4BBVA

The pb0 photocycle intermediate of photoactive yellow protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Watching a Signaling Protein Function in Real Time Via 100-Ps Time-Resolved Laue Crystallography.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4bbvA00
3T50A 1OT6A 4LRYC 4KQDA 1XJ2A 1XJ6A 4JGPA 2H28A 4PKYA 3LIAA 5A8BA 5EFWA 1TS8A 4HHDA 4EESA 3UB9A 4K08A 3SW1A 2KDKA 5HZHA 3IS2A 2V0WA 3NOPC 3UMEA 5HWTA 2QHKA 5KIZA 2YKFA 3LIDA 1UGUA 5TBMB 4EERA 3RH8B 4E04A 3UE6A 4EQ1A 2R78A 1GSWA 3CWFA 2WKQA 4PKYG 3MXQA 4EEPA 2A24B 4EETB 5HDCA 1S67L 4JGQA 3F1PB 1XFNA 5J4EA 5TBMA 1N9OA 5DKKA 4GHIB 4HIAA 2YKHA 3IBRA 1S1ZA 2OWJA 3A0SA 3VOLA 3F1PA 4MN5A 1DP6A 4M4XA 3C2WA 1N9NA 3MFXA 4L9GA 1LL8A 4GHIA 1UWNX 1GSVA 3LUQA 1XFQA 4XT2B 1LSWA 3F1OB 2V0UA 3BY9A 1MZUA 2HV1A 2QKPA 4L9EA 3UB6A 4WLAA 2B02A 1T19A 3K3CA 4NXGA 3E4PA 4F3LB 3NHQA 3LIBA 5J3WA 4XT2A 1DRMA 1TS7A 4HJ4A 4I39A 3F1OA 5F68A 4DJ2A 5I5LA 4WN5A 3NOUC 3H7WB 3G6OA 2Z6DA 2PYPA 3FC7A 4LRZE 4F3LA 5F5YA 3OLOA 2PR6A 1OJGA 1P97A 3E4OA 3MR0A 3HJIA 4DJ3A 1N9LA 1T1AA 3ICYA 4L9FA 3H7WA 3EWKA 3A0VA 3LI8A 4I3AA 3E4QA 2PD7A 4R38A 4HJ3A 2JHEA 1DP9A 3NJAA 2PR5A 5IU1A 4LRXC 2PDRA 2CMNA 3MJQA 3ULFA 2VEAA 4RQ9A 1LSXA 2JN7A 4HI4A 2I9VA 5IS1A 1OTDA 4KUOA 4GS9B 4NXEA 1UWPX 2QJ5A 4I3IA 1T1CA 3MQQA 1T18A 2W0NA 3BWLA 3VE3A 1S4RA 3P7NA 4GS9A 1X0OA 5AVFA 4WL9A 1S66L 2EA9A 3H82B 2VV6A 1OJ5A 5AVEA 1LT0A 1D7EA 4HH3A 3NOTC 1S4SA 3CLOA 1NWZA 2PHYA 4I5SA 1G28A 2V9AA 3K3DA 1ODVA 2Z6CA 3LIFA 5G4YA 1Y28A 4R3AA 3LI9A 3GDIA 3UB7A 3H82A 2L0WA 4HOIA 4HNBA 2PD8A 2BASA 4HP9A 5DKLA 5DJUA 1KOUA 2OWHA 4KUKA 1DP8A 1P0ZA 4HH2A 3H9WA 4R6LA 1V9YA 2W27A 1EW0A 4YWZA 1S1YA 2QJ7A 3FG8A 3LICA 2VV7A 1LSVA 4HJ6A 3F1NB 2K7SA 4JGOA 3UMDA 4EEUA 5DJTA 4WUJA 4EXOA 2WKPA 2INWA 5HWVA 4MN6A 5J7EA 1JNUA 1WA9A 5HDSA 1TS6A 2QWSA 3F1NA 2VV8A 3C8CA 2ZOHA 2PYRA 4BBVA 4H6JB 5G4ZA 4BBUA 2ZOIA 3LYXA 5HD5A 2L4RA 3VE4A 1GSXA 1F9IA 1OTBA 1OTEA 5HDDA 4R70A 3EEHA 1TS0A 4WF0A 2J80A 4H6JA 4I3JA 5F6AA 3RTYA 4HP4A 2OOLA 4NXBA 3MQOA 3ZQ5A 1VB6A 5F69A 1V9ZA 2WKRA 5HD3A 4I38A 5HSQA 2VLGA 4LLOB 3D72A 3BY8A 4GW9A 2A24A 2V1BA 2P7JA 3UB8A 2KX6A 1OTAA 4JGRA 1OTIA 2V1AA 3PHYA 4EW7A 3HJKA 2D01A 1F98A 4HY8A 1XJ4A 1XJ3A 1T1BA 2D02A 2L1MA 2ZBBA 3LIEA 4GCZA 1BYWA 4NXFA 3CAXA 1D06A 3B33A 4B9OA 3A0RA 5HWWA 1OT9A 4LPZA 2GJ3A 3GECA 3KX0X 3PYPA 2M1CA 3IS2B 4HQAA 4BBTA
chains in the Genus database with same CATH superfamily
3T50A 3SH9A 5L2FA 4JGPA 2H28A 3LIAA 1XA7A 3V3SA 1GHIA 5FI6A 1I2WA 4O7DA 3RXXA 4HHDA 3UB9A 3D4FA 4GJ4A 2VKSA 1PWCA 2V0WA 3UMEA 5FDSA 3GTCA 3RFBA 3R7WB 3IX8A 5FEGA 1SZVA 1GHMA 1JWVA 2H10A 1H5XA 1I2SA 3CWFA 1YT4A 1TD5A 4PKYG 3MXQA 4DRTA 3UN7A 3R7WA 3Q07A 1ZTUA 5FATA 5DF9A 4ME4A 2O9CA 4WELA 2EXBA 2XLNA 4UEYA 4OVDA 4HIAA 5EVEA 3V5MA 1PW1A 3BQ8A 3R4KA 3VOLA 1YSQA 1E25A 4P87A 2VK3A 3S7QA 1K56A 1J9MA 3D9YA 4KQQA 4X53A 3PBOA 4XT2B 5TR7A 3LR4A 3BY9A 3TW8A 2OLVA 1MZUA 2HV1A 3HLBA 1NZUA 2IWBA 4S2KA 3UB6A 4S2NC 3SS4A 5IHVA 3E4PA 4F3LB 1N4OA 1IFQA 3LR5A 4XT2A 1FCNA 1VETB 4N9LA 4I39A 4YINA 5EUAA 5I5LA 1FSYA 3BM6A 3G6OA 3T4OA 1ES3A 4F3LA 4GB7A 5F5YA 3EQUA 1JWZA 1YLJA 2O0YA 1SDEA 1N9LA 1VETA 2Y2OA 3ICYA 4UA7A 3ITAA 4WM9A 2E8JA 3U2AA 4WMCA 3EWKA 5AQAA 3A0VA 3BLMA 1NYMA 3BW6A 1BUEA 3E4QA 4QB8A 5GL9A 2KLIA 3LR0A 4U0XA 5CHMA 3MXSA 4RX3A 1K56D 3ULFA 2Y2GA 3T1SA 1PWDA 1BT5A 2XF3A 3OBFA 3VFHA 3B47A 1UWPX 3ZG7B 1HTZA 3NY4A 3MF0A 4KQRA 2V8CA 4KENB 1WYCA 2W3FA 4FOFA 4JKTA 4GD8A 3S7OA 3UY6A 3WRTA 2W0NA 4IEDA 4OPYA 4FH4A 4GKUA 4ID4A 1SKFA 5HPIA 5KMWA 3V39A 2J9PA 2OSUA 5AVFA 1M6KA 3VSLA 2M7VA 3H82B 1OJ5A 2Y2HA 3PBTA 5AVEA 3W4PA 1LT0A 4LV1A 2JBFA 3FPWA 1XPBA 2ZMFA 2W3GA 4II7A 3KO6A 1S4SA 1NWZA 4I5SA 2XSSA 5F1FA 3PBRA 1KVLA 4JF4A 4WMCD 2XROA 2CC1A 4PM8A 3N4IA 4R3AA 3GDIA 3H82A 3IHBA 2L0WA 2HDUA 4QY6A 3LY4A 3V3RA 1S0WA 2Z2MB 3HBRA 4B4ZA 5F82A 3KSGA 1KOUA 3MFDA 3S4XA 4KUKA 1DP8A 3A3JA 4S2NA 5JYOA 1XGIA 1W63M 3EOIA 1FR6A 1NXYA 5L10A 3ZHHA 4KZ5A 3H9WA 3NDEA 3KSHA 1V9YA 2W27A 3IWQA 1S1YA 2J3TD 3FG8A 2M7UA 4DKIA 5CECA 4R4RA 3SS3A 4D2OA 4EBNA 1K57C 4WZ4A 3Q7VB 1JWPA 5EECA 4EXOA 1K38A 1AXBA 3FPVA 5HWVA 4MN6A 4KZ9A 2Y2PA 1WA9A 1TS6A 1HLUP 3SH8A 1NYYA 4HBTA 3C8CA 2ZOHA 3Q7VA 2FZ0A 3WS2A 4EBLA 4S2LA 5G4ZA 2ZOIA 5HD5A 1ZG4A 2XFTA 4CLCB 2O9BA 4N1HA 5HDDA 4E3MA 3EEHA 1PZOA 4WF0A 3LEQA 2A49A 2HP6A 1ERMA 3QP2A 4FTXA 4I3JA 4BLMA 3MKFA 1BTLA 1H3QA 4B4XA 3MQOA 5FL3A 2V20A 3DWZA 5CTMA 4X55A 5HSQA 4LLOB 2BG1A 3HUMA 4GOGA 1O07A 1F5MA 1RGZA 2WKHA 2XRNA 3BY8A 2G7UA 4GW9A 5GLAA 2HF6A 3UB8A 1G5UA 4Q0JA 2VJWA 2A2LA 3PBNA 3UE1A 3W2ZA 2WKIA 3WS5A 1OTIA 3EEAA 4MBKA 5CTNA 1IOUA 1HVBA 2NUPC 4BJPA 1IYSA 1MY8A 3DTIA 3IQAA 1VM1A 2HDQA 5KSHA 2VZWA 2D02A 2L1MA 3L7HA 1LI9A 5M19A 1NY0A 5MC7A 4GCZA 4KG2A 3HLFA 1A0KA 2EXAA 4NXFA 1D06A 4U0TA 1IELA 3PBQA 1GA9A 3GRJA 2C5WB 4GDBA 5L09A 1TVFA 2PBYA 3VP2A 4N92A 1H8ZA 1LI0A 1OT9A 3MZFA 1G68A 3KX0X 5AJGA 1IYQA 4IVKA 4XXRA 4HQAA 1RCJA 2HDRA 2XGNA 5K5BA 1YLYA 2ZL1B 4P6BA 4MBFA 2GZAA 4PKYA 4IUHA 2HPBA 3LFVA 3V50A 4EESA 1BLHA 4OLDA 5CEDA 3HUOA 2KDKA 