A;  5IU1 A;  1K55 A;  4R23 A;  4B88 A;  5KSH A;  1J3W A;  3W4O A;  2R9W A;  4I39 A;  3TW8 A;  1STZ A;  2OLV A;  5F5Y A;  4UQI M;  5FAS A;  1BLS A;  1N4O A;  5HAP A;  1XJ4 A;  3LY3 A;  3MXS A;  2K2N A;  3SZT A;  4I3I A;  3C5A A;  5DF7 A;  4PM7 A;  4LV0 A;  5HDD A;  4R6L A;  5FI7 A;  1PWD A;  4M4X A;  3NC8 A;  1MXO A;  2CMN A;  2A2L A;  4DKI A;  3HRE A;  2XR0 A;  2Y2O A;  4ZJ3 A;  3VP3 A;  2VV7 A;  3D9Y A;  3S1Y A;  4PKY G;  1XGI A;  3QNC A;  1OTB A;  5GLD A;  2PD7 A;  4WBG A;  2VV8 A;  3VFH A;  4JKT A;  5HFO A;  3NUL A;  2QJ5 A;  1XJ6 A;  2ZQ8 A;  5DF8 A;  2J3T C;  1ES4 A;  3S4X A;  1YSQ A;  4LPZ A;  4NET A;  1ODV A;  2ZBB A;  2HPB A;  4N9K A;  3NJA A;  3D3O A;  4KZ3 A;  1NYM A;  2A24 B;  1O07 A;  4B4Z A;  2A24 A;  1TS7 A;  3ULF A;  2ZC7 A;  3MMH A;  4L0L A;  2PBD P;  3IF6 B;  4H6J B;  4EBL A;  3DW0 A;  3IF6 A;  3LEZ A;  3A0S A;  3BYD A;  4H6J A;  2BAS A;  4FUW A;  1FCN A;  3GEC A;  2Q0O A;  3T1Q B;  4JXW A;  1E3U D;  1KE3 A;  3B33 A;  3HLW A;  5DJT A;  5F1F A;  2Z6D A;  3FKW A;  2ZM2 A;  2EXB A;  4OQI A;  2J3T D;  3KX0 X;  3VE3 A;  5KIZ A;  4PM8 A;  5HD3 A;  3VP4 A;  5KMW A;  3BFD A;  1SDN A;  3W8K A;  1XA1 A;  5F68 A;  3KYQ A;  1NJ4 A;  1ERM A;  4WN5 A;  1Z6F A;  1OTD A;  4GKU A;  4ETX A;  2Q9M A;  3PBT A;  3L7H A;  4OP5 A;  3DWZ A;  5KSC A;  3E4Q A;  4E3O A;  2JE5 A;  3C4P A;  5GLB A;  1OPX A;  3PR6 A;  4S2P A;  4E04 A;  4IVK A;  3M6B A;  1IEL A;  1LI9 A;  1YLT A;  3VP2 A;  5FQ9 A;  3DTE A;  4S2K A;  3BY8 A;  2B18 A;  1S67 L;  1SDE A;  3M2J A;  1KVM A;  4WLA A;  3NCK A;  4U0X A;  4JXV A;  2FFY A;  5HL1 A;  4G3K A;  1D1J A;  2XEP A;  3ZFZ A;  2VGK A;  2LB5 A;  5GHX A;  4JGP A;  5K5B A;  5DTK A;  4KQR A;  1NWZ A;  3VP1 A;  3LY4 A;  3WS5 A;  4JF5 A;  3OCL A;  2V1B A;  4OLG A;  4R4R A;  1QMF A;  2V8C A;  4PAU A;  2KLI A;  2OWJ A;  4Y0T A;  3K2N A;  2NUP C;  5F6A A;  4NXF A;  2HJ9 C;  1D06 A;  2W3E A;  1BLC A;  4OOY A;  1F2K A;  1GCE A;  3UDI A;  4UA7 A;  4Z1W A;  5TFQ A;  1Z09 A;  2JN7 A;  3IH9 A;  4KG2 A;  5J4E A;  2PU2 A;  4PHT A;  4LCM A;  5L10 A;  1LSV A;  1VHM A;  4S2I A;  1H8Z A;  3HJK A;  4YOF A;  5E2E A;  1MWT A;  2EX6 A;  4O8G A;  3A3D A;  4Y3I A;  1ZG4 A;  3PBQ A;  1BT5 A;  4XT2 B;  5EVE A;  4XT2 A;  5HPI A;  5HPF A;  3UE6 A;  2ZQ7 A;  5IHV A;  3VP0 A;  1MKM A;  3UDF A;  1ESI A;  2EWW A;  5U47 A;  4HJ3 A;  4D2O A;  3NDG A;  4MN6 A;  5IT5 A;  1N9B A;  2GNX A;  3LR0 A;  2M7U A;  3N4I A;  1XXM A;  3HVF A;  3VMA A;  3T4Q A;  3UY6 A;  4QD4 A;  5JYP A;  