4BBVA

The pb0 photocycle intermediate of photoactive yellow protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Watching a Signaling Protein Function in Real Time Via 100-Ps Time-Resolved Laue Crystallography.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
molecule keywords PHOTOACTIVE YELLOW PROTEIN
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4bbvA00
3GECA 3F1NB 4DJ3A 2W0NA 5DJUA 1S4RA 3EEHA 3FC7A 4BBUA 2PDRA 2I9VA 1JNUA 2PYRA 3H7WA 2BASA 2ZOHA 3A0RA 4HJ4A 2PD8A 5HD5A 5J3WA 3ULFA 4RQ9A 1DRMA 4LRXC 2QJ7A 2W27A 1XJ4A 4NXGA 3VE4A 1OTIA 1N9OA 3LICA 4R3AA 2L0WA 3F1PB 1T1CA 4EETB 3MQOA 4XT2A 1S1ZA 4EESA 3CWFA 4HNBA 5AVFA 5J7EA 4WUJA 1LSVA 3PHYA 1LT0A 2CMNA 4H6JB 2PHYA 1OT9A 3EWKA 4B9OA 1UWNX 1NWZA 4EXOA 3CLOA 2PR6A 3VOLA 4JGRA 1EW0A 4PKYG 5IS1A 4DJ2A 5HDSA 3HJIA 2OWJA 4KUOA 3KX0X 4LPZA 5AVEA 1UWPX 3H82A 3C8CA 3LIDA 5DKLA 1TS7A 4KUKA 5F68A 4BBTA 2GJ3A 1S1YA 1OTDA 1KOUA 1XFNA 1P0ZA 2R78A 3F1PA 2PD7A 3PYPA 4H6JA 1MZUA 2D01A 3NOTC 4HJ6A 5HWVA 4JGOA 5I5LA 1GSVA 5TBMA 3LIBA 1N9NA 1OJ5A 1X0OA 1XFQA 3MXQA 3P7NA 3MJQA 1DP6A 2A24A 4HH3A 4HH2A 4K08A 4WL9A 3K3CA 5HDCA 1LSXA 3RTYA 5A8BA 1UGUA 3F1OB 3G6OA 4I39A 2M1CA 1WA9A 3BWLA 4HY8A 3K3DA 3H82B 4HQAA 3LI8A 4NXBA 5G4YA 4F3LA 1S67L 3F1NA 1F98A 3LIFA 3NHQA 4I3IA 4EEUA 5G4ZA 1OTAA 4EQ1A 5J4EA 4HOIA 1V9YA 1TS8A 4I38A 1BYWA 3IS2B 4LRZE 4NXEA 3MR0A 3NJAA 4JGPA 3IBRA 4F3LB 1S66L 1S4SA 5F5YA 3UB6A 2ZBBA 2QHKA 4GHIA 1T1AA 2A24B 2JN7A 1T1BA 1P97A 1D7EA 1TS0A 2OOLA 2V9AA 3BY9A 2V0UA 3CAXA 3LIEA 4R6LA 4WN5A 5IU1A 1V9ZA 3RH8B 5HWTA 4L9EA 4R70A 5DKKA 1XJ2A 5F6AA 1OJGA 3A0SA 2JHEA 1GSXA 3E4PA 1LL8A 2VV8A 2VEAA 2ZOIA 2QKPA 2QWSA 4EERA 3LIAA 4R38A 3UMDA 1XJ3A 2INWA 3MQQA 3LI9A 1OTEA 1DP8A 2HV1A 2Z6CA 4LLOB 3SW1A 2H28A 2P7JA 3UB9A 4HP9A 4XT2B 4GHIB 4LRYC 5HD3A 2KX6A 4L9GA 2L4RA 3LUQA 2K7SA 2VV7A 5TBMB 5HWWA 2EA9A 1VB6A 1DP9A 2PYPA 2WKQA 5KIZA 2QJ5A 2V0WA 4I3JA 4JGQA 3E4OA 1N9LA 2B02A 2WKRA 2YKHA 5HZHA 3VE3A 5HDDA 5HSQA 1OTBA 3NOPC 4GCZA 2D02A 4GW9A 4HIAA 2OWHA 3LYXA 3E4QA 4PKYA 4WF0A 4HI4A 5EFWA 3T50A 4I3AA 3UB7A 4E04A 3GDIA 1ODVA 3D72A 3OLOA 1G28A 3IS2A 3ZQ5A 2WKPA 3UE6A 3UMEA 4MN6A 4EEPA 1D06A 2KDKA 3BY8A 3C2WA 4EW7A 4GS9A 4HP4A 4M4XA 4NXFA 3NOUC 1XJ6A 1T18A 4HJ3A 1T19A 2Z6DA 1OT6A 4HHDA 2VLGA 2YKFA 3F1OA 3ICYA 2VV6A 3MFXA 4MN5A 1F9IA 4I5SA 2V1BA 4YWZA 1TS6A 3H7WB 4L9FA 2L1MA 3UB8A 3B33A 4GS9B 1GSWA 2J80A 4BBVA 1LSWA 4KQDA 3HJKA 3FG8A 3A0VA 2PR5A 4WLAA 1Y28A 3H9WA 5DJTA 5F69A 2V1AA
chains in the Genus database with same CATH superfamily
1F5MA 2EX6A 5FEGA 5L10A 1MXOA 2K31A 1GHIA 3N6IA 5DF8A 4EETB 1FIKA 2JCHA 3LR5A 3Q07A 1H8YA 3CPTA 2ZQ8A 5FQJA 3ZFZA 1S1YA 2R78A 3HLCA 2XF3A 2ZQ7A 3MXSA 5E2GA 3IT9A 4OKPA 3ZG8B 4OOLA 3UPNA 3OPHA 2J9PA 3IWIA 4LGWA 3T12B 2Y2PA 3WRZA 1XP4A 3IS2B 2Y79A 3PBOA 3IBRA 2Y2MA 1CI9A 1P97A 2V9AA 2HDSA 1LHYA 4WZ5A 1YLTA 3FKWA 4P6ZS 2QKPA 2BTFP 4R38A 4O7DA 2INWA 4LV1A 4JF5A 3A3DA 4LV2A 4P6ZM 4IEDA 2HGVA 1CQAA 3HBRA 4OQGA 4BMWA 2WKRA 4PHTA 4Y0TA 2R9XA 2X71A 2ZQ9A 4QD4A 3G2YA 1ES3A 4LCLA 4WM9A 1IEMA 3Q81A 3ZQ5A 1XJ6A 5A91A 3P98A 2L1MA 1XGJA 3LY3A 1TF1A 4R3JA 1PRQA 3TJZC 3L9KA 1DJCA 3MQ0A 3F1NB 4O0PA 5HD5A 4R0QA 5J3WA 3HLWA 3BFFA 2V8CA 3IF6A 4A5RA 2IA2A 5KZHA 1LT0A 1FSWA 1OT9A 1W63Q 1K38A 1U60A 3CLOA 5IS1A 2VKSA 3IHBA 5DKLA 2Y2HA 1MZUA 5FI6A 3QNBA 1XFQA 5FQQA 2W3HA 2FFYA 4HY8A 1KE0A 3S4XA 4YINA 2QZ6A 3ZVTA 3ZG9B 1TS8A 3C38A 1K25A 4NXEA 2WADA 3Q7ZA 1FR6A 4GHIA 5DKKA 2VEAA 4ZDXA 4QY6A 3CPTB 3LI9A 1K55C 4OPZA 5F83A 4PM7A 3V5MA 2XD1A 4YNRA 3D4FA 4I3JA 2KLIA 1PNEA 4IUKA 3WRTA 4UA9A 5DTKA 5G4ZA 2YKFA 5EECA 4YWZA 1SKFA 2HJEA 3U4LP 4E6WA 1MWSA 3A3EA 2O9AA 3GECA 1IYOA 4BBUA 3W4PA 3ZYTA 1ONGA 4XUZA 4JBFA 2VGLM 5EOOA 1LSVA 3ZG7B 4B9OA 4LFUA 4JGRA 4R23A 3OPRA 1Y4OA 5HSQA 2VGLS 3WS4A 2FH5A 3VOYA 2D01A 3HVFA 3NOTC 4DDSA 5I5LA 3MXQA 5M19A 1OMEA 5CHUA 3NDEA 3G6OA 2WZZA 1FSYA 3H82B 4KZ8A 3U2AA 4ARZA 3M6BA 2XA7S 3S22A 4HESA 5AQAA 1MWUA 4E3MA 5A93A 1FR1A 3MR0A 4RX2A 4WZ5C 2Y2IA 3UB5P 1IYQA 2E8IA 1TS0A 1YLPA 1XJ2A 1OJGA 1NLYA 2JHEA 3G34A 2M7UA 3SS5A 2B18A 3MKEA 3UMDA 1KE4A 3JYIA 3G2ZA 4OPRA 2P7JA 4HP9A 2KX6A 2PU4A 4PM9A 3RXWA 4KZ4A 1JWZA 2Y91A 4WMCA 4EEPA 3GDIA 2V20A 1NXYA 3VP4A 2J3TD 4LENA 3BRMA 1SHVA 2ZLYA 5E2HA 2WGIA 1E3UA 4M4XA 1PWCA 2V8FA 1T18A 5HAIA 5HARA 1YT4A 2K2NA 2V1BA 3QP6A 4ZTKA 1K54C 3E98A 2OAP1 4GD8A 2WK0A 4AFIA 3LEZA 2X01A 1ESUA 2PBYA 4KQQA 4PAUA 3HLBA 2AVXA 3TRCA 2PDRA 3C7UA 4PM8A 3A3JA 4R3AA 1G68A 5AVFA 3MSHA 4WUJA 2JKRI 3VSKA 3OPPA 4IVIA 4PM5A 2PR6A 1IYPA 5F68A 4Y2FA 4GKUA 3C5AA 1P0ZA 5CEDA 2ZQDA 2XH9A 1GSVA 3HCYA 3B42A 4K08A 5DF7A 2HZ5A 3K2NA 4MBFA 3FPVA 3TW8A 3IWOA 3TE8A 2WAEA 1K55A 1NLZA 4IBRA 4JXSA 1RGYA 3BFGA 4DE1A 4OONA 5F5YA 2C5WB 1T1AA 4R4RA 4X53A 1YMXA 2V0UA 4LV0A 4C3QA 4H8RA 4S2MA 4X56A 1EWZA 3W2ZA 2GZAA 4FH2A 5A90A 1NZOA 4KZ3A 5DF9A 4LCMA 1L0DA 4ETZA 1JTGA 4IBXA 2K7SA 2L4RA 2VZWA 2EA9A 2QJ5A 3MZFA 5IHVA 1OTBA 2MJ6A 3E4QA 1ODVA 1FCNA 1G28A 2GX5A 3G32A 1SKOA 1JWVA 3CG5A 1T19A 1NJ4A 2VLGA 4FTXA 1BLSA 4L9FA 3O88A 4B88A 3UB8A 4CLCC 2HP9A 3FG8A 2W3GA 