3MSHA 3WRZA 4GZBA 3ZDJA 3NDGA 2ZL1A 1ALQA 2X01A 3AGFA 3GV9A 3EGXC 3MMHA 1KGGA 5EM0A 3JPUA 4ARZB 2JKGA 1H8YA 2WKQA 4EEPA 2ZC4B 1PW8A 4MLLA 4DXCA 5GHZA 4QPRA 5HDCA 3C5AA 1ES5A 4Y0TA 4JGQA 1XFNA 5J4EA 3LCEA 2O9AA 4IUKA 1STZA 4EWFA 1N9OA 1YM1A 5DKKA 5FEFA 4GHIB 5D3OA 4ARZA 3HVFA 1G6AA 3HREA 1YQSA 4JLFA 1XX2A 3BECA 4JXVA 1S1ZA 1W79A 4MBHA 5EV0A 3BFEA 1DP6A 2QYBA 3C2WA 4GHIA 3BYDA 3LUQA 1XFQA 3SOIA 3ZVTA 1LL9A 5EVLA 4WLAA 1MKMA 4MNRA 3K3CA 3NC8A 4WEJA 1YLTA 5DF7A 1YLWA 2P9VB 3NHQA 4UQIS 1TS7A 5DFXA 4ZTKA 3GMWA 3QHYA 3KSFA 5IT5A 2ZQCA 4WN5A 1ONGA 4PAUA 1N9BA 1YMSA 1ES2A 4DE1A 3M2JA 2P9VA 5CHUA 1BULA 2PR6A 3S1YA 1OJGA 1P97A 3E4OA 2Y2NA 3HJIA 4RYEA 2Q9NA 4L9FA 4HBUA 1CEFA 2XFSA 1JVJA 3LI8A 5FQQA 5CGXA 4R38A 3CMZA 4KG6A 4NKPA 2PR5A 4OOMA 4OONA 4F94A 2PDRA 5GLBA 1DJAA 3MJQA 3QNCA 3VV4A 2J7VA 1KDWA 3U4LP 1LSXA 4HI4A 3G31A 5IS1A 2HZ5A 4KUOA 1BSGA 1LL5A 2EX8A 2Y8HA 5EM1A 1KE4A 4LCMA 4OKPA 1HD8A 1T18A 1G6OA 5EVIC 4BD0A 2W3DA 4DF6A 1CEGA 4OPRA 4WL9A 2P04A 4BQMA 1S66L 3PXPA 5EOOA 4R0QA 2VV6A 1MWTA 1KDSA 1MWSA 2RCXA 4HH3A 2WADA 2VGJA 3ZG9B 2PHYA 1G28A 2V9AA 3QP6A 1ODVA 3DW0A 4R1GA 4CPKA 1QMEA 3M6BA 3QP5A 1K6RA 2JKFA 3I7JA 4Q0HA 3G34A 4QJGA 4HOIA 2HJ9C 4B93A 1BLCA 1K6SA 4E3IA 4HNBA 2PD8A 5DKLA 1I5QA 3TG9A 3IX3A 2XQZA 4JF5A 4HESA 2ZD8A 2KOIA 4S2IA 4Y13A 1NZOA 4R6LA 1ES4A 1L0EA 5AQ9A 5FDHA 4DDYA 2LB5A 4UHUA 3LICA 3Q1FA 1LSVA 2PU2A 2WYXA 4HJ6A 4DE3A 2X71A 3F1NB 2K7SA 4JGOA 3BEBA 3W8KA 3K2NA 1WE4A 5FI7A 4QY5A 3UO9A 2DNSA 2J8YA 4WUJA 3UPOA 3N8RA 4MEZA 2V2FF 5HX9A 2PAVP 2WKPA 5HDSA 3TOIA 1NRFA 2QWSA 3F1NA 2VV8A 4YFMA 2PYRA 5FAPA 4BBVA 1SCWA 4BBUA 2QMIA 3EQVA 4LENA 4CJNA 2VGLS 4DXBA 1SDNA 1GSXA 1F9IA 2Z2LB 4R70A 4Y15A 3JVVA 5DFYA 2DMWA 3TE8A 3BFFA 3VP0A 3MBZA 4JXSA 2A3UA 3RTYA 4NXBA 4BL3A 1EI5A 5EVIA 3ZQ5A 5FSRA 4N9KA 4D60A 4EBPA 2ZQ8A 1K0KA 4OPZA 5F83A 1W7FA 3IH8A 5CX7A 3NULA 2A24A 1FCMA 2KX6A 2ACGA 3P01A 3TSGA 1KE0A 5L07A 1ZHHB 4E3NA 2IWCA 1S6RA 3QP1A 5HFOA 4S2MA 2V1AA 2EX2A 3PHYA 5DVAA 4KZ8A 1GCEA 3UDFA 4EW7A 3CUEC 4P0MA 2D01A 2P08A 1F98A 2XD5A 3PR6A 4IBXA 1XJ3A 1T1BA 2UV0E 3MZEA 4WYYA 5FAOA 4X56A 3T1QB 2Y2QA 1J3WA 3DWKA 3A3FA 4B9OA 3B3XA 1XKZA 5TFQA 3KYEA 3IXDA 2Y59A 3VP1A 3VSKA 2M1CA 3IS2B 2WKEA 1U60A 3SW1A 1XGJA 4ZBEA 4G3VA 3HLDA 5DTSA 4U3TA 4ESPA 4PM7A 2R9WA 3C4PA 4UA6A 4BD1A 4NK3A 3HLGA 3EGDC 5A90A 5A8BA 1P9RA 5EFWA 1FSWA 3S7NA 4K08A 2WGVA 3CPTB 3IS2A 4GLQA 2X02A 5HWTA 2ZMVA 1ESIA 4RVAA 4JF6A 3LIDA 3MS6A 1UGUA 5TBMB 1W8YA 4EUVA 2PRFA 4NEED 2XDMA 5FQKA 3RH8B 3TJZC 3UE6A 3MZDA 4EQ1A 4OOLA 1GSWA 5EOEA 3CPTA 1YKDA 1MBLA 1L0DA 4EETB 2H0TA 4LFUA 3N8SA 3QNBA 4Y7PA 4JXGA 1K4FA 3UDIA 1CK3A 1S67L 2J3WA 1M40A 4RX2A 3T4QA 3F1PB 3AGEA 3S7PA 2JE5A 5TBMA 2EFUA 2W3EA 5HL6A 4O01A 3DTMA 3WS1A 2B95A 4KZ6A 4IVIA 4KG5A 2OWJA 1K55C 3A0SA 3VFFA 2QZ6A 3M2KA 3F1PA 4MN5A 4FCFA 3N6IA 4M4XA 3QP8A 4UQIM 3SZTA 3NI9A 1N9NA 4ZJ3A 1LL8A 1UWNX 1WYBA 3IF5A 2W1TB 1Z09A 3IXHA 2V0UA 3BFDA 1IYOA 1W5DA 1MWRA 2QKPA 4BL2A 1BLSA 2ZQ9A 2B02A 5CGWA 3CUEA 5TJJA 1JTGA 3BJNA 2Q0OA 4NXGA 1SHVA 2WUQA 3LIBA 5J3WA 5E2EA 5GHYA 5F1GA 2Y2IA 3OPHA 3VOYA 3UE0A 4K0XA 2W1TA 3BFGA 2PBDP 4UA9A 1EROA 2G2UA 2XA7S 5F68A 4DJ2A 4JBFA 3T4KA 3NOUC 1CQAA 3H7WB 3DTKA 2PYPA 5DF8A 4Y0UA 1VHMA 3VP4A 5HL1A 1KGEA 4LRZE 1PI4A 2FFFB 3OLOA 3ZG5A 5CHJA 4ZDXA 2OAQ1 2EX9A 2GNXA 3MR0A 2JKTI 4FD8A 4DJ3A 1K57A 1SKOA 3ZFZA 1ACFA 2E8IA 3H7WA 1BLPA 3E0YA 3VP3A 2EFXA 4JXWA 4I3AA 1CI9A 2PD7A 4HJ3A 1DP9A 1KVMA 2WAFA 1BZAA 4DN0A 3NJAA 4CLCE 1CI8A 1MC0A 3C38A 3ZNYA 4RA7A 3FKWA 4OQHA 4Y17A 4RQ9A 3GQZA 4P85A 2I9VA 2DRWA 1OTDA 3WWXA 4E3OA 4GS9B 2GDNA 2WAEA 4KQOA 4NXEA 1YLPA 2JKRI 3CI6A 1Q2PA 5DTKA 4G3KA 4FH2A 3IF6C 2IWDA 4QWOA 2Y4AA 1EWZA 1E4DA 3P7NA 4GS9A 4PMAA 3NCKA 5FQIA 3DBAA 5FI2A 1IKIA 3HLCA 1TEMA 1D7EA 3NOTC 2HDSA 3FKVA 4BMWA 5FQJA 1K55A 3K3DA 5G18A 4KZAA 3LIFA 4EU0A 1OMEA 1Y28A 3RXWA 3O5YA 3LI9A 3E98A 3UB7A 2WZXA 4BWIA 2ZJ9A 2BASA 3MQ0A 4HP9A 5LBRA 3IX4A 5DJUA 3AGDA 1FCOA 2IA2A 2OWHA 3IT9A 4WZ5C 2HP9A 2JKTM 2DCFA 1P9WA 1P0ZA 4HH2A 3L9KA 1ZKJA 2W3HA 4ETXA 1RP5A 3G2ZA 3CG5A 2Y2MA 5M18A 4BENA 1EW0A 4K91A 1H8MA 2J9OA 5E2GA 2XR0A 3V67A 3T1XA 1IEMA 5CERA 4NETA 5FA7A 3CHWP 5AQBA 4OH0A 3T4JA 1C3BA 2AVXA 3UMDA 2VGLM 3HL9A 4LCLA 4CQHA 4ZJ1A 3ZYTA 2INWA 2JKRM 4C6YA 3Q81A 4R3JA 1F2KA 1PIOA 4X25A 1JNUA 2XK1A 3B42A 1KE3A 3OZHA 4FSFA 1PWGA 2Y2JA 2H5SA 1KGFA 1L3LA 4H6JB 5HAQA 1MWUA 3IF6B 3IWIA 3LYXA 3VE4A 4MMNA 3O87A 3LGOA 4R4SA 3DTEA 1PYYA 1TS0A 1VQQA 1OPXA 2J3TC 2QPNA 2J80A 4H6JA 3OPPA 5F6AA 3IF6A 4HP4A 1ZG6A 2OOLA 1CJFA 3BLSA 4GDNA 5F69A 1V9ZA 2WKRA 1Z6FA 1TDLA 2ZM8A 5HD3A 4I38A 3IWOA 3FYZA 4HEFA 3D72A 3Q7ZA 5BOHA 4E3LA 1LHYA 2ZM2A 2P7JA 2OV5A 1L0FA 4JGRA 2HGVA 5JYPA 3G2YA 2ZMAA 1L2SA 1K54C 2H0YA 3C30A 3M6HA 4HY8A 2XEPA 3E2KA 3CJMA 3A3DA 4R23A 2LB9A 2Y55A 5GHXA 3WS4A 1H0MA 3N8LA 2FFYA 4E6WA 3PTEA 3SS5A 3G32A 4UAAA 1ESUA 2JC7A 3B33A 3T4TA 4WZ5A 2I72A 1TF1A 3KSIA 4MDZA 4M3KA 1NLYA 4P6ZM 4QU3A 4LGWA 4ETZA 1GHPA 4LPZA 5EPHA 2GJ3A 3T1RA 3IHAA 3S22A 4PM9A 3UNWA 3VMAA 1NJ4A 4BBTA 1OT6A 4LRYC 4KQDA 4PPRA 1XJ2A 1XJ6A 