3HJIA

1.8 angstrom crystal structure of the i74v:i85v variant of vivid (vvd).
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
149
structure length
149
Chain Sequence
MHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALVLCDLKQKDTPVVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Vivid PAS protein VVD
publication title Mechanism-based tuning of a LOV domain photoreceptor.
pubmed doi rcsb
source organism Neurospora crassa
total genus 36
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3hjiA00
1OTBA 3VE3A 3E4OA 2PR6A 2B02A 4HQAA 5IU1A 4F3LA 3F1OA 3FC7A 4MN5A 1BYWA 4NXFA 3K3CA 4BBTA 4HJ4A 5J4EA 2J80A 1P97A 3F1NB 4GHIB 5HSQA 1OTIA 4LPZA 3VOLA 4EERA 3G6OA 1WA9A 2V1AA 3PHYA 5HD5A 4EEUA 4HP4A 2A24A 2QWSA 3LIBA 3BY8A 2WKQA 3RH8B 2Z6DA 1T1AA 2QJ5A 3UB9A 2VV7A 2PDRA 3EEHA 5IS1A 1XFNA 5TBMB 1V9YA 4HP9A 3H82B 5HD3A 2JN7A 3A0VA 3UMDA 4HNBA 5DJUA 2L1MA 3LI9A 4F3LB 3E4PA 4H6JA 3F1OB 5DKLA 1T1CA 2D01A 3CLOA 4M4XA 2D02A 2V0WA 2K7SA 3LIFA 1OT9A 5HDCA 2Z6CA 3KX0X 2QHKA 5HDDA 3UB6A 3K3DA 1GSVA 1OTAA 2INWA 4KQDA 5DKKA 5HZHA 1S4RA 3F1PA 2A24B 4BBVA 4HJ6A 3MR0A 2WKRA 4L9EA 4JGOA 1GSXA 1XJ2A 3LIDA 2PYRA 5F69A 2YKFA 4LRYC 5HWWA 5HWVA 3PYPA 3BY9A 2GJ3A 1N9NA 3GECA 2JHEA 4LRXC 4PKYG 2PYPA 1XJ3A 2VV8A 4HY8A 4H6JB 3CWFA 4JGQA 1XJ6A 1OT6A 3HJIA 5F68A 1N9LA 3H9WA 2KX6A 2BASA 3MJQA 1F9IA 1UWNX 4I38A 5HWTA 4GCZA 1S4SA 2VLGA 3D72A 2M1CA 3F1PB 3UMEA 1LSWA 4R3AA 1V9ZA 3P7NA 2PHYA 2OOLA 3NOPC 4R38A 4I39A 4PKYA 3LIEA 5F5YA 4R70A 3ICYA 3NHQA 4NXGA 1T1BA 3ZQ5A 4HH2A 2QJ7A 1OTEA 5F6AA 3ULFA 5G4ZA 1D06A 5KIZA 2ZBBA 2ZOIA 1NWZA 1DRMA 5J7EA 3LI8A 1S66L 3UE6A 5AVEA 4E04A 1Y28A 2V0UA 4RQ9A 1DP6A 1TS0A 4GS9A 4BBUA 3OLOA 3BWLA 3NOUC 5EFWA 1OJGA 5DJTA 1TS7A 3H7WA 3IBRA 4HIAA 1JNUA 2W0NA 3UB8A 2L4RA 4YWZA 1KOUA 4L9GA 1OJ5A 2L0WA 5AVFA 3EWKA 4R6LA 3LICA 1GSWA 3A0SA 4HI4A 1P0ZA 1XFQA 3C8CA 4JGPA 2HV1A 3B33A 2OWJA 1TS6A 2V9AA 3RTYA 1T18A 3NOTC 2H28A 4DJ2A 1F98A 4GW9A 1S1ZA 4K08A 1LL8A 2VV6A 2R78A 3NJAA 3MQQA 4I3IA 4GS9B 2KDKA 1MZUA 3IS2A 2QKPA 4I3AA 5I5LA 4HH3A 1UWPX 1LSXA 3FG8A 3H7WB 2WKPA 4NXEA 1VB6A 3A0RA 4EESA 4XT2A 3UB7A 4WLAA 3SW1A 2PD7A 1S1YA 2PR5A 2YKHA 1X0OA 3MFXA 1S67L 3LUQA 4KUOA 1LSVA 4JGRA 3MXQA 4LRZE 4KUKA 2VEAA 1D7EA 4EEPA 5HDSA 2I9VA 4EQ1A 4WF0A 3E4QA 1DP8A 4I5SA 1TS8A 4I3JA 1DP9A 4NXBA 4B9OA 3CAXA 4EW7A 4WN5A 1LT0A 2EA9A 3C2WA 4HHDA 4LLOB 3IS2B 3T50A 4HJ3A 5J3WA 2PD8A 3VE4A 3MQOA 2V1BA 3F1NA 4MN6A 4GHIA 4DJ3A 4EXOA 1OTDA 5A8BA 4XT2B 5G4YA 3GDIA 2ZOHA 4EETB 1XJ4A 4HOIA 4WL9A 3LIAA 1N9OA 1EW0A 1UGUA 2OWHA 1ODVA 4WUJA 2P7JA 1G28A 2W27A 3HJKA 2CMNA 5TBMA 4L9FA 3LYXA 3H82A 1T19A
chains in the Genus database with same CATH superfamily
1OTBA 1YLZA 2XSSA 4OOLA 2HDSA 5IHVA 1W8YA 1RP5A 4RVAA 3LFVA 1BYWA 4GB7A 1JWZA 5GHZA 4HJ4A 4ARZA 5J4EA 3Q82A 3T1RA 3F1NB 3S7QA 4LPZA 5FSRA 1BT5A 4PM8A 2PBDP 3G6OA 1GA9A 5U47A 2DCFA 1WA9A 3G2ZA 2C5WB 4HBTA 4JXSA 1MPLA 1KVLA 2QWSA 3LIBA 1LI9A 3BY8A 2WKQA 3RH8B 1T1AA 1PNEA 3TOIA 3EEHA 3CUEA 2GNXA 4NETA 1E4DA 1EWZA 3K2NA 5E43A 3A0VA 3ZVWA 3KYQA 4HNBA 4DRTA 4LCLA 4WZ4A 2GDNA 3ZDJA 3E4PA 3F1OB 1T1CA 3MKEA 1ZG4A 3CLOA 3VOZA 3T1QB 5FDSA 1L0EA 3N8SA 5TFQA 3MS6A 2V0WA 3E2KA 2RL3A 3IH9A 3HLWA 3CMZA 3IXBA 5HDCA 1ES4A 5CHMA 1P9WA 2Z6CA 4NKPA 3C7UA 4XUZA 3KX0X 5F1FA 1J9MA 2VGLS 1IYSA 1W63M 3UB6A 3OC2A 1YMSA 4JXVA 4E3KA 1KGEA 3K3DA 1GSVA 3Q7ZA 1IYPA 2WYXA 2WKRA 5EECA 2WK0A 1YLPA 5GL9A 3W4QA 2NUPC 2DMWA 4PHTA 4BENA 3G35A 3BEBA 4YNRA 1PW1A 4LRYC 1KGGA 5HWVA 3UPOA 3N8LA 4MLLA 2UWXA 2VK3A 4DF6A 4MNRA 2XK1A 4CLCA 1TD5A 2HP9A 3WS1A 3IHBA 5HL6A 3CUEC 3FWLA 5HAPA 4GD8A 2JKTI 3A3JA 5EUAA 1N9LA 1ES5A 3H9WA 2KX6A 2P9VA 5AQAA 3BLMA 3HLEA 1UWNX 3Q1FA 5HWTA 3PBTA 4GCZA 3T1SA 4UA7A 3PBRA 4KZAA 4KZ6A 1MBLA 2JC7A 3D72A 2M1CA 3ZHHA 5BOHA 3PTEA 2WAFA 3F1PB 3UPNA 1YLWA 3LY4A 3BRMA 5CEBA 4FD8A 2PHYA 3CPTB 3FZCA 5L09A 1MWUA 1TEMA 5FQMA 3M6BA 1XGJA 2JKRM 2ZC5B 4IHQA 3LR5A 4QWOA 2ZMVA 1EROA 4KENB 3ZQ5A 4HH2A 4ETZA 3TRCA 5TGFA 4HEFA 1OTEA 3M6HA 2QYBA 2Y59A 3VP0A 4IBXA 5FEGA 4CLCE 4C3QA 3QHYA 4QY6A 4X53A 5HPIA 2W1TA 1XKZA 4KZ3A 4L0LA 3OOVA 3BM6A 2PBYA 3NOUC 3OCNA 1MWTA 5J8XA 2GX5A 3ZVTA 1YLTA 5GLDA 3OPPA 2R9XA 5DJTA 4EBNA 2Y2OA 4DE0A 4GN2A 3IBRA 3IH8A 4JPMA 4Y0TA 4N9LA 2L4RA 3UDIA 4LV1A 3IWOA 3IT9A 5K5BA 1LHYA 3CHWP 5AVFA 4E3MA 2JKFA 2DNSA 1TDGA 5DTTA 4PAUA 3A0SA 1CK3A 3PXPA 4EUVA 4JGPA 4KG5A 2EX8A 2V9AA 1BLHA 2OAQ1 1JVJA 4Q8IA 3T4KA 1IOUA 3T4TA 5MC7A 2H28A 5FL3A 2Z2LB 4GW9A 3ITAA 3O86A 2RCXA 1IKIA 2Y91A 1PZPA 1W79A 1RGYA 2VZWA 1M6KA 1IEMA 5JYPA 1XX2A 2XR0A 2KDKA 3HVFA 1MZUA 1M40A 2EWWA 5I5LA 2WAEA 2QMIA 1IFQA 1VB6A 1YMXA 2J3TD 3ZG8B 2PD7A 4DN0A 2R9WA 3D9YA 2Y8HA 4ZDXA 1FCNA 3C4PA 1S67L 1LL9A 2FFYA 1BSGA 3MXQA 4LCMA 2ZM2A 4LRZE 4KUKA 4S2PA 4FSFA 5E2EA 1VQQA 3Q81A 4X55A 3SS5A 4EQ1A 2VA0A 2AVXA 4WF0A 2IWBA 1GHIA 4HBUA 4OP5A 1DP8A 1TF1A 1DP9A 2HJ9C 3CAXA 4EW7A 2A49A 1LLBA 4HHDA 3PBQA 3IS2B 2PD8A 5CXWA 4OPYA 4O0PA 4K91A 4MBKA 3KO6A 3VE4A 3E98A 3R7WB 1WYCA 4LV3A 5FQ9A 5M1AA 4A5RA 3LY3A 4EXOA 2Q0OA 4KZBA 5HX9A 5A8BA 3UE3A 3JVVA 3MMHA 4E3OA 5DVAA 4WYYA 5EVIA 