3HJIA

1.8 angstrom crystal structure of the i74v:i85v variant of vivid (vvd).
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
149
structure length
149
Chain Sequence
MHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALVLCDLKQKDTPVVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism-based tuning of a LOV domain photoreceptor.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Signaling protein
molecule keywords Vivid PAS protein VVD
total genus 36
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3hjiA00
4KUKA 3UB8A 3UB6A 1LT0A 2R78A 3MQOA 3NJAA 1S1YA 4I3IA 2W27A 1TS7A 4R38A 4LPZA 3H7WB 4HP9A 4LRXC 4EERA 1XJ6A 2BASA 2PYPA 4E04A 3LI9A 2WKRA 3LUQA 4PKYA 3NOUC 1DP8A 2INWA 3MXQA 2QJ5A 3P7NA 3E4PA 5HD5A 3UMEA 3PHYA 2YKHA 2PD8A 1OTEA 2KX6A 3IBRA 4I3JA 4KQDA 4R70A 5G4YA 1KOUA 2QJ7A 4BBUA 4EQ1A 5J4EA 4EETB 3LIBA 1T18A 1N9OA 4GHIA 3EWKA 4HJ3A 5TBMB 3ZQ5A 5HSQA 3F1NB 3SW1A 1T1CA 4L9FA 2V9AA 3H7WA 4HH2A 3KX0X 4R3AA 1S1ZA 2VLGA 3GDIA 1GSWA 3D72A 4HNBA 2PDRA 4JGRA 3G6OA 1S66L 2V0WA 2W0NA 4F3LA 3RH8B 1XFQA 4WLAA 2EA9A 2V1AA 1V9ZA 2OWJA 1P97A 3F1OA 3GECA 5DKKA 5HDSA 3RTYA 2M1CA 2J80A 4M4XA 4WN5A 2ZBBA 4HP4A 2PYRA 1DP9A 3VOLA 3LIFA 3CLOA 5G4ZA 3NOPC 3VE4A 5IS1A 4B9OA 5HWVA 1UGUA 2QKPA 1EW0A 2V1BA 4HIAA 4EW7A 1OJGA 1OTDA 2PR5A 3F1PB 1GSXA 3F1PA 3H82A 2PD7A 3K3DA 3A0RA 3NOTC 2L1MA 3F1OB 2JN7A 4XT2B 3MR0A 4LRZE 1TS0A 4NXGA 2A24A 1XFNA 4KUOA 4EEPA 1XJ4A 2P7JA 1LSWA 1T1BA 2VEAA 3CWFA 4DJ3A 5HWWA 2V0UA 1S4RA 4HJ4A 4JGQA 5HDDA 4HY8A 1XJ3A 4H6JB 4JGPA 2OOLA 4GS9A 4H6JA 4PKYG 3UMDA 5J7EA 4I3AA 1ODVA 3H82B 1D7EA 5F5YA 4JGOA 5AVFA 3IS2B 1LSXA 3ICYA 1OTBA 4YWZA 3B33A 1P0ZA 1T1AA 2KDKA 4WUJA 3A0SA 5DJTA 5IU1A 1WA9A 2B02A 1VB6A 1NWZA 4HJ6A 4LLOB 4L9EA 4NXBA 5DJUA 2I9VA 2CMNA 3LIAA 4BBVA 3VE3A 2GJ3A 1LSVA 4I5SA 2Z6DA 4LRYC 3OLOA 1F98A 1Y28A 4HOIA 4L9GA 4XT2A 2WKQA 3CAXA 2D01A 2QWSA 4MN6A 4NXFA 3C8CA 5F69A 4WF0A 3FG8A 1G28A 2VV6A 3UB9A 4DJ2A 3BY9A 1DRMA 3E4OA 1BYWA 1GSVA 2OWHA 5HDCA 3T50A 4I38A 2PR6A 3HJIA 5F68A 3E4QA 4NXEA 4GW9A 4RQ9A 4HI4A 4GCZA 4GS9B 3LI8A 2HV1A 1UWNX 5HWTA 3BWLA 1N9NA 5EFWA 3UE6A 5HZHA 3FC7A 3PYPA 5KIZA 4BBTA 2L0WA 3BY8A 4HH3A 1TS8A 3K3CA 1OTAA 4GHIB 4MN5A 2JHEA 3F1NA 3LYXA 2K7SA 1D06A 2PHYA 2VV8A 3MJQA 3EEHA 5DKLA 4EXOA 4HQAA 1DP6A 1OTIA 5A8BA 1S67L 1TS6A 1LL8A 1OJ5A 5J3WA 5AVEA 4EESA 3MQQA 5F6AA 3MFXA 3H9WA 3IS2A 2QHKA 1MZUA 2A24B 5I5LA 5TBMA 3C2WA 4EEUA 3LIEA 1N9LA 1X0OA 2VV7A 1OT6A 5HD3A 2D02A 1S4SA 2ZOHA 4HHDA 1T19A 3NHQA 4R6LA 3HJKA 4F3LB 2H28A 1OT9A 3UB7A 1JNUA 2L4RA 1F9IA 1XJ2A 2WKPA 2YKFA 2Z6CA 1UWPX 2ZOIA 3A0VA 3LIDA 4I39A 3LICA 4K08A 1V9YA 4WL9A 3ULFA
chains in the Genus database with same CATH superfamily
2ZM0A 3UB8A 2XROA 1GHIA 2O0YA 4P6ZM 4R38A 3H7WB 4WMCA 1NXYA 2JKGA 3IBRA 2H10A 1ZG6A 3ZG7B 5A92A 2V1ZA 2V9AA 5FI6A 4NK3A 1GHMA 4QJGA 3UY6A 3BECA 4WLAA 1K57A 4BL2A 5GLDA 4N92A 2XSSA 3NY4A 1ZTUA 4KZBA 5G4ZA 1MWSA 4B9OA 2VK3A 2V1BA 5GLAA 1L0DA 4EW7A 2PD7A 3A0RA 1K56A 1Y54A 4NETA 5HDDA 4ZRRA 4D60A 1LL9A 4Y7PA 1I2WA 1OTBA 2DMWA 3IBJA 4EBLA 2P08A 2KDKA 4KG6A 3KSIA 5IT5A 4BD1A 2D01A 1IKGA 4CJNA 5CTMA 3HLGA 3O5YA 2ZQ7A 3WS4A 3U2AA 5FATA 1MPLA 2K7SA 1SKOB 2NUPC 3K2NA 2EWVA 2ZC4B 3NDGA 2W3FA 3HLCA 1MZUA 3O87A 3W4PA 4S2IA 3MKEA 3KYQA 2H28A 1Z09A 2L4RA 1JWVA 4MN7A 5IHVA 3G4PA 1KGFA 2XFSA 1XGIA 1S1YA 1XPBA 4LRXC 2DNSA 1BT5A 1ACFA 2J3TC 4HJ3A 2ZC3B 4IHQA 2J9OA 3G32A 2Y2NA 2ZC7A 4IJGA 3CHWP 1WYCA 5DKKA 3RTYA 3IXDA 2ZM8A 4KQOA 2P9VB 1JTGA 2PR5A 4JGRA 3NOTC 2HP6A 3MR0A 4OP8A 5FI7A 2ZC6B 4DMZA 5FQJA 3E2LA 4B4ZA 4EBPA 4JGQA 4LCLA 3TE8A 1ZKJA 1QMEA 5L10A 3S7NA 3LR4A 5IU1A 1NWZA 4EWFA 2I9VA 4QHCA 1Y28A 2KLIA 4NXFA 1L3LA 3ZG9B 1MKIA 4GZBA 5F68A 2Y55A 3QP8A 5DTTA 5F82A 5DFYA 5HPIA 4GS9B 2Y2KA 5GLBA 3Q07A 1NY0A 4HH3A 4GHIB 1OTAA 5A93A 4NEED 4O8GA 3LYXA 5FEFA 2ZL1B 3T4JA 4UQIM 3IWOA 4JLFA 4X56A 3OOVA 5GHYA 1BLHA 3BFDA 1IYPA 1K56D 1K54C 3BQ8A 4PPRA 1H8YA 1KE0A 1MWRA 3G31A 4DXBA 1IFQA 2YKFA 3N4IA 3T4LA 1CI8A 1NZOA 2W3HA 2Y2QA 4WL9A 2Y4AA 5JYPA 1YMXA 3UO9A 2BASA 4PKYA 2JBFA 4X68A 4IEDA 3T1QB 2Y2MA 3PAEA 2WGWA 3VP4A 3RXWA 4Y15A 3G35A 2HZ5A 5AQ9A 4WN5A 1YQSA 3PTEA 2WGIA 4OQGA 1OJGA 1OTDA 3WS0A 3DBAA 1HD8A 2J7VA 1BLCA 4RA7A 5FAQA 2Y2OA 3TRCA 4U0XA 3NULA 2J9PA 3ZCZA 3BJNA 1TF1A 5HPFA 1JWPA 1JTDA 3LEQA 1D7EA 3B42A 3GSGA 3ICYA 2V2FF 4KG5A 2ZQ9A 3UE3A 4XT2A 5FQ9A 3CAXA 4X6TA 4ME4A 2IWDA 4WM9A 1ES2A 4I38A 3BFCA 3WS2A 3NI9A 4GCZA 1YSQA 3BWLA 1MXOA 3N6IA 3T12B 3Q81A 2EFUA 2ZL1A 2PHYA 1I5QA 5DKLA 2I72A 1S67L 1OJ5A 5M1AA 4JF5A 3MZEA 3IF6C 3O86A 2FFFB 1DJBA 4WZ5A 3S1YA 1IYSA 4QY5A 4UA9A 4R6LA 5HW3A 5CHJA 4FSFA 1K4EA 3LICA 3SH8A 3ZGAB 3BFFA 4O0PA 5DFXA 3ZHHA 4QPRA 3UPPA 2EX2A 5FDSA 1O07A 1T1CA 4KZ7A 3SZTA 4FH4A 3WS5A 4LV0A 1DP9A 3SH9A 4EBNA 4HIAA 2C6WB 1S0WA 3D3OA 4IUKA 1K57C 4Y5FA 2LB5A 5E2HA 4C6YA 1LSWA 2VEAA 5CHMA 5EOEA 4GS9A 3FKVA 2FZ0A 1P0ZA 3AGFA 1PFLA 1ES3A 1VB6A 3CUEC 3QP6A 1HLUP 5DJUA 3L7HA 3DW0A 2Z6DA 2QWSA 4MLLA 2VV6A 3BY9A 3Q7ZA 3B47A 1XP4A 2WAFA 2VZWA 3LCEA 3E4QA 1NJ4A 4NXEA 2W1RA 2HV1A 5EVEA 2K31A 3ITAA 2L0WA 2IWBA 3O3VA 4D2OA 