3HL9 A;  2UV0 E;  3IXD A;  3KSF A;  3EQV A;  3JYI A;  1IYO A;  2Z2M B;  2WKQ A;  3LYX A;  5A8B A;  1ERO A;  5CEC A;  5E2H A;  4R38 A;  3DTM A;  3LUQ A;  5MC7 A;  4BJP A;  2XH9 A;  2IWC A;  5HX9 A;  1ES2 A;  3C38 A;  2FH5 A;  5AVE A;  4Q0H A;  1MC0 A;  4HI4 A;  4GOG A;  3N7W A;  5EUA A;  2EA9 A;  4S2N C;  2R9X A;  3QP8 A;  5FAQ A;  1MPL A;  3E0Y A;  1DP6 A;  3P01 A;  3T1R A;  4LRY C;  5HAR A;  4PM6 A;  4XUX A;  4LRZ E;  4LV1 A;  3IBR A;  1SCW A;  2VKS A;  2RCX A;  2Y79 A;  3FG8 A;  3GSG A;  5AQ7 A;  1MWU A;  4LLO B;  5FQI A;  3L9K A;  2G7U A;  4E6X A;  1GHP A;  1YLZ A;  5TBM A;  3T4K A;  3FKV A;  4EET B;  1GHM A;  2GJ3 A;  3E2L A;  1PWG A;  4ZJ2 A;  2A3U A;  2QJ7 A;  1BLH A;  3RH8 B;  1YM1 A;  1JWP A;  3MZD A;  1F98 A;  2X02 A;  4OPR A;  1KOU A;  3OOV A;  1KGE A;  1P9W A;  5G4Y A;  1RCJ A;  3PXP A;  4JXG A;  2G2U A;  3O87 A;  2EFX A;  3KYE A;  2L1M A;  2PYP A;  5JYO A;  4I3A A;  5DFX A;  1H8Y A;  1JWV A;  4YNR A;  1K6R A;  3HBR A;  4RX3 A;  4DE0 A;  4NXG A;  2JKR M;  3LFV A;  3V50 A;  3C2W A;  4MNR A;  2W0N A;  2ZQ9 A;  5FI2 A;  3FPV A;  4EBP A;  3T4J A;  2WKH A;  4HES A;  2XD5 A;  2Y91 A;  3F1P B;  2VZW A;  3OLO A;  3F1P A;  2PRF A;  2O9C A;  2WGW B;  2WGW A;  3NOT C;  1NLY A;  2WYX A;  3T4T A;  4CLC C;  3ZHH A;  3BFG A;  3PBS A;  3N8R A;  5M18 A;  1XFQ A;  5HL6 A;  2K31 A;  3O5Y A;  3IHA A;  2HP6 A;  3PTE A;  3E2K A;  3UME A;  4E3J A;  3G34 A;  1HVB A;  4HH2 A;  4KUK A;  3D4F A;  2XGN A;  3GQZ A;  4WEL A;  4D60 A;  4R3B A;  2ZM8 A;  1WYB A;  1CEF A;  1K54 C;  5IS1 A;  4FCF A;  4LRX C;  1M6K A;  5EV0 A;  1XP4 A;  2MJ6 A;  1G28 A;  2ZC6 B;  5A93 A;  3MSH A;  2C5W B;  2XF3 A;  4P87 A;  5EOE A;  3V3S A;  3P7N A;  4EV4 A;  4WZ5 C;  3H9W A;  2Y2P A;  2YKH A;  4BD0 A;  5HDS A;  2XRN A;  5EVL A;  4CQH A;  1ZHH B;  3TG9 A;  2P74 A;  4RVA A;  1EWZ A;  2W3D A;  4HOI A;  1W7F A;  4LV2 A;  3TE8 A;  1SKO B;  4DDY A;  2VGL S;  1SKO A;  3O3V A;  3VOL A;  4EBN A;  4XUZ A;  1FOF A;  4BBT A;  4K91 A;  3LCE A;  1ACF A;  2M1C A;  4OQH A;  4EWF A;  3DTK A;  1W63 M;  2B5R A;  1LLB A;  4JGO A;  4F94 A;  1HD8 A;  3T12 B;  4O01 A;  1PI5 A;  3TRC A;  1WYC A;  4DE2 A;  1PNE A;  1Q2P A;  1ZKJ A;  2HDR A;  3DWK A;  1FQG A;  3MKF A;  3SS4 A;  4LCL A;  3BFC A;  2OSU A;  4WF0 A;  1TD5 A;  1XA7 A;  3SH7 A;  1YLP A;  4S2N A;  5FAP A;  4JPM A;  5FQM A;  2VK3 A;  1LI0 A;  4GZB A;  1GA0 A;  5CTM A;  1F5M A;  1PYY A;  3GV9 A;  1DJC A;  2ZC4 B;  3IS2 B;  5KZH A;  2WGI A;  1LT0 A;  3IS2 A;  4NXB