3QHYA 4D60A 4GDNA 1K0KA 3V3RA 4OOMA 4N9LA 3MF0A 3HLFA 4LRXC 2CC1A 4Q0IA 3LICA 4Q8IA 1K4EA 2XR0A 4HNBA 3AGFA 5CGSA 5FL3A 2O9BA 3FZCA 5CTMA 4G3KA 3VP0A 5FASA 1ZC2A 1I2WA 4FSFA 1IFQA 3K3CA 1L3LA 5A8BA 3UE0A 2NUTC 1K56A 1F98A 3VV4A 1K57A 3EGXC 5FDSA 3UN7A 4LRZE 2PAVP 3EGDC 5KSCA 2JN7A 2J3WA 3BW6A 3BY9A 5CTNA 2H10A 1BLPA 3IQAA 5HWTA 5FQIA 2XRNA 2Y2KA 1P9WA 4Y13A 4S2OA 1OPXA 2ZOIA 3NECA 4JPMA 2J7VA 3E2LA 2JKGA 4MBKA 3KYQA 2XLNA 2Y2NA 2XFSA 3ZNYA 5HD3A 5JYPA 5CRFA 4OLGA 1VB6A 1DP9A 5F82A 2B02A 3HUMA 1PIOA 2ZC7A 4OH0A 3SH7A 4E3LA 4K0XA 3JVUA 2HDUA 3BFCA 4MN6A 1PFLA 1J9MA 3UDIA 2JE5A 5GHYA 2WKEA 2ZC4B 4WYYA 4MN5A 3MFXA 5KSHA 2J9OA 3IXBA 4P0MA 3BECA 1Z6FA 4OP5A 3NY4A 2PR5A 4WLAA 3OCNA 1KGFA 3BQAA 3FC7A 3A0RA 5AJGA 1TVFA 2P9VA 3WS0A 2L0WA 1S1ZA 5CERA 5J7EA 1L0FA 1DJAA 4S2NA 4GDBA 4EXOA 1NRJA 3KSGA 4R3BA 4LPZA 4Z9QA 5AVEA 3AGEA 1KOUA 2HJ9C 3W4QA 1AXBA 4HH3A 3N4IA 2XD5A 1UGUA 5FEFA 3LGOA 4KZ6A 3VP1A 4OLDA 4KZAA 1L2SA 4PM6A 2A24B 1KE3A 1QMEA 5EVID 2ZQAA 3FV7A 4GNUA 2C6WB 3SZTA 3PBRA 4JLFA 4JF6A 1ESIA 1DP8A 2JKTI 4E3JA 4XT2B 3MS6A 2ZC5B 2ZM0A 4CLCD 5HZHA 3C7VA 2Y4AA 1QMFA 5FAOA 4E6XA 2Y2JA 4WF0A 2XEPA 1ONHA 2P08A 3O5YA 3IS2A 4GJ4A 4PPRA 4CLCE 3ZCZA 4EUZA 5BOHA 1MWTA 3V67A 5HAPA 1H8MA 1C3BA 1PYYA 3KYEA 4ZAMA 5E43A 1O7EA 4BENA 2EFXA 5GL9A 1W7FA 3BQ8A 4ESPA 2QYBA 5DFYA 3UO9A 3NCKA 5A92A 3W8KA 2ZOHA 1YSPA 4NXGA 3VE4A 3N8LA 1HD8A 1T1CA 2JKRM 4XT2A 5EVIA 1PI4A 3MQOA 3CWFA 1MY8A 4DDYA 2P9VB 5GHXA 1VETA 3NDGA 3IF5A 3PBNA 1UWNX 1EW0A 3BJNA 4DJ2A 3KX0X 1FCOA 1L0GA 3H82A 4DE2A 1TS7A 1FOFA 1F2KA 3PYPA 4GZBA 1VQQA 1CEFA 3SS4A 2X02A 5FQKA 5EOEA 4KZ9A 3BWLA 2WGWA 1MPLA 1S67L 4S2JA 3F1NA 4HOIA 4ZBEA 2O9CA 4JXVA 3WS2A 4E3NA 3T4SA 1S4SA 3GSGA 4NG2A 4P6BA 2HDRA 3GMWA 3RH8B 3UDFA 2R9WA 4R70A 5K5BA 3LY4A 2Y55A 3MQQA 5L2FA 3FPWA 4LLOB 3D3OA 2H28A 1LL5A 1ALQA 3GRJA 4FCFA 5KIZA 4C6YA 3G4PA 3TG9A 4BWIA 1KGGA 3GQZA 3HL9A 3UMEA 5CECA 3P09A 2ZM8A 4NXFA 4N9KA 1YQSA 4JXGA 4HHDA 4JF4A 1PI5A 3CUEA 5DTTA 1N9BA 5J8XA 1DJBA 2UWXA 5CGXA 4MMNA 1VEUA 3PBTA 5FAQA 3T1SA 1BLHA 4O01A 5F1FA 2J3TC 2G7UA 1XGIA 1PZOA 2I9VA 3PXPA 3CJMA 3KYZA 5FAPA 1ZKJA 2EXAA 4EWFA 1NRFA 1ES4A 1ES5A 1FCMA 3PBQA 1RGZA 2VJWA 3QP4A 1NYYA 2WKHA 2Y8HA 3HJIA 4KUOA 5AQ7A 3C8CA 4MCWA 4KUKA 3G31A 3F1PA 2PD7A 3BFDA 4HJ6A 5TBMA 3MBZA 3P7NA 1DP6A 3G30A 4QB8A 1PZPA 5M1AA 1KVMA 2LB5A 4EQ1A 1W8YA 3GTCA 4MLLA 4KG2A 4F3LB 1S66L 2ZBBA 4RVAA 5FQ9A 4DMZA 5FI2A 3CAXA 1TEMA 3PR6A 2W3EA 1LL8A 3LIAA 3T1XA 1GCEA 1H0MA 4DN0A 2ZQCA 2IWBA 3LO7A 2A3UA 2WKQA 1TD5A 5HDDA 2FZ0A 4WBGA 3O87A 3T50A 1YKDA 3SH9A 4Y0UA 1ZG4A 3VOZA 5FDHA 2H0YA 2HP6A 1ERQA 3IXGA 4HP4A 3HREA 4S2KA 3T4OA 1F9IA 4I5SA 1YM1A 4GS9B 1K6RA 1LSWA 4DRTA 3W4OA 3MFDA 1IOUA 2JKFA 3PAEA 1SZVA 3HLDA 3MMHA 3H7WA 1XJ4A 3IF6C 3QP1A 3GR2A 3SS3A 2J8YA 4BBTA 4IJGA 3T4LA 3LIBA 4EV4A 4HH2A 4C75A 3Q1FA 4OQIA 5TGFA 2XROA 1HLUP 4EEUA 3B47A 4G3VA 1LLBA 5J4EA 1EI5A 1BYWA 4GB7A 5EVLA 5FA7A 2Y2GA 3T4TA 4DE3A 3N8SA 4OPQA 3CI6A 4MEZA 3HUOA 2NUPC 3UE1A 1OTEA 3R4KA 5TJJA 5DTSA 1GA0A 3AGDA 4E3KA 3DW0A 5TBMB 3BM6A 2IWDA 4QJGA 2V0WA 1CI8A 4X68A 1RP5A 4P85A 3B3XA 3N7WA 1RCJA 4CQHA 4F94A 1D06A 4GOGA 2OAQ1 4ZJ3A 1J3WA 3E2KA 1SDNA 1FILA 2EX9A 3JPUA 2P74A 4CJNA 4EBNA 3VFFA 1N4OA 2LB9A 3HJKA 4B93A 1XA1A 5L07A 2G2UA 2PD8A 1VETB 3S7NA 4BL2A 5U47A 2ZL1B 1NYMA 4K91A 1WE4A 5KMWA 3CUEC 4Y0OA 3R7WA 1SCWA 3LR4A 4DE0A 4NK3A 3VP3A 3IBJA 4PKYG 4WEJA 3IXDA 1A0KA 2Y2LA 4WZ4A 4IVKA 4JXWA 5HDCA 3SH8A 4MDZA 2WYXA 3LI8A 3NHQA 4QY5A 1MC0A 4KENB 2EWWA 1WYBA 3NJAA 4JGPA 1PW1A 2ZC3B 3CITA 2OOLA 3MXRA 4R6LA 2M7VA 1YPRA 2W1TB 2OLUA 2Z6CA 2XDMA 4QWOA 4KQOA 3Q82A 2EX8A 4GHIB 4O8GA 4N1HA 4L9GA 3LUQA 4KZ5A 2XQZA 4II7A 4EUVA 4FH4A 5EM1A 3IXHA 4JGQA 1HTZA 3FWLA 3M6HA 3LYXA 1L0EA 1JTDA 1CF0A 1I2SA 3IX8A 4Y5FA 2V1ZA 5HFOA 4E3OA 3ICYA 1HVBA 3QP5A 1KVLA 1S0WA 3S7OA 3HLEA 1K57C 4KQDA 3ISGA 1E3UD 1KDWA 4UA7A 4DKIA 4EBPA 2W1TA 2W0NA 1VHMA 2VGKA 3KSIA 3NI9A 2PYRA 2WGVA 3WS5A 4NKPA 1WYCA 2W27A 4QU3A 2HDQA 1N9OA 1XX2A 5IT5A 4EESA 4R4SA 1SKOB 1Q2PA 4Q0HA 1BTLA 3LCEA 2RL3A 4NETA 4E3IA 2GDNA 3LIDA 4BQMA 3L7HA 5IU1A 4B4ZA 5LBRA 2WKIA 2Q9MA 4WL9A 4FOFA 1PW8A 1ZHHB 1FQGA 1LSXA 3BEBA 4GD6A 3K3DA 2UV0E 5CHMA 4F3LA 3ZHHA 3GV9A 4NEED 3LIFA 1GHPA 1MKIA 1BLCA 3IHAA 4B4XA 4HBUA 3LR3A 1Y54A 3VFHA 4U0XA 4IUHA 4L9EA 2EX2A 3MZEA 2DCFA 2QWSA 5DFXA 5TFQA 3UB9A 3RXXA 3OBFA 2PU2A 4XUXA 2EFUA 1H3QA 3OC2A 4D2OA 2W1RA 4KG5A 4XXRA 3FYZA 4HI4A 3P01A 4I3AA 1K4FA 3DBAA 1VEUB 3BY8A 3ITBA 1D1JA 4EBLA 4GS9A 4PMAA 3C30A 4HJ3A 1I5QA 3F1OA 2A2LA 3S1YA 5EUAA 1TDGA 3FKVA 3S7PA 4ME4A 3DAVA 5HPFA 5F69A 4X69A 2ACGA 4YFMA 1BT5A 1S4RA 2Y2QA 1JNUA 1P9RA 2BASA 4ID4A 3ULFA 3D9YA 3LEQA 4RQ9A 1K56D 4FD8A 1OTIA 4OQ0A 3F1PB 2EXBA 4U0TA 3PHYA 2PHYA 2XK1A 5AQBA 3VP2A 5GLDA 4MBHA 2OWJA 2PRFA 1CK3A 1E25A 3M2KA 1EROA 3QNCA 2E8JA 2JC7A 2JBFA 1G6AA 5HWVA 4BD0A 4KQRA 4N92A 1YMSA 1W79A 3VMAA 2WZXA 3F1OB 3KO6A 3KSFA 4WMCD 5G4YA 5D3OA 4DXCA 1M40A 4I38A 4S2IA 5EVIB 1JVJA 3MZDA 4Q0JA 2OLVA 4Y15A 3KSHA 3LFVA 1KGEA 5FSRA 1IKIA 4QPRA 3SW1A 5EVEA 5CX7A 3BYDA 1YLWA 1STZA 3E4OA 