3HJIA

1.8 angstrom crystal structure of the i74v:i85v variant of vivid (vvd).
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
149
structure length
149
Chain Sequence
MHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALVLCDLKQKDTPVVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism-based tuning of a LOV domain photoreceptor.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Signaling protein
molecule keywords Vivid PAS protein VVD
total genus 36
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3hjiA00
3NJAA 3PHYA 3LUQA 1Y28A 1OJ5A 2PR5A 1OTAA 2WKRA 3MQOA 4MN5A 4JGRA 3KX0X 3UMEA 3VE3A 4EEUA 4EQ1A 2WKPA 4HJ3A 5DKLA 3B33A 4PKYG 3HJIA 4E04A 1UGUA 2Z6CA 2GJ3A 3GECA 4HH2A 1DP9A 2CMNA 5HD3A 5F5YA 1S4RA 3OLOA 3UB7A 3ZQ5A 3BY8A 1EW0A 4NXFA 2D02A 5DJUA 4HH3A 1XJ3A 2PYRA 4KUKA 5HDDA 3SW1A 1D7EA 5F69A 5F6AA 4HY8A 4NXEA 1DRMA 4HHDA 3ICYA 3H7WA 2D01A 3K3CA 4R3AA 4RQ9A 5F68A 3RTYA 2VEAA 3E4QA 5I5LA 3H82A 4LPZA 5G4YA 5J3WA 3F1PA 3CLOA 3IS2B 4GS9A 4I39A 3VE4A 4F3LA 2V9AA 2JHEA 1XJ4A 2PHYA 4HOIA 2VV8A 2YKHA 2QJ5A 2YKFA 3LIEA 4EERA 3E4PA 4H6JA 3BY9A 1BYWA 1F9IA 2HV1A 2W27A 4K08A 4EW7A 3UB8A 5KIZA 1OTEA 4DJ2A 3MQQA 1LSVA 2EA9A 1V9YA 2QKPA 3FC7A 3RH8B 3PYPA 3CWFA 2K7SA 1G28A 1MZUA 4H6JB 5HDSA 1S67L 3LIAA 4EXOA 2I9VA 1TS7A 3LI9A 4PKYA 4GCZA 4HI4A 3NOTC 1XFNA 5IS1A 3EWKA 3IS2A 4F3LB 3LIFA 3F1NB 3F1PB 1P0ZA 3MR0A 3P7NA 3H82B 4HNBA 4DJ3A 5HZHA 2WKQA 3UE6A 4EEPA 4YWZA 2W0NA 4LRYC 5HWWA 1WA9A 3E4OA 1KOUA 1JNUA 1GSVA 1S1YA 2ZBBA 1S1ZA 3CAXA 2P7JA 3ULFA 2OWHA 3VOLA 1X0OA 2H28A 3MXQA 1S4SA 5HSQA 5HWTA 3T50A 3UB9A 3A0SA 3HJKA 4HIAA 1P97A 3EEHA 1T1CA 3NOUC 1LSXA 2ZOIA 1OTIA 1TS6A 1XJ2A 1XJ6A 2Z6DA 2PYPA 3BWLA 3NOPC 4GS9B 4I38A 4JGOA 4R38A 4BBVA 4EESA 1T18A 1UWNX 3UB6A 3IBRA 3GDIA 3MJQA 4JGQA 4GW9A 4XT2B 5HWVA 1V9ZA 1N9OA 2V0WA 3H7WB 4WUJA 3LI8A 1T1BA 2QWSA 5A8BA 3F1NA 2VLGA 2JN7A 3G6OA 5DKKA 5TBMA 4LRZE 4BBUA 4HJ4A 1UWPX 4KUOA 2L4RA 4M4XA 3UMDA 4HQAA 5HD5A 2INWA 2R78A 4LRXC 4WL9A 5AVEA 1TS8A 4I3AA 3FG8A 2BASA 4GHIB 3A0RA 1LSWA 4R6LA 2V0UA 2QJ7A 2OWJA 2PDRA 4WN5A 2VV7A 4HP9A 2V1AA 4HP4A 1N9NA 1DP8A 5IU1A 1NWZA 3LYXA 5TBMB 4EETB 3LIDA 2OOLA 2PD7A 1N9LA 5HDCA 4R70A 1OTDA 3F1OB 4XT2A 1S66L 1OT6A 1D06A 4NXGA 3NHQA 1TS0A 1F98A 3C2WA 1GSWA 1ODVA 2ZOHA 2B02A 4MN6A 1VB6A 1XFQA 2PR6A 4LLOB 2M1CA 2A24B 3A0VA 4BBTA 1LT0A 3D72A 4I3JA 3H9WA 2KX6A 4WF0A 2L0WA 1LL8A 2J80A 3LICA 3LIBA 4I5SA 4KQDA 3MFXA 2L1MA 1OJGA 2VV6A 4L9EA 4GHIA 2PD8A 4NXBA 4B9OA 5J4EA 2A24A 4I3IA 4L9FA 4WLAA 5DJTA 2KDKA 5J7EA 3K3DA 5AVFA 4HJ6A 4JGPA 2V1BA 1OT9A 2QHKA 1OTBA 3C8CA 1T19A 3F1OA 5G4ZA 1T1AA 5EFWA 4L9GA 1GSXA 1DP6A
chains in the Genus database with same CATH superfamily
4K0XA 2JBFA 4KENB 3KO6A 1KVLA 4OPQA 3MMHA 4A5RA 4MEZA 1JVJA 2WADA 2ZC4B 2Y79A 3EGDC 4EUZA 3IF6C 2D01A 3K3CA 1KE3A 3LY4A 3TJZC 1YLWA 2XRNA 2PHYA 1K4FA 2EWWA 2YKHA 1ESUA 1F9IA 2Y2MA 3P01A 5DFYA 5TJJA 4JF4A 1G28A 4H6JB 3E0YA 4DJ3A 1VETB 5BOHA 2ZJ9A 1BTLA 1K55A 1S1YA 4AFIA 1PFLA 4Y15A 2VK3A 1EI5A 1CI8A 3IT9A 4R38A 1G6AA 2Y8HA 3IWQA 4LV3A 4XT2B 1T1BA 3DBAA 2PBDP 3TE8A 3Q81A 1MXOA 4EUVA 4WL9A 1GA0A 3IXDA 1IYQA 1E3UD 1DP8A 3T4LA 4EWFA 5EOOA 2OLVA 3T4SA 3GV9A 2ZOHA 1SCWA 3GMWA 5FI2A 5GLCA 1W7FA 2VV6A 4X68A 5FEGA 1J3WA 5CEDA 4CLCC 4IJGA 3LUQA 3CUEA 3O5YA 3KX0X 4EQ1A 3QHYA 4PKYG 4UA9A 4DF6A 4IHQA 1AXBA 4GD6A 3ZQ5A 5K5BA 2AVXA 1C3BA 3A3IA 4DE1A 5HX9A 4K91A 2VEAA 4QWOA 4I39A 2PAVP 4MMNA 3G32A 4H6JA 5F82A 4LV2A 1OTEA 1PRQA 1YAXA 4B4XA 3UDXA 4R1GA 3GSGA 4FTXA 5HPIA 4EEPA 2HDQA 1LL9A 2OSUA 1WA9A 2Y2OA 5A93A 4X56A 2P7JA 3QNBA 4S2NC 4FH2A 4KZ3A 1ES4A 3A0SA 1T1CA 2UV0E 3RXWA 3SW1A 4EESA 1T18A 3UB5P 3ZNYA 4E3KA 4EBLA 4Y0OA 4NKPA 2NUTC 1MWUA 3OPPA 5HL6A 1HTZA 2WGIA 1KVMA 4GOGA 2Y55A 3FWLA 1VQQA 3UDIA 1NZOA 3CHWP 2PRFA 1HZOA 3HL9A 2JKRI 2A24B 4LLOB 1EROA 5KMWA 3O87A 2EX2A 2A24A 4E3IA 3G2ZA 4Y5FA 4QD4A 4ETZA 2QHKA 3C8CA 1T19A 3G2YA 3AGEA 3OPRA 4LENA 3ITAA 4YINA 1OTAA 2ZMAA 4R3JA 4R0QA 5M19A 3KSGA 3OLOA 5DFXA 4JPMA 3N6IA 4OOYA 4R3AA 1MWTA 2O9BA 5G4YA 4O0PA 2HF6A 4BQMA 5CECA 2DNSA 3WRZA 5GLDA 5E2EA 4ARZB 2DMWA 3W4PA 4OP8A 2I9VA 4M3KA 3EWKA 3HLBA 1P0ZA 5KZHA 3E4OA 1S1ZA 2B95A 5HSQA 3NOUC 4Y17A 4JGOA 2PYPA 3B3XA 4OPRA 3C30A 1IYOA 1YMXA 3G6OA 2JCHA 3RFBA 1UWPX 4KZ8A 3UMDA 4Q0JA 4YOFA 4P6ZS 1LI9A 4C6YA 5IT5A 2UWXA 4CQHA 5CX7A 1BZAA 4FCFA 3S7NA 2BLSA 1FIKA 3LYXA 2PD7A 1IKGA 1F98A 5FSRA 3HLDA 4OPZA 3T4JA 4OKPA 4QU3A 3PR6A 4B9OA 2ZQCA 4ID4A 5G4ZA 3R7WA 2HGVA 5DF8A 1Y28A 1RP5A 2HDUA 4E04A 1KGEA 1DP9A 3GTCA 1YLTA 3FPWA 4XXRA 1K38A 4FUWA 1FR6A 3VP2A 3LR0A 1TDGA 5I5LA 5J3WA 3TW8A 4C3QA 3S7OA 1L2SA 1MPLA 4RYEA 4HOIA 4BLMA 2QJ5A 1FCMA 4KG5A 1K6SA 5AJGA 1G6OA 3LEQA 1VETA 1W8QA 3F1NB 5EM0A 5KSCA 3HUMA 3EOIA 3VOLA 4S2NA 2FH5A 2Y2KA 2XGNA 5FDSA 4LPZA 2DCFA 2XDMA 3B42A 1UWNX 5CTNA 4JGQA 3MJQA 5DKKA 1MY8A 4JBFA 3KYEA 4KG2A 4M4XA 1F2KA 2RL3A 2ZD8A 4X25A 1K57C 2XA7M 2BASA 3IH8A 2V0UA 5EUAA 3IWOA 5GHXA 1NYYA 5TBMB 4OQHA 1PIOA 4EETB 2B18A 2G7UA 2OLUA 3A0VA 3D72A 4OLDA 5HWTA 1ERMA 3LIBA 1ZC2A 1Y4OA 3WWXA 3QP5A 3VSKA 1L3LA 3T4QA 2HPBA 3QP4A 1KGGA 