4BBVA

The pb0 photocycle intermediate of photoactive yellow protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Watching a Signaling Protein Function in Real Time Via 100-Ps Time-Resolved Laue Crystallography.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4bbvA00
1OTBA 5HWWA 3LI8A 3VOLA 5HSQA 5DKLA 2K7SA 3LIAA 4DJ2A 1TS7A 2L0WA 4HHDA 2WKPA 1NWZA 4HNBA 4KQDA 3H7WA 3F1PA 2A24B 3SW1A 3LUQA 4NXEA 5IS1A 2M1CA 2OWHA 5J7EA 1DP6A 2CMNA 2V0WA 1N9LA 1S4RA 2ZOHA 4GS9A 1BYWA 3CWFA 1OTEA 5HWTA 1OTAA 1LT0A 2L4RA 4L9GA 3LI9A 3MQOA 4EEUA 4EESA 2PDRA 4R6LA 4I3JA 4LRXC 2WKRA 3LYXA 1MZUA 2VLGA 1XJ6A 3IS2A 3UB7A 4NXFA 1P97A 5HDSA 2QWSA 2PD7A 4KUKA 3GECA 4LPZA 1OT6A 1GSVA 1VB6A 2YKFA 3BY9A 5F5YA 4I38A 3MJQA 3BWLA 3F1OB 2JHEA 3HJKA 3H82A 3LIFA 2JN7A 4HJ6A 4I3AA 1T18A 2OOLA 3H9WA 4PKYA 1ODVA 5AVFA 5TBMA 2H28A 1S1ZA 4PKYG 3UE6A 2D02A 5HDDA 4GHIB 4H6JB 2GJ3A 2PYPA 3NHQA 4EW7A 3T50A 1OJGA 2KDKA 1TS6A 4GW9A 3F1NB 3B33A 2PR6A 2ZOIA 3MFXA 3NOUC 5DJUA 1T1AA 1S4SA 2V1AA 3PYPA 5F6AA 4YWZA 1S1YA 4K08A 1V9YA 1XFNA 1LSWA 1DP9A 2WKQA 4RQ9A 4WLAA 3A0VA 5I5LA 2I9VA 4L9EA 3LIBA 4HH2A 2V9AA 3BY8A 2Z6DA 3E4QA 1OJ5A 4HQAA 3E4OA 3UMDA 1D7EA 5F69A 1WA9A 4HH3A 1KOUA 1OTDA 2VEAA 3PHYA 4F3LB 2W0NA 3GDIA 1LL8A 5HD5A 2EA9A 4MN5A 4JGOA 5G4YA 5KIZA 4I3IA 2W27A 4JGRA 1GSXA 3HJIA 4XT2B 4R3AA 1LSVA 2QJ7A 2A24A 2VV8A 4I5SA 1N9NA 3ICYA 4WN5A 5EFWA 4R38A 1T1BA 2L1MA 4GCZA 3K3CA 3D72A 2OWJA 2B02A 1XJ4A 4WUJA 5DJTA 2PYRA 2PD8A 4HJ3A 4R70A 1UGUA 3IBRA 4HOIA 5AVEA 1DRMA 1JNUA 4E04A 3LIEA 3EEHA 3H7WB 5DKKA 2V0UA 1P0ZA 3F1PB 3EWKA 1T19A 4M4XA 3OLOA 4WF0A 1XFQA 4DJ3A 4LLOB 3VE3A 4NXBA 4LRZE 4GS9B 4HY8A 3F1OA 3MQQA 3NJAA 4HI4A 4BBUA 3UB6A 1XJ2A 3CLOA 3P7NA 3FC7A 4EETB 1OTIA 1DP8A 5HZHA 2D01A 4HP4A 5HDCA 2QJ5A 1V9ZA 5HWVA 5J3WA 3G6OA 3MR0A 1S67L 4GHIA 3IS2B 4H6JA 3LICA 4KUOA 2ZBBA 5G4ZA 1X0OA 3RH8B 2VV7A 2PR5A 3FG8A 1GSWA 1F98A 2HV1A 2P7JA 3F1NA 4LRYC 4MN6A 3C8CA 2KX6A 4WL9A 2QKPA 3E4PA 3H82B 2PHYA 1Y28A 3UMEA 1G28A 1EW0A 4EEPA 3RTYA 3CAXA 5TBMB 1F9IA 5HD3A 4B9OA 3KX0X 4NXGA 3VE4A 5F68A 3NOPC 1LSXA 1OT9A 4JGPA 4F3LA 5A8BA 3A0SA 3K3DA 4EERA 4EQ1A 2Z6CA 4BBTA 2INWA 4HIAA 4HJ4A 3MXQA 1XJ3A 2J80A 1S66L 4BBVA 4JGQA 3ULFA 2QHKA 3UB8A 5IU1A 1T1CA 2VV6A 5J4EA 4XT2A 4L9FA 1UWNX 1TS0A 3C2WA 4EXOA 3A0RA 1UWPX 2R78A 2YKHA 2V1BA 1D06A 4HP9A 4I39A 3LIDA 1N9OA 3UB9A 3ZQ5A 1TS8A 3NOTC 2BASA
chains in the Genus database with same CATH superfamily
3IT9A 2K7SA 2ZL1B 1PZPA 2ZJ9A 4HHDA 2WKPA 4HNBA 1MWRA 4KQDA 1L0DA 1K25A 1LL9A 2WKEA 1K4EA 3F1PA 2A24B 3T4SA 4ZJ2A 3V3SA 2M1CA 5J7EA 4H8RA 3CZDA 1DY6A 1N9LA 4R0QA 3SH9A 2Y2LA 1K57C 4QY6A 3CWFA 3PBOA 2WGVA 2XH9A 1KGGA 2L4RA 3T12B 3MQOA 4EEUA 2EX9A 5L07A 3GRJA 2PDRA 1G6OA 4B88A 4X68A 1PFLA 3NC8A 1F5MA 3VFFA 2HDRA 3LYXA 4MN7A 2VLGA 1TEMA 4FOFA 2JKTI 4HEFA 2PD7A 1K54A 1SDEA 2ZM8A 5HPFA 3NDEA 4HESA 1GSVA 3O5YA 2BTFP 2HP5A 2YKFA 3BY9A 4Z9QA 1FSWA 2HZ5A 3RJUA 2C6WB 3FV7A 3E0YA 1PWDA 3F1OB 3IXHA 3JYIA 2JN7A 2GZAA 5AQBA 4HJ6A 1NYMA 4P6BA 2OOLA 2KLIA 1IYQA 3HCYA 2FH5A 1MWTA 3VV4A 1ERQA 1L0GA 2JKFA 3A3IA 5LBRA 3UE6A 2D02A 3TRCA 2ZLYA 2H10A 1K54C 1XGJA 2Y79A 3T4TA 2W3DA 5EV0A 4MBKA 2Y2JA 4R4RA 1EI5A 4UA7A 3F1NB 4FH2A 3B33A 2J3TC 4CLCB 2HDSA 1P9RA 5DJUA 1VETA 3UDXA 3QHYA 2V1AA 1LI0A 5F6AA 3ZVWA 5DF7A 2W3GA 3QP8A 1FOFA 2WKQA 4K0XA 1ACFA 2GX5A 4IUKA 3VP0A 5CEBA 2BLSA 3PTEA 2JBFA 1AWIA 2HDUA 3A0VA 5I5LA 1FIKA 2I9VA 4DDSA 1KGFA 4L9EA 1G68A 3VP3A 4HH2A 1ONGA 2V9AA 3IBJA 4NETA 3BECA 1YLWA 1E4DA 2WAFA 4HH3A 3B3XA 4YNRA 3AGDA 3L7HA 2ZMVA 1ES5A 2VEAA 1W8YA 3PHYA 3WS1A 2A3UA 2W0NA 4P85A 3GDIA 3EGXC 1H8YA 1LL8A 4K0WA 2PAVP 3NY4A 5HD5A 1WYBA 2WGIA 1TF1A 3S4XA 4PHTA 4CJNA 1WE4A 1ESIA 5L2FA 1Y4OA 1STZA 1LSVA 1ES4A 2R9XA 4YOFA 4UQIS 4O0PA 2AVXA 1KGEA 3OCNA 3JVVA 4R38A 3PAGA 4R3JA 3TJZC 2B02A 4WUJA 2PD8A 4GZBA 4R70A 1UGUA 3GMWA 4KZ4A 5AVEA 3R7WA 4DE0A 1ZG4A 1ZKJA 3EEHA 5DF9A 3H7WB 4FCFA 3OPRA 4B4ZA 5L8MA 3ZFZA 2XEPA 1T19A 5TJJA 4XUXA 3KSIA 3A3EA 4DJ3A 2ZQ8A 4LLOB 4RYEA 4NXBA 3VOZA 4GS9B 4HY8A 4A5RA 2XFSA 3UB6A 5HW3A 3W2ZA 4DXCA 2OV5A 5KMWA 3CLOA 3R4KA 3MQ0A 2KOIA 3O86A 3Q7VB 5EE8A 3MR0A 4GHIA 3IS2B 4H6JA 1IKIA 5G18A 1JTDA 4F94A 4EBPA 3DTEA 1G6AA 3SS5A 1ZC2A 3WS5A 1F98A 4ARZB 2K31A 2JE5A 4OQ0A 5HAIA 3N4IA 4IHQA 3C8CA 3N6IA 5AQAA 2KX6A 1EROA 2C5WB 1NRFA 3E4PA 1IOUA 2P04A 3UMEA 3PBNA 4XXRA 2XGNA 3CAXA 2ZC3B 2E8IA 2G2UA 4R1GA 2Z2LB 1K55A 2Q0OA 3T4JA 2H0YA 3ZG9B 5EVIA 5FI7A 2HPBA 3NOPC 2Y2PA 1OMEA 4X69A 2O99A 2HGVA 3IXDA 5DTSA 4BQMA 3BLSA 1CF0A 4BBTA 4B4XA 3SOIA 3MXQA 3VSKA 2J80A 1K6SA 2Y91A 1K55C 2QYBA 3FPVA 1T1CA 4XT2A 4PPRA 4UQIM 1TS0A 2A49A 1SKOA 5FQMA 5E43A 3C2WA 4QU3A 2W1TB 3SS3A 1FR1A 4ZDXA 1N9BA 1E3UA 4I39A 4ZTKA 2J7VA 4O7DA 1XXMA 3HBRA 1BT5A 2EX6A 1QMEA 4P0MA 2J3TD 3LI8A 3LIAA 3OC2A 2ZQDA 3IF6C 5FEFA 5MC7A 3NECA 1I2SA 4KQQA 5GLCA 4O01A 2VKSA 3L9KA 4LV1A 3LUQA 4X25A 5BOHA 5IS1A 3NIAA 3O3VA 2V0WA 4L0LA 3DWZA 3EEAA 4DN0A 3QP5A 3KSHA 4D2OA 3TW8A 1LT0A 3OCLA 3IQAA 3UDIA 2XA7S 5EVEA 4R6LA 5HL1A 4I3JA 2Y2OA 2Y55A 3LY4A 2WKRA 3IX8A 3CPTA 3UB7A 2OLUA 