1JWPA 3NOPC 4GW9A 4HIAA 3UB7A 4PKYA 5AQ9A 4GLQA 2I72A 2WKPA 4EU0A 3C2WA 2ZMVA 3Q7VB 3EQVA 1GHMA 4EQIA 3H7WB 2J80A 4BBVA 3G35A 1YSQA 3V50A 4BJPA 2OV5A 3A0VA 1Y28A 5DJTA 1YLZA 5HW3A 1IELA 5DJUA 4YOFA 5L09A 4HJ4A 2QJ7A 3ITAA 1XXMA 4MN7A 1BULA 2CMNA 4RA7A 3SOIA 1NWZA 2Y59A 5M18A 1KDSA 2H5SA 4H6JA 1XFNA 3T4KA 1PWDA 1N9NA 3ZG0A 2HPBA 3Q7VA 1IYSA 4CPKA 4IHQA 4HQAA 3TOIA 4UA6A 3DWZA 2HP5A 2Y2OA 5GLBA 2QHKA 3D72A 4ETXA 3RFBA 4WN5A 1LI0A 1GA9A 1BZAA 4HBTA 5GLAA 3DTMA 4OPYA 1XPBA 2HV1A 2W3FA 4BL3A 4LRYC 2WGWB 4X1MA 4BLMA 2PYPA 2ZJ9A 3EEAA 3VE3A 2VA0A 5HL6A 4HEFA 3UE3A 1SDEA 1VM1A 3OLOA 1IKGA 1CEGA 1XA7A 1ACFA 2KDKA 3IX3A 1OT6A 2O0YA 4K0WA 1MKMA 2G2WA 3B33A 2ZL1A 2IWCA 2XFTA 4S2PA 3R7WB 3UY6A 2DRWA 3I7JA 2O99A 1DRMA 4CLCA 1BUEA 2Z2MB 3O86A 2WUQA 3PAGA 2EWVA 3BLSA 5GHZA 3CMZA 1UWPX 5HPIA 4M3KA 2GJ3A 2Q0OA 3M2JA 1X0OA 4ZRRA 2A24A 4DF6A 2M1CA 1WA9A 3C4PA 3CZDA 3V3SA 2XA7M 4NXBA 2JKTM 1OTAA 3MKFA 1V9YA 2B95A 5DVAA 1MBLA 4S2LA 3WWXA 3UB6A 1T1BA 4I39A 2QMIA 3CHWP 2XSSA 4ZJ1A 3UNWA 3E4PA 2DNSA 4LV3A 5CEBA 5HX9A 4KG6A 5HAQA 4X25A 3UPOA 3NBLA 3DTIA 3LR0A 1YAXA 2VV7A 3WS1A 3IH9A 1K6SA 1N9LA 3OOVA 4X1LA 2OWHA 5EFWA 4E04A 4WELA 3C4OA 3IWQA 3UE6A 4JKTA 4X6TA 3DTEA 2H0TA 5EV0A 2ZM2A 4X55A 5G18A 5FQMA 1ES2A 5F1GA 3A3IA 4OP8A 1GSWA 3HUNA 3QP2A 3S7QA 5L8MA 1W8QA 1G6OA 5CXWA 1ZG6A 2V1AA 4MNRA 1W5DA 3ZVWA 3UDXA 4RX3A 3EEHA 3EOIA 2WAFA 3IX4A 4P87A 4CLCB 5EVIC 3BFEA 2P04A 3VOLA 3T1RA 1NZUA 5HDSA 3ZGAB 4BD1A 5I94A 3T1QB 3OZHA 4UHUA 1OJ5A 3MJQA 2V2FF 3PBSA 1XKZA 5HL1A 3ZG5A 4OOYA 4I3IA 4OVDA 3HLGA 3NIAA 3T4JA 5E2EA 5GLCA 3EQUA 3NC8A 1D7EA 2A49A 3LIEA 3BLMA 3ZNTA 5E2FA 1K54A 2Q9NA 4FUWA 2ZMAA 4EERA 2ZC6B 2B5RA 2PT7A 2Z2LB 1YLJA 1PWGA 4DXBA 3T4QA 1E4DA 1DY6A 4Y3IA 3RJUA 2YKHA 4GCZA 3QP8A 2D02A 5HWWA 5EPHA 3JVVA 2OSUA 2ZMFA 2BLSA 4EW7A 4ZJ2A 3NOUC 1M6KA 2FFFB 2VV6A 4WEKA 5EE8A 4UQIS 2VK3A 4R1GA 3UPPA 2ZD8A 4DJ3A 2VX8A 5EM0A 2VGJA 4UQIM 1ERMA 2BG1A 4L0LA 1AWIA 2HF6A 5JYOA 1G5UA 1HZOA 3PTEA 4UAAA 4H6JB 3EWKA 3IH8A 2W3DA 3O3VA 2DMWA 1CJFA 1OTDA 1S6RA 1YLYA 4JGOA 1W63M 4Y17A 4S2NC 3TSGA 3GVBA 3RTYA 3V39A 4G3WA 3NULA 1H5XA 2PBDP 1ZTUA 2RCXA 5C5KA 3A3FA 4ARZB 2QPNA 4QHCA 1BSGA 5CGWA 1O07A 1V9ZA 1LI9A 4Z1WA 3A0SA 1GSXA 2VV8A 5FATA 5FI7A 1Q2QA 3VSLA 1XJ3A 4U3TA 1Z09A 4UEYA 1LL9A 3OPLA 2GNXA 5MC7A 1TDLA 3IF6B 3OCLA 4KZBA 3DTKA 3E0YA 3N8RA 1MWRA 2KOIA 3DWKA 2XGNA 4OQHA 1NY0A 4RYEA 4KZ7A 4Y7PA 5TR7A 2Z6DA 5F6AA 1TS6A 4GN2A 1H8ZA 4N1XA 3H9WA 3ZDJA 5CHJA
chains in the Genus database with same CATH topology
1F5MA 4OOMA 5DJUA 4YOFA 3MF0A 3MMHA 3H7WA 4HJ4A 4LRXC 2QJ7A 2K31A 1XJ4A 4Q0IA 3LICA 4EETB 4HNBA 4MN7A 3LR5A 2CMNA 5FL3A 2O9BA 1NWZA 4G3KA 4BBTA 4IJGA 1S1YA 2R78A 4H6JA 1XFNA 3T4LA 3T4KA 3LIBA 1N9NA 4HH2A 4FSFA 1IFQA 3K3CA 5A8BA 2NUTC 4IHQA 4HQAA 4OOLA 2XROA 1F98A 3VV4A 3B47A 4EEUA 4G3VA 5J4EA 3EGXC 1BYWA 3IS2B 4LRZE 2Y79A 3PBOA 3EGDC 3IBRA 2QHKA 3D72A 4ETXA 2JN7A 3RFBA 1P97A 2J3WA 2V9AA 3BW6A 3BY9A 3T4TA 4WN5A 5HWTA 2XRNA 3CI6A 1P9WA 1OPXA 2ZOIA 2QKPA 4P6ZS 4R38A 2NUPC 2INWA 3KYQA 1OTEA 3R4KA 2HV1A 5TJJA 2W3FA 4LRYC 5HD3A 4P6ZM 5TBMB 1VB6A 1DP9A 2PYPA 2HGVA 2V0WA 4BMWA 2WKRA 2B02A 3EEAA 4PHTA 3VE3A 2VA0A 5HL6A 3UE3A 4CQHA 3OLOA 3JVUA 3ZQ5A 4MN6A 1D06A 2KDKA 2OAQ1 1XJ6A 1OT6A 2O0YA 4MN5A 3MFXA 5KSHA 1MKMA 2L1MA 3B33A 1TF1A 2LB9A 3HJKA 3TJZC 4B93A 2PR5A 4WLAA 3OCNA 3MQ0A 3R7WB 3F1NB 3BQAA 3FC7A 4O0PA 3A0RA 5HD5A 5AJGA 2PD8A 5J3WA 3S7NA 2O99A 1DRMA 4CLCA 2L0WA 1S1ZA 3CUEC 5J7EA 2IA2A 3R7WA 1LT0A 1OT9A 3LR4A 1W63Q 2EWVA 4EXOA 3CLOA 3IBJA 1NRJA 3KSGA 4PKYG 5IS1A 2VKSA 4WEJA 4LPZA 5AVEA 1UWPX 5HPIA 5DKLA 2GJ3A 1KOUA 1MZUA 2HJ9C 1X0OA 1XFQA 4HH3A 4ZRRA 2A24A 5HDCA 4MDZA 1UGUA 2W3HA 2M1CA 1WA9A 4HY8A 3LI8A 2XA7M 4NXBA 2JKTM 3NHQA 1MC0A 1OTAA 1V9YA 1TS8A 3C38A 2EWWA 4NXEA 3NJAA 4JGPA 3UB6A 4GHIA 2A24B 1T1BA 3CITA 4I39A 2OOLA 4R6LA 2XSSA 2M7VA 5DKKA 3E4PA 3PBRA 2VEAA 2W1TB 3LI9A 1DP8A 2JKTI 2Z6CA 4KQOA 4XT2B 3LR0A 4GHIB 4O8GA 1YAXA 4L9GA 3LUQA 2VV7A 4YNRA 4II7A 4EUVA 4I3JA 4JGQA 4CLCD 1N9LA 3OOVA 5HZHA 4WF0A 2OWHA 3LYXA 5EFWA 2KLIA 4E04A 4WELA 2P08A 3O5YA 3IS2A 4Y5FA 4IUKA 3UE6A 4GJ4A 4CLCE 5G4ZA 3V67A 2YKFA 4YWZA 3ICYA 1H8MA 3S7OA 1GSWA 2HJEA 3S7QA 4KQDA 3BQ8A 5L8MA 1G6OA 2QYBA 2O9AA 2V1AA 5DFYA 3GECA 2W1TA 2W0NA 1VHMA 3KSIA 3EEHA 4BBUA 2PYRA 2ZOHA 3EOIA 3ZYTA 4NKPA 1YSPA 2W27A 4NXGA 3VE4A 1N9OA 1T1CA 2JKRM 3MQOA 4XT2A 4EESA 5IT5A 3CWFA 2VGLM 4CLCB 1LSVA 4Q0HA 3PBNA 1UWNX 2P04A 4B9OA 3VOLA 4JGRA 1EW0A 3BJNA 5HDSA 4DJ2A 3KX0X 3H82A 3LIDA 1TS7A 5HSQA 2VGLS 5IU1A 2FH5A 5LBRA 3PYPA 2D01A 3NOTC 5I5LA 1OJ5A 3MXQA 3MJQA 4FOFA 4WL9A 1ZHHB 1LSXA 3G6OA 3PBSA 3BWLA 3K3DA 3H82B 4ARZA 3U2AA 4F3LA 1S67L 3F1NA 4NEED 2XA7S 3LIFA 4I3IA 4HOIA 3T4JA 2O9CA 3MR0A 3LR3A 3T4SA 1S4SA 3EQUA 1D7EA 1TS0A 3LIEA 3RH8B 4IUHA 4L9EA 4R70A 1XJ2A 1OJGA 1NLYA 2JHEA 2M7UA 5K5BA 4EERA 2QWSA 2B18A 3UMDA 5DFXA 3MQQA 3FPWA 4LLOB 2PT7A 3D3OA 2H28A 2P7JA 3UB9A 4HP9A 3OBFA 3T4QA 2KX6A 5KIZA 4Y3IA 1H3QA 3OC2A 2YKHA 2W1RA 4GCZA 2D02A 5HWWA 4EEPA 4HI4A 3P01A 3JVVA 4I3AA 4BWIA 3GDIA 2ZMFA 2J3TD 3DBAA 3UMEA 