5CHJA 2XQZA 5EE8A 4WM9A 1UGUA 3GECA 5F5YA 2J8YA 3CPTA 1K57A 1M6KA 5HDDA 4KUKA 3PBOA 3IF6A 2H0TA 4OQ0A 4DE3A 3OPHA 1DY6A 5DF9A 3CPTB 1PZPA 1V9YA 3FC7A 4GNUA 3RH8B 1HVBA 4JXWA 4ME4A 3H82B 3EEAA 3KSFA 1PI5A 1RGZA 4E3NA 1KE4A 2FFFB 2O99A 5EPHA 3WS2A 1S4SA 2J9OA 2ZC3B 2E8JA 5GHZA 4GS9B 2R9WA 1XP4A 4PM9A 4H8RA 3UY6A 3GDIA 3H7WB 3IBJA 4KG6A 5TBMA 3UDFA 4HJ4A 3MXSA 4BD0A 2R78A 3S7QA 1K56A 5FL3A 3IXGA 4BL2A 1BLSA 1TS8A 1K0KA 1LSWA 2W3DA 3BRMA 2VV7A 2BTFP 4R23A 2KLIA 3LIDA 1SDNA 1OTDA 3NC8A 3WS0A 2M1CA 4BMWA 3QP6A 2XH9A 3EQUA 2Q9NA 4LCLA 2I72A 2GX5A 1FOFA 4X53A 4LCMA 4Z1WA 4S2KA 1GA9A 1VEUA 1TEMA 5A92A 3FYZA 1PW8A 2DRWA 2GJ3A 1SHVA 2K2NA 1L0GA 1STZA 4XUXA 1NXYA 5I94A 3T1SA 1CJFA 4L0LA 3IX8A 3RTYA 3VE4A 4F3LA 4ZRRA 1ZG4A 1HLUP 3MXRA 4Y0TA 1PWGA 1PWDA 4U3TA 1L0FA 2EXBA 3FPVA 3EQVA 1TS7A 4GCZA 3DWZA 5DTSA 3F1PB 4BL3A 1BUEA 1BSGA 3GRJA 2W1TB 4S2MA 2HDRA 3JVUA 3C4PA 4UAAA 3CUEC 1P97A 2EFUA 1ES2A 3JPUA 3FKWA 4Q0HA 3IBRA 1S0WA 4X1LA 4PM6A 4GDBA 2QYBA 3T1QB 1SDEA 5HD5A 3UO9A 1NJ4A 2NUPC 5AVEA 1E3UA 4HP9A 5L10A 2Y2GA 1N4OA 2V8FA 3FV7A 1MC0A 3DWKA 4GZBA 1N9LA 1GHMA 4YFMA 4HESA 5L09A 4I3JA 3UNWA 3ZDJA 4L9FA 5IHVA 3K3DA 2Y59A 1WE4A 1DP6A 3NDEA 1LLBA 2QPNA 3S7PA 5FATA 3MBZA 2P9VA 1GHIA 3HJIA 4NG2A 3VP3A 3N4IA 2VGKA 4NXFA 5DJUA 3KYQA 1XJ3A 1XXMA 1IFQA 4BJPA 1YSPA 3QP8A 3PBNA 5AQ7A 2XK1A 1YPRA 1JTDA 2YKFA 3LIEA 1ZKJA 1LI0A 2W27A 2ZM0A 1O7EA 1MWSA 4LV1A 2ZC7A 4EQIA 5HAPA 3KSHA 1F5MA 5CGSA 3RXXA 3IS2A 3LIFA 3P7NA 4O8GA 1FSWA 1CF0A 4S2JA 4UHUA 1NY0A 4OOLA 3IHBA 3I7JA 4U0XA 3DTKA 4IBRA 4P6BA 3MXQA 4C75A 2ZQ8A 4CLCE 2ZOIA 3BWLA 4O01A 4S2LA 2JC7A 3VP4A 2JN7A 5AQ9A 2L4RA 3OZHA 4G3WA 4Q0IA 4GD8A 3L9KA 3LFVA 2JE5A 2Q9MA 4DE2A 1XPBA 4Y13A 4WN5A 5A91A 1NWZA 3ZFZA 4R70A 1RGYA 2EX6A 2V2FF 2PR6A 4HEFA 4X69A 5M18A 3NIAA 4WYYA 5EVEA 3TSGA 1G5UA 3T4OA 2WYXA 3BECA 5DF7A 4Y7PA 3HUNA 4OLGA 4MN5A 3UMEA 5DKLA 4CLCB 2Z6CA 4GB7A 3UE0A 2D02A 2OV5A 2PYRA 4X55A 4HY8A 4NXEA 4HHDA 5HL1A 4QB8A 1J9MA 1HD8A 4D60A 2ZL1B 3UPOA 3BY9A 3UPPA 5E43A 2XSSA 3LIAA 5IS1A 4RA7A 2Y2NA 4DMZA 3A3JA 4N92A 2Y91A 3VP0A 1KOUA 2ZM2A 5HPFA 3T4TA 2O9CA 2OAQ1 4QY6A 1JTGA 4GDNA 3D3OA 1LSXA 1TS6A 1S6RA 2HJEA 3DTIA 3LI8A 2VGJA 2WGWB 4G3KA 1YLYA 3A3DA 5EECA 3SOIA 4LV0A 3S22A 2QJ7A 4OVDA 2ZQDA 4MDZA 4WMCA 3C38A 4R3BA 5HDCA 5CEBA 3HCYA 4XT2A 1S66L 3C2WA 1VB6A 2V20A 2XF3A 2W3GA 3H9WA 1AWIA 4DKIA 2J3TD 5CXWA 4ETXA 2LB5A 3MZDA 1ESIA 3SS4A 1ES5A 1H8YA 1OTBA 1KE0A 3NDGA 4WZ5A 4B88A 4U0TA 2XD1A 1IYSA 4ZJ1A 2V1ZA 1CK3A 2IWDA 1CQAA 1RCJA 4KZ4A 5MC7A 3SH9A 3PAGA 5HARA 4HH3A 3IF5A 1DRMA 3IXHA 4QHCA 1FILA 1XX2A 3SH7A 4RQ9A 3S1YA 4HBTA 2HJ9C 1D1JA 1CI9A 3E2KA 3Q7ZA 5KIZA 2GDNA 4E6WA 2G2UA 1NLYA 2EX9A 2P08A 4HI4A 3U4LP 3WRTA 1XFNA 3T12B 4GKUA 4UQIS 5EM1A 1GSVA 5CRFA 3E2LA 2EX8A 2FZ0A 3UB9A 4JXGA 5F1GA 3NOPC 1WYBA 3HREA 1IEMA 3K2NA 5TR7A 2IA2A 2WKIA 4IVKA 5FI6A 3V3SA 5M1AA 3A3EA 4HQAA 2B5RA 4LRXC 5E2GA 3NCKA 2J3WA 1PWCA 1WYCA 4GHIB 4R6LA 3ZG7B 2OWJA 5EVIB 3VOZA 3CI6A 2OOLA 3CITA 4N1HA 1YM1A 4MN6A 3EGXC 1XFQA 3N8SA 3LICA 1FR1A 2Z2MB 1TVFA 1JWVA 4GHIA 5CERA 4WLAA 2XFTA 2V1BA 3F1OA 3T1XA 1K25A 2PDRA 3ZG0A 3NJAA 3BQAA 4N9KA 4QJGA 3LEZA 3PAEA 4JGRA 3VE3A 3B33A 4JXSA 3UB7A 5EOEA 5FA7A 2ZMVA 3BFGA 1K54C 2J9PA 5F68A 2ZLYA 4KZ5A 3OCNA 2W1RA 1K55C 3PBQA 1YQSA 3L7HA 4LFUA 2A2LA 4JXVA 3MKEA 4NEED 2HV1A 2EA9A 3IXBA 2Y2IA 4P0MA 2G2WA 4KQQA 4X1MA 4UEYA 3LI9A 3BLSA 2IWBA 3OC2A 3MZEA 2ZQAA 4LRYC 5HWWA 3O3VA 4KQOA 5FQJA 3HUOA 5E2FA 2H28A 4EBNA 4HIAA 3BFDA 1OTIA 4BBVA 3UB6A 5HAQA 3B47A 5HWVA 5A8BA 3F1NA 3W4QA 2H10A 2EWVA 2VJWA 3BFFA 5HFOA 4Y0UA 5FQIA 5GLAA 2PU2A 3CG5A 5DTTA 1LL5A 3PTEA 2W3HA 4NXGA 1MBLA 3NHQA 3MF0A 2KX6A 1A0KA 1OJGA 1NLZA 3JYIA 4HBUA 1GHPA 1XA1A 4CJNA 2QMIA 4PPRA 4N9LA 3IWIA 2WZXA 2WKHA 1Z6FA 3NULA 3O86A 1XGIA 2ZC5B 3R7WB 2WKRA 1KDSA 4E6XA 4Y3IA 3IX4A 1QMEA 3Q1FA 1IYPA 2CMNA 3WS4A 1FQGA 3PXPA 2Y2HA 3Q7VB 2XD5A 4UQIM 3A3FA 3MFDA 3CMZA 4S2IA 3IX3A 3UPNA 3OPLA 1E25A 4EERA 4OQGA 4CLCD 4PM7A 4PKYA 1K4EA 4RX3A 1H8MA 4ZDXA 1OPXA 3BQ8A 4OQIA 4QPRA 3ULFA 2OWHA 3N8RA 2MJ6A 4Z9QA 3EEHA 4GN2A 5DTKA 3P09A 4CLCA 1BULA 3DW0A 2XFSA 3GR2A 3NECA 4E3MA 1MWRA 3Q07A 2P04A 5D3OA 5E2HA 4WEJA 2PT7A 5CTMA 4HP4A 5CHUA 1BLCA 3F1OB 1D06A 1GSWA 1Q2QA 5EV0A 3ZVTA 3MZFA 4I5SA 2L1MA 4D2OA 3W8KA 4PAUA 4I3IA 1PNEA 2VZWA 2KDKA 3LR3A 3PBRA 3VOYA 4P85A 1OT9A 4X6TA 4KQRA 2IWCA 3ZHHA 3VV4A 3KSIA 2ACGA 4EBPA 1OJ5A 5LBRA 1TF1A 4ZAMA 5U47A 1MKIA 1VM1A 5CGXA 4R4RA 4PHTA 4E3LA 4MN7A 5GLBA 3IS2B 4BENA 1KDWA 1XJ4A 2Y2QA 4JLFA 4DJ2A 3MQQA 2QKPA 3CZDA 1MZUA 5HW3A 1PZOA 4YNRA 4DXCA 2EXAA 3VP1A 4Y2FA 2VGLM 4YWZA 1VHMA 1SKOA 2X71A 1SZVA 1ONHA 4ZTKA 3T50A 3HLFA 1G68A 3E98A 3HLEA 2PBYA 4MBHA 1NYMA 1FCNA 4LRZE 2VA0A 4KUOA 4DRTA 2J7VA 5FQMA 3BYDA 1DJAA 2C5WB 3V39A 3FG8A 2Y2PA 1XGJA 3ZYTA 1MKMA 3Q82A 3WS1A 3BM6A 1H3QA 2E8IA 1U60A 1ZTUA 1FSYA 3G35A 3WS5A 1E4DA 1H5XA 4KQDA 5EVID 3VFFA 1KGFA 2PD8A 4RX2A 5DJTA 1L0DA 2BG1A 1YLJA 1P9WA 4WZ5C 4ZBEA 1T1AA 3ISGA 2XROA 3DTEA 1TDLA 2ZQ9A 5JYOA 3MQOA 5GHYA 2K31A 4HH2A 4UA6A 4FH4A 4GJ4A 3G30A 1S4RA 3V50A 1XKZA 4OPYA 4FD8A 2WGWA 1EW0A 4ZJ3A 