4BBVA

The pb0 photocycle intermediate of photoactive yellow protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Watching a Signaling Protein Function in Real Time Via 100-Ps Time-Resolved Laue Crystallography.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4bbvA00
3LICA 4L9FA 1GSXA 4GS9A 3B33A 3OLOA 4EESA 1KOUA 1LL8A 2H28A 1DP8A 4MN6A 2M1CA 2ZOIA 3UB9A 4HHDA 5A8BA 4B9OA 1V9YA 5IU1A 3K3CA 1D7EA 4R3AA 3CLOA 3F1NB 5J7EA 1DRMA 2I9VA 4EW7A 3MQOA 3VE3A 2A24B 1D06A 4LRYC 3EWKA 1T1AA 5HD3A 5HDDA 1OJGA 5G4ZA 2PR5A 4I38A 2V1AA 2V9AA 4NXEA 1OTIA 1P0ZA 3F1PA 4GS9B 2W27A 3H82A 4HJ3A 3HJKA 1OTEA 5HSQA 2KX6A 3E4OA 5HD5A 2PYRA 2QJ7A 3F1OA 2J80A 1T1CA 4L9EA 3CWFA 4I5SA 4DJ2A 3ZQ5A 3RTYA 4GW9A 5IS1A 4E04A 4HQAA 1GSVA 2ZOHA 2Z6CA 4GCZA 3H7WA 2VEAA 5F5YA 4WN5A 4HH2A 4KQDA 3K3DA 5AVEA 2L1MA 4KUKA 4R6LA 5DKLA 3A0VA 1X0OA 1LSXA 2VV8A 2K7SA 4BBUA 4EEUA 3MR0A 2QHKA 3F1PB 3H82B 1N9LA 3LI9A 1DP9A 3MQQA 3NJAA 5DJUA 5HWVA 2BASA 4F3LA 1ODVA 5J3WA 3F1OB 5TBMA 5HWWA 3FG8A 4JGQA 1TS6A 1F98A 4H6JA 5EFWA 5HZHA 3IBRA 4XT2A 2VLGA 1T18A 3LIDA 3MXQA 1BYWA 2QJ5A 4HI4A 1N9NA 4HOIA 4L9GA 3MJQA 1G28A 1S1YA 4EQ1A 3UB6A 2KDKA 3NOUC 1P97A 4JGRA 2WKRA 1TS7A 4BBTA 3PHYA 3NOTC 3LIBA 4BBVA 3BY8A 1VB6A 4LLOB 2ZBBA 1OTBA 4EETB 5G4YA 3UB7A 2OOLA 4R70A 1DP6A 4LRXC 4WLAA 4EEPA 3E4QA 4MN5A 5AVFA 2W0NA 2YKHA 4M4XA 4F3LB 3GECA 2VV7A 5TBMB 2PD8A 3D72A 5HDCA 1JNUA 4H6JB 4I3AA 4XT2B 4PKYA 4NXFA 4HP9A 3PYPA 1UWPX 2VV6A 5KIZA 4I3IA 1LSVA 3UB8A 2CMNA 1OT9A 1EW0A 3BY9A 3LIAA 1MZUA 3ICYA 3A0SA 3MFXA 3BWLA 3IS2A 1XJ3A 4RQ9A 3VE4A 1GSWA 4HP4A 3P7NA 1LSWA 4GHIA 1S1ZA 4WL9A 4LPZA 3UMDA 1S67L 4NXGA 3T50A 5I5LA 3ULFA 1XJ2A 5F6AA 5DKKA 3E4PA 5F68A 2L0WA 1OTDA 4LRZE 3H7WB 3C2WA 3C8CA 2HV1A 2INWA 5F69A 1OTAA 2GJ3A 3NHQA 4HY8A 2D02A 2QKPA 1T19A 3KX0X 2EA9A 4EERA 1F9IA 2L4RA 1TS8A 3H9WA 3LYXA 5DJTA 4I3JA 3FC7A 3IS2B 1WA9A 5HWTA 2V1BA 4WUJA 2B02A 2P7JA 2V0WA 3LI8A 4GHIB 2OWHA 4I39A 2WKQA 3UE6A 4K08A 3NOPC 1XFQA 1LT0A 4R38A 3HJIA 1T1BA 4PKYG 2OWJA 2V0UA 3RH8B 5J4EA 1Y28A 1OJ5A 2JN7A 2D01A 1NWZA 4HJ6A 2WKPA 4JGOA 3VOLA 3LUQA 3SW1A 1XFNA 1S4SA 1V9ZA 1XJ6A 2Z6DA 2JHEA 1OT6A 4HIAA 1UGUA 3F1NA 4HNBA 4YWZA 1XJ4A 3LIEA 4HH3A 5HDSA 3CAXA 2YKFA 2QWSA 2PDRA 2A24A 2PYPA 1S4RA 4HJ4A 2PR6A 4WF0A 3G6OA 3UMEA 2PD7A 4NXBA 4KUOA 1UWNX 1S66L 3A0RA 4DJ3A 3EEHA 3GDIA 1TS0A 3LIFA 2R78A 4JGPA 2PHYA 1N9OA 4EXOA
chains in the Genus database with same CATH superfamily
3LICA 3IX8A 3UE1A 3BM6A 4IBRA 5L10A 3WS5A 3OLOA 2HZ5A 1WYCA 1LL8A 1DP8A 2Y55A 1MKIA 2M7VA 1IYQA 1Z6FA 2G2WA 4HHDA 4KG5A 5E2GA 4EBNA 3M6HA 2EX9A 3DWZA 3CLOA 3FKVA 3HUOA 3IXGA 3TW8A 4B4XA 3C7VA 1K56D 3HLDA 1XP4A 2ZC4B 3UE3A 3JVVA 5EV0A 2DRWA 1N4OA 5HDDA 4FSFA 3OCNA 1OJGA 2P74A 3BFDA 3IH9A 2PR5A 1TF1A 4R0QA 1OTIA 4GS9B 1VQQA 4DDYA 1E4DA 4X25A 1IYSA 5D3OA 2ZQAA 2QJ7A 4LV3A 1G68A 3CWFA 4UA6A 4DJ2A 1PWGA 3FV7A 3R7WA 4GW9A 5IS1A 5L09A 1IYOA 2ZM0A 3DTIA 3V3RA 5GLCA 1H8MA 4BL3A 4CJNA 4NEED 4ARZB 3QP5A 2WKEA 4ZJ2A 1K54A 3KYZA 4R6LA 4JXSA 5U47A 1X0OA 2PRFA 1ZTUA 2XD5A 4RVAA 2JBFA 2VV8A 4JKTA 2K7SA 4DE3A 2JKTI 4BBUA 4EEUA 3S7NA 3VP3A 3F1PB 4Y3IA 2Y91A 3LI9A 1DP9A 5E2HA 3MQQA 1I5QA 2H5SA 3SS4A 4JF4A 4Z9QA 1VHMA 5JYPA 5EFWA 3LR5A 3HLCA 1KE4A 1TEMA 1ZHHB 2JKTM 3G35A 5TJJA 4CQHA 5DTKA 4X1MA 3KSGA 4PM9A 1W79A 1I2SA 4PMAA 4WM9A 4EUZA 3N6IA 3S7OA 3N4IA 5EVEA 1F5MA 5FQQA 3UB6A 1LI9A 4KZBA 2GNXA 3UDFA 2EXAA 2ZM8A 1IKGA 4BBVA 4E3MA 4GKUA 1KGGA 4BENA 1YLZA 4BMWA 2WUQA 4ZJ3A 5G4YA 1K56A 3ISGA 5GL9A 3UB7A 1DP6A 5EPHA 4EEPA 3U2AA 3ZVTA 1MKMA 5J8XA 3GECA 2FFFB 4QHCA 4F94A 2PD8A 3D72A 4EWFA 4B4ZA 3T1RA 4X6TA 2EXBA 2QMIA 2XA7M 2XK1A 2G2UA 3LO7A 2IWCA 3Q07A 3L9KA 4HP9A 2W3EA 2O9CA 2VV6A 4EV4A 1PW8A 3OCLA 3NY4A 3JPUA 4JF5A 3HBRA 2HPBA 3T4SA 2ZQDA 4I3IA 1CI8A 1EWZA 4X1LA 3C38A 1MZUA 4KZ4A 1VEUA 5AJGA 1EI5A 3A0SA 1FR6A 1IELA 5CTMA 4DN0A 3I7JA 1SKOA 2EX2A 1GSWA 1P9RA 1PI5A 5FAPA 4WL9A 4OOLA 3UMDA 2K31A 2JE5A 3T50A 3VMAA 5FEFA 3UY6A 1OMEA 3ZYTA 3PBNA 4NK3A 4S2JA 5FQIA 2OAQ1 1K0KA 4DE1A 1OTDA 1G5UA 3BFFA 3LY4A 2PBYA 2PU4A 4KZ9A 3CHWP 2HV1A 2INWA 5FI2A 3NI9A 4LENA 2VKSA 4GLQA 4HY8A 1G6AA 1NYYA 2D02A 4E3OA 2QKPA 1T19A 4ZAMA 4FTXA 4P6ZS 1TS8A 2W3DA 1ESIA 1Z09A 3LYXA 5DJTA 4UAAA 2JCHA 3IS2B 4IHQA 3BJNA 3UPOA 1YMSA 4WUJA 1SDEA 2WZXA 4I39A 3NIAA 2WKQA 4JXVA 2J3WA 4K08A 1O7EA 1XPBA 5EOEA 2LB9A 1BSGA 1LT0A 2B95A 3HJIA 3RXWA 3DTEA 2Y8HA 4Y17A 3QNBA 4MDZA 2V8FA 2X02A 4Q0IA 2UWXA 3WS0A 4QU3A 2OWJA 5EM0A 5J4EA 1Y28A 3LEQA 1ZKJA 2WKHA 2Y2HA 3T4QA 1KDSA 1JWPA 3LGOA 1LLBA 4S2MA 2W3GA 4OONA 3AGFA 4JGOA 5I94A 3VOLA 1BT5A 1Y54A 3GMWA 4LV0A 1XFNA 4JXGA 3U4LP 3QP8A 2JHEA 1DJCA 1MWRA 4YWZA 4HNBA 1M6KA 4O8GA 5HL6A 5HPIA 5HDSA 3CAXA 2DNSA 2JKGA 1MC0A 5CGWA 1EROA 4M3KA 4A5RA 4OP8A 1S4RA 5AQ9A 2Q9NA 4WF0A 1S0WA 4E3NA 2XLNA 3UMEA 1L2SA 3OBFA 1K25A 5M18A 1UWNX 4DDSA 4IBXA 1PZOA 1TS0A 4MBFA 3MKFA 2W1RA 1JNUA 1N9OA 3O3VA 4EXOA 4GS9A 2NUTC 1FCMA 3HLWA 4DRTA 4EQIA 4KQOA 4OPZA 4EESA 1XKZA 3UPPA 2EWVA 1KDWA 1KOUA 4QD4A 4H8RA 1N9BA 1YM1A 3TRCA 4ME4A 2M1CA 3T4LA 1OPXA 2ZOIA 4MN7A 3VFFA 