4C75A 3NECA 3HUNA 2Q9MA 1TS8A 3LEZA 4N1XA 4C3QA 3W4OA 1DY6A 1NLZA 5HZHA 5A91A 5CXWA 2B5RA 4YNRA 3C7VA 4DE0A 3NOPC 2W1RA 2QHKA 5KIZA 3IXBA 2O99A 4OQ0A 5EVIB 2YKFA 4MN7A 3JVUA 4EERA 4E04A 4OQIA 5CEBA 1FILA 2R78A 2VGKA 5KSCA 2A24B 1JTDA 4Y0OA 2ZLYA 1YLZA 3NIAA 3T4LA 4O8GA 3O88A 4OOYA 3D3OA 5DTTA 3G30A 4NG2A 5U47A 4KZBA 2YKHA 1YAXA 3IBRA 2HP5A 5E2FA 4CLCC 2P74A 4PHTA 5FQ9A 2Y91A 1RGYA 1PNEA 4X68A 3E2LA 2K2NA 3BFCA 1FOFA 3P09A 5L8MA 3MFXA 3LO7A 4Y3IA 4L9GA 3C7UA 3OC2A 1FIKA 3ZGAB 1GSVA 2XA7M 1LSWA 4GD6A 1XP4A 2WZZA 3F1OB 4S2OA 1YSPA 1K54A 4IJGA 4L9EA 3N7WA 5FASA 2G2WA 4Q0IA 4XUXA 2XD1A 3T4SA 1T19A 1HZOA 4A5RA 2ZC3B 1NRJA 3ZG0A 3A3IA 5GLDA 1DRMA 4HJ4A 5E43A 3F1OA 3OOVA 1AWIA 3PBSA 1QMFA 1YPRA 4E3JA 2Z6DA 4L0LA 4Y5FA 2ZQDA 3CZDA 4EQIA 3FC7A 5A92A 3HLEA 5EVID 3T12B 4G3WA 1IYPA 2Y2LA 1L0GA 1DJBA 1T1AA 3IXGA 1FR1A 4E3KA 4P6ZS 2ZM0A 3ITBA 3FWLA 3G35A 4PM5A 1O7EA 2XH9A 3W4QA 2JHEA 3BRMA 1ERQA 3ZG8B 5HAIA 5C5KA 2K31A 3BQAA 4OLGA 4Y2FA 5IU1A 4KZ4A 4ZRRA 4LRXC 4YOFA 2CMNA 3HLWA 1PFLA 3NBLA 2VEAA 2JN7A 3PAEA 4DDSA 1DJCA 3PAGA 2QJ5A 4I3IA 1T1CA 4LV3A 5FQMA 3MQQA 3BWLA 3VE3A 3HCYA 3IH9A 1S4RA 2RL3A 1X0OA 1ZC2A 2EWWA 3GR2A 4S2JA 2EA9A 4LV2A 4QD4A 1W8QA 4CLCA 1MXOA 5GLCA 3FZCA 3CLOA 3CITA 4FUWA 4GN2A 5CRFA 3ZCZA 2Z6CA 3KYZA 1PZPA 5G4YA 3C4OA 1D1JA 3MKEA 5E2HA 3P98A 4WBGA 4EUZA 2BLSA 3MXRA 3SH7A 2ZQAA 3OCLA 2Y79A 3UB5P 4MCWA 1Y54A 3O3VA 1SKOB 1LLBA 4EV4A 4O0PA 3VOZA 4OP5A 4LV0A 4GNUA 2EX6A 4KZ7A 4OQGA 4DMZA 3OPLA 3WS0A 4X69A 1PI5A 4R3BA 3Q82A 4Z9QA 2JCHA 4YWZA 1TDGA 4X1MA 2VA0A 2QJ7A 5AQ7A 2VV7A 1E3UA 5J8XA 2UWXA 2OLUA 5FAQA 4PM6A 4EEUA 5DJTA 4OPQA 5CGSA 3FV7A 4CLCD 1PRQA 5A93A 2Y2KA 5HPFA 5J7EA 1IKGA 2C6WB 3O86A 1XA1A 1VEUB 2WGWB 2PT7A 2HJEA 3DAVA 1Y4OA 3TRCA 2OAP1 4X6TA 2B18A 4Z1WA 2L4RA 1OTBA 2WGIA 1OTEA 3IBJA 1XXMA 3JYIA 4IHQA 1VEUA 4WEKA 2NUTC 2WGWA 5M1AA 2MJ6A 4XUZA 1Q2QA 4X1LA 1MPLA 4S2PA 3UPPA 3UPNA 2R9XA 1K25A 4E6XA 1VB6A 3GVBA 2VLGA 1MKIA 2ZQ7A 4DE2A 1E3UD 1CF0A 3ZVWA 2VX8A 3GSGA 3ISGA 1FQGA 2V1BA 1K4EA 3KYQA 3LY3A 1OTAA 2FH5A 4H8RA 3OPRA 2ZC7A 4K0WA 3LR3A 5HW3A 5EE8A 2BTFP 2V1ZA 5KZHA 4IBRA 3HJKA 4Q8IA 5I94A 2ZC5B 1XJ4A 5HAPA 2GX5A 2ZC6B 4ZAMA 5HARA 3UE3A 3ZNTA 1YMXA 2ZBBA 3QP4A 3LIEA 3UDXA 3OCNA 1BYWA 3CAXA 4KZ3A 3A3EA 3RJUA 3A0RA 3G4PA 5TGFA 4B88A 5HWWA 2WK0A 4OP8A 1ONHA 4ZJ2A 2PU4A 4QHCA 3GECA 3PYPA 1W63Q 2V8FA 4JPMA 2EWVA 1GA0A 4AFIA
chains in the Genus database with same CATH topology
3T50A 5K5BA 4G3VA 1OT6A 4LRYC 4KQDA 2GZAA 1XJ2A 1XJ6A 4JGPA 2H28A 4PKYA 4IUHA 3LIAA 3EGDC 5A8BA 1P9RA 3LFVA 5EFWA 1TS8A 4HHDA 4EESA 3UB9A 3S7NA 4K08A 3SW1A 1NLZA 2KDKA 5HZHA 3IS2A 4GJ4A 4GLQA 2VKSA 4YNRA 2V0WA 3NOPC 3UMEA 2W1RA 5HWTA 2QHKA 2ZMVA 3RFBA 3R7WB 5KIZA 2O99A 2YKFA 4MN7A 3LIDA 3JVUA 1UGUA 5TBMB 4EERA 4EUVA 4NEED 3EGXC 3RH8B 4E04A 3MMHA 3TJZC 3UE6A 4EQ1A 2R78A 4OOLA 1GSWA 4ARZB 3CWFA 1YKDA 2WKQA 1TD5A 4PKYG 3MXQA 4EEPA 2A24B 4EETB 4QPRA 5HDCA 3T4LA 4O8GA 1S67L 3R7WA 2J3WA 4JGQA 3T4QA 3F1PB 1XFNA 1ZTUA 3D3OA 5DF9A 3S7PA 5J4EA 5TBMA 2O9AA 4ME4A 2O9CA 4WELA 4IUKA 1STZA 1N9OA 5DKKA 2W3EA 4GHIB 4UEYA 5HL6A 4ARZA 4O01A 4HIAA 2YKHA 1YAXA 3IBRA 4CLCC 4PHTA 1S1ZA 3BQ8A 2OWJA 3A0SA 3R4KA 3VOLA 1YSQA 2K2NA 3F1PA 4MN5A 1DP6A 2QYBA 4M4XA 4UQIM 3S7QA 3C2WA 1N9NA 3MFXA 5L8MA 4Y3IA 4L9GA 1LL8A 3OC2A 4GHIA 1UWNX 1GSVA 3LUQA 1XFQA 3PBOA 2XA7M 1LSWA 4XT2B 3LR4A 2W1TB 3F1OB 2V0UA 3BY9A 3TW8A 1YSPA 1MZUA 2HV1A 4IJGA 2QKPA 4L9EA 3UB6A 4WLAA 5TJJA 2B02A 4Q0IA 3CUEA 1MKMA 3T4SA 1T19A 3K3CA 4WEJA 3BJNA 4NXGA 3E4PA 4F3LB 3NHQA 3LIBA 5J3WA 1NRJA 4UQIS 4XT2A 1IFQA 3LR5A 1DRMA 1TS7A 5DFXA 2W1TA 4HJ4A 4I39A 3F1OA 2XA7S 5F68A 4DJ2A 3OOVA 3KSFA 3PBSA 5IT5A 5I5LA 3T4KA 4WN5A 3NOUC 3H7WB 4PAUA 3G6OA 2Z6DA 2PYPA 4L0LA 4Y5FA 3T4OA 1VHMA 3FC7A 4LRZE 4F3LA 5F5YA 3OLOA 3EQUA 2PR6A 1OJGA 2OAQ1 1P97A 3E4OA 4G3WA 2GNXA 3MR0A 3HJIA 2JKTI 4DJ3A 2O0YA 1N9LA 1T1AA 3ICYA 3U2AA 4L9FA 4P6ZS 3H7WA 3E0YA 3EWKA 3A0VA 3LI8A 4I3AA 3BW6A 3E4QA 2PD7A 4R38A 4HJ3A 2JHEA 1DP9A 2KLIA 4DN0A 4NKPA 3NJAA 5C5KA 3LR0A 2PR5A 4OOMA 2K31A 3BQAA 4Y2FA 5IU1A 4CLCE 4ZRRA 4LRXC 1MC0A 2PDRA 3C38A 4YOFA 2CMNA 3MJQA 3ULFA 2VEAA 3VV4A 4RQ9A 1LSXA 2JN7A 4HI4A 2I9VA 5IS1A 1OTDA 3OBFA 4KUOA 4GS9B 4KQOA 3B47A 1UWPX 4NXEA 3MF0A 2Y8HA 2JKRI 2QJ5A 3CI6A 2W3FA 4FOFA 4I3IA 1T1CA 4G3KA 3S7OA 3MQQA 1T18A 2W0NA 3BWLA 1G6OA 3VE3A 3HCYA 5HPIA 2W3DA 1S4RA 3P7NA 4GS9A 1X0OA 2EWWA 5AVFA 4WL9A 2P04A 2M7VA 1S66L 2EA9A 3PXPA 3H82B 2VV6A 1OJ5A 3DBAA 3PBTA 5AVEA 1LT0A 3FPWA 1D7EA 4CLCA 4HH3A 2ZMFA 2W3GA 3NOTC 4II7A 3KO6A 4BMWA 1S4SA 3CLOA 1NWZA 2PHYA 4I5SA 1G28A 2XSSA 2V9AA 3CITA 3K3DA 3PBRA 1ODVA 2Z6CA 3KYZA 3LIFA 4EU0A 2XROA 5G4YA 1Y28A 3O5YA 4R3AA 3LI9A 3E98A 3GDIA 3UB7A 3H82A 4BWIA 2L0WA 4Q0HA 4HOIA 2HJ9C 4B93A 4HNBA 2PD8A 2BASA 3MQ0A 4HP9A 5LBRA 5DKLA 5DJUA 3KSGA 2IA2A 3OCLA 1KOUA 2OWHA 2Y79A 4KUKA 4MCWA 1DP8A 1W63M 2JKTM 3EOIA 1P9WA 4O0PA 1P0ZA 4HH2A 2W3HA 4ETXA 4DMZA 3H9WA 2KOIA 3KSHA 4R6LA 1V9YA 2W27A 1EW0A 4YWZA 1S1YA 1H8MA 2J3TD 3V67A 2VA0A 2QJ7A 3FG8A 2M7UA 2LB5A 3LICA 2VV7A 1LSVA 4HJ6A 