1P97A 5HL6A 5HDSA 1Y54A 3CI6A 4G3WA 4JBFA 4WELA 2Y59A 4LPZA 1HLUP 2OLVA 4PM5A 2BG1A 1MXOA 1VB6A 1BSGA 1K38A 3KSFA 3TOIA 3MKEA 4E3OA 2EX8A 3G30A 2J9PA 4P6ZM 1MPLA 3DTMA 3MZDA 1XA7A 5F83A 3H82A 1N4OA 4ESPA 5EPHA 3EOIA 4PMAA 3KSGA 5DTTA 3GV9A 5FQKA 3Q1FA 3A3FA 4E3IA 1L3LA 2DCFA 5AVFA 5TBMA 3T4LA 2H28A 2XD5A 5FI2A 4PKYG 1TD5A 2P9VA 1Q2QA 3V39A 2FFFB 2GNXA 5GHXA 2EFXA 2GJ3A 4EUZA 5L09A 2PYPA 4JF6A 4KG6A 3LR3A 4BL3A 3VFHA 4DDYA 1NLZA 3WWXA 1TDLA 5CGWA 1SKFA 4ETZA 4GJ4A 1OJGA 4WMCA 3ISGA 3HLEA 2WKHA 4Z1WA 3ZVTA 3T1XA 2P08A 3E2KA 1T1AA 1YPRA 2ZC5B 2Y2QA 4Q8IA 5M1AA 3BFFA 1S1YA 2OSUA 2ZM0A 5FDHA 1DP9A 2LB5A 1BLHA 4UEYA 3MXSA 1BZAA 4RQ9A 3WRZA 4FTXA 1IYPA 1LI9A 5C5KA 1W8QA 3HLFA 1ES3A 3LIBA 5I94A 5F1FA 3UPOA 3E4QA 4HQAA 3E4OA 5F82A 4OONA 5FQIA 2VZWA 3TG9A 5F69A 4EV4A 1YAXA 1HTZA 3BM6A 1H5XA 1KVLA 1KOUA 3FWLA 4ME4A 2X01A 3D9YA 3T1SA 4MEZA 5FAPA 1AXBA 4S2NA 1FCMA 4OQGA 2EA9A 4BD0A 4JGOA 5G4YA 5KIZA 3SS4A 3WRTA 2Q9NA 2G7UA 2QPNA 1VEUA 1KE0A 1GSXA 4S2JA 2QJ7A 1GHIA 3I7JA 4EQIA 2VV8A 4I5SA 4E3NA 4BWIA 5EFWA 3FYZA 5CERA 2V2FF 2L1MA 5CTNA 4B93A 4CLCC 4PM6A 4KG2A 2OWJA 1GHMA 1XJ4A 1LL5A 4NG2A 4S2NC 2OAQ1 2XA7M 4OPZA 1ES2A 4HOIA 5CRFA 1K56D 2MJ6A 4DF6A 4JXWA 1JNUA 3C7VA 3LIEA 3GTCA 3O88A 3P98A 3JVUA 2WZXA 2V0UA 2CC1A 2IWDA 1FQGA 3F1PB 3Q82A 3LR4A 1YM1A 3GR2A 3C7UA 5M19A 4M4XA 4JXSA 5EVID 4WF0A 3UB5P 4OQIA 3M2JA 3M2KA 4C75A 4KZ7A 4PM8A 4PAUA 5U47A 2A2LA 3IHAA 3LEZA 3MQQA 1XJ2A 3VP1A 4OOYA 3FC7A 4EETB 4JXGA 4QPRA 5HZHA 4UA6A 1O07A 1L2SA 4NEED 5HDCA 3S7QA 3GQZA 2XK1A 2W3HA 4EBLA 4KZ9A 1S67L 3LR5A 4KZ6A 3BFDA 2WAEA 4EWFA 4OLGA 4KUOA 3AGFA 4GKUA 4NK3A 5GLBA 3OBFA 3IXBA 5GHYA 4EBNA 4X1MA 5AQ7A 2P7JA 2Y2KA 3W4QA 3E98A 3BLMA 1E3UD 1IFQA 3C5AA 3C30A 2EWWA 3MXRA 4WL9A 3QP2A 2QKPA 1YSQA 5FQJA 5CHJA 2PHYA 1Y28A 5F1GA 1IYSA 1C3BA 2ZQ9A 4BJPA 2O9AA 4CLCE 4FH4A 3W4PA 1F9IA 1WYCA 2ZMAA 2XFTA 1NXYA 3G2YA 3KX0X 1FILA 5F68A 1SHVA 3T1QB 4E3JA 3NBLA 3IX3A 4F3LA 5A8BA 2PBDP 1J9MA 3K3DA 3S22A 4EERA 4EQ1A 4MBFA 1VETB 4R3BA 2INWA 4HIAA 4DRTA 1PW8A 1XPBA 1GA9A 4EU0A 5M18A 2EWVA 3P09A 3ZDJA 1XJ3A 4Y13A 4BBVA 4JGQA 3ZG0A 4WBGA 3ULFA 3MKFA 2JKRI 4MCWA 2H0TA 1I5QA 4KZ8A 3ZGAB 5FI6A 5J4EA 4L9FA 4LCMA 3T4OA 3G2ZA 1RCJA 4DE2A 2HDQA 3E2LA 1UWPX 1ESUA 5EOOA 2V1BA 3LIDA 1YLTA 4WZ5A 1N9OA 3UB9A 2V8FA 4Y7PA 1CK3A 4MBHA 1JWZA 1W63Q 3LY3A 4Y0UA 2RCXA 2BASA 5K5BA 4P87A 5FAOA 2VGJA 1OTBA 5HWWA 1YT4A 3K2NA 5DKLA 4R23A 1NWZA 5TGFA 4Y15A 3CITA 3DBAA 3HUOA 2IWCA 1BULA 5FEGA 2M7VA 3KYQA 5FDSA 3SW1A 4WZ5C 2PRFA 4NXEA 3C4PA 1SCWA 2OWHA 1DP6A 1MBLA 4LCLA 4BD1A 3S7PA 1YLZA 2OAP1 1S4RA 4WMCD 2V1ZA 3IHBA 2WK0A 1BYWA 5E2FA 3HREA 3O87A 4DXBA 3LI9A 1NRJA 2FFYA 4ZJ1A 1TVFA 3HLCA 4LRXC 4MLLA 3R7WB 3OOVA 2IWBA 2Q9MA 1MZUA 4NXFA 3HVFA 3ZCZA 3GECA 4E3KA 3VSLA 2ZD8A 4OPRA 5L10A 1CEGA 1BTLA 3W8KA 4I38A 1NLYA 3MJQA 3T4KA 4E6XA 3BQAA 1YKDA 3A3DA 4CQHA 4UAAA 1PWGA 4ID4A 3T1RA 4WZ4A 3QP1A 3MFDA 4X6TA 2DNSA 3IF6A 1PWCA 4IBRA 1S1ZA 4M3KA 5HDDA 4GHIB 4H6JB 3TE8A 4S2OA 3NHQA 5A90A 4MNRA 4S2PA 4OOMA 3UNWA 4GDBA 3T50A 1JVJA 2KDKA 1TS6A 3DWKA 2FZ0A 3BQ8A 2DRWA 3MFXA 3NOUC 2ZC6B 3EQVA 1PZOA 4LV0A 2W3FA 3D3OA 1MY8A 3MMHA 5GHZA 1KE3A 1OPXA 1XFNA 2O9CA 1LSWA 2ZQAA 1MWSA 5KZHA 3JPUA 2WGWA 2Y2MA 1SDNA 3CG5A 4NKPA 4Y0TA 2XD1A 4YFMA 1W63M 4E6WA 3BY8A 1ZHHB 2Z6DA 4PM7A 4GB7A 5EVIB 1BLCA 4Y5FA 4U0TA 4N92A 3UMDA 3GSGA 4HBUA 2HP6A 1QMFA 1WA9A 4KENB 2LB9A 5HAPA 1PIOA 4Y17A 1OTDA 3M6HA 1F2KA 1YLJA 3V5MA 4JXVA 2ZMFA 4D60A 3N8LA 3MSHA 2W27A 4IVKA 4OLDA 3SZTA 5GL9A 4FSFA 5E2GA 4XT2B 1PYYA 4R3AA 1CEFA 2A24A 1SKOB 4WN5A 3IH9A 4ZRRA 4GD6A 4WEKA 1P9WA 1SZVA 1Z09A 3IX4A 2VX8A 4II7A 3QP6A 4FD8A 3N7WA 1CQAA 4BLMA 4RX3A 3VMAA 3RXWA 1ALQA 1HVBA 4GCZA 3K3CA 2ZM2A 4AFIA 5FSRA 5DJTA 2PYRA 3IWOA 3KYEA 1TDGA 3IBRA 4EUVA 3MS6A 1G5UA 5EVLA 1NZOA 4WEJA 4GOGA 3IF5A 4E04A 4IBXA 5DKKA 1GCEA 5FASA 1MC0A 3N8RA 5FQ9A 5CECA 3C4OA 4Q0IA 3OLOA 4OKPA 1RGZA 3WS4A 3IH8A 2M7UA 2HJEA 3B42A 2XQZA 5E2EA 4WYYA 1XKZA 4LRZE 3FPWA 1NJ4A 3F1OA 4ZBEA 4BBUA 3HUMA 3OPPA 4Y3IA 3ZG5A 2JKTM 1L0FA 3P7NA 1OTIA 3UE0A 1DP8A 2NUTC 1NY0A 4QD4A 4JF4A 1KDSA 2D01A 4HP4A 1Z6FA 2XR0A 2QJ5A 2PT7A 5AJGA 5J3WA 3G6OA 2HP9A 5JYOA 2GDNA 2JCHA 3CPTB 3LICA 2ZBBA 1PRQA 5G4ZA 1PI5A 1H0MA 3RXXA 2VV7A 1IKGA 4LFUA 2PR5A 3FG8A 2Y2IA 3UPPA 5TR7A 2ZQCA 3F1NA 4CLCA 4E3MA 2Y2NA 4GNUA 4WM9A 3G4PA 4QJGA 2P74A 3H82B 3ZYTA 1W79A 3ZNYA 1NZUA 3PBSA 5CHUA 5DFXA 1G28A 4KG5A 4KZBA 4EEPA 2VK3A 3RTYA 5TBMB 3Q81A 3CMZA 1W7FA 3G31A 5HD3A 4B9OA 2P9VB 3BFEA 3QP4A 2B5RA 5HAQA 2Y4AA 3MZEA 4MMNA 3WS2A 4Y2FA 1A0KA 5CGXA 2XRNA 1OT9A 4JGPA 3A0SA 3FZCA 4GD8A 3V50A 2VGLS 4HJ4A 4KZAA 4JPMA 5GLAA 2EXBA 3NI9A 1YSPA 3UE1A 1JWVA 4N1HA 1K6RA 2QHKA 5E2HA 3LCEA 4XUZA 3ZG7B 4OQHA 4DKIA 1FCOA 2XDMA 1XGIA 3V3RA 3P01A 3A0RA 2R78A 3WS0A 2YKHA 1D06A 2Y2GA 3HUNA 3S7OA 4CPKA 4QWOA 5CX7A 2H5SA 4X55A 1M40A 3V67A 1XA1A 1TS8A 3ZG8B 2IA2A 3DAVA 3MBZA 3NOTC 2K2NA 5TFQA 3M6BA 5DTKA 3BW6A 2XROA 4JKTA 3EQUA 3QNBA 3Q07A 1H8ZA 3VOLA 5HSQA 4DJ2A 1IELA 1TS7A 4KZ3A 2L0WA 1YLYA 1EWZA 5CXWA 3BJNA 3C38A 3UY6A 5FATA 3H7WA 