3HJIA

1.8 angstrom crystal structure of the i74v:i85v variant of vivid (vvd).
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
149
structure length
149
Chain Sequence
b'MHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALVLCDLKQKDTPVVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vivid PAS protein VVD
publication title Mechanism-based tuning of a LOV domain photoreceptor.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Signaling protein
total genus 36
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3hjiA00
3UMDA 4K08A 1KOUA 1VB6A 3MQQA 3RTYA 4JGOA 2PR5A 1GSXA 2Z6DA 3FG8A 5HWTA 5IS1A 4NXGA 3NOPC 4EXOA 2V1BA 1D06A 1S4SA 1WA9A 3HJIA 3BWLA 2WKRA 3IBRA 4GS9A 2VLGA 2GJ3A 1LL8A 4PKYG 3H9WA 1XFQA 3A0RA 5G4YA 4JGPA 3ZQ5A 1TS8A 3LYXA 2V0WA 2QHKA 1OT9A 4EQ1A 3LIFA 3ULFA 3IS2A 1OT6A 4R6LA 1T1AA 3CWFA 1OTBA 5AVEA 3H82B 1Y28A 4GW9A 4EESA 4I3JA 4HJ3A 4B9OA 2M1CA 3NOTC 5HDCA 2B02A 2OWHA 5HWVA 5I5LA 3EEHA 2V1AA 2VV6A 3KX0X 2CMNA 2R78A 4L9EA 3NJAA 2QWSA 4BBVA 4HNBA 1TS0A 5TBMA 4JGQA 3GECA 1T19A 3UMEA 2EA9A 1XJ3A 4GHIA 4R38A 3F1PB 1F9IA 1LSXA 2V9AA 4NXEA 3LIEA 4WL9A 4EEUA 1LSVA 1S1YA 5KIZA 4WLAA 3UB6A 3MJQA 5F5YA 3BY8A 1DRMA 3LUQA 3UB9A 1V9ZA 2L4RA 3OLOA 2K7SA 3B33A 3F1NA 4KUKA 3RH8B 2JN7A 2VV8A 3IS2B 3D72A 4LRZE 5J4EA 2PYRA 3MXQA 3LI9A 4HP4A 4I5SA 3LICA 1V9YA 5HD3A 5F69A 1S66L 1OTAA 2Z6CA 3BY9A 3LIAA 3LIDA 3F1OA 2ZOIA 2A24B 1XJ2A 2WKPA 4F3LB 5DJTA 5TBMB 4LPZA 3C8CA 1XFNA 1TS6A 1OJGA 4I3AA 2WKQA 2PD8A 4NXFA 4I3IA 2PDRA 4LRXC 5HWWA 5IU1A 2ZOHA 4GHIB 3H7WA 2QJ5A 1F98A 3VE4A 4BBUA 5J7EA 2QKPA 2VEAA 3T50A 3MR0A 5AVFA 3NOUC 4RQ9A 1T1BA 2D02A 3CAXA 4L9GA 4EW7A 5G4ZA 2HV1A 2OOLA 4E04A 5J3WA 1OTEA 5HDSA 4NXBA 2VV7A 1N9NA 4GCZA 4H6JA 1UWNX 3UB8A 2PR6A 1GSVA 3VOLA 3FC7A 4DJ2A 4HI4A 3PHYA 1S1ZA 3H82A 1ODVA 3E4OA 4KUOA 2ZBBA 3MQOA 4GS9B 1G28A 1X0OA 5DKLA 4L9FA 4DJ3A 1S4RA 