A;  1IFQ A;  4MMN A;  1MY8 A;  2ZMA A;  3H7W B;  3H7W A;  3EGD C;  5L07 A;  1K6S A;  4ESP A;  2WUQ A;  3UE3 A;  1KE0 A;  4CPK A;  3LGO A;  1ZC2 A;  1K56 D;  1S0W A;  2RL3 A;  5HD5 A;  3QP1 A;  3WS1 A;  1UWN X;  4K08 A;  1DJA A;  3Q07 A;  4GB7 A;  3IBJ A;  2V2F F;  2EXA A;  2XQZ A;  2Y2Q A;  4N92 A;  1PW1 A;  3ZYT A;  4OPZ A;  3UPP A;  4E3K A;  4EEP A;  4LFU A;  3BLS A;  4IUK A;  4GS9 B;  4DE3 A;  4PPR A;  4GS9 A;  4HQA A;  1YMS A;  4C75 A;  2LB9 A;  2EFU A;  3V3R A;  5HWW A;  3HLC A;  1VQQ A;  3OCN A;  2Y2G A;  3GTC A;  4GLQ A;  5AQB A;  2EX8 A;  3E4O A;  4EER A;  4IBX A;  3H82 B;  4O0P A;  5J3W A;  1CF0 A;  2Y59 A;  3H82 A;  1K57 A;  4XXR A;  4Q8I A;  2PD8 A;  5EEC A;  2JKR I;  3G4P A;  1G6O A;  4HH3 A;  1V9Y A;  3R4K A;  4X53 A;  3A0R A;  1YLW A;  4X1L A;  4Y15 A;  5FQJ A;  3NI9 A;  4MBK A;  4WMC D;  3NIA A;  5EE8 A;  3SOI A;  4GN2 A;  3JVU A;  2XDM A;  3Q7V B;  2AVX A;  4CLC B;  1NLZ A;  3Q7V A;  4CLC A;  2QHK A;  4P85 A;  1CQA A;  4B4X A;  4KZ5 A;  4QJG A;  1LL9 A;  1MKI A;  5FA7 A;  3ZCZ A;  2VJW A;  4KZB A;  5FEF A;  4WUJ A;  3G30 A;  2P7J A;  4IHQ A;  1H3Q A;  1K4F A;  2XA7 S;  1IKI A;  4QHC A;  2VV6 A;  1CI9 A;  2XD1 A;  4X6T A;  1N9O A;  3DBA A;  3ZG7 B;  1AXB A;  1N9L A;  3C7V A;  3B42 A;  3VV4 A;  2ZJ9 A;  4JF6 A;  1TS8 A;  4UA6 A;  3KYZ A;  1ES3 A;  1FCO A;  4BQM A;  3BQ8 A;  3W4P A;  4WZ5 A;  4NKP A;  3LIA A;  1XJ2 A;  3VSL A;  2PYR A;  3IX4 A;  4HBU A;  4B93 A;  4KZ6 A;  2GDN A;  1NZU A;  1VET B;  4BBV A;  1VET A;  2V1A A;  4Y0O A;  1W63 Q;  2KOI A;  3BEB A;  3F1N B;  4QB8 A;  2QKP A;  3F1N A;  2NUT C;  4KQO A;  4QY5 A;  1H8M A;  1XJ3 A;  2H10 A;  4OLD A;  2WAF A;  5M19 A;  3WWX A;  4HJ4 A;  2X01 A;  2VGL M;  3LIC A;  1Y4O A;  4GD8 A;  3UE1 A;  2JHE A;  3UDX A;  2WKR A;  3A0V A;  1XGJ A;  1DP8 A;  4EES A;  3QNB A;  3PAE A;  3MF0 A;  4BWI A;  2FZ0 A;  4Y7P A;  1VB6 A;  2A49 A;  5HZH A;  1NY0 A;  1FSW A;  1PW8 A;  3QHY A;  3VSK A;  1K38 A;  2Y2H A;  3WS4 A;  4ZTK A;  3MFX A;  1E4D A;  3CUE C;  5DFY A;  5CHU A;  1JWZ A;  3MQ0 A;  5EFW A;  1PWC A;  2J9P A;  1MBL A;  3Q81 A;  5FEG A;  3OPP A;  1YQS A;  2XFT A;  5CHJ A;  2J8Y A;  3ZG5 A;  5FAO A;  2W3F A;  2K7S A;  1AWI A;  3VE4 A;  4E3N A;  1RGY A;  3CAX A;  4PM5 A;  2OV5 A;  5J7E A;  3UE0 A;  4X68 A;  1A0K A;  3CMZ A;  2EX9 A;  2XK1 A;  1K0K A;  4S2J A;  3ZVW A;  3EWK A;  3FC7 A;  2V1Z A;  1CEG A;  3TJZ C;  3IXG A;  4Y13 A;  2WAE A;  3IT9 A;  2GZA A;  1OT9 A;  2DNS A;  4KZ4 A;  4GD6 A;  3ICY