5EM0A 4JF5A 1KE4A 5CHMA 1VEUB 2V8CA 1BUEA 2EFUA 1MKIA 3G34A 3VP2A 4OOLA 4BL2A 2CMNA 3MF0A 3S7NA 3RFBA 4OPQA 2O0YA 1ZTUA 2ZOHA 4GS9A 2VJWA 2G2WA 4IUHA 4QB8A 1HD8A 2B18A 2XSSA 1OTEA 2WADA 5HWTA 5EM1A 2JKRM 1OTAA 4L9GA 3OPHA 1KVMA 1LLBA 1RP5A 2HJ9C 3A3JA 2JKGA 1VM1A 4EESA 5FQQA 1JWPA 4LV2A 3Q7VA 5DF8A 5A91A 3ZNTA 2ACGA 1HZOA 1XJ6A 3G35A 3IS2A 1XP4A 3LFVA 2QWSA 4KUKA 1YQSA 2PU4A 1H3QA 4ARZA 1S6RA 1OT6A 4OPYA 3UDFA 2VA0A 4DE1A 3BEBA 1Q2PA 3NULA 5F5YA 5KSHA 1L0EA 1YMXA 3CJMA 2UV0E 3BWLA 5IHVA 2NUPC 2JHEA 3HJKA 3LIFA 4GLQA 4I3AA 1LHYA 3UN7A 1T18A 3H9WA 1BLPA 1VQQA 4KQRA 5HARA 2ZQ7A 5HPIA 4PKYA 3NCKA 1ODVA 4BENA 3PR6A 1CI9A 3D4FA 1MWUA 1DJCA 1YLPA 4OH0A 4GDNA 4ETXA 4KZ5A 2HF6A 1E25A 3VOYA 1CJFA 4EW7A 1FCNA 4R4SA 3UPNA 4GW9A 1MKMA 4G3VA 2PR6A 2ZC4B 4OP5A 2ZOIA 2JC7A 1KDWA 1S0WA 2VGLM 1S4SA 5J8XA 3PYPA 1O7EA 1J3WA 4YWZA 4X56A 1VHMA 4K08A 1V9YA 1W5DA 2W3EA 4LENA 5KSCA 2XLNA 4WLAA 2J8YA 4QY5A 2W1TA 1OJ5A 2I72A 1D7EA 4RX2A 2VGKA 4S2KA 3BFGA 2XF3A 3BYDA 4LGWA 4X53A 5FAQA 1U60A 5EUAA 2EXAA 2X02A 2Y2HA 3UO9A 1PW1A 5FA7A 4F3LB 3OPLA 4S2LA 2UWXA 5GLDA 3PBTA 3SH8A 3GVBA 3S1YA 4MDZA 4P6ZS 1GA0A 5CEDA 4N1XA 3HLBA 3LEQA 3U4LP 5CGSA 3G32A 2B95A 1K56A 4DE3A 4MN5A 3ITBA 4I3IA 4JLFA 4JGRA 5IT5A 3HJIA 3QNCA 2Y8HA 5HX9A 1N9NA 1H8MA 3ICYA 3PBQA 3KYZA 4K91A 1IEMA 1ERMA 4U0XA 1T1BA 4ZJ3A 3DW0A 3ITAA 5FL3A 3PAEA 3VP4A 2WUQA 3D72A 3NDGA 5AQ9A 3B47A 4Y0OA 4C3QA 4CLCD 5JYPA 1XX2A 5CTMA 3Q7ZA 3N8SA 3LGOA 4HJ3A 3PBRA 3IWIA 5A93A 5EECA 4E3LA 1DRMA 1NYYA 4Q0JA 4IEDA 3DTKA 4IJGA 4GN2A 2WZZA 1P0ZA 4X1LA 3EWKA 2EX2A 5EVIC 2J9OA 3HLGA 3KO6A 1DJAA 1XFQA 1I2WA 4RVAA 3VE3A 4N9LA 3NJAA 4HI4A 1PI4A 5DFYA 2J3WA 1ZG6A 3HLWA 1IYOA 2PU2A 4IVIA 3PXPA 4N9KA 2X71A 3BFCA 1FR6A 3FKWA 1V9ZA 5HWVA 3OZHA 4OP8A 3T4QA 3LO7A 2Z2MB 3FKVA 1X0OA 3RH8B 4BMWA 3U2AA 1GSWA 2HV1A 4S2IA 1YMSA 3IXGA 4UA9A 1PNEA 2R9WA 4LRYC 4MN6A 5DVAA 4G3KA 5HFOA 2ZL1A 4RA7A 4O8GA 5A92A 2RL3A 1BLSA 2E8JA 1EW0A 4C6YA 3CUEA 4ZAMA 1K4FA 3IF6B 1DJBA 5EOEA 3DTIA 3HLDA 3SH7A 3HL9A 3TSGA 4NXGA 4KQOA 1GHPA 3AGEA 3CHWP 3VE4A 4OVDA 2V20A 2QZ6A 3ZHHA 4PM9A 1LSXA 4DMZA 1CI8A 4S2MA 4UHUA 2Z6CA 4FUWA 2QMIA 1ONHA 2PBYA 2ZC7A 3CUEC 3UE3A 1S66L 5D3OA 2O9BA 1M6KA 2W1RA 3UB8A 4YINA 4LV3A 1RGYA 2WGWB 5IU1A 4QHCA 3EGDC 2VV6A 1UWNX 4EXOA 2WKIA 4Q0HA 3BRMA 2WYXA 4HP9A 3MZFA 1FSYA 3W4OA 2DMWA 4HBTA 1D1JA 3ZQ5A 1K0KA 1K57A 3LR0A 1JTGA 3IWQA 4U3TA
chains in the Genus database with same CATH topology
2XROA 3EQUA 1OTBA 2J3TD 5HWWA 3LI8A 3VOLA 5HSQA 3K2NA 2K7SA 5DKLA 3LIAA 3OC2A 4DJ2A 1TS7A 2L0WA 4HHDA 2WKPA 1NWZA 4HNBA 3CITA 5MC7A 3BJNA 4KQDA 3C38A 3DBAA 3H7WA 3F1PA 2M7VA 4O01A 3KYQA 2A24B 3T4SA 2VKSA 3SW1A 3LUQA 4NXEA 5IS1A 2M1CA 2OWHA 4OOLA 5J7EA 1DP6A 2CMNA 3MF0A 3S7NA 2V0WA 1N9LA 3RFBA 3S7PA 4L0LA 2OAP1 2O0YA 1ZTUA 1S4RA 2ZOHA 4GS9A 2VJWA 3EEAA 4DN0A 3KSHA 4IUHA 1BYWA 2B18A 3CWFA 3PBOA 2XSSA 1OTEA 5HWTA 2JKRM 3TW8A 1OTAA 1LT0A 2L4RA 4L9GA 3LI9A 3MQOA 1NRJA 4EEUA 2HJ9C 3OCLA 4EESA 2PDRA 1G6OA 2XA7S 4R6LA 4I3JA 4LRXC 3R7WB 2WKRA 3OOVA 1F5MA 3LYXA 4MN7A 1MZUA 2VLGA 1XJ6A 3IS2A 3UB7A 4FOFA 4NXFA 1P97A 3LFVA 2JKTI 5HL6A 5HDSA 2QWSA 2PD7A 3CI6A 4G3WA 4KUKA 4WELA 3GECA 1H3QA 4ARZA 5HPFA 4LPZA 1OT6A 1GSVA 3O5YA 1VB6A 2VA0A 3KSFA 2YKFA 3BY9A 5F5YA 5KSHA 4I38A 1NLYA 3MJQA 4P6ZM 3T4KA 3E0YA 3BQAA 1YKDA 4CQHA 3BWLA 3F1OB 2NUPC 2JHEA 3HJKA 3H82A 3LIFA 2JN7A 2GZAA 4GLQA 4HJ6A 4I3AA 1T18A 2OOLA 3EOIA 3H9WA 2KLIA 3KSGA 3HCYA 2FH5A 5HPIA 4PKYA 1ODVA 5AVFA 5TBMA 3VV4A 3PR6A 3T4LA 2H28A 1S1ZA 4PKYG 1TD5A 5LBRA 3UE6A 2D02A 3TRCA 5HDDA 2GNXA 4GHIB 4H6JB 3TE8A 2GJ3A 4ETXA 2HF6A 2Y79A 2PYPA 3NHQA 3LR3A 3T4TA 2W3DA 1NLZA 4OOMA 4EW7A 4ETZA 3T50A 4GJ4A 1OJGA 2KDKA 1TS6A 2FZ0A 1MKMA 3F1NB 3BQ8A 3B33A 2J3TC 2PR6A 4G3VA 4GW9A 4Z1WA 2ZOIA 1P9RA 2P08A 3MFXA 3NOUC 4CLCB 5DJUA 1T1AA 3EQVA 2W3FA 2VGLM 1S4SA 2V1AA 3D3OA 3PYPA 5F6AA 3MMHA 4YWZA 1S1YA 1VHMA 4K08A 1OPXA 1V9YA 1XFNA 2O9CA 2W3GA 1LSWA 1DP9A 2W3EA 2LB5A 2WKQA 2GX5A 4UEYA 4IUKA 4RQ9A 4WLAA 3A0VA 5I5LA 2I9VA 5C5KA 4L9EA 4NKPA 3LIBA 4HH2A 1W63M 2V9AA 3BY8A 1ZHHB 2Z6DA 3IBJA 3E4QA 2W1TA 1OJ5A 4HQAA 4Y5FA 3E4OA 3UMDA 1D7EA 2VZWA 5F69A 1YAXA 1WA9A 2LB9A 4HH3A 4YNRA 1KOUA 1OTDA 4ME4A 2ZMVA 2VEAA 3PHYA 4F3LB 2ZMFA 2W0NA 3PBTA 3GDIA 4MDZA 4P6ZS 3EGXC 1LL8A 5HD5A 2EA9A 4MN5A 4JGOA 5G4YA 5KIZA 4I3IA 1TF1A 2W27A 4PHTA 2G7UA 4JGRA 5IT5A 4FSFA 1GSXA 3HJIA 4XT2B 1STZA 4R3AA 1LSVA 2QJ7A 2A24A 2Y8HA 2VV8A 4I5SA 4YOFA 1N9NA 1H8MA 3ICYA 3PBQA 4UQIS 4WN5A 3KYZA 4O0PA 4BWIA 4ZRRA 3OCNA 5EFWA 4WEKA 1P9WA 4II7A 3JVVA 2VX8A 1T1BA 4R38A 2L1MA 5FL3A 3TJZC 4B93A 4GCZA 3K3CA 3D72A 4CLCC 4AFIA 2OWJA 3B47A 2B02A 4CLCD 1XJ4A 4WUJA 5DJTA 2PYRA 2PD8A 4HJ3A 3PBRA 2OAQ1 2XA7M 1UGUA 4R70A 3IBRA 4HOIA 4EUVA 2MJ6A 5AVEA 1DRMA 3R7WA 4WEJA 4Q0JA 1JNUA 4E04A 3LIEA 3EEHA 3H7WB 5DF9A 4IJGA 5DKKA 3JVUA 2V0UA 1P0ZA 3F1PB 5L8MA 1MC0A 3LR4A 3EWKA 1T19A 5TJJA 4Q0IA 4M4XA 3OLOA 3KSIA 4WF0A 3KO6A 1XFQA 2M7UA 4DJ3A 2HJEA 3B42A 4LLOB 3VE3A 4NXBA 4LRZE 4GS9B 4HY8A 3FPWA 4PAUA 2A2LA 3F1OA 3MQQA 3NJAA 4HI4A 4BBUA 3UB6A 1XJ2A 3W2ZA 