1YPRA 1WE4A 3UB9A 3LEZA 5A8BA 4S2OA 1YSQA 1GHIA 1V9YA 1TD5A 4HEFA 3KYEA 1D7EA 1GCEA 3Q7ZA 1JTGA 1VEUB 4AFIA 4Y15A 3KO6A 1CEGA 4ARZA 1A0KA 2I9VA 3A3IA 3G31A 3S22A 2ZC5B 2PT7A 2R9WA 1XGIA 1D06A 1JWVA 1YLWA 2HP9A 4UA7A 5HD3A 1QMFA 1YLJA 2P08A 3SS5A 4UEYA 2Y2OA 4I38A 2V1AA 5CRFA 4QPRA 3UDXA 3V50A 5CECA 1P0ZA 3F1PA 2W27A 3PXPA 3NULA 1SCWA 4FH4A 5HSQA 1LL5A 2WGWB 3M2KA 2ZC7A 5E2FA 5K5BA 4OLDA 5A92A 4WEJA 2GDNA 1MPLA 2O99A 4L9EA 2QZ6A 3C5AA 5IT5A 4I5SA 3HREA 3ZQ5A 3RTYA 4FD8A 4E04A 3Q7VA 4HQAA 5F1FA 1GSVA 2ZOHA 4OQ0A 3G4PA 2HJ9C 1MY8A 3GTCA 2PBDP 4WMCA 5FI7A 4Q8IA 1LHYA 3N8LA 1IOUA 4KQQA 3OPPA 4MLLA 1K54C 5FDSA 4N1XA 3KYQA 3AGEA 3CMZA 1NZUA 3A3EA 1M40A 1PWCA 3ZHHA 4CLCE 4DF6A 4KZAA 2H10A 3C7UA 1K38A 4BWIA 1K55A 3IX3A 5KMWA 1K6RA 1TDLA 4GN2A 4R3JA 3R4KA 3BQAA 5DF7A 2ZM2A 1TDGA 4DXBA 4BD1A 1PIOA 4DMZA 4YNRA 1N9LA 3ZG8B 1YLPA 4E3JA 3T4TA 4GD8A 4WYYA 2BASA 1ODVA 4Y0OA 4G3KA 2Y2MA 4QB8A 5HWWA 1AXBA 1ESUA 1TS6A 1F98A 2XROA 2R9XA 1GA9A 3IBRA 2VLGA 1PI4A 3ZFZA 2ZQ8A 4WELA 4C75A 1BYWA 5JYOA 4HI4A 3WS2A 1W5DA 3QP1A 4FH2A 2VGJA 1ACFA 3KSFA 3QNCA 1RCJA 3MZFA 4KQRA 4WBGA 5FQ9A 2KDKA 4JGRA 4BBTA 3PHYA 4R4RA 4XXRA 2B5RA 3G30A 1CQAA 3D4FA 3V5MA 4S2NA 4IUKA 1PFLA 4PHTA 3WS4A 1FIKA 3MF0A 5EOOA 2OOLA 3MXSA 4JF6A 5AVFA 2KLIA 2YKHA 3CG5A 5FQJA 2VV7A 5FDHA 2VX8A 4S2KA 2ZC6B 2DCFA 4H6JB 1FCOA 4XT2B 1K4FA 5A90A 4UQIM 4P6ZM 3IQAA 2HDUA 2Y4AA 5GHZA 3G2YA 3IHBA 3BRMA 5G18A 4MCWA 4DKIA 1HTZA 4LCLA 4N9LA 5HAPA 1XXMA 2H0TA 4N1HA 4N9KA 3VP1A 3UB8A 2CMNA 1EW0A 1ES2A 5CX7A 3BY9A 2Y2LA 5TFQA 1K4EA 3LIAA 3ICYA 2Y2NA 4UHUA 3IS2A 2P9VB 4OPYA 1D1JA 2IA2A 4HP4A 5DVAA 3P7NA 1LSWA 4PM8A 4LGWA 3EQUA 1YSPA 1VETA 1FSWA 4LPZA 5FAOA 1S67L 1YLYA 2J3TD 3O87A 3ULFA 1HLUP 3LY3A 3RXXA 4ETXA 1SDNA 4N92A 3MZEA 3N8SA 3HUMA 2Y59A 1W63Q 4CLCB 2W1TB 2BG1A 4OOMA 3Q7VB 2L0WA 3HUNA 4O01A 2WGIA 1HZOA 1SKFA 4KG6A 2J3TC 2VGKA 5E43A 2B18A 5EUAA 5KZHA 3NCKA 3NHQA 3IX4A 2RL3A 4OP5A 3SH8A 3B3XA 4S2PA 5E2EA 3KX0X 1U60A 4Y0UA 5FAQA 4EERA 4HESA 4DE0A 2ZLYA 4DXCA 1S6RA 1O07A 2EWWA 3ZDJA 2ZC3B 4OOYA 4Y0TA 2ZQ9A 5MC7A 4UA9A 4Y5FA 2V0WA 2V2FF 4E3KA 5CXWA 3DW0A 1Y4OA 3NOPC 2XSSA 2QYBA 4Y13A 4R38A 3C4OA 3RFBA 5CHMA 5EVIB 1ONHA 3CUEA 5HPFA 3TJZC 2VJWA 4ID4A 2HP5A 2V0UA 3RH8B 5FI6A 4B88A 2VK3A 2XGNA 3Q82A 3CITA 3AGDA 5L8MA 3S4XA 3RJUA 1NWZA 4HJ6A 4PM6A 4HBTA 3K2NA 1S4SA 3PBOA 1XJ6A 4QJGA 3SS3A 2PAVP 1OT6A 3TOIA 4OQHA 1QMEA 1G6OA 5M19A 1ZG4A 3ZG7B 3IF6B 2ZL1B 3EGDC 4FOFA 4U0TA 2PYPA 1NLZA 1Q2QA 2E8IA 2V1ZA 2ZMVA 5DTSA 1PWDA 4B93A 3S7PA 5C5KA 5DF9A 5FQMA 3A0RA 1H8YA 1L0FA 3LIFA 2R78A 4JGPA 1JWZA 2PHYA 1CJFA 2NUPC 4L9FA 1GSXA 5HX9A 3BEBA 4X56A 3QHYA 1LL9A 1PYYA 3B33A 4ZTKA 2WGWA 3HLBA 3SH9A 3CJMA 2H28A 2HJEA 2ZMFA 3WRTA 4BLMA 3IHAA 3OC2A 2Y79A 4R3AA 4UQIS 3TG9A 1K6SA 1W63M 2BLSA 3NDEA 5TR7A 3ZNYA 4RX2A 5J7EA 1DRMA 3PBQA 5EVLA 5GLAA 5F1GA 3EWKA 1JVJA 1VETB 1T1AA 1ES4A 3ZGAB 4FUWA 3ZNTA 1RP5A 5G4ZA 4EU0A 2XRNA 4OKPA 4NXEA 4IVKA 4EBLA 2HDRA 4ZDXA 1KE0A 4II7A 4HJ3A 4RA7A 3HJKA 5AQ7A 4CLCD 1W8YA 3BFEA 2XH9A 3E4OA 2IWBA 5HD5A 1NYMA 3KSIA 5HFOA 3D3OA 3E98A 4WMCD 4OPQA 5L07A 3HLEA 3PBTA 4JLFA 2HDQA 4U0XA 4GDNA 3NDGA 3H7WA 2VEAA 5HAIA 1DJAA 5CEDA 2ZD8A 5F5YA 2BTFP 4WN5A 3W8KA 3ITBA 3B42A 3K3DA 5AVEA 2L1MA 2Y2GA 4WZ5A 5DKLA 3BLSA 1ES3A 3GVBA 1LSXA 1K55C 2Y2IA 2Q9MA 4BD0A 3HCYA 3LFVA 1SHVA 4P85A 4S2LA 2HP6A 5EE8A 2QHKA 3QP4A 4KZ6A 5EVID 3H82B 4MEZA 1CK3A 2V8CA 3NJAA 2XFSA 3OPLA 3IBJA 2G7UA 5J3WA 3F1OB 3FG8A 3FZCA 4MBKA 4JGQA 4X55A 2JKRI 4H6JA 2UV0E 4XT2A 1T18A 4WZ4A 5HW3A 1DJBA 2IWDA 2QJ5A 1KVLA 1W7FA 1G28A 3BYDA 3BFCA 4EQ1A 2XR0A 3VP2A 4KENB 3NOUC 1P97A 2WKRA 2WAEA 5FATA 1KVMA 2VA0A 1MWUA 4YFMA 1VB6A 4G3WA 4LLOB 3IXBA 3PTEA 2ZBBA 2JKRM 3ZG5A 4EETB 5FEGA 3VOZA 4S2NC 1AWIA 2P9VA 1XA7A 3P98A 4R70A 2MJ6A 2Z2LB 2WKIA 4MN5A 2W0NA 5CEBA 3EGXC 3IWQA 3N8RA 3W4OA 4F3LB 1BULA 3IH8A 5TBMB 1J3WA 1I2WA 2H0YA 4OLGA 3T1SA 3OPHA 4E3LA 1FSYA 5DFYA 4CLCA 4PKYA 2W1TA 4C3QA 4DE2A 3CI6A 3W2ZA 1ES5A 3Q81A 2O9BA 1UWPX 2EFUA 3VSKA 4G3VA 2QPNA 2M7UA 4U3TA 3HL9A 3HLFA 5KIZA 4LV2A 1C3BA 2HGVA 1H0MA 4FCFA 3EOIA 2FZ0A 1GA0A 3UDIA 3C4PA 1MWSA 3MFXA 4K0WA 4NG2A 1XJ3A 3MQ0A 3VE4A 1HD8A 3G32A 3A3JA 2WADA 1S1ZA 2Y2KA 1YQSA 3IXDA 2EX8A 1BLPA 4MNRA 5CGSA 2GX5A 1XJ2A 5F6AA 5CTNA 5DKKA 3PBSA 3E4PA 3S7QA 5EVIA 3WWXA 3FPWA 5F68A 5F83A 4LRZE 3T12B 4EUVA 3DTKA 3H7WB 1BLCA 2OLUA 2W3FA 3C8CA 5GLDA 1OTAA 2GJ3A 3NC8A 3IWIA 4C6YA 3CPTA 4O0PA 4GD6A 2VZWA 2P04A 1JTDA 3S1YA 2Y2QA 1W8QA 3C30A 3ZVWA 4Y7PA 4GDBA 1GHPA 1MBLA 2J7VA 1VM1A 3PAEA 5GHYA 3VP4A 4KZ5A 4Q0JA 3FC7A 3GSGA 3BFGA 4JPMA 4XUXA 4KZ8A 4CPKA 1BZAA 3IF6A 3IXHA 2B02A 3UNWA 1HVBA 2P7JA 3O5YA 2ZL1A 2E8JA 4GHIB 3IF5A 5HL1A 1FQGA 4R23A 4ZJ1A 1YAXA 5A93A 4X68A 2GZAA 3LR0A 1K57A 4E6XA 3TE8A 4PKYG 3FWLA 3E2LA 3CUEC 1IKIA 1NRFA 1IFQA 4BQMA 5FSRA 2JN7A 1SZVA 4O7DA 2D01A 1E3UA 4GB7A 4YINA 4MMNA 2OLVA 5FA7A 2C5WB 3SW1A 1V9ZA 5HARA 2Z6DA 2ZJ9A 3UB5P 1UGUA 1LI0A 1F2KA 4E6WA 1GHMA 4HH3A 2WYXA 2QWSA 3NECA 4LV1A 3E2KA 4K0XA 1CI9A 2I72A 4PPRA 4IVIA 3WS1A 4R1GA 3M6BA 1FILA 4ZBEA 3ZCZA 1S66L 