A;  4DMZ A;  2V20 A;  5AQ9 A;  1E3U A;  1P9R A;  3KSI A;  3KO6 A;  3RFB A;  3IH8 A;  3LEQ A;  2VLG A;  1OME A;  4Q0I A;  5DKL A;  1IOU A;  2WZZ A;  4MEZ A;  3LO7 A;  3UMD A;  2WKI A;  1T1B A;  1IKG A;  3TSG A;  5FQQ A;  3O86 A;  3IQA A;  3IF5 A;  3MS6 A;  3MXQ A;  3PYP A;  5FI6 A;  4U3T A;  3UN7 A;  1GA9 A;  3V39 A;  1VM1 A;  2V9A A;  4FH4 A;  1EW0 A;  4FOF A;  4I38 A;  3OPL A;  1XPB A;  1BLP A;  3ITB A;  1L0F A;  3MZE A;  2HP5 A;  4UA9 A;  1H5X A;  2WKE A;  2I9V A;  4C3Q A;  1J9M A;  3WS0 A;  1VEU B;  5TBM B;  1VEU A;  2XA7 M;  2H0Y A;  5A91 A;  4UAA A;  4IED A;  3EEH A;  3CI6 A;  3MXR A;  3RXW A;  4QWO A;  1I2W A;  1ES5 A;  1O7E A;  4JF4 A;  4GW9 A;  2O9B A;  4ARZ B;  4UQI S;  4ARZ A;  3GDI A;  4RX2 A;  1S66 L;  1JVJ A;  5EVI D;  1L3L A;  2QYB A;  5C5K A;  3GR2 A;  1Y54 A;  4UHU A;  5CER A;  3BQA A;  4OPY A;  2DCF A;  4ID4 A;  1ALQ A;  4N9L A;  3UB7 A;  3CHW P;  5CGS A;  2I72 A;  3T1X A;  2WGV A;  1YAX A;  1G6A A;  5CEB A;  3C30 A;  3UB6 A;  3ZG9 B;  2Z2L B;  4P6B A;  1IEM A;  4IBR A;  2PDR A;  4FH2 A;  2M7V A;  1ZG6 A;  4IVI A;  4OH0 A;  5CGX A;  5AVF A;  4Z9Q A;  3R7W B;  1LL8 A;  3R7W A;  3S7P A;  3BFE A;  1HLU P;  5A90 A;  5DTS A;  5HSQ A;  1S1Y A;  4R3A A;  1T1C A;  2YKF A;  4Y5F A;  3QP6 A;  3CUE A;  4ZDX A;  3D72 A;  4WZ4 A;  3HLE A;  2DRW A;  4GJ4 A;  1T18 A;  2HGV A;  4OQ0 A;  1MZU A;  4HP4 A;  4DRT A;  3BW6 A;  4X1M A;  3SS5 A;  4A5R A;  1G68 A;  1M40 A;  2J3W A;  4R0Q A;  4UEY A;  3UNW A;  2FFF B;  5CTN A;  3MFD A;  3A3I A;  3IF6 C;  1D7E A;  2JKT M;  4R1G A;  4QY6 A;  3PBR A;  1LHY A;  3CLO A;  4LV3 A;  2E8I A;  4DDS A;  3G2Y A;  3T4S A;  3B47 A;  5E2G A;  4MN5 A;  3UPN A;  3AGF A;  4DXB A;  2B02 A;  2ZC3 B;  4JXS A;  5LBR A;  4EXO A;  1C3B A;  3MZF A;  2JKG A;  2HDS A;  3E98 A;  3Q7Z A;  3NOU C;  4KZ9 A;  2W3H A;  4L9G A;  3UB5 P;  4G3V A;  4GDN A;  3F1O B;  3F1O A;  4DF6 A;  4NEE D;  1PRQ A;  3MBZ A;  1W8Y A;  1NRF A;  3M2K A;  1S4R A;  1LSW A;  3T4L A;  1KDW A;  1YT4 A;  3IX8 A;  4EQ1 A;  3IXB A;  1QME A;  4YFM A;  4IUH A;  1P97 A;  5FL3 A;  1L0G A;  1GHI A;  1L0E A;  2IWB A;  4BL2 A;  4DJ3 A;  4BLM A;  4O7D A;  4OVD A;  2Y2I A;  5CRF A;  3OPH A;  3UO9 A;  4MDZ A;  4OOM A;  2PU4 A;  4KG6 A;  3U4L P;  5HWT A;  1JNU A;  4KUO A;  1KGG A;  3CZD A;  4MN7 A;  4HP9 A;  2V8F A;  3HJI A;  1OTA A;  3G35 A;  2WK0 A;  1SKF A;  2J7V A;  5L8M A;  2Y2L A;  1BZA A;  3BWL A;  3N6I A;  5GLC A;  1MWS A;  2KDK A;  2CC1 A;  1YSP A;  3GRJ A;  5TJJ A;  4MLL A;  