1P97A 5A8BA 3MFXA 2KX6A 4HP9A 4HJ6A 2W0NA 4EERA 4YWZA 4PKYA 4R3AA 4HH3A 1LT0A 1LSWA 4EETB 4EEPA 1DP9A 4KQDA 2J80A 4WF0A 3P7NA 1N9LA 5HZHA 3UB7A 5F6AA 4WUJA 3ICYA 4HY8A 4XT2A 3H7WB 3PYPA 1UWPX 3F1PA 4HIAA 2H28A 2PD7A 3LIBA 1P0ZA 4MN6A 3EWKA 1XJ4A 2I9VA 1OTDA 1NWZA 5DKKA 3K3DA 4BBTA 5HD5A 2QJ7A 2L0WA 2YKFA 3LI8A 1BYWA 4H6JB 5F68A 4HQAA 3E4PA 3A0VA 3G6OA 4LLOB 4LRYC 3NHQA 3A0SA 3SW1A 5DJUA 4HJ4A 4MN5A 5HSQA 3GDIA 1T1CA 5HDDA 1OTIA 3E4QA 1OJ5A 2OWJA 2D01A 3CLOA 4HH2A 4JGRA 3C2WA 2W27A 2BASA 2KDKA 3F1NB 1JNUA 1DP8A 2A24A 3VE3A 1D7EA 5EFWA 1S67L 2L1MA 4F3LA 4HHDA 1MZUA 2V0UA 4XT2B 4I39A 2YKHA 2PYPA 3HJKA 2PHYA 1EW0A 2P7JA 2INWA 4WN5A 4M4XA 4I38A 3F1OB 1GSWA 1XJ6A 1UGUA 4HOIA 1N9OA 1TS7A 1T18A 1DP6A 4R70A 3K3CA 3UE6A 2JHEA
chains in the Genus database with same CATH superfamily
3CZDA 5HL1A 4K08A 1VB6A 4HBTA 4JLFA 5A93A 1GSXA 2Z6DA 2O9BA 3JVUA 5IS1A 3AGEA 4FOFA 4EXOA 3CHWP 1D06A 5L10A 1K57A 3HJIA 3E2KA 2ZM0A 5FEGA 2XD1A 1M6KA 3DBAA 2W3HA 2VLGA 2GJ3A 2HDRA 4IVIA 2HZ5A 3A0RA 3FZCA 2XROA 5KSHA 1HLUP 3ZQ5A 3RFBA 4YOFA 2G7UA 4P0MA 5CXWA 1BZAA 3PR6A 5EOOA 1KVMA 5M1AA 3EEAA 1IYQA 1JWZA 4FD8A 5AVEA 5CERA 2ZQ8A 1IEMA 4WM9A 2HDSA 4GW9A 2WGVA 4JF6A 3BW6A 4S2NC 3G4PA 1PIOA 1YLJA 5EE8A 4WZ5C 2OWHA 1NYMA 1PWDA 5I5LA 2VGJA 4S2JA 2V1AA 4OLGA 2R78A 4L9EA 2Q0OA 3V3SA 4OQGA 4OP8A 1H3QA 1NXYA 4X53A 4BBVA 3VP0A 5TBMA 1J3WA 4JGQA 1BUEA 2J8YA 1MWSA 1FCMA 1T19A 4S2LA 1GHMA 4WEJA 3HLEA 5F82A 5IT5A 1SHVA 1GA0A 4O0PA 1F9IA 2WKEA 5EVEA 4Q0HA 1LSXA 3KSFA 2V9AA 3HLWA 3ZG8B 2OAQ1 3SS4A 2XQZA 3LIEA 4EEUA 2HDUA 3LEZA 2J3TD 3BFFA 3C30A 3UB6A 3GR2A 4C6YA 3VMAA 5GLBA 3O87A 2P9VA 4IHQA 3G30A 3FWLA 3T4JA 3VV4A 3OLOA 2K7SA 3KSIA 3MXSA 4MLLA 2Y2OA 4KQRA 1IFQA 3A3IA 3F1NA 2WZXA 2XLNA 3RH8B 3C38A 4FTXA 4R3BA 5FA7A 3IS2B 4LRZE 4GD8A 2ZQDA 2PBYA 1CI9A 1LL5A 2Y2KA 1ES5A 2EXAA 3AGDA 3D3OA 3LI9A 2KLIA 3DWZA 4P6ZM 