4EW7A 3BY8A 4GS9A 4M4XA 3C30A 4NXFA 3NOUC 1T18A 4HJ3A 4HHDA 3F1OA 2VV6A 2A2LA 3CUEA 2K2NA 2V1BA 4WEKA 3E98A 2OAP1 4UQIS 4AFIA 4MMNA 3PBTA 4PAUA 3S7PA 4ME4A 5HPFA 5F69A 4DJ3A 4O01A 2VX8A 2J3TC 1S4RA 2G7UA 3TRCA 2PDRA 2I9VA 1JNUA 4UQIM 1P9RA 2BASA 3PXPA 3ULFA 4RQ9A 3KYZA 1OTIA 4R3AA 4L0LA 2HF6A 3F1PB 5AVFA 4WUJA 3PBQA 3PHYA 2VJWA 4H6JB 2JKRI 2PHYA 3EWKA 2W3DA 2PR6A 2DMWA 2Y8HA 2OWJA 3HJIA 4KUOA 5F68A 3C8CA 4MCWA 4KUKA 4Y2FA 3F1PA 1OTDA 1P0ZA 2PD7A 4HJ6A 5HWVA 4JGOA 1W63M 1GSVA 5TBMA 3HCYA 3B42A 3P7NA 1DP6A 4K08A 3RTYA 3K2NA 3FPVA 4G3WA 3F1OB 3KO6A 3TW8A 1ZTUA 3TE8A 3KSFA 5G4YA 1NLZA 2LB5A 4EQ1A 4I38A 5C5KA 4ARZB 1S66L 5F5YA 4F3LB 2ZBBA 1T1AA 4DMZA 2V0UA 3CAXA 4Q0JA 3KSHA 1V9ZA 3LFVA 4Z1WA 3PR6A 3A0SA 1GSXA 2W3EA 1LL8A 2VV8A 3LIAA 3W2ZA 1XJ3A 2GZAA 4QPRA 4UEYA 5DF9A 3SW1A 2GNXA 5CX7A 5MC7A 4DN0A 4ETZA 2L4RA 2K7SA 2VZWA 3OCLA 2EA9A 2WKQA 1STZA 1TD5A 2QJ5A 3E0YA 3E4OA 2KOIA 5HDDA 1OTBA 2FZ0A 3NOPC 4GW9A 4HIAA 2MJ6A 4PKYA 3E4QA 3T50A 3UB7A 1YKDA 4GLQA 1ODVA 1G28A 2GX5A 2WKPA 4EU0A 3C2WA 2ZMVA 4HP4A 3T4OA 3EQVA 1T19A 2Z6DA 2VLGA 5F6AA 1F9IA 4I5SA 1TS6A 3H7WB 4L9FA 3UB8A 4GS9B 2J80A 4BBVA 4CLCC 1YSQA 1LSWA 4BJPA 3FG8A 2W3GA 3A0VA 1Y28A 3H9WA 5DJTA 1IOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GEC A;  3F1N B;  4DJ3 A;  2W0N A;  5DJU A;  1S4R A;  3EEH A;  3FC7 A;  4BBU A;  2PDR A;  2I9V A;  1JNU A;  2PYR A;  3H7W A;  2BAS A;  2ZOH A;  3A0R A;  4HJ4 A;  2PD8 A;  5HD5 A;  5J3W A;  3ULF A;  4RQ9 A;  1DRM A;  4LRX C;  2QJ7 A;  2W27 A;  1XJ4 A;  4NXG A;  3VE4 A;  1OTI A;  1N9O A;  3LIC A;  4R3A A;  2L0W A;  3F1P B;  1T1C A;  4EET B;  3MQO A;  4XT2 A;  1S1Z A;  4EES A;  3CWF A;  4HNB A;  5AVF A;  5J7E A;  4WUJ A;  1LSV A;  3PHY A;  1LT0 A;  2CMN A;  4H6J B;  2PHY A;  1OT9 A;  3EWK A;  4B9O A;  1UWN X;  1NWZ A;  4EXO A;  3CLO A;  2PR6 A;  3VOL A;  4JGR A;  1EW0 A;  4PKY G;  5IS1 A;  4DJ2 A;  5HDS A;  3HJI A;  2OWJ A;  4KUO A;  3KX0 X;  4LPZ A;  5AVE A;  1UWP X;  3H82 A;  3C8C A;  3LID A;  5DKL A;  1TS7 A;  4KUK A;  5F68 A;  4BBT A;  2GJ3 A;  1S1Y A;  1OTD A;  1KOU A;  1XFN A;  1P0Z A;  2R78 A;  3F1P A;  2PD7 A;  3PYP A;  4H6J A;  1MZU A;  2D01 A;  3NOT C;  4HJ6 A;  5HWV A;  4JGO A;  5I5L A;  1GSV A;  5TBM A;  3LIB A;  1N9N A;  1OJ5 A;  1X0O A;  1XFQ A;  3MXQ A;  3P7N A;  3MJQ A;  1DP6 A;  2A24 A;  4HH3 A;  4HH2 A;  4K08 A;  4WL9 A;  3K3C A;  5HDC A;  1LSX A;  3RTY A;  5A8B A;  1UGU A;  3F1O B;  3G6O A;  4I39 A;  2M1C A;  1WA9 A;  3BWL A;  4HY8 A;  3K3D A;  3H82 B;  4HQA A;  3LI8 A;  4NXB A;  5G4Y A;  4F3L A;  1S67 L;  3F1N A;  1F98 A;  3LIF A;  3NHQ A;  4I3I A;  4EEU A;  5G4Z A;  1OTA A;  4EQ1 A;  5J4E A;  4HOI A;  1V9Y A;  1TS8 A;  4I38 A;  1BYW A;  3IS2 B;  4LRZ E;  4NXE A;  3MR0 A;  3NJA A;  4JGP A;  3IBR A;  4F3L B;  1S66 L;  1S4S A;  5F5Y A;  3UB6 A;  2ZBB A;  2QHK A;  4GHI A;  1T1A A;  2A24 B;  2JN7 A;  1T1B A;  1P97 A;  1D7E A;  1TS0 A;  2OOL A;  2V9A A;  3BY9 A;  2V0U A;  3CAX A;  3LIE A;  4R6L A;  4WN5 A;  5IU1 A;  1V9Z A;  3RH8 B;  5HWT A;  4L9E A;  4R70 A;  5DKK A;  1XJ2 A;  5F6A A;  1OJG A;  3A0S A;  2JHE A;  1GSX A;  3E4P A;  1LL8 A;  2VV8 A;  2VEA A;  2ZOI A;  2QKP A;  2QWS A;  4EER A;  3LIA A;  4R38 A;  3UMD A;  1XJ3 A;  2INW A;  3MQQ A;  3LI9 A;  1OTE A;  1DP8 A;  2HV1 A;  2Z6C A;  4LLO B;  3SW1 A;  2H28 A;  2P7J A;  3UB9 A;  4HP9 A;  4XT2 B;  4GHI B;  4LRY C;  5HD3 A;  2KX6 A;  4L9G A;  2L4R A;  3LUQ A;  2K7S A;  2VV7 A;  5TBM B;  5HWW A;  2EA9 A;  1VB6 A;  1DP9 A;  2PYP A;  2WKQ A;  5KIZ A;  2QJ5 A;  2V0W A;  4I3J A;  4JGQ A;  3E4O A;  1N9L A;  2B02 A;  2WKR A;  2YKH A;  5HZH A;  3VE3 A;  5HDD A;  5HSQ A;  1OTB A;  3NOP C;  4GCZ A;  2D02 A;  4GW9 A;  4HIA A;  2OWH A;  3LYX A;  3E4Q A;  4PKY A;  4WF0 A;  4HI4 A;  5EFW A;  3T50 A;  4I3A A;  3UB7 A;  4E04 A;  3GDI A;  1ODV A;  3D72 A;  3OLO A;  1G28 A;  3IS2 A;  3ZQ5 A;  2WKP A;  3UE6 A;  3UME A;  4MN6 A;  4EEP A;  1D06 A;  2KDK A;  3BY8 A;  3C2W A;  4EW7 A;  4GS9 A;  4HP4 A;  4M4X A;  4NXF A;  3NOU C;  1XJ6 A;  1T18 A;  4HJ3 A;  1T19 A;  2Z6D A;  1OT6 A;  4HHD A;  2VLG A;  2YKF A;  3F1O A;  3ICY A;  2VV6 A;  3MFX A;  4MN5 A;  1F9I A;  4I5S A;  2V1B A;  4YWZ A;  1TS6 A;  3H7W B;  4L9F A;  2L1M A;  3UB8 A;  3B33 A;  4GS9 B;  1GSW A;  2J80 A;  4BBV A;  1LSW A;  4KQD A;  3HJK A;  3FG8 A;  3A0V A;  2PR5 A;  4WLA A;  1Y28 A;  3H9W A;  5DJT A;  5F69 A;  2V1A A; 
#chains in the Genus database with same CATH topology