3F1NB 2K7SA 4JGOA 3K2NA 3T4JA 3UMDA 4EEUA 5DJTA 2VGLM 4WUJA 4CLCD 4EXOA 4CQHA 3ZYTA 2WKPA 2INWA 2JKRM 3FPVA 5HWVA 5HPFA 4MN6A 5J7EA 1JNUA 1WA9A 3B42A 5HDSA 1TS6A 2QWSA 3F1NA 2VV8A 4FSFA 3C8CA 2PT7A 2ZOHA 2HJEA 2PYRA 4BBVA 3TRCA 2FZ0A 4H6JB 5G4ZA 4BBUA 3EQVA 2ZOIA 2OAP1 2B18A 4Z1WA 2VGLS 3LYXA 5HD5A 2L4RA 3VE4A 4MMNA 1GSXA 4CLCB 1F9IA 2O9BA 1OTBA 1OTEA 5HDDA 4R70A 3IBJA 4IHQA 3EEHA 3JVVA 1TS0A 4WF0A 2NUTC 4WEKA 5DFYA 1OPXA 2J3TC 2DMWA 2MJ6A 3TE8A 2J80A 4H6JA 4I3JA 5F6AA 3RTYA 1H3QA 4HP4A 2OOLA 4NXBA 3MQOA 3ZQ5A 5FL3A 1VB6A 5F69A 1V9ZA 2WKRA 5HD3A 4I38A 5HSQA 2VLGA 4LLOB 1F5MA 3D72A 2VX8A 4BBTA 2XRNA 3BY8A 2G7UA 4GW9A 2A24A 5CX7A 2HF6A 2V1BA 2P7JA 3UB8A 4Q0JA 2KX6A 2VJWA 3KYQA 3P01A 1OTAA 2FH5A 4JGRA 2A2LA 2HGVA 3PBNA 3W2ZA 1ZHHB 1OTIA 3LR3A 3EEAA 2V1AA 1IOUA 3PHYA 3C30A 2NUPC 4BJPA 4EW7A 3CUEC 3HJKA 2D01A 2P08A 1F98A 4HY8A 3PR6A 1XJ4A 1XJ3A 1T1BA 5KSHA 2VZWA 2D02A 2L1MA 2LB9A 5MC7A 2GX5A 3UE3A 2ZBBA 3LIEA 4GCZA 3OCNA 1BYWA 4NXFA 3CAXA 1D06A 3B33A 3T4TA 1TF1A 3KSIA 4MDZA 3PBQA 4B9OA 1NLYA 3A0RA 4P6ZM 5HWWA 4ETZA 1OT9A 4LPZA 2GJ3A 3KX0X 3GECA 3PYPA 1W63Q 5AJGA 2M1CA 3IS2B 2EWVA 4HQAA 4AFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T50 A;  1OT6 A;  4LRY C;  4KQD A;  1XJ2 A;  1XJ6 A;  4JGP A;  2H28 A;  4PKY A;  3LIA A;  5A8B A;  5EFW A;  1TS8 A;  4HHD A;  4EES A;  3UB9 A;  4K08 A;  3SW1 A;  2KDK A;  5HZH A;  3IS2 A;  2V0W A;  3NOP C;  3UME A;  5HWT A;  2QHK A;  5KIZ A;  2YKF A;  3LID A;  1UGU A;  5TBM B;  4EER A;  3RH8 B;  4E04 A;  3UE6 A;  4EQ1 A;  2R78 A;  1GSW A;  3CWF A;  2WKQ A;  4PKY G;  3MXQ A;  4EEP A;  2A24 B;  4EET B;  5HDC A;  1S67 L;  4JGQ A;  3F1P B;  1XFN A;  5J4E A;  5TBM A;  1N9O A;  5DKK A;  4GHI B;  4HIA A;  2YKH A;  3IBR A;  1S1Z A;  2OWJ A;  3A0S A;  3VOL A;  3F1P A;  4MN5 A;  1DP6 A;  4M4X A;  3C2W A;  1N9N A;  3MFX A;  4L9G A;  1LL8 A;  4GHI A;  1UWN X;  1GSV A;  3LUQ A;  1XFQ A;  4XT2 B;  1LSW A;  3F1O B;  2V0U A;  3BY9 A;  1MZU A;  2HV1 A;  2QKP A;  4L9E A;  3UB6 A;  4WLA A;  2B02 A;  1T19 A;  3K3C A;  4NXG A;  3E4P A;  4F3L B;  3NHQ A;  3LIB A;  5J3W A;  4XT2 A;  1DRM A;  1TS7 A;  4HJ4 A;  4I39 A;  3F1O A;  5F68 A;  4DJ2 A;  5I5L A;  4WN5 A;  3NOU C;  3H7W B;  3G6O A;  2Z6D A;  2PYP A;  3FC7 A;  4LRZ E;  4F3L A;  5F5Y A;  3OLO A;  2PR6 A;  1OJG A;  1P97 A;  3E4O A;  3MR0 A;  3HJI A;  4DJ3 A;  1N9L A;  1T1A A;  3ICY A;  4L9F A;  3H7W A;  3EWK A;  3A0V A;  3LI8 A;  4I3A A;  3E4Q A;  2PD7 A;  4R38 A;  4HJ3 A;  2JHE A;  1DP9 A;  3NJA A;  2PR5 A;  5IU1 A;  4LRX C;  2PDR A;  2CMN A;  3MJQ A;  3ULF A;  2VEA A;  4RQ9 A;  1LSX A;  2JN7 A;  4HI4 A;  2I9V A;  5IS1 A;  1OTD A;  4KUO A;  4GS9 B;  4NXE A;  1UWP X;  2QJ5 A;  4I3I A;  1T1C A;  3MQQ A;  1T18 A;  2W0N A;  3BWL A;  3VE3 A;  1S4R A;  3P7N A;  4GS9 A;  1X0O A;  5AVF A;  4WL9 A;  1S66 L;  2EA9 A;  3H82 B;  2VV6 A;  1OJ5 A;  5AVE A;  1LT0 A;  1D7E A;  4HH3 A;  3NOT C;  1S4S A;  3CLO A;  1NWZ A;  2PHY A;  4I5S A;  1G28 A;  2V9A A;  3K3D A;  1ODV A;  2Z6C A;  3LIF A;  5G4Y A;  1Y28 A;  4R3A A;  3LI9 A;  3GDI A;  3UB7 A;  3H82 A;  2L0W A;  4HOI A;  4HNB A;  2PD8 A;  2BAS A;  4HP9 A;  5DKL A;  5DJU A;  1KOU A;  2OWH A;  4KUK A;  1DP8 A;  1P0Z A;  4HH2 A;  3H9W A;  4R6L A;  1V9Y A;  2W27 A;  1EW0 A;  4YWZ A;  1S1Y A;  2QJ7 A;  3FG8 A;  3LIC A;  2VV7 A;  1LSV A;  4HJ6 A;  3F1N B;  2K7S A;  4JGO A;  3UMD A;  4EEU A;  5DJT A;  4WUJ A;  4EXO A;  2WKP A;  2INW A;  5HWV A;  4MN6 A;  5J7E A;  1JNU A;  1WA9 A;  5HDS A;  1TS6 A;  2QWS A;  3F1N A;  2VV8 A;  3C8C A;  2ZOH A;  2PYR A;  4BBV A;  4H6J B;  5G4Z A;  4BBU A;  2ZOI A;  3LYX A;  5HD5 A;  2L4R A;  3VE4 A;  1GSX A;  1F9I A;  1OTB A;  1OTE A;  5HDD A;  4R70 A;  3EEH A;  1TS0 A;  4WF0 A;  2J80 A;  4H6J A;  4I3J A;  5F6A A;  3RTY A;  4HP4 A;  2OOL A;  4NXB A;  3MQO A;  3ZQ5 A;  1VB6 A;  5F69 A;  1V9Z A;  2WKR A;  5HD3 A;  4I38 A;  5HSQ A;  2VLG A;  4LLO B;  3D72 A;  3BY8 A;  4GW9 A;  2A24 A;  2V1B A;  2P7J A;  3UB8 A;  2KX6 A;  1OTA A;  4JGR A;  1OTI A;  2V1A A;  3PHY A;  4EW7 A;  3HJK A;  2D01 A;  1F98 A;  4HY8 A;  1XJ4 A;  1XJ3 A;  1T1B A;  2D02 A;  2L1M A;  2ZBB A;  3LIE A;  4GCZ A;  1BYW A;  4NXF A;  3CAX A;  1D06 A;  3B33 A;  4B9O A;  3A0R A;  5HWW A;  1OT9 A;  4LPZ A;  2GJ3 A;  3GEC A;  3KX0 X;  3PYP A;  2M1C A;  3IS2 B;  4HQA A;  4BBT A; 
#chains in the Genus database with same CATH topology