1W63M 1V9YA 5EVID 5F69A 1S66L 3V50A 1DY6A 1OTAA 1ES4A 4S2KA 3PBSA 4BQMA 2DRWA 2A24B 4MBHA 4NK3A 4Y5FA 1XX2A 1XFNA 1TS6A 1OJGA 4BL3A 1BULA 1QMFA 3G31A 4UEYA 4NXFA 4FSFA 2ZOHA 5DF8A 4FH2A 2V1ZA 2OSUA 1Z09A 2QJ5A 2ZL1B 3UNWA 1EI5A 3FKVA 2HF6A 1F98A 5GLCA 4QY6A 3NY4A 3Q7VA 4RQ9A 4FCFA 3ZG9B 2D02A 3QP4A 4WMCD 2XF3A 3CAXA 4L9GA 5G4ZA 5U47A 3VP3A 4O01A 2UWXA 4E3IA 3EOIA 4GZBA 2VV7A 4GCZA 2ZM2A 4MEZA 1ESUA 2ZQ7A 5DF9A 5HAIA 1TDLA 3FC7A 2PT7A 4UHUA 2HPBA 4MBFA 4MCWA 3VSLA 3RJUA 1S1ZA 3H82A 2J9PA 2JCHA 1W8YA 2LB9A 1MBLA 2HGVA 3CJMA 3E4OA 1E4DA 1YAXA 4R0QA 3OCNA 3JYIA 5FQ9A 4GDNA 4NG2A 3S7OA 5A8BA 3OBFA 3LGOA 2Y59A 4UA9A 2A3UA 3IXGA 4HP9A 4EERA 1PYYA 5EM1A 5HL6A 2C5WB 3SH8A 1LT0A 1L2SA 4GB7A 2OV5A 3P7NA 3UB7A 4WUJA 3ICYA 1SKFA 3WS0A 4Y0UA 3NBLA 3HUOA 1KE4A 3LR3A 3UPNA 3G32A 3M6HA 3IH8A 4E6XA 2WAFA 1RP5A 1E25A 3W8KA 4GD6A 2I72A 4DKIA 4ZBEA 3P98A 1K54A 5DKKA 2GNXA 3MSHA 2QJ7A 1BYWA 1K0KA 4XUZA 3WS5A 3A0VA 4L0LA 4ARZB 1H0MA 2J3WA 5KZHA 2C6WB 1MWUA 4DE2A 1ZKJA 1YMSA 4HJ4A 1L0EA 4GLQA 5HDDA 3E4QA 4NEED 2B95A 2CC1A 2H5SA 3S7NA 2P9VB 1K6SA 1EWZA 1OJ5A 3DWKA 3CLOA 3L7HA 1YMXA 2XSSA 3HLDA 5DVAA 4FUWA 3F1NB 4DXCA 4ESPA 1DP8A 3C4OA 3QNCA 2L1MA 5JYOA 4F3LA 3QP5A 2JKRM 1XGIA 5EM0A 3BRMA 3V5MA 4IUHA 4OPZA 4P6ZS 4LV3A 3OPLA 4PPRA 1SZVA 4U0TA 4X25A 4B4ZA 2J9OA 3HJKA 1EW0A 2P7JA 3QP2A 4WN5A 2DNSA 4M4XA 4I38A 1BT5A 3B47A 3NULA 2EXBA 4BENA 3MZFA 4OVDA 4E3LA 1M40A 1TS7A 4IVKA 4BLMA 1LI9A 4R70A 2Y2PA 3K3CA 2AVXA 3RXWA 3UE6A 4QHCA 4OPRA 1KDWA 2QPNA 3UMDA 4UQIM 3MQQA 3S7PA 3QP8A 3RTYA 1STZA 1Y4OA 4Z1WA 2PR5A 3FG8A 5HWTA 4GNUA 2V8CA 1F2KA 2XH9A 3NOPC 2V20A 4MMNA 3TW8A 3Q7VB 4OP5A 1YQSA 1S4SA 5KSCA 3PBTA 3BWLA 3WS1A 3PBRA 5CGSA 3CI6A 1IYSA 4P85A 1LL8A 2P04A 3ZCZA 3H9WA 2G2UA 5G4YA 5CTMA 5F83A 4R3JA 3BFCA 5GHYA 4JGPA 4IBXA 3IWQA 3CUEC 1W5DA 2UV0E 3Q7ZA 1F5MA 3ZG0A 4YINA 3IS2A 1T1AA 4P87A 3VFFA 1YLYA 1L3LA 