4DJ3A 5IHVA 3EEHA 3GDIA 2WGVA 2DMWA 2W3HA 2XFTA 3VP0A 3QP2A 1ERQA 4BJPA 2VGLM 4P6BA 3ZG9B 4E3IA 2X01A 2XD1A 4MN6A 3GRJA 1P9WA 1BLHA 4L0LA 4B9OA 3CZDA 1ZC2A 5FASA 5IU1A 3K3CA 3UPNA 4D2OA 1NY0A 3F1NB 3DWKA 3OOVA 4LCMA 4EW7A 3MQOA 1PRQA 3PR6A 5FL3A 3VE3A 4KZ7A 2A24B 2FFYA 4LRYC 4NETA 4JXWA 3GV9A 1J9MA 4OH0A 5GHXA 3GQZA 3VSLA 2OV5A 2C6WB 2V9AA 1L0GA 4ETZA 1WYBA 3H82A 2J9OA 3LR3A 1OTEA 4QWOA 2Z2MB 2KX6A 4IUHA 2PYRA 3OZHA 2J9PA 3F1OA 2J80A 1T1CA 4LFUA 3CPTB 1PZPA 4K91A 3MKEA 3UE0A 3O86A 2OSUA 2Z6CA 4GCZA 4HBUA 5CGXA 1Q2PA 3MS6A 2AVXA 3O88A 3MFDA 1L3LA 4HH2A 4KQDA 5CHJA 1MWTA 4EBPA 4KUKA 2ZQ7A 3A3DA 4P87A 3A0VA 3V39A 4WZ5C 4JBFA 2LB5A 1YLTA 1PW1A 1KE3A 3JVUA 4IJGA 3MR0A 3SOIA 2FH5A 4GZBA 5DF8A 1L0DA 1H5XA 3MZDA 1RGZA 3DBAA 1KGEA 5DJUA 5HWVA 4F3LA 5TBMA 4P0MA 1H3QA 3BECA 2JKFA 3QP6A 3R7WB 5HZHA 4XUZA 3LIDA 3MXQA 4IEDA 3BLMA 4PM5A 3BQ8A 3TSGA 1N9NA 5KSHA 1IYPA 4HOIA 3E0YA 3L7HA 4L9GA 3MJQA 3FYZA 2ZMAA 1S1YA 2HF6A 1NJ4A 1PNEA 3UO9A 3EEAA 3NBLA 1NLYA 1TS7A 4GOGA 3NOTC 3LIBA 4OQGA 3BY8A 3D9YA 3IWOA 2X71A 5AQBA 1OTBA 3P01A 3VV4A 2XF3A 3T4OA 3FKWA 4LRXC 4WLAA 3E4QA 1NZOA 2O9AA 4M4XA 2J8YA 1MXOA 4OQIA 3M2JA 3T1QB 5CHUA 5HDCA 2KOIA 3VOYA 4I3AA 1IEMA 3W4PA 4CLCC 4NKPA 1YT4A 4NXFA 5CERA 5DFXA 3GR2A 2EX6A 2VGLS 1L0EA 3PYPA 2A2LA 3B47A 3WRZA 1LSVA 5KSCA 1ERMA 2Q0OA 2XDMA 1OT9A 3SH7A 5EM1A 3T1XA 2ACGA 3BWLA 4PM7A 2WZZA 3JYIA 2K2NA 3MBZA 3A3FA 4RQ9A 3OPRA 5EECA 4GHIA 2A3UA 1E25A 3T4KA 4NXGA 3SZTA 4KZ3A 3G2ZA 5I5LA 5LBRA 5M1AA 3ITAA 2Y2PA 3ZG0A 5EVIC 5HAQA 4WEKA 5TGFA 4ESPA 5L2FA 2CC1A 3VFHA 5FQKA 3C2WA 4QY5A 1RGYA 2O0YA 2WK0A 5F69A 3N7WA 3LCEA 2Y2JA 1CEFA 3HLGA 4KG2A 5BOHA 2A49A 3MMHA 1ZG6A 3FPVA 1ONGA 1NXYA 2EA9A 1XGJA 1F9IA 2L4RA 4R4SA 3DAVA 2XA7S 3LR4A 3H9WA 4RX3A 5F82A 2PU2A 4I3JA 5A91A 1WA9A 1SKOB 3BW6A 4OVDA 4Y2FA 1BTLA 5HWTA 2V1BA 2V20A 4D60A 4RYEA 3MSHA 2JC7A 3IT9A 3LI8A 1XX2A 3IF6C 1FR1A 2OWHA 3UE6A 2WAFA 2EFXA 4YOFA 1XFQA 1BUEA 1STZA 3MXRA 5DTTA 1FCNA 5GLBA 1T1BA 1E3UD 3EQVA 4S2IA 1K57C 4Q0HA 3V67A 2OAP1 3PBRA 4QY6A 1OJ5A 2XQZA 4PAUA 3T4JA 1TVFA 2XEPA 2WKPA 1YMXA 3DTMA 4X69A 3P09A 3LUQA 1FOFA 3PAGA 1DY6A 1H8ZA 4HIAA 3Q1FA 3F1NA 1XJ4A 3LIEA 4R3BA 1CF0A 4GNUA 2YKFA 4BL2A 2PDRA 2ZQCA 3UN7A 2A24A 1BLSA 3V3SA 4ZRRA 4Z1WA 4HJ4A 2PR6A 1NRJA 2HDSA 4GJ4A 3G6OA 5AQAA 2PD7A 4NXBA 1KGFA 4KUOA 4X53A 3KSHA 1XA1A 3W4QA 3HVFA 4MBHA 1ALQA 3G34A 1YKDA 4OPRA 2RCXA
chains in the Genus database with same CATH topology
3LICA 4L9FA 1GSXA 4GS9A 2NUTC 4BJPA 2VGLM 4KQOA 3B33A 3OLOA 4EESA 2EWVA 1KOUA 1LL8A 2H28A 1DP8A 2HJEA 2M7VA 2ZMFA 4MN6A 4ME4A 3TRCA 2M1CA 1P9WA 3T4LA 1OPXA 2ZOIA 4MN7A 4L0LA 3UB9A 4HHDA 5A8BA 4B9OA 1YSQA 1V9YA 1TD5A 3OC2A 5IU1A 2Y79A 3K3CA 1D7EA 4R3AA 4UQIS 1W63M 3CLOA 4AFIA 3F1NB 3KO6A 5J7EA 3TW8A 1DRMA 3PBQA 4ARZA 3OOVA 2I9VA 4EW7A 3MQOA 5FL3A 3PR6A 3VE3A 3UE3A 2PT7A 2A24B 3JVVA 1D06A 4LRYC 3EWKA 1T1AA 5HD3A 5HDDA 2P08A 4FSFA 4UEYA 3OCNA 1OJGA 5G4ZA 2PR5A 2XRNA 2V1AA 4I38A 4EU0A 1TF1A 2V9AA 4NXEA 1OTIA 4QPRA 4ETZA 1P0ZA 3F1PA 4GS9B 4II7A 2W27A 3H82A 4HJ3A 3LR3A 3HJKA 3PXPA 4CLCD 1OTEA 5HSQA 2KX6A 2NUPC 4IUHA 3E4OA 5HD5A 2PYRA 2QJ7A 5K5BA 4WEJA 3KSIA 3F1OA 3D3OA 3E98A 2J80A 1T1CA 2O99A 4L9EA 3CWFA 5IT5A 4I5SA 4DJ2A 3R7WA 3ZQ5A 3RTYA 4GW9A 3PBTA 5IS1A 4E04A 4HQAA 1GSVA 1H8MA 2ZOHA 2Z6CA 4GCZA 2HJ9C 3H7WA 2VEAA 4NEED 4ARZB 5F5YA 4WN5A 4HH2A 4KQDA 1IOUA 3B42A 3K3DA 3KYQA 3KYZA 5AVEA 2L1MA 4KUKA 4R6LA 4CLCE 5DKLA 3A0VA 1X0OA 4BWIA 1LSXA 1ZTUA 2LB5A 2VV8A 2K7SA 3JVUA 2JKTI 4IJGA 3HCYA 3LFVA 4BBUA 4EEUA 3R4KA 3BQAA 3S7NA 3MR0A 2QHKA 2FH5A 3F1PB 4Y3IA 3H82B 4DMZA 4YNRA 1N9LA 3LI9A 1DP9A 3DBAA 3MQQA 3T4TA 3NJAA 5DJUA 3IBJA 2BASA 4F3LA 2G7UA 5HWVA 1ODVA 5J3WA 4G3KA 3F1OB 5TBMA 5HWWA 1H3QA 3FG8A 4JGQA 1TS6A 1VHMA 1F98A 2XROA 2JKRI 4H6JA 5EFWA 3R7WB 5HZHA 3IBRA 4XT2A 2VLGA 3LR5A 1ZHHB 2JKTM 1T18A 3LIDA 3MXQA 5TJJA 4WELA 4CQHA 1BYWA 3BQ8A 2QJ5A 4HI4A 3KSGA 1N9NA 5KSHA 4HOIA 3E0YA 4L9GA 3MJQA 1G28A 3KSFA 1S1YA 3S7OA 2HF6A 4EQ1A 1F5MA 3UB6A 2KDKA 3NOUC 3EEAA 1P97A 4JGRA 2GNXA 1NLYA 2WKRA 1TS7A 4BBTA 3PHYA 3NOTC 3LIBA 4BBVA 2VA0A 3BY8A 1VB6A 4G3WA 4LLOB 2ZBBA 2JKRM 1OTBA 2W3HA 4EETB 4BMWA 3P01A 3VV4A 4IUKA 5G4YA 4PHTA 3T4OA 3MF0A 3UB7A 2OOLA 4R70A 1DP6A 4LRXC 2MJ6A 4WLAA 4EEPA 3E4QA 4MN5A 5AVFA 2W0NA 3U2AA 3EGXC 2KLIA 2YKHA 2O9AA 1MKMA 4M4XA 4F3LB 3GECA 2VV7A 5TBMB 2VX8A 2PD8A 3D72A 1JNUA 5HDCA 2KOIA 4H6JB 4I3AA 4XT2B 5DFYA 4CLCA 4PKYA 2W1TA 4UQIM 3CI6A 2XA7M 4NKPA 4P6ZM 3W2ZA 4CLCC 4NXFA 2O9BA 5DFXA 4HP9A 2W3EA 2VGLS 3PYPA 4MCWA 2O9CA 1UWPX 2A2LA 2VV6A 4G3VA 3OCLA 3B47A 2M7UA 5KIZA 3T4SA 4I3IA 2HGVA 1LSVA 3UB8A 2CMNA 1OT9A 1EW0A 5CX7A 3BY9A 3C38A 2FZ0A 3EOIA 3LIAA 1MZUA 3ICYA 5AJGA 3A0SA 3MFXA 3BWLA 4DN0A 3IS2A 2K2NA 1XJ3A 4RQ9A 3MQ0A 3VE4A 2IA2A 1GSWA 1P9RA 4HP4A 3P7NA 1LSWA 4GHIA 3EQUA 1YSPA 1S1ZA 4WL9A 4LPZA 3T4KA 4OOLA 3UMDA 1S67L 4NXGA 2K31A 3T50A 5I5LA 2GX5A 2J3TD 1XJ2A 3ULFA 3ZYTA 5F6AA 5LBRA 4ETXA 5DKKA 3PBNA 3PBSA 3E4PA 3S7QA 1W63Q 2OAQ1 4CLCB 3FPWA 2W1TB 5F68A 4WEKA 4OOMA 2L0WA 1OTDA 4LRZE 4EUVA 4O01A 3H7WB 3C2WA 