2LB9A 5GL9A 1TD5A 4OP5A 3F1PA 3DTMA 2EFXA 3CLOA 4NETA 2V9AA 2JHEA 3ZG9B 4MBKA 1PI4A 4B4ZA 3QP2A 3ZNTA 4EXOA 3M2JA 4WEKA 1CEGA 1OMEA 3NY4A 4F3LB 1W63Q 3G4PA 1JWPA 3MR0A 3OCLA 2Y4AA 1H8ZA 2VGLS 1PW1A 1JNUA 2ZBBA 1ALQA 1EWZA 1W5DA 4E3JA 4DE0A 5EVLA 2ZL1A 5TFQA 3AGDA 4CPKA 4GW9A 1VEUB 3LY3A 2V0WA 1H0MA 1YSQA 3G34A 2VLGA 3UN7A 2Y2LA 4R4SA 3M6HA 4S2OA 5CGWA 3A0RA 5G18A 1Y54A 1OT6A 3C7VA 1ACFA 4KZ9A 5F83A 4BBTA 3BEBA 2L0WA 2J80A 3OBFA 1O07A 2QZ6A 4NXBA 4KZAA 3LCEA 2RCXA 2JKTM 5AVFA 1SKOB 3TOIA 4ZJ2A 4KZBA 5FAQA 3D9YA 4BWIA 3BW6A 1IOUA 4FSFA 3HLCA 2PR5A 5FQQA 4PM8A 5JYPA 4G3VA 1YLZA 2ZC6B 5A90A 4WZ4A 1ES3A 2WUQA 3NI9A 3ZG8B 1YLPA 3D4FA 5F69A 5F6AA 2ZQ7A 3H82A 1K56D 4MLLA 3U2AA 3V5MA 3MKFA 1BLHA 3UB8A 1LSVA 3DAVA 4EV4A 4II7A 3CWFA 2CC1A 4NK3A 3N7WA 4HNBA 3UE6A 3C4OA 2W0NA 1N9BA 3HVFA 3CJMA 1W8YA 2FFYA 1ERQA 1CEFA 1LHYA 3IQAA 3UE1A 4GLQA 3QP1A 2Z6DA 1XJ6A 4I38A 4MCWA 4FOFA 2XA7S 3S4XA 1NRFA 3G31A 3IHAA 4F94A 4JF6A 1V9ZA 2PU4A 4B93A 3SS3A 4P6ZM 3TRCA 5FQKA 3ZG5A 5FDHA 2P9VB 4KZ6A 5CHMA 1I5QA 2A3UA 1I2WA 4DN0A 4UA7A 1ZHHB 5FAPA 2HDSA 4DDYA 1LT0A 4OONA 1LL8A 2OAP1 5FI7A 3GVBA 4OH0A 1W79A 4HJ6A 4JGPA 2H5SA 5DVAA 4L9GA 1GSXA 2XR0A 3PHYA 2XLNA 4WBGA 2A49A 2WKPA 4HJ3A 2VKSA 2JKGA 1I2SA 1DJBA 5FAOA 1D7EA 1JWZA 4Q8IA 3ICYA 1FCOA 3E4QA 4ESPA 2Y2JA 3ZGAB 3Q7VA 2VV8A 4DXBA 1BYWA 3LR5A 1SKFA 3LO7A 1L0EA 1W63M 4IVIA 1S67L 2W1TA 4PMAA 5HZHA 2GNXA 4OOMA 3M2KA 4JF5A 1BT5A 1X0OA 4PM5A 4IUKA 3HJKA 1XJ2A 4K0WA 4IBXA 2J3TC 1N9OA 4WUJA 1GCEA 2QWSA 3W4OA 3AGFA 4EU0A 5FEFA 5HAIA 5L8MA 3GQZA 2INWA 4IEDA 3RJUA 1XA7A 3IH9A 2Z2LB 4JKTA 3QNCA 2X01A 3JVVA 1N9NA 2WKEA 3HLWA 2JKRM 4MBFA 2V8CA 3V3RA 1ZG6A 2X02A 4P87A 1ODVA 2B02A 1BLPA 3T4KA 2M7UA 4WF0A 3V67A 4LGWA 3N8LA 3VFHA 3HBRA 4RVAA 1Z09A 3TG9A 1P9RA 4XUZA 1YMSA 2Q0OA 3P98A 4WELA 4EEUA 1QMFA 3W2ZA 2XEPA 1YT4A 5HD3A 3SH8A 3BY8A 5FASA 3PBTA 4S2PA 3BFEA 2M7VA 3O88A 3H7WA 1IELA 4DDSA 5EVIC 1Q2PA 2VX8A 4GS9A 3KYZA 5F1FA 4WMCD 3SS5A 2HP6A 3ZCZA 5AQBA 2WZZA 3E4PA 3ITBA 3PBSA 4ARZA 4K08A 4N1XA 4EW7A 3MS6A 2ZMFA 5J8XA 5AQAA 3OOVA 2K7SA 3PYPA 2W3FA 5HDSA 3NBLA 4KZ7A 5FQ9A 3NOTC 2HP9A 3R4KA 1IKIA 3BJNA 2WAFA 2WKQA 2HZ5A 2H0YA 2O9AA 1YKDA 3VMAA 3CAXA 2W3EA 3HLGA 4MNRA 1PYYA 5TGFA 2R9XA 1K54A 3MSHA 5C5KA 2ZM8A 1K6RA 2C6WB 3BLMA 2WK0A 3IF6B 3ZVWA 2HP5A 3C7UA 4BBUA 2WAEA 5EVIA 4BD1A 2JKFA 4IUHA 4I3AA 3M6BA 2P74A 2KOIA 2V1AA 1ONGA 5IU1A 3LR4A 1NZUA 2GZAA 3FZCA 3SZTA 1TS0A 2O0YA 3UE3A 5KSHA 1NRJA 3FKVA 4L9EA 3MFXA 2WGVA 1DJCA 3LGOA 3VSLA 5J4EA 4O7DA 4QY5A 5J7EA 5L2FA 3C5AA 4E3OA 1M40A 3BFCA 3MQ0A 3T1RA 2JKTI 5EFWA 5L07A
chains in the Genus database with same CATH topology
3KO6A 3MQOA 3T4QA 3MMHA 1UGUA 3GECA 2K31A 4HH2A 4GJ4A 5F5YA 1S4RA 5MC7A 2Y79A 1EW0A 5HDDA 4HH3A 4KUKA 3EGDC 2LB9A 3PBOA 1DRMA 1TD5A 2D01A 3K3CA 4RQ9A 3TJZC 3F1PA 3CLOA 2HJ9C 2V9AA 5DF9A 2JHEA 2XRNA 2PHYA 2EWWA 2YKHA 1F9IA 5KIZA 3P01A 1NLYA 1V9YA 3FC7A 5DFYA 5TJJA 3RH8B 1G28A 2P08A 4H6JB 4EXOA 4HI4A 4WEKA 1XFNA 4F3LB 1W63Q 3E0YA 3MR0A 4DJ3A 4ME4A 3OCLA 3H82B 4UQIS 3EEAA 3KSFA 2VGLS 1JNUA 1GSVA 1S1YA 2ZBBA 2O99A 4AFIA 2FZ0A 1S4SA 3UB9A 3NOPC 4GS9B 4R38A 2Y8HA 3GDIA 3K2NA 4GW9A 4XT2B 3H7WB 2IA2A 2V0WA 3IBJA 1T1BA 1YSQA 2VLGA 5TBMA 3DBAA 4HJ4A 3TE8A 4HQAA 2R78A 4LRXC 3S7QA 4WL9A 5FL3A 4EUVA 1TS8A 2J3WA 4GHIB 3A0RA 1LSWA 2W3DA 4R6LA 2OWJA 2VV7A 2KLIA 3CI6A 1DP8A 3T4LA 3LIDA 2OOLA 3CITA 3T4SA 1OTDA 1OT6A 2ZOHA 4MN6A 3EGXC 1XFQA 2M1CA 4BBTA 4BMWA 3EQUA 2L0WA 2J80A 3LICA 3OBFA 2VV6A 4GHIA 4NXBA 2GX5A 4WLAA 2JKTM 5AVFA 2V1BA 3F1OA 4CLCC 2PDRA 4Z1WA 4IJGA 4BWIA 3BW6A 3NJAA 3BQAA 1IOUA 3LUQA 4FSFA 2PR5A 3CUEA 3O5YA 4JGRA 3KX0X 3VE3A 4EQ1A 3B33A 4G3VA 4PKYG 2GJ3A 4IHQA 3UB7A 3ZQ5A 5K5BA 2K2NA 1STZA 2ZMVA 5F69A 5F6AA 4L0LA 5F68A 3RTYA 2VEAA 3OCNA 3H82A 2W1RA 3PBQA 4I39A 3VE4A 4F3LA 2A2LA 4ZRRA 4MMNA 3U2AA 4H6JA 4NEED 2HV1A 3UB8A 1OTEA 1LSVA 2EA9A 4II7A 3FPVA 3CWFA 1YAXA 3EQVA 4UEYA 1TS7A 3LI9A 4GCZA 3OC2A 3F1PB 4HNBA 5HPIA 3UE6A 4EEPA 2W1TB 2W0NA 4LRYC 5HWWA 4KQOA 1WA9A 2P7JA 3JVUA 2H28A 3A0SA 3CUEC 4HIAA 1P97A 4GLQA 1T1CA 1OTIA 1XJ6A 2Z6DA 4I38A 3SW1A 4MCWA 4BBVA 4EESA 4FOFA 1T18A 3UB6A 2XA7S 4Q0HA 3IBRA 3B47A 5HWVA 1V9ZA 5A8BA 3F1NA 4B93A 2EWVA 2VJWA 2QYBA 4P6ZM 4NKPA 5HD5A 3TRCA 2NUTC 2NUPC 5AVEA 5HL6A 4HP9A 1MC0A 4DN0A 1N9LA 1ZHHB 2W3HA 4NXGA 3NHQA 4LLOB 2JKRI 2A24B 1LT0A 3MF0A 4I3JA 2KX6A 1LL8A 2OAP1 1OJGA 1NLZA 2A24A 4L9FA 4Y5FA 3K3DA 4ETZA 4HJ6A 4JGPA 2QHKA 3C8CA 1T19A 4L9GA 1GSXA 1DP6A 3PHYA 3R7WB 2WKRA 1OTAA 4Y3IA 3S7PA 2WKPA 4HJ3A 2VKSA 3HJIA 2CMNA 3KSGA 3OLOA 3PXPA 4NXFA 5DJUA 3KYQA 1XJ3A 5DFXA 1D7EA 4UQIM 1IFQA 3ICYA 4R3AA 3E4QA 4BJPA 2O9BA 1YSPA 5G4YA 3PBNA 4O0PA 2HF6A 2VV8A 2YKFA 3LIEA 4EERA 1BYWA 2W27A 3LR5A 4CLCD 4ARZB 2DMWA 1W63M 1S67L 2I9VA 2W1TA 4PKYA 3KSHA 1F5MA 3EWKA 3IS2A 3LIFA 3P7NA 1H8MA 1P0ZA 5HZHA 2GNXA 4O8GA 4OOMA 1OPXA 3E4OA 3BQ8A 4OOLA 1S1ZA 4QPRA 3ULFA 2OWHA 1X0OA 3MXQA 2MJ6A 5HSQA 4IUKA 3HJKA 3EEHA 3NOUC 4CLCE 2ZOIA 1XJ2A 4JGOA 3BWLA 2PYPA 4CLCA 3C30A 4O01A 2J3TC 1N9OA 4WUJA 2QWSA 3G6OA 2JN7A 4EU0A 3RFBA 1UWPX 2P04A 2L4RA 3UMDA 4G3WA 4Q0JA 