1W5D A;  3PBN A;  5D3O A;  3OPR A;  3E4P A;  4JLF A;  1GSX A;  4MCW A;  4L9F A;  2VEA A;  1TDL A;  2XLN A;  3LI8 A;  4PKY A;  4GHI B;  4GHI A;  3FPW A;  4NG2 A;  1DJB A;  3CPT B;  3CJM A;  3C8C A;  3CPT A;  1RP5 A;  1T1A A;  4LGW A;  2ZLY A;  3T50 A;  4R4S A;  2HP9 A;  2PBY A;  2Q9N A;  3SH8 A;  3IHB A;  2Y8H A;  1FIL A;  1T19 A;  5EOO A;  4I3J A;  2D01 A;  2PAV P;  2ZQD A;  2QPN A;  4E6W A;  3NEC A;  3JPU A;  3RJU A;  3BEC A;  4JGR A;  1K25 A;  5F1G A;  3NHQ A;  2XFS A;  1NZO A;  5I5L A;  2HF6 A;  1TS0 A;  5J8X A;  5G4Z A;  4RA7 A;  3ZQ5 A;  2Z6C A;  4YWZ A;  4HY8 A;  1GSV A;  4OON A;  5CHM A;  3W2Z A;  4DN0 A;  3A3J A;  3VFF A;  3IX3 A;  1CK3 A;  5GL9 A;  3Q1F A;  2INW A;  4CJN A;  3QP4 A;  4L9E A;  1L0D A;  1GSW A;  2E8J A;  4N1X A;  2P04 A;  3K3C A;  2J9O A;  3TOI A;  4FSF A;  5HWV A;  2HZ5 A;  4E3I A;  3LIB A;  1BYW A;  4JGQ A;  5HDC A;  3S7Q A;  1K54 A;  5GHY A;  5CGW A;  3PBO A;  5EM1 A;  3QP2 A;  4I5S A;  4Q0J A;  4BL3 A;  1W8Q A;  1ONG A;  1WE4 A;  2JKT I;  1ESU A;  1NRJ A;  3UPO A;  1ZTU A;  4IJG A;  5CXW A;  1FR6 A;  5L2F A;  4NXE A;  5F83 A;  3ZDJ A;  3G2Z A;  4Y0U A;  1S4S A;  3SH9 A;  4S2M A;  1SHV A;  4FD8 A;  4WEK A;  4DE1 A;  3ZVT A;  5A92 A;  3MQO A;  3HCY A;  1DRM A;  3K3D A;  3BY9 A;  2Y2M A;  4K0X A;  2UWX A;  5DVA A;  1ONH A;  1I5Q A;  1CJF A;  1K56 A;  1TEM A;  3GVB A;  3FYZ A;  4ZAM A;  5HW3 A;  2JBF A;  2O0Y A;  2KX6 A;  3SW1 A;  1P0Z A;  3MQQ A;  3U2A A;  3BLM A;  3FWL A;  4OP8 A;  4KZ8 A;  3JVV A;  1S1Z A;  4X55 A;  3A3F A;  1H0M A;  1V9Z A;  4PMA A;  1OJ5 A;  2V0W A;  4EW7 A;  4HJ6 A;  1LL5 A;  4JBF A;  4LEN A;  1OJG A;  2ZD8 A;  4PM9 A;  3BFF A;  3KSG A;  4RYE A;  3NDE A;  4P6Z S;  4BBU A;  2W1R A;  4BD1 A;  2Y2K A;  4KQD A;  3DTI A;  2ZOI A;  4KEN B;  4II7 A;  1S6R A;  4GNU A;  2G2W A;  2EX2 A;  4MBH A;  3ZNY A;  1YKD A;  2ZM0 A;  5FDH A;  2BTF P;  4X69 A;  3DAV A;  2W27 A;  4U0T A;  2ZQA A;  4Y17 A;  4WMC A;  4K0W A;  1IYQ A;  4BMW A;  4B9O A;  2PT7 A;  5F82 A;  3EGX C;  3HLG A;  2PR5 A;  4GDB A;  3P09 A;  2EWV A;  2WAD A;  1MWR A;  2W1T B;  5EPH A;  2W1T A;  2ZL1 B;  2ZL1 A;  3BRM A;  2IWD A;  5GLA A;  5E2F A;  4DXC A;  5G18 A;  3LIF A;  3HUN A;  4MBF A;  3G6O A;  1K4E A;  2O9A A;  3I7J A;  1BUE A;  2QZ6 A;  1TS6 A;  1PZO A;  3IWI A;  2OLU A;  5DF9 A;  3PAG A;  1YLY A;  3HLD A;  2O99 A;  4WYY A;  3EOI A;  1U60 A;  3N8L A;  4X25 A;  3FZC A;  4EUV A;  1FCM A;  3NOP C;  4M3K A;  5EVI C;  4ETZ A;  4KG5 A;  1BSG A;  2H0T A;  2ZOH