3BLMA 4UA6A 3TG9A 2H0TA 4Q8IA 3PXPA 2P74A 3FZCA 2CC1A 3SH7A 1VM1A 1OT9A 1XX2A 3C5AA 5A90A 4RVAA 2XK1A 4LGWA 3GVBA 1BUEA 2PYPA 3S22A 3UMEA 3PHYA 3MS6A 2PD8A 1OTEA 4EQIA 1T18A 3VV4A 1YT4A 4X55A 3MF0A 2ACGA 3TJZC 1K55A 4N9KA 2JKRI 2ZLYA 1IKIA 2ZBBA 2XD5A 5FAPA 3VOLA 4XUXA 3AGEA 1ZHHB 3H82A 3UPNA 5E43A 4E3KA 2JN7A 4JBFA 4KZ4A 4CLCA 1XJ4A 4Z1WA 3LEZA 3U4LP 2V0UA 3S7OA 5E2EA 4H6JB 3NECA 1VQQA 4R4RA 3C4PA 1LSXA 3RFBA 4ZTKA 5EM0A 5FASA 2HDUA 3BM6A 1WA9A 1FQGA 4HJ6A 4DE0A 1ES4A 2CMNA 1K55C 1DJCA 1VEUB 1W8QA 5FQMA 3NC8A 4LV1A 1DRMA 4X1LA 2J8YA 1YMSA 1A0KA 4E6XA 3UPOA 5D3OA 2OAQ1 3JYIA 4JXVA 4KZ8A 4P87A 3FC7A 2XQZA 3BY8A 2KOIA 4ETXA 4E3LA 3H9WA 3M2JA 1FOFA 1LL5A 3JPUA 1XJ2A 4IBRA 3CPTB 2WADA 1MBLA 3GTCA 3Q7VB 2R78A 2EXAA 4OVDA 1DP8A 4OPYA 5FQQA 3SS4A 2QJ5A 3QP4A 1FSWA 4I3JA 3GQZA 5CTNA 4U3TA 1K4FA 4F3LA 1SHVA 4NG2A 2VA0A 1V9ZA 4WYYA 5MC7A 5FL3A 1D1JA 4JKTA 3VP2A 4A5RA 1CI9A 4B4XA 1K38A 2VGLM 4Y0OA 2ZJ9A 3T4KA 1UGUA 3CMZA 3IWIA 5JYOA 5EOOA 5F5YA 4EUVA 2FFYA 1FR6A 1T1AA 4CPKA 2ZQAA 3OPLA 1KE3A 1CK3A 1JWZA 5AJGA 1VEUA 3IQAA 3T1SA 4MEZA 5LBRA 5HDCA 5CEBA 3D9YA 2B95A 5EVIB 2OAP1 1P9WA 3IX3A 1YLPA 3AGDA 4R4SA 3PYPA 2XEPA 4FCFA 2HDSA 3WS1A 1I2SA 3T1RA 1F2KA 1CJFA 2E8JA 3C30A 1BSGA 1BLSA 4LV2A 1MY8A 2EWWA 1MKMA 4U0TA 4S2KA 2VV7A 1KVMA 1S4SA 5DF8A 4F3LB 1JNUA 4OOLA 1H0MA 1VHMA 4DKIA 3W4QA 1E4DA 3NJAA 4I3IA 1J9MA 1XJ6A 4E04A 2INWA 3MXRA 4RX3A 4DDYA 1PI5A 4N1XA 3LIBA 3MQ0A 2OLVA 2BLSA 4HESA 2PDRA 1YLZA 2W0NA 1OMEA 3GECA 3P09A 2OWJA 3T4SA 4OQHA 1RGYA 5L2FA 4Z9QA 3LIFA 5FDHA 1EW0A 3VMAA 4G3WA 4OLDA 4BMWA 5FQIA 2BTFP 3Q82A 3IXHA 4DJ3A 2H0YA 4JXGA 5L09A 4Y13A 5BOHA 4GDNA 1ZC2A 2W1TA 3A0SA 4S2NC 5HL6A 3M2KA 5GLCA 4Y0UA 2XFTA 2AVXA 5HAQA 2R9XA 1GSVA 1LI0A 2ZMVA 1F5MA 1SDNA 1CF0A 5FEGA 3IX4A 2WGVA 1SKFA 5HZHA 5EE8A 4ARZB 2JE5A 3LR0A 3VSLA 5A8BA 3RXXA 1KDSA 3IT9A 5F6AA 2RCXA 1IELA 4WZ4A 4OQIA 1HZOA 2O9BA 1NRFA 5AQBA 3DTIA 2JC7A 4K08A 4DE1A 4B88A 4YFMA 4MDZA 3UB6A 3MQOA 3W8KA 3V50A 3LR3A 4WMCD 4M3KA 3B3XA 4KG2A 1STZA 5E2FA 4OPZA 3EWKA 1EI5A 2V8FA 4Y17A 3GV9A 1XFQA 1BTLA 4GN2A 4P6BA 2J80A 4OH0A 5F1FA 1K54A 2ZD8A 4OPQA 1ESIA 1GSXA 1PZOA 3F1OB 1CEGA 2EX6A 1J3WA 1NLYA 1H8ZA 4BQMA 1ONHA 4KZAA 3C38A 1GA0A 2J3TD 3O88A 2OOLA 4H6JA 2B18A 3ZNYA 3FPVA 2EXBA 3LR5A 5EVIA 4BBVA 2XD1A 2OV5A 3D4FA 1LSVA 2J3WA 1ES5A 4P85A 4Y0TA 2QYBA 3IX8A 1DJAA 1BLPA 2PR6A 3LY4A 4C3QA 4X53A 4S2OA 4GW9A 5EUAA 4HI4A 1Z6FA 2WZZA 3PR6A 5EM1A 4QB8A 2JHEA 4LCMA 4GD6A 3OBFA 3MJQA 2VGJA 1MWUA 3OC2A 4K0XA 3VOZA 2W1TB 2A24B 3C2WA 4EEUA 1K0KA 1NZUA 3ZFZA 3VP1A 3MXSA 3NDEA 3IHBA 2Y2GA 5HD5A 1S6RA 4XXRA 3Q7VA 2V8CA 2RL3A 3G34A 5EVIC 3EQVA 4PM5A 4ETZA 1SZVA 4KQDA 3T4OA 3EGDC 5J4EA 2ZQCA 5M19A 1EROA 2DCFA 3RH8B 2GNXA 5HDSA 5KSHA 3CPTA 3HLFA 1XXMA 3W2ZA 4Q0JA 1PWGA 4X25A 4DN0A 4R3BA 2Y2IA 4K0WA 2Y8HA 4PM7A 1Y4OA 5DTKA 4JXWA 1AWIA 3HBRA 4G3KA 2P7JA 3CWFA 3QNCA 1S4RA 2X71A 4P6ZS 4JGPA 3E2KA 3R7WA 4I3AA 5HAIA 4B93A 3IF6A 4XUZA 2G2UA 1ONGA 4NKPA 3UNWA 4LLOB 4NXBA 4WEJA 5HARA 5F69A 4MBFA 3UB9A 5F83A 1KDWA 4UAAA 3T50A 2GDNA 1EWZA 1PRQA 2HP9A 4II7A 3S7QA 3ZVTA 3RJUA 1TDGA 4UEYA 1CEFA 5FSRA 4CLCC 4FOFA 2FH5A 3MFXA 3S7PA 5I94A 3LIEA 4F94A 3QP1A 2PAVP 2D02A 3T1XA 4ZDXA 2ZOIA 1UWPX 1FR1A 4I39A 2VGKA 1Q2PA 3UE1A 1YSPA 3EEAA 5CX7A 4N9LA 4HP9A 5U47A 3V67A 1K6SA 4MBHA 3LI9A 4E3JA 4QY6A 1W8YA 3A3FA 4Q0IA 2JCHA 2O99A 4EQ1A 2Y2PA 3SW1A 2E8IA 4R3AA 2Y2JA 3MZDA 3V5MA 3QP5A 3GR2A 5AQAA 3HUNA 5EVLA 1PYYA 3VP3A 1XA7A 1TS0A 5TR7A 2BG1A 3OZHA 4EU0A 4MMNA 3FV7A 4S2NA 4GNUA 3H82B 4JGOA 3DWKA 4OP5A 3NCKA 2R9WA 1KVLA 3DAVA 3GRJA 4PM8A 3E98A 3IXBA 1W79A 4IVIA 2WKQA 2HJ9C 4P0MA 1VETB 4DDSA 4EUZA 3UDXA 4L0LA 1RCJA 4OOMA 4E6WA 5FI2A 4YOFA 1N4OA 4DF6A 4Y3IA 3SS3A 3HCYA 4O01A 5CHUA 3Q1FA 1RGZA 3BQAA 3K3CA 4RYEA 2Q9MA 3A3IA 1D06A 1PW1A 1DP6A 1PWDA 4JPMA 4C75A 4OQ0A 5AVEA 5CXWA 1W63M 5I5LA 2W3GA 1IOUA 2ZOHA 5G18A 5CRFA 2WKPA 3A0VA 3ULFA 5TJJA 1YLWA 2WYXA 3QHYA 1NRJA 3BFGA 2VGLS 4OOYA 3P7NA 3MZFA 2KX6A 4JXSA 5CECA 2O9AA 5G4YA 1KOUA 4GHIA 1G6OA 2PT7A 4GB7A 3ZQ5A 4IVKA 3MSHA 4MBKA 3H7WA 4HH2A 4LFUA 4CLCD 2V1AA 3F1OA 5L07A 1G5UA 1BULA 5HX9A 4HBTA 2QKPA 1L0FA 3F1PA 3K3DA 4LV3A 3W4OA 4EEPA 4KENB 5KSCA 3L9KA 1FCMA 4ZBEA 3ITBA 3UMDA 2XDMA 1GHPA 4OONA 2HDQA 3EGXC 4MN6A 3HVFA 3LFVA 4ID4A 1BYWA 4R3JA 3LGOA 3ZDJA 3G30A 2PBDP 1XGJA 4PMAA 2Q9NA 5CGSA 5HWTA 3UE6A 4OLGA 2LB9A 4PHTA 3T4TA 1PNEA 2XGNA 1IEMA 3JVVA 1PIOA 2X02A 2V20A 2WKEA 2QMIA 1M6KA 2Y59A 3IHAA 4HHDA 1T19A 3NHQA 4JF6A 3IF6B 4HBUA 5HAPA 4GLQA 4KZ3A 3BEBA 4KUKA 1G68A 2ZM2A 1L2SA 2ZC5B 3HLWA 4JF4A 3V3SA 3D72A 1FCNA 2A2LA 3ZYTA 1W63Q 1IYOA 3TSGA 3KSHA 4HEFA 3ZNTA 2K2NA 3NOPC 1TEMA 4KQRA 4Q0HA 3F1PB 3OCLA 2XH9A 4EV4A 3PAGA 1YLTA 4NXGA 4KUOA 3C7UA 4LENA 3SOIA 1K25A 1ERMA 1PW8A 1JVJA 3NBLA 3DTMA 1YM1A 4PKYG 5TFQA 3V39A 2VX8A 3PBQA 3CZDA 4X1MA 4BWIA 4BD0A 2IA2A 1KGGA 1K6RA 3G2ZA 1DY6A 5EVID 3VE3A 4I5SA 3OLOA 1F98A 4BL3A 2OSUA 2A3UA 1LI9A 3MFDA 1SDEA 4KZ5A 3HJIA 1UWNX 3KSGA 1N9NA 5GL9A 1WE4A 5DTSA 5KIZA 3TOIA 3NIAA 1SCWA 3FYZA 5J3WA 4S2JA 5TBMA 4DXCA 2WAEA 4FTXA 2PU2A 2P9VA 1OT6A 1KE4A 1GA9A 2JKTM 