4Q0IA 4P6ZS 4WEJA 4YOFA 5L8MA 2INWA 3LFVA 2PT7A 5IT5A 4CQHA 5CX7A 4WN5A 4HP4A 3JVVA 1N9NA 3S7NA 1NWZA 3LYXA 2PD7A 4R70A 2JKRM 3F1OB 1D06A 1F98A 1GSWA 1ODVA 2B02A 2PR6A 3T4JA 3T4KA 2M7UA 4WF0A 4I5SA 3PR6A 3V67A 2L1MA 4B9OA 4PAUA 4I3IA 2VZWA 2KDKA 3LR3A 3PBRA 5G4ZA 1OT9A 3R7WA 3T4OA 3VV4A 2HGVA 1P9RA 3KSIA 1Y28A 1OJ5A 4WELA 4MN5A 5LBRA 1TF1A 3UMEA 4EEUA 5DKLA 4CLCB 3W2ZA 4E04A 2Z6CA 1DP9A 5HD3A 3BY8A 3PBTA 3FPWA 4PHTA 2D02A 2PYRA 2M7VA 4HY8A 4NXEA 4HHDA 4MN7A 3H7WA 3LR0A 5I5LA 5J3WA 3TW8A 2VX8A 3S7OA 3IS2B 4GS9A 3KYZA 1XJ4A 4HOIA 2QJ5A 3E4PA 3PBSA 3BY9A 4ARZA 4K08A 4EW7A 4DJ2A 3MQQA 2QKPA 2ZMFA 3OOVA 2XSSA 2K7SA 1G6OA 3PYPA 1MZUA 2W3FA 5AJGA 5HDSA 3LIAA 3NOTC 5IS1A 4YNRA 3F1NB 3R4KA 4Y2FA 4DMZA 3BJNA 2WKQA 2VGLM 4YWZA 1VHMA 2O9AA 1YKDA 1KOUA 3EOIA 3CAXA 3VOLA 2W3EA 2FH5A 3T4TA 5HPFA 2O9CA 2OAQ1 3T50A 3D3OA 5C5KA 1LSXA 1TS6A 4LPZA 3B42A 2HJEA 1UWNX 3E98A 4JGQA 3MJQA 3LI8A 5DKKA 4LRZE 4BBUA 2VA0A 4KUOA 4M4XA 4G3KA 4IUHA 4I3AA 3FG8A 2XA7M 2BASA 2V0UA 2QJ7A 3ZYTA 1MKMA 2KOIA 2V1AA 4MDZA 3C38A 5IU1A 3LR4A 5TBMB 4EETB 1H3QA 2B18A 2GZAA 5HDCA 1ZTUA 3HCYA 4XT2A 2G7UA 1S66L 1TS0A 3C2WA 2O0YA 1VB6A 3UE3A 2W3GA 3A0VA 5KSHA 3D72A 3H9WA 1NRJA 4KQDA 5HWTA 3LIBA 4L9EA 2J3TD 3MFXA 2PD8A 5J4EA 4ETXA 2LB5A 5DJTA 5J7EA 1P9WA 1OTBA 1T1AA 3MQ0A 2JKTI 5EFWA 2XROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NJA A;  3PHY A;  3LUQ A;  1Y28 A;  1OJ5 A;  2PR5 A;  1OTA A;  2WKR A;  3MQO A;  4MN5 A;  4JGR A;  3KX0 X;  3UME A;  3VE3 A;  4EEU A;  4EQ1 A;  2WKP A;  4HJ3 A;  5DKL A;  3B33 A;  4PKY G;  3HJI A;  4E04 A;  1UGU A;  2Z6C A;  2GJ3 A;  3GEC A;  4HH2 A;  1DP9 A;  2CMN A;  5HD3 A;  5F5Y A;  1S4R A;  3OLO A;  3UB7 A;  3ZQ5 A;  3BY8 A;  1EW0 A;  4NXF A;  2D02 A;  5DJU A;  4HH3 A;  1XJ3 A;  2PYR A;  4KUK A;  5HDD A;  3SW1 A;  1D7E A;  5F69 A;  5F6A A;  4HY8 A;  4NXE A;  1DRM A;  4HHD A;  3ICY A;  3H7W A;  2D01 A;  3K3C A;  4R3A A;  4RQ9 A;  5F68 A;  3RTY A;  2VEA A;  3E4Q A;  5I5L A;  3H82 A;  4LPZ A;  5G4Y A;  5J3W A;  3F1P A;  3CLO A;  3IS2 B;  4GS9 A;  4I39 A;  3VE4 A;  4F3L A;  2V9A A;  2JHE A;  1XJ4 A;  2PHY A;  4HOI A;  2VV8 A;  2YKH A;  2QJ5 A;  2YKF A;  3LIE A;  4EER A;  3E4P A;  4H6J A;  3BY9 A;  1BYW A;  1F9I A;  2HV1 A;  2W27 A;  4K08 A;  4EW7 A;  3UB8 A;  5KIZ A;  1OTE A;  4DJ2 A;  3MQQ A;  1LSV A;  2EA9 A;  1V9Y A;  2QKP A;  3FC7 A;  3RH8 B;  3PYP A;  3CWF A;  2K7S A;  1G28 A;  1MZU A;  4H6J B;  5HDS A;  1S67 L;  3LIA A;  4EXO A;  2I9V A;  1TS7 A;  3LI9 A;  4PKY A;  4GCZ A;  4HI4 A;  3NOT C;  1XFN A;  5IS1 A;  3EWK A;  3IS2 A;  4F3L B;  3LIF A;  3F1N B;  3F1P B;  1P0Z A;  3MR0 A;  3P7N A;  3H82 B;  4HNB A;  4DJ3 A;  5HZH A;  2WKQ A;  3UE6 A;  4EEP A;  4YWZ A;  2W0N A;  4LRY C;  5HWW A;  1WA9 A;  3E4O A;  1KOU A;  1JNU A;  1GSV A;  1S1Y A;  2ZBB A;  1S1Z A;  3CAX A;  2P7J A;  3ULF A;  2OWH A;  3VOL A;  1X0O A;  2H28 A;  3MXQ A;  1S4S A;  5HSQ A;  5HWT A;  3T50 A;  3UB9 A;  3A0S A;  3HJK A;  4HIA A;  1P97 A;  3EEH A;  1T1C A;  3NOU C;  1LSX A;  2ZOI A;  1OTI A;  1TS6 A;  1XJ2 A;  1XJ6 A;  2Z6D A;  2PYP A;  3BWL A;  3NOP C;  4GS9 B;  4I38 A;  4JGO A;  4R38 A;  4BBV A;  4EES A;  1T18 A;  1UWN X;  3UB6 A;  3IBR A;  3GDI A;  3MJQ A;  4JGQ A;  4GW9 A;  4XT2 B;  5HWV A;  1V9Z A;  1N9O A;  2V0W A;  3H7W B;  4WUJ A;  3LI8 A;  1T1B A;  2QWS A;  5A8B A;  3F1N A;  2VLG A;  2JN7 A;  3G6O A;  5DKK A;  5TBM A;  4LRZ E;  4BBU A;  4HJ4 A;  1UWP X;  4KUO A;  2L4R A;  4M4X A;  3UMD A;  4HQA A;  5HD5 A;  2INW A;  2R78 A;  4LRX C;  4WL9 A;  5AVE A;  1TS8 A;  4I3A A;  3FG8 A;  2BAS A;  4GHI B;  3A0R A;  1LSW A;  4R6L A;  2V0U A;  2QJ7 A;  2OWJ A;  2PDR A;  4WN5 A;  2VV7 A;  4HP9 A;  2V1A A;  4HP4 A;  1N9N A;  1DP8 A;  5IU1 A;  1NWZ A;  3LYX A;  5TBM B;  4EET B;  3LID A;  2OOL A;  2PD7 A;  1N9L A;  5HDC A;  4R70 A;  1OTD A;  3F1O B;  4XT2 A;  1S66 L;  1OT6 A;  1D06 A;  4NXG A;  3NHQ A;  1TS0 A;  1F98 A;  3C2W A;  1GSW A;  1ODV A;  2ZOH A;  2B02 A;  4MN6 A;  1VB6 A;  1XFQ A;  2PR6 A;  4LLO B;  2M1C A;  2A24 B;  3A0V A;  4BBT A;  1LT0 A;  3D72 A;  4I3J A;  3H9W A;  2KX6 A;  4WF0 A;  2L0W A;  1LL8 A;  2J80 A;  3LIC A;  3LIB A;  4I5S A;  4KQD A;  3MFX A;  2L1M A;  1OJG A;  2VV6 A;  4L9E A;  4GHI A;  2PD8 A;  4NXB A;  4B9O A;  5J4E A;  2A24 A;  4I3I A;  4L9F A;  4WLA A;  5DJT A;  2KDK A;  5J7E A;  3K3D A;  5AVF A;  4HJ6 A;  4JGP A;  2V1B A;  1OT9 A;  2QHK A;  1OTB A;  3C8C A;  1T19 A;  3F1O A;  5G4Z A;  1T1A A;  5EFW A;  4L9G A;  1GSX A;  1DP6 A; 
#chains in the Genus database with same CATH topology