A;  1FR1 A;  4HEF A;  5FQK A;  3V5M A;  2C6W B;  3IWQ A;  3QP5 A;  4X56 A;  3RXX A;  1OTE A;  1XX2 A;  4R70 A;  3S7N A;  1X0O A;  2L0W A;  2OAQ 1;  5M1A A;  1IYS A;  3ZGA B;  1UWP X;  3S22 A;  1PI4 A;  4OKP A;  4F3L B;  4Y2F A;  3N8S A;  4F3L A;  1XKZ A;  3NBL A;  3IWO A;  3UB8 A;  1XFN A;  2P08 A;  5HAI A;  3C7U A;  1CI8 A;  5BOH A;  3HUM A;  5DTT A;  3LR3 A;  2J80 A;  3V67 A;  3VOY A;  3ZG8 B;  4ZJ1 A;  2D02 A;  3CIT A;  2Y55 A;  2V0U A;  2HDU A;  4RQ9 A;  1Q2Q A;  2DMW A;  4QU3 A;  1K55 C;  1I2S A;  3ZNT A;  1SZV A;  2ZMF A;  4WL9 A;  4CLC E;  1KE4 A;  4P0M A;  1TF1 A;  3ISG A;  3UB9 A;  3W4Q A;  1JTD A;  4NK3 A;  2ZQC A;  1NYY A;  3NY4 A;  1YMX A;  5AQA A;  1IYP A;  2OWH A;  1KDS A;  2L4R A;  5FDS A;  4BEN A;  2PHY A;  3LR4 A;  1FSY A;  2OAP 1;  5TGF A;  4EQI A;  3P98 A;  3AGE A;  1W79 A;  3FV7 A;  4OOL A;  1N9N A;  1F9I A;  3A3E A;  4GCZ A;  1TVF A;  3MJQ A;  4OPQ A;  3T1S A;  4C6Y A;  1E25 A;  1DY6 A;  4ME4 A;  5F69 A;  3G31 A;  5E43 A;  2W3G A;  2WKP A;  4S2O A;  2XRO A;  2H5S A;  1L2S A;  4HHD A;  3C4O A;  3S7O A;  3WS2 A;  1PFL A;  2BLS A;  2WZX A;  3M6H A;  3OC2 A;  3GMW A;  5EM0 A;  2VA0 A;  1K57 C;  2XSS A;  1OTI A;  3OBF A;  4ZBE A;  2HV1 A;  3HUO A;  1TDG A;  5HAQ A;  2Y2N A;  5CED A;  3BJN A;  3SS3 A;  1YPR A;  4HIA A;  3WRZ A;  4N1H A;  3ITA A;  4P6Z M;  1UGU A;  4E3M A;  1ERQ A;  4H8R A;  3EQU A;  2PR6 A;  4EUZ A;  1BUL A;  1KGF A;  2P9V B;  4KQQ A;  4AFI A;  2P9V A;  3LID A;  2ZMV A;  4KZA A;  3AGD A;  1HTZ A;  3B3X A;  5FSR A;  1FIK A;  1NXY A;  3Q82 A;  2QMI A;  2VGJ A;  2JKF A;  2QWS A;  3HLB A;  4YIN A;  3IXH A;  5I94 A;  1PIO A;  1WA9 A;  2ZC5 B;  3EEA A;  2Y4A A;  3CWF A;  2HJE A;  3ZG0 A;  4S2L A;  3MKE A;  4QPR A;  4CLC D;  4EU0 A;  5DJU A;  1EI5 A;  3KSH A;  5FAT A;  2Y2J A;  2HDQ A;  2GX5 A; 
#chains in the Genus database with same CATH homology
 3LIE A;  1GSV A;  3W2Z A;  4DN0 A;  4EEU A;  1Y28 A;  2QJ7 A;  1DP9 A;  3RH8 B;  2W3F A;  2K7S A;  2H28 A;  2INW A;  4WEJ A;  1F98 A;  3VE4 A;  4L9E A;  2R78 A;  4DJ2 A;  5DKK A;  1GSW A;  2IA2 A;  4ZRR A;  3RTY A;  2P04 A;  3K3C A;  4HNB A;  3CAX A;  4FSF A;  5HWV A;  2OOL A;  5AJG A;  1KOU A;  3LIB A;  3OOV A;  1P9W A;  5G4Y A;  5J7E A;  3PXP A;  1BYW A;  4JGQ A;  5HDC A;  3S7Q A;  2L1M A;  2PYP A;  2VX8 A;  4I3A A;  5DFX A;  3LI9 A;  3EWK A;  3PBO A;  3FC7 A;  4G3W A;  4YNR A;  3TJZ C;  3MR0 A;  4I5S A;  4Q0J A;  2JKT I;  4NXG A;  2GZA A;  2JKR M;  3LFV A;  1NRJ A;  1OT6 A;  1OT9 