2W3FA 3C8CA 2HV1A 2INWA 2O0YA 2J3TC 5F69A 2VKSA 1OTAA 2GJ3A 2B18A 4GLQA 4O0PA 3NHQA 4HY8A 2VZWA 2P04A 3C30A 3MMHA 2D02A 2QKPA 1T19A 3FPVA 3KX0X 2EA9A 4EERA 1F9IA 2L4RA 2XA7S 3LR4A 4P6ZS 1TS8A 2W3DA 3H9WA 3LYXA 5DJTA 4I3JA 2EWWA 4Q0JA 3FC7A 3IS2B 4IHQA 1WA9A 5MC7A 3BJNA 3BW6A 4Y2FA 5HWTA 2V1BA 4WUJA 2B02A 2P7JA 3O5YA 2V0WA 4Y5FA 3LI8A 4GHIB 2OWHA 4I39A 2WKQA 3UE6A 2J3WA 4K08A 4YOFA 3NOPC 2XSSA 1XFQA 2LB9A 2QYBA 1LT0A 1YAXA 1STZA 4R38A 3HJIA 2GZAA 3RFBA 1T1BA 3LR0A 2Y8HA 3EQVA 4MDZA 3CUEA 3TE8A 4Q0IA 5HPFA 4PKYG 3TJZC 2OWJA 2VJWA 3CUEC 2V0UA 3RH8B 1IFQA 5J4EA 4Q0HA 3V67A 1Y28A 2OAP1 3PBRA 1OJ5A 3T4QA 2JN7A 3CITA 5L8MA 4PAUA 2D01A 1NWZA 4HJ6A 2W3GA 3T4JA 2WKPA 4JGOA 4MMNA 3VOLA 3K2NA 3LUQA 3SW1A 1XFNA 1S4SA 3PBOA 1V9ZA 1XJ6A 2Z6DA 2JHEA 1OT6A 4HIAA 1UGUA 1G6OA 3F1NA 4HNBA 4YWZA 1XJ4A 4O8GA 5HL6A 5HPIA 3LIEA 4HH3A 5HDSA 3CAXA 2YKFA 1MC0A 2QWSA 2PDRA 3EGDC 4FOFA 2A24A 2PYPA 1NLZA 4ZRRA 4Z1WA 2ZMVA 1S4RA 4HJ4A 2PR6A 4WF0A 1NRJA 4B93A 4GJ4A 3G6OA 3S7PA 3UMEA 5C5KA 5DF9A 2PD7A 4NXBA 3OBFA 4KUOA 3KSHA 1UWNX 1S66L 3A0RA 4DJ3A 3EEHA 3GDIA 1TS0A 3LIFA 2R78A 4JGPA 1YKDA 2DMWA 2W1RA 2PHYA 1N9OA 4EXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIC A;  4L9F A;  1GSX A;  4GS9 A;  3B33 A;  3OLO A;  4EES A;  1KOU A;  1LL8 A;  2H28 A;  1DP8 A;  4MN6 A;  2M1C A;  2ZOI A;  3UB9 A;  4HHD A;  5A8B A;  4B9O A;  1V9Y A;  5IU1 A;  3K3C A;  1D7E A;  4R3A A;  3CLO A;  3F1N B;  5J7E A;  1DRM A;  2I9V A;  4EW7 A;  3MQO A;  3VE3 A;  2A24 B;  1D06 A;  4LRY C;  3EWK A;  1T1A A;  5HD3 A;  5HDD A;  1OJG A;  5G4Z A;  2PR5 A;  4I38 A;  2V1A A;  2V9A A;  4NXE A;  1OTI A;  1P0Z A;  3F1P A;  4GS9 B;  2W27 A;  3H82 A;  4HJ3 A;  3HJK A;  1OTE A;  5HSQ A;  2KX6 A;  3E4O A;  5HD5 A;  2PYR A;  2QJ7 A;  3F1O A;  2J80 A;  1T1C A;  4L9E A;  3CWF A;  4I5S A;  4DJ2 A;  3ZQ5 A;  3RTY A;  4GW9 A;  5IS1 A;  4E04 A;  4HQA A;  1GSV A;  2ZOH A;  2Z6C A;  4GCZ A;  3H7W A;  2VEA A;  5F5Y A;  4WN5 A;  4HH2 A;  4KQD A;  3K3D A;  5AVE A;  2L1M A;  4KUK A;  4R6L A;  5DKL A;  3A0V A;  1X0O A;  1LSX A;  2VV8 A;  2K7S A;  4BBU A;  4EEU A;  3MR0 A;  2QHK A;  3F1P B;  3H82 B;  1N9L A;  3LI9 A;  1DP9 A;  3MQQ A;  3NJA A;  5DJU A;  5HWV A;  2BAS A;  4F3L A;  1ODV A;  5J3W A;  3F1O B;  5TBM A;  5HWW A;  3FG8 A;  4JGQ A;  1TS6 A;  1F98 A;  4H6J A;  5EFW A;  5HZH A;  3IBR A;  4XT2 A;  2VLG A;  1T18 A;  3LID A;  3MXQ A;  1BYW A;  2QJ5 A;  4HI4 A;  1N9N A;  4HOI A;  4L9G A;  3MJQ A;  1G28 A;  1S1Y A;  4EQ1 A;  3UB6 A;  2KDK A;  3NOU C;  1P97 A;  4JGR A;  2WKR A;  1TS7 A;  4BBT A;  3PHY A;  3NOT C;  3LIB A;  4BBV A;  3BY8 A;  1VB6 A;  4LLO B;  2ZBB A;  1OTB A;  4EET B;  5G4Y A;  3UB7 A;  2OOL A;  4R70 A;  1DP6 A;  4LRX C;  4WLA A;  4EEP A;  3E4Q A;  4MN5 A;  5AVF A;  2W0N A;  2YKH A;  4M4X A;  4F3L B;  3GEC A;  2VV7 A;  5TBM B;  2PD8 A;  3D72 A;  5HDC A;  1JNU A;  4H6J B;  4I3A A;  4XT2 B;  4PKY A;  4NXF A;  4HP9 A;  3PYP A;  1UWP X;  2VV6 A;  5KIZ A;  4I3I A;  1LSV A;  3UB8 A;  2CMN A;  1OT9 A;  1EW0 A;  3BY9 A;  3LIA A;  1MZU A;  3ICY A;  3A0S A;  3MFX A;  3BWL A;  3IS2 A;  1XJ3 A;  4RQ9 A;  3VE4 A;  1GSW A;  4HP4 A;  3P7N A;  1LSW A;  4GHI A;  1S1Z A;  4WL9 A;  4LPZ A;  3UMD A;  1S67 L;  4NXG A;  3T50 A;  5I5L A;  3ULF A;  1XJ2 A;  5F6A A;  5DKK A;  3E4P A;  5F68 A;  2L0W A;  1OTD A;  4LRZ E;  3H7W B;  3C2W A;  3C8C A;  2HV1 A;  2INW A;  5F69 A;  1OTA A;  2GJ3 A;  3NHQ A;  4HY8 A;  2D02 A;  2QKP A;  1T19 A;  3KX0 X;  2EA9 A;  4EER A;  1F9I A;  2L4R A;  1TS8 A;  3H9W A;  3LYX A;  5DJT A;  4I3J A;  3FC7 A;  3IS2 B;  1WA9 A;  5HWT A;  2V1B A;  4WUJ A;  2B02 A;  2P7J A;  2V0W A;  3LI8 A;  4GHI B;  2OWH A;  4I39 A;  2WKQ A;  3UE6 A;  4K08 A;  3NOP C;  1XFQ A;  1LT0 A;  4R38 A;  3HJI A;  1T1B A;  4PKY G;  2OWJ A;  2V0U A;  3RH8 B;  5J4E A;  1Y28 A;  1OJ5 A;  2JN7 A;  2D01 A;  1NWZ A;  4HJ6 A;  2WKP A;  4JGO A;  3VOL A;  3LUQ A;  3SW1 A;  1XFN A;  1S4S A;  1V9Z A;  1XJ6 A;  2Z6D A;  2JHE A;  1OT6 A;  4HIA A;  1UGU A;  3F1N A;  4HNB A;  4YWZ A;  1XJ4 A;  3LIE A;  4HH3 A;  5HDS A;  3CAX A;  2YKF A;  2QWS A;  2PDR A;  2A24 A;  2PYP A;  1S4R A;  4HJ4 A;  2PR6 A;  4WF0 A;  3G6O A;  3UME A;  2PD7 A;  4NXB A;  4KUO A;  1UWN X;  1S66 L;  3A0R A;  4DJ3 A;  3EEH A;  3GDI A;  1TS0 A;  3LIF A;  2R78 A;  4JGP A;  2PHY A;  1N9O A;  4EXO A; 
#chains in the Genus database with same CATH topology