 4K0X A;  2JBF A;  4KEN B;  3KO6 A;  1KVL A;  4OPQ A;  3MMH A;  4A5R A;  4MEZ A;  1JVJ A;  2WAD A;  2ZC4 B;  2Y79 A;  3EGD C;  4EUZ A;  3IF6 C;  2D01 A;  3K3C A;  1KE3 A;  3LY4 A;  3TJZ C;  1YLW A;  2XRN A;  2PHY A;  1K4F A;  2EWW A;  2YKH A;  1ESU A;  1F9I A;  2Y2M A;  3P01 A;  5DFY A;  5TJJ A;  4JF4 A;  1G28 A;  4H6J B;  3E0Y A;  4DJ3 A;  1VET B;  5BOH A;  2ZJ9 A;  1BTL A;  1K55 A;  1S1Y A;  4AFI A;  1PFL A;  4Y15 A;  2VK3 A;  1EI5 A;  1CI8 A;  3IT9 A;  4R38 A;  1G6A A;  2Y8H A;  3IWQ A;  4LV3 A;  4XT2 B;  1T1B A;  3DBA A;  2PBD P;  3TE8 A;  3Q81 A;  1MXO A;  4EUV A;  4WL9 A;  1GA0 A;  3IXD A;  1IYQ A;  1E3U D;  1DP8 A;  3T4L A;  4EWF A;  5EOO A;  2OLV A;  3T4S A;  3GV9 A;  2ZOH A;  1SCW A;  3GMW A;  5FI2 A;  5GLC A;  1W7F A;  2VV6 A;  4X68 A;  5FEG A;  1J3W A;  5CED A;  4CLC C;  4IJG A;  3LUQ A;  3CUE A;  3O5Y A;  3KX0 X;  4EQ1 A;  3QHY A;  4PKY G;  4UA9 A;  4DF6 A;  4IHQ A;  1AXB A;  4GD6 A;  3ZQ5 A;  5K5B A;  2AVX A;  1C3B A;  3A3I A;  4DE1 A;  5HX9 A;  4K91 A;  2VEA A;  4QWO A;  4I39 A;  2PAV P;  4MMN A;  3G32 A;  4H6J A;  5F82 A;  4LV2 A;  1OTE A;  1PRQ A;  1YAX A;  4B4X A;  3UDX A;  4R1G A;  3GSG A;  4FTX A;  5HPI A;  4EEP A;  2HDQ A;  1LL9 A;  2OSU A;  1WA9 A;  2Y2O A;  5A93 A;  4X56 A;  2P7J A;  3QNB A;  4S2N C;  4FH2 A;  4KZ3 A;  1ES4 A;  3A0S A;  1T1C A;  2UV0 E;  3RXW A;  3SW1 A;  4EES A;  1T18 A;  3UB5 P;  3ZNY A;  4E3K A;  4EBL A;  4Y0O A;  4NKP A;  2NUT C;  1MWU A;  3OPP A;  5HL6 A;  1HTZ A;  2WGI A;  1KVM A;  4GOG A;  2Y55 A;  3FWL A;  1VQQ A;  3UDI A;  1NZO A;  3CHW P;  2PRF A;  1HZO A;  3HL9 A;  2JKR I;  2A24 B;  4LLO B;  1ERO A;  5KMW A;  3O87 A;  2EX2 A;  2A24 A;  4E3I A;  3G2Z A;  4Y5F A;  4QD4 A;  4ETZ A;  2QHK A;  3C8C A;  1T19 A;  3G2Y A;  3AGE A;  3OPR A;  4LEN A;  3ITA A;  4YIN A;  1OTA A;  2ZMA A;  4R3J A;  4R0Q A;  5M19 A;  3KSG A;  3OLO A;  5DFX A;  4JPM A;  3N6I A;  4OOY A;  4R3A A;  1MWT A;  2O9B A;  5G4Y A;  4O0P A;  2HF6 A;  4BQM A;  5CEC A;  2DNS A;  3WRZ A;  5GLD A;  5E2E A;  4ARZ B;  2DMW A;  3W4P A;  4OP8 A;  2I9V A;  4M3K A;  3EWK A;  3HLB A;  1P0Z A;  5KZH A;  3E4O A;  1S1Z A;  2B95 A;  5HSQ A;  3NOU C;  4Y17 A;  4JGO A;  2PYP A;  3B3X A;  4OPR A;  3C30 A;  1IYO A;  1YMX A;  3G6O A;  2JCH A;  3RFB A;  1UWP X;  4KZ8 A;  3UMD A;  4Q0J A;  4YOF A;  4P6Z S;  1LI9 A;  4C6Y A;  5IT5 A;  2UWX A;  4CQH A;  5CX7 A;  1BZA A;  4FCF A;  3S7N A;  2BLS A;  1FIK A;  3LYX A;  2PD7 A;  1IKG A;  1F98 A;  5FSR A;  3HLD A;  4OPZ A;  3T4J A;  4OKP A;  4QU3 A;  3PR6 A;  4B9O A;  2ZQC A;  4ID4 A;  5G4Z A;  3R7W A;  2HGV A;  5DF8 A;  1Y28 A;  1RP5 A;  2HDU A;  4E04 A;  1KGE A;  1DP9 A;  3GTC A;  1YLT A;  3FPW A;  4XXR A;  1K38 A;  4FUW A;  1FR6 A;  3VP2 A;  3LR0 A;  1TDG A;  5I5L A;  5J3W A;  3TW8 A;  4C3Q A;  3S7O A;  1L2S A;  1MPL A;  4RYE A;  4HOI A;  4BLM A;  2QJ5 A;  1FCM A;  4KG5 A;  1K6S A;  5AJG A;  1G6O A;  3LEQ A;  1VET A;  1W8Q A;  3F1N B;  5EM0 A;  5KSC A;  3HUM A;  3EOI A;  3VOL A;  4S2N A;  2FH5 A;  2Y2K A;  2XGN A;  5FDS A;  4LPZ A;  2DCF A;  2XDM A;  3B42 A;  1UWN X;  5CTN A;  4JGQ A;  3MJQ A;  5DKK A;  1MY8 A;  4JBF A;  3KYE A;  4KG2 A;  4M4X A;  1F2K A;  2RL3 A;  2ZD8 A;  4X25 A;  1K57 C;  2XA7 M;  2BAS A;  3IH8 A;  2V0U A;  5EUA A;  3IWO A;  5GHX A;  1NYY A;  5TBM B;  4OQH A;  1PIO A;  4EET B;  2B18 A;  2G7U A;  2OLU A;  3A0V A;  3D72 A;  4OLD A;  5HWT A;  1ERM A;  3LIB A;  1ZC2 A;  1Y4O A;  3WWX A;  3QP5 A;  3VSK A;  1L3L A;  3T4Q A;  2HPB A;  3QP4 A;  1KGG A;  5CHJ A;  2XQZ A;  5EE8 A;  4WM9 A;  1UGU A;  3GEC A;  5F5Y A;  2J8Y A;  3CPT A;  1K57 A;  1M6K A;  5HDD A;  4KUK A;  3PBO A;  3IF6 A;  2H0T A;  4OQ0 A;  4DE3 A;  3OPH A;  1DY6 A;  5DF9 A;  3CPT B;  1PZP A;  1V9Y A;  3FC7 A;  4GNU A;  3RH8 B;  1HVB A;  4JXW A;  4ME4 A;  3H82 B;  3EEA A;  3KSF A;  1PI5 A;  1RGZ A;  4E3N A;  1KE4 A;  2FFF B;  2O99 A;  5EPH A;  3WS2 A;  1S4S A;  2J9O A;  2ZC3 B;  2E8J A;  5GHZ A;  4GS9 B;  2R9W A;  1XP4 A;  4PM9 A;  4H8R A;  3UY6 A;  3GDI A;  3H7W B;  3IBJ A;  4KG6 A;  5TBM A;  3UDF A;  4HJ4 A;  3MXS A;  4BD0 A;  2R78 A;  3S7Q A;  1K56 A;  5FL3 A;  3IXG A;  4BL2 A;  1BLS A;  1TS8 A;  1K0K A;  1LSW A;  2W3D A;  3BRM A;  2VV7 A;  2BTF P;  4R23 A;  2KLI A;  3LID A;  1SDN A;  1OTD A;  3NC8 A;  3WS0 A;  2M1C A;  4BMW A;  3QP6 A;  2XH9 A;  3EQU A;  2Q9N A;  4LCL A;  2I72 A;  2GX5 A;  1FOF A;  4X53 A;  4LCM A;  4Z1W A;  4S2K A;  1GA9 A;  1VEU A;  1TEM A;  5A92 A;  3FYZ A;  1PW8 A;  2DRW A;  2GJ3 A;  1SHV A;  2K2N A;  1L0G A;  1STZ A;  4XUX A;  1NXY A;  5I94 A;  3T1S A;  1CJF A;  4L0L A;  3IX8 A;  3RTY A;  3VE4 A;  4F3L A;  4ZRR A;  1ZG4 A;  1HLU P;  3MXR A;  4Y0T A;  1PWG A;  1PWD A;  4U3T A;  1L0F A;  2EXB A;  3FPV A;  3EQV A;  1TS7 A;  4GCZ A;  3DWZ A;  5DTS A;  3F1P B;  4BL3 A;  1BUE A;  1BSG A;  3GRJ A;  2W1T B;  4S2M A;  2HDR A;  3JVU A;  3C4P A;  4UAA A;  3CUE C;  1P97 A;  2EFU A;  1ES2 A;  3JPU A;  3FKW A;  4Q0H A;  3IBR A;  1S0W A;  4X1L A;  4PM6 A;  4GDB A;  2QYB A;  3T1Q B;  1SDE A;  5HD5 A;  3UO9 A;  1NJ4 A;  2NUP C;  5AVE A;  1E3U A;  4HP9 A;  5L10 A;  2Y2G A;  1N4O A;  2V8F A;  3FV7 A;  1MC0 A;  3DWK A;  4GZB A;  1N9L A;  1GHM A;  4YFM A;  4HES A;  5L09 A;  4I3J A;  3UNW A;  3ZDJ A;  4L9F A;  5IHV A;  3K3D A;  2Y59 A;  1WE4 A;  1DP6 A;  3NDE A;  1LLB A;  2QPN A;  3S7P A;  5FAT A;  3MBZ A;  2P9V A;  1GHI A;  3HJI A;  4NG2 A;  3VP3 A;  3N4I A;  2VGK A;  4NXF A;  5DJU A;  3KYQ A;  1XJ3 A;  1XXM A;  1IFQ A;  4BJP A;  1YSP A;  3QP8 A;  3PBN A;  5AQ7 A;  