3FPWA 3UB7A 5TGFA 2M7UA 2UWXA 5EFWA 2XRNA 2HDRA 1AXBA 3IXGA 3UDIA 1CQAA 1TS7A 2HF6A 4RX2A 4R70A 2G2WA 4EETB 5HSQA 3KX0X 3N7WA 2Y91A 3QP2A 2Z2MB 4ZAMA 1LHYA 1W7FA 4GOGA 4OPRA 4R23A 1TVFA 4QWOA 4ZJ1A 1XFNA 1H8MA 3WRZA 3OPRA 3KSFA 5J7EA 4YINA 5AVFA 3PBNA 3MKFA 5C5KA 5DJTA 3PBOA 3A3JA 2ZMFA 4E3IA 4FD8A 3UE0A 4R1GA 1G28A 1ERQA 5E2GA 1MC0A 2Y2LA 2EFXA 4RQ9A 3LI8A 2IWCA 4MN5A 2JKTI 1L0EA 2ZQ8A 2ZQDA 2VV8A 3S4XA 4HQAA 2B5RA 2QZ6A 4N1HA 5DVAA 1TS6A 2HP5A 5A91A 2Y2HA 1XKZA 3BRMA 2G7UA 1X0OA 3C4OA 4GDBA 3UDFA 1NYMA 4X69A 2WZXA 4GD8A 4UA7A 1P9RA 1V9YA 4O7DA 3G2YA 1QMFA 5F1GA 4WEKA 1ESUA 2WKRA 3LUQA 4CLCE 5EECA 3E0YA 1YAXA 2XR0A 4AFIA 4KQQA 2YKHA 3A3EA 1O7EA 2PU4A 2ZMAA 5GHXA 5FA7A 2XA7M 3R7WB 3A3DA 2EA9A 1P97A 1ZG4A 1TD5A 5CGWA 4KZ9A 4M4XA 3BLSA 2JKFA 1G6AA 3DWZA 3CLOA 5IS1A 5HWVA 3CI6A 4IUHA 3ZG5A 3BW6A 4ESPA 5HFOA 4MNRA 4HJ4A 1XJ3A 2WK0A 1ODVA 3IS2B 2EX8A 4UHUA 3B33A 5CEDA 2B02A 4FH2A 4L9EA 3OPPA 3LIAA 3KO6A 4HOIA 3VSKA 3C8CA 4GKUA 1L0GA 3FG8A 3V3RA 4FUWA 3LO7A 2O9CA 3WRTA 3N8LA 4WBGA 5AQ7A 4WELA 1TS8A 3IH8A 1U60A 3PBTA 1PI4A 3F1NA 1LLBA 2EX9A 2H5SA 3EEHA 1LL8A 1BZAA 5FAOA 1IYQA 4EESA 3MQQA 3FKWA 3IS2A 3HREA 2QHKA 2VKSA 5GHZA 3EQUA 5CERA 2Z2LB 1N9LA 1E3UA 3UN7A 4KZ6A 2A49A 4BJPA 2HJEA 1F9IA 3I7JA 4DRTA 2Z6CA 4EXOA 1LT0A 4E3MA 2PBYA 2W27A 1W5DA 4R0QA 1HVBA 3VFHA 1N9BA 5KMWA 3KYZA 3MXQA 5FQKA 2X01A 4BBUA 2QJ7A 2OLUA 2XLNA 5TBMB 1N9OA 3F1NB 1GSWA 4HNBA 1S66L 1H5XA 5J8XA 2HPBA 4E3OA 3CUEA 2M1CA 4WZ5C 1FCOA 4HP4A 4CLCB 3T4QA 3VE4A 2WUQA 2GX5A 3HLEA 1GCEA 2Y79A 3HUMA 3PBRA 2Q0OA 4ARZA 3OPHA 2A24A 1T1BA 4GJ4A 3IH9A 4G3VA 3TW8A 4YWZA 1PWCA 3CJMA 4CQHA 4WUJA 4MCWA 4ZJ2A 3HL9A 2GJ3A 3N8RA 3UB5P 4LRYC 2W3DA 4WF0A 3HLBA 4DJ2A 3PBSA 3E4OA 4PM6A 2XF3A 1SKOA 5EV0A 3HLDA 4Y2FA 2M7VA 3DTEA 5M18A 1VETA 3N8SA 4BBTA 2JKRM 1TDLA 3ISGA 3LY3A 1C3BA 4PM9A 4ZJ3A 4BLMA 3MMHA 2MJ6A 3QNBA 1PZPA 4S2LA 3ZVWA 4S2PA 1Q2QA 5HD3A 4BENA 4K91A 3ZG0A 3KYEA 3SS5A 2PRFA 4E3NA 3HJKA 3HUOA 3LIDA 3FWLA 4QD4A 5EPHA 1YLYA 1M40A 1FSYA 4LPZA 4EERA 3MBZA 1FILA 3NOUC 3BFEA 3E4PA 1KGEA 3C7VA 5L8MA 4L9FA 2WGWB 1S1ZA 2VLGA 3GDIA 4DE2A 3G6OA 2V0WA 2VJWA 1MWTA 1WYBA 1H3QA 2DRWA 4PAUA 4UQIS 2PYRA 5DF7A 1YKDA 2NUTC 3OCNA 1NYYA 3BYDA 5HL1A 3IF5A 3EOIA 4XT2B 2L1MA 4DE3A 4LRZE 5KZHA 5CGXA 1YPRA 4OKPA 3P98A 1XA1A 5HWWA 3CG5A 2C5WB 1ALQA 4HY8A 1E3UD 1RP5A 2HGVA 3M6BA 1NLZA 3VP0A 4S2MA 4L9GA 5DF9A 1YLJA 3R4KA 2WKIA 3JVUA 2QPNA 4QU3A 2OWHA 3VFFA 2P04A 3DTKA 2GZAA 4IBXA 3GMWA 2XA7S 3ZG8B 2UV0E 3P01A 3CITA 3WWXA 2W3EA 1OTIA 4H8RA 1OPXA 4YNRA 3M6HA 1FIKA 3VOYA 1HTZA 5K5BA 3IWQA 2WKHA 1E25A
chains in the Genus database with same CATH topology
3UB8A 2XROA 1TS7A 2O0YA 4P6ZM 3H7WB 4R38A 2HF6A 2PYPA 3EQVA 3UMEA 4ETZA 3PHYA 2PD8A 1OTEA 3IBRA 4R70A 4KQDA 3T4OA 3EGDC 5J4EA 4EETB 1T18A 3VV4A 5HSQA 2V9AA 3MF0A 3KX0X 3TJZC 3RH8B 2GNXA 2JKRI 4WLAA 5HDSA 5KSHA 3W2ZA 4Q0JA 2XSSA 2ZBBA 4DN0A 3VOLA 1ZTUA 5G4ZA 2Y8HA 4B9OA 2V1BA 4EW7A 1ZHHB 3H82A 2PD7A 3A0RA 2JN7A 1XFNA 4G3KA 4CLCA 1XJ4A 1H8MA 2P7JA 3CWFA 4Z1WA 3KSFA 2V0UA 1S4RA 5HDDA 4P6ZS 4JGPA 4H6JB 3S7OA 4ZRRA 5J7EA 3R7WA 4I3AA 4B93A 5AVFA 3PBNA 1LSXA 1OTBA 3RFBA 2DMWA 3IBJA 2P08A 4NKPA 2KDKA 5C5KA 5DJTA 1WA9A 3KSIA 3PBOA 4HJ6A 4LLOB 4NXBA 4WEJA 2ZMFA 2CMNA 5IT5A 5F69A 2D01A 3UB9A 1G28A 1DRMA 3O5YA 3T50A 1MC0A 2OAQ1 4RQ9A 3LI8A 4II7A 3FC7A 3U2AA 3S7QA 3BY8A 4MN5A 4UEYA 2JKTI 2K7SA 2VV8A 4CLCC 4FOFA 4HQAA 2NUPC 3K2NA 1TS6A 2FH5A 2EWVA 2KOIA 4ETXA 3MFXA 2W3FA 3H9WA 1MZUA 3S7PA 2G7UA 3LIEA 1X0OA 2D02A 3KYQA 2H28A 2L4RA 2ZOIA 1XJ2A 1UWPX 4I39A 4MN7A 1P9RA 1V9YA 1YSPA 3EEAA 5CX7A 2R78A 4WEKA 1S1YA 4HP9A 4LRXC 3V67A 3LI9A 2WKRA 3LUQA 4CLCE 1DP8A 3E0YA 1YAXA 2QJ5A 4AFIA 2YKHA 4I3JA 2J3TC 4Q0IA 4EQ1A 2O99A 4HJ3A 4IHQA 3SW1A 4R3AA 2XA7M 4F3LA 4IJGA 3R7WB 2VA0A 2EA9A 5DKKA 1V9ZA 3RTYA 1P97A 5MC7A 1TD5A 4M4XA 5FL3A 4KQOA 3CLOA 2VGLM 5IS1A 5HWVA 3CI6A 1UGUA 3T4KA 2PR5A 4JGRA 4IUHA 3NOTC 3MR0A 1TS0A 3BW6A 4DMZA 4EU0A 4HJ4A 4JGQA 4MMNA 1XJ3A 5F5YA 1ODVA 3H82B 3TE8A 4JGOA 4EUVA 3IS2B 3S7NA 3B33A 1T1AA 3LR4A 5IU1A 2B02A 1NWZA 4L9EA 2I9VA 3LIAA 3E98A 3KO6A 5AJGA 4HOIA 1Y28A 2KLIA 2WKQA 2HJ9C 4NXFA 3C8CA 3FG8A 4L0LA 4OOMA 5LBRA 4YOFA 5HDCA 2OAP1 4Y3IA 5F68A 5DFYA 1P9WA 2O9CA 5HPIA 4GS9B 3HCYA 4O01A 4WELA 3PYPA 3BQAA 4HH3A 1TS8A 3K3CA 1OTAA 4GHIB 4NEED 3PBTA 3F1NA 4O8GA 3LYXA 1D06A 3EEHA 1DP6A 1LL8A 3C30A 5AVEA 4EESA 3MQQA 4UQIM 3T4JA 3IS2A 1W63M 3OOVA 2QHKA 2VKSA 2EWWA 3EQUA 5I5LA 1MKMA 1N9LA 2W3GA 2VV7A 3BQ8A 1IOUA 4BJPA 1S4SA 2ZOHA 4F3LB 2HJEA 1IFQA 1JNUA 1F9IA 2WKPA 2YKFA 2Z6CA 3A0VA 4OOLA 3T4LA 2W3HA 4WL9A 3ULFA 4EXOA 1VHMA 5TJJA 1LT0A 3NJAA 4I3IA 2W27A 1XJ6A 2BASA 4E04A 1NRJA 2VGLS 4PKYA 2INWA 3KYZA 3MXQA 3P7NA 2KX6A 4BBUA 2O9AA 5G4YA 1KOUA 2QJ7A 3LIBA 1G6OA 1N9OA 2PT7A 4GHIA 5TBMB 3ZQ5A 3F1NB 3H7WA 4HH2A 3MQ0A 1GSWA 4HNBA 2PDRA 4CLCD 1S66L 2W0NA 2V1AA 3F1OA 3GECA 2OWJA 3T4SA 3CUEA 2M1CA 4WN5A 4HP4A 4CLCB 3LIFA 3T4QA 3VE4A 2GX5A 2QKPA 1EW0A 1OJGA 1OTDA 4G3WA 3F1PA 3DBAA 2Y79A 3K3DA 4BMWA 3PBRA 4ARZA 2A24A 4EEPA 3TRCA 1T1BA 4DJ3A 4GJ4A 3BJNA 1TF1A 5HPFA 3UMDA 4G3VA 1D7EA 