 3LIC A;  3IX8 A;  3UE1 A;  3BM6 A;  4IBR A;  5L10 A;  3WS5 A;  3OLO A;  2HZ5 A;  1WYC A;  1LL8 A;  1DP8 A;  2Y55 A;  1MKI A;  2M7V A;  1IYQ A;  1Z6F A;  2G2W A;  4HHD A;  4KG5 A;  5E2G A;  4EBN A;  3M6H A;  2EX9 A;  3DWZ A;  3CLO A;  3FKV A;  3HUO A;  3IXG A;  3TW8 A;  4B4X A;  3C7V A;  1K56 D;  3HLD A;  1XP4 A;  2ZC4 B;  3UE3 A;  3JVV A;  5EV0 A;  2DRW A;  1N4O A;  5HDD A;  4FSF A;  3OCN A;  1OJG A;  2P74 A;  3BFD A;  3IH9 A;  2PR5 A;  1TF1 A;  4R0Q A;  1OTI A;  4GS9 B;  1VQQ A;  4DDY A;  1E4D A;  4X25 A;  1IYS A;  5D3O A;  2ZQA A;  2QJ7 A;  4LV3 A;  1G68 A;  3CWF A;  4UA6 A;  4DJ2 A;  1PWG A;  3FV7 A;  3R7W A;  4GW9 A;  5IS1 A;  5L09 A;  1IYO A;  2ZM0 A;  3DTI A;  3V3R A;  5GLC A;  1H8M A;  4BL3 A;  4CJN A;  4NEE D;  4ARZ B;  3QP5 A;  2WKE A;  4ZJ2 A;  1K54 A;  3KYZ A;  4R6L A;  4JXS A;  5U47 A;  1X0O A;  2PRF A;  1ZTU A;  2XD5 A;  4RVA A;  2JBF A;  2VV8 A;  4JKT A;  2K7S A;  4DE3 A;  2JKT I;  4BBU A;  4EEU A;  3S7N A;  3VP3 A;  3F1P B;  4Y3I A;  2Y91 A;  3LI9 A;  1DP9 A;  5E2H A;  3MQQ A;  1I5Q A;  2H5S A;  3SS4 A;  4JF4 A;  4Z9Q A;  1VHM A;  5JYP A;  5EFW A;  3LR5 A;  3HLC A;  1KE4 A;  1TEM A;  1ZHH B;  2JKT M;  3G35 A;  5TJJ A;  4CQH A;  5DTK A;  4X1M A;  3KSG A;  4PM9 A;  1W79 A;  1I2S A;  4PMA A;  4WM9 A;  4EUZ A;  3N6I A;  3S7O A;  3N4I A;  5EVE A;  1F5M A;  5FQQ A;  3UB6 A;  1LI9 A;  4KZB A;  2GNX A;  3UDF A;  2EXA A;  2ZM8 A;  1IKG A;  4BBV A;  4E3M A;  4GKU A;  1KGG A;  4BEN A;  1YLZ A;  4BMW A;  2WUQ A;  4ZJ3 A;  5G4Y A;  1K56 A;  3ISG A;  5GL9 A;  3UB7 A;  1DP6 A;  5EPH A;  4EEP A;  3U2A A;  3ZVT A;  1MKM A;  5J8X A;  3GEC A;  2FFF B;  4QHC A;  4F94 A;  2PD8 A;  3D72 A;  4EWF A;  4B4Z A;  3T1R A;  4X6T A;  2EXB A;  2QMI A;  2XA7 M;  2XK1 A;  2G2U A;  3LO7 A;  2IWC A;  3Q07 A;  3L9K A;  4HP9 A;  2W3E A;  2O9C A;  2VV6 A;  4EV4 A;  1PW8 A;  3OCL A;  3NY4 A;  3JPU A;  4JF5 A;  3HBR A;  2HPB A;  3T4S A;  2ZQD A;  4I3I A;  1CI8 A;  1EWZ A;  4X1L A;  3C38 A;  1MZU A;  4KZ4 A;  1VEU A;  5AJG A;  1EI5 A;  3A0S A;  1FR6 A;  1IEL A;  5CTM A;  4DN0 A;  3I7J A;  1SKO A;  2EX2 A;  1GSW A;  1P9R A;  1PI5 A;  5FAP A;  4WL9 A;  4OOL A;  3UMD A;  2K31 A;  2JE5 A;  3T50 A;  3VMA A;  5FEF A;  3UY6 A;  1OME A;  3ZYT A;  3PBN A;  4NK3 A;  4S2J A;  5FQI A;  2OAQ 1;  1K0K A;  4DE1 A;  1OTD A;  1G5U A;  3BFF A;  3LY4 A;  2PBY A;  2PU4 A;  4KZ9 A;  3CHW P;  2HV1 A;  2INW A;  5FI2 A;  3NI9 A;  4LEN A;  2VKS A;  4GLQ A;  4HY8 A;  1G6A A;  1NYY A;  2D02 A;  4E3O A;  2QKP A;  1T19 A;  4ZAM A;  4FTX A;  4P6Z S;  1TS8 A;  2W3D A;  1ESI A;  1Z09 A;  3LYX A;  5DJT A;  4UAA A;  2JCH A;  3IS2 B;  4IHQ A;  3BJN A;  3UPO A;  1YMS A;  4WUJ A;  1SDE A;  2WZX A;  4I39 A;  3NIA A;  2WKQ A;  4JXV A;  2J3W A;  4K08 A;  1O7E A;  1XPB A;  5EOE A;  2LB9 A;  1BSG A;  1LT0 A;  2B95 A;  3HJI A;  3RXW A;  3DTE A;  2Y8H A;  4Y17 A;  3QNB A;  4MDZ A;  2V8F A;  2X02 A;  4Q0I A;  2UWX A;  3WS0 A;  4QU3 A;  2OWJ A;  5EM0 A;  5J4E A;  1Y28 A;  3LEQ A;  1ZKJ A;  2WKH A;  2Y2H A;  3T4Q A;  1KDS A;  1JWP A;  3LGO A;  1LLB A;  4S2M A;  2W3G A;  4OON A;  3AGF A;  4JGO A;  5I94 A;  3VOL A;  1BT5 A;  1Y54 A;  3GMW A;  4LV0 A;  1XFN A;  4JXG A;  3U4L P;  3QP8 A;  2JHE A;  1DJC A;  1MWR A;  4YWZ A;  4HNB A;  1M6K A;  4O8G A;  5HL6 A;  5HPI A;  5HDS A;  3CAX A;  2DNS A;  2JKG A;  1MC0 A;  5CGW A;  1ERO A;  4M3K A;  4A5R A;  4OP8 A;  1S4R A;  5AQ9 A;  2Q9N A;  4WF0 A;  1S0W A;  4E3N A;  2XLN A;  3UME A;  1L2S A;  3OBF A;  1K25 A;  5M18 A;  1UWN X;  4DDS A;  4IBX A;  1PZO A;  1TS0 A;  4MBF A;  3MKF A;  2W1R A;  1JNU A;  1N9O A;  3O3V A;  4EXO A;  4GS9 A;  2NUT C;  1FCM A;  3HLW A;  4DRT A;  4EQI A;  4KQO A;  4OPZ A;  4EES A;  1XKZ A;  3UPP A;  2EWV A;  1KDW A;  1KOU A;  4QD4 A;  4H8R A;  1N9B A;  1YM1 A;  3TRC A;  4ME4 A;  2M1C A;  3T4L A;  1OPX A;  2ZOI A;  4MN7 A;  3VFF A;  1YPR A;  1WE4 A;  3UB9 A;  3LEZ A;  5A8B A;  4S2O A;  1YSQ A;  1GHI A;  1V9Y A;  1TD5 A;  4HEF A;  3KYE A;  1D7E A;  1GCE A;  3Q7Z A;  1JTG A;  1VEU B;  4AFI A;  4Y15 A;  3KO6 A;  1CEG A;  4ARZ A;  1A0K A;  2I9V A;  3A3I A;  3G31 A;  3S22 A;  2ZC5 B;  2PT7 A;  2R9W A;  1XGI A;  1D06 A;  1JWV A;  1YLW A;  2HP9 A;  4UA7 A;  5HD3 A;  1QMF A;  1YLJ A;  2P08 A;  3SS5 A;  4UEY A;  2Y2O A;  4I38 A;  2V1A A;  5CRF A;  4QPR A;  3UDX A;  3V50 A;  5CEC A;  1P0Z A;  3F1P A;  2W27 A;  3PXP A;  3NUL A;  1SCW A;  4FH4 A;  5HSQ A;  1LL5 A;  2WGW B;  3M2K A;  2ZC7 A;  5E2F A;  5K5B A;  4OLD A;  5A92 A;  4WEJ A;  2GDN A;  1MPL A;  2O99 A;  4L9E A;  2QZ6 A;  3C5A A;  5IT5 A;  4I5S A;  3HRE A;  3ZQ5 A;  3RTY A;  4FD8 A;  4E04 A;  3Q7V A;  4HQA A;  5F1F A;  1GSV A;  2ZOH A;  4OQ0 A;  3G4P A;  2HJ9 C;  1MY8 A;  3GTC A;  2PBD P;  4WMC A;  5FI7 A;  4Q8I A;  1LHY A;  3N8L A;  1IOU A;  4KQQ A;  3OPP A;  4MLL A;  1K54 C;  5FDS A;  4N1X A;  3KYQ A;  3AGE A;  3CMZ A;  1NZU A;  3A3E A;  1M40 A;  1PWC A;  3ZHH A;  4CLC E;  4DF6 A;  4KZA A;  2H10 A;  3C7U A;  1K38 A;  4BWI A;  1K55 A;  3IX3 A;  5KMW A;  1K6R A;  1TDL A;  4GN2 A;  4R3J A;  3R4K A;  3BQA A;  5DF7 A;  2ZM2 A;  1TDG A;  4DXB A;  4BD1 A;  1PIO A;  4DMZ A;  4YNR A;  1N9L A;  3ZG8 B;  1YLP A;  4E3J A;  3T4T A;  4GD8 A;  4WYY A;  2BAS A;  1ODV A;  4Y0O A;  4G3K A;  2Y2M A;  4QB8 A;  5HWW A;  1AXB A;  1ESU A;  1TS6 A;  1F98 A;  2XRO A;  2R9X A;  1GA9 A;  3IBR A;  2VLG A;  1PI4 A;  3ZFZ A;  2ZQ8 A;  4WEL A;  4C75 A;  1BYW A;  5JYO A;  4HI4 A;  3WS2 A;  1W5D A;  3QP1 A;  4FH2 A;  2VGJ A;  1ACF A;  3KSF A;  3QNC A;  1RCJ A;  3MZF A;  4KQR A;  4WBG A;  5FQ9 A;  2KDK A;  4JGR A;  4BBT A;  3PHY A;  4R4R A;  4XXR A;  2B5R A;  3G30 A;  