2XK1 A;  1YPR A;  1JTD A;  2YKF A;  3LIE A;  1ZKJ A;  1LI0 A;  2W27 A;  2ZM0 A;  1O7E A;  1MWS A;  4LV1 A;  2ZC7 A;  4EQI A;  5HAP A;  3KSH A;  1F5M A;  5CGS A;  3RXX A;  3IS2 A;  3LIF A;  3P7N A;  4O8G A;  1FSW A;  1CF0 A;  4S2J A;  4UHU A;  1NY0 A;  4OOL A;  3IHB A;  3I7J A;  4U0X A;  3DTK A;  4IBR A;  4P6B A;  3MXQ A;  4C75 A;  2ZQ8 A;  4CLC E;  2ZOI A;  3BWL A;  4O01 A;  4S2L A;  2JC7 A;  3VP4 A;  2JN7 A;  5AQ9 A;  2L4R A;  3OZH A;  4G3W A;  4Q0I A;  4GD8 A;  3L9K A;  3LFV A;  2JE5 A;  2Q9M A;  4DE2 A;  1XPB A;  4Y13 A;  4WN5 A;  5A91 A;  1NWZ A;  3ZFZ A;  4R70 A;  1RGY A;  2EX6 A;  2V2F F;  2PR6 A;  4HEF A;  4X69 A;  5M18 A;  3NIA A;  4WYY A;  5EVE A;  3TSG A;  1G5U A;  3T4O A;  2WYX A;  3BEC A;  5DF7 A;  4Y7P A;  3HUN A;  4OLG A;  4MN5 A;  3UME A;  5DKL A;  4CLC B;  2Z6C A;  4GB7 A;  3UE0 A;  2D02 A;  2OV5 A;  2PYR A;  4X55 A;  4HY8 A;  4NXE A;  4HHD A;  5HL1 A;  4QB8 A;  1J9M A;  1HD8 A;  4D60 A;  2ZL1 B;  3UPO A;  3BY9 A;  3UPP A;  5E43 A;  2XSS A;  3LIA A;  5IS1 A;  4RA7 A;  2Y2N A;  4DMZ A;  3A3J A;  4N92 A;  2Y91 A;  3VP0 A;  1KOU A;  2ZM2 A;  5HPF A;  3T4T A;  2O9C A;  2OAQ 1;  4QY6 A;  1JTG A;  4GDN A;  3D3O A;  1LSX A;  1TS6 A;  1S6R A;  2HJE A;  3DTI A;  3LI8 A;  2VGJ A;  2WGW B;  4G3K A;  1YLY A;  3A3D A;  5EEC A;  3SOI A;  4LV0 A;  3S22 A;  2QJ7 A;  4OVD A;  2ZQD A;  4MDZ A;  4WMC A;  3C38 A;  4R3B A;  5HDC A;  5CEB A;  3HCY A;  4XT2 A;  1S66 L;  3C2W A;  1VB6 A;  2V20 A;  2XF3 A;  2W3G A;  3H9W A;  1AWI A;  4DKI A;  2J3T D;  5CXW A;  4ETX A;  2LB5 A;  3MZD A;  1ESI A;  3SS4 A;  1ES5 A;  1H8Y A;  1OTB A;  1KE0 A;  3NDG A;  4WZ5 A;  4B88 A;  4U0T A;  2XD1 A;  1IYS A;  4ZJ1 A;  2V1Z A;  1CK3 A;  2IWD A;  1CQA A;  1RCJ A;  4KZ4 A;  5MC7 A;  3SH9 A;  3PAG A;  5HAR A;  4HH3 A;  3IF5 A;  1DRM A;  3IXH A;  4QHC A;  1FIL A;  1XX2 A;  3SH7 A;  4RQ9 A;  3S1Y A;  4HBT A;  2HJ9 C;  1D1J A;  1CI9 A;  3E2K A;  3Q7Z A;  5KIZ A;  2GDN A;  4E6W A;  2G2U A;  1NLY A;  2EX9 A;  2P08 A;  4HI4 A;  3U4L P;  3WRT A;  1XFN A;  3T12 B;  4GKU A;  4UQI S;  5EM1 A;  1GSV A;  5CRF A;  3E2L A;  2EX8 A;  2FZ0 A;  3UB9 A;  4JXG A;  5F1G A;  3NOP C;  1WYB A;  3HRE A;  1IEM A;  3K2N A;  5TR7 A;  2IA2 A;  2WKI A;  4IVK A;  5FI6 A;  3V3S A;  5M1A A;  3A3E A;  4HQA A;  2B5R A;  4LRX C;  5E2G A;  3NCK A;  2J3W A;  1PWC A;  1WYC A;  4GHI B;  4R6L A;  3ZG7 B;  2OWJ A;  5EVI B;  3VOZ A;  3CI6 A;  2OOL A;  3CIT A;  4N1H A;  1YM1 A;  4MN6 A;  3EGX C;  1XFQ A;  3N8S A;  3LIC A;  1FR1 A;  2Z2M B;  1TVF A;  1JWV A;  4GHI A;  5CER A;  4WLA A;  2XFT A;  2V1B A;  3F1O A;  3T1X A;  1K25 A;  2PDR A;  3ZG0 A;  3NJA A;  3BQA A;  4N9K A;  4QJG A;  3LEZ A;  3PAE A;  4JGR A;  3VE3 A;  3B33 A;  4JXS A;  3UB7 A;  5EOE A;  5FA7 A;  2ZMV A;  3BFG A;  1K54 C;  2J9P A;  5F68 A;  2ZLY A;  4KZ5 A;  3OCN A;  2W1R A;  1K55 C;  3PBQ A;  1YQS A;  3L7H A;  4LFU A;  2A2L A;  4JXV A;  3MKE A;  4NEE D;  2HV1 A;  2EA9 A;  3IXB A;  2Y2I A;  4P0M A;  2G2W A;  4KQQ A;  4X1M A;  4UEY A;  3LI9 A;  3BLS A;  2IWB A;  3OC2 A;  3MZE A;  2ZQA A;  4LRY C;  5HWW A;  3O3V A;  4KQO A;  5FQJ A;  3HUO A;  5E2F A;  2H28 A;  4EBN A;  4HIA A;  3BFD A;  1OTI A;  4BBV A;  3UB6 A;  5HAQ A;  3B47 A;  5HWV A;  5A8B A;  3F1N A;  3W4Q A;  2H10 A;  2EWV A;  2VJW A;  3BFF A;  5HFO A;  4Y0U A;  5FQI A;  5GLA A;  2PU2 A;  3CG5 A;  5DTT A;  1LL5 A;  3PTE A;  2W3H A;  4NXG A;  1MBL A;  3NHQ A;  3MF0 A;  2KX6 A;  1A0K A;  1OJG A;  1NLZ A;  3JYI A;  4HBU A;  1GHP A;  1XA1 A;  4CJN A;  2QMI A;  4PPR A;  4N9L A;  3IWI A;  2WZX A;  2WKH A;  1Z6F A;  3NUL A;  3O86 A;  1XGI A;  2ZC5 B;  3R7W B;  2WKR A;  1KDS A;  4E6X A;  4Y3I A;  3IX4 A;  1QME A;  3Q1F A;  1IYP A;  2CMN A;  3WS4 A;  1FQG A;  3PXP A;  2Y2H A;  3Q7V B;  2XD5 A;  4UQI M;  3A3F A;  3MFD A;  3CMZ A;  4S2I A;  3IX3 A;  3UPN A;  3OPL A;  1E25 A;  4EER A;  4OQG A;  4CLC D;  4PM7 A;  4PKY A;  1K4E A;  4RX3 A;  1H8M A;  4ZDX A;  1OPX A;  3BQ8 A;  4OQI A;  4QPR A;  3ULF A;  2OWH A;  3N8R A;  2MJ6 A;  4Z9Q A;  3EEH A;  4GN2 A;  5DTK A;  3P09 A;  4CLC A;  1BUL A;  3DW0 A;  2XFS A;  3GR2 A;  3NEC A;  4E3M A;  1MWR A;  3Q07 A;  2P04 A;  5D3O A;  5E2H A;  4WEJ A;  2PT7 A;  5CTM A;  4HP4 A;  5CHU A;  1BLC A;  3F1O B;  1D06 A;  1GSW A;  1Q2Q A;  5EV0 A;  3ZVT A;  3MZF A;  4I5S A;  2L1M A;  4D2O A;  3W8K A;  4PAU A;  4I3I A;  1PNE A;  2VZW A;  2KDK A;  3LR3 A;  3PBR A;  3VOY A;  4P85 A;  1OT9 A;  4X6T A;  4KQR A;  2IWC A;  3ZHH A;  3VV4 A;  3KSI A;  2ACG A;  4EBP A;  1OJ5 A;  5LBR A;  1TF1 A;  4ZAM A;  5U47 A;  1MKI A;  1VM1 A;  5CGX A;  4R4R A;  4PHT A;  4E3L A;  4MN7 A;  5GLB A;  3IS2 B;  4BEN A;  1KDW A;  1XJ4 A;  2Y2Q A;  4JLF A;  4DJ2 A;  3MQQ A;  2QKP A;  3CZD A;  1MZU A;  5HW3 A;  1PZO A;  4YNR A;  4DXC A;  2EXA A;  3VP1 A;  4Y2F A;  2VGL M;  4YWZ A;  1VHM A;  1SKO A;  2X71 A;  1SZV A;  1ONH A;  4ZTK A;  3T50 A;  3HLF A;  1G68 A;  3E98 A;  3HLE A;  2PBY A;  4MBH A;  1NYM A;  1FCN A;  4LRZ E;  2VA0 A;  4KUO A;  4DRT A;  2J7V A;  5FQM A;  3BYD A;  1DJA A;  2C5W B;  3V39 A;  3FG8 A;  2Y2P A;  1XGJ A;  3ZYT A;  1MKM A;  3Q82 A;  3WS1 A;  3BM6 A;  1H3Q A;  2E8I A;  1U60 A;  1ZTU A;  1FSY A;  3G35 A;  3WS5 A;  1E4D A;  1H5X A;  4KQD A;  5EVI D;  3VFF A;  1KGF A;  2PD8 A;  4RX2 A;  5DJT A;  1L0D A;  2BG1 A;  1YLJ A;  1P9W A;  4WZ5 C;  4ZBE A;  1T1A A;  3ISG A;  2XRO A;  3DTE A;  1TDL A;  2ZQ9 A;  5JYO A;  3MQO A;  5GHY A;  2K31 A;  4HH2 A;  4UA6 A;  4FH4 A;  4GJ4 A;  3G30 A;  1S4R A;  3V50 A;  1XKZ A;  4OPY A;  4FD8 A;  2WGW A;  1EW0 A;  4ZJ3 A;  2LB9 A;  5GL9 A;  1TD5 A;  4OP5 A;  3F1P A;  3DTM A;  2EFX A;  3CLO A;  4NET A;  2V9A A;  2JHE A;  3ZG9 B;  4MBK A;  1PI4 A;  4B4Z A;  3QP2 A;  3ZNT A;  4EXO A;  3M2J A;  4WEK A;  1CEG A;  1OME A;  3NY4 A;  4F3L B;  1W63 Q;  3G4P A;  1JWP A;  3MR0 A;  3OCL A;  2Y4A A;  1H8Z A;  2VGL S;  1PW1 A;  1JNU A;  2ZBB A;  1ALQ A;  1EWZ A;  1W5D A;  4E3J A;  4DE0 A;  5EVL A;  2ZL1 A;  5TFQ A;  3AGD A;  4CPK A;  4GW9 A;  1VEU B;  3LY3 A;  2V0W A;  1H0M A;  1YSQ A;  3G34 A;  2VLG A;  3UN7 A;  2Y2L A;  4R4S A;  3M6H A;  4S2O A;  5CGW A;  3A0R A;  5G18 A;  1Y54 A;  1OT6 A;  3C7V A;  1ACF A;  4KZ9 A;  5F83 A;  4BBT A;  3BEB A;  2L0W A;  2J80 A;  3OBF A;  1O07 A;  2QZ6 A;  4NXB A;  4KZA A;  3LCE A;  2RCX A;  2JKT M;  5AVF A;  1SKO B;  3TOI A;  4ZJ2 A;  4KZB A;  5FAQ A;  3D9Y A;  4BWI A;  3BW6 A;  1IOU A;  4FSF A;  3HLC A;  2PR5 A;  5FQQ A;  4PM8 A;  5JYP A;  4G3V A;  1YLZ A;  2ZC6 B;  5A90 A;  4WZ4 A;  1ES3 A;  2WUQ A;  3NI9 A;  3ZG8 B;  1YLP A;  3D4F A;  5F69 A;  5F6A A;  2ZQ7 A;  3H82 A;  1K56 D;  4MLL A;  3U2A A;  3V5M A;  3MKF A;  1BLH A;  3UB8 A;  1LSV A;  3DAV A;  4EV4 A;  4II7 A;  3CWF A;  2CC1 A;  4NK3 A;  3N7W A;  4HNB A;  3UE6 A;  3C4O A;  2W0N A;  1N9B A;  3HVF A;  3CJM A;  1W8Y A;  2FFY A;  1ERQ A;  1CEF A;  1LHY A;  3IQA A;  3UE1 A;  4GLQ A;  3QP1 A;  2Z6D A;  1XJ6 A;  4I38 A;  4MCW A;  4FOF A;  2XA7 S;  3S4X A;  1NRF A;  3G31 A;  3IHA A;  4F94 A;  4JF6 A;  1V9Z A;  2PU4 A;  4B93 A;  3SS3 A;  4P6Z M;  3TRC A;  5FQK A;  3ZG5 A;  5FDH A;  2P9V B;  4KZ6 A;  5CHM A;  1I5Q A;  2A3U A;  1I2W A;  4DN0 A;  4UA7 A;  1ZHH B;  5FAP A;  2HDS A;  4DDY A;  1LT0 A;  4OON A;  1LL8 A;  2OAP 1;  5FI7 A;  3GVB A;  4OH0 A;  1W79 A;  4HJ6 A;  4JGP A;  2H5S A;  5DVA A;  4L9G A;  1GSX A;  2XR0 A;  3PHY A;  2XLN A;  4WBG A;  2A49 A;  2WKP A;  4HJ3 A;  2VKS A;  2JKG A;  1I2S A;  1DJB A;  5FAO A;  1D7E A;  1JWZ A;  4Q8I A;  3ICY A;  1FCO A;  3E4Q A;  4ESP A;  2Y2J A;  3ZGA B;  3Q7V A;  2VV8 A;  4DXB A;  1BYW A;  3LR5 A;  1SKF A;  3LO7 A;  1L0E A;  1W63 M;  4IVI A;  1S67 L;  2W1T A;  4PMA A;  5HZH A;  2GNX A;  4OOM A;  3M2K A;  4JF5 A;  1BT5 A;  1X0O A;  4PM5 A;  4IUK A;  3HJK A;  1XJ2 A;  4K0W A;  4IBX A;  2J3T C;  1N9O A;  4WUJ A;  1GCE A;  2QWS A;  3W4O A;  3AGF A;  4EU0 A;  5FEF A;  5HAI A;  5L8M A;  3GQZ A;  2INW A;  4IED A;  3RJU A;  1XA7 A;  3IH9 A;  2Z2L B;  4JKT A;  3QNC A;  2X01 A;  3JVV A;  1N9N A;  2WKE A;  3HLW A;  2JKR M;  4MBF A;  2V8C A;  3V3R A;  1ZG6 A;  2X02 A;  4P87 A;  1ODV A;  2B02 A;  1BLP A;  3T4K A;  2M7U A;  4WF0 A;  3V67 A;  4LGW A;  3N8L A;  3VFH A;  3HBR A;  4RVA A;  1Z09 A;  3TG9 A;  1P9R A;  4XUZ A;  1YMS A;  2Q0O A;  3P98 A;  4WEL A;  4EEU A;  1QMF A;  3W2Z A;  2XEP A;  1YT4 A;  5HD3 A;  3SH8 A;  3BY8 A;  5FAS A;  3PBT A;  4S2P A;  3BFE A;  2M7V A;  3O88 A;  3H7W A;  1IEL A;  4DDS A;  5EVI C;  1Q2P A;  2VX8 A;  4GS9 A;  3KYZ A;  5F1F A;  4WMC D;  3SS5 A;  2HP6 A;  3ZCZ A;  5AQB A;  2WZZ A;  3E4P A;  3ITB A;  3PBS A;  4ARZ A;  4K08 A;  4N1X A;  4EW7 A;  3MS6 A;  2ZMF A;  5J8X A;  5AQA A;  3OOV A;  2K7S A;  3PYP A;  2W3F A;  5HDS A;  3NBL A;  4KZ7 A;  5FQ9 A;  3NOT C;  2HP9 A;  3R4K A;  1IKI A;  3BJN A;  2WAF A;  2WKQ A;  2HZ5 A;  2H0Y A;  2O9A A;  1YKD A;  3VMA A;  3CAX A;  2W3E A;  3HLG A;  4MNR A;  1PYY A;  5TGF A;  2R9X A;  1K54 A;  3MSH A;  5C5K A;  2ZM8 A;  1K6R A;  2C6W B;  3BLM A;  2WK0 A;  3IF6 B;  3ZVW A;  2HP5 A;  3C7U A;  4BBU A;  2WAE A;  5EVI A;  4BD1 A;  2JKF A;  4IUH A;  4I3A A;  3M6B A;  2P74 A;  2KOI A;  2V1A A;  1ONG A;  5IU1 A;  3LR4 A;  1NZU A;  2GZA A;  3FZC A;  3SZT A;  1TS0 A;  2O0Y A;  3UE3 A;  5KSH A;  1NRJ A;  3FKV A;  4L9E A;  3MFX A;  2WGV A;  1DJC A;  3LGO A;  3VSL A;  5J4E A;  4O7D A;  4QY5 A;  5J7E A;  5L2F A;  3C5A A;  4E3O A;  1M40 A;  3BFC A;  3MQ0 A;  3T1R A;  2JKT I;  5EFW A;  5L07 A; 
#chains in the Genus database with same CATH homology