3B42A 3TW8A 3ICYA 4YWZA 4CQHA 2W1TA 4WUJA 3A0SA 4MCWA 5HL6A 2GJ3A 3UE3A 4LRYC 4XT2A 3EGXC 3CAXA 4MN6A 2W3DA 4WF0A 3LFVA 4DJ2A 3PBSA 4ME4A 3E4OA 1BYWA 1GSVA 2ZMVA 1F5MA 4I38A 4GCZA 4Y2FA 1YSQA 2M7VA 5HWTA 3BWLA 3UE6A 5HZHA 4BBTA 4ARZB 2LB9A 4PHTA 2JKRM 3T4TA 2PHYA 3LR0A 5DKLA 5A8BA 3MMHA 1S67L 2MJ6A 1OJ5A 3JVVA 5F6AA 2O9BA 5HD3A 4HHDA 1T19A 3NHQA 4R6LA 3HJKA 3LIDA 4FSFA 4K08A 4GLQA 3LICA 4KUKA 4MDZA 3UB6A 3MQOA 4LPZA 4EERA 3LR3A 4O0PA 5DFXA 3NOUC 3E4PA 4QPRA 1STZA 3EWKA 5L8MA 1T1CA 4L9FA 1S1ZA 2VLGA 3GDIA 3D72A 3G6OA 2A2LA 2V0WA 2VJWA 3ZYTA 1W63Q 1XFQA 1H3QA 3KSHA 2J80A 4PAUA 4UQIS 2K2NA 2PYRA 1DP9A 1YKDA 2NUTC 3NOPC 3OCNA 4Q0HA 4HIAA 3EOIA 3F1PB 3OCLA 1GSXA 4XT2B 2L1MA 3D3OA 3F1OB 4IUKA 4LRZE 4NXGA 1NLYA 4Y5FA 2LB5A 4KUOA 3C38A 1LSWA 2J3TD 2VEAA 5HWWA 4HY8A 4PKYG 2OOLA 4GS9A 4H6JA 2VX8A 3PBQA 4BWIA 2B18A 2FZ0A 2HGVA 1P0ZA 2IA2A 3FPVA 1VB6A 3CUEC 3LR5A 5DJUA 4BBVA 1NLZA 3VE3A 1LSVA 4I5SA 2Z6DA 2J3WA 3OLOA 1F98A 4L9GA 2QWSA 3R4KA 5DF9A 3JVUA 2VV6A 3BY9A 2QYBA 3B47A 2OWHA 2P04A 2PR6A 2VZWA 3HJIA 3E4QA 4NXEA 4GW9A 2W1RA 4HI4A 1UWNX 2HV1A 3KSGA 1N9NA 2K31A 2GZAA 5KIZA 2L0WA 3PR6A 2JHEA 2XA7S 3OBFA 3MJQA 3P01A 3CITA 2W3EA 1OTIA 5J3WA 1OPXA 3OC2A 3PXPA 4YNRA 2W1TB 2A24B 5TBMA 3C2WA 4EEUA 1OT6A 5K5BA 2JKTM 3FPWA 1OT9A 3UB7A 2M7UA 5HD5A 5EFWA 2XRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KUK A;  3UB8 A;  3UB6 A;  1LT0 A;  2R78 A;  3MQO A;  3NJA A;  1S1Y A;  4I3I A;  2W27 A;  1TS7 A;  4R38 A;  4LPZ A;  3H7W B;  4HP9 A;  4LRX C;  4EER A;  1XJ6 A;  2BAS A;  2PYP A;  4E04 A;  3LI9 A;  2WKR A;  3LUQ A;  4PKY A;  3NOU C;  1DP8 A;  2INW A;  3MXQ A;  2QJ5 A;  3P7N A;  3E4P A;  5HD5 A;  3UME A;  3PHY A;  2YKH A;  2PD8 A;  1OTE A;  2KX6 A;  3IBR A;  4I3J A;  4KQD A;  4R70 A;  5G4Y A;  1KOU A;  2QJ7 A;  4BBU A;  4EQ1 A;  5J4E A;  4EET B;  3LIB A;  1T18 A;  1N9O A;  4GHI A;  3EWK A;  4HJ3 A;  5TBM B;  3ZQ5 A;  5HSQ A;  3F1N B;  3SW1 A;  1T1C A;  4L9F A;  2V9A A;  3H7W A;  4HH2 A;  3KX0 X;  4R3A A;  1S1Z A;  2VLG A;  3GDI A;  1GSW A;  3D72 A;  4HNB A;  2PDR A;  4JGR A;  3G6O A;  1S66 L;  2V0W A;  2W0N A;  4F3L A;  3RH8 B;  1XFQ A;  4WLA A;  2EA9 A;  2V1A A;  1V9Z A;  2OWJ A;  1P97 A;  3F1O A;  3GEC A;  5DKK A;  5HDS A;  3RTY A;  2M1C A;  2J80 A;  4M4X A;  4WN5 A;  2ZBB A;  4HP4 A;  2PYR A;  1DP9 A;  3VOL A;  3LIF A;  3CLO A;  5G4Z A;  3NOP C;  3VE4 A;  5IS1 A;  4B9O A;  5HWV A;  1UGU A;  2QKP A;  1EW0 A;  2V1B A;  4HIA A;  4EW7 A;  1OJG A;  1OTD A;  2PR5 A;  3F1P B;  1GSX A;  3F1P A;  3H82 A;  2PD7 A;  3K3D A;  3A0R A;  3NOT C;  2L1M A;  3F1O B;  2JN7 A;  4XT2 B;  3MR0 A;  4LRZ E;  1TS0 A;  4NXG A;  2A24 A;  1XFN A;  4KUO A;  4EEP A;  1XJ4 A;  2P7J A;  1LSW A;  1T1B A;  2VEA A;  3CWF A;  4DJ3 A;  5HWW A;  2V0U A;  1S4R A;  4HJ4 A;  4JGQ A;  5HDD A;  4HY8 A;  1XJ3 A;  4H6J B;  4JGP A;  2OOL A;  4GS9 A;  4H6J A;  4PKY G;  3UMD A;  5J7E A;  4I3A A;  1ODV A;  3H82 B;  1D7E A;  5F5Y A;  4JGO A;  5AVF A;  3IS2 B;  1LSX A;  3ICY A;  1OTB A;  4YWZ A;  3B33 A;  1P0Z A;  1T1A A;  2KDK A;  4WUJ A;  3A0S A;  5DJT A;  5IU1 A;  1WA9 A;  2B02 A;  1VB6 A;  1NWZ A;  4HJ6 A;  4LLO B;  4L9E A;  4NXB A;  5DJU A;  2I9V A;  2CMN A;  3LIA A;  4BBV A;  3VE3 A;  2GJ3 A;  1LSV A;  4I5S A;  2Z6D A;  4LRY C;  3OLO A;  1F98 A;  1Y28 A;  4HOI A;  4L9G A;  4XT2 A;  2WKQ A;  3CAX A;  2D01 A;  2QWS A;  4MN6 A;  4NXF A;  3C8C A;  5F69 A;  4WF0 A;  3FG8 A;  1G28 A;  2VV6 A;  3UB9 A;  4DJ2 A;  3BY9 A;  1DRM A;  3E4O A;  1BYW A;  1GSV A;  2OWH A;  5HDC A;  3T50 A;  4I38 A;  2PR6 A;  3HJI A;  5F68 A;  3E4Q A;  4NXE A;  4GW9 A;  4RQ9 A;  4HI4 A;  4GCZ A;  4GS9 B;  3LI8 A;  2HV1 A;  1UWN X;  5HWT A;  3BWL A;  1N9N A;  5EFW A;  3UE6 A;  5HZH A;  3FC7 A;  3PYP A;  5KIZ A;  4BBT A;  2L0W A;  3BY8 A;  4HH3 A;  1TS8 A;  3K3C A;  1OTA A;  4GHI B;  4MN5 A;  2JHE A;  3F1N A;  3LYX A;  2K7S A;  1D06 A;  2PHY A;  2VV8 A;  3MJQ A;  3EEH A;  5DKL A;  4EXO A;  4HQA A;  1DP6 A;  1OTI A;  5A8B A;  1S67 L;  1TS6 A;  1LL8 A;  1OJ5 A;  5J3W A;  5AVE A;  4EES A;  3MQQ A;  5F6A A;  3MFX A;  3H9W A;  3IS2 A;  2QHK A;  1MZU A;  2A24 B;  5I5L A;  5TBM A;  3C2W A;  4EEU A;  3LIE A;  1N9L A;  1X0O A;  2VV7 A;  1OT6 A;  5HD3 A;  2D02 A;  1S4S A;  2ZOH A;  4HHD A;  1T19 A;  3NHQ A;  4R6L A;  3HJK A;  4F3L B;  2H28 A;  1OT9 A;  3UB7 A;  1JNU A;  2L4R A;  1F9I A;  1XJ2 A;  2WKP A;  2YKF A;  2Z6C A;  1UWP X;  2ZOI A;  3A0V A;  3LID A;  4I39 A;  3LIC A;  4K08 A;  1V9Y A;  4WL9 A;  3ULF A; 
#chains in the Genus database with same CATH topology