1CQA A;  3D4F A;  3V5M A;  4S2N A;  4IUK A;  1PFL A;  4PHT A;  3WS4 A;  1FIK A;  3MF0 A;  5EOO A;  2OOL A;  3MXS A;  4JF6 A;  5AVF A;  2KLI A;  2YKH A;  3CG5 A;  5FQJ A;  2VV7 A;  5FDH A;  2VX8 A;  4S2K A;  2ZC6 B;  2DCF A;  4H6J B;  1FCO A;  4XT2 B;  1K4F A;  5A90 A;  4UQI M;  4P6Z M;  3IQA A;  2HDU A;  2Y4A A;  5GHZ A;  3G2Y A;  3IHB A;  3BRM A;  5G18 A;  4MCW A;  4DKI A;  1HTZ A;  4LCL A;  4N9L A;  5HAP A;  1XXM A;  2H0T A;  4N1H A;  4N9K A;  3VP1 A;  3UB8 A;  2CMN A;  1EW0 A;  1ES2 A;  5CX7 A;  3BY9 A;  2Y2L A;  5TFQ A;  1K4E A;  3LIA A;  3ICY A;  2Y2N A;  4UHU A;  3IS2 A;  2P9V B;  4OPY A;  1D1J A;  2IA2 A;  4HP4 A;  5DVA A;  3P7N A;  1LSW A;  4PM8 A;  4LGW A;  3EQU A;  1YSP A;  1VET A;  1FSW A;  4LPZ A;  5FAO A;  1S67 L;  1YLY A;  2J3T D;  3O87 A;  3ULF A;  1HLU P;  3LY3 A;  3RXX A;  4ETX A;  1SDN A;  4N92 A;  3MZE A;  3N8S A;  3HUM A;  2Y59 A;  1W63 Q;  4CLC B;  2W1T B;  2BG1 A;  4OOM A;  3Q7V B;  2L0W A;  3HUN A;  4O01 A;  2WGI A;  1HZO A;  1SKF A;  4KG6 A;  2J3T C;  2VGK A;  5E43 A;  2B18 A;  5EUA A;  5KZH A;  3NCK A;  3NHQ A;  3IX4 A;  2RL3 A;  4OP5 A;  3SH8 A;  3B3X A;  4S2P A;  5E2E A;  3KX0 X;  1U60 A;  4Y0U A;  5FAQ A;  4EER A;  4HES A;  4DE0 A;  2ZLY A;  4DXC A;  1S6R A;  1O07 A;  2EWW A;  3ZDJ A;  2ZC3 B;  4OOY A;  4Y0T A;  2ZQ9 A;  5MC7 A;  4UA9 A;  4Y5F A;  2V0W A;  2V2F F;  4E3K A;  5CXW A;  3DW0 A;  1Y4O A;  3NOP C;  2XSS A;  2QYB A;  4Y13 A;  4R38 A;  3C4O A;  3RFB A;  5CHM A;  5EVI B;  1ONH A;  3CUE A;  5HPF A;  3TJZ C;  2VJW A;  4ID4 A;  2HP5 A;  2V0U A;  3RH8 B;  5FI6 A;  4B88 A;  2VK3 A;  2XGN A;  3Q82 A;  3CIT A;  3AGD A;  5L8M A;  3S4X A;  3RJU A;  1NWZ A;  4HJ6 A;  4PM6 A;  4HBT A;  3K2N A;  1S4S A;  3PBO A;  1XJ6 A;  4QJG A;  3SS3 A;  2PAV P;  1OT6 A;  3TOI A;  4OQH A;  1QME A;  1G6O A;  5M19 A;  1ZG4 A;  3ZG7 B;  3IF6 B;  2ZL1 B;  3EGD C;  4FOF A;  4U0T A;  2PYP A;  1NLZ A;  1Q2Q A;  2E8I A;  2V1Z A;  2ZMV A;  5DTS A;  1PWD A;  4B93 A;  3S7P A;  5C5K A;  5DF9 A;  5FQM A;  3A0R A;  1H8Y A;  1L0F A;  3LIF A;  2R78 A;  4JGP A;  1JWZ A;  2PHY A;  1CJF A;  2NUP C;  4L9F A;  1GSX A;  5HX9 A;  3BEB A;  4X56 A;  3QHY A;  1LL9 A;  1PYY A;  3B33 A;  4ZTK A;  2WGW A;  3HLB A;  3SH9 A;  3CJM A;  2H28 A;  2HJE A;  2ZMF A;  3WRT A;  4BLM A;  3IHA A;  3OC2 A;  2Y79 A;  4R3A A;  4UQI S;  3TG9 A;  1K6S A;  1W63 M;  2BLS A;  3NDE A;  5TR7 A;  3ZNY A;  4RX2 A;  5J7E A;  1DRM A;  3PBQ A;  5EVL A;  5GLA A;  5F1G A;  3EWK A;  1JVJ A;  1VET B;  1T1A A;  1ES4 A;  3ZGA B;  4FUW A;  3ZNT A;  1RP5 A;  5G4Z A;  4EU0 A;  2XRN A;  4OKP A;  4NXE A;  4IVK A;  4EBL A;  2HDR A;  4ZDX A;  1KE0 A;  4II7 A;  4HJ3 A;  4RA7 A;  3HJK A;  5AQ7 A;  4CLC D;  1W8Y A;  3BFE A;  2XH9 A;  3E4O A;  2IWB A;  5HD5 A;  1NYM A;  3KSI A;  5HFO A;  3D3O A;  3E98 A;  4WMC D;  4OPQ A;  5L07 A;  3HLE A;  3PBT A;  4JLF A;  2HDQ A;  4U0X A;  4GDN A;  3NDG A;  3H7W A;  2VEA A;  5HAI A;  1DJA A;  5CED A;  2ZD8 A;  5F5Y A;  2BTF P;  4WN5 A;  3W8K A;  3ITB A;  3B42 A;  3K3D A;  5AVE A;  2L1M A;  2Y2G A;  4WZ5 A;  5DKL A;  3BLS A;  1ES3 A;  3GVB A;  1LSX A;  1K55 C;  2Y2I A;  2Q9M A;  4BD0 A;  3HCY A;  3LFV A;  1SHV A;  4P85 A;  4S2L A;  2HP6 A;  5EE8 A;  2QHK A;  3QP4 A;  4KZ6 A;  5EVI D;  3H82 B;  4MEZ A;  1CK3 A;  2V8C A;  3NJA A;  2XFS A;  3OPL A;  3IBJ A;  2G7U A;  5J3W A;  3F1O B;  3FG8 A;  3FZC A;  4MBK A;  4JGQ A;  4X55 A;  2JKR I;  4H6J A;  2UV0 E;  4XT2 A;  1T18 A;  4WZ4 A;  5HW3 A;  1DJB A;  2IWD A;  2QJ5 A;  1KVL A;  1W7F A;  1G28 A;  3BYD A;  3BFC A;  4EQ1 A;  2XR0 A;  3VP2 A;  4KEN B;  3NOU C;  1P97 A;  2WKR A;  2WAE A;  5FAT A;  1KVM A;  2VA0 A;  1MWU A;  4YFM A;  1VB6 A;  4G3W A;  4LLO B;  3IXB A;  3PTE A;  2ZBB A;  2JKR M;  3ZG5 A;  4EET B;  5FEG A;  3VOZ A;  4S2N C;  1AWI A;  2P9V A;  1XA7 A;  3P98 A;  4R70 A;  2MJ6 A;  2Z2L B;  2WKI A;  4MN5 A;  2W0N A;  5CEB A;  3EGX C;  3IWQ A;  3N8R A;  3W4O A;  4F3L B;  1BUL A;  3IH8 A;  5TBM B;  1J3W A;  1I2W A;  2H0Y A;  4OLG A;  3T1S A;  3OPH A;  4E3L A;  1FSY A;  5DFY A;  4CLC A;  4PKY A;  2W1T A;  4C3Q A;  4DE2 A;  3CI6 A;  3W2Z A;  1ES5 A;  3Q81 A;  2O9B A;  1UWP X;  2EFU A;  3VSK A;  4G3V A;  2QPN A;  2M7U A;  4U3T A;  3HL9 A;  3HLF A;  5KIZ A;  4LV2 A;  1C3B A;  2HGV A;  1H0M A;  4FCF A;  3EOI A;  2FZ0 A;  1GA0 A;  3UDI A;  3C4P A;  1MWS A;  3MFX A;  4K0W A;  4NG2 A;  1XJ3 A;  3MQ0 A;  3VE4 A;  1HD8 A;  3G32 A;  3A3J A;  2WAD A;  1S1Z A;  2Y2K A;  1YQS A;  3IXD A;  2EX8 A;  1BLP A;  4MNR A;  5CGS A;  2GX5 A;  1XJ2 A;  5F6A A;  5CTN A;  5DKK A;  3PBS A;  3E4P A;  3S7Q A;  5EVI A;  3WWX A;  3FPW A;  5F68 A;  5F83 A;  4LRZ E;  3T12 B;  4EUV A;  3DTK A;  3H7W B;  1BLC A;  2OLU A;  2W3F A;  3C8C A;  5GLD A;  1OTA A;  2GJ3 A;  3NC8 A;  3IWI A;  4C6Y A;  3CPT A;  4O0P A;  4GD6 A;  2VZW A;  2P04 A;  1JTD A;  3S1Y A;  2Y2Q A;  1W8Q A;  3C30 A;  3ZVW A;  4Y7P A;  4GDB A;  1GHP A;  1MBL A;  2J7V A;  1VM1 A;  3PAE A;  5GHY A;  3VP4 A;  4KZ5 A;  4Q0J A;  3FC7 A;  3GSG