 3KO6 A;  3MQO A;  3T4Q A;  3MMH A;  1UGU A;  3GEC A;  2K31 A;  4HH2 A;  4GJ4 A;  5F5Y A;  1S4R A;  5MC7 A;  2Y79 A;  1EW0 A;  5HDD A;  4HH3 A;  4KUK A;  3EGD C;  2LB9 A;  3PBO A;  1DRM A;  1TD5 A;  2D01 A;  3K3C A;  4RQ9 A;  3TJZ C;  3F1P A;  3CLO A;  2HJ9 C;  2V9A A;  5DF9 A;  2JHE A;  2XRN A;  2PHY A;  2EWW A;  2YKH A;  1F9I A;  5KIZ A;  3P01 A;  1NLY A;  1V9Y A;  3FC7 A;  5DFY A;  5TJJ A;  3RH8 B;  1G28 A;  2P08 A;  4H6J B;  4EXO A;  4HI4 A;  4WEK A;  1XFN A;  4F3L B;  1W63 Q;  3E0Y A;  3MR0 A;  4DJ3 A;  4ME4 A;  3OCL A;  3H82 B;  4UQI S;  3EEA A;  3KSF A;  2VGL S;  1JNU A;  1GSV A;  1S1Y A;  2ZBB A;  2O99 A;  4AFI A;  2FZ0 A;  1S4S A;  3UB9 A;  3NOP C;  4GS9 B;  4R38 A;  2Y8H A;  3GDI A;  3K2N A;  4GW9 A;  4XT2 B;  3H7W B;  2IA2 A;  2V0W A;  3IBJ A;  1T1B A;  1YSQ A;  2VLG A;  5TBM A;  3DBA A;  4HJ4 A;  3TE8 A;  4HQA A;  2R78 A;  4LRX C;  3S7Q A;  4WL9 A;  5FL3 A;  4EUV A;  1TS8 A;  2J3W A;  4GHI B;  3A0R A;  1LSW A;  2W3D A;  4R6L A;  2OWJ A;  2VV7 A;  2KLI A;  3CI6 A;  1DP8 A;  3T4L A;  3LID A;  2OOL A;  3CIT A;  3T4S A;  1OTD A;  1OT6 A;  2ZOH A;  4MN6 A;  3EGX C;  1XFQ A;  2M1C A;  4BBT A;  4BMW A;  3EQU A;  2L0W A;  2J80 A;  3LIC A;  3OBF A;  2VV6 A;  4GHI A;  4NXB A;  2GX5 A;  4WLA A;  2JKT M;  5AVF A;  2V1B A;  3F1O A;  4CLC C;  2PDR A;  4Z1W A;  4IJG A;  4BWI A;  3BW6 A;  3NJA A;  3BQA A;  1IOU A;  3LUQ A;  4FSF A;  2PR5 A;  3CUE A;  3O5Y A;  4JGR A;  3KX0 X;  3VE3 A;  4EQ1 A;  3B33 A;  4G3V A;  4PKY G;  2GJ3 A;  4IHQ A;  3UB7 A;  3ZQ5 A;  5K5B A;  2K2N A;  1STZ A;  2ZMV A;  5F69 A;  5F6A A;  4L0L A;  5F68 A;  3RTY A;  2VEA A;  3OCN A;  3H82 A;  2W1R A;  3PBQ A;  4I39 A;  3VE4 A;  4F3L A;  2A2L A;  4ZRR A;  4MMN A;  3U2A A;  4H6J A;  4NEE D;  2HV1 A;  3UB8 A;  1OTE A;  1LSV A;  2EA9 A;  4II7 A;  3FPV A;  3CWF A;  1YAX A;  3EQV A;  4UEY A;  1TS7 A;  3LI9 A;  4GCZ A;  3OC2 A;  3F1P B;  4HNB A;  5HPI A;  3UE6 A;  4EEP A;  2W1T B;  2W0N A;  4LRY C;  5HWW A;  4KQO A;  1WA9 A;  2P7J A;  3JVU A;  2H28 A;  3A0S A;  3CUE C;  4HIA A;  1P97 A;  4GLQ A;  1T1C A;  1OTI A;  1XJ6 A;  2Z6D A;  4I38 A;  3SW1 A;  4MCW A;  4BBV A;  4EES A;  4FOF A;  1T18 A;  3UB6 A;  2XA7 S;  4Q0H A;  3IBR A;  3B47 A;  5HWV A;  1V9Z A;  5A8B A;  3F1N A;  4B93 A;  2EWV A;  2VJW A;  2QYB A;  4P6Z M;  4NKP A;  5HD5 A;  3TRC A;  2NUT C;  2NUP C;  5AVE A;  5HL6 A;  4HP9 A;  1MC0 A;  4DN0 A;  1N9L A;  1ZHH B;  2W3H A;  4NXG A;  3NHQ A;  4LLO B;  2JKR I;  2A24 B;  1LT0 A;  3MF0 A;  4I3J A;  2KX6 A;  1LL8 A;  2OAP 1;  1OJG A;  1NLZ A;  2A24 A;  4L9F A;  4Y5F A;  3K3D A;  4ETZ A;  4HJ6 A;  4JGP A;  2QHK A;  3C8C A;  1T19 A;  4L9G A;  1GSX A;  1DP6 A;  3PHY A;  3R7W B;  2WKR A;  1OTA A;  4Y3I A;  3S7P A;  2WKP A;  4HJ3 A;  2VKS A;  3HJI A;  2CMN A;  3KSG A;  3OLO A;  3PXP A;  4NXF A;  5DJU A;  3KYQ A;  1XJ3 A;  5DFX A;  1D7E A;  4UQI M;  1IFQ A;  3ICY A;  4R3A A;  3E4Q A;  4BJP A;  2O9B A;  1YSP A;  5G4Y A;  3PBN A;  4O0P A;  2HF6 A;  2VV8 A;  2YKF A;  3LIE A;  4EER A;  1BYW A;  2W27 A;  3LR5 A;  4CLC D;  4ARZ B;  2DMW A;  1W63 M;  1S67 L;  2I9V A;  2W1T A;  4PKY A;  3KSH A;  1F5M A;  3EWK A;  3IS2 A;  3LIF A;  3P7N A;  1H8M A;  1P0Z A;  5HZH A;  2GNX A;  4O8G A;  4OOM A;  1OPX A;  3E4O A;  3BQ8 A;  4OOL A;  1S1Z A;  4QPR A;  3ULF A;  2OWH A;  1X0O A;  3MXQ A;  2MJ6 A;  5HSQ A;  4IUK A;  3HJK A;  3EEH A;  3NOU C;  4CLC E;  2ZOI A;  1XJ2 A;  4JGO A;  3BWL A;  2PYP A;  4CLC A;  3C30 A;  4O01 A;  2J3T C;  1N9O A;  4WUJ A;  2QWS A;  3G6O A;  2JN7 A;  4EU0 A;  3RFB A;  1UWP X;  2P04 A;  2L4R A;  3UMD A;  4G3W A;  4Q0J A;  4Q0I A;  4P6Z S;  4WEJ A;  4YOF A;  5L8M A;  2INW A;  3LFV A;  2PT7 A;  5IT5 A;  4CQH A;  5CX7 A;  4WN5 A;  4HP4 A;  3JVV A;  1N9N A;  3S7N A;  1NWZ A;  3LYX A;  2PD7 A;  4R70 A;  2JKR M;  3F1O B;  1D06 A;  1F98 A;  1GSW A;  1ODV A;  2B02 A;  2PR6 A;  3T4J A;  3T4K A;  2M7U A;  4WF0 A;  4I5S A;  3PR6 A;  3V67 A;  2L1M A;  4B9O A;  4PAU A;  4I3I A;  2VZW A;  2KDK A;  3LR3 A;  3PBR A;  5G4Z A;  1OT9 A;  3R7W A;  3T4O A;  3VV4 A;  2HGV A;  1P9R A;  3KSI A;  1Y28 A;  1OJ5 A;  4WEL A;  4MN5 A;  5LBR A;  1TF1 A;  3UME A;  4EEU A;  5DKL A;  4CLC B;  3W2Z A;  4E04 A;  2Z6C A;  1DP9 A;  5HD3 A;  3BY8 A;  3PBT A;  3FPW A;  4PHT A;  2D02 A;  2PYR A;  2M7V A;  4HY8 A;  4NXE A;  4HHD A;  4MN7 A;  3H7W A;  3LR0 A;  5I5L A;  5J3W A;  3TW8 A;  2VX8 A;  3S7O A;  3IS2 B;  4GS9 A;  3KYZ A;  1XJ4 A;  4HOI A;  2QJ5 A;  3E4P A;  3PBS A;  3BY9 A;  4ARZ A;  4K08 A;  4EW7 A;  4DJ2 A;  3MQQ A;  2QKP A;  2ZMF A;  3OOV A;  2XSS A;  2K7S A;  1G6O A;  3PYP A;  1MZU A;  2W3F A;  5AJG A;  5HDS A;  3LIA A;  3NOT C;  5IS1 A;  4YNR A;  3F1N B;  3R4K A;  4Y2F A;  4DMZ A;  3BJN A;  2WKQ A;  2VGL M;  4YWZ A;  1VHM A;  2O9A A;  1YKD A;  1KOU A;  3EOI A;  3CAX A;  3VOL A;  2W3E A;  2FH5 A;  3T4T A;  5HPF A;  2O9C A;  2OAQ 1;  3T50 A;  3D3O A;  5C5K A;  1LSX A;  1TS6 A;  4LPZ A;  3B42 A;  2HJE A;  1UWN X;  3E98 A;  4JGQ A;  3MJQ A;  3LI8 A;  5DKK A;  4LRZ E;  4BBU A;  2VA0 A;  4KUO A;  4M4X A;  4G3K A;  4IUH A;  4I3A A;  3FG8 A;  2XA7 M;  2BAS A;  2V0U A;  2QJ7 A;  3ZYT A;  1MKM A;  2KOI A;  2V1A A;  4MDZ A;  3C38 A;  5IU1 A;  3LR4 A;  5TBM B;  4EET B;  1H3Q A;  2B18 A;  2GZA A;  5HDC A;  1ZTU A;  3HCY A;  4XT2 A;  2G7U A;  1S66 L;  1TS0 A;  3C2W A;  2O0Y A;  1VB6 A;  3UE3 A;  2W3G A;  3A0V A;  5KSH A;  3D72 A;  3H9W A;  1NRJ A;  4KQD A;  5HWT A;  3LIB A;  4L9E A;  2J3T D;  3MFX A;  2PD8 A;  5J4E A;  4ETX A;  2LB5 A;  5DJT A;  5J7E A;  1P9W A;  1OTB A;  1T1A A;  3MQ0 A;  2JKT I;  5EFW A;  2XRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...