 1F5M A;  2EX6 A;  5FEG A;  5L10 A;  1MXO A;  2K31 A;  1GHI A;  3N6I A;  5DF8 A;  4EET B;  1FIK A;  2JCH A;  3LR5 A;  3Q07 A;  1H8Y A;  3CPT A;  2ZQ8 A;  5FQJ A;  3ZFZ A;  1S1Y A;  2R78 A;  3HLC A;  2XF3 A;  2ZQ7 A;  3MXS A;  5E2G A;  3IT9 A;  4OKP A;  3ZG8 B;  4OOL A;  3UPN A;  3OPH A;  2J9P A;  3IWI A;  4LGW A;  3T12 B;  2Y2P A;  3WRZ A;  1XP4 A;  3IS2 B;  2Y79 A;  3PBO A;  3IBR A;  2Y2M A;  1CI9 A;  1P97 A;  2V9A A;  2HDS A;  1LHY A;  4WZ5 A;  1YLT A;  3FKW A;  4P6Z S;  2QKP A;  2BTF P;  4R38 A;  4O7D A;  2INW A;  4LV1 A;  4JF5 A;  3A3D A;  4LV2 A;  4P6Z M;  4IED A;  2HGV A;  1CQA A;  3HBR A;  4OQG A;  4BMW A;  2WKR A;  4PHT A;  4Y0T A;  2R9X A;  2X71 A;  2ZQ9 A;  4QD4 A;  3G2Y A;  1ES3 A;  4LCL A;  4WM9 A;  1IEM A;  3Q81 A;  3ZQ5 A;  1XJ6 A;  5A91 A;  3P98 A;  2L1M A;  1XGJ A;  3LY3 A;  1TF1 A;  4R3J A;  1PRQ A;  3TJZ C;  3L9K A;  1DJC A;  3MQ0 A;  3F1N B;  4O0P A;  5HD5 A;  4R0Q A;  5J3W A;  3HLW A;  3BFF A;  2V8C A;  3IF6 A;  4A5R A;  2IA2 A;  5KZH A;  1LT0 A;  1FSW A;  1OT9 A;  1W63 Q;  1K38 A;  1U60 A;  3CLO A;  5IS1 A;  2VKS A;  3IHB A;  5DKL A;  2Y2H A;  1MZU A;  5FI6 A;  3QNB A;  1XFQ A;  5FQQ A;  2W3H A;  2FFY A;  4HY8 A;  1KE0 A;  3S4X A;  4YIN A;  2QZ6 A;  3ZVT A;  3ZG9 B;  1TS8 A;  3C38 A;  1K25 A;  4NXE A;  2WAD A;  3Q7Z A;  1FR6 A;  4GHI A;  5DKK A;  2VEA A;  4ZDX A;  4QY6 A;  3CPT B;  3LI9 A;  1K55 C;  4OPZ A;  5F83 A;  4PM7 A;  3V5M A;  2XD1 A;  4YNR A;  3D4F A;  4I3J A;  2KLI A;  1PNE A;  4IUK A;  3WRT A;  4UA9 A;  5DTK A;  5G4Z A;  2YKF A;  5EEC A;  4YWZ A;  1SKF A;  2HJE A;  3U4L P;  4E6W A;  1MWS A;  3A3E A;  2O9A A;  3GEC A;  1IYO A;  4BBU A;  3W4P A;  3ZYT A;  1ONG A;  4XUZ A;  4JBF A;  2VGL M;  5EOO A;  1LSV A;  3ZG7 B;  4B9O A;  4LFU A;  4JGR A;  4R23 A;  3OPR A;  1Y4O A;  5HSQ A;  2VGL S;  3WS4 A;  2FH5 A;  3VOY A;  2D01 A;  3HVF A;  3NOT C;  4DDS A;  5I5L A;  3MXQ A;  5M19 A;  1OME A;  5CHU A;  3NDE A;  3G6O A;  2WZZ A;  1FSY A;  3H82 B;  4KZ8 A;  3U2A A;  4ARZ A;  3M6B A;  2XA7 S;  3S22 A;  4HES A;  5AQA A;  1MWU A;  4E3M A;  5A93 A;  1FR1 A;  3MR0 A;  4RX2 A;  4WZ5 C;  2Y2I A;  3UB5 P;  1IYQ A;  2E8I A;  1TS0 A;  1YLP A;  1XJ2 A;  1OJG A;  1NLY A;  2JHE A;  3G34 A;  2M7U A;  3SS5 A;  2B18 A;  3MKE A;  3UMD A;  1KE4 A;  3JYI A;  3G2Z A;  4OPR A;  2P7J A;  4HP9 A;  2KX6 A;  2PU4 A;  4PM9 A;  3RXW A;  4KZ4 A;  1JWZ A;  2Y91 A;  4WMC A;  4EEP A;  3GDI A;  2V20 A;  1NXY A;  3VP4 A;  2J3T D;  4LEN A;  3BRM A;  1SHV A;  2ZLY A;  5E2H A;  2WGI A;  1E3U A;  4M4X A;  1PWC A;  2V8F A;  1T18 A;  5HAI A;  5HAR A;  1YT4 A;  2K2N A;  2V1B A;  3QP6 A;  4ZTK A;  1K54 C;  3E98 A;  2OAP 1;  4GD8 A;  2WK0 A;  4AFI A;  3LEZ A;  2X01 A;  1ESU A;  2PBY A;  4KQQ A;  4PAU A;  3HLB A;  2AVX A;  3TRC A;  2PDR A;  3C7U A;  4PM8 A;  3A3J A;  4R3A A;  1G68 A;  5AVF A;  3MSH A;  4WUJ A;  2JKR I;  3VSK A;  3OPP A;  4IVI A;  4PM5 A;  2PR6 A;  1IYP A;  5F68 A;  4Y2F A;  4GKU A;  3C5A A;  1P0Z A;  5CED A;  2ZQD A;  2XH9 A;  1GSV A;  3HCY A;  3B42 A;  4K08 A;  5DF7 A;  2HZ5 A;  3K2N A;  4MBF A;  3FPV A;  3TW8 A;  3IWO A;  3TE8 A;  2WAE A;  1K55 A;  1NLZ A;  4IBR A;  4JXS A;  1RGY A;  3BFG A;  4DE1 A;  4OON A;  5F5Y A;  2C5W B;  1T1A A;  4R4R A;  4X53 A;  1YMX A;  2V0U A;  4LV0 A;  4C3Q A;  4H8R A;  4S2M A;  4X56 A;  1EWZ A;  3W2Z A;  2GZA A;  4FH2 A;  5A90 A;  1NZO A;  4KZ3 A;  5DF9 A;  4LCM A;  1L0D A;  4ETZ A;  1JTG A;  4IBX A;  2K7S A;  2L4R A;  2VZW A;  2EA9 A;  2QJ5 A;  3MZF A;  5IHV A;  1OTB A;  2MJ6 A;  3E4Q A;  1ODV A;  1FCN A;  1G28 A;  2GX5 A;  3G32 A;  1SKO A;  1JWV A;  3CG5 A;  1T19 A;  1NJ4 A;  2VLG A;  4FTX A;  1BLS A;  4L9F A;  3O88 A;  4B88 A;  3UB8 A;  4CLC C;  2HP9 A;  3FG8 A;  2W3G A;  3QHY A;  4D60 A;  4GDN A;  1K0K A;  3V3R A;  4OOM A;  4N9L A;  3MF0 A;  3HLF A;  4LRX C;  2CC1 A;  4Q0I A;  3LIC A;  4Q8I A;  1K4E A;  2XR0 A;  4HNB A;  3AGF A;  5CGS A;  5FL3 A;  2O9B A;  3FZC A;  5CTM A;  4G3K A;  3VP0 A;  5FAS A;  1ZC2 A;  1I2W A;  4FSF A;  1IFQ A;  3K3C A;  1L3L A;  5A8B A;  3UE0 A;  2NUT C;  1K56 A;  1F98 A;  3VV4 A;  1K57 A;  3EGX C;  5FDS A;  3UN7 A;  4LRZ E;  2PAV P;  3EGD C;  5KSC A;  2JN7 A;  2J3W A;  3BW6 A;  3BY9 A;  5CTN A;  2H10 A;  1BLP A;  3IQA A;  5HWT A;  5FQI A;  2XRN A;  2Y2K A;  1P9W A;  4Y13 A;  4S2O A;  1OPX A;  2ZOI A;  3NEC A;  4JPM A;  2J7V A;  3E2L A;  2JKG A;  4MBK A;  3KYQ A;  2XLN A;  2Y2N A;  2XFS A;  3ZNY A;  5HD3 A;  5JYP A;  5CRF A;  4OLG A;  1VB6 A;  1DP9 A;  5F82 A;  2B02 A;  3HUM A;  1PIO A;  2ZC7 A;  4OH0 A;  3SH7 A;  4E3L A;  4K0X A;  3JVU A;  2HDU A;  3BFC A;  4MN6 A;  1PFL A;  1J9M A;  3UDI A;  2JE5 A;  5GHY A;  2WKE A;  2ZC4 B;  4WYY A;  4MN5 A;  3MFX A;  5KSH A;  2J9O A;  3IXB A;  4P0M A;  3BEC A;  1Z6F A;  4OP5 A;  3NY4 A;  2PR5 A;  4WLA A;  3OCN A;  1KGF A;  3BQA A;  3FC7 A;  3A0R A;  5AJG A;  1TVF A;  2P9V A;  3WS0 A;  2L0W A;  1S1Z A;  5CER A;  5J7E A;  1L0F A;  1DJA A;  4S2N A;  4GDB A;  4EXO A;  1NRJ A;  3KSG A;  4R3B A;  4LPZ A;  4Z9Q A;  5AVE A;  3AGE A;  1KOU A;  2HJ9 C;  3W4Q A;  1AXB A;  4HH3 A;  3N4I A;  2XD5 A;  1UGU A;  5FEF A;  3LGO A;  4KZ6 A;  3VP1 A;  4OLD A;  4KZA A;  1L2S A;  4PM6 A;  2A24 B;  1KE3 A;  1QME A;  5EVI D;  2ZQA A;  3FV7 A;  4GNU A;  2C6W B;  3SZT A;  3PBR A;  4JLF A;  4JF6 A;  1ESI A;  1DP8 A;  2JKT I;  4E3J A;  4XT2 B;  3MS6 A;  2ZC5 B;  2ZM0 A;  4CLC D;  5HZH A;  3C7V A;  2Y4A A;  1QMF A;  5FAO A;  4E6X A;  2Y2J A;  4WF0 A;  2XEP A;  1ONH A;  2P08 A;  3O5Y A;  3IS2 A;  4GJ4 A;  4PPR A;  4CLC E;  3ZCZ A;  4EUZ A;  5BOH A;  1MWT A;  3V67 A;  5HAP