5DFYA 2J3WA 4Y3IA 2JKTM 3CLOA 3P7NA 3FC7A 3R4KA 4EETB 1OTIA 4QPRA 1DP8A 2NUTC 5HZHA 3MQ0A 3PXPA 2D01A 4NEED 4HP4A 5HDCA 3S7QA 2KOIA 2QJ5A 1V9ZA 2PT7A 2W3HA 5HWVA 5AJGA 5J3WA 3G6OA 3MR0A 1S67L 4GHIA 3LR5A 3IS2B 4H6JA 3T4QA 3LICA 4KUOA 2ZBBA 5G4ZA 1X0OA 3RH8B 2VV7A 4BMWA 2PR5A 3FG8A 3U2AA 1GSWA 3OBFA 1F98A 2HV1A 4ARZB 2K31A 2P7JA 3E98A 4IHQA 3F1NA 4LRYC 4MN6A 4CLCA 1IFQA 3C8CA 2KX6A 3C30A 2EWWA 4G3KA 4WL9A 2QKPA 1YSQA 3E4PA 4O8GA 1IOUA 3H82B 2PHYA 3ZYTA 1Y28A 2P04A 3PBSA 3UMEA 4BJPA 5DFXA 3PBNA 1G28A 2O9AA 1EW0A 4CLCE 4EEPA 3CUEA 3RTYA 3CAXA 5TBMB 1F9IA 5HD3A 4B9OA 3T4JA 3KX0X 4NXGA 4KQOA 3VE4A 5F68A 4MMNA 3NOPC 4Y2FA 2O99A 2HGVA 2XRNA 1LSXA 1OT9A 4DMZA 4JGPA 4F3LA 5A8BA 3A0SA 3K3DA 4EERA 4EQ1A 2Z6CA 4BBTA 2INWA 4HIAA 2VGLS 4EU0A 4HJ4A 2EWVA 3CUEC 3MXQA 3UE3A 1YSPA 1XJ3A 2J80A 1S66L 2O9BA 4JGQA 4BBVA 3ULFA 2JKRI 2QHKA 2W1RA 4MCWA 3UB8A 5IU1A 3EGDC 2QYBA 3FPVA 1T1CA 2VV6A 5J4EA 4XT2A 4L9FA 1UWNX 4UQIM 1TS0A 3T4OA 3C2WA 2W1TB 4EXOA 3A0RA 3P01A 4Q0HA 1UWPX 2R78A 2YKHA 2V1BA 1D06A 4HP9A 4I39A 3LIDA 1N9OA 3UB9A 3S7OA 5CX7A 2DMWA 1W63Q 3V67A 3ZQ5A 1TS8A 2IA2A 3NOTC 2K2NA 2BASA 3LR0A 5K5BA 3BW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTB A;  5HWW A;  3LI8 A;  3VOL A;  5HSQ A;  5DKL A;  2K7S A;  3LIA A;  4DJ2 A;  1TS7 A;  2L0W A;  4HHD A;  2WKP A;  1NWZ A;  4HNB A;  4KQD A;  3H7W A;  3F1P A;  2A24 B;  3SW1 A;  3LUQ A;  4NXE A;  5IS1 A;  2M1C A;  2OWH A;  5J7E A;  1DP6 A;  2CMN A;  2V0W A;  1N9L A;  1S4R A;  2ZOH A;  4GS9 A;  1BYW A;  3CWF A;  1OTE A;  5HWT A;  1OTA A;  1LT0 A;  2L4R A;  4L9G A;  3LI9 A;  3MQO A;  4EEU A;  4EES A;  2PDR A;  4R6L A;  4I3J A;  4LRX C;  2WKR A;  3LYX A;  1MZU A;  2VLG A;  1XJ6 A;  3IS2 A;  3UB7 A;  4NXF A;  1P97 A;  5HDS A;  2QWS A;  2PD7 A;  4KUK A;  3GEC A;  4LPZ A;  1OT6 A;  1GSV A;  1VB6 A;  2YKF A;  3BY9 A;  5F5Y A;  4I38 A;  3MJQ A;  3BWL A;  3F1O B;  2JHE A;  3HJK A;  3H82 A;  3LIF A;  2JN7 A;  4HJ6 A;  4I3A A;  1T18 A;  2OOL A;  3H9W A;  4PKY A;  1ODV A;  5AVF A;  5TBM A;  2H28 A;  1S1Z A;  4PKY G;  3UE6 A;  2D02 A;  5HDD A;  4GHI B;  4H6J B;  2GJ3 A;  2PYP A;  3NHQ A;  4EW7 A;  3T50 A;  1OJG A;  2KDK A;  1TS6 A;  4GW9 A;  3F1N B;  3B33 A;  2PR6 A;  2ZOI A;  3MFX A;  3NOU C;  5DJU A;  1T1A A;  1S4S A;  2V1A A;  3PYP A;  5F6A A;  4YWZ A;  1S1Y A;  4K08 A;  1V9Y A;  1XFN A;  1LSW A;  1DP9 A;  2WKQ A;  4RQ9 A;  4WLA A;  3A0V A;  5I5L A;  2I9V A;  4L9E A;  3LIB A;  4HH2 A;  2V9A A;  3BY8 A;  2Z6D A;  3E4Q A;  1OJ5 A;  4HQA A;  3E4O A;  3UMD A;  1D7E A;  5F69 A;  1WA9 A;  4HH3 A;  1KOU A;  1OTD A;  2VEA A;  3PHY A;  4F3L B;  2W0N A;  3GDI A;  1LL8 A;  5HD5 A;  2EA9 A;  4MN5 A;  4JGO A;  5G4Y A;  5KIZ A;  4I3I A;  2W27 A;  4JGR A;  1GSX A;  3HJI A;  4XT2 B;  4R3A A;  1LSV A;  2QJ7 A;  2A24 A;  2VV8 A;  4I5S A;  1N9N A;  3ICY A;  4WN5 A;  5EFW A;  4R38 A;  1T1B A;  2L1M A;  4GCZ A;  3K3C A;  3D72 A;  2OWJ A;  2B02 A;  1XJ4 A;  4WUJ A;  5DJT A;  2PYR A;  2PD8 A;  4HJ3 A;  4R70 A;  1UGU A;  3IBR A;  4HOI A;  5AVE A;  1DRM A;  1JNU A;  4E04 A;  3LIE A;  3EEH A;  3H7W B;  5DKK A;  2V0U A;  1P0Z A;  3F1P B;  3EWK A;  1T19 A;  4M4X A;  3OLO A;  4WF0 A;  1XFQ A;  4DJ3 A;  4LLO B;  3VE3 A;  4NXB A;  4LRZ E;  4GS9 B;  4HY8 A;  3F1O A;  3MQQ A;  3NJA A;  4HI4 A;  4BBU A;  3UB6 A;  1XJ2 A;  3CLO A;  3P7N A;  3FC7 A;  4EET B;  1OTI A;  1DP8 A;  5HZH A;  2D01 A;  4HP4 A;  5HDC A;  2QJ5 A;  1V9Z A;  5HWV A;  5J3W A;  3G6O A;  3MR0 A;  1S67 L;  4GHI A;  3IS2 B;  4H6J A;  3LIC A;  4KUO A;  2ZBB A;  5G4Z A;  1X0O A;  3RH8 B;  2VV7 A;  2PR5 A;  3FG8 A;  1GSW A;  1F98 A;  2HV1 A;  2P7J A;  3F1N A;  4LRY C;  4MN6 A;  3C8C A;  2KX6 A;  4WL9 A;  2QKP A;  3E4P A;  3H82 B;  2PHY A;  1Y28 A;  3UME A;  1G28 A;  1EW0 A;  4EEP A;  3RTY A;  3CAX A;  5TBM B;  1F9I A;  5HD3 A;  4B9O A;  3KX0 X;  4NXG A;  3VE4 A;  5F68 A;  3NOP C;  1LSX A;  1OT9 A;  4JGP A;  4F3L A;  5A8B A;  3A0S A;  3K3D A;  4EER A;  4EQ1 A;  2Z6C A;  4BBT A;  2INW A;  4HIA A;  4HJ4 A;  3MXQ A;  1XJ3 A;  2J80 A;  1S66 L;  4BBV A;  4JGQ A;  3ULF A;  2QHK A;  3UB8 A;  5IU1 A;  1T1C A;  2VV6 A;  5J4E A;  4XT2 A;  4L9F A;  1UWN X;  1TS0 A;  3C2W A;  4EXO A;  3A0R A;  1UWP X;  2R78 A;  2YKH A;  2V1B A;  1D06 A;  4HP9 A;  4I39 A;  3LID A;  1N9O A;  3UB9 A;  3ZQ5 A;  1TS8 A;  3NOT C;  2BAS A; 
#chains in the Genus database with same CATH topology