A;  3ICY A;  1ZTU A;  4DMZ A;  3C2W A;  3T4O A;  4IJG A;  3LR5 A;  1LSX A;  2W0N A;  1P9R A;  3KSI A;  3PHY A;  3FPV A;  3KO6 A;  3RFB A;  4NXE A;  5CX7 A;  2VLG A;  3T4J A;  1S4S A;  5IU1 A;  3F1P B;  5KSH A;  2VZW A;  3OLO A;  3F1P A;  4Q0I A;  2O9C A;  5DKL A;  4WEK A;  1IOU A;  3NOT C;  1NLY A;  3T4T A;  3MQO A;  3HCY A;  4CLC C;  1DRM A;  4I39 A;  3K3D A;  3TW8 A;  3BY9 A;  3UMD A;  1T1B A;  3PBS A;  1STZ A;  1XFQ A;  5F5Y A;  4UQI M;  5HL6 A;  3MXQ A;  2K31 A;  3PYP A;  3O5Y A;  3UME A;  2O0Y A;  1XJ4 A;  2KX6 A;  3SW1 A;  1P0Z A;  2K2N A;  3MQQ A;  3U2A A;  4I3I A;  2V9A A;  4HH2 A;  4KUK A;  1EW0 A;  4WEL A;  5HDD A;  3JVV A;  4FOF A;  1S1Z A;  4R6L A;  1V9Z A;  4I38 A;  4M4X A;  1OJ5 A;  2CMN A;  2A2L A;  2V0W A;  4EW7 A;  4HJ6 A;  5IS1 A;  4LRX C;  1OJG A;  2I9V A;  2MJ6 A;  1G28 A;  3KSG A;  2VV7 A;  4PKY G;  4P6Z S;  4BBU A;  5TBM B;  3P7N A;  2W1R A;  1OTB A;  2XA7 M;  2PD7 A;  3H9W A;  2VV8 A;  4KQD A;  2YKH A;  3EEH A;  3CI6 A;  5HDS A;  2ZOI A;  2XRN A;  4CQH A;  4GW9 A;  2O9B A;  1ZHH B;  2QJ5 A;  4ARZ B;  4UQI S;  4II7 A;  4ARZ A;  3GDI A;  1XJ6 A;  2W3D A;  4HOI A;  2J3T C;  1S66 L;  3TE8 A;  2QYB A;  5C5K A;  1YSQ A;  2VGL S;  4LPZ A;  3VOL A;  1YKD A;  1ODV A;  2ZBB A;  3BQA A;  4BBT A;  2M1C A;  3NJA A;  2W27 A;  1W63 M;  3D3O A;  3UB7 A;  2A24 B;  2A24 A;  4JGO A;  1TS7 A;  3ULF A;  4BMW A;  4B9O A;  2PT7 A;  3EGX C;  1YAX A;  3MMH A;  4L0L A;  2PR5 A;  3C30 A;  4O01 A;  3TRC A;  3UB6 A;  4H6J B;  4H6J A;  3A0S A;  2EWV A;  2BAS A;  2W1T B;  2W1T A;  3GEC A;  4WF0 A;  1TD5 A;  2PDR A;  3B33 A;  2M7V A;  5DJT A;  2Z6D A;  1F5M A;  5AVF A;  3R7W B;  1LL8 A;  3R7W A;  3IS2 B;  3S7P A;  2J3T D;  1LT0 A;  3IS2 A;  3KX0 X;  3LIF A;  3VE3 A;  3G6O A;  1IFQ A;  4NXB A;  4MMN A;  5KIZ A;  5HSQ A;  5HD3 A;  1S1Y A;  2O9A A;  4R3A A;  3H7W B;  1T1C A;  3H7W A;  3EGD C;  1TS6 A;  2YKF A;  5F68 A;  3KYQ A;  4Y5F A;  5DF9 A;  3CUE A;  4WN5 A;  3UE3 A;  1OTD A;  4ETX A;  2O99 A;  3D72 A;  5HD5 A;  3EOI A;  3PBT A;  1UWN X;  4K08 A;  4EUV A;  4GJ4 A;  3E4Q A;  3NOP C;  1T18 A;  2HGV A;  3IBJ A;  4ETZ A;  1MZU A;  4HP4 A;  3BW6 A;  1OPX A;  3PR6 A;  4E04 A;  3ZYT A;  4EEP A;  2ZOH A;  4IUK A;  2J3W A;  4UEY A;  4GS9 B;  3BY8 A;  1OTE A;  4GS9 A;  4R70 A;  3S7N A;  2B18 A;  4HQA A;  1S67 L;  1X0O A;  2L0W A;  2OAQ 1;  4WLA A;  1UWP X;  1D7E A;  2JKT M;  2LB9 A;  3PBR A;  4Y2F A;  4F3L B;  3CLO A;  4F3L A;  4G3K A;  3UB8 A;  5HWW A;  3OCN A;  1XFN A;  