A;  3BFG A;  4JPM A;  4XUX A;  4KZ8 A;  4CPK A;  1BZA A;  3IF6 A;  3IXH A;  2B02 A;  3UNW A;  1HVB A;  2P7J A;  3O5Y A;  2ZL1 A;  2E8J A;  4GHI B;  3IF5 A;  5HL1 A;  1FQG A;  4R23 A;  4ZJ1 A;  1YAX A;  5A93 A;  4X68 A;  2GZA A;  3LR0 A;  1K57 A;  4E6X A;  3TE8 A;  4PKY G;  3FWL A;  3E2L A;  3CUE C;  1IKI A;  1NRF A;  1IFQ A;  4BQM A;  5FSR A;  2JN7 A;  1SZV A;  4O7D A;  2D01 A;  1E3U A;  4GB7 A;  4YIN A;  4MMN A;  2OLV A;  5FA7 A;  2C5W B;  3SW1 A;  1V9Z A;  5HAR A;  2Z6D A;  2ZJ9 A;  3UB5 P;  1UGU A;  1LI0 A;  1F2K A;  4E6W A;  1GHM A;  4HH3 A;  2WYX A;  2QWS A;  3NEC A;  4LV1 A;  3E2K A;  4K0X A;  1CI9 A;  2I72 A;  4PPR A;  4IVI A;  3WS1 A;  4R1G A;  3M6B A;  1FIL A;  4ZBE A;  3ZCZ A;  1S66 L;  4DJ3 A;  5IHV A;  3EEH A;  3GDI A;  2WGV A;  2DMW A;  2W3H A;  2XFT A;  3VP0 A;  3QP2 A;  1ERQ A;  4BJP A;  2VGL M;  4P6B A;  3ZG9 B;  4E3I A;  2X01 A;  2XD1 A;  4MN6 A;  3GRJ A;  1P9W A;  1BLH A;  4L0L A;  4B9O A;  3CZD A;  1ZC2 A;  5FAS A;  5IU1 A;  3K3C A;  3UPN A;  4D2O A;  1NY0 A;  3F1N B;  3DWK A;  3OOV A;  4LCM A;  4EW7 A;  3MQO A;  1PRQ A;  3PR6 A;  5FL3 A;  3VE3 A;  4KZ7 A;  2A24 B;  2FFY A;  4LRY C;  4NET A;  4JXW A;  3GV9 A;  1J9M A;  4OH0 A;  5GHX A;  3GQZ A;  3VSL A;  2OV5 A;  2C6W B;  2V9A A;  1L0G A;  4ETZ A;  1WYB A;  3H82 A;  2J9O A;  3LR3 A;  1OTE A;  4QWO A;  2Z2M B;  2KX6 A;  4IUH A;  2PYR A;  3OZH A;  2J9P A;  3F1O A;  2J80 A;  1T1C A;  4LFU A;  3CPT B;  1PZP A;  4K91 A;  3MKE A;  3UE0 A;  3O86 A;  2OSU A;  2Z6C A;  4GCZ A;  4HBU A;  5CGX A;  1Q2P A;  3MS6 A;  2AVX A;  3O88 A;  3MFD A;  1L3L A;  4HH2 A;  4KQD A;  5CHJ A;  1MWT A;  4EBP A;  4KUK A;  2ZQ7 A;  3A3D A;  4P87 A;  3A0V A;  3V39 A;  4WZ5 C;  4JBF A;  2LB5 A;  1YLT A;  1PW1 A;  1KE3 A;  3JVU A;  4IJG A;  3MR0 A;  3SOI A;  2FH5 A;  4GZB A;  5DF8 A;  1L0D A;  1H5X A;  3MZD A;  1RGZ A;  3DBA A;  1KGE A;  5DJU A;  5HWV A;  4F3L A;  5TBM A;  4P0M A;  1H3Q A;  3BEC A;  2JKF A;  3QP6 A;  3R7W B;  5HZH A;  4XUZ A;  3LID A;  3MXQ A;  4IED A;  3BLM A;  4PM5 A;  3BQ8 A;  3TSG A;  1N9N A;  5KSH A;  1IYP A;  4HOI A;  3E0Y A;  3L7H A;  4L9G A;  3MJQ A;  3FYZ A;  2ZMA A;  1S1Y A;  2HF6 A;  1NJ4 A;  1PNE A;  3UO9 A;  3EEA A;  3NBL A;  1NLY A;  1TS7 A;  4GOG A;  3NOT C;  3LIB A;  4OQG A;  3BY8 A;  3D9Y A;  3IWO A;  2X71 A;  5AQB A;  1OTB A;  3P01 A;  3VV4 A;  2XF3 A;  3T4O A;  3FKW A;  4LRX C;  4WLA A;  3E4Q A;  1NZO A;  2O9A A;  4M4X A;  2J8Y A;  1MXO A;  4OQI A;  3M2J A;  3T1Q B;  5CHU A;  5HDC A;  2KOI A;  3VOY A;  4I3A A;  1IEM A;  3W4P A;  4CLC C;  4NKP A;  1YT4 A;  4NXF A;  5CER A;  5DFX A;  3GR2 A;  2EX6 A;  2VGL S;  1L0E A;  3PYP A;  2A2L A;  3B47 A;  3WRZ A;  1LSV A;  5KSC A;  1ERM A;  2Q0O A;  2XDM A;  1OT9 A;  3SH7 A;  5EM1 A;  3T1X A;  2ACG A;  3BWL A;  4PM7 A;  2WZZ A;  3JYI A;  2K2N A;  3MBZ A;  3A3F A;  4RQ9 A;  3OPR A;  5EEC A;  4GHI A;  2A3U A;  1E25 A;  3T4K A;  4NXG A;  3SZT A;  4KZ3 A;  3G2Z A;  5I5L A;  5LBR A;  5M1A A;  3ITA A;  2Y2P A;  3ZG0 A;  5EVI C;  5HAQ A;  4WEK A;  5TGF A;  4ESP A;  5L2F A;  2CC1 A;  3VFH A;  5FQK A;  3C2W A;  4QY5 A;  1RGY A;  2O0Y A;  2WK0 A;  5F69 A;  3N7W A;  3LCE A;  2Y2J A;  1CEF A;  3HLG A;  4KG2 A;  5BOH A;  2A49 A;  3MMH A;  1ZG6 A;  3FPV A;  1ONG A;  1NXY A;  2EA9 A;  1XGJ A;  1F9I A;  2L4R A;  4R4S A;  3DAV A;  2XA7 S;  3LR4 A;  3H9W A;  4RX3 A;  5F82 A;  2PU2 A;  4I3J A;  5A91 A;  1WA9 A;  1SKO B;  3BW6 A;  4OVD A;  4Y2F A;  1BTL A;  5HWT A;  2V1B A;  2V20 A;  4D60 A;  4RYE A;  3MSH A;  2JC7 A;  3IT9 A;  3LI8 A;  1XX2 A;  3IF6 C;  1FR1 A;  2OWH A;  3UE6 A;  2WAF A;  2EFX A;  4YOF A;  1XFQ A;  1BUE A;  1STZ A;  3MXR A;  5DTT A;  1FCN A;  5GLB A;  1T1B A;  1E3U D;  3EQV A;  4S2I A;  1K57 C;  4Q0H A;  3V67 A;  2OAP 1;  3PBR A;  4QY6 A;  1OJ5 A;  2XQZ A;  4PAU A;  3T4J A;  1TVF A;  2XEP A;  2WKP A;  1YMX A;  3DTM A;  4X69 A;  3P09 A;  3LUQ A;  1FOF A;  3PAG A;  1DY6 A;  1H8Z A;  4HIA A;  3Q1F A;  3F1N A;  1XJ4 A;  3LIE A;  4R3B A;  1CF0 A;  4GNU A;  2YKF A;  4BL2 A;  2PDR A;  2ZQC A;  3UN7 A;  2A24 A;  1BLS A;  3V3S A;  4ZRR A;  4Z1W A;  4HJ4 A;  2PR6 A;  1NRJ A;  2HDS A;  4GJ4 A;  3G6O A;  5AQA A;  2PD7 A;  4NXB A;  1KGF A;  4KUO A;  4X53 A;  3KSH A;  1XA1 A;  3W4Q A;  3HVF A;  4MBH A;  1ALQ A;  3G34 A;  1YKD A;  4OPR A;  2RCX A; 
#chains in the Genus database with same CATH homology