3W8KA 3MF0A 1K4FA 1NZOA 3LGOA 1GHMA 2JKRI 1Y4OA 2PRFA 2ZL1B 4WL9A 2A2LA 3P98A 4X56A 3VP3A 1EW0A 4GLQA 3HUOA 4MEZA 4WUJA 2EXAA 2P7JA 4AFIA 4ZRRA 3WRZA 3GMWA 2W27A 4Q0HA 3HJKA 3E0YA 1YSQA 1VM1A 5TBMA 2V8CA 3LYXA 4GKUA 3O87A 3T4OA 5CGWA 1STZA 2B02A 4OOYA 4F3LA 1S0WA 2JBFA 3BECA 3WRTA 4MN5A 2JE5A 4NK3A 4OQHA 4BBTA 3JYIA 2HF6A 4ZBEA 2P74A 2FZ0A 1XP4A 1JTDA 4D2OA 2WGVA 3C30A 3V67A 2V1AA 2QZ6A 4FOFA 4HP4A 3B3XA 2WKIA 2A24A 2B5RA 3DBAA 2O9CA 3EOIA 3ZG7B 2Z6DA 1FR6A 5AQ9A 1XA7A 5GHXA 2PDRA 3N8RA 1BLSA 3SH7A 2B95A 4HP9A 4FCFA 1BLPA 4OKPA 3VFHA 4PMAA 2FH5A 3WWXA 1K25A 3KYEA 2W3HA 5DJUA 2L1MA 2J9PA 3O5YA 2D01A 4IJGA 2J3TC 4OLDA 4ESPA 2D02A 3OPRA 3M2KA 1F2KA 3O88A 2K7SA 4ARZB 4FTXA 3LIFA 3TJZC 2ZM8A 4HESA 3NULA 2XD5A 4CJNA 4UQIS 4QD4A 4DE2A 4E3IA 4BWIA 5HDDA 1NY0A 3HUMA 3QP4A 3BFFA 4JKTA 4UEYA 2O99A 2XRNA 3FPVA 3IF6A 5E2GA 3LR4A 4P6ZS 5C5KA 2O0YA 3KSIA 1L3LA 4E3LA 4EBPA 2W3DA 1XGIA 1PRQA 3PYPA 1RCJA 1DJCA 3GECA 4LRXC 3MZEA 2CC1A 5A92A 3MZFA 4KQRA 3QP6A 3QP5A 2PYPA 1SHVA 2WZZA 1OT6A 3HJIA 3KSGA 5F68A 1KE4A 4U0TA 5EOOA 2BASA 3ITBA 4WZ5A 1ALQA 3NI9A 5FDHA 1I2SA 4DE1A 3S22A 4QY5A 1VETA 2XLNA 3UMEA 1LSWA 4E6WA 4CLCD 2KOIA 2DRWA 2OOLA 1PFLA 4K0XA 4R38A 4I39A 1OMEA 4S2MA 3LIEA 5F5YA 5CECA 4S2JA 3G2YA 2A3UA 1SZVA 4U3TA 1PW8A 2QJ7A 3IF6C 2OV5A 2LB9A 4CLCB 5HFOA 4PM7A 1IELA 2HZ5A 1VHMA 4KZ9A 5CEDA 5J7EA 5CGXA 1K57C 1IYQA 3Q7VA 2XA7S 3LI8A 4UHUA 1S66L 2P9VB 3ZG5A 1YPRA 1TVFA 4E04A 4O01A 1W8QA 1ES3A 3UPPA 4RQ9A 4RX3A 3IQAA 5JYOA 1TS0A 5DFYA 3BWLA 4LV0A 4Y13A 5EFWA 4WZ5C 2Y4AA 4Y17A 3UNWA 1TS7A 2P08A 4HIAA 4EQIA 4WMCA 1SKOA 2W0NA 3UB8A 2HDRA 5A93A 5DF7A 4DDYA 4ZJ3A 1KOUA 1YLJA 4L9GA 1PWDA 2EFXA 4Q0IA 2NUTC 2H0TA 5CX7A 2M7UA 3LICA 4U0XA 4KQQA 4HI4A 3OBFA 1TS6A 3RTYA 5F83A 1K6SA 3N6IA 3C38A 3GRJA 5FQJA 4BJPA 4DJ2A 1S1ZA 4O8GA 3NC8A 2BG1A 2Y2QA 3G31A 3MQQA 3ZGAB 4I3IA 2W1TB 3BFGA 2EXBA 3IWIA 5L10A 4IVKA 4Z1WA 4PM5A 3FYZA 4RX2A 2LB5A 3GTCA 1ACFA 3T4LA 1ZG6A 2QKPA 4I3AA 3U2AA 1W5DA 4IUHA 2G2UA 1H5XA 1UWPX 5EPHA 5FI6A 3O3VA 2J8YA 3A0RA 4EESA 2J9OA 3OCLA 1KVMA 4Q0JA 4WLAA 3SW1A 2XEPA 3A3DA 2W1RA 3HLGA 3FV7A 1KDSA 2ZC3B 1NXYA 1X0OA 5E2FA 3HLBA 3ZG0A 3LUQA 3RJUA 5CGSA 3D3OA 2ZQ7A 1D7EA 5HDSA 2I9VA 4Y3IA 4CLCC 4G3WA 2XGNA 3LCEA 4I5SA 3M2JA 4G3KA 4I3JA 2BTFP 4P0MA 2P04A 4OONA 4B9OA 4DXCA 1K4EA 3LEQA 3C2WA 3T4QA 3LR0A 2ZC6B 4HJ3A 5J3WA 2I72A 4H8RA 1N4OA 3BFDA 3MQOA 2V1BA 4S2NA 4GHIA 3ZNTA 1YM1A 2WGWA 1KGFA 3MFDA 4Z9QA 2HDUA 4BL2A 2ZOHA 4G3VA 4HOIA 3BFCA 3LIAA 5HAIA 3JVUA 3VSKA 1G6OA 4OQIA 2OWHA 4X69A 2H0YA 4ZTKA 2PU2A 1SDEA 5L2FA 4R4SA 3LO7A 3BLSA 5CRFA 3G32A 4CPKA 4N92A 4LFUA 3BQAA 3H82A 3BW6A 1T19A 3ZYTA 3WS0A 3I7JA 3VE3A 3G30A 2PR6A 3EQVA 5EVID 4GZBA 1GCEA 3W4PA 5GLBA 3FC7A 4OOMA 3CZDA 4XXRA 3TW8A 2JCHA 1YT4A 1XA1A 1G5UA 3QP2A 3K3CA 2WGIA 2J80A 4S2OA 3MZDA 1P97A 3GVBA 3QP1A 1OTIA 2UV0E 3VOLA 3S4XA 5HAQA 1D1JA 5FATA 1NLYA 2XH9A 5EVIB 2W3EA 1L0GA 4EEUA 5L07A 5DF9A 1H8MA 5FAOA 4MN7A 4S2NC 5LBRA 1BLCA 1SKFA 5FI7A 4GNUA 2QJ5A 4B88A 2VV7A 3UN7A 4FH2A 5IS1A 3NCKA 5TR7A 5TBMB 2OSUA 1V9YA 3HBRA 2ZMAA 5M19A 3IX4A 3IBJA 1FCOA 4P6BA 3UMDA 3IF5A 1NRFA 3VSLA 3UO9A 2ZQCA 4F3LB 4H6JA 3AGDA 1CI8A 4FH4A 3E2LA 1K54A 3EGXC 3UY6A 1MXOA 1DJAA 2O9BA 4MDZA 2ZQ8A 1CF0A 4GD6A 1KDWA 3MXRA 3HCYA 1CEFA 2VGLM 4Y7PA 5DFXA 2W3FA 3SS4A 1PZOA 5A90A 5KSCA 4OH0A 2A24B 2V2FF 3KSHA 4HJ6A 2G2WA 4L9EA 1TDLA 3S7OA 2HDQA 1JWPA 5GHYA 3DW0A 4YOFA 4LENA 1VEUA 3EGDC 3VP4A 2VGJA 2K2NA 4R0QA 3EEAA 2EX2A 2YKFA 3V5MA 3WS5A 5HWWA 2Y2HA 4WEKA 3FKWA 3AGEA 3BY9A 2GJ3A 5TJJA 5M18A 1N9NA 2JHEA 3QNCA 3S1YA 3C7VA 4PKYG 2VX8A 4X25A 5FAQA 1ESUA 1H8YA 1S6RA 1XJ3A 4HY8A 2XFSA 2Y2MA 4X6TA 2EX9A 3CWFA 3ZNYA 2WADA 2JKGA 4PM6A 4BL3A 4X68A 2MJ6A 1J3WA 1K56A 3NIAA 4R3JA 1F9IA 3MSHA 3VP1A 1K0KA 3V3RA 5KSHA 3C4OA 3VMAA 3PAGA 1SCWA 1K54C 3VP2A 4R3AA 5KZHA 3P7NA 3MKFA 3IF6B 1YKDA 5F82A 3NOPC 3EQUA 2Z2MB 2C6WB 4PKYA 3P09A 1HLUP 1E3UD 5HPFA 5EM0A 1BULA 4P85A 5EVIC 3A3IA 3ICYA 4MBFA 3NHQA 3UDFA 4NXGA 4IUKA 2X71A 3A3FA 4Y0OA 3L9KA 1A0KA 3S7PA 5F6AA 4OQ0A 4JF4A 3ULFA 4PPRA 2ZBBA 1ZHHB 1NWZA 4B4XA 1DRMA 1Y54A 5FI2A 3DTEA 3NDGA 2VJWA 4JF6A 1L2SA 3HL9A 5AVEA 1E25A 5KMWA 3OZHA 3WS4A 2V0UA 3FPWA 5FQIA 4GS9A 1VETB 3BQ8A 1FIKA 1O07A 1G6AA 1F5MA 1XPBA 1AXBA 1WE4A 2IA2A 4N1XA 2ZQ9A 4GJ4A 3H7WA 4IBRA 1I2WA 3HUNA 3SS3A 4F94A 4PM9A 5FQKA 1MY8A 1LL5A 4JXGA 1BZAA 4YWZA 2XFTA 4KZ5A 3RXWA 2L0WA 5CHJA 3VV4A 4R6LA 1GSWA 3IWQA 3BFEA 3C8CA 2HV1A 5I94A 3Q7VB 1T18A 1E3UA 2IWCA 3IXDA 2IWDA 4ZJ2A 3NOTC 2VGKA 3P01A 1F98A 2Y55A 4WMCD 1ES2A 4R3BA 5CHUA 4MCWA 3ISGA 3PBNA 1EI5A 1JTGA 4QHCA 1NLZA 4HH3A 3UE0A 3KSFA 4NXEA 5FASA 3DTKA 3U4LP 4XT2A 2K31A 2V1ZA 1SKOB 3PAEA 1KE3A 2EWVA 2G7UA 4EU0A 4QU3A 2EFUA 4BQMA 4OVDA 4YINA 4R1GA 4GDBA 3T12B 3RXXA 3KYZA 3MFXA 1ONGA 4GOGA 4KUOA 3SH8A 1LSVA 4JGRA 4OP8A 1YQSA 5E2HA 1HVBA 1Q2PA 1XXMA 2Y2PA 5EM1A 1L0DA 3D4FA 3NECA 2ZQDA 3E4QA 2XQZA 1NYYA 3ZCZA 1RGZA 4NXBA 1Z09A 4NG2A 3QP8A 4QB8A 4WN5A 2W3GA 4ZJ1A 2HJEA 4BD1A 3W4OA 1DY6A 3IX8A 5FA7A 3SH9A 4DKIA 3F1NA 4MN6A 2J7VA 4DJ3A 1OTDA 1HD8A 1PWCA 3GDIA 1YSPA 5FEFA 2V8FA 1N9BA 1XJ4A 