3H82B 4EESA 3IF6A 3NDEA 4B9OA 3PXPA 2M1CA 2JKTM 3BM6A 4MNRA 2VKSA 5HDCA 1KE3A 1FR6A 3SOIA 2O9CA 1LLBA 2VX8A 1WE4A 4BJPA 3EEHA 4LFUA 4BD0A 5F1FA 2JKRI 3P01A 2VV6A 3HCYA 3ZG5A 3BFEA 3N4IA 2QWSA 4MN7A 1NRJA 1TS0A 4LCLA 5E2EA 2NUTC 5FDSA 5GLDA 4EUVA 3GECA 4PM8A 1YLTA 1XJ3A 2ZL1A 1SKOB 2W1TA 3BFGA 4NXEA 4WL9A 1XA7A 3C5AA 5AQ7A 2VGLM 4ZDXA 2EFXA 4K0XA 3SS3A 3I7JA 1YPRA 3IBJA 3BY8A 1DRMA 3LUQA 3UB9A 2MJ6A 2H0YA 2XFSA 1CK3A 3LR4A 4N1HA 4WBGA 1G68A 4OKPA 1MC0A 2EX8A 4KZ5A 4KZ3A 1XA1A 3WRTA 4OOMA 3MXQA 4P6BA 5FAQA 4CLCC 3UE0A 4HP4A 4I5SA 1G6AA 1NLZA 5L2FA 3E0YA 3N8RA 2O0YA 4N1XA 2E8IA 3RXXA 5GL9A 4X6TA 3LIDA 4S2NA 1XJ2A 2V8FA 4F3LB 2EWVA 4EU0A 2LB5A 3C8CA 1W8QA 4WZ5A 2JKTI 4E3KA 1K25A 3A3EA 2WKQA 2Y79A 4R23A 2PDRA 5IU1A 3M6BA 3TJZC 4GHIB 4LV2A 3N7WA 2W3EA 2EX2A 1NJ4A 1GCEA 4GN2A 3VE4A 4X56A 3T50A 3TE8A 1MXOA 1Q2QA 1T1BA 5L8MA 1E3UA 4D2OA 1PRQA 3N8SA 3LY3A 2HV1A 4UQIS 4E04A 1JWPA 4S2MA 1CI8A 1AWIA 4YFMA 1OTEA 4E3MA 1N9NA 3ITBA 2IWCA 4CPKA 3UB8A 4OQIA 4ARZA 1ONHA 1GSVA 1L0FA 4BWIA 4OOLA 3UO9A 4Y7PA 3Q1FA 3QNBA 1HZOA 2FFYA 3BECA 2P74A 4KUOA 3MQOA 4Y0TA 1G28A 1OPXA 1KDSA 1D1JA 1MWRA 4JXSA 1YLZA 3R7WA 5L09A 3ZVTA 1S0WA 4E3OA 1FOFA 1I2WA 3GMWA 3QP1A 5FSRA 5FATA 3CMZA 2Y55A 1LHYA 1LSWA 4EEPA 4KQDA 2J80A 3IF6B 3N8LA 4WF0A 4F94A 4Y13A 1P9RA 3CITA 4KZ8A 5F6AA 3S1YA 1DJBA 2G2WA 4HY8A 3UE1A 5CHJA 3ZNYA 3P09A 4KQOA 4X68A 3F1PA 4X1LA 3ISGA 4N9KA 2VGKA 1W7FA 5CGXA 3DTEA 3LIBA 1P0ZA 3VP2A 1S6RA 1XJ4A 1OTDA 3UB5P 3K3DA 2JKGA 2YKFA 3S4XA 3MMHA 4H6JB 4HQAA 3E4PA 2Y8HA 1NY0A 2FH5A 4B88A 2K31A 4PM5A 3MFDA 3W2ZA 3NHQA 3A0SA 1GHIA 2W1TB 4E3NA 5TFQA 5HSQA 2VGLS 3BEBA 1T1CA 5E2HA 3UN7A 2W1RA 4O8GA 4KENB 1IKIA 2D01A 2GZAA 1JTDA 3LR0A 4ME4A 3A3FA 1ONGA 1IOUA 4PM9A 3MS6A 2KDKA 3ZNTA 3T12B 4DDSA 5TR7A 3G34A 2Y2LA 4M3KA 2EWWA 5EFWA 1CJFA 1FIKA 1S67L 2E8JA 5FI7A 2WUQA 2Y91A 1MZUA 2X01A 4IEDA 4E3JA 5EVLA 