A;  1H8M A;  1C3B A;  1PYY A;  3KYE A;  4ZAM A;  5E43 A;  1O7E A;  4BEN A;  2EFX A;  5GL9 A;  1W7F A;  3BQ8 A;  4ESP A;  2QYB A;  5DFY A;  3UO9 A;  3NCK A;  5A92 A;  3W8K A;  2ZOH A;  1YSP A;  4NXG A;  3VE4 A;  3N8L A;  1HD8 A;  1T1C A;  2JKR M;  4XT2 A;  5EVI A;  1PI4 A;  3MQO A;  3CWF A;  1MY8 A;  4DDY A;  2P9V B;  5GHX A;  1VET A;  3NDG A;  3IF5 A;  3PBN A;  1UWN X;  1EW0 A;  3BJN A;  4DJ2 A;  3KX0 X;  1FCO A;  1L0G A;  3H82 A;  4DE2 A;  1TS7 A;  1FOF A;  1F2K A;  3PYP A;  4GZB A;  1VQQ A;  1CEF A;  3SS4 A;  2X02 A;  5FQK A;  5EOE A;  4KZ9 A;  3BWL A;  2WGW A;  1MPL A;  1S67 L;  4S2J A;  3F1N A;  4HOI A;  4ZBE A;  2O9C A;  4JXV A;  3WS2 A;  4E3N A;  3T4S A;  1S4S A;  3GSG A;  4NG2 A;  4P6B A;  2HDR A;  3GMW A;  3RH8 B;  3UDF A;  2R9W A;  4R70 A;  5K5B A;  3LY4 A;  2Y55 A;  3MQQ A;  5L2F A;  3FPW A;  4LLO B;  3D3O A;  2H28 A;  1LL5 A;  1ALQ A;  3GRJ A;  4FCF A;  5KIZ A;  4C6Y A;  3G4P A;  3TG9 A;  4BWI A;  1KGG A;  3GQZ A;  3HL9 A;  3UME A;  5CEC A;  3P09 A;  2ZM8 A;  4NXF A;  4N9K A;  1YQS A;  4JXG A;  4HHD A;  4JF4 A;  1PI5 A;  3CUE A;  5DTT A;  1N9B A;  5J8X A;  1DJB A;  2UWX A;  5CGX A;  4MMN A;  1VEU A;  3PBT A;  5FAQ A;  3T1S A;  1BLH A;  4O01 A;  5F1F A;  2J3T C;  2G7U A;  1XGI A;  1PZO A;  2I9V A;  3PXP A;  3CJM A;  3KYZ A;  5FAP A;  1ZKJ A;  2EXA A;  4EWF A;  1NRF A;  1ES4 A;  1ES5 A;  1FCM A;  3PBQ A;  1RGZ A;  2VJW A;  3QP4 A;  1NYY A;  2WKH A;  2Y8H A;  3HJI A;  4KUO A;  5AQ7 A;  3C8C A;  4MCW A;  4KUK A;  3G31 A;  3F1P A;  2PD7 A;  3BFD A;  4HJ6 A;  5TBM A;  3MBZ A;  3P7N A;  1DP6 A;  3G30 A;  4QB8 A;  1PZP A;  5M1A A;  1KVM A;  2LB5 A;  4EQ1 A;  1W8Y A;  3GTC A;  4MLL A;  4KG2 A;  4F3L B;  1S66 L;  2ZBB A;  4RVA A;  5FQ9 A;  4DMZ A;  5FI2 A;  3CAX A;  1TEM A;  3PR6 A;  2W3E A;  1LL8 A;  3LIA A;  3T1X A;  1GCE A;  1H0M A;  4DN0 A;  2ZQC A;  2IWB A;  3LO7 A;  2A3U A;  2WKQ A;  1TD5 A;  5HDD A;  2FZ0 A;  4WBG A;  3O87 A;  3T50 A;  1YKD A;  3SH9 A;  4Y0U A;  1ZG4 A;  3VOZ A;  5FDH A;  2H0Y A;  2HP6 A;  1ERQ A;  3IXG A;  4HP4 A;  3HRE A;  4S2K A;  3T4O A;  1F9I A;  4I5S A;  1YM1 A;  4GS9 B;  1K6R A;  1LSW A;  4DRT A;  3W4O A;  3MFD A;  1IOU A;  2JKF A;  3PAE A;  1SZV A;  3HLD A;  3MMH A;  3H7W A;  1XJ4 A;  3IF6 C;  3QP1 A;  3GR2 A;  3SS3 A;  2J8Y A;  4BBT A;  4IJG A;  3T4L A;  3LIB A;  4EV4 A;  4HH2 A;  4C75 A;  3Q1F A;  4OQI A;  5TGF A;  2XRO A;  1HLU P;  4EEU A;  3B47 A;  4G3V A;  1LLB A;  5J4E A;  1EI5 A;  1BYW A;  4GB7 A;  5EVL A;  5FA7 A;  2Y2G A;  3T4T A;  4DE3 A;  3N8S A;  4OPQ A;  3CI6 A;  4MEZ A;  3HUO A;  2NUP C;  3UE1 A;  1OTE A;  3R4K A;  5TJJ A;  5DTS A;  1GA0 A;  3AGD A;  4E3K A;  3DW0 A;  5TBM B;  3BM6 A;  2IWD A;  4QJG A;  2V0W A;  1CI8 A;  4X68 A;  1RP5 A;  4P85 A;  3B3X A;  3N7W A;  1RCJ A;  4CQH A;  4F94 A;  1D06 A;  4GOG A;  2OAQ 1;  4ZJ3 A;  1J3W A;  3E2K A;  1SDN A;  1FIL A;  2EX9 A;  3JPU A;  2P74 A;  4CJN A;  4EBN A;  3VFF A;  1N4O A;  2LB9 A;  3HJK A;  4B93 A;  1XA1 A;  5L07 A;  2G2U A;  2PD8 A;  1VET B;  3S7N A;  4BL2 A;  5U47 A;  2ZL1 B;  1NYM A;  4K91 A;  1WE4 A;  5KMW A;  3CUE C;  4Y0O A;  3R7W A;  1SCW A;  3LR4 A;  4DE0 A;  4NK3 A;  3VP3 A;  3IBJ A;  4PKY G;  4WEJ A;  3IXD A;  1A0K A;  2Y2L A;  4WZ4 A;  4IVK A;  4JXW A;  5HDC A;  3SH8 A;  4MDZ A;  2WYX A;  3LI8 A;  3NHQ A;  4QY5 A;  1MC0 A;  4KEN B;  2EWW A;  1WYB A;  3NJA A;  4JGP A;  1PW1 A;  2ZC3 B;  3CIT A;  2OOL A;  3MXR A;  4R6L A;  2M7V A;  1YPR A;  2W1T B;  2OLU A;  2Z6C A;  2XDM A;  4QWO A;  4KQO A;  3Q82 A;  2EX8 A;  4GHI B;  4O8G A;  4N1H A;  4L9G A;  3LUQ A;  4KZ5 A;  2XQZ A;  4II7 A;  4EUV A;  4FH4 A;  5EM1 A;  3IXH A;  4JGQ A;  1HTZ A;  3FWL A;  3M6H A;  3LYX A;  1L0E A;  1JTD A;  1CF0 A;  1I2S A;  3IX8 A;  4Y5F A;  2V1Z A;  5HFO A;  4E3O A;  3ICY A;  1HVB A;  3QP5 A;  1KVL A;  1S0W A;  3S7O A;  3HLE A;  1K57 C;  4KQD A;  3ISG A;  1E3U D;  1KDW A;  4UA7 A;  4DKI A;  4EBP A;  2W1T A;  2W0N A;  1VHM A;  2VGK A;  3KSI A;  3NI9 A;  2PYR A;  2WGV A;  3WS5 A;  4NKP A;  1WYC A;  2W27 A;  4QU3 A;  2HDQ A;  1N9O A;  1XX2 A;  5IT5 A;  4EES A;  4R4S A;  1SKO B;  1Q2P A;  4Q0H A;  1BTL A;  3LCE A;  2RL3 A;  4NET A;  4E3I A;  2GDN A;  3LID A;  4BQM A;  3L7H A;  5IU1 A;  4B4Z A;  5LBR A;  2WKI A;  2Q9M A;  4WL9 A;  4FOF A;  1PW8 A;  1ZHH B;  1FQG A;  1LSX A;  3BEB A;  4GD6 A;  3K3D A;  2UV0 E;  5CHM A;  4F3L A;  3ZHH A;  3GV9 A;  4NEE D;  3LIF A;  1GHP A;  1MKI A;  1BLC A;  3IHA A;  4B4X A;  4HBU A;  3LR3 A;  1Y54 A;  3VFH A;  4U0X A;  4IUH A;  4L9E A;  2EX2 A;  3MZE A;  2DCF A;  2QWS A;  5DFX A;  5TFQ A;  3UB9 A;  3RXX A;  3OBF A;  2PU2 A;  4XUX A;  2EFU A;  1H3Q A;  3OC2 A;  4D2O A;  2W1R A;  4KG5 A;  4XXR A;  3FYZ A;  4HI4 A;  3P01 A;  4I3A A;  1K4F A;  3DBA A;  1VEU B;  3BY8 A;  3ITB A;  1D1J A;  4EBL A;  4GS9 A;  4PMA A;  3C30 A;  4HJ3 A;  1I5Q A;  3F1O A;  2A2L A;  3S1Y A;  5EUA A;  1TDG A;  3FKV A;  3S7P A;  4ME4 A;  3DAV A;  5HPF A;  5F69 A;  4X69 A;  2ACG A;  4YFM A;  1BT5 A;  1S4R A;  2Y2Q A;  1JNU A;  