 3LIC A;  4L9F A;  1GSX A;  4GS9 A;  2NUT C;  4BJP A;  2VGL M;  4KQO A;  3B33 A;  3OLO A;  4EES A;  2EWV A;  1KOU A;  1LL8 A;  2H28 A;  1DP8 A;  2HJE A;  2M7V A;  2ZMF A;  4MN6 A;  4ME4 A;  3TRC A;  2M1C A;  1P9W A;  3T4L A;  1OPX A;  2ZOI A;  4MN7 A;  4L0L A;  3UB9 A;  4HHD A;  5A8B A;  4B9O A;  1YSQ A;  1V9Y A;  1TD5 A;  3OC2 A;  5IU1 A;  2Y79 A;  3K3C A;  1D7E A;  4R3A A;  4UQI S;  1W63 M;  3CLO A;  4AFI A;  3F1N B;  3KO6 A;  5J7E A;  3TW8 A;  1DRM A;  3PBQ A;  4ARZ A;  3OOV A;  2I9V A;  4EW7 A;  3MQO A;  5FL3 A;  3PR6 A;  3VE3 A;  3UE3 A;  2PT7 A;  2A24 B;  3JVV A;  1D06 A;  4LRY C;  3EWK A;  1T1A A;  5HD3 A;  5HDD A;  2P08 A;  4FSF A;  4UEY A;  3OCN A;  1OJG A;  5G4Z A;  2PR5 A;  2XRN A;  2V1A A;  4I38 A;  4EU0 A;  1TF1 A;  2V9A A;  4NXE A;  1OTI A;  4QPR A;  4ETZ A;  1P0Z A;  3F1P A;  4GS9 B;  4II7 A;  2W27 A;  3H82 A;  4HJ3 A;  3LR3 A;  3HJK A;  3PXP A;  4CLC D;  1OTE A;  5HSQ A;  2KX6 A;  2NUP C;  4IUH A;  3E4O A;  5HD5 A;  2PYR A;  2QJ7 A;  5K5B A;  4WEJ A;  3KSI A;  3F1O A;  3D3O A;  3E98 A;  2J80 A;  1T1C A;  2O99 A;  4L9E A;  3CWF A;  5IT5 A;  4I5S A;  4DJ2 A;  3R7W A;  3ZQ5 A;  3RTY A;  4GW9 A;  3PBT A;  5IS1 A;  4E04 A;  4HQA A;  1GSV A;  1H8M A;  2ZOH A;  2Z6C A;  4GCZ A;  2HJ9 C;  3H7W A;  2VEA A;  4NEE D;  4ARZ B;  5F5Y A;  4WN5 A;  4HH2 A;  4KQD A;  1IOU A;  3B42 A;  3K3D A;  3KYQ A;  3KYZ A;  5AVE A;  2L1M A;  4KUK A;  4R6L A;  4CLC E;  5DKL A;  3A0V A;  1X0O A;  4BWI A;  1LSX A;  1ZTU A;  2LB5 A;  2VV8 A;  2K7S A;  3JVU A;  2JKT I;  4IJG A;  3HCY A;  3LFV A;  4BBU A;  4EEU A;  3R4K A;  3BQA A;  3S7N A;  3MR0 A;  2QHK A;  2FH5 A;  3F1P B;  4Y3I A;  3H82 B;  4DMZ A;  4YNR A;  1N9L A;  3LI9 A;  1DP9 A;  3DBA A;  3MQQ A;  3T4T A;  3NJA A;  5DJU A;  3IBJ A;  2BAS A;  4F3L A;  2G7U A;  5HWV A;  1ODV A;  5J3W A;  4G3K A;  3F1O B;  5TBM A;  5HWW A;  1H3Q A;  3FG8 A;  4JGQ A;  1TS6 A;  1VHM A;  1F98 A;  2XRO A;  2JKR I;  4H6J A;  5EFW A;  3R7W B;  5HZH A;  3IBR A;  4XT2 A;  2VLG A;  3LR5 A;  1ZHH B;  2JKT M;  1T18 A;  3LID A;  3MXQ A;  5TJJ A;  4WEL A;  4CQH A;  1BYW A;  3BQ8 A;  2QJ5 A;  4HI4 A;  3KSG A;  1N9N A;  5KSH A;  4HOI A;  3E0Y A;  4L9G A;  3MJQ A;  1G28 A;  3KSF A;  1S1Y A;  3S7O A;  2HF6 A;  4EQ1 A;  1F5M A;  3UB6 A;  2KDK A;  3NOU C;  3EEA A;  1P97 A;  4JGR A;  2GNX A;  1NLY A;  2WKR A;  1TS7 A;  4BBT A;  3PHY A;  3NOT C;  3LIB A;  4BBV A;  2VA0 A;  3BY8 A;  1VB6 A;  4G3W A;  4LLO B;  2ZBB A;  2JKR M;  1OTB A;  2W3H A;  4EET B;  4BMW A;  3P01 A;  3VV4 A;  4IUK A;  5G4Y A;  4PHT A;  3T4O A;  3MF0 A;  3UB7 A;  2OOL A;  4R70 A;  1DP6 A;  4LRX C;  2MJ6 A;  4WLA A;  4EEP A;  3E4Q A;  4MN5 A;  5AVF A;  2W0N A;  3U2A A;  3EGX C;  2KLI A;  2YKH A;  2O9A A;  1MKM A;  4M4X A;  4F3L B;  3GEC A;  2VV7 A;  5TBM B;  2VX8 A;  2PD8 A;  3D72 A;  1JNU A;  5HDC A;  2KOI A;  4H6J B;  4I3A A;  4XT2 B;  5DFY A;  4CLC A;  4PKY A;  2W1T A;  4UQI M;  3CI6 A;  2XA7 M;  4NKP A;  4P6Z M;  3W2Z A;  4CLC C;  4NXF A;  2O9B A;  5DFX A;  4HP9 A;  2W3E A;  2VGL S;  3PYP A;  4MCW A;  2O9C A;  1UWP X;  2A2L A;  2VV6 A;  4G3V A;  3OCL A;  3B47 A;  2M7U A;  5KIZ A;  3T4S A;  4I3I A;  2HGV A;  1LSV A;  3UB8 A;  2CMN A;  1OT9 A;  1EW0 A;  5CX7 A;  3BY9 A;  3C38 A;  2FZ0 A;  3EOI A;  3LIA A;  1MZU A;  3ICY A;  5AJG A;  3A0S A;  3MFX A;  3BWL A;  4DN0 A;  3IS2 A;  2K2N A;  1XJ3 A;  4RQ9 A;  3MQ0 A;  3VE4 A;  2IA2 A;  1GSW A;  1P9R A;  4HP4 A;  3P7N A;  1LSW A;  4GHI A;  3EQU A;  1YSP A;  1S1Z A;  4WL9 A;  4LPZ A;  3T4K A;  4OOL A;  3UMD A;  1S67 L;  4NXG A;  2K31 A;  3T50 A;  5I5L A;  2GX5 A;  2J3T D;  1XJ2 A;  3ULF A;  3ZYT A;  5F6A A;  5LBR A;  4ETX A;  5DKK A;  3PBN A;  3PBS A;  3E4P A;  3S7Q A;  1W63 Q;  2OAQ 1;  4CLC B;  3FPW A;  2W1T B;  5F68 A;  4WEK A;  4OOM A;  2L0W A;  1OTD A;  4LRZ E;  4EUV A;  4O01 A;  3H7W B;  3C2W A;  2W3F A;  3C8C A;  2HV1 A;  2INW A;  2O0Y A;  2J3T C;  5F69 A;  2VKS A;  1OTA A;  2GJ3 A;  2B18 A;  4GLQ A;  4O0P A;  3NHQ A;  4HY8 A;  2VZW A;  2P04 A;  3C30 A;  3MMH A;  2D02 A;  2QKP A;  1T19 A;  3FPV A;  3KX0 X;  2EA9 A;  4EER A;  1F9I A;  2L4R A;  2XA7 S;  3LR4 A;  4P6Z S;  1TS8 A;  2W3D A;  3H9W A;  3LYX A;  5DJT A;  4I3J A;  2EWW A;  4Q0J A;  3FC7 A;  3IS2 B;  4IHQ A;  1WA9 A;  5MC7 A;  3BJN A;  3BW6 A;  4Y2F A;  5HWT A;  2V1B A;  4WUJ A;  2B02 A;  2P7J A;  3O5Y A;  2V0W A;  4Y5F A;  3LI8 A;  4GHI B;  2OWH A;  4I39 A;  2WKQ A;  3UE6 A;  2J3W A;  4K08 A;  4YOF A;  3NOP C;  2XSS A;  1XFQ A;  2LB9 A;  2QYB A;  1LT0 A;  1YAX A;  1STZ A;  4R38 A;  3HJI A;  2GZA A;  3RFB A;  1T1B A;  3LR0 A;  2Y8H A;  3EQV A;  4MDZ A;  3CUE A;  3TE8 A;  4Q0I A;  5HPF A;  4PKY G;  3TJZ C;  2OWJ A;  2VJW A;  3CUE C;  2V0U A;  3RH8 B;  1IFQ A;  5J4E A;  4Q0H A;  3V67 A;  1Y28 A;  2OAP 1;  3PBR A;  1OJ5 A;  3T4Q A;  2JN7 A;  3CIT A;  5L8M A;  4PAU A;  2D01 A;  1NWZ A;  4HJ6 A;  2W3G A;  3T4J A;  2WKP A;  4JGO A;  4MMN A;  3VOL A;  3K2N A;  3LUQ A;  3SW1 A;  1XFN A;  1S4S A;  3PBO A;  1V9Z A;  1XJ6 A;  2Z6D A;  2JHE A;  1OT6 A;  4HIA A;  1UGU A;  1G6O A;  3F1N A;  4HNB A;  4YWZ A;  1XJ4 A;  4O8G A;  5HL6 A;  5HPI A;  3LIE A;  4HH3 A;  5HDS A;  3CAX A;  2YKF A;  1MC0 A;  2QWS A;  2PDR A;  3EGD C;  4FOF A;  2A24 A;  2PYP A;  1NLZ A;  4ZRR A;  4Z1W A;  2ZMV A;  1S4R A;  4HJ4 A;  2PR6 A;  4WF0 A;  1NRJ A;  4B93 A;  4GJ4 A;  3G6O A;  3S7P A;  3UME A;  5C5K A;  5DF9 A;  2PD7 A;  4NXB A;  3OBF A;  4KUO A;  3KSH A;  1UWN X;  1S66 L;  3A0R A;  4DJ3 A;  3EEH A;  3GDI A;  1TS0 A;  3LIF A;  2R78 A;  4JGP A;  1YKD A;  2DMW A;  2W1R A;  2PHY A;  1N9O A;  4EXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...