2P08 A;  3T4S A;  3B47 A;  4GLQ A;  3E4O A;  3LR3 A;  2LB5 A;  2J80 A;  3V67 A;  4EER A;  4JGP A;  4MN5 A;  3H82 B;  4O0P A;  5J3W A;  5K5B A;  2B02 A;  3H82 A;  2D02 A;  3CIT A;  2V0U A;  5LBR A;  4EXO A;  2PD8 A;  4RQ9 A;  1NWZ A;  2DMW A;  2JKR I;  1G6O A;  4HH3 A;  1V9Y A;  3R4K A;  2ZMF A;  4WL9 A;  3OCL A;  4CLC E;  2V1B A;  3A0R A;  1TF1 A;  3UB9 A;  3E98 A;  3NOU C;  2W3H A;  4PAU A;  2KLI A;  4L9G A;  2OWJ A;  3K2N A;  2NUP C;  5F6A A;  2OWH A;  4NXF A;  3JVU A;  1D06 A;  2HJ9 C;  2W3E A;  3F1O B;  4G3V A;  2L4R A;  3F1O A;  4NEE D;  4CLC B;  1NLZ A;  4CLC A;  2PHY A;  3LR4 A;  2OAP 1;  2QHK A;  1S4R A;  1LSW A;  3T4L A;  4Z1W A;  4OOL A;  1N9N A;  2JN7 A;  5J4E A;  1F9I A;  4PHT A;  1LSV A;  2VJW A;  4EQ1 A;  1VHM A;  4GCZ A;  3MJQ A;  4IUH A;  1P97 A;  3HJK A;  4YOF A;  5FL3 A;  4WUJ A;  4O8G A;  4ME4 A;  5F69 A;  4Y3I A;  2P7J A;  4IHQ A;  1H3Q A;  2XA7 S;  2W3G A;  2WKP A;  2XRO A;  3PBQ A;  4DJ3 A;  4XT2 B;  2VV6 A;  4HHD A;  4XT2 A;  5HPI A;  3S7O A;  5HPF A;  1N9O A;  3UE6 A;  3DBA A;  1MKM A;  1N9L A;  4MDZ A;  3B42 A;  2EWW A;  4OOM A;  4HJ3 A;  3VV4 A;  4MN6 A;  3OC2 A;  5HWT A;  1JNU A;  5IT5 A;  4KUO A;  1TS8 A;  4HP9 A;  2GNX A;  3KYZ A;  4MN7 A;  2VA0 A;  3LR0 A;  3HJI A;  2M7U A;  2XSS A;  1OTA A;  1OTI A;  3BQ8 A;  3OBF A;  4NKP A;  2HV1 A;  3T4Q A;  5L8M A;  3LIA A;  1XJ2 A;  3BWL A;  3BJN A;  2PYR A;  4HIA A;  2KDK A;  3KSF A;  4B93 A;  1YSP A;  3EQV A;  5TJJ A;  4P6Z M;  3PBN A;  2WKQ A;  1UGU A;  4BBV A;  3E4P A;  2V1A A;  3LYX A;  5A8B A;  1W63 Q;  1GSX A;  2KOI A;  4MCW A;  3F1N B;  4L9F A;  4R38 A;  2VEA A;  2QKP A;  3EQU A;  3F1N A;  2PR6 A;  3LUQ A;  5MC7 A;  4AFI A;  2NUT C;  4KQO A;  3LID A;  4BJP A;  3LI8 A;  1H8M A;  4GHI B;  4PKY A;  1XJ3 A;  4GHI A;  3FPW A;  2ZMV A;  3C38 A;  3C8C A;  2FH5 A;  5AVE A;  4HJ4 A;  4Q0H A;  1MC0 A;  2VGL M;  3LIC A;  4HI4 A;  1T1A A;  2EA9 A;  3T50 A;  2JHE A;  2WKR A;  3A0V A;  2QWS A;  1DP8 A;  4EES A;  3E0Y A;  1DP6 A;  3P01 A;  2Y8H A;  1T19 A;  4LRY C;  4I3J A;  4LRZ E;  2D01 A;  1WA9 A;  3IBR A;  3MF0 A;  4BWI A;  2FZ0 A;  1VB6 A;  2VKS A;  2Y79 A;  3EEA A;  3FG8 A;  4JGR A;  3CWF A;  5HZH A;  2HJE A;  4LLO B;  3NHQ A;  2G7U A;  3MFX A;  5I5L A;  3CUE C;  2HF6 A;  5DFY A;  1TS0 A;  5TBM A;  3T4K A;  4QPR A;  4EET B;  4CLC D;  5G4Z A;  4EU0 A;  5DJU A;  2GJ3 A;  3MQ0 A;  3KSH A;  5EFW A;  3ZQ5 A;  2Z6C A;  4YWZ A;  4HY8 A;  2GX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...