5L8MA 5GLAA 1AWIA 3OPLA 3DWKA 2HGVA 1ODVA 3T1XA 2KLIA 1H8ZA 1G28A 4JXWA 3Q07A 4E3NA 4MMNA 3A3EA 1NZUA 3E4OA 4HQAA 4LV2A 4ETXA 5IU1A 3MXSA 3ZFZA 1OPXA 3F1OA 4ME4A 5EVEA 3RFBA 4C6YA 3DAVA 5DF8A 4NXFA 4R4RA 4B93A 4GHIB 5HSQA 4EBLA 1FR1A 2WGWB 2VKSA 4EERA 1BUEA 3GQZA 3SOIA 5EVLA 3B47A 3PHYA 2WUQA 4UAAA 5HD5A 3LEZA 4EWFA 4LGWA 3TG9A 3NY4A 3UDXA 3UB9A 2ZD8A 1H3QA 4JF5A 4O7DA 1FCMA 1MKIA 4DDSA 4OQGA 1XFNA 1MWSA 1FSYA 4OPRA 1KE0A 1CEGA 2OLUA 3H82B 2V20A 5HD3A 2JN7A 1W7FA 1ESIA 1IKGA 1K55A 3LI9A 1Z6FA 5G18A 4BD0A 5DKLA 2EX6A 4OLGA 5AQBA 2XF3A 4M4XA 1P9RA 3HLDA 1U60A 3C5AA 1SDNA 4KZ4A 1OT9A 4GDNA 4WELA 1W63Q 4IEDA 2QHKA 3QNBA 4E6XA 1BTLA 2Y79A 2BLSA 4UQIM 2OAP1 4M3KA 1OTAA 2INWA 1LI0A 4KQDA 5DKKA 5HZHA 1S4RA 3F1PA 4BBVA 1GHPA 3MR0A 2O9AA 2HP5A 5DTKA 2PAVP 4JGOA 1CI9A 1QMFA 1GSXA 3CPTA 2ZMFA 2ZC7A 4N9KA 1XJ2A 2ACGA 1H0MA 3LIDA 2PYRA 5F69A 4P6ZM 3DTMA 1MKMA 4JBFA 3VOYA 3BJNA 1GA0A 3HLCA 2VV8A 3TE8A 2E8JA 4H6JB 4E3JA 3FKVA 3SZTA 4JGQA 2H10A 2XDMA 2Q9NA 1XJ6A 3B42A 4ID4A 4NEED 3N4IA 3PBSA 2M7VA 4Y0UA 3LR3A 3MJQA 1K55C 3VFFA 4EUZA 3HLFA 1NRJA 4I38A 4C75A 1S4SA 4S2KA 2VLGA 3OPHA 3V50A 3CITA 1I5QA 4KG6A 2ZLYA 1V9ZA 5FQQA 4QPRA 1HTZA 1MWRA 1NJ4A 5AQ7A 4KZ8A 5EV0A 2FFFB 1VEUB 5FAPA 4UA6A 4EV4A 4R70A 1G68A 1K56D 2B18A 2PT7A 1T1BA 5GLCA 1YAXA 5G4ZA 1D06A 5KIZA 1CQAA 2ZOIA 1ZKJA 3GV9A 2Q9MA 3CG5A 1WYBA 1QMEA 3IXHA 4K0WA 3UE6A 1O7EA 2HPBA 4WBGA 2Y2GA 2XA7M 1Y28A 4DXBA 2ZQAA 4WEJA 1DP6A 1ZC2A 5F1GA 5HARA 4BBUA 3OLOA 4Y5FA 3MBZA 1HZOA 4N1HA 3JPUA 3IHAA 1OJGA 2HP6A 3V39A 4DE3A 3HREA 3W2ZA 5EE8A 1FQGA 1JNUA 4S2IA 4MBHA 1IYOA 1OJ5A 4BLMA 4Y15A 3UE1A 2X01A 3EWKA 1PYYA 5AJGA 5DTSA 4FUWA 1JWVA 1P0ZA 1XFQA 5HW3A 3B33A 5A91A 2OWJA 3G4PA 2ZM0A 2Y2KA 5CERA 4K08A 1LL8A 2VV6A 2R78A 2WZXA 4S2LA 3NJAA 2OLVA 4GS9B 2Y2LA 4XUXA 3MQ0A 3AGFA 2QPNA 4OPZA 3IS2A 4B4ZA 3G34A 1PI5A 3R4KA 3T4SA 1MC0A 3R7WA 1LSXA 3FG8A 3DWZA 3H7WB 2WKPA 4RYEA 2H5SA 2ZC4B 4X1MA 3UB7A 4KG2A 1ERMA 1S1YA 5D3OA 2PR5A 2ZJ9A 1FOFA 4R23A 1PIOA 1K38A 2YKHA 2ZL1A 1PWGA 3IXGA 3BYDA 4DMZA 5IT5A 1C3BA 4QJGA 4WM9A 4II7A 3UB5P 3IX3A 2VEAA 3PR6A 5CTNA 2E8IA 4EEPA 1ZTUA 3V3SA 1L0FA 3S7NA 2WKHA 3T4JA 1PI4A 1TS8A 4UA9A 2XD1A 4OPQA 2Y2NA 3CJMA 5CTMA 2JKTM 1Q2QA 1YLYA 1LT0A 3N7WA 4BMWA 2EA9A 1ERQA 4LLOB 2J3WA 3T50A 4RA7A 5HL1A 2Y2JA 3NDEA 2Y2IA 3NBLA 4D60A 1NYMA 4IVIA 4ZAMA 3ZG9B 1K6RA 2GZAA 4XT2B 3L7HA 4KQOA 4CQHA 5G4YA 3PBOA 3WS2A 1CJFA 3GSGA 4EETB 3TSGA 4Y2FA 1N9OA 2PU4A 1UGUA 5EOEA 4JLFA 4KZ7A 3GR2A 1FILA 4X1LA 1FSWA 3DTIA 1ONHA 4P87A 2CMNA 4L9FA 3CI6A 1K57A 2WKEA 1DJBA 4YFMA 2X02A 2XROA
chains in the Genus database with same CATH topology
3ZYTA 1OTBA 3VE3A 1STZA 2XSSA 3E4OA 2PR6A 2B02A 3EQVA 4HQAA 4OOLA 4ETXA 5IU1A 4F3LA 1OPXA 3F1OA 3FC7A 4ME4A 3RFBA 4MN5A 4OOMA 3TW8A 3LFVA 1BYWA 4NXFA 3K3CA 4BBTA 4HJ4A 4ARZA 5J4EA 2J80A 4B93A 2HF6A 1P97A 3F1NB 4GHIB 2FZ0A 5HSQA 3S7QA 1OTIA 4LPZA 3VOLA 2VKSA 4EERA 3G6OA 3C30A 3V67A 1WA9A 1NLYA 3B47A 2V1AA 3PHYA 4FOFA 2W3EA 5HD5A 4EEUA 4HP4A 2A24A 5DF9A 1H8MA 3DBAA 4MN7A 2QWSA 2O9CA 5LBRA 3EOIA 3LIBA 3BY8A 2WKQA 3RH8B 2Z6DA 1T1AA 2QJ5A 3UB9A 1H3QA 2VV7A 2PDRA 3EEHA 5IS1A 1XFNA 3CUEA 5TBMB 2GNXA 1V9YA 3K2NA 4HP9A 3H82B 5HD3A 2JN7A 3IBJA 3A0VA 3UMDA 2FH5A 3KYQA 4HNBA 2W3HA 5DJUA 2L1MA 3LI9A 4F3LB 3E4PA 4H6JA 3F1OB 5DKLA 1T1CA 3O5YA 2D01A 3CLOA 4IJGA 4M4XA 1P9RA 2J3TC 2D02A 3EGXC 2V0WA 4MDZA 2O9BA 2K7SA 4ARZB 3LIFA 3TJZC 1OT9A 5HDCA 4WELA 1P9WA 1W63Q 2Z6CA 4NKPA 3KX0X 4UQIS 2VGLS 2QHKA 4BWIA 3HCYA 2Y79A 5HDDA 1W63M 3UB6A 3OC2A 4UQIM 2OAP1 2VGLM 3K3DA 1GSVA 1OTAA 2INWA 5DFXA 2W3FA 4UEYA 4KQDA 5DKKA 5HZHA 1S4RA 2O99A 3KSHA 3F1PA 2A24B 4BBVA 2WKRA 3MR0A 4HJ6A 2O9AA 2XRNA 4L9EA 3FPVA 3S7OA 4JGOA 4YOFA 1GSXA 2ZMFA 3LR4A 4P6ZS 5C5KA 1XJ2A 2O0YA 2NUPC 3KSIA 3LIDA 2DMWA 2PYRA 3EGDC 4PHTA 5F69A 2K2NA 2W3DA 4P6ZM 3EEAA 2YKFA 4YNRA 4LRYC 5HWWA 5HWVA 4WEKA 3PYPA 3BY9A 2GJ3A 5TJJA 1N9NA 3GECA 2JHEA 4LRXC 1MKMA 4PKYG 2VX8A 3BJNA 2PYPA 4CLCA 1TD5A 1XJ3A 2VV8A 4HY8A 3TE8A 5HL6A 4H6JB 3CUEC 3CWFA 4JGQA 1XJ6A 2JKTI 3B42A 1OT6A 3HJIA 4NEED 3KSGA 5F68A 2MJ6A 3PBSA 1N9LA 2M7VA 3H9WA 2KX6A 2BASA 3LR3A 3MJQA 1F9IA 1NRJA 1UWNX 4I38A 5HWTA 3PBTA 1S4SA 4GCZA 5KSHA 3PBRA 2VLGA 3D72A 2M1CA 3CITA 3F1PB 3UMEA 1LSWA 4R3AA 4CLCD 1V9ZA 3P7NA 2KOIA 4QPRA 2PHYA 1YKDA 2OOLA 3NOPC 3EQUA 4R38A 4I39A 4PKYA 3LIEA 5F5YA 5HPFA 4R70A 2JKRM 3ICYA 4IHQA 3LR5A 2B18A 2PT7A 3NHQA 2ZMVA 4NXGA 4IUKA 1T1BA 3ZQ5A 4HH2A 2QJ7A 4ETZA 3S7PA 3TRCA 1YAXA 1OTEA 2LB9A 5F6AA 4CLCB 3ULFA 5G4ZA 1D06A 5KIZA 2QYBA 2ZBBA 1ZHHB 2ZOIA 1VHMA 1NWZA 1DRMA 5J7EA 2XA7S 3LI8A 2VJWA 1S66L 3UE6A 4CLCE 2XA7M 5AVEA 4E04A 1Y28A 4O01A 2V0UA 4RQ9A 3FPWA 5HPIA 4WEJA 1DP6A 2W1TA 1TS0A 4L0LA 4GS9A 4BBUA 3OLOA 5DFYA 3OOVA 4Y5FA 3BWLA 3BQ8A 3NOUC 5EFWA 3OCNA 1F5MA 2IA2A 2GX5A 1OJGA 4GJ4A 5DJTA 1TS7A 3H7WA 2P08A 3IBRA 4HIAA 3W2ZA 1JNUA 2W0NA 3UB8A 2L4RA 4YWZA 1KOUA 5K5BA 4L9GA 1OJ5A 2L0WA 5AVFA 4Q0IA 2NUTC 5CX7A 3VV4A 3EWKA 2M7UA 5AJGA 4R6LA 4PAUA 3LICA 1GSWA 3A0SA 3PXPA 4HI4A 1P0ZA 4EUVA 1XFQA 3C8CA 4JGPA 2HV1A 3OBFA 3B33A 2OWJA 1TS6A 2V9AA 3RTYA 1T18A 