 3T50 A;  3SH9 A;  5L2F A;  4JGP A;  2H28 A;  3LIA A;  1XA7 A;  3V3S A;  1GHI A;  5FI6 A;  1I2W A;  4O7D A;  3RXX A;  4HHD A;  3UB9 A;  3D4F A;  4GJ4 A;  2VKS A;  1PWC A;  2V0W A;  3UME A;  5FDS A;  3GTC A;  3RFB A;  3R7W B;  3IX8 A;  5FEG A;  1SZV A;  1GHM A;  1JWV A;  2H10 A;  1H5X A;  1I2S A;  3CWF A;  1YT4 A;  1TD5 A;  4PKY G;  3MXQ A;  4DRT A;  3UN7 A;  3R7W A;  3Q07 A;  1ZTU A;  5FAT A;  5DF9 A;  4ME4 A;  2O9C A;  4WEL A;  2EXB A;  2XLN A;  4UEY A;  4OVD A;  4HIA A;  5EVE A;  3V5M A;  1PW1 A;  3BQ8 A;  3R4K A;  3VOL A;  1YSQ A;  1E25 A;  4P87 A;  2VK3 A;  3S7Q A;  1K56 A;  1J9M A;  3D9Y A;  4KQQ A;  4X53 A;  3PBO A;  4XT2 B;  5TR7 A;  3LR4 A;  3BY9 A;  3TW8 A;  2OLV A;  1MZU A;  2HV1 A;  3HLB A;  1NZU A;  2IWB A;  4S2K A;  3UB6 A;  4S2N C;  3SS4 A;  5IHV A;  3E4P A;  4F3L B;  1N4O A;  1IFQ A;  3LR5 A;  4XT2 A;  1FCN A;  1VET B;  4N9L A;  4I39 A;  4YIN A;  5EUA A;  5I5L A;  1FSY A;  3BM6 A;  3G6O A;  3T4O A;  1ES3 A;  4F3L A;  4GB7 A;  5F5Y A;  3EQU A;  1JWZ A;  1YLJ A;  2O0Y A;  1SDE A;  1N9L A;  1VET A;  2Y2O A;  3ICY A;  4UA7 A;  3ITA A;  4WM9 A;  2E8J A;  3U2A A;  4WMC A;  3EWK A;  5AQA A;  3A0V A;  3BLM A;  1NYM A;  3BW6 A;  1BUE A;  3E4Q A;  4QB8 A;  5GL9 A;  2KLI A;  3LR0 A;  4U0X A;  5CHM A;  3MXS A;  4RX3 A;  1K56 D;  3ULF A;  2Y2G A;  3T1S A;  1PWD A;  1BT5 A;  2XF3 A;  3OBF A;  3VFH A;  3B47 A;  1UWP X;  3ZG7 B;  1HTZ A;  3NY4 A;  3MF0 A;  4KQR A;  2V8C A;  4KEN B;  1WYC A;  2W3F A;  4FOF A;  4JKT A;  4GD8 A;  3S7O A;  3UY6 A;  3WRT A;  2W0N A;  4IED A;  4OPY A;  4FH4 A;  4GKU A;  4ID4 A;  1SKF A;  5HPI A;  5KMW A;  3V39 A;  2J9P A;  2OSU A;  5AVF A;  1M6K A;  3VSL A;  2M7V A;  3H82 B;  1OJ5 A;  2Y2H A;  3PBT A;  5AVE A;  3W4P A;  1LT0 A;  4LV1 A;  2JBF A;  3FPW A;  1XPB A;  2ZMF A;  2W3G A;  4II7 A;  3KO6 A;  1S4S A;  1NWZ A;  4I5S A;  2XSS A;  5F1F A;  3PBR A;  1KVL A;  4JF4 A;  4WMC D;  2XRO A;  2CC1 A;  4PM8 A;  3N4I A;  4R3A A;  3GDI A;  3H82 A;  3IHB A;  2L0W A;  2HDU A;  4QY6 A;  3LY4 A;  3V3R A;  1S0W A;  2Z2M B;  3HBR A;  4B4Z A;  5F82 A;  3KSG A;  1KOU A;  3MFD A;  3S4X A;  4KUK A;  1DP8 A;  3A3J A;  4S2N A;  5JYO A;  1XGI A;  1W63 M;  3EOI A;  1FR6 A;  1NXY A;  5L10 A;  3ZHH A;  4KZ5 A;  3H9W A;  3NDE A;  3KSH A;  1V9Y A;  2W27 A;  3IWQ A;  1S1Y A;  2J3T D;  3FG8 A;  2M7U A;  4DKI A;  5CEC A;  4R4R A;  3SS3 A;  4D2O A;  4EBN A;  1K57 C;  4WZ4 A;  3Q7V B;  1JWP A;  5EEC A;  4EXO A;  1K38 A;  1AXB A;  3FPV A;  5HWV A;  4MN6 A;  4KZ9 A;  2Y2P A;  1WA9 A;  1TS6 A;  1HLU P;  3SH8 A;  1NYY A;  4HBT A;  3C8C A;  2ZOH A;  3Q7V A;  2FZ0 A;  3WS2 A;  4EBL A;  4S2L A;  5G4Z A;  2ZOI A;  5HD5 A;  1ZG4 A;  2XFT A;  4CLC B;  2O9B A;  4N1H A;  5HDD A;  4E3M A;  3EEH A;  1PZO A;  4WF0 A;  3LEQ A;  2A49 A;  2HP6 A;  1ERM A;  3QP2 A;  4FTX A;  4I3J A;  4BLM A;  3MKF A;  1BTL A;  1H3Q A;  4B4X A;  3MQO A;  5FL3 A;  2V20 A;  3DWZ A;  5CTM A;  4X55 A;  5HSQ A;  4LLO B;  2BG1 A;  3HUM A;  4GOG A;  1O07 A;  1F5M A;  1RGZ A;  2WKH A;  2XRN A;  3BY8 A;  2G7U A;  4GW9 A;  5GLA A;  2HF6 A;  3UB8 A;  1G5U A;  4Q0J A;  2VJW A;  2A2L A;  3PBN A;  3UE1 A;  3W2Z A;  2WKI A;  3WS5 A;  1OTI A;  3EEA A;  4MBK A;  5CTN A;  1IOU A;  1HVB A;  2NUP C;  4BJP A;  1IYS A;  1MY8 A;  3DTI A;  3IQA A;  1VM1 A;  2HDQ A;  5KSH A;  2VZW A;  2D02 A;  2L1M A;  3L7H A;  1LI9 A;  5M19 A;  1NY0 A;  5MC7 A;  4GCZ A;  4KG2 A;  3HLF A;  1A0K A;  2EXA A;  4NXF A;  1D06 A;  4U0T A;  1IEL A;  3PBQ A;  1GA9 A;  3GRJ A;  2C5W B;  4GDB A;  5L09 A;  1TVF A;  2PBY A;  3VP2 A;  4N92 A;  1H8Z A;  1LI0 A;  1OT9 A;  3MZF A;  1G68 A;  3KX0 X;  5AJG A;  1IYQ A;  4IVK A;  4XXR A;  4HQA A;  1RCJ A;  2HDR A;  2XGN A;  5K5B A;  1YLY A;  2ZL1 B;  4P6B A;  4MBF A;  2GZA A;  4PKY A;  4IUH A;  2HPB A;  3LFV A;  3V50 A;  4EES A;  1BLH A;  4OLD A;  5CED A;  3HUO A;  2KDK A;  3MSH A;  3WRZ A;  4GZB A;  3ZDJ A;  3NDG A;  2ZL1 A;  1ALQ A;  2X01 A;  3AGF A;  3GV9 A;  3EGX C;  3MMH A;  1KGG A;  5EM0 A;  3JPU A;  4ARZ B;  2JKG A;  1H8Y A;  2WKQ A;  4EEP A;  2ZC4 B;  1PW8 A;  4MLL A;  4DXC A;  5GHZ A;  4QPR A;  5HDC A;  3C5A A;  1ES5 A;  4Y0T A;  4JGQ A;  1XFN A;  5J4E A;  3LCE A;  2O9A A;  4IUK A;  1STZ A;  4EWF A;  1N9O A;  1YM1 A;  5DKK A;  5FEF A;  4GHI B;  5D3O A;  4ARZ A;  3HVF A;  1G6A A;  3HRE A;  1YQS A;  4JLF A;  1XX2 A;  3BEC A;  4JXV A;  1S1Z A;  1W79 A;  4MBH A;  5EV0 A;  3BFE A;  1DP6 A;  2QYB A;  3C2W A;  4GHI A;  3BYD A;  3LUQ A;  1XFQ A;  3SOI A;  3ZVT A;  1LL9 A;  5EVL A;  4WLA A;  1MKM A;  4MNR A;  3K3C A;  3NC8 A;  4WEJ A;  1YLT A;  5DF7 A;  1YLW A;  2P9V B;  3NHQ A;  4UQI S;  1TS7 A;  5DFX A;  4ZTK A;  3GMW A;  3QHY A;  3KSF A;  5IT5 A;  2ZQC A;  4WN5 A;  1ONG A;  4PAU A;  1N9B A;  1YMS A;  1ES2 A;  4DE1 A;  3M2J A;  2P9V A;  5CHU A;  1BUL A;  2PR6 A;  3S1Y A;  1OJG A;  1P97 A;  3E4O A;  2Y2N A;  3HJI A;  4RYE A;  2Q9N A;  4L9F A;  4HBU A;  1CEF A;  2XFS A;  1JVJ A;  3LI8 A;  5FQQ A;  5CGX A;  4R38 A;  3CMZ A;  4KG6 A;  4NKP A;  2PR5 A;  4OOM A;  4OON A;  4F94 A;  2PDR A;  5GLB A;  1DJA A;  3MJQ A;  3QNC A;  3VV4 A;  2J7V A;  1KDW A;  3U4L P;  1LSX A;  4HI4 A;  3G31 A;  5IS1 A;  2HZ5 A;  4KUO A;  1BSG A;  1LL5 A;  2EX8 A;  2Y8H A;  5EM1 A;  1KE4 A;  4LCM A;  4OKP A;  1HD8 A;  1T18 A;  1G6O A;  5EVI C;  4BD0 A;  2W3D A;  4DF6 A;  1CEG A;  4OPR A;  4WL9 A;  2P04 A;  4BQM A;  1S66 L;  3PXP A;  5EOO A;  4R0Q A;  2VV6 A;  1MWT A;  1KDS A;  1MWS A;  2RCX A;  4HH3 A;  2WAD A;  2VGJ A;  3ZG9 B;  2PHY A;  1G28 A;  2V9A A;  3QP6 A;  1ODV A;  3DW0 A;  4R1G A;  4CPK A;  1QME A;  3M6B A;  3QP5 A;  1K6R A;  2JKF A;  3I7J A;  