 2ZM0 A;  3UB8 A;  2XRO A;  1GHI A;  2O0Y A;  4P6Z M;  4R38 A;  3H7W B;  4WMC A;  1NXY A;  2JKG A;  3IBR A;  2H10 A;  1ZG6 A;  3ZG7 B;  5A92 A;  2V1Z A;  2V9A A;  5FI6 A;  4NK3 A;  1GHM A;  4QJG A;  3UY6 A;  3BEC A;  4WLA A;  1K57 A;  4BL2 A;  5GLD A;  4N92 A;  2XSS A;  3NY4 A;  1ZTU A;  4KZB A;  5G4Z A;  1MWS A;  4B9O A;  2VK3 A;  2V1B A;  5GLA A;  1L0D A;  4EW7 A;  2PD7 A;  3A0R A;  1K56 A;  1Y54 A;  4NET A;  5HDD A;  4ZRR A;  4D60 A;  1LL9 A;  4Y7P A;  1I2W A;  1OTB A;  2DMW A;  3IBJ A;  4EBL A;  2P08 A;  2KDK A;  4KG6 A;  3KSI A;  5IT5 A;  4BD1 A;  2D01 A;  1IKG A;  4CJN A;  5CTM A;  3HLG A;  3O5Y A;  2ZQ7 A;  3WS4 A;  3U2A A;  5FAT A;  1MPL A;  2K7S A;  1SKO B;  2NUP C;  3K2N A;  2EWV A;  2ZC4 B;  3NDG A;  2W3F A;  3HLC A;  1MZU A;  3O87 A;  3W4P A;  4S2I A;  3MKE A;  3KYQ A;  2H28 A;  1Z09 A;  2L4R A;  1JWV A;  4MN7 A;  5IHV A;  3G4P A;  1KGF A;  2XFS A;  1XGI A;  1S1Y A;  1XPB A;  4LRX C;  2DNS A;  1BT5 A;  1ACF A;  2J3T C;  4HJ3 A;  2ZC3 B;  4IHQ A;  2J9O A;  3G32 A;  2Y2N A;  2ZC7 A;  4IJG A;  3CHW P;  1WYC A;  5DKK A;  3RTY A;  3IXD A;  2ZM8 A;  4KQO A;  2P9V B;  1JTG A;  2PR5 A;  4JGR A;  3NOT C;  2HP6 A;  3MR0 A;  4OP8 A;  5FI7 A;  2ZC6 B;  4DMZ A;  5FQJ A;  3E2L A;  4B4Z A;  4EBP A;  4JGQ A;  4LCL A;  3TE8 A;  1ZKJ A;  1QME A;  5L10 A;  3S7N A;  3LR4 A;  5IU1 A;  1NWZ A;  4EWF A;  2I9V A;  4QHC A;  1Y28 A;  2KLI A;  4NXF A;  1L3L A;  3ZG9 B;  1MKI A;  4GZB A;  5F68 A;  2Y55 A;  3QP8 A;  5DTT A;  5F82 A;  5DFY A;  5HPI A;  4GS9 B;  2Y2K A;  5GLB A;  3Q07 A;  1NY0 A;  4HH3 A;  4GHI B;  1OTA A;  5A93 A;  4NEE D;  4O8G A;  3LYX A;  5FEF A;  2ZL1 B;  3T4J A;  4UQI M;  3IWO A;  4JLF A;  4X56 A;  3OOV A;  5GHY A;  1BLH A;  3BFD A;  1IYP A;  1K56 D;  1K54 C;  3BQ8 A;  4PPR A;  1H8Y A;  1KE0 A;  1MWR A;  3G31 A;  4DXB A;  1IFQ A;  2YKF A;  3N4I A;  3T4L A;  1CI8 A;  1NZO A;  2W3H A;  2Y2Q A;  4WL9 A;  2Y4A A;  5JYP A;  1YMX A;  3UO9 A;  2BAS A;  4PKY A;  2JBF A;  4X68 A;  4IED A;  3T1Q B;  2Y2M A;  3PAE A;  2WGW A;  3VP4 A;  3RXW A;  4Y15 A;  3G35 A;  2HZ5 A;  5AQ9 A;  4WN5 A;  1YQS A;  3PTE A;  2WGI A;  4OQG A;  1OJG A;  1OTD A;  3WS0 A;  3DBA A;  1HD8 A;  2J7V A;  1BLC A;  4RA7 A;  5FAQ A;  2Y2O A;  3TRC A;  4U0X A;  3NUL A;  2J9P A;  3ZCZ A;  3BJN A;  1TF1 A;  5HPF A;  1JWP A;  1JTD A;  3LEQ A;  1D7E A;  3B42 A;  3GSG A;  3ICY A;  2V2F F;  4KG5 A;  2ZQ9 A;  3UE3 A;  4XT2 A;  5FQ9 A;  3CAX A;  4X6T A;  4ME4 A;  2IWD A;  4WM9 A;  1ES2 A;  4I38 A;  3BFC A;  3WS2 A;  3NI9 A;  4GCZ A;  1YSQ A;  3BWL A;  1MXO A;  3N6I A;  3T12 B;  3Q81 A;  2EFU A;  2ZL1 A;  2PHY A;  1I5Q A;  5DKL A;  2I72 A;  1S67 L;  1OJ5 A;  5M1A A;  4JF5 A;  3MZE A;  3IF6 C;  3O86 A;  2FFF B;  1DJB A;  4WZ5 A;  3S1Y A;  1IYS A;  4QY5 A;  4UA9 A;  4R6L A;  5HW3 A;  5CHJ A;  4FSF A;  1K4E A;  3LIC A;  3SH8 A;  3ZGA B;  3BFF A;  4O0P A;  5DFX A;  3ZHH A;  4QPR A;  3UPP A;  2EX2 A;  5FDS A;  1O07 A;  1T1C A;  4KZ7 A;  3SZT A;  4FH4 A;  3WS5 A;  4LV0 A;  1DP9 A;  3SH9 A;  4EBN A;  4HIA A;  2C6W B;  1S0W A;  3D3O A;  4IUK A;  1K57 C;  4Y5F A;  2LB5 A;  5E2H A;  4C6Y A;  1LSW A;  2VEA A;  5CHM A;  5EOE A;  4GS9 A;  3FKV A;  2FZ0 A;  1P0Z A;  3AGF A;  1PFL A;  1ES3 A;  1VB6 A;  3CUE C;  3QP6 A;  1HLU P;  5DJU A;  3L7H A;  3DW0 A;  2Z6D A;  2QWS A;  4MLL A;  2VV6 A;  3BY9 A;  3Q7Z A;  3B47 A;  1XP4 A;  2WAF A;  2VZW A;  3LCE A;  3E4Q A;  1NJ4 A;  4NXE A;  2W1R A;  2HV1 A;  5EVE A;  2K31 A;  3ITA A;  2L0W A;  2IWB A;  3O3V A;  4D2O A;  3BLM A;  4UA6 A;  3TG9 A;  2H0T A;  4Q8I A;  3PXP A;  2P74 A;  3FZC A;  2CC1 A;  3SH7 A;  1VM1 A;  1OT9 A;  1XX2 A;  3C5A A;  5A90 A;  4RVA A;  2XK1 A;  4LGW A;  3GVB A;  1BUE A;  2PYP A;  3S22 A;  3UME A;  3PHY A;  3MS6 A;  2PD8 A;  1OTE A;  4EQI A;  1T18 A;  3VV4 A;  1YT4 A;  4X55 A;  3MF0 A;  2ACG A;  3TJZ C;  1K55 A;  4N9K A;  2JKR I;  2ZLY A;  1IKI A;  2ZBB A;  2XD5 A;  5FAP A;  3VOL A;  4XUX A;  3AGE A;  1ZHH B;  3H82 A;  3UPN A;  5E43 A;  4E3K A;  2JN7 A;  4JBF A;  4KZ4 A;  4CLC A;  1XJ4 A;  4Z1W A;  3LEZ A;  3U4L P;  2V0U A;  3S7O A;  5E2E A;  4H6J B;  3NEC A;  1VQQ A;  4R4R A;  3C4P A;  1LSX A;  3RFB A;  4ZTK A;  5EM0 A;  5FAS A;  2HDU A;  3BM6 A;  1WA9 A;  1FQG A;  4HJ6 A;  4DE0 A;  1ES4 A;  2CMN A;  1K55 C;  1DJC A;  1VEU B;  1W8Q A;  5FQM A;  3NC8 A;  4LV1 A;  1DRM A;  4X1L A;  2J8Y A;  1YMS A;  1A0K A;  4E6X A;  3UPO A;  5D3O A;  2OAQ 1;  3JYI A;  4JXV A;  4KZ8 A;  4P87 A;  3FC7 A;  2XQZ A;  3BY8 A;  2KOI A;  4ETX A;  4E3L A;  3H9W A;  3M2J A;  1FOF A;  1LL5 A;  3JPU A;  1XJ2 A;  4IBR A;  3CPT B;  2WAD A;  1MBL A;  3GTC A;  3Q7V B;  2R78 A;  2EXA A;  4OVD A;  1DP8 A;  4OPY A;  5FQQ A;  3SS4 A;  2QJ5 A;  3QP4 A;  1FSW A;  4I3J A;  3GQZ A;  5CTN A;  4U3T A;  1K4F A;  4F3L A;  1SHV A;  4NG2 A;  2VA0 A;  1V9Z A;  4WYY A;  5MC7 A;  5FL3 A;  1D1J A;  4JKT A;  3VP2 A;  4A5R A;  1CI9 A;  4B4X A;  1K38 A;  2VGL M;  4Y0O A;  2ZJ9 A;  3T4K A;  1UGU A;  3CMZ A;  3IWI A;  5JYO A;  5EOO A;  5F5Y A;  4EUV A;  2FFY A;  1FR6 A;  1T1A A;  4CPK A;  2ZQA A;  3OPL A;  1KE3 A;  1CK3 A;  1JWZ A;  5AJG A;  1VEU A;  3IQA A;  3T1S A;  4MEZ A;  5LBR A;  5HDC A;  5CEB A;  3D9Y A;  2B95 A;  5EVI B;  2OAP 1;  1P9W A;  3IX3 A;  1YLP A;  3AGD A;  4R4S A;  3PYP A;  2XEP A;  4FCF A;  2HDS A;  3WS1 A;  1I2S A;  3T1R A;  1F2K A;  1CJF A;  2E8J A;  3C30 A;  1BSG A;  1BLS A;  4LV2 A;  1MY8 A;  2EWW A;  1MKM A;  4U0T A;  4S2K A;  2VV7 A;  1KVM A;  1S4S A;  5DF8 A;  4F3L B;  1JNU A;  4OOL A;  1H0M A;  1VHM A;  