2OAQ1 3T4KA 1IOUA 3C38A 3T4TA 3NOTC 5MC7A 4BJPA 2H28A 5FL3A 4DJ2A 3P01A 1F98A 4GW9A 1S1ZA 4K08A 4O8GA 1LL8A 2VV6A 2R78A 3NJAA 3MQQA 4I3IA 2W1TB 4GS9B 2VZWA 4Z1WA 4MCWA 3MQ0A 2LB5A 3PBNA 2KDKA 1MZUA 3IS2A 2QKPA 3T4LA 4I3AA 3U2AA 3R4KA 2EWWA 4IUHA 3T4SA 5I5LA 1MC0A 1NLZA 4HH3A 1UWPX 3R7WA 1LSXA 3FG8A 3KSFA 3H7WB 2WKPA 1IFQA 4NXEA 1VB6A 3A0RA 2J3TD 4EESA 4XT2A 2K31A 3OCLA 3UB7A 4Q0JA 4WLAA 3SW1A 2EWVA 2PD7A 2G7UA 4DN0A 4EU0A 1S1YA 2PR5A 2W1RA 2YKHA 3KYZA 2Y8HA 1X0OA 3MFXA 1S67L 3LUQA 4KUOA 1LSVA 4JGRA 3MXQA 4DMZA 5IT5A 4LRZE 4II7A 3D3OA 4KUKA 3PR6A 2VEAA 4FSFA 1D7EA 4EEPA 1ZTUA 5HDSA 2I9VA 4Y3IA 4EQ1A 3S7NA 2VA0A 4WF0A 3T4JA 4CLCC 3E4QA 1DP8A 4G3WA 1TF1A 4I5SA 4G3KA 1TS8A 4I3JA 1DP9A 4NXBA 2P04A 2JKTM 2HJ9C 3CAXA 4B9OA 4EW7A 4WN5A 2W3GA 1LT0A 4BMWA 2EA9A 2HJEA 3C2WA 3PBQA 3IS2B 2J3WA 3LR0A 4HHDA 4LLOB 3T50A 3T4QA 4HJ3A 5J3WA 2PD8A 4O0PA 3KO6A 3VE4A 3MQOA 2V1BA 3E98A 3R7WB 3F1NA 4MN6A 4GHIA 4DJ3A 2GZAA 4EXOA 1OTDA 5A8BA 3UE3A 3JVVA 4XT2B 4KQOA 3MMHA 4CQHA 5G4YA 3GDIA 3PBOA 1YSPA 2ZOHA 4G3VA 3MF0A 4EETB 2JKRI 1XJ4A 5L8MA 4Y2FA 4HOIA 4WL9A 2A2LA 3LIAA 1N9OA 3JVUA 1G6OA 1EW0A 1UGUA 2HGVA 2OWHA 4GLQA 1ODVA 2KLIA 4WUJA 2P7JA 1G28A 4ZRRA 4AFIA 4Q0HA 2W27A 3HJKA 3E0YA 1YSQA 2CMNA 5TBMA 4L9FA 4MMNA 3CI6A 3LYXA 3T4OA 3BQAA 3H82A 2XROA 3BW6A 1T19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTB A;  3VE3 A;  3E4O A;  2PR6 A;  2B02 A;  4HQA A;  5IU1 A;  4F3L A;  3F1O A;  3FC7 A;  4MN5 A;  1BYW A;  4NXF A;  3K3C A;  4BBT A;  4HJ4 A;  5J4E A;  2J80 A;  1P97 A;  3F1N B;  4GHI B;  5HSQ A;  1OTI A;  4LPZ A;  3VOL A;  4EER A;  3G6O A;  1WA9 A;  2V1A A;  3PHY A;  5HD5 A;  4EEU A;  4HP4 A;  2A24 A;  2QWS A;  3LIB A;  3BY8 A;  2WKQ A;  3RH8 B;  2Z6D A;  1T1A A;  2QJ5 A;  3UB9 A;  2VV7 A;  2PDR A;  3EEH A;  5IS1 A;  1XFN A;  5TBM B;  1V9Y A;  4HP9 A;  3H82 B;  5HD3 A;  2JN7 A;  3A0V A;  3UMD A;  4HNB A;  5DJU A;  2L1M A;  3LI9 A;  4F3L B;  3E4P A;  4H6J A;  3F1O B;  5DKL A;  1T1C A;  2D01 A;  3CLO A;  4M4X A;  2D02 A;  2V0W A;  2K7S A;  3LIF A;  1OT9 A;  5HDC A;  2Z6C A;  3KX0 X;  2QHK A;  5HDD A;  3UB6 A;  3K3D A;  1GSV A;  1OTA A;  2INW A;  4KQD A;  5DKK A;  5HZH A;  1S4R A;  3F1P A;  2A24 B;  4BBV A;  4HJ6 A;  3MR0 A;  2WKR A;  4L9E A;  4JGO A;  1GSX A;  1XJ2 A;  3LID A;  2PYR A;  5F69 A;  2YKF A;  4LRY C;  5HWW A;  5HWV A;  3PYP A;  3BY9 A;  2GJ3 A;  1N9N A;  3GEC A;  2JHE A;  4LRX C;  4PKY G;  2PYP A;  1XJ3 A;  2VV8 A;  4HY8 A;  4H6J B;  3CWF A;  4JGQ A;  1XJ6 A;  1OT6 A;  3HJI A;  5F68 A;  1N9L A;  3H9W A;  2KX6 A;  2BAS A;  3MJQ A;  1F9I A;  1UWN X;  4I38 A;  5HWT A;  4GCZ A;  1S4S A;  2VLG A;  3D72 A;  2M1C A;  3F1P B;  3UME A;  1LSW A;  4R3A A;  1V9Z A;  3P7N A;  2PHY A;  2OOL A;  3NOP C;  4R38 A;  4I39 A;  4PKY A;  3LIE A;  5F5Y A;  4R70 A;  3ICY A;  3NHQ A;  4NXG A;  1T1B A;  3ZQ5 A;  4HH2 A;  2QJ7 A;  1OTE A;  5F6A A;  3ULF A;  5G4Z A;  1D06 A;  5KIZ A;  2ZBB A;  2ZOI A;  1NWZ A;  1DRM A;  5J7E A;  3LI8 A;  1S66 L;  3UE6 A;  5AVE A;  4E04 A;  1Y28 A;  2V0U A;  4RQ9 A;  1DP6 A;  1TS0 A;  4GS9 A;  4BBU A;  3OLO A;  3BWL A;  3NOU C;  5EFW A;  1OJG A;  5DJT A;  1TS7 A;  3H7W A;  3IBR A;  4HIA A;  1JNU A;  2W0N A;  3UB8 A;  2L4R A;  4YWZ A;  1KOU A;  4L9G A;  1OJ5 A;  2L0W A;  5AVF A;  3EWK A;  4R6L A;  3LIC A;  1GSW A;  3A0S A;  4HI4 A;  1P0Z A;  1XFQ A;  3C8C A;  4JGP A;  2HV1 A;  3B33 A;  2OWJ A;  1TS6 A;  2V9A A;  3RTY A;  1T18 A;  3NOT C;  2H28 A;  4DJ2 A;  1F98 A;  4GW9 A;  1S1Z A;  4K08 A;  1LL8 A;  2VV6 A;  2R78 A;  3NJA A;  3MQQ A;  4I3I A;  4GS9 B;  2KDK A;  1MZU A;  3IS2 A;  2QKP A;  4I3A A;  5I5L A;  4HH3 A;  1UWP X;  1LSX A;  3FG8 A;  3H7W B;  2WKP A;  4NXE A;  1VB6 A;  3A0R A;  4EES A;  4XT2 A;  3UB7 A;  4WLA A;  3SW1 A;  2PD7 A;  1S1Y A;  2PR5 A;  2YKH A;  1X0O A;  3MFX A;  1S67 L;  3LUQ A;  4KUO A;  1LSV A;  4JGR A;  3MXQ A;  4LRZ E;  4KUK A;  2VEA A;  1D7E A;  4EEP A;  5HDS A;  2I9V A;  4EQ1 A;  4WF0 A;  3E4Q A;  1DP8 A;  4I5S A;  1TS8 A;  4I3J A;  1DP9 A;  4NXB A;  4B9O A;  3CAX A;  4EW7 A;  4WN5 A;  1LT0 A;  2EA9 A;  3C2W A;  4HHD A;  4LLO B;  3IS2 B;  3T50 A;  4HJ3 A;  5J3W A;  2PD8 A;  3VE4 A;  3MQO A;  2V1B A;  3F1N A;  4MN6 A;  4GHI A;  4DJ3 A;  4EXO A;  1OTD A;  5A8B A;  4XT2 B;  5G4Y A;  3GDI A;  2ZOH A;  4EET B;  1XJ4 A;  4HOI A;  4WL9 A;  3LIA A;  1N9O A;  1EW0 A;  1UGU A;  2OWH A;  1ODV A;  4WUJ A;  2P7J A;  1G28 A;  2W27 A;  3HJK A;  2CMN A;  5TBM A;  4L9F A;  3LYX A;  3H82 A;  1T19 A; 
#chains in the Genus database with same CATH topology