4Q0H A;  3G34 A;  4QJG A;  4HOI A;  2HJ9 C;  4B93 A;  1BLC A;  1K6S A;  4E3I A;  4HNB A;  2PD8 A;  5DKL A;  1I5Q A;  3TG9 A;  3IX3 A;  2XQZ A;  4JF5 A;  4HES A;  2ZD8 A;  2KOI A;  4S2I A;  4Y13 A;  1NZO A;  4R6L A;  1ES4 A;  1L0E A;  5AQ9 A;  5FDH A;  4DDY A;  2LB5 A;  4UHU A;  3LIC A;  3Q1F A;  1LSV A;  2PU2 A;  2WYX A;  4HJ6 A;  4DE3 A;  2X71 A;  3F1N B;  2K7S A;  4JGO A;  3BEB A;  3W8K A;  3K2N A;  1WE4 A;  5FI7 A;  4QY5 A;  3UO9 A;  2DNS A;  2J8Y A;  4WUJ A;  3UPO A;  3N8R A;  4MEZ A;  2V2F F;  5HX9 A;  2PAV P;  2WKP A;  5HDS A;  3TOI A;  1NRF A;  2QWS A;  3F1N A;  2VV8 A;  4YFM A;  2PYR A;  5FAP A;  4BBV A;  1SCW A;  4BBU A;  2QMI A;  3EQV A;  4LEN A;  4CJN A;  2VGL S;  4DXB A;  1SDN A;  1GSX A;  1F9I A;  2Z2L B;  4R70 A;  4Y15 A;  3JVV A;  5DFY A;  2DMW A;  3TE8 A;  3BFF A;  3VP0 A;  3MBZ A;  4JXS A;  2A3U A;  3RTY A;  4NXB A;  4BL3 A;  1EI5 A;  5EVI A;  3ZQ5 A;  5FSR A;  4N9K A;  4D60 A;  4EBP A;  2ZQ8 A;  1K0K A;  4OPZ A;  5F83 A;  1W7F A;  3IH8 A;  5CX7 A;  3NUL A;  2A24 A;  1FCM A;  2KX6 A;  2ACG A;  3P01 A;  3TSG A;  1KE0 A;  5L07 A;  1ZHH B;  4E3N A;  2IWC A;  1S6R A;  3QP1 A;  5HFO A;  4S2M A;  2V1A A;  2EX2 A;  3PHY A;  5DVA A;  4KZ8 A;  1GCE A;  3UDF A;  4EW7 A;  3CUE C;  4P0M A;  2D01 A;  2P08 A;  1F98 A;  2XD5 A;  3PR6 A;  4IBX A;  1XJ3 A;  1T1B A;  2UV0 E;  3MZE A;  4WYY A;  5FAO A;  4X56 A;  3T1Q B;  2Y2Q A;  1J3W A;  3DWK A;  3A3F A;  4B9O A;  3B3X A;  1XKZ A;  5TFQ A;  3KYE A;  3IXD A;  2Y59 A;  3VP1 A;  3VSK A;  2M1C A;  3IS2 B;  2WKE A;  1U60 A;  3SW1 A;  1XGJ A;  4ZBE A;  4G3V A;  3HLD A;  5DTS A;  4U3T A;  4ESP A;  4PM7 A;  2R9W A;  3C4P A;  4UA6 A;  4BD1 A;  4NK3 A;  3HLG A;  3EGD C;  5A90 A;  5A8B A;  1P9R A;  5EFW A;  1FSW A;  3S7N A;  4K08 A;  2WGV A;  3CPT B;  3IS2 A;  4GLQ A;  2X02 A;  5HWT A;  2ZMV A;  1ESI A;  4RVA A;  4JF6 A;  3LID A;  3MS6 A;  1UGU A;  5TBM B;  1W8Y A;  4EUV A;  2PRF A;  4NEE D;  2XDM A;  5FQK A;  3RH8 B;  3TJZ C;  3UE6 A;  3MZD A;  4EQ1 A;  4OOL A;  1GSW A;  5EOE A;  3CPT A;  1YKD A;  1MBL A;  1L0D A;  4EET B;  2H0T A;  4LFU A;  3N8S A;  3QNB A;  4Y7P A;  4JXG A;  1K4F A;  3UDI A;  1CK3 A;  1S67 L;  2J3W A;  1M40 A;  4RX2 A;  3T4Q A;  3F1P B;  3AGE A;  3S7P A;  2JE5 A;  5TBM A;  2EFU A;  2W3E A;  5HL6 A;  4O01 A;  3DTM A;  3WS1 A;  2B95 A;  4KZ6 A;  4IVI A;  4KG5 A;  2OWJ A;  1K55 C;  3A0S A;  3VFF A;  2QZ6 A;  3M2K A;  3F1P A;  4MN5 A;  4FCF A;  3N6I A;  4M4X A;  3QP8 A;  4UQI M;  3SZT A;  3NI9 A;  1N9N A;  4ZJ3 A;  1LL8 A;  1UWN X;  1WYB A;  3IF5 A;  2W1T B;  1Z09 A;  3IXH A;  2V0U A;  3BFD A;  1IYO A;  1W5D A;  1MWR A;  2QKP A;  4BL2 A;  1BLS A;  2ZQ9 A;  2B02 A;  5CGW A;  3CUE A;  5TJJ A;  1JTG A;  3BJN A;  2Q0O A;  4NXG A;  1SHV A;  2WUQ A;  3LIB A;  5J3W A;  5E2E A;  5GHY A;  5F1G A;  2Y2I A;  3OPH A;  3VOY A;  3UE0 A;  4K0X A;  2W1T A;  3BFG A;  2PBD P;  4UA9 A;  1ERO A;  2G2U A;  2XA7 S;  5F68 A;  4DJ2 A;  4JBF A;  3T4K A;  3NOU C;  1CQA A;  3H7W B;  3DTK A;  2PYP A;  5DF8 A;  4Y0U A;  1VHM A;  3VP4 A;  5HL1 A;  1KGE A;  4LRZ E;  1PI4 A;  2FFF B;  3OLO A;  3ZG5 A;  5CHJ A;  4ZDX A;  2OAQ 1;  2EX9 A;  2GNX A;  3MR0 A;  2JKT I;  4FD8 A;  4DJ3 A;  1K57 A;  1SKO A;  3ZFZ A;  1ACF A;  2E8I A;  3H7W A;  1BLP A;  3E0Y A;  3VP3 A;  2EFX A;  4JXW A;  4I3A A;  1CI9 A;  2PD7 A;  4HJ3 A;  1DP9 A;  1KVM A;  2WAF A;  1BZA A;  4DN0 A;  3NJA A;  4CLC E;  1CI8 A;  1MC0 A;  3C38 A;  3ZNY A;  4RA7 A;  3FKW A;  4OQH A;  4Y17 A;  4RQ9 A;  3GQZ A;  4P85 A;  2I9V A;  2DRW A;  1OTD A;  3WWX A;  4E3O A;  4GS9 B;  2GDN A;  2WAE A;  4KQO A;  4NXE A;  1YLP A;  2JKR I;  3CI6 A;  1Q2P A;  5DTK A;  4G3K A;  4FH2 A;  3IF6 C;  2IWD A;  4QWO A;  2Y4A A;  1EWZ A;  1E4D A;  3P7N A;  4GS9 A;  4PMA A;  3NCK A;  5FQI A;  3DBA A;  5FI2 A;  1IKI A;  3HLC A;  1TEM A;  1D7E A;  3NOT C;  2HDS A;  3FKV A;  4BMW A;  5FQJ A;  1K55 A;  3K3D A;  5G18 A;  4KZA A;  3LIF A;  4EU0 A;  1OME A;  1Y28 A;  3RXW A;  3O5Y A;  3LI9 A;  3E98 A;  3UB7 A;  2WZX A;  4BWI A;  2ZJ9 A;  2BAS A;  3MQ0 A;  4HP9 A;  5LBR A;  3IX4 A;  5DJU A;  3AGD A;  1FCO A;  2IA2 A;  2OWH A;  3IT9 A;  4WZ5 C;  2HP9 A;  2JKT M;  2DCF A;  1P9W A;  1P0Z A;  4HH2 A;  3L9K A;  1ZKJ A;  2W3H A;  4ETX A;  1RP5 A;  3G2Z A;  3CG5 A;  2Y2M A;  5M18 A;  4BEN A;  1EW0 A;  4K91 A;  1H8M A;  2J9O A;  5E2G A;  2XR0 A;  3V67 A;  3T1X A;  1IEM A;  5CER A;  4NET A;  5FA7 A;  3CHW P;  5AQB A;  4OH0 A;  3T4J A;  1C3B A;  2AVX A;  3UMD A;  2VGL M;  3HL9 A;  4LCL A;  4CQH A;  4ZJ1 A;  3ZYT A;  2INW A;  2JKR M;  4C6Y A;  3Q81 A;  4R3J A;  1F2K A;  1PIO A;  4X25 A;  1JNU A;  2XK1 A;  3B42 A;  1KE3 A;  3OZH A;  4FSF A;  1PWG A;  2Y2J A;  2H5S A;  1KGF A;  1L3L A;  4H6J B;  5HAQ A;  1MWU A;  3IF6 B;  3IWI A;  3LYX A;  3VE4 A;  4MMN A;  3O87 A;  3LGO A;  4R4S A;  3DTE A;  1PYY A;  1TS0 A;  1VQQ A;  1OPX A;  2J3T C;  2QPN A;  2J80 A;  4H6J A;  3OPP A;  5F6A A;  3IF6 A;  4HP4 A;  1ZG6 A;  2OOL A;  1CJF A;  3BLS A;  4GDN A;  5F69 A;  1V9Z