 3IT9 A;  2K7S A;  2ZL1 B;  1PZP A;  2ZJ9 A;  4HHD A;  2WKP A;  4HNB A;  1MWR A;  4KQD A;  1L0D A;  1K25 A;  1LL9 A;  2WKE A;  1K4E A;  3F1P A;  2A24 B;  3T4S A;  4ZJ2 A;  3V3S A;  2M1C A;  5J7E A;  4H8R A;  3CZD A;  1DY6 A;  1N9L A;  4R0Q A;  3SH9 A;  2Y2L A;  1K57 C;  4QY6 A;  3CWF A;  3PBO A;  2WGV A;  2XH9 A;  1KGG A;  2L4R A;  3T12 B;  3MQO A;  4EEU A;  2EX9 A;  5L07 A;  3GRJ A;  2PDR A;  1G6O A;  4B88 A;  4X68 A;  1PFL A;  3NC8 A;  1F5M A;  3VFF A;  2HDR A;  3LYX A;  4MN7 A;  2VLG A;  1TEM A;  4FOF A;  2JKT I;  4HEF A;  2PD7 A;  1K54 A;  1SDE A;  2ZM8 A;  5HPF A;  3NDE A;  4HES A;  1GSV A;  3O5Y A;  2BTF P;  2HP5 A;  2YKF A;  3BY9 A;  4Z9Q A;  1FSW A;  2HZ5 A;  3RJU A;  2C6W B;  3FV7 A;  3E0Y A;  1PWD A;  3F1O B;  3IXH A;  3JYI A;  2JN7 A;  2GZA A;  5AQB A;  4HJ6 A;  1NYM A;  4P6B A;  2OOL A;  2KLI A;  1IYQ A;  3HCY A;  2FH5 A;  1MWT A;  3VV4 A;  1ERQ A;  1L0G A;  2JKF A;  3A3I A;  5LBR A;  3UE6 A;  2D02 A;  3TRC A;  2ZLY A;  2H10 A;  1K54 C;  1XGJ A;  2Y79 A;  3T4T A;  2W3D A;  5EV0 A;  4MBK A;  2Y2J A;  4R4R A;  1EI5 A;  4UA7 A;  3F1N B;  4FH2 A;  3B33 A;  2J3T C;  4CLC B;  2HDS A;  1P9R A;  5DJU A;  1VET A;  3UDX A;  3QHY A;  2V1A A;  1LI0 A;  5F6A A;  3ZVW A;  5DF7 A;  2W3G A;  3QP8 A;  1FOF A;  2WKQ A;  4K0X A;  1ACF A;  2GX5 A;  4IUK A;  3VP0 A;  5CEB A;  2BLS A;  3PTE A;  2JBF A;  1AWI A;  2HDU A;  3A0V A;  5I5L A;  1FIK A;  2I9V A;  4DDS A;  1KGF A;  4L9E A;  1G68 A;  3VP3 A;  4HH2 A;  1ONG A;  2V9A A;  3IBJ A;  4NET A;  3BEC A;  1YLW A;  1E4D A;  2WAF A;  4HH3 A;  3B3X A;  4YNR A;  3AGD A;  3L7H A;  2ZMV A;  1ES5 A;  2VEA A;  1W8Y A;  3PHY A;  3WS1 A;  2A3U A;  2W0N A;  4P85 A;  3GDI A;  3EGX C;  1H8Y A;  1LL8 A;  4K0W A;  2PAV P;  3NY4 A;  5HD5 A;  1WYB A;  2WGI A;  1TF1 A;  3S4X A;  4PHT A;  4CJN A;  1WE4 A;  1ESI A;  5L2F A;  1Y4O A;  1STZ A;  1LSV A;  1ES4 A;  2R9X A;  4YOF A;  4UQI S;  4O0P A;  2AVX A;  1KGE A;  3OCN A;  3JVV A;  4R38 A;  3PAG A;  4R3J A;  3TJZ C;  2B02 A;  4WUJ A;  2PD8 A;  4GZB A;  4R70 A;  1UGU A;  3GMW A;  4KZ4 A;  5AVE A;  3R7W A;  4DE0 A;  1ZG4 A;  1ZKJ A;  3EEH A;  5DF9 A;  3H7W B;  4FCF A;  3OPR A;  4B4Z A;  5L8M A;  3ZFZ A;  2XEP A;  1T19 A;  5TJJ A;  4XUX A;  3KSI A;  3A3E A;  4DJ3 A;  2ZQ8 A;  4LLO B;  4RYE A;  4NXB A;  3VOZ A;  4GS9 B;  4HY8 A;  4A5R A;  2XFS A;  3UB6 A;  5HW3 A;  3W2Z A;  4DXC A;  2OV5 A;  5KMW A;  3CLO A;  3R4K A;  3MQ0 A;  2KOI A;  3O86 A;  3Q7V B;  5EE8 A;  3MR0 A;  4GHI A;  3IS2 B;  4H6J A;  1IKI A;  5G18 A;  1JTD A;  4F94 A;  4EBP A;  3DTE A;  1G6A A;  3SS5 A;  1ZC2 A;  3WS5 A;  1F98 A;  4ARZ B;  2K31 A;  2JE5 A;  4OQ0 A;  5HAI A;  3N4I A;  4IHQ A;  3C8C A;  3N6I A;  5AQA A;  2KX6 A;  1ERO A;  2C5W B;  1NRF A;  3E4P A;  1IOU A;  2P04 A;  3UME A;  3PBN A;  4XXR A;  2XGN A;  3CAX A;  2ZC3 B;  2E8I A;  2G2U A;  4R1G A;  2Z2L B;  1K55 A;  2Q0O A;  3T4J A;  2H0Y A;  3ZG9 B;  5EVI A;  5FI7 A;  2HPB A;  3NOP C;  2Y2P A;  1OME A;  4X69 A;  2O99 A;  2HGV A;  3IXD A;  5DTS A;  4BQM A;  3BLS A;  1CF0 A;  4BBT A;  4B4X A;  3SOI A;  3MXQ A;  3VSK A;  2J80 A;  1K6S A;  2Y91 A;  1K55 C;  2QYB A;  3FPV A;  1T1C A;  4XT2 A;  4PPR A;  4UQI M;  1TS0 A;  2A49 A;  1SKO A;  5FQM A;  5E43 A;  3C2W A;  4QU3 A;  2W1T B;  3SS3 A;  1FR1 A;  4ZDX A;  1N9B A;  1E3U A;  4I39 A;  4ZTK A;  2J7V A;  4O7D A;  1XXM A;  3HBR A;  1BT5 A;  2EX6 A;  1QME A;  4P0M A;  2J3T D;  3LI8 A;  3LIA A;  3OC2 A;  2ZQD A;  3IF6 C;  5FEF A;  5MC7 A;  3NEC A;  1I2S A;  4KQQ A;  5GLC A;  4O01 A;  2VKS A;  3L9K A;  4LV1 A;  3LUQ A;  4X25 A;  5BOH A;  5IS1 A;  3NIA A;  3O3V A;  2V0W A;  4L0L A;  3DWZ A;  3EEA A;  4DN0 A;  3QP5 A;  3KSH A;  4D2O A;  3TW8 A;  1LT0 A;  3OCL A;  3IQA A;  3UDI A;  2XA7 S;  5EVE A;  4R6L A;  5HL1 A;  4I3J A;  2Y2O A;  2Y55 A;  3LY4 A;  2WKR A;  3IX8 A;  3CPT A;  3UB7 A;  2OLU A;  1P97 A;  5HL6 A;  5HDS A;  1Y54 A;  3CI6 A;  4G3W A;  4JBF A;  4WEL A;  2Y59 A;  4LPZ A;  1HLU P;  2OLV A;  4PM5 A;  2BG1 A;  1MXO A;  1VB6 A;  1BSG A;  1K38 A;  3KSF A;  3TOI A;  3MKE A;  4E3O A;  2EX8 A;  3G30 A;  2J9P A;  4P6Z M;  1MPL A;  3DTM A;  3MZD A;  1XA7 A;  5F83 A;  3H82 A;  1N4O A;  4ESP A;  5EPH A;  3EOI A;  4PMA A;  3KSG A;  5DTT A;  3GV9 A;  5FQK A;  3Q1F A;  3A3F A;  4E3I A;  1L3L A;  2DCF A;  5AVF A;  5TBM A;  3T4L A;  2H28 A;  2XD5 A;  5FI2 A;  4PKY G;  1TD5 A;  2P9V A;  1Q2Q A;  3V39 A;  2FFF B;  2GNX A;  5GHX A;  2EFX A;  2GJ3 A;  4EUZ A;  5L09 A;  2PYP A;  4JF6 A;  4KG6 A;  3LR3 A;  4BL3 A;  3VFH A;  4DDY A;  1NLZ A;  3WWX A;  1TDL A;  5CGW A;  1SKF A;  4ETZ A;  4GJ4 A;  1OJG A;  4WMC A;  3ISG A;  3HLE A;  2WKH A;  4Z1W A;  3ZVT A;  3T1X A;  2P08 A;  3E2K A;  1T1A A;  1YPR A;  2ZC5 B;  2Y2Q A;  4Q8I A;  5M1A A;  3BFF A;  1S1Y A;  2OSU A;  2ZM0 A;  5FDH A;  1DP9 A;  2LB5 A;  1BLH A;  4UEY A;  3MXS A;  1BZA A;  4RQ9 A;  3WRZ A;  4FTX A;  1IYP A;  1LI9 A;  5C5K A;  1W8Q A;  3HLF A;  1ES3 A;  3LIB A;  5I94 A;  5F1F A;  3UPO A;  3E4Q A;  4HQA A;  3E4O A;  5F82 A;  4OON A;  5FQI A;  2VZW A;  3TG9 A;  5F69 A;  4EV4 A;  1YAX A;  1HTZ A;  3BM6 A;  1H5X A;  1KVL A;  1KOU A;  3FWL A;  4ME4 A;  2X01 A;  3D9Y A;  3T1S A;  4MEZ A;  5FAP A;  1AXB A;  4S2N A;  1FCM A;  4OQG A;  2EA9 A;  4BD0 A;  4JGO A;  5G4Y A;  5KIZ A;  3SS4 A;  3WRT A;  2Q9N A;  2G7U A;  2QPN A;  1VEU A;  1KE0 A;  1GSX A;  4S2J A;  2QJ7 A;  1GHI A;  3I7J A;  4EQI A;  2VV8 A;  4I5S A;  4E3N A;  4BWI A;  5EFW A;  3FYZ A;  5CER A;  2V2F F;  2L1M A;  5CTN A;  4B93 A;  4CLC C;  4PM6 A;  4KG2 A;  2OWJ A;  1GHM A;  1XJ4 A;  1LL5 A;  4NG2 A;  4S2N C;  2OAQ 1;  2XA7 M;  4OPZ A;  1ES2 A;  