 1OTB A;  1YLZ A;  2XSS A;  4OOL A;  2HDS A;  5IHV A;  1W8Y A;  1RP5 A;  4RVA A;  3LFV A;  1BYW A;  4GB7 A;  1JWZ A;  5GHZ A;  4HJ4 A;  4ARZ A;  5J4E A;  3Q82 A;  3T1R A;  3F1N B;  3S7Q A;  4LPZ A;  5FSR A;  1BT5 A;  4PM8 A;  2PBD P;  3G6O A;  1GA9 A;  5U47 A;  2DCF A;  1WA9 A;  3G2Z A;  2C5W B;  4HBT A;  4JXS A;  1MPL A;  1KVL A;  2QWS A;  3LIB A;  1LI9 A;  3BY8 A;  2WKQ A;  3RH8 B;  1T1A A;  1PNE A;  3TOI A;  3EEH A;  3CUE A;  2GNX A;  4NET A;  1E4D A;  1EWZ A;  3K2N A;  5E43 A;  3A0V A;  3ZVW A;  3KYQ A;  4HNB A;  4DRT A;  4LCL A;  4WZ4 A;  2GDN A;  3ZDJ A;  3E4P A;  3F1O B;  1T1C A;  3MKE A;  1ZG4 A;  3CLO A;  3VOZ A;  3T1Q B;  5FDS A;  1L0E A;  3N8S A;  5TFQ A;  3MS6 A;  2V0W A;  3E2K A;  2RL3 A;  3IH9 A;  3HLW A;  3CMZ A;  3IXB A;  5HDC A;  1ES4 A;  5CHM A;  1P9W A;  2Z6C A;  4NKP A;  3C7U A;  4XUZ A;  3KX0 X;  5F1F A;  1J9M A;  2VGL S;  1IYS A;  1W63 M;  3UB6 A;  3OC2 A;  1YMS A;  4JXV A;  4E3K A;  1KGE A;  3K3D A;  1GSV A;  3Q7Z A;  1IYP A;  2WYX A;  2WKR A;  5EEC A;  2WK0 A;  1YLP A;  5GL9 A;  3W4Q A;  2NUP C;  2DMW A;  4PHT A;  4BEN A;  3G35 A;  3BEB A;  4YNR A;  1PW1 A;  4LRY C;  1KGG A;  5HWV A;  3UPO A;  3N8L A;  4MLL A;  2UWX A;  2VK3 A;  4DF6 A;  4MNR A;  2XK1 A;  4CLC A;  1TD5 A;  2HP9 A;  3WS1 A;  3IHB A;  5HL6 A;  3CUE C;  3FWL A;  5HAP A;  4GD8 A;  2JKT I;  3A3J A;  5EUA A;  1N9L A;  1ES5 A;  3H9W A;  2KX6 A;  2P9V A;  5AQA A;  3BLM A;  3HLE A;  1UWN X;  3Q1F A;  5HWT A;  3PBT A;  4GCZ A;  3T1S A;  4UA7 A;  3PBR A;  4KZA A;  4KZ6 A;  1MBL A;  2JC7 A;  3D72 A;  2M1C A;  3ZHH A;  5BOH A;  3PTE A;  2WAF A;  3F1P B;  3UPN A;  1YLW A;  3LY4 A;  3BRM A;  5CEB A;  4FD8 A;  2PHY A;  3CPT B;  3FZC A;  5L09 A;  1MWU A;  1TEM A;  5FQM A;  3M6B A;  1XGJ A;  2JKR M;  2ZC5 B;  4IHQ A;  3LR5 A;  4QWO A;  2ZMV A;  1ERO A;  4KEN B;  3ZQ5 A;  4HH2 A;  4ETZ A;  3TRC A;  5TGF A;  4HEF A;  1OTE A;  3M6H A;  2QYB A;  2Y59 A;  3VP0 A;  4IBX A;  5FEG A;  4CLC E;  4C3Q A;  3QHY A;  4QY6 A;  4X53 A;  5HPI A;  2W1T A;  1XKZ A;  4KZ3 A;  4L0L A;  3OOV A;  3BM6 A;  2PBY A;  3NOU C;  3OCN A;  1MWT A;  5J8X A;  2GX5 A;  3ZVT A;  1YLT A;  5GLD A;  3OPP A;  2R9X A;  5DJT A;  4EBN A;  2Y2O A;  4DE0 A;  4GN2 A;  3IBR A;  3IH8 A;  4JPM A;  4Y0T A;  4N9L A;  2L4R A;  3UDI A;  4LV1 A;  3IWO A;  3IT9 A;  5K5B A;  1LHY A;  3CHW P;  5AVF A;  4E3M A;  2JKF A;  2DNS A;  1TDG A;  5DTT A;  4PAU A;  3A0S A;  1CK3 A;  3PXP A;  4EUV A;  4JGP A;  4KG5 A;  2EX8 A;  2V9A A;  1BLH A;  2OAQ 1;  1JVJ A;  4Q8I A;  3T4K A;  1IOU A;  3T4T A;  5MC7 A;  2H28 A;  5FL3 A;  2Z2L B;  4GW9 A;  3ITA A;  3O86 A;  2RCX A;  1IKI A;  2Y91 A;  1PZP A;  1W79 A;  1RGY A;  2VZW A;  1M6K A;  1IEM A;  5JYP A;  1XX2 A;  2XR0 A;  2KDK A;  3HVF A;  1MZU A;  1M40 A;  2EWW A;  5I5L A;  2WAE A;  2QMI A;  1IFQ A;  1VB6 A;  1YMX A;  2J3T D;  3ZG8 B;  2PD7 A;  4DN0 A;  2R9W A;  3D9Y A;  2Y8H A;  4ZDX A;  1FCN A;  3C4P A;  1S67 L;  1LL9 A;  2FFY A;  1BSG A;  3MXQ A;  4LCM A;  2ZM2 A;  4LRZ E;  4KUK A;  4S2P A;  4FSF A;  5E2E A;  1VQQ A;  3Q81 A;  4X55 A;  3SS5 A;  4EQ1 A;  2VA0 A;  2AVX A;  4WF0 A;  2IWB A;  1GHI A;  4HBU A;  4OP5 A;  1DP8 A;  1TF1 A;  1DP9 A;  2HJ9 C;  3CAX A;  4EW7 A;  2A49 A;  1LLB A;  4HHD A;  3PBQ A;  3IS2 B;  2PD8 A;  5CXW A;  4OPY A;  4O0P A;  4K91 A;  4MBK A;  3KO6 A;  3VE4 A;  3E98 A;  3R7W B;  1WYC A;  4LV3 A;  5FQ9 A;  5M1A A;  4A5R A;  3LY3 A;  4EXO A;  2Q0O A;  4KZB A;  5HX9 A;  5A8B A;  3UE3 A;  3JVV A;  3MMH A;  4E3O A;  5DVA A;  4WYY A;  5EVI A;  3W8K A;  3MF0 A;  1K4F A;  1NZO A;  3LGO A;  1GHM A;  2JKR I;  1Y4O A;  2PRF A;  2ZL1 B;  4WL9 A;  2A2L A;  3P98 A;  4X56 A;  3VP3 A;  1EW0 A;  4GLQ A;  3HUO A;  4MEZ A;  4WUJ A;  2EXA A;  2P7J A;  4AFI A;  4ZRR A;  3WRZ A;  3GMW A;  2W27 A;  4Q0H A;  3HJK A;  3E0Y A;  1YSQ A;  1VM1 A;  5TBM A;  2V8C A;  3LYX A;  4GKU A;  3O87 A;  3T4O A;  5CGW A;  1STZ A;  2B02 A;  4OOY A;  4F3L A;  1S0W A;  2JBF A;  3BEC A;  3WRT A;  4MN5 A;  2JE5 A;  4NK3 A;  4OQH A;  4BBT A;  3JYI A;  2HF6 A;  4ZBE A;  2P74 A;  2FZ0 A;  1XP4 A;  1JTD A;  4D2O A;  2WGV A;  3C30 A;  3V67 A;  2V1A A;  2QZ6 A;  4FOF A;  4HP4 A;  3B3X A;  2WKI A;  2A24 A;  2B5R A;  3DBA A;  2O9C A;  3EOI A;  3ZG7 B;  2Z6D A;  1FR6 A;  5AQ9 A;  1XA7 A;  5GHX A;  2PDR A;  3N8R A;  1BLS A;  3SH7 A;  2B95 A;  4HP9 A;  4FCF A;  1BLP A;  4OKP A;  3VFH A;  4PMA A;  2FH5 A;  3WWX A;  1K25 A;  3KYE A;  2W3H A;  5DJU A;  2L1M A;  2J9P A;  3O5Y A;  2D01 A;  4IJG A;  2J3T C;  4OLD A;  4ESP A;  2D02 A;  3OPR A;  3M2K A;  1F2K A;  3O88 A;  2K7S A;  4ARZ B;  4FTX A;  3LIF A;  3TJZ C;  2ZM8 A;  4HES A;  3NUL A;  2XD5 A;  4CJN A;  4UQI S;  4QD4 A;  4DE2 A;  4E3I A;  4BWI A;  5HDD A;  1NY0 A;  3HUM A;  3QP4 A;  3BFF A;  4JKT A;  4UEY A;  2O99 A;  2XRN A;  3FPV A;  3IF6 A;  5E2G A;  3LR4 A;  4P6Z S;  5C5K A;  2O0Y A;  3KSI A;  1L3L A;  4E3L A;  4EBP A;  2W3D A;  1XGI A;  1PRQ A;  3PYP A;  1RCJ A;  1DJC A;  3GEC A;  4LRX C;  3MZE A;  2CC1 A;  5A92 A;  3MZF A;  4KQR A;  3QP6 A;  3QP5 A;  2PYP A;  1SHV A;  2WZZ A;  1OT6 A;  3HJI A;  3KSG A;  5F68 A;  1KE4 A;  4U0T A;  5EOO A;  2BAS A;  3ITB A;  4WZ5 A;  1ALQ A;  3NI9 A;  5FDH A;  1I2S A;  4DE1 A;  3S22 A;  4QY5 A;  1VET A;  2XLN A;  3UME A;  1LSW A;  4E6W A;  4CLC D;  2KOI A;  2DRW A;  2OOL A;  1PFL A;  4K0X A;  4R38 A;  4I39 A;  1OME A;  4S2M A;  3LIE A;  5F5Y A;  5CEC A;  4S2J A;  3G2Y A;  2A3U A;  1SZV A;  4U3T A;  1PW8 A;  2QJ7 A;  3IF6 C;  2OV5 A;  2LB9 A;  4CLC B;  5HFO A;  4PM7 A;  1IEL A;  