1P9R A;  2BAS A;  4ID4 A;  3ULF A;  3D9Y A;  3LEQ A;  4RQ9 A;  1K56 D;  4FD8 A;  1OTI A;  4OQ0 A;  3F1P B;  2EXB A;  4U0T A;  3PHY A;  2PHY A;  2XK1 A;  5AQB A;  3VP2 A;  5GLD A;  4MBH A;  2OWJ A;  2PRF A;  1CK3 A;  1E25 A;  3M2K A;  1ERO A;  3QNC A;  2E8J A;  2JC7 A;  2JBF A;  1G6A A;  5HWV A;  4BD0 A;  4KQR A;  4N92 A;  1YMS A;  1W79 A;  3VMA A;  2WZX A;  3F1O B;  3KO6 A;  3KSF A;  4WMC D;  5G4Y A;  5D3O A;  4DXC A;  1M40 A;  4I38 A;  4S2I A;  5EVI B;  1JVJ A;  3MZD A;  4Q0J A;  2OLV A;  4Y15 A;  3KSH A;  3LFV A;  1KGE A;  5FSR A;  1IKI A;  4QPR A;  3SW1 A;  5EVE A;  5CX7 A;  3BYD A;  1YLW A;  1STZ A;  3E4O A;  1JWP A;  3NOP C;  4GW9 A;  4HIA A;  3UB7 A;  4PKY A;  5AQ9 A;  4GLQ A;  2I72 A;  2WKP A;  4EU0 A;  3C2W A;  2ZMV A;  3Q7V B;  3EQV A;  1GHM A;  4EQI A;  3H7W B;  2J80 A;  4BBV A;  3G35 A;  1YSQ A;  3V50 A;  4BJP A;  2OV5 A;  3A0V A;  1Y28 A;  5DJT A;  1YLZ A;  5HW3 A;  1IEL A;  5DJU A;  4YOF A;  5L09 A;  4HJ4 A;  2QJ7 A;  3ITA A;  1XXM A;  4MN7 A;  1BUL A;  2CMN A;  4RA7 A;  3SOI A;  1NWZ A;  2Y59 A;  5M18 A;  1KDS A;  2H5S A;  4H6J A;  1XFN A;  3T4K A;  1PWD A;  1N9N A;  3ZG0 A;  2HPB A;  3Q7V A;  1IYS A;  4CPK A;  4IHQ A;  4HQA A;  3TOI A;  4UA6 A;  3DWZ A;  2HP5 A;  2Y2O A;  5GLB A;  2QHK A;  3D72 A;  4ETX A;  3RFB A;  4WN5 A;  1LI0 A;  1GA9 A;  1BZA A;  4HBT A;  5GLA A;  3DTM A;  4OPY A;  1XPB A;  2HV1 A;  2W3F A;  4BL3 A;  4LRY C;  2WGW B;  4X1M A;  4BLM A;  2PYP A;  2ZJ9 A;  3EEA A;  3VE3 A;  2VA0 A;  5HL6 A;  4HEF A;  3UE3 A;  1SDE A;  1VM1 A;  3OLO A;  1IKG A;  1CEG A;  1XA7 A;  1ACF A;  2KDK A;  3IX3 A;  1OT6 A;  2O0Y A;  4K0W A;  1MKM A;  2G2W A;  3B33 A;  2ZL1 A;  2IWC A;  2XFT A;  4S2P A;  3R7W B;  3UY6 A;  2DRW A;  3I7J A;  2O99 A;  1DRM A;  4CLC A;  1BUE A;  2Z2M B;  3O86 A;  2WUQ A;  3PAG A;  2EWV A;  3BLS A;  5GHZ A;  3CMZ A;  1UWP X;  5HPI A;  4M3K A;  2GJ3 A;  2Q0O A;  3M2J A;  1X0O A;  4ZRR A;  2A24 A;  4DF6 A;  2M1C A;  1WA9 A;  3C4P A;  3CZD A;  3V3S A;  2XA7 M;  4NXB A;  2JKT M;  1OTA A;  3MKF A;  1V9Y A;  2B95 A;  5DVA A;  1MBL A;  4S2L A;  3WWX A;  3UB6 A;  1T1B A;  4I39 A;  2QMI A;  3CHW P;  2XSS A;  4ZJ1 A;  3UNW A;  3E4P A;  2DNS A;  4LV3 A;  5CEB A;  5HX9 A;  4KG6 A;  5HAQ A;  4X25 A;  3UPO A;  3NBL A;  3DTI A;  3LR0 A;  1YAX A;  2VV7 A;  3WS1 A;  3IH9 A;  1K6S A;  1N9L A;  3OOV A;  4X1L A;  2OWH A;  5EFW A;  4E04 A;  4WEL A;  3C4O A;  3IWQ A;  3UE6 A;  4JKT A;  4X6T A;  3DTE A;  2H0T A;  5EV0 A;  2ZM2 A;  4X55 A;  5G18 A;  5FQM A;  1ES2 A;  5F1G A;  3A3I A;  4OP8 A;  1GSW A;  3HUN A;  3QP2 A;  3S7Q A;  5L8M A;  1W8Q A;  1G6O A;  5CXW A;  1ZG6 A;  2V1A A;  4MNR A;  1W5D A;  3ZVW A;  3UDX A;  4RX3 A;  3EEH A;  3EOI A;  2WAF A;  3IX4 A;  4P87 A;  4CLC B;  5EVI C;  3BFE A;  2P04 A;  3VOL A;  3T1R A;  1NZU A;  5HDS A;  3ZGA B;  4BD1 A;  5I94 A;  3T1Q B;  3OZH A;  4UHU A;  1OJ5 A;  3MJQ A;  2V2F F;  3PBS A;  1XKZ A;  5HL1 A;  3ZG5 A;  4OOY A;  4I3I A;  4OVD A;  3HLG A;  3NIA A;  3T4J A;  5E2E A;  5GLC A;  3EQU A;  3NC8 A;  1D7E A;  2A49 A;  3LIE A;  3BLM A;  3ZNT A;  5E2F A;  1K54 A;  2Q9N A;  4FUW A;  2ZMA A;  4EER A;  2ZC6 B;  2B5R A;  2PT7 A;  2Z2L B;  1YLJ A;  1PWG A;  4DXB A;  3T4Q A;  1E4D A;  1DY6 A;  4Y3I A;  3RJU A;  2YKH A;  4GCZ A;  3QP8 A;  2D02 A;  5HWW A;  5EPH A;  3JVV A;  2OSU A;  2ZMF A;  2BLS A;  4EW7 A;  4ZJ2 A;  3NOU C;  1M6K A;  2FFF B;  2VV6 A;  4WEK A;  5EE8 A;  4UQI S;  2VK3 A;  4R1G A;  3UPP A;  2ZD8 A;  4DJ3 A;  2VX8 A;  5EM0 A;  2VGJ A;  4UQI M;  1ERM A;  2BG1 A;  4L0L A;  1AWI A;  2HF6 A;  5JYO A;  1G5U A;  1HZO A;  3PTE A;  4UAA A;  4H6J B;  3EWK A;  3IH8 A;  2W3D A;  3O3V A;  2DMW A;  1CJF A;  1OTD A;  1S6R A;  1YLY A;  4JGO A;  1W63 M;  4Y17 A;  4S2N C;  3TSG A;  3GVB A;  3RTY A;  3V39 A;  4G3W A;  3NUL A;  1H5X A;  2PBD P;  1ZTU A;  2RCX A;  5C5K A;  3A3F A;  4ARZ B;  2QPN A;  4QHC A;  1BSG A;  5CGW A;  1O07 A;  1V9Z A;  1LI9 A;  4Z1W A;  3A0S A;  1GSX A;  2VV8 A;  5FAT A;  5FI7 A;  1Q2Q A;  3VSL A;  1XJ3 A;  4U3T A;  1Z09 A;  4UEY A;  1LL9 A;  3OPL A;  2GNX A;  5MC7 A;  1TDL A;  3IF6 B;  3OCL A;  4KZB A;  3DTK A;  3E0Y A;  3N8R A;  1MWR A;  2KOI A;  3DWK A;  2XGN A;  4OQH A;  1NY0 A;  4RYE A;  4KZ7 A;  4Y7P A;  5TR7 A;  2Z6D A;  5F6A A;  1TS6 A;  4GN2 A;  1H8Z A;  4N1X A;  3H9W A;  3ZDJ A;  5CHJ A; 
#chains in the Genus database with same CATH homology
 1F5M A;  4OOM A;  5DJU A;  4YOF A;  3MF0 A;  3MMH A;  3H7W A;  4HJ4 A;  4LRX C;  2QJ7 A;  2K31 A;  1XJ4 A;  4Q0I A;  3LIC A;  4EET B;  4HNB A;  4MN7 A;  3LR5 A;  2CMN A;  5FL3 A;  2O9B A;  1NWZ A;  4G3K A;  4BBT A;  4IJG A;  1S1Y A;  2R78 A;  4H6J A;  1XFN A;  3T4L A;  3T4K A;  3LIB A;  1N9N A;  4HH2 A;  4FSF A;  1IFQ A;  3K3C A;  5A8B A;  2NUT C;  4IHQ A;  4HQA A;  4OOL A;  2XRO A;  1F98 A;  3VV4 A;  3B47 A;  4EEU A;  4G3V A;  5J4E A;  3EGX C;  1BYW A;  3IS2 B;  4LRZ E;  2Y79 A;  3PBO A;  3EGD C;  3IBR A;  2QHK A;  3D72 A;  4ETX A;  2JN7 A;  3RFB A;  1P97 A;  2J3W A;  2V9A A;  3BW6 A;  3BY9 A;  3T4T A;  4WN5 A;  5HWT A;  2XRN A;  3CI6 A;  1P9W A;  1OPX A;  2ZOI A;  2QKP A;  4P6Z S;  4R38 A;  2NUP C;  2INW A;  3KYQ A;  1OTE A;  3R4K A;  2HV1 A;  5TJJ A;  2W3F A;  4LRY C;  5HD3 A;  4P6Z M;  5TBM B;  1VB6 A;  1DP9 A;  2PYP A;  2HGV A;  2V0W A;  4BMW A;  2WKR A;  2B02 A;  3EEA A;  4PHT A;  3VE3 A;  2VA0 A;  5HL6 A;  3UE3 A;  4CQH A;  3OLO A;  3JVU A;  3ZQ5 A;  4MN6 A;  1D06 A;  2KDK A;  2OAQ 1;  1XJ6 A;  1OT6 A;  2O0Y A;  4MN5 A;  3MFX A;  5KSH A;  1MKM A;  2L1M A;  3B33 A;  1TF1 A;  2LB9 A;  3HJK A;  3TJZ C;  4B93 A;  2PR5 A;  4WLA A;  3OCN A;  3MQ0 A;  3R7W B;  3F1N B;  3BQA A;  3FC7 A;  4O0P A;  3A0R A;  5HD5 A;  5AJG A;  2PD8 A;  5J3W A;  3S7N A;  2O99 A;  1DRM A;  4CLC A;  2L0W A;  1S1Z A;  3CUE C;  5J7E A;  2IA2 A;  3R7W A;  1LT0 A;  1OT9 A;  3LR4 A;  1W63 Q;  2EWV A;  4EXO A;  3CLO A;  3IBJ A;  1NRJ A;  3KSG A;  4PKY G;  5IS1 A;  2VKS A;  4WEJ A;  4LPZ A;  5AVE A;  1UWP X;  5HPI A;  5DKL A;  2GJ3 A;  1KOU A;  1MZU A;  2HJ9 C;  1X0O A;  1XFQ A;  4HH3 A;  4ZRR A;  2A24 A;  5HDC A;  4MDZ A;  1UGU A;  2W3H A;  2M1C A;  1WA9 A;  4HY8 A;  3LI8 A;  2XA7 M;  4NXB A;  2JKT M;  3NHQ A;  1MC0 A;  1OTA A;  1V9Y A;  1TS8 A;  3C38 A;  2EWW A;  4NXE A;  3NJA A;  4JGP A;  3UB6 A;  4GHI A;  2A24 B;  1T1B A;  3CIT A;  4I39 A;  2OOL A;  4R6L A;  2XSS A;  2M7V A;  5DKK A;  3E4P A;  3PBR A;  2VEA A;  2W1T B;  3LI9 A;  1DP8 A;  2JKT I;  2Z6C A;  4KQO A;  4XT2 B;  3LR0 A;  4GHI B;  4O8G A;  1YAX A;  4L9G A;  3LUQ A;  2VV7 A;  4YNR A;  4II7 A;  4EUV A;  4I3J A;  4JGQ A;  4CLC D;  1N9L A;  3OOV A;  5HZH A;  4WF0 A;  2OWH A;  3LYX A;  5EFW A;  2KLI A;  4E04 A;  4WEL A;  2P08 A;  3O5Y A;  3IS2 A;  4Y5F A;  4IUK A;  3UE6 A;  4GJ4 A;  4CLC E;  5G4Z A;  3V67 A;  2YKF A;  4YWZ A;  3ICY A;  1H8M A;  3S7O A;  1GSW A;  2HJE A;  3S7Q A;  4KQD A;  3BQ8 A;  5L8M A;  1G6O A;  2QYB A;  2O9A A;  2V1A A;  5DFY A;  3GEC A;  2W1T A;  2W0N A;  1VHM A;  3KSI A;  3EEH A;  4BBU A;  2PYR A;  2ZOH A;  3EOI A;  3ZYT A;  4NKP A;  1YSP A;  2W27 A;  4NXG A;  3VE4 A;  1N9O A;  1T1C A;  2JKR M;  3MQO A;  4XT2 A;  4EES A;  5IT5 A;  3CWF A;  2VGL M;  4CLC B;  1LSV A;  4Q0H A;  3PBN A;  1UWN X;  2P04 A;  4B9O A;  3VOL A;  4JGR A;  1EW0 A;  3BJN A;  5HDS A;  4DJ2 A;  3KX0 X;  3H82 A;  3LID A;  1TS7 A;  5HSQ A;  2VGL S;  5IU1 A;  2FH5 A;  5LBR A;  3PYP A;  2D01 A;  3NOT C;  5I5L A;  1OJ5 A;  3MXQ A;  3MJQ A;  4FOF A;  4WL9 A;  1ZHH B;  1LSX A;  3G6O A;  3PBS A;  3BWL A;  3K3D A;  3H82 B;  4ARZ A;  3U2A A;  4F3L A;  1S67 L;  3F1N A;  4NEE D;  2XA7 S;  3LIF A;  4I3I A;  4HOI A;  3T4J A;  2O9C A;  3MR0 A;  3LR3 A;  3T4S A;  1S4S A;  3EQU A;  1D7E A;  1TS0 A;  3LIE A;  3RH8 B;  4IUH A;  4L9E A;  4R70 A;  1XJ2 A;  1OJG A;  1NLY A;  2JHE A;  2M7U A;  5K5B A;  4EER A;  2QWS A;  2B18 A;  3UMD A;  5DFX A;  3MQQ A;  3FPW A;  4LLO B;  2PT7 A;  3D3O A;  2H28 A;  2P7J A;  3UB9 A;  4HP9 A;  3OBF A;  3T4Q A;  2KX6 A;  5KIZ A;  4Y3I A;  1H3Q A;  3OC2 A;  2YKH A;  2W1R A;  4GCZ A;  2D02 A;  5HWW A;  4EEP A;  4HI4 A;  3P01 A;  3JVV A;  4I3A A;  4BWI A;  3GDI A;  2ZMF A;  2J3T D;  3DBA A;  3UME A;  4EW7 A;  3BY8 A;  4GS9 A;  4M4X A;  3C30 A;  4NXF A;  3NOU C;  1T18 A;  4HJ3 A;  4HHD A;  3F1O A;  2VV6 A;  2A2L A;  3CUE A;  2K2N A;  2V1B A;  4WEK A;  3E98 A;  2OAP 1;  4UQI S;  4AFI A;  4MMN A;  3PBT A;  4PAU A;  3S7P A;  4ME4 A;  5HPF A;  5F69 A;  4DJ3 A;  4O01 A;  2VX8 A;  2J3T C;  1S4R A;  2G7U A;  3TRC A;  2PDR A;  2I9V A;  1JNU A;  4UQI M;  1P9R A;  2BAS A;  3PXP A;  3ULF A;  4RQ9 A;  3KYZ A;  1OTI A;  4R3A A;  4L0L A;  2HF6 A;  3F1P B;  5AVF A;  4WUJ A;  3PBQ A;  3PHY A;  2VJW A;  4H6J B;  2JKR I;  2PHY A;  3EWK A;  2W3D A;  2PR6 A;  2DMW A;  2Y8H A;  2OWJ A;  3HJI A;  4KUO A;  5F68 A;  3C8C A;  4MCW A;  4KUK A;  4Y2F A;  3F1P A;  1OTD A;  1P0Z A;  2PD7 A;  4HJ6 A;  5HWV A;  4JGO A;  1W63 M;  1GSV A;  5TBM A;  3HCY A;  3B42 A;  3P7N A;  1DP6 A;  4K08 A;  3RTY A;  3K2N A;  3FPV A;  4G3W A;  3F1O B;  3KO6 A;  3TW8 A;  1ZTU A;  3TE8 A;  3KSF A;  5G4Y A;  1NLZ A;  2LB5 A;  4EQ1 A;  4I38 A;  5C5K A;  4ARZ B;  1S66 L;  5F5Y A;  4F3L B;  2ZBB A;  1T1A A;  4DMZ A;  2V0U A;  3CAX A;  4Q0J A;  3KSH A;  1V9Z A;  3LFV A;  4Z1W A;  3PR6 A;  3A0S A;  1GSX A;  2W3E A;  1LL8 A;  2VV8 A;  3LIA A;  3W2Z A;  1XJ3 A;  2GZA A;  4QPR A;  4UEY A;  5DF9 A;  3SW1 A;  2GNX A;  5CX7 A;  5MC7 A;  4DN0 A;  4ETZ A;  2L4R A;  2K7S A;  2VZW A;  3OCL A;  2EA9 A;  2WKQ A;  1STZ A;  1TD5 A;  2QJ5 A;  3E0Y A;  3E4O A;  2KOI A;  5HDD A;  1OTB A;  2FZ0 A;  3NOP C;  4GW9 A;  4HIA A;  2MJ6 A;  4PKY A;  3E4Q A;  3T50 A;  3UB7 A;  1YKD A;  4GLQ A;  1ODV A;  1G28 A;  2GX5 A;  2WKP A;  4EU0 A;  3C2W A;  2ZMV A;  4HP4 A;  3T4O A;  3EQV A;  1T19 A;  2Z6D A;  2VLG A;  5F6A A;  1F9I A;  4I5S A;  1TS6 A;  3H7W B;  4L9F A;  3UB8 A;  4GS9 B;  2J80 A;  4BBV A;  4CLC C;  1YSQ A;  1LSW A;  4BJP A;  3FG8 A;  2W3G A;  3A0V A;  1Y28 A;  3H9W A;  5DJT A;  1IOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...