4HOI A;  5CRF A;  1K56 D;  2MJ6 A;  4DF6 A;  4JXW A;  1JNU A;  3C7V A;  3LIE A;  3GTC A;  3O88 A;  3P98 A;  3JVU A;  2WZX A;  2V0U A;  2CC1 A;  2IWD A;  1FQG A;  3F1P B;  3Q82 A;  3LR4 A;  1YM1 A;  3GR2 A;  3C7U A;  5M19 A;  4M4X A;  4JXS A;  5EVI D;  4WF0 A;  3UB5 P;  4OQI A;  3M2J A;  3M2K A;  4C75 A;  4KZ7 A;  4PM8 A;  4PAU A;  5U47 A;  2A2L A;  3IHA A;  3LEZ A;  3MQQ A;  1XJ2 A;  3VP1 A;  4OOY A;  3FC7 A;  4EET B;  4JXG A;  4QPR A;  5HZH A;  4UA6 A;  1O07 A;  1L2S A;  4NEE D;  5HDC A;  3S7Q A;  3GQZ A;  2XK1 A;  2W3H A;  4EBL A;  4KZ9 A;  1S67 L;  3LR5 A;  4KZ6 A;  3BFD A;  2WAE A;  4EWF A;  4OLG A;  4KUO A;  3AGF A;  4GKU A;  4NK3 A;  5GLB A;  3OBF A;  3IXB A;  5GHY A;  4EBN A;  4X1M A;  5AQ7 A;  2P7J A;  2Y2K A;  3W4Q A;  3E98 A;  3BLM A;  1E3U D;  1IFQ A;  3C5A A;  3C30 A;  2EWW A;  3MXR A;  4WL9 A;  3QP2 A;  2QKP A;  1YSQ A;  5FQJ A;  5CHJ A;  2PHY A;  1Y28 A;  5F1G A;  1IYS A;  1C3B A;  2ZQ9 A;  4BJP A;  2O9A A;  4CLC E;  4FH4 A;  3W4P A;  1F9I A;  1WYC A;  2ZMA A;  2XFT A;  1NXY A;  3G2Y A;  3KX0 X;  1FIL A;  5F68 A;  1SHV A;  3T1Q B;  4E3J A;  3NBL A;  3IX3 A;  4F3L A;  5A8B A;  2PBD P;  1J9M A;  3K3D A;  3S22 A;  4EER A;  4EQ1 A;  4MBF A;  1VET B;  4R3B A;  2INW A;  4HIA A;  4DRT A;  1PW8 A;  1XPB A;  1GA9 A;  4EU0 A;  5M18 A;  2EWV A;  3P09 A;  3ZDJ A;  1XJ3 A;  4Y13 A;  4BBV A;  4JGQ A;  3ZG0 A;  4WBG A;  3ULF A;  3MKF A;  2JKR I;  4MCW A;  2H0T A;  1I5Q A;  4KZ8 A;  3ZGA B;  5FI6 A;  5J4E A;  4L9F A;  4LCM A;  3T4O A;  3G2Z A;  1RCJ A;  4DE2 A;  2HDQ A;  3E2L A;  1UWP X;  1ESU A;  5EOO A;  2V1B A;  3LID A;  1YLT A;  4WZ5 A;  1N9O A;  3UB9 A;  2V8F A;  4Y7P A;  1CK3 A;  4MBH A;  1JWZ A;  1W63 Q;  3LY3 A;  4Y0U A;  2RCX A;  2BAS A;  5K5B A;  4P87 A;  5FAO A;  2VGJ A;  1OTB A;  5HWW A;  1YT4 A;  3K2N A;  5DKL A;  4R23 A;  1NWZ A;  5TGF A;  4Y15 A;  3CIT A;  3DBA A;  3HUO A;  2IWC A;  1BUL A;  5FEG A;  2M7V A;  3KYQ A;  5FDS A;  3SW1 A;  4WZ5 C;  2PRF A;  4NXE A;  3C4P A;  1SCW A;  2OWH A;  1DP6 A;  1MBL A;  4LCL A;  4BD1 A;  3S7P A;  1YLZ A;  2OAP 1;  1S4R A;  4WMC D;  2V1Z A;  3IHB A;  2WK0 A;  1BYW A;  5E2F A;  3HRE A;  3O87 A;  4DXB A;  3LI9 A;  1NRJ A;  2FFY A;  4ZJ1 A;  1TVF A;  3HLC A;  4LRX C;  4MLL A;  3R7W B;  3OOV A;  2IWB A;  2Q9M A;  1MZU A;  4NXF A;  3HVF A;  3ZCZ A;  3GEC A;  4E3K A;  3VSL A;  2ZD8 A;  4OPR A;  5L10 A;  1CEG A;  1BTL A;  3W8K A;  4I38 A;  1NLY A;  3MJQ A;  3T4K A;  4E6X A;  3BQA A;  1YKD A;  3A3D A;  4CQH A;  4UAA A;  1PWG A;  4ID4 A;  3T1R A;  4WZ4 A;  3QP1 A;  3MFD A;  4X6T A;  2DNS A;  3IF6 A;  1PWC A;  4IBR A;  1S1Z A;  4M3K A;  5HDD A;  4GHI B;  4H6J B;  3TE8 A;  4S2O A;  3NHQ A;  5A90 A;  4MNR A;  4S2P A;  4OOM A;  3UNW A;  4GDB A;  3T50 A;  1JVJ A;  2KDK A;  1TS6 A;  3DWK A;  2FZ0 A;  3BQ8 A;  2DRW A;  3MFX A;  3NOU C;  2ZC6 B;  3EQV A;  1PZO A;  4LV0 A;  2W3F A;  3D3O A;  1MY8 A;  3MMH A;  5GHZ A;  1KE3 A;  1OPX A;  1XFN A;  2O9C A;  1LSW A;  2ZQA A;  1MWS A;  5KZH A;  3JPU A;  2WGW A;  2Y2M A;  1SDN A;  3CG5 A;  4NKP A;  4Y0T A;  2XD1 A;  4YFM A;  1W63 M;  4E6W A;  3BY8 A;  1ZHH B;  2Z6D A;  4PM7 A;  4GB7 A;  5EVI B;  1BLC A;  4Y5F A;  4U0T A;  4N92 A;  3UMD A;  3GSG A;  4HBU A;  2HP6 A;  1QMF A;  1WA9 A;  4KEN B;  2LB9 A;  5HAP A;  1PIO A;  4Y17 A;  1OTD A;  3M6H A;  1F2K A;  1YLJ A;  3V5M A;  4JXV A;  2ZMF A;  4D60 A;  3N8L A;  3MSH A;  2W27 A;  4IVK A;  4OLD A;  3SZT A;  5GL9 A;  4FSF A;  5E2G A;  4XT2 B;  1PYY A;  4R3A A;  1CEF A;  2A24 A;  1SKO B;  4WN5 A;  3IH9 A;  4ZRR A;  4GD6 A;  4WEK A;  1P9W A;  1SZV A;  1Z09 A;  3IX4 A;  2VX8 A;  4II7 A;  3QP6 A;  4FD8 A;  3N7W A;  1CQA A;  4BLM A;  4RX3 A;  3VMA A;  3RXW A;  1ALQ A;  1HVB A;  4GCZ A;  3K3C A;  2ZM2 A;  4AFI A;  5FSR A;  5DJT A;  2PYR A;  3IWO A;  3KYE A;  1TDG A;  3IBR A;  4EUV A;  3MS6 A;  1G5U A;  5EVL A;  1NZO A;  4WEJ A;  4GOG A;  3IF5 A;  4E04 A;  4IBX A;  5DKK A;  1GCE A;  5FAS A;  1MC0 A;  3N8R A;  5FQ9 A;  5CEC A;  3C4O A;  4Q0I A;  3OLO A;  4OKP A;  1RGZ A;  3WS4 A;  3IH8 A;  2M7U A;  2HJE A;  3B42 A;  2XQZ A;  5E2E A;  4WYY A;  1XKZ A;  4LRZ E;  3FPW A;  1NJ4 A;  3F1O A;  4ZBE A;  4BBU A;  3HUM A;  3OPP A;  4Y3I A;  3ZG5 A;  2JKT M;  1L0F A;  3P7N A;  1OTI A;  3UE0 A;  1DP8 A;  2NUT C;  1NY0 A;  4QD4 A;  4JF4 A;  1KDS A;  2D01 A;  4HP4 A;  1Z6F A;  2XR0 A;  2QJ5 A;  2PT7 A;  5AJG A;  5J3W A;  3G6O A;  2HP9 A;  5JYO A;  2GDN A;  2JCH A;  3CPT B;  3LIC A;  2ZBB A;  1PRQ A;  5G4Z A;  1PI5 A;  1H0M A;  3RXX A;  2VV7 A;  1IKG A;  4LFU A;  2PR5 A;  3FG8 A;  2Y2I A;  3UPP A;  5TR7 A;  2ZQC A;  3F1N A;  4CLC A;  4E3M A;  2Y2N A;  4GNU A;  4WM9 A;  3G4P A;  4QJG A;  2P74 A;  3H82 B;  3ZYT A;  1W79 A;  3ZNY A;  1NZU A;  3PBS A;  5CHU A;  5DFX A;  1G28 A;  4KG5 A;  4KZB A;  4EEP A;  2VK3 A;  3RTY A;  5TBM B;  3Q81 A;  3CMZ A;  1W7F A;  3G31 A;  5HD3 A;  4B9O A;  2P9V B;  3BFE A;  3QP4 A;  2B5R A;  5HAQ A;  2Y4A A;  3MZE A;  4MMN A;  3WS2 A;  4Y2F A;  1A0K A;  5CGX A;  2XRN A;  1OT9 A;  4JGP A;  3A0S A;  3FZC A;  4GD8 A;  3V50 A;  2VGL S;  4HJ4 A;  4KZA A;  4JPM A;  5GLA A;  2EXB A;  3NI9 A;  1YSP A;  3UE1 A;  1JWV A;  4N1H A;  1K6R A;  2QHK A;  5E2H A;  3LCE A;  4XUZ A;  3ZG7 B;  4OQH A;  4DKI A;  1FCO A;  2XDM A;  1XGI A;  3V3R A;  3P01 A;  3A0R A;  2R78 A;  3WS0 A;  2YKH A;  1D06 A;  2Y2G A;  3HUN A;  3S7O A;  4CPK A;  4QWO A;  5CX7 A;  2H5S A;  4X55 A;  1M40 A;  3V67 A;  1XA1 A;  1TS8 A;  3ZG8 B;  2IA2 A;  3DAV A;  3MBZ A;  3NOT C;  2K2N A;  5TFQ A;  3M6B A;  5DTK A;  3BW6 A;  2XRO A;  4JKT A;  3EQU A;  3QNB A;  3Q07 A;  1H8Z A;  3VOL A;  5HSQ A;  4DJ2 A;  1IEL A;  1TS7 A;  4KZ3 A;  2L0W A;  1YLY A;  1EWZ A;  5CXW A;  3BJN A;  3C38 A;  3UY6 A;  5FAT A;  3H7W A;  5EM0 A;  4JF5 A;  1KE4 A;  5CHM A;  1VEU B;  2V8C A;  1BUE A;  2EFU A;  1MKI A;  3G34 A;  3VP2 A;  4OOL A;  4BL2 A;  2CMN A;  3MF0 A;  3S7N A;  3RFB A;  4OPQ A;  2O0Y A;  1ZTU A;  2ZOH A;  4GS9 A;  2VJW A;  2G2W A;  4IUH A;  4QB8 A;  1HD8 A;  2B18 A;  2XSS A;  1OTE A;  2WAD A;  5HWT A;  5EM1 A;  2JKR M;  1OTA A;  4L9G A;  3OPH A;  1KVM A;  1LLB A;  1RP5 A;  2HJ9 C;  3A3J A;  2JKG A;  1VM1 A;  4EES A;  5FQQ A;  1JWP A;  4LV2 A;  3Q7V A;  5DF8 A;  5A91 A;  3ZNT A;  2ACG A;  1HZO A;  1XJ6 A;  3G35 A;  3IS2 A;  1XP4 A;  3LFV A;  2QWS A;  4KUK A;  1YQS A;  2PU4 A;  1H3Q A;  4ARZ A;  1S6R A;  1OT6 A;  4OPY A;  3UDF A;  2VA0 A;  4DE1 A;  3BEB A;  1Q2P A;  3NUL A;  5F5Y A;  5KSH A;  1L0E A;  1YMX A;  3CJM A;  2UV0 E;  3BWL A;  5IHV A;  2NUP C;  2JHE A;  3HJK A;  3LIF A;  4GLQ A;  4I3A A;  1LHY A;  3UN7 A;  1T18 A;  3H9W A;  1BLP A;  1VQQ A;  4KQR A;  5HAR A;  2ZQ7 A;  5HPI A;  4PKY A;  3NCK A;  1ODV A;  4BEN A;  3PR6 A;  1CI9 A;  3D4F A;  1MWU A;  1DJC A;  1YLP A;  4OH0 A;  4GDN A;  4ETX A;  4KZ5 A;  2HF6 A;  1E25 A;  3VOY A;  1CJF A;  4EW7 A;  1FCN A;  4R4S A;  3UPN A;  4GW9 A;  1MKM A;  4G3V A;  2PR6 A;  2ZC4 B;  4OP5 A;  2ZOI A;  2JC7 A;  1KDW A;  1S0W A;  2VGL M;  1S4S A;  5J8X A;  3PYP A;  1O7E A;  1J3W A;  4YWZ A;  4X56 A;  1VHM A;  4K08 A;  1V9Y A;  1W5D A;  2W3E A;  4LEN A;  5KSC A;  2XLN A;  4WLA A;  2J8Y A;  4QY5 A;  2W1T A;  1OJ5 A;  2I72 A;  1D7E A;  4RX2 A;  2VGK A;  4S2K A;  3BFG A;  2XF3 A;  3BYD A;  4LGW A;  4X53 A;  5FAQ A;  1U60 A;  5EUA A;  2EXA A;  2X02 A;  2Y2H A;  3UO9 A;  1PW1 A;  5FA7 A;  4F3L B;  3OPL A;  4S2L A;  2UWX A;  5GLD A;  3PBT A;  3SH8 A;  3GVB A;  3S1Y A;  4MDZ A;  4P6Z S;  1GA0 A;  5CED A;  4N1X A;  3HLB A;  3LEQ A;  3U4L P;  5CGS A;  3G32 A;  2B95 A;  1K56 A;  4DE3 A;  4MN5 A;  3ITB A;  4I3I A;  4JLF A;  4JGR A;  5IT5 A;  3HJI A;  3QNC A;  2Y8H A;  5HX9 A;  1N9N A;  1H8M A;  3ICY A;  3PBQ A;  3KYZ A;  4K91 A;  1IEM A;  1ERM A;  4U0X A;  1T1B A;  4ZJ3 A;  3DW0 A;  3ITA A;  5FL3 A;  3PAE A;  3VP4 A;  2WUQ A;  3D72 A;  3NDG A;  5AQ9 A;  3B47 A;  4Y0O A;  4C3Q A;  4CLC D;  5JYP A;  1XX2 A;  5CTM A;  3Q7Z A;  3N8S A;  3LGO A;  4HJ3 A;  3PBR A;  3IWI A;  5A93 A;  5EEC A;  4E3L A;  1DRM A;  1NYY A;  4Q0J A;  4IED A;  3DTK A;  4IJG A;  4GN2 A;  2WZZ A;  1P0Z A;  4X1L A;  3EWK A;  2EX2 A;  5EVI C;  2J9O A;  3HLG A;  3KO6 A;  1DJA A;  1XFQ A;  1I2W A;  4RVA A;  3VE3 A;  4N9L A;  3NJA A;  4HI4 A;  1PI4 A;  5DFY A;  2J3W A;  1ZG6 A;  3HLW A;  1IYO A;  2PU2 A;  4IVI A;  3PXP A;  4N9K A;  2X71 A;  3BFC A;  1FR6 A;  3FKW A;  1V9Z A;  5HWV A;  3OZH A;  4OP8 A;  3T4Q A;  3LO7 A;  2Z2M B;  3FKV A;  1X0O A;  3RH8 B;  4BMW A;  3U2A A;  1GSW A;  2HV1 A;  4S2I A;  1YMS A;  3IXG A;  4UA9 A;  1PNE A;  2R9W A;  4LRY C;  4MN6 A;  5DVA A;  4G3K A;  5HFO A;  2ZL1 A;  4RA7 A;  4O8G A;  5A92 A;  2RL3 A;  1BLS A;  2E8J A;  1EW0 A;  4C6Y A;  3CUE A;  4ZAM A;  1K4F A;  3IF6 B;  1DJB A;  5EOE A;  3DTI A;  3HLD A;  3SH7 A;  3HL9 A;  3TSG A;  4NXG A;  4KQO A;  1GHP A;  3AGE A;  3CHW P;  3VE4 A;  4OVD A;  2V20 A;  2QZ6 A;  3ZHH A;  4PM9 A;  1LSX A;  4DMZ A;  1CI8 A;  4S2M A;  4UHU A;  2Z6C A;  4FUW A;  2QMI A;  1ONH A;  2PBY A;  2ZC7 A;  3CUE C;  3UE3 A;  1S66 L;  5D3O A;  2O9B A;  1M6K A;  2W1R A;  3UB8 A;  4YIN A;  4LV3 A;  1RGY A;  2WGW B;  5IU1 A;  4QHC A;  3EGD C;  2VV6 A;  1UWN X;  4EXO A;  2WKI A;  4Q0H A;  3BRM A;  2WYX A;  4HP9 A;  3MZF A;  1FSY A;  3W4O A;  2DMW A;  4HBT A;  1D1J A;  3ZQ5 A;  1K0K A;  1K57 A;  3LR0 A;  1JTG A;  3IWQ A;  4U3T A; 
#chains in the Genus database with same CATH homology
 2XRO A;  3EQU A;  1OTB A;  2J3T D;  5HWW A;  3LI8 A;  3VOL A;  5HSQ A;  3K2N A;  2K7S A;  5DKL A;  3LIA A;  3OC2 A;  4DJ2 A;  1TS7 A;  2L0W A;  4HHD A;  2WKP A;  1NWZ A;  4HNB A;  3CIT A;  5MC7 A;  3BJN A;  4KQD A;  3C38 A;  3DBA A;  3H7W A;  3F1P A;  2M7V A;  4O01 A;  3KYQ A;  2A24 B;  3T4S A;  2VKS A;  3SW1 A;  3LUQ A;  4NXE A;  5IS1 A;  2M1C A;  2OWH A;  4OOL A;  5J7E A;  1DP6 A;  2CMN A;  3MF0 A;  3S7N A;  2V0W A;  1N9L A;  3RFB A;  3S7P A;  4L0L A;  2OAP 1;  2O0Y A;  1ZTU A;  1S4R A;  2ZOH A;  4GS9 A;  2VJW A;  3EEA A;  4DN0 A;  3KSH A;  4IUH A;  1BYW A;  2B18 A;  3CWF A;  3PBO A;  2XSS A;  1OTE A;  5HWT A;  2JKR M;  3TW8 A;  1OTA A;  1LT0 A;  2L4R A;  4L9G A;  3LI9 A;  3MQO A;  1NRJ A;  4EEU A;  2HJ9 C;  3OCL A;  4EES A;  2PDR A;  1G6O A;  2XA7 S;  4R6L A;  4I3J A;  4LRX C;  3R7W B;  2WKR A;  3OOV A;  1F5M A;  3LYX A;  4MN7 A;  1MZU A;  2VLG A;  1XJ6 A;  3IS2 A;  3UB7 A;  4FOF A;  4NXF A;  1P97 A;  3LFV A;  2JKT I;  5HL6 A;  5HDS A;  2QWS A;  2PD7 A;  3CI6 A;  4G3W A;  4KUK A;  4WEL A;  3GEC A;  1H3Q A;  4ARZ A;  5HPF A;  4LPZ A;  1OT6 A;  1GSV A;  3O5Y A;  1VB6 A;  2VA0 A;  3KSF A;  2YKF A;  3BY9 A;  5F5Y A;  5KSH A;  4I38 A;  1NLY A;  3MJQ A;  4P6Z M;  3T4K A;  3E0Y A;  3BQA A;  1YKD A;  4CQH A;  3BWL A;  3F1O B;  2NUP C;  2JHE A;  3HJK A;  3H82 A;  3LIF A;  2JN7 A;  2GZA A;  4GLQ A;  4HJ6 A;  4I3A A;  1T18 A;  2OOL A;  3EOI A;  3H9W A;  2KLI A;  3KSG A;  3HCY A;  2FH5 A;  5HPI A;  4PKY A;  1ODV A;  5AVF A;  5TBM A;  3VV4 A;  3PR6 A;  3T4L A;  2H28 A;  1S1Z A;  4PKY G;  1TD5 A;  5LBR A;  3UE6 A;  2D02 A;  3TRC A;  5HDD A;  2GNX A;  4GHI B;  4H6J B;  3TE8 A;  2GJ3 A;  4ETX A;  2HF6 A;  2Y79 A;  2PYP A;  3NHQ A;  3LR3 A;  3T4T A;  2W3D A;  1NLZ A;  4OOM A;  4EW7 A;  4ETZ A;  3T50 A;  4GJ4 A;  1OJG A;  2KDK A;  1TS6 A;  2FZ0 A;  1MKM A;  3F1N B;  3BQ8 A;  3B33 A;  2J3T C;  2PR6 A;  4G3V A;  4GW9 A;  4Z1W A;  2ZOI A;  1P9R A;  2P08 A;  3MFX A;  3NOU C;  4CLC B;  5DJU A;  1T1A A;  3EQV A;  2W3F A;  2VGL M;  1S4S A;  2V1A A;  3D3O A;  3PYP A;  5F6A A;  3MMH A;  4YWZ A;  1S1Y A;  1VHM A;  4K08 A;  1OPX A;  1V9Y A;  1XFN A;  2O9C A;  2W3G A;  1LSW A;  1DP9 A;  2W3E A;  2LB5 A;  2WKQ A;  2GX5 A;  4UEY A;  4IUK A;  4RQ9 A;  4WLA A;  3A0V A;  5I5L A;  2I9V A;  5C5K A;  4L9E A;  4NKP A;  3LIB A;  4HH2 A;  1W63 M;  2V9A A;  3BY8 A;  1ZHH B;  2Z6D A;  3IBJ A;  3E4Q A;  2W1T A;  1OJ5 A;  4HQA A;  4Y5F A;  3E4O A;  3UMD A;  1D7E A;  2VZW A;  5F69 A;  1YAX A;  1WA9 A;  2LB9 A;  4HH3 A;  4YNR A;  1KOU A;  1OTD A;  4ME4 A;  2ZMV A;  2VEA A;  3PHY A;  4F3L B;  2ZMF A;  2W0N A;  3PBT A;  3GDI A;  4MDZ A;  4P6Z S;  3EGX C;  1LL8 A;  5HD5 A;  2EA9 A;  4MN5 A;  4JGO A;  5G4Y A;  5KIZ A;  4I3I A;  1TF1 A;  2W27 A;  4PHT A;  2G7U A;  4JGR A;  5IT5 A;  4FSF A;  1GSX A;  3HJI A;  4XT2 B;  1STZ A;  4R3A A;  1LSV A;  2QJ7 A;  2A24 A;  2Y8H A;  2VV8 A;  4I5S A;  4YOF A;  1N9N A;  1H8M A;  3ICY A;  3PBQ A;  4UQI S;  4WN5 A;  3KYZ A;  4O0P A;  4BWI A;  4ZRR A;  3OCN A;  5EFW A;  4WEK A;  1P9W A;  4II7 A;  3JVV A;  2VX8 A;  1T1B A;  4R38 A;  2L1M A;  5FL3 A;  3TJZ C;  4B93 A;  4GCZ A;  3K3C A;  3D72 A;  4CLC C;  4AFI A;  2OWJ A;  3B47 A;  2B02 A;  4CLC D;  1XJ4 A;  4WUJ A;  5DJT A;  2PYR A;  2PD8 A;  4HJ3 A;  3PBR A;  2OAQ 1;  2XA7 M;  1UGU A;  4R70 A;  3IBR A;  4HOI A;  4EUV A;  2MJ6 A;  5AVE A;  1DRM A;  3R7W A;  4WEJ A;  4Q0J A;  1JNU A;  4E04 A;  3LIE A;  3EEH A;  3H7W B;  5DF9 A;  4IJG A;  5DKK A;  3JVU A;  2V0U A;  1P0Z A;  3F1P B;  5L8M A;  1MC0 A;  3LR4 A;  3EWK A;  1T19 A;  5TJJ A;  4Q0I A;  4M4X A;  3OLO A;  3KSI A;  4WF0 A;  3KO6 A;  1XFQ A;  2M7U A;  4DJ3 A;  2HJE A;  3B42 A;  4LLO B;  3VE3 A;  4NXB A;  4LRZ E;  4GS9 B;  4HY8 A;  3FPW A;  4PAU A;  2A2L A;  3F1O A;  3MQQ A;  3NJA A;  4HI4 A;  4BBU A;  3UB6 A;  1XJ2 A;  3W2Z A;  5DFY A;  2J3W A;  4Y3I A;  2JKT M;  3CLO A;  3P7N A;  3FC7 A;  3R4K A;  4EET B;  1OTI A;  4QPR A;  1DP8 A;  2NUT C;  5HZH A;  3MQ0 A;  3PXP A;  2D01 A;  4NEE D;  4HP4 A;  5HDC A;  3S7Q A;  2KOI A;  2QJ5 A;  1V9Z A;  2PT7 A;  2W3H A;  5HWV A;  5AJG A;  5J3W A;  3G6O A;  3MR0 A;  1S67 L;  4GHI A;  3LR5 A;  3IS2 B;  4H6J A;  3T4Q A;  3LIC A;  4KUO A;  2ZBB A;  5G4Z A;  1X0O A;  3RH8 B;  2VV7 A;  4BMW A;  2PR5 A;  3FG8 A;  3U2A A;  1GSW A;  3OBF A;  1F98 A;  2HV1 A;  4ARZ B;  2K31 A;  2P7J A;  3E98 A;  4IHQ A;  3F1N A;  4LRY C;  4MN6 A;  4CLC A;  1IFQ A;  3C8C A;  2KX6 A;  3C30 A;  2EWW A;  4G3K A;  4WL9 A;  2QKP A;  1YSQ A;  3E4P A;  4O8G A;  1IOU A;  3H82 B;  2PHY A;  3ZYT A;  1Y28 A;  2P04 A;  3PBS A;  3UME A;  4BJP A;  5DFX A;  3PBN A;  1G28 A;  2O9A A;  1EW0 A;  4CLC E;  4EEP A;  3CUE A;  3RTY A;  3CAX A;  5TBM B;  1F9I A;  5HD3 A;  4B9O A;  3T4J A;  3KX0 X;  4NXG A;  4KQO A;  3VE4 A;  5F68 A;  4MMN A;  3NOP C;  4Y2F A;  2O99 A;  2HGV A;  2XRN A;  1LSX A;  1OT9 A;  4DMZ A;  4JGP A;  4F3L A;  5A8B A;  3A0S A;  3K3D A;  4EER A;  4EQ1 A;  2Z6C A;  4BBT A;  2INW A;  4HIA A;  2VGL S;  4EU0 A;  4HJ4 A;  2EWV A;  3CUE C;  3MXQ A;  3UE3 A;  1YSP A;  1XJ3 A;  2J80 A;  1S66 L;  2O9B A;  4JGQ A;  4BBV A;  3ULF A;  2JKR I;  2QHK A;  2W1R A;  4MCW A;  3UB8 A;  5IU1 A;  3EGD C;  2QYB A;  3FPV A;  1T1C A;  2VV6 A;  5J4E A;  4XT2 A;  4L9F A;  1UWN X;  4UQI M;  1TS0 A;  3T4O A;  3C2W A;  2W1T B;  4EXO A;  3A0R A;  3P01 A;  4Q0H A;  1UWP X;  2R78 A;  2YKH A;  2V1B A;  1D06 A;  4HP9 A;  4I39 A;  3LID A;  1N9O A;  3UB9 A;  3S7O A;  5CX7 A;  2DMW A;  1W63 Q;  3V67 A;  3ZQ5 A;  1TS8 A;  2IA2 A;  3NOT C;  2K2N A;  2BAS A;  3LR0 A;  5K5B A;  3BW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...