A;  2WKR A;  1Z6F A;  1TDL A;  2ZM8 A;  5HD3 A;  4I38 A;  3IWO A;  3FYZ A;  4HEF A;  3D72 A;  3Q7Z A;  5BOH A;  4E3L A;  1LHY A;  2ZM2 A;  2P7J A;  2OV5 A;  1L0F A;  4JGR A;  2HGV A;  5JYP A;  3G2Y A;  2ZMA A;  1L2S A;  1K54 C;  2H0Y A;  3C30 A;  3M6H A;  4HY8 A;  2XEP A;  3E2K A;  3CJM A;  3A3D A;  4R23 A;  2LB9 A;  2Y55 A;  5GHX A;  3WS4 A;  1H0M A;  3N8L A;  2FFY A;  4E6W A;  3PTE A;  3SS5 A;  3G32 A;  4UAA A;  1ESU A;  2JC7 A;  3B33 A;  3T4T A;  4WZ5 A;  2I72 A;  1TF1 A;  3KSI A;  4MDZ A;  4M3K A;  1NLY A;  4P6Z M;  4QU3 A;  4LGW A;  4ETZ A;  1GHP A;  4LPZ A;  5EPH A;  2GJ3 A;  3T1R A;  3IHA A;  3S22 A;  4PM9 A;  3UNW A;  3VMA A;  1NJ4 A;  4BBT A;  1OT6 A;  4LRY C;  4KQD A;  4PPR A;  1XJ2 A;  1XJ6 A;  4C75 A;  3NEC A;  3HUN A;  2Q9M A;  1TS8 A;  3LEZ A;  4N1X A;  4C3Q A;  3W4O A;  1DY6 A;  1NLZ A;  5HZH A;  5A91 A;  5CXW A;  2B5R A;  4YNR A;  3C7V A;  4DE0 A;  3NOP C;  2W1R A;  2QHK A;  5KIZ A;  3IXB A;  2O99 A;  4OQ0 A;  5EVI B;  2YKF A;  4MN7 A;  3JVU A;  4EER A;  4E04 A;  4OQI A;  5CEB A;  1FIL A;  2R78 A;  2VGK A;  5KSC A;  2A24 B;  1JTD A;  4Y0O A;  2ZLY A;  1YLZ A;  3NIA A;  3T4L A;  4O8G A;  3O88 A;  4OOY A;  3D3O A;  5DTT A;  3G30 A;  4NG2 A;  5U47 A;  4KZB A;  2YKH A;  1YAX A;  3IBR A;  2HP5 A;  5E2F A;  4CLC C;  2P74 A;  4PHT A;  5FQ9 A;  2Y91 A;  1RGY A;  1PNE A;  4X68 A;  3E2L A;  2K2N A;  3BFC A;  1FOF A;  3P09 A;  5L8M A;  3MFX A;  3LO7 A;  4Y3I A;  4L9G A;  3C7U A;  3OC2 A;  1FIK A;  3ZGA B;  1GSV A;  2XA7 M;  1LSW A;  4GD6 A;  1XP4 A;  2WZZ A;  3F1O B;  4S2O A;  1YSP A;  1K54 A;  4IJG A;  4L9E A;  3N7W A;  5FAS A;  2G2W A;  4Q0I A;  4XUX A;  2XD1 A;  3T4S A;  1T19 A;  1HZO A;  4A5R A;  2ZC3 B;  1NRJ A;  3ZG0 A;  3A3I A;  5GLD A;  1DRM A;  4HJ4 A;  5E43 A;  3F1O A;  3OOV A;  1AWI A;  3PBS A;  1QMF A;  1YPR A;  4E3J A;  2Z6D A;  4L0L A;  4Y5F A;  2ZQD A;  3CZD A;  4EQI A;  3FC7 A;  5A92 A;  3HLE A;  5EVI D;  3T12 B;  4G3W A;  1IYP A;  2Y2L A;  1L0G A;  1DJB A;  1T1A A;  3IXG A;  1FR1 A;  4E3K A;  4P6Z S;  2ZM0 A;  3ITB A;  3FWL A;  3G35 A;  4PM5 A;  1O7E A;  2XH9 A;  3W4Q A;  2JHE A;  3BRM A;  1ERQ A;  3ZG8 B;  5HAI A;  5C5K A;  2K31 A;  3BQA A;  4OLG A;  4Y2F A;  5IU1 A;  4KZ4 A;  4ZRR A;  4LRX C;  4YOF A;  2CMN A;  3HLW A;  1PFL A;  3NBL A;  2VEA A;  2JN7 A;  3PAE A;  4DDS A;  1DJC A;  3PAG A;  2QJ5 A;  4I3I A;  1T1C A;  4LV3 A;  5FQM A;  3MQQ A;  3BWL A;  3VE3 A;  3HCY A;  3IH9 A;  1S4R A;  2RL3 A;  1X0O A;  1ZC2 A;  2EWW A;  3GR2 A;  4S2J A;  2EA9 A;  4LV2 A;  4QD4 A;  1W8Q A;  4CLC A;  1MXO A;  5GLC A;  3FZC A;  3CLO A;  3CIT A;  4FUW A;  4GN2 A;  5CRF A;  3ZCZ A;  2Z6C A;  3KYZ A;  1PZP A;  5G4Y A;  3C4O A;  1D1J A;  3MKE A;  5E2H A;  3P98 A;  4WBG A;  4EUZ A;  2BLS A;  3MXR A;  3SH7 A;  2ZQA A;  3OCL A;  2Y79 A;  3UB5 P;  4MCW A;  1Y54 A;  3O3V A;  1SKO B;  1LLB A;  4EV4 A;  4O0P A;  3VOZ A;  4OP5 A;  4LV0 A;  4GNU A;  2EX6 A;  4KZ7 A;  4OQG A;  4DMZ A;  3OPL A;  3WS0 A;  4X69 A;  1PI5 A;  4R3B A;  3Q82 A;  4Z9Q A;  2JCH A;  4YWZ A;  1TDG A;  4X1M A;  2VA0 A;  2QJ7 A;  5AQ7 A;  2VV7 A;  1E3U A;  5J8X A;  2UWX A;  2OLU A;  5FAQ A;  4PM6 A;  4EEU A;  5DJT A;  4OPQ A;  5CGS A;  3FV7 A;  4CLC D;  1PRQ A;  5A93 A;  2Y2K A;  5HPF A;  5J7E A;  1IKG A;  2C6W B;  3O86 A;  1XA1 A;  1VEU B;  2WGW B;  2PT7 A;  2HJE A;  3DAV A;  1Y4O A;  3TRC A;  2OAP 1;  4X6T A;  2B18 A;  4Z1W A;  2L4R A;  1OTB A;  2WGI A;  1OTE A;  3IBJ A;  1XXM A;  3JYI A;  4IHQ A;  1VEU A;  4WEK A;  2NUT C;  2WGW A;  5M1A A;  2MJ6 A;  4XUZ A;  1Q2Q A;  4X1L A;  1MPL A;  4S2P A;  3UPP A;  3UPN A;  2R9X A;  1K25 A;  4E6X A;  1VB6 A;  3GVB A;  2VLG A;  1MKI A;  2ZQ7 A;  4DE2 A;  1E3U D;  1CF0 A;  3ZVW A;  2VX8 A;  3GSG A;  3ISG A;  1FQG A;  2V1B A;  1K4E A;  3KYQ A;  3LY3 A;  1OTA A;  2FH5 A;  4H8R A;  3OPR A;  2ZC7 A;  4K0W A;  3LR3 A;  5HW3 A;  5EE8 A;  2BTF P;  2V1Z A;  5KZH A;  4IBR A;  3HJK A;  4Q8I A;  5I94 A;  2ZC5 B;  1XJ4 A;  5HAP A;  2GX5 A;  2ZC6 B;  4ZAM A;  5HAR A;  3UE3 A;  3ZNT A;  1YMX A;  2ZBB A;  3QP4 A;  3LIE A;  3UDX A;  3OCN A;  1BYW A;  3CAX A;  4KZ3 A;  3A3E A;  3RJU A;  3A0R A;  3G4P A;  5TGF A;  4B88 A;  5HWW A;  2WK0 A;  4OP8 A;  1ONH A;  4ZJ2 A;  2PU4 A;  4QHC A;  3GEC A;  3PYP A;  1W63 Q;  2V8F A;  4JPM A;  2EWV A;  1GA0 A;  4AFI A; 
#chains in the Genus database with same CATH homology
 3T50 A;  5K5B A;  4G3V A;  1OT6 A;  4LRY C;  4KQD A;  2GZA A;  1XJ2 A;  1XJ6 A;  4JGP A;  2H28 A;  4PKY A;  4IUH A;  3LIA A;  3EGD C;  5A8B A;  1P9R A;  3LFV A;  5EFW A;  1TS8 A;  4HHD A;  4EES A;  3UB9 A;  3S7N A;  4K08 A;  3SW1 A;  1NLZ A;  2KDK A;  5HZH A;  3IS2 A;  4GJ4 A;  4GLQ A;  2VKS A;  4YNR A;  2V0W A;  3NOP C;  3UME A;  2W1R A;  5HWT A;  2QHK A;  2ZMV A;  3RFB A;  3R7W B;  5KIZ A;  2O99 A;  2YKF A;  4MN7 A;  3LID A;  3JVU A;  1UGU A;  5TBM B;  4EER A;  4EUV A;  4NEE D;  3EGX C;  3RH8 B;  4E04 A;  3MMH A;  3TJZ C;  3UE6 A;  4EQ1 A;  2R78 A;  4OOL A;  1GSW A;  4ARZ B;  3CWF A;  1YKD A;  2WKQ A;  1TD5 A;  4PKY G;  3MXQ A;  4EEP A;  2A24 B;  4EET B;  4QPR A;  5HDC A;  3T4L A;  4O8G A;  1S67 L;  3R7W A;  2J3W A;  4JGQ A;  3T4Q A;  3F1P B;  1XFN A;  1ZTU A;  3D3O A;  5DF9 A;  3S7P A;  5J4E A;  5TBM A;  2O9A A;  4ME4 A;  2O9C A;  4WEL A;  4IUK A;  1STZ A;  1N9O A;  5DKK A;  2W3E A;  4GHI B;  4UEY A;  5HL6 A;  4ARZ A;  4O01 A;  4HIA A;  2YKH A;  1YAX A;  3IBR A;  4CLC C;  4PHT A;  1S1Z A;  3BQ8 A;  2OWJ A;  3A0S A;  3R4K A;  3VOL A;  1YSQ A;  2K2N A;  3F1P A;  4MN5 A;  1DP6 A;  2QYB A;  4M4X A;  4UQI M;  3S7Q A;  3C2W A;  1N9N A;  3MFX A;  5L8M A;  4Y3I A;  4L9G A;  1LL8 A;  3OC2 A;  4GHI A;  1UWN X;  1GSV A;  3LUQ A;  1XFQ A;  3PBO A;  2XA7 M;  1LSW A;  4XT2 B;  3LR4 A;  2W1T B;  3F1O B;  2V0U A;  3BY9 A;  3TW8 A;  1YSP A;  1MZU A;  2HV1 A;  4IJG A;  2QKP A;  4L9E A;  3UB6 A;  4WLA A;  5TJJ A;  2B02 A;  4Q0I A;  3CUE A;  1MKM A;  3T4S A;  1T19 A;  3K3C A;  4WEJ A;  3BJN A;  4NXG A;  3E4P A;  4F3L B;  3NHQ A;  3LIB A;  5J3W A;  1NRJ A;  4UQI S;  4XT2 A;  1IFQ A;  3LR5 A;  1DRM A;  1TS7 A;  5DFX A;  2W1T A;  4HJ4 A;  4I39 A;  3F1O A;  2XA7 S;  5F68 A;  4DJ2 A;  3OOV A;  3KSF A;  3PBS A;  5IT5 A;  5I5L A;  3T4K A;  4WN5 A;  3NOU C;  3H7W B;  4PAU A;  3G6O A;  2Z6D A;  2PYP A;  4L0L A;  4Y5F A;  3T4O A;  1VHM A;  3FC7 A;  4LRZ E;  4F3L A;  5F5Y A;  3OLO A;  3EQU A;  2PR6 A;  1OJG A;  2OAQ 1;  1P97 A;  3E4O A;  4G3W A;  2GNX A;  3MR0 A;  3HJI A;  2JKT I;  4DJ3 A;  2O0Y A;  1N9L A;  1T1A A;  3ICY A;  3U2A A;  4L9F A;  4P6Z S;  3H7W A;  3E0Y A;  3EWK A;  3A0V A;  3LI8 A;  4I3A A;  3BW6 A;  3E4Q A;  2PD7 A;  4R38 A;  4HJ3 A;  2JHE A;  1DP9 A;  2KLI A;  4DN0 A;  4NKP A;  3NJA A;  5C5K A;  3LR0 A;  2PR5 A;  4OOM A;  2K31 A;  3BQA A;  4Y2F A;  5IU1 A;  4CLC E;  4ZRR A;  4LRX C;  1MC0 A;  2PDR A;  3C38 A;  4YOF A;  2CMN A;  3MJQ A;  3ULF A;  2VEA A;  3VV4 A;  4RQ9 A;  1LSX A;  2JN7 A;  4HI4 A;  2I9V A;  5IS1 A;  1OTD A;  3OBF A;  4KUO A;  4GS9 B;  4KQO A;  3B47 A;  1UWP X;  4NXE A;  3MF0 A;  2Y8H A;  2JKR I;  2QJ5 A;  3CI6 A;  2W3F A;  4FOF A;  4I3I A;  1T1C A;  4G3K A;  3S7O A;  3MQQ A;  1T18 A;  2W0N A;  3BWL A;  1G6O A;  3VE3 A;  3HCY A;  5HPI A;  2W3D A;  1S4R A;  3P7N A;  4GS9 A;  1X0O A;  2EWW A;  5AVF A;  4WL9 A;  2P04 A;  2M7V A;  1S66 L;  2EA9 A;  3PXP A;  3H82 B;  2VV6 A;  1OJ5 A;  3DBA A;  3PBT A;  5AVE A;  1LT0 A;  3FPW A;  1D7E A;  4CLC A;  4HH3 A;  2ZMF A;  2W3G A;  3NOT C;  4II7 A;  3KO6 A;  4BMW A;  1S4S A;  3CLO A;  1NWZ A;  2PHY A;  4I5S A;  1G28 A;  2XSS A;  2V9A A;  3CIT A;  3K3D A;  3PBR A;  1ODV A;  2Z6C A;  3KYZ A;  3LIF A;  4EU0 A;  2XRO A;  5G4Y A;  1Y28 A;  3O5Y A;  4R3A A;  3LI9 A;  3E98 A;  3GDI A;  3UB7 A;  3H82 A;  4BWI A;  2L0W A;  4Q0H A;  4HOI A;  2HJ9 C;  4B93 A;  4HNB A;  2PD8 A;  2BAS A;  3MQ0 A;  4HP9 A;  5LBR A;  5DKL A;  5DJU A;  3KSG A;  2IA2 A;  3OCL A;  1KOU A;  2OWH A;  2Y79 A;  4KUK A;  4MCW A;  1DP8 A;  1W63 M;  2JKT M;  3EOI A;  1P9W A;  4O0P A;  1P0Z A;  4HH2 A;  2W3H A;  4ETX A;  4DMZ A;  3H9W A;  2KOI A;  3KSH A;  4R6L A;  1V9Y A;  2W27 A;  1EW0 A;  4YWZ A;  1S1Y A;  1H8M A;  2J3T D;  3V67 A;  2VA0 A;  2QJ7 A;  3FG8 A;  2M7U A;  2LB5 A;  3LIC A;  2VV7 A;  1LSV A;  4HJ6 A;  3F1N B;  2K7S A;  4JGO A;  3K2N A;  3T4J A;  3UMD A;  4EEU A;  5DJT A;  2VGL M;  4WUJ A;  4CLC D;  4EXO A;  4CQH A;  3ZYT A;  2WKP A;  2INW A;  2JKR M;  3FPV A;  5HWV A;  5HPF A;  4MN6 A;  5J7E A;  1JNU A;  1WA9 A;  3B42 A;  5HDS A;  1TS6 A;  2QWS A;  3F1N A;  2VV8 A;  4FSF A;  3C8C A;  2PT7 A;  2ZOH A;  2HJE A;  2PYR A;  4BBV A;  3TRC A;  2FZ0 A;  4H6J B;  5G4Z A;  4BBU A;  3EQV A;  2ZOI A;  2OAP 1;  2B18 A;  4Z1W A;  2VGL S;  3LYX A;  5HD5 A;  2L4R A;  3VE4 A;  4MMN A;  1GSX A;  4CLC B;  1F9I A;  2O9B A;  1OTB A;  1OTE A;  5HDD A;  4R70 A;  3IBJ A;  4IHQ A;  3EEH A;  3JVV A;  1TS0 A;  4WF0 A;  2NUT C;  4WEK A;  5DFY A;  1OPX A;  2J3T C;  2DMW A;  2MJ6 A;  3TE8 A;  2J80 A;  4H6J A;  4I3J A;  5F6A A;  3RTY A;  1H3Q A;  4HP4 A;  2OOL A;  4NXB A;  3MQO A;  3ZQ5 A;  5FL3 A;  1VB6 A;  5F69 A;  1V9Z A;  2WKR A;  5HD3 A;  4I38 A;  5HSQ A;  2VLG A;  4LLO B;  1F5M A;  3D72 A;  2VX8 A;  4BBT A;  2XRN A;  3BY8 A;  2G7U A;  4GW9 A;  2A24 A;  5CX7 A;  2HF6 A;  2V1B A;  2P7J A;  3UB8 A;  4Q0J A;  2KX6 A;  2VJW A;  3KYQ A;  3P01 A;  1OTA A;  2FH5 A;  4JGR A;  2A2L A;  2HGV A;  3PBN A;  3W2Z A;  1ZHH B;  1OTI A;  3LR3 A;  3EEA A;  2V1A A;  1IOU A;  3PHY A;  3C30 A;  2NUP C;  4BJP A;  4EW7 A;  3CUE C;  3HJK A;  2D01 A;  2P08 A;  1F98 A;  4HY8 A;  3PR6 A;  1XJ4 A;  1XJ3 A;  1T1B A;  5KSH A;  2VZW A;  2D02 A;  2L1M A;  2LB9 A;  5MC7 A;  2GX5 A;  3UE3 A;  2ZBB A;  3LIE A;  4GCZ A;  3OCN A;  1BYW A;  4NXF A;  3CAX A;  1D06 A;  3B33 A;  3T4T A;  1TF1 A;  3KSI A;  4MDZ A;  3PBQ A;  4B9O A;  1NLY A;  3A0R A;  4P6Z M;  5HWW A;  4ETZ A;  1OT9 A;  4LPZ A;  2GJ3 A;  3KX0 X;  3GEC A;  3PYP A;  1W63 Q;  5AJG A;  2M1C A;  3IS2 B;  2EWV A;  4HQA A;  4AFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...