4DKI A;  3W4Q A;  1E4D A;  3NJA A;  4I3I A;  1J9M A;  1XJ6 A;  4E04 A;  2INW A;  3MXR A;  4RX3 A;  4DDY A;  1PI5 A;  4N1X A;  3LIB A;  3MQ0 A;  2OLV A;  2BLS A;  4HES A;  2PDR A;  1YLZ A;  2W0N A;  1OME A;  3GEC A;  3P09 A;  2OWJ A;  3T4S A;  4OQH A;  1RGY A;  5L2F A;  4Z9Q A;  3LIF A;  5FDH A;  1EW0 A;  3VMA A;  4G3W A;  4OLD A;  4BMW A;  5FQI A;  2BTF P;  3Q82 A;  3IXH A;  4DJ3 A;  2H0Y A;  4JXG A;  5L09 A;  4Y13 A;  5BOH A;  4GDN A;  1ZC2 A;  2W1T A;  3A0S A;  4S2N C;  5HL6 A;  3M2K A;  5GLC A;  4Y0U A;  2XFT A;  2AVX A;  5HAQ A;  2R9X A;  1GSV A;  1LI0 A;  2ZMV A;  1F5M A;  1SDN A;  1CF0 A;  5FEG A;  3IX4 A;  2WGV A;  1SKF A;  5HZH A;  5EE8 A;  4ARZ B;  2JE5 A;  3LR0 A;  3VSL A;  5A8B A;  3RXX A;  1KDS A;  3IT9 A;  5F6A A;  2RCX A;  1IEL A;  4WZ4 A;  4OQI A;  1HZO A;  2O9B A;  1NRF A;  5AQB A;  3DTI A;  2JC7 A;  4K08 A;  4DE1 A;  4B88 A;  4YFM A;  4MDZ A;  3UB6 A;  3MQO A;  3W8K A;  3V50 A;  3LR3 A;  4WMC D;  4M3K A;  3B3X A;  4KG2 A;  1STZ A;  5E2F A;  4OPZ A;  3EWK A;  1EI5 A;  2V8F A;  4Y17 A;  3GV9 A;  1XFQ A;  1BTL A;  4GN2 A;  4P6B A;  2J80 A;  4OH0 A;  5F1F A;  1K54 A;  2ZD8 A;  4OPQ A;  1ESI A;  1GSX A;  1PZO A;  3F1O B;  1CEG A;  2EX6 A;  1J3W A;  1NLY A;  1H8Z A;  4BQM A;  1ONH A;  4KZA A;  3C38 A;  1GA0 A;  2J3T D;  3O88 A;  2OOL A;  4H6J A;  2B18 A;  3ZNY A;  3FPV A;  2EXB A;  3LR5 A;  5EVI A;  4BBV A;  2XD1 A;  2OV5 A;  3D4F A;  1LSV A;  2J3W A;  1ES5 A;  4P85 A;  4Y0T A;  2QYB A;  3IX8 A;  1DJA A;  1BLP A;  2PR6 A;  3LY4 A;  4C3Q A;  4X53 A;  4S2O A;  4GW9 A;  5EUA A;  4HI4 A;  1Z6F A;  2WZZ A;  3PR6 A;  5EM1 A;  4QB8 A;  2JHE A;  4LCM A;  4GD6 A;  3OBF A;  3MJQ A;  2VGJ A;  1MWU A;  3OC2 A;  4K0X A;  3VOZ A;  2W1T B;  2A24 B;  3C2W A;  4EEU A;  1K0K A;  1NZU A;  3ZFZ A;  3VP1 A;  3MXS A;  3NDE A;  3IHB A;  2Y2G A;  5HD5 A;  1S6R A;  4XXR A;  3Q7V A;  2V8C A;  2RL3 A;  3G34 A;  5EVI C;  3EQV A;  4PM5 A;  4ETZ A;  1SZV A;  4KQD A;  3T4O A;  3EGD C;  5J4E A;  2ZQC A;  5M19 A;  1ERO A;  2DCF A;  3RH8 B;  2GNX A;  5HDS A;  5KSH A;  3CPT A;  3HLF A;  1XXM A;  3W2Z A;  4Q0J A;  1PWG A;  4X25 A;  4DN0 A;  4R3B A;  2Y2I A;  4K0W A;  2Y8H A;  4PM7 A;  1Y4O A;  5DTK A;  4JXW A;  1AWI A;  3HBR A;  4G3K A;  2P7J A;  3CWF A;  3QNC A;  1S4R A;  2X71 A;  4P6Z S;  4JGP A;  3E2K A;  3R7W A;  4I3A A;  5HAI A;  4B93 A;  3IF6 A;  4XUZ A;  2G2U A;  1ONG A;  4NKP A;  3UNW A;  4LLO B;  4NXB A;  4WEJ A;  5HAR A;  5F69 A;  4MBF A;  3UB9 A;  5F83 A;  1KDW A;  4UAA A;  3T50 A;  2GDN A;  1EWZ A;  1PRQ A;  2HP9 A;  4II7 A;  3S7Q A;  3ZVT A;  3RJU A;  1TDG A;  4UEY A;  1CEF A;  5FSR A;  4CLC C;  4FOF A;  2FH5 A;  3MFX A;  3S7P A;  5I94 A;  3LIE A;  4F94 A;  3QP1 A;  2PAV P;  2D02 A;  3T1X A;  4ZDX A;  2ZOI A;  1UWP X;  1FR1 A;  4I39 A;  2VGK A;  1Q2P A;  3UE1 A;  1YSP A;  3EEA A;  5CX7 A;  4N9L A;  4HP9 A;  5U47 A;  3V67 A;  1K6S A;  4MBH A;  3LI9 A;  4E3J A;  4QY6 A;  1W8Y A;  3A3F A;  4Q0I A;  2JCH A;  2O99 A;  4EQ1 A;  2Y2P A;  3SW1 A;  2E8I A;  4R3A A;  2Y2J A;  3MZD A;  3V5M A;  3QP5 A;  3GR2 A;  5AQA A;  3HUN A;  5EVL A;  1PYY A;  3VP3 A;  1XA7 A;  1TS0 A;  5TR7 A;  2BG1 A;  3OZH A;  4EU0 A;  4MMN A;  3FV7 A;  4S2N A;  4GNU A;  3H82 B;  4JGO A;  3DWK A;  4OP5 A;  3NCK A;  2R9W A;  1KVL A;  3DAV A;  3GRJ A;  4PM8 A;  3E98 A;  3IXB A;  1W79 A;  4IVI A;  2WKQ A;  2HJ9 C;  4P0M A;  1VET B;  4DDS A;  4EUZ A;  3UDX A;  4L0L A;  1RCJ A;  4OOM A;  4E6W A;  5FI2 A;  4YOF A;  1N4O A;  4DF6 A;  4Y3I A;  3SS3 A;  3HCY A;  4O01 A;  5CHU A;  3Q1F A;  1RGZ A;  3BQA A;  3K3C A;  4RYE A;  2Q9M A;  3A3I A;  1D06 A;  1PW1 A;  1DP6 A;  1PWD A;  4JPM A;  4C75 A;  4OQ0 A;  5AVE A;  5CXW A;  1W63 M;  5I5L A;  2W3G A;  1IOU A;  2ZOH A;  5G18 A;  5CRF A;  2WKP A;  3A0V A;  3ULF A;  5TJJ A;  1YLW A;  2WYX A;  3QHY A;  1NRJ A;  3BFG A;  2VGL S;  4OOY A;  3P7N A;  3MZF A;  2KX6 A;  4JXS A;  5CEC A;  2O9A A;  5G4Y A;  1KOU A;  4GHI A;  1G6O A;  2PT7 A;  4GB7 A;  3ZQ5 A;  4IVK A;  3MSH A;  4MBK A;  3H7W A;  4HH2 A;  4LFU A;  4CLC D;  2V1A A;  3F1O A;  5L07 A;  1G5U A;  1BUL A;  5HX9 A;  4HBT A;  2QKP A;  1L0F A;  3F1P A;  3K3D A;  4LV3 A;  3W4O A;  4EEP A;  4KEN B;  5KSC A;  3L9K A;  1FCM A;  4ZBE A;  3ITB A;  3UMD A;  2XDM A;  1GHP A;  4OON A;  2HDQ A;  3EGX C;  4MN6 A;  3HVF A;  3LFV A;  4ID4 A;  1BYW A;  4R3J A;  3LGO A;  3ZDJ A;  3G30 A;  2PBD P;  1XGJ A;  4PMA A;  2Q9N A;  5CGS A;  5HWT A;  3UE6 A;  4OLG A;  2LB9 A;  4PHT A;  3T4T A;  1PNE A;  2XGN A;  1IEM A;  3JVV A;  1PIO A;  2X02 A;  2V20 A;  2WKE A;  2QMI A;  1M6K A;  2Y59 A;  3IHA A;  4HHD A;  1T19 A;  3NHQ A;  4JF6 A;  3IF6 B;  4HBU A;  5HAP A;  4GLQ A;  4KZ3 A;  3BEB A;  4KUK A;  1G68 A;  2ZM2 A;  1L2S A;  2ZC5 B;  3HLW A;  4JF4 A;  3V3S A;  3D72 A;  1FCN A;  2A2L A;  3ZYT A;  1W63 Q;  1IYO A;  3TSG A;  3KSH A;  4HEF A;  3ZNT A;  2K2N A;  3NOP C;  1TEM A;  4KQR A;  4Q0H A;  3F1P B;  3OCL A;  2XH9 A;  4EV4 A;  3PAG A;  1YLT A;  4NXG A;  4KUO A;  3C7U A;  4LEN A;  3SOI A;  1K25 A;  1ERM A;  1PW8 