3PBOA 3VOZA 2PBDP 1K38A 4OOYA 4OQHA 3U2AA 4OLDA 3DAVA 2OAP1 1SCWA 2PHYA 2HJ9C 3EGDC 4QU3A 1VQQA 2VJWA 3D9YA 5EECA 4ETZA 4KG2A 1YSQA 3LCEA 3EQUA 5FDHA 3IHAA 5JYPA 1N9OA 2BLSA 1T18A 2ZQ9A 2ZQCA 4EWFA 2Q9MA 1TEMA 1PI4A 2JHEA 4Y15A 1KOUA 1Z6FA 4GOGA 2HDQA 4QD4A 4ZAMA 3TSGA 1KGEA 4S2OA 3O3VA 4BMWA 4NXGA 4XXRA 4R1GA 1SKOA 3NI9A 3IF5A 2M7VA 2W3GA 3NDGA 3IBRA 2XD5A 2RL3A 5GHZA 3AGFA 3UPOA 4EBNA 1TS8A 1FSYA 1PFLA 2DMWA 3LYXA 2QHKA 4S2IA 3TRCA 3IQAA 3LIFA 1H8YA 4OPYA 1OT6A 1BSGA 1U60A 1OTBA 1ES2A 1H8ZA 3M2KA 4I3JA 4NETA 3T4TA 3E2LA 4Q8IA 1IYPA 3T4KA 3NECA 3NOTC 2ZJ9A 2H0TA 3VFHA 3R7WB 4KZBA 4RX2A 2B18A 3IWOA 2VA0A 2CMNA 3NJAA 2HP9A 3UDXA 3OC2A 3OPRA 2GDNA 4HNBA 1E3UD 4R4SA 3ZGAB 1BLHA 3WRZA 2RCXA 1WYCA 1ZC2A 4EV4A 2EA9A 5E2GA 4GHIA 4B4XA 3DTMA 3F1PB 3PAEA 1G6OA 4DDYA 4DXBA 2VZWA 4JXVA 2X71A 5KIZA 5HX9A 1TD5A 3JPUA 1MWTA 5FAOA 4U0XA 3G35A 2K2NA 2L4RA 4ZJ3A 4O7DA 5TJJA 1HTZA 2J3TC 4KQQA 2HJEA 4Y0OA 4BL2A 1K55C 4KUKA 3OCLA 1L0GA 5MC7A 1N4OA 2JN7A 5C5KA 2VV8A 3BFDA 3W4PA 2NUPC 5CEDA 1K6RA 5J4EA 1ESIA 2PYRA 1BLPA 5GHXA 3S22A 2R9XA 3HREA 3CUEA 5EVIA 2ZQAA 3T4QA 5CHUA 3C7UA 3LICA 2J7VA 4MDZA 3N6IA 3OPPA 4KZAA 1NLYA 1ERQA 1CQAA 3V67A 4DMZA 3BQ8A 5EVIC 3LIAA 1CEFA 3F1OA 3FPVA 1PWCA 1G5UA 3QHYA 4OH0A 1H8MA 1TVFA 3BQAA 5A92A 1RGYA 2Y2QA 2ZMAA 2Y2HA 4LRXC 5HWWA 1SDEA 1TF1A 5FQKA 5E43A 1DJCA 3HL9A 5HAQA 3EGXC 4LENA 1KGFA 1MPLA 4BBUA 5J7EA 2QKPA 2VEAA 3MR0A 5AVFA 3NOUC 5TGFA 4X1MA 1IELA 4DE1A 3B3XA 4XUXA 4FH4A 1FILA 4EW7A 4JF4A 3QP6A 4JBFA 3KYEA 2IWDA 2OOLA 2Q9NA 3CPTA 5J3WA 5DFYA 5HDSA 3MZEA 4H6JA 1W63Q 3PTEA 4G3VA 3A3DA 5KMWA 3FV7A 2OLVA 1ZG4A 4EBPA 4IBRA 1PWGA 1C3BA 5DTTA 5IHVA 1TDGA 2O9AA 1ODVA 2FFFB 2ZBBA 2ZD8A 4H8RA 4X55A 3UDIA 4L9FA 4ZJ2A 1L0DA 2OLUA 2A2LA 3MFXA 1RGZA 3GQZA 3LR5A 4CLCA 4HJ6A 2WGIA 4KZ9A 4PKYA 1ALQA 4KZ7A 5HPFA 4HH3A 3IX4A 3GVBA 1MKMA 4DRTA 5L07A 1YLPA 4N92A 5LBRA 