2HZ5 A;  1VHM A;  4KZ9 A;  5CED A;  5J7E A;  5CGX A;  1K57 C;  1IYQ A;  3Q7V A;  2XA7 S;  3LI8 A;  4UHU A;  1S66 L;  2P9V B;  3ZG5 A;  1YPR A;  1TVF A;  4E04 A;  4O01 A;  1W8Q A;  1ES3 A;  3UPP A;  4RQ9 A;  4RX3 A;  3IQA A;  5JYO A;  1TS0 A;  5DFY A;  3BWL A;  4LV0 A;  4Y13 A;  5EFW A;  4WZ5 C;  2Y4A A;  4Y17 A;  3UNW A;  1TS7 A;  2P08 A;  4HIA A;  4EQI A;  4WMC A;  1SKO A;  2W0N A;  3UB8 A;  2HDR A;  5A93 A;  5DF7 A;  4DDY A;  4ZJ3 A;  1KOU A;  1YLJ A;  4L9G A;  1PWD A;  2EFX A;  4Q0I A;  2NUT C;  2H0T A;  5CX7 A;  2M7U A;  3LIC A;  4U0X A;  4KQQ A;  4HI4 A;  3OBF A;  1TS6 A;  3RTY A;  5F83 A;  1K6S A;  3N6I A;  3C38 A;  3GRJ A;  5FQJ A;  4BJP A;  4DJ2 A;  1S1Z A;  4O8G A;  3NC8 A;  2BG1 A;  2Y2Q A;  3G31 A;  3MQQ A;  3ZGA B;  4I3I A;  2W1T B;  3BFG A;  2EXB A;  3IWI A;  5L10 A;  4IVK A;  4Z1W A;  4PM5 A;  3FYZ A;  4RX2 A;  2LB5 A;  3GTC A;  1ACF A;  3T4L A;  1ZG6 A;  2QKP A;  4I3A A;  3U2A A;  1W5D A;  4IUH A;  2G2U A;  1H5X A;  1UWP X;  5EPH A;  5FI6 A;  3O3V A;  2J8Y A;  3A0R A;  4EES A;  2J9O A;  3OCL A;  1KVM A;  4Q0J A;  4WLA A;  3SW1 A;  2XEP A;  3A3D A;  2W1R A;  3HLG A;  3FV7 A;  1KDS A;  2ZC3 B;  1NXY A;  1X0O A;  5E2F A;  3HLB A;  3ZG0 A;  3LUQ A;  3RJU A;  5CGS A;  3D3O A;  2ZQ7 A;  1D7E A;  5HDS A;  2I9V A;  4Y3I A;  4CLC C;  4G3W A;  2XGN A;  3LCE A;  4I5S A;  3M2J A;  4G3K A;  4I3J A;  2BTF P;  4P0M A;  2P04 A;  4OON A;  4B9O A;  4DXC A;  1K4E A;  3LEQ A;  3C2W A;  3T4Q A;  3LR0 A;  2ZC6 B;  4HJ3 A;  5J3W A;  2I72 A;  4H8R A;  1N4O A;  3BFD A;  3MQO A;  2V1B A;  4S2N A;  4GHI A;  3ZNT A;  1YM1 A;  2WGW A;  1KGF A;  3MFD A;  4Z9Q A;  2HDU A;  4BL2 A;  2ZOH A;  4G3V A;  4HOI A;  3BFC A;  3LIA A;  5HAI A;  3JVU A;  3VSK A;  1G6O A;  4OQI A;  2OWH A;  4X69 A;  2H0Y A;  4ZTK A;  2PU2 A;  1SDE A;  5L2F A;  4R4S A;  3LO7 A;  3BLS A;  5CRF A;  3G32 A;  4CPK A;  4N92 A;  4LFU A;  3BQA A;  3H82 A;  3BW6 A;  1T19 A;  3ZYT A;  3WS0 A;  3I7J A;  3VE3 A;  3G30 A;  2PR6 A;  3EQV A;  5EVI D;  4GZB A;  1GCE A;  3W4P A;  5GLB A;  3FC7 A;  4OOM A;  3CZD A;  4XXR A;  3TW8 A;  2JCH A;  1YT4 A;  1XA1 A;  1G5U A;  3QP2 A;  3K3C A;  2WGI A;  2J80 A;  4S2O A;  3MZD A;  1P97 A;  3GVB A;  3QP1 A;  1OTI A;  2UV0 E;  3VOL A;  3S4X A;  5HAQ A;  1D1J A;  5FAT A;  1NLY A;  2XH9 A;  5EVI B;  2W3E A;  1L0G A;  4EEU A;  5L07 A;  5DF9 A;  1H8M A;  5FAO A;  4MN7 A;  4S2N C;  5LBR A;  1BLC A;  1SKF A;  5FI7 A;  4GNU A;  2QJ5 A;  4B88 A;  2VV7 A;  3UN7 A;  4FH2 A;  5IS1 A;  3NCK A;  5TR7 A;  5TBM B;  2OSU A;  1V9Y A;  3HBR A;  2ZMA A;  5M19 A;  3IX4 A;  3IBJ A;  1FCO A;  4P6B A;  3UMD A;  3IF5 A;  1NRF A;  3VSL A;  3UO9 A;  2ZQC A;  4F3L B;  4H6J A;  3AGD A;  1CI8 A;  4FH4 A;  3E2L A;  1K54 A;  3EGX C;  3UY6 A;  1MXO A;  1DJA A;  2O9B A;  4MDZ A;  2ZQ8 A;  1CF0 A;  4GD6 A;  1KDW A;  3MXR A;  3HCY A;  1CEF A;  2VGL M;  4Y7P A;  5DFX A;  2W3F A;  3SS4 A;  1PZO A;  5A90 A;  5KSC A;  4OH0 A;  2A24 B;  2V2F F;  3KSH A;  4HJ6 A;  2G2W A;  4L9E A;  1TDL A;  3S7O A;  2HDQ A;  1JWP A;  5GHY A;  3DW0 A;  4YOF A;  4LEN A;  1VEU A;  3EGD C;  3VP4 A;  2VGJ A;  2K2N A;  4R0Q A;  3EEA A;  2EX2 A;  2YKF A;  3V5M A;  3WS5 A;  5HWW A;  2Y2H A;  4WEK A;  3FKW A;  3AGE A;  3BY9 A;  2GJ3 A;  5TJJ A;  5M18 A;  1N9N A;  2JHE A;  3QNC A;  3S1Y A;  3C7V A;  4PKY G;  2VX8 A;  4X25 A;  5FAQ A;  1ESU A;  1H8Y A;  1S6R A;  1XJ3 A;  4HY8 A;  2XFS A;  2Y2M A;  4X6T A;  2EX9 A;  3CWF A;  3ZNY A;  2WAD A;  2JKG A;  4PM6 A;  4BL3 A;  4X68 A;  2MJ6 A;  1J3W A;  1K56 A;  3NIA A;  4R3J A;  1F9I A;  3MSH A;  3VP1 A;  1K0K A;  3V3R A;  5KSH A;  3C4O A;  3VMA A;  3PAG A;  1SCW A;  1K54 C;  3VP2 A;  4R3A A;  5KZH A;  3P7N A;  3MKF A;  3IF6 B;  1YKD A;  5F82 A;  3NOP C;  3EQU A;  2Z2M B;  2C6W B;  4PKY A;  3P09 A;  1HLU P;  1E3U D;  5HPF A;  5EM0 A;  1BUL A;  4P85 A;  5EVI C;  3A3I A;  3ICY A;  4MBF A;  3NHQ A;  3UDF A;  4NXG A;  4IUK A;  2X71 A;  3A3F A;  4Y0O A;  3L9K A;  1A0K A;  3S7P A;  5F6A A;  4OQ0 A;  4JF4 A;  3ULF A;  4PPR A;  2ZBB A;  1ZHH B;  1NWZ A;  4B4X A;  1DRM A;  1Y54 A;  5FI2 A;  3DTE A;  3NDG A;  2VJW A;  4JF6 A;  1L2S A;  3HL9 A;  5AVE A;  1E25 A;  5KMW A;  3OZH A;  3WS4 A;  2V0U A;  3FPW A;  5FQI A;  4GS9 A;  1VET B;  3BQ8 A;  1FIK A;  1O07 A;  1G6A A;  1F5M A;  1XPB A;  1AXB A;  1WE4 A;  2IA2 A;  4N1X A;  2ZQ9 A;  4GJ4 A;  3H7W A;  4IBR A;  1I2W A;  3HUN A;  3SS3 A;  4F94 A;  4PM9 A;  5FQK A;  1MY8 A;  1LL5 A;  4JXG A;  1BZA A;  4YWZ A;  2XFT A;  4KZ5 A;  3RXW A;  2L0W A;  5CHJ A;  3VV4 A;  4R6L A;  1GSW A;  3IWQ A;  3BFE A;  3C8C A;  2HV1 A;  5I94 A;  3Q7V B;  1T18 A;  1E3U A;  2IWC A;  3IXD A;  2IWD A;  4ZJ2 A;  3NOT C;  2VGK A;  3P01 A;  1F98 A;  2Y55 A;  4WMC D;  1ES2 A;  4R3B A;  5CHU A;  4MCW A;  3ISG A;  3PBN A;  1EI5 A;  1JTG A;  4QHC A;  1NLZ A;  4HH3 A;  3UE0 A;  3KSF A;  4NXE A;  5FAS A;  3DTK A;  3U4L P;  4XT2 A;  2K31 A;  2V1Z A;  1SKO B;  3PAE A;  1KE3 A;  2EWV A;  2G7U A;  4EU0 A;  4QU3 A;  2EFU A;  4BQM A;  4OVD A;  4YIN A;  4R1G A;  4GDB A;  3T12 B;  3RXX A;  3KYZ A;  3MFX A;  1ONG A;  4GOG A;  4KUO A;  3SH8 A;  1LSV A;  4JGR A;  4OP8 A;  1YQS A;  5E2H A;  1HVB A;  1Q2P A;  1XXM A;  2Y2P A;  5EM1 A;  1L0D A;  3D4F A;  3NEC A;  2ZQD A;  3E4Q A;  2XQZ A;  1NYY A;  3ZCZ A;  1RGZ A;  4NXB A;  1Z09 A;  4NG2 A;  3QP8 A;  4QB8 A;  4WN5 A;  2W3G A;  4ZJ1 A;  2HJE A;  4BD1 A;  3W4O A;  1DY6 A;  3IX8 A;  5FA7 A;  3SH9 A;  4DKI A;  3F1N A;  4MN6 A;  2J7V A;  4DJ3 A;  1OTD A;  1HD8 A;  1PWC A;  3GDI A;  1YSP A;  5FEF A;  2V8F A;  1N9B A;  1XJ4 A;  5L8M A;  5GLA A;  1AWI A;  3OPL A;  3DWK A;  2HGV A;  1ODV A;  3T1X A;  2KLI A;  1H8Z A;  1G28 A;  4JXW A;  3Q07 A;  4E3N A;  4MMN A;  3A3E A;  1NZU A;  3E4O A;  4HQA A;  4LV2 A;  4ETX A;  5IU1 A;  3MXS A;  3ZFZ A;  1OPX A;  3F1O A;  4ME4 A;  5EVE A;  3RFB A;  4C6Y A;  3DAV A;  5DF8 A;  4NXF A;  4R4R A;  4B93 A;  4GHI B;  5HSQ A;  4EBL A;  1FR1 A;  2WGW B;  2VKS A;  4EER A;  1BUE A;  3GQZ A;  3SOI A;  5EVL A;  3B47 A;  3PHY A;  2WUQ A;  4UAA A;  5HD5 A;  3LEZ A;  4EWF A;  4LGW A;  3TG9 A;  3NY4 A;  3UDX A;  3UB9 A;  2ZD8 A;  1H3Q A;  4JF5 A;  4O7D A;  1FCM A;  1MKI A;  4DDS A;  4OQG A;  1XFN A;  1MWS A;  1FSY A;  4OPR A;  1KE0 A;  1CEG A;  2OLU A;  3H82 B;  2V20 A;  5HD3 A;  2JN7 A;  1W7F A;  1ESI A;  1IKG A;  1K55 A;  3LI9 A;  1Z6F A;  5G18 A;  4BD0 A;  5DKL A;  2EX6 A;  4OLG A;  5AQB A;  2XF3 A;  4M4X A;  1P9R A;  3HLD A;  1U60 A;  3C5A A;  1SDN A;  4KZ4 A;  1OT9 A;  4GDN A;  4WEL A;  1W63 Q;  4IED A;  2QHK A;  3QNB A;  4E6X A;  1BTL A;  2Y79 A;  2BLS A;  4UQI M;  2OAP 1;  4M3K A;  1OTA A;  2INW A;  1LI0 A;  4KQD A;  5DKK A;  5HZH A;  1S4R A;  3F1P A;  4BBV A;  1GHP A;  3MR0 A;  2O9A A;  2HP5 A;  5DTK A;  2PAV P;  4JGO A;  1CI9 A;  1QMF A;  1GSX A;  3CPT A;  2ZMF A;  2ZC7 A;  4N9K A;  1XJ2 A;  2ACG A;  1H0M A;  3LID A;  2PYR A;  5F69 A;  4P6Z M;  3DTM A;  1MKM A;  4JBF A;  3VOY A;  3BJN A;  1GA0 A;  3HLC A;  2VV8 A;  3TE8 A;  2E8J A;  4H6J B;  4E3J A;  3FKV A;  3SZT A;  4JGQ A;  2H10 A;  2XDM A;  2Q9N A;  1XJ6 A;  3B42 A;  4ID4 A;  4NEE D;  3N4I A;  3PBS A;  2M7V A;  4Y0U A;  3LR3 A;  3MJQ A;  1K55 C;  3VFF A;  4EUZ A;  3HLF A;  1NRJ A;  4I38 A;  4C75 A;  1S4S A;  4S2K A;  2VLG A;  3OPH A;  3V50 A;  3CIT A;  1I5Q A;  4KG6 A;  2ZLY A;  1V9Z A;  5FQQ A;  4QPR A;  1HTZ A;  1MWR A;  1NJ4 A;  5AQ7 A;  4KZ8 A;  5EV0 A;  2FFF B;  1VEU B;  5FAP A;  4UA6 A;  4EV4 A;  4R70 A;  1G68 A;  1K56 D;  2B18 A;  2PT7 A;  1T1B A;  5GLC A;  1YAX A;  5G4Z A;  1D06 A;  5KIZ A;  1CQA A;  2ZOI A;  1ZKJ A;  3GV9 A;  2Q9M A;  3CG5 A;  1WYB A;  1QME A;  3IXH A;  4K0W A;  3UE6 A;  1O7E A;  2HPB A;  4WBG A;  2Y2G A;  2XA7 M;  1Y28 A;  4DXB A;  2ZQA A;  4WEJ A;  1DP6 A;  1ZC2 A;  5F1G A;  5HAR A;  4BBU A;  3OLO A;  4Y5F A;  3MBZ A;  1HZO A;  4N1H A;  3JPU A;  3IHA A;  1OJG A;  2HP6 A;  3V39 A;  4DE3 A;  3HRE A;  3W2Z A;  5EE8 A;  1FQG A;  1JNU A;  4S2I A;  4MBH A;  1IYO A;  1OJ5 A;  4BLM A;  4Y15 A;  3UE1 A;  2X01 A;  3EWK A;  1PYY A;  5AJG A;  5DTS A;  4FUW A;  1JWV A;  1P0Z A;  1XFQ A;  5HW3 A;  3B33 A;  5A91 A;  2OWJ A;  3G4P A;  2ZM0 A;  2Y2K A;  5CER A;  4K08 A;  1LL8 A;  2VV6 A;  2R78 A;  2WZX A;  4S2L A;  3NJA A;  2OLV A;  4GS9 B;  2Y2L A;  4XUX A;  3MQ0 A;  3AGF A;  2QPN A;  4OPZ A;  3IS2 A;  4B4Z A;  3G34 A;  1PI5 A;  3R4K A;  3T4S A;  1MC0 A;  3R7W A;  1LSX A;  3FG8 A;  3DWZ A;  3H7W B;  2WKP A;  4RYE A;  2H5S A;  2ZC4 B;  4X1M A;  3UB7 A;  4KG2 A;  1ERM A;  1S1Y A;  5D3O A;  2PR5 A;  2ZJ9 A;  1FOF A;  4R23 A;  1PIO A;  1K38 A;  2YKH A;  2ZL1 A;  1PWG A;  3IXG A;  3BYD A;  4DMZ A;  5IT5 A;  1C3B A;  4QJG A;  4WM9 A;  4II7 A;  3UB5 P;  3IX3 A;  2VEA A;  3PR6 A;  5CTN A;  2E8I A;  4EEP A;  1ZTU A;  3V3S A;  1L0F A;  3S7N A;  2WKH A;  3T4J A;  1PI4 A;  1TS8 A;  4UA9 A;  2XD1 A;  4OPQ A;  2Y2N A;  3CJM A;  5CTM A;  2JKT M;  1Q2Q A;  1YLY A;  1LT0 A;  3N7W A;  4BMW A;  2EA9 A;  1ERQ A;  4LLO B;  2J3W A;  3T50 A;  4RA7 A;  5HL1 A;  2Y2J A;  3NDE A;  2Y2I A;  3NBL A;  4D60 A;  1NYM A;  4IVI A;  4ZAM A;  3ZG9 B;  1K6R A;  2GZA A;  4XT2 B;  3L7H A;  4KQO A;  4CQH A;  5G4Y A;  3PBO A;  3WS2 A;  1CJF A;  3GSG A;  4EET B;  3TSG A;  4Y2F A;  1N9O A;  2PU4 A;  1UGU A;  5EOE A;  4JLF A;  4KZ7 A;  3GR2 A;  1FIL A;  4X1L A;  1FSW A;  3DTI A;  1ONH A;  4P87 A;  2CMN A;  4L9F A;  3CI6 A;  1K57 A;  2WKE A;  1DJB A;  4YFM A;  2X02 A;  2XRO A; 
#chains in the Genus database with same CATH homology
 3ZYT A;  1OTB A;  3VE3 A;  1STZ A;  2XSS A;  3E4O A;  2PR6 A;  2B02 A;  3EQV A;  4HQA A;  4OOL A;  4ETX A;  5IU1 A;  4F3L A;  1OPX A;  3F1O A;  3FC7 A;  4ME4 A;  3RFB A;  4MN5 A;  4OOM A;  3TW8 A;  3LFV A;  1BYW A;  4NXF A;  3K3C A;  4BBT A;  4HJ4 A;  4ARZ A;  5J4E A;  2J80 A;  4B93 A;  2HF6 A;  1P97 A;  3F1N B;  4GHI B;  2FZ0 A;  5HSQ A;  3S7Q A;  1OTI A;  4LPZ A;  3VOL A;  2VKS A;  4EER A;  3G6O A;  3C30 A;  3V67 A;  1WA9 A;  1NLY A;  3B47 A;  2V1A A;  3PHY A;  4FOF A;  2W3E A;  5HD5 A;  4EEU A;  4HP4 A;  2A24 A;  5DF9 A;  1H8M A;  3DBA A;  4MN7 A;  2QWS A;  2O9C A;  5LBR A;  3EOI A;  3LIB A;  3BY8 A;  2WKQ A;  3RH8 B;  2Z6D A;  1T1A A;  2QJ5 A;  3UB9 A;  1H3Q A;  2VV7 A;  2PDR A;  3EEH A;  5IS1 A;  1XFN A;  3CUE A;  5TBM B;  2GNX A;  1V9Y A;  3K2N A;  4HP9 A;  3H82 B;  5HD3 A;  2JN7 A;  3IBJ A;  3A0V A;  3UMD A;  2FH5 A;  3KYQ A;  4HNB A;  2W3H A;  5DJU A;  2L1M A;  3LI9 A;  4F3L B;  3E4P A;  4H6J A;  3F1O B;  5DKL A;  1T1C A;  3O5Y A;  2D01 A;  3CLO A;  4IJG A;  4M4X A;  1P9R A;  2J3T C;  2D02 A;  3EGX C;  2V0W A;  4MDZ A;  2O9B A;  2K7S A;  4ARZ B;  3LIF A;  3TJZ C;  1OT9 A;  5HDC A;  4WEL A;  1P9W A;  1W63 Q;  2Z6C A;  4NKP A;  3KX0 X;  4UQI S;  2VGL S;  2QHK A;  4BWI A;  3HCY A;  2Y79 A;  5HDD A;  1W63 M;  3UB6 A;  3OC2 A;  4UQI M;  2OAP 1;  2VGL M;  3K3D A;  1GSV A;  1OTA A;  2INW A;  5DFX A;  2W3F A;  4UEY A;  4KQD A;  5DKK A;  5HZH A;  1S4R A;  2O99 A;  3KSH A;  3F1P A;  2A24 B;  4BBV A;  2WKR A;  3MR0 A;  4HJ6 A;  2O9A A;  2XRN A;  4L9E A;  3FPV A;  3S7O A;  4JGO A;  4YOF A;  1GSX A;  2ZMF A;  3LR4 A;  4P6Z S;  5C5K A;  1XJ2 A;  2O0Y A;  2NUP C;  3KSI A;  3LID A;  2DMW A;  2PYR A;  3EGD C;  4PHT A;  5F69 A;  2K2N A;  2W3D A;  4P6Z M;  3EEA A;  2YKF A;  4YNR A;  4LRY C;  5HWW A;  5HWV A;  4WEK A;  3PYP A;  3BY9 A;  2GJ3 A;  5TJJ A;  1N9N A;  3GEC A;  2JHE A;  4LRX C;  1MKM A;  4PKY G;  2VX8 A;  3BJN A;  2PYP A;  4CLC A;  1TD5 A;  1XJ3 A;  2VV8 A;  4HY8 A;  3TE8 A;  5HL6 A;  4H6J B;  3CUE C;  3CWF A;  4JGQ A;  1XJ6 A;  2JKT I;  3B42 A;  1OT6 A;  3HJI A;  4NEE D;  3KSG A;  5F68 A;  2MJ6 A;  3PBS A;  1N9L A;  2M7V A;  3H9W A;  2KX6 A;  2BAS A;  3LR3 A;  3MJQ A;  1F9I A;  1NRJ A;  1UWN X;  4I38 A;  5HWT A;  3PBT A;  1S4S A;  4GCZ A;  5KSH A;  3PBR A;  2VLG A;  3D72 A;  2M1C A;  3CIT A;  3F1P B;  3UME A;  1LSW A;  4R3A A;  4CLC D;  1V9Z A;  3P7N A;  2KOI A;  4QPR A;  2PHY A;  1YKD A;  2OOL A;  3NOP C;  3EQU A;  4R38 A;  4I39 A;  4PKY A;  3LIE A;  5F5Y A;  5HPF A;  4R70 A;  2JKR M;  3ICY A;  4IHQ A;  3LR5 A;  2B18 A;  2PT7 A;  3NHQ A;  2ZMV A;  4NXG A;  4IUK A;  1T1B A;  3ZQ5 A;  4HH2 A;  2QJ7 A;  4ETZ A;  3S7P A;  3TRC A;  1YAX A;  1OTE A;  2LB9 A;  5F6A A;  4CLC B;  3ULF A;  5G4Z A;  1D06 A;  5KIZ A;  2QYB A;  2ZBB A;  1ZHH B;  2ZOI A;  1VHM A;  1NWZ A;  1DRM A;  5J7E A;  2XA7 S;  3LI8 A;  2VJW A;  1S66 L;  3UE6 A;  4CLC E;  2XA7 M;  5AVE A;  4E04 A;  1Y28 A;  4O01 A;  2V0U A;  4RQ9 A;  3FPW A;  5HPI A;  4WEJ A;  1DP6 A;  2W1T A;  1TS0 A;  4L0L A;  4GS9 A;  4BBU A;  3OLO A;  5DFY A;  3OOV A;  4Y5F A;  3BWL A;  3BQ8 A;  3NOU C;  5EFW A;  3OCN A;  1F5M A;  2IA2 A;  2GX5 A;  1OJG A;  4GJ4 A;  5DJT A;  1TS7 A;  3H7W A;  2P08 A;  3IBR A;  4HIA A;  3W2Z A;  1JNU A;  2W0N A;  3UB8 A;  2L4R A;  4YWZ A;  1KOU A;  5K5B A;  4L9G A;  1OJ5 A;  2L0W A;  5AVF A;  4Q0I A;  2NUT C;  5CX7 A;  3VV4 A;  3EWK A;  2M7U A;  5AJG A;  4R6L A;  4PAU A;  3LIC A;  1GSW A;  3A0S A;  3PXP A;  4HI4 A;  1P0Z A;  4EUV A;  1XFQ A;  3C8C A;  4JGP A;  2HV1 A;  3OBF A;  3B33 A;  2OWJ A;  1TS6 A;  2V9A A;  3RTY A;  1T18 A;  2OAQ 1;  3T4K A;  1IOU A;  3C38 A;  3T4T A;  3NOT C;  5MC7 A;  4BJP A;  2H28 A;  5FL3 A;  4DJ2 A;  3P01 A;  1F98 A;  4GW9 A;  1S1Z A;  4K08 A;  4O8G A;  1LL8 A;  2VV6 A;  2R78 A;  3NJA A;  3MQQ A;  4I3I A;  2W1T B;  4GS9 B;  2VZW A;  4Z1W A;  4MCW A;  3MQ0 A;  2LB5 A;  3PBN A;  2KDK A;  1MZU A;  3IS2 A;  2QKP A;  3T4L A;  4I3A A;  3U2A A;  3R4K A;  2EWW A;  4IUH A;  3T4S A;  5I5L A;  1MC0 A;  1NLZ A;  4HH3 A;  1UWP X;  3R7W A;  1LSX A;  3FG8 A;  3KSF A;  3H7W B;  2WKP A;  1IFQ A;  4NXE A;  1VB6 A;  3A0R A;  2J3T D;  4EES A;  4XT2 A;  2K31 A;  3OCL A;  3UB7 A;  4Q0J A;  4WLA A;  3SW1 A;  2EWV A;  2PD7 A;  2G7U A;  4DN0 A;  4EU0 A;  1S1Y A;  2PR5 A;  2W1R A;  2YKH A;  3KYZ A;  2Y8H A;  1X0O A;  3MFX A;  1S67 L;  3LUQ A;  4KUO A;  1LSV A;  4JGR A;  3MXQ A;  4DMZ A;  5IT5 A;  4LRZ E;  4II7 A;  3D3O A;  4KUK A;  3PR6 A;  2VEA A;  4FSF A;  1D7E A;  4EEP A;  1ZTU A;  5HDS A;  2I9V A;  4Y3I A;  4EQ1 A;  3S7N A;  2VA0 A;  4WF0 A;  3T4J A;  4CLC C;  3E4Q A;  1DP8 A;  4G3W A;  1TF1 A;  4I5S A;  4G3K A;  1TS8 A;  4I3J A;  1DP9 A;  4NXB A;  2P04 A;  2JKT M;  2HJ9 C;  3CAX A;  4B9O A;  4EW7 A;  4WN5 A;  2W3G A;  1LT0 A;  4BMW A;  2EA9 A;  2HJE A;  3C2W A;  3PBQ A;  3IS2 B;  2J3W A;  3LR0 A;  4HHD A;  4LLO B;  3T50 A;  3T4Q A;  4HJ3 A;  5J3W A;  2PD8 A;  4O0P A;  3KO6 A;  3VE4 A;  3MQO A;  2V1B A;  3E98 A;  3R7W B;  3F1N A;  4MN6 A;  4GHI A;  4DJ3 A;  2GZA A;  4EXO A;  1OTD A;  5A8B A;  3UE3 A;  3JVV A;  4XT2 B;  4KQO A;  3MMH A;  4CQH A;  5G4Y A;  3GDI A;  3PBO A;  1YSP A;  2ZOH A;  4G3V A;  3MF0 A;  4EET B;  2JKR I;  1XJ4 A;  5L8M A;  4Y2F A;  4HOI A;  4WL9 A;  2A2L A;  3LIA A;  1N9O A;  3JVU A;  1G6O A;  1EW0 A;  1UGU A;  2HGV A;  2OWH A;  4GLQ A;  1ODV A;  2KLI A;  4WUJ A;  2P7J A;  1G28 A;  4ZRR A;  4AFI A;  4Q0H A;  2W27 A;  3HJK A;  3E0Y A;  1YSQ A;  2CMN A;  5TBM A;  4L9F A;  4MMN A;  3CI6 A;  3LYX A;  3T4O A;  3BQA A;  3H82 A;  2XRO A;  3BW6 A;  1T19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...