A;  1JVJ A;  3NBL A;  3DTM A;  1YM1 A;  4PKY G;  5TFQ A;  3V39 A;  2VX8 A;  3PBQ A;  3CZD A;  4X1M A;  4BWI A;  4BD0 A;  2IA2 A;  1KGG A;  1K6R A;  3G2Z A;  1DY6 A;  5EVI D;  3VE3 A;  4I5S A;  3OLO A;  1F98 A;  4BL3 A;  2OSU A;  2A3U A;  1LI9 A;  3MFD A;  1SDE A;  4KZ5 A;  3HJI A;  1UWN X;  3KSG A;  1N9N A;  5GL9 A;  1WE4 A;  5DTS A;  5KIZ A;  3TOI A;  3NIA A;  1SCW A;  3FYZ A;  5J3W A;  4S2J A;  5TBM A;  4DXC A;  2WAE A;  4FTX A;  2PU2 A;  2P9V A;  1OT6 A;  1KE4 A;  1GA9 A;  2JKT M;  3FPW A;  3UB7 A;  5TGF A;  2M7U A;  2UWX A;  5EFW A;  2XRN A;  2HDR A;  1AXB A;  3IXG A;  3UDI A;  1CQA A;  1TS7 A;  2HF6 A;  4RX2 A;  4R70 A;  2G2W A;  4EET B;  5HSQ A;  3KX0 X;  3N7W A;  2Y91 A;  3QP2 A;  2Z2M B;  4ZAM A;  1LHY A;  1W7F A;  4GOG A;  4OPR A;  4R23 A;  1TVF A;  4QWO A;  4ZJ1 A;  1XFN A;  1H8M A;  3WRZ A;  3OPR A;  3KSF A;  5J7E A;  4YIN A;  5AVF A;  3PBN A;  3MKF A;  5C5K A;  5DJT A;  3PBO A;  3A3J A;  2ZMF A;  4E3I A;  4FD8 A;  3UE0 A;  4R1G A;  1G28 A;  1ERQ A;  5E2G A;  1MC0 A;  2Y2L A;  2EFX A;  4RQ9 A;  3LI8 A;  2IWC A;  4MN5 A;  2JKT I;  1L0E A;  2ZQ8 A;  2ZQD A;  2VV8 A;  3S4X A;  4HQA A;  2B5R A;  2QZ6 A;  4N1H A;  5DVA A;  1TS6 A;  2HP5 A;  5A91 A;  2Y2H A;  1XKZ A;  3BRM A;  2G7U A;  1X0O A;  3C4O A;  4GDB A;  3UDF A;  1NYM A;  4X69 A;  2WZX A;  4GD8 A;  4UA7 A;  1P9R A;  1V9Y A;  4O7D A;  3G2Y A;  1QMF A;  5F1G A;  4WEK A;  1ESU A;  2WKR A;  3LUQ A;  4CLC E;  5EEC A;  3E0Y A;  1YAX A;  2XR0 A;  4AFI A;  4KQQ A;  2YKH A;  3A3E A;  1O7E A;  2PU4 A;  2ZMA A;  5GHX A;  5FA7 A;  2XA7 M;  3R7W B;  3A3D A;  2EA9 A;  1P97 A;  1ZG4 A;  1TD5 A;  5CGW A;  4KZ9 A;  4M4X A;  3BLS A;  2JKF A;  1G6A A;  3DWZ A;  3CLO A;  5IS1 A;  5HWV A;  3CI6 A;  4IUH A;  3ZG5 A;  3BW6 A;  4ESP A;  5HFO A;  4MNR A;  4HJ4 A;  1XJ3 A;  2WK0 A;  1ODV A;  3IS2 B;  2EX8 A;  4UHU A;  3B33 A;  5CED A;  2B02 A;  4FH2 A;  4L9E A;  3OPP A;  3LIA A;  3KO6 A;  4HOI A;  3VSK A;  3C8C A;  4GKU A;  1L0G A;  3FG8 A;  3V3R A;  4FUW A;  3LO7 A;  2O9C A;  3WRT A;  3N8L A;  4WBG A;  5AQ7 A;  4WEL A;  1TS8 A;  3IH8 A;  1U60 A;  3PBT A;  1PI4 A;  3F1N A;  1LLB A;  2EX9 A;  2H5S A;  3EEH A;  1LL8 A;  1BZA A;  5FAO A;  1IYQ A;  4EES A;  3MQQ A;  3FKW A;  3IS2 A;  3HRE A;  2QHK A;  2VKS A;  5GHZ A;  3EQU A;  5CER A;  2Z2L B;  1N9L A;  1E3U A;  3UN7 A;  4KZ6 A;  2A49 A;  4BJP A;  2HJE A;  1F9I A;  3I7J A;  4DRT A;  2Z6C A;  4EXO A;  1LT0 A;  4E3M A;  2PBY A;  2W27 A;  1W5D A;  4R0Q A;  1HVB A;  3VFH A;  1N9B A;  5KMW A;  3KYZ A;  3MXQ A;  5FQK A;  2X01 A;  4BBU A;  2QJ7 A;  2OLU A;  2XLN A;  5TBM B;  1N9O A;  3F1N B;  1GSW A;  4HNB A;  1S66 L;  1H5X A;  5J8X A;  2HPB A;  4E3O A;  3CUE A;  2M1C A;  4WZ5 C;  1FCO A;  4HP4 A;  4CLC B;  3T4Q A;  3VE4 A;  2WUQ A;  2GX5 A;  3HLE A;  1GCE A;  2Y79 A;  3HUM A;  3PBR A;  2Q0O A;  4ARZ A;  3OPH A;  2A24 A;  1T1B A;  4GJ4 A;  3IH9 A;  4G3V A;  3TW8 A;  4YWZ A;  1PWC A;  3CJM A;  4CQH A;  4WUJ A;  4MCW A;  4ZJ2 A;  3HL9 A;  2GJ3 A;  3N8R A;  3UB5 P;  4LRY C;  2W3D A;  4WF0 A;  3HLB A;  4DJ2 A;  3PBS A;  3E4O A;  4PM6 A;  2XF3 A;  1SKO A;  5EV0 A;  3HLD A;  4Y2F A;  2M7V A;  3DTE A;  5M18 A;  1VET A;  3N8S A;  4BBT A;  2JKR M;  1TDL A;  3ISG A;  3LY3 A;  1C3B A;  4PM9 A;  4ZJ3 A;  4BLM A;  3MMH A;  2MJ6 A;  3QNB A;  1PZP A;  4S2L A;  3ZVW A;  4S2P A;  1Q2Q A;  5HD3 A;  4BEN A;  4K91 A;  3ZG0 A;  3KYE A;  3SS5 A;  2PRF A;  4E3N A;  3HJK A;  3HUO A;  3LID A;  3FWL A;  4QD4 A;  5EPH A;  1YLY A;  1M40 A;  1FSY A;  4LPZ A;  4EER A;  3MBZ A;  1FIL A;  3NOU C;  3BFE A;  3E4P A;  1KGE A;  3C7V A;  5L8M A;  4L9F A;  2WGW B;  1S1Z A;  2VLG A;  3GDI A;  4DE2 A;  3G6O A;  2V0W A;  2VJW A;  1MWT A;  1WYB A;  1H3Q A;  2DRW A;  4PAU A;  4UQI S;  2PYR A;  5DF7 A;  1YKD A;  2NUT C;  3OCN A;  1NYY A;  3BYD A;  5HL1 A;  3IF5 A;  3EOI A;  4XT2 B;  2L1M A;  4DE3 A;  4LRZ E;  5KZH A;  5CGX A;  1YPR A;  4OKP A;  3P98 A;  1XA1 A;  5HWW A;  3CG5 A;  2C5W B;  1ALQ A;  4HY8 A;  1E3U D;  1RP5 A;  2HGV A;  3M6B A;  1NLZ A;  3VP0 A;  4S2M A;  4L9G A;  5DF9 A;  1YLJ A;  3R4K A;  2WKI A;  3JVU A;  2QPN A;  4QU3 A;  2OWH A;  3VFF A;  2P04 A;  3DTK A;  2GZA A;  4IBX A;  3GMW A;  2XA7 S;  3ZG8 B;  2UV0 E;  3P01 A;  3CIT A;  3WWX A;  2W3E A;  1OTI A;  4H8R A;  1OPX A;  4YNR A;  3M6H A;  1FIK A;  3VOY A;  1HTZ A;  5K5B A;  3IWQ A;  2WKH A;  1E25 A; 
#chains in the Genus database with same CATH homology
 3UB8 A;  2XRO A;  1TS7 A;  2O0Y A;  4P6Z M;  3H7W B;  4R38 A;  2HF6 A;  2PYP A;  3EQV A;  3UME A;  4ETZ A;  3PHY A;  2PD8 A;  1OTE A;  3IBR A;  4R70 A;  4KQD A;  3T4O A;  3EGD C;  5J4E A;  4EET B;  1T18 A;  3VV4 A;  5HSQ A;  2V9A A;  3MF0 A;  3KX0 X;  3TJZ C;  3RH8 B;  2GNX A;  2JKR I;  4WLA A;  5HDS A;  5KSH A;  3W2Z A;  4Q0J A;  2XSS A;  2ZBB A;  4DN0 A;  3VOL A;  1ZTU A;  5G4Z A;  2Y8H A;  4B9O A;  2V1B A;  4EW7 A;  1ZHH B;  3H82 A;  2PD7 A;  3A0R A;  2JN7 A;  1XFN A;  4G3K A;  4CLC A;  1XJ4 A;  1H8M A;  2P7J A;  3CWF A;  4Z1W A;  3KSF A;  2V0U A;  1S4R A;  5HDD A;  4P6Z S;  4JGP A;  4H6J B;  3S7O A;  4ZRR A;  5J7E A;  3R7W A;  4I3A A;  4B93 A;  5AVF A;  3PBN A;  1LSX A;  1OTB A;  3RFB A;  2DMW A;  3IBJ A;  2P08 A;  4NKP A;  2KDK A;  5C5K A;  5DJT A;  1WA9 A;  3KSI A;  3PBO A;  4HJ6 A;  4LLO B;  4NXB A;  4WEJ A;  2ZMF A;  2CMN A;  5IT5 A;  5F69 A;  2D01 A;  3UB9 A;  1G28 A;  1DRM A;  3O5Y A;  3T50 A;  1MC0 A;  2OAQ 1;  4RQ9 A;  3LI8 A;  4II7 A;  3FC7 A;  3U2A A;  3S7Q A;  3BY8 A;  4MN5 A;  4UEY A;  2JKT I;  2K7S A;  2VV8 A;  4CLC C;  4FOF A;  4HQA A;  2NUP C;  3K2N A;  1TS6 A;  2FH5 A;  2EWV A;  2KOI A;  4ETX A;  3MFX A;  2W3F A;  3H9W A;  1MZU A;  3S7P A;  2G7U A;  3LIE A;  1X0O A;  2D02 A;  3KYQ A;  2H28 A;  2L4R A;  2ZOI A;  1XJ2 A;  1UWP X;  4I39 A;  4MN7 A;  1P9R A;  1V9Y A;  1YSP A;  3EEA A;  5CX7 A;  2R78 A;  4WEK A;  1S1Y A;  4HP9 A;  4LRX C;  3V67 A;  3LI9 A;  2WKR A;  3LUQ A;  4CLC E;  1DP8 A;  3E0Y A;  1YAX A;  2QJ5 A;  4AFI A;  2YKH A;  4I3J A;  2J3T C;  4Q0I A;  4EQ1 A;  2O99 A;  4HJ3 A;  4IHQ A;  3SW1 A;  4R3A A;  2XA7 M;  4F3L A;  4IJG A;  3R7W B;  2VA0 A;  2EA9 A;  5DKK A;  1V9Z A;  3RTY A;  1P97 A;  5MC7 A;  1TD5 A;  4M4X A;  5FL3 A;  4KQO A;  3CLO A;  2VGL M;  5IS1 A;  5HWV A;  3CI6 A;  1UGU A;  3T4K A;  2PR5 A;  4JGR A;  4IUH A;  3NOT C;  3MR0 A;  1TS0 A;  3BW6 A;  4DMZ A;  4EU0 A;  4HJ4 A;  4JGQ A;  4MMN A;  1XJ3 A;  5F5Y A;  1ODV A;  3H82 B;  3TE8 A;  4JGO A;  4EUV A;  3IS2 B;  3S7N A;  3B33 A;  1T1A A;  3LR4 A;  5IU1 A;  2B02 A;  1NWZ A;  4L9E A;  2I9V A;  3LIA A;  3E98 A;  3KO6 A;  5AJG A;  4HOI A;  1Y28 A;  2KLI A;  2WKQ A;  2HJ9 C;  4NXF A;  3C8C A;  3FG8 A;  4L0L A;  4OOM A;  5LBR A;  4YOF A;  5HDC A;  2OAP 1;  4Y3I A;  5F68 A;  5DFY A;  1P9W A;  2O9C A;  5HPI A;  4GS9 B;  3HCY A;  4O01 A;  4WEL A;  3PYP A;  3BQA A;  4HH3 A;  1TS8 A;  3K3C A;  1OTA A;  4GHI B;  4NEE D;  3PBT A;  3F1N A;  4O8G A;  3LYX A;  1D06 A;  3EEH A;  1DP6 A;  1LL8 A;  3C30 A;  5AVE A;  4EES A;  3MQQ A;  4UQI M;  3T4J A;  3IS2 A;  1W63 M;  3OOV A;  2QHK A;  2VKS A;  2EWW A;  3EQU A;  5I5L A;  1MKM A;  1N9L A;  2W3G A;  2VV7 A;  3BQ8 A;  1IOU A;  4BJP A;  1S4S A;  2ZOH A;  4F3L B;  2HJE A;  1IFQ A;  1JNU A;  1F9I A;  2WKP A;  2YKF A;  2Z6C A;  3A0V A;  4OOL A;  3T4L A;  2W3H A;  4WL9 A;  3ULF A;  4EXO A;  1VHM A;  5TJJ A;  1LT0 A;  3NJA A;  4I3I A;  2W27 A;  1XJ6 A;  2BAS A;  4E04 A;  1NRJ A;  2VGL S;  4PKY A;  2INW A;  3KYZ A;  3MXQ A;  3P7N A;  2KX6 A;  4BBU A;  2O9A A;  5G4Y A;  1KOU A;  2QJ7 A;  3LIB A;  1G6O A;  1N9O A;  2PT7 A;  4GHI A;  5TBM B;  3ZQ5 A;  3F1N B;  3H7W A;  4HH2 A;  3MQ0 A;  1GSW A;  4HNB A;  2PDR A;  4CLC D;  1S66 L;  2W0N A;  2V1A A;  3F1O A;  3GEC A;  2OWJ A;  3T4S A;  3CUE A;  2M1C A;  4WN5 A;  4HP4 A;  4CLC B;  3LIF A;  3T4Q A;  3VE4 A;  2GX5 A;  2QKP A;  1EW0 A;  1OJG A;  1OTD A;  4G3W A;  3F1P A;  3DBA A;  2Y79 A;  3K3D A;  4BMW A;  3PBR A;  4ARZ A;  2A24 A;  4EEP A;  3TRC A;  1T1B A;  4DJ3 A;  4GJ4 A;  3BJN A;  1TF1 A;  5HPF A;  3UMD A;  4G3V A;  1D7E A;  3B42 A;  3TW8 A;  3ICY A;  4YWZ A;  4CQH A;  2W1T A;  4WUJ A;  3A0S A;  4MCW A;  5HL6 A;  2GJ3 A;  3UE3 A;  4LRY C;  4XT2 A;  3EGX C;  3CAX A;  4MN6 A;  2W3D A;  4WF0 A;  3LFV A;  4DJ2 A;  3PBS A;  4ME4 A;  3E4O A;  1BYW A;  1GSV A;  2ZMV A;  1F5M A;  4I38 A;  4GCZ A;  4Y2F A;  1YSQ A;  2M7V A;  5HWT A;  3BWL A;  3UE6 A;  5HZH A;  4BBT A;  4ARZ B;  2LB9 A;  4PHT A;  2JKR M;  3T4T A;  2PHY A;  3LR0 A;  5DKL A;  5A8B A;  3MMH A;  1S67 L;  2MJ6 A;  1OJ5 A;  3JVV A;  5F6A A;  2O9B A;  5HD3 A;  4HHD A;  1T19 A;  3NHQ A;  4R6L A;  3HJK A;  3LID A;  4FSF A;  4K08 A;  4GLQ A;  3LIC A;  4KUK A;  4MDZ A;  3UB6 A;  3MQO A;  4LPZ A;  4EER A;  3LR3 A;  4O0P A;  5DFX A;  3NOU C;  3E4P A;  4QPR A;  1STZ A;  3EWK A;  5L8M A;  1T1C A;  4L9F A;  1S1Z A;  2VLG A;  3GDI A;  3D72 A;  3G6O A;  2A2L A;  2V0W A;  2VJW A;  3ZYT A;  1W63 Q;  1XFQ A;  1H3Q A;  3KSH A;  2J80 A;  4PAU A;  4UQI S;  2K2N A;  2PYR A;  1DP9 A;  1YKD A;  2NUT C;  3NOP C;  3OCN A;  4Q0H A;  4HIA A;  3EOI A;  3F1P B;  3OCL A;  1GSX A;  4XT2 B;  2L1M A;  3D3O A;  3F1O B;  4IUK A;  4LRZ E;  4NXG A;  1NLY A;  4Y5F A;  2LB5 A;  4KUO A;  3C38 A;  1LSW A;  2J3T D;  2VEA A;  5HWW A;  4HY8 A;  4PKY G;  2OOL A;  4GS9 A;  4H6J A;  2VX8 A;  3PBQ A;  4BWI A;  2B18 A;  2FZ0 A;  2HGV A;  1P0Z A;  2IA2 A;  3FPV A;  1VB6 A;  3CUE C;  3LR5 A;  5DJU A;  4BBV A;  1NLZ A;  3VE3 A;  1LSV A;  4I5S A;  2Z6D A;  2J3W A;  3OLO A;  1F98 A;  4L9G A;  2QWS A;  3R4K A;  5DF9 A;  3JVU A;  2VV6 A;  3BY9 A;  2QYB A;  3B47 A;  2OWH A;  2P04 A;  2PR6 A;  2VZW A;  3HJI A;  3E4Q A;  4NXE A;  4GW9 A;  2W1R A;  4HI4 A;  1UWN X;  2HV1 A;  3KSG A;  1N9N A;  2K31 A;  2GZA A;  5KIZ A;  2L0W A;  3PR6 A;  2JHE A;  2XA7 S;  3OBF A;  3MJQ A;  3P01 A;  3CIT A;  2W3E A;  1OTI A;  5J3W A;  1OPX A;  3OC2 A;  3PXP A;  4YNR A;  2W1T B;  2A24 B;  5TBM A;  3C2W A;  4EEU A;  1OT6 A;  5K5B A;  2JKT M;  3FPW A;  1OT9 A;  3UB7 A;  2M7U A;  5HD5 A;  5EFW A;  2XRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...