4IJGA 2XR0A 1N9LA 2HP6A 3R4KA 5E2FA 2P08A 4BD1A 1VM1A 3H7WB 4LV1A 3PYPA 1UWPX 5HAPA 3JVVA 3FPWA 2X02A 3IX3A 3T1SA 4ETXA 1FSWA 2H28A 4OONA 3HLGA 3NC8A 4MN6A 3EWKA 1NWZA 4BBTA 5EUAA 3GRJA 1K57C 2XRNA 5FEFA 4LLOB 1IKGA 2XGNA 3ZG7B 4KG6A 3SW1A 5DJUA 3KYQA 3ZVWA 4R4RA 4K0WA 1PZPA 1VHMA 4CQHA 2A49A 3MF0A 3IXBA 5HPIA 1O07A 3OOVA 5CRFA 4LV0A 2WKHA 2OWJA 4HH2A 1LL9A 2W27A 3C2WA 3EQVA 2KOIA 3PBQA 4WEKA 2BASA 4KZ6A 2Y2GA 5EPHA 3WWXA 1J9MA 2XDMA 2VK3A 2ZC7A 5DTSA 4EUZA 5HFOA 4PHTA 4Y3IA 2Y4AA 4HHDA 4EBLA 4JPMA 5CECA 1VEUA 5CEBA 2JBFA 5EVIB 2Z2MB 4E6WA 4XT2B 5AQAA 4I39A 1ERMA 1JTGA 3IX8A 4PAUA 1GA9A 1VETA 4Q0JA 2PYPA 4U3TA 3MZDA 5CTNA 4JXGA 5G18A 3OPHA 3TG9A 3W4QA 3BLMA 1Q2PA 3MKEA 2INWA 3HUNA 3F1OB 3BLSA 1GSWA 1XJ6A 2O99A 1K4EA 3SH7A 4N9LA 5AQBA 4HOIA 1RCJA 4PM7A 3DTKA 3PBNA 1PZOA 4UAAA 1XPBA 2XEPA 2Y2IA 5M19A 5A90A 4DF6A 2IWBA 4C75A 1I2SA 3LFVA 4JGOA 3W4OA 4QB8A 4GKUA 1FCOA 2V1BA 1ZHHB 4KZ4A 2XK1A 4EQIA 1WA9A 4PMAA 5M18A 2WKRA 5FI6A 4GS9A 4PKYG 3O86A 3CPTB 3UE3A 1XFQA 1N9BA 1P9WA 3VP1A 3WS4A 2V0WA 1OT9A 4EQ1A 5FL3A 3ULFA 3HBRA 4CLCE 3UDFA 4R6LA 3CWFA 2PU4A 1Y28A 4HJ3A 4S2PA 1DJAA 3O5YA 1YT4A 1K4FA 3IT9A 1K56A 2IA2A 1XP4A 2B02A 3IWIA 5HWVA 3T1RA 4RX3A 2W3DA 4CLCB 3NIAA 3KX0X 1JWVA 1MKIA 4GDBA 4X69A 3TOIA 2XA7S 1LI0A 3ZYTA 2JE5A 1A0KA 2ZLYA 3FKWA 3UMEA 3CG5A 1PNEA 4ZRRA 4R38A 4LGWA 2PU2A 3O88A 4HEFA 2V2FF 4WZ4A 1LSVA 5FQIA 1ZG6A 2ACGA 2WADA 3UPPA 1S1YA 5CX7A 4KG5A 4WLAA 4RVAA 2ZMVA 1AXBA 3MJQA 5F5YA 3KSHA 1HVBA 1V9ZA 4DE3A 1MY8A 3BYDA 2B5RA 3LO7A 3B33A 3L9KA 4CLCD 5FASA 3MXRA 3T1QB 4QY5A 1JVJA 1KVLA 3D72A 2WZZA 4CJNA 3IXHA 1NZUA 2ZMFA 4D60A 2WKIA 3KO6A 4JF5A 1ACFA 1PW1A 2EX6A 5HD3A 3VOYA 4G3KA 1XGJA 2Z6CA 1SDNA 3BY9A 5AJGA 2PRFA 2BG1A 2Y2MA 3D4FA 2WGWA 2ZOIA 5BOHA 2WKPA 2ZC5B 3V39A 3T4LA 1H5XA 4II7A 5DJTA 3MKFA 5HARA 3ZFZA 4LPZA 5TBMB 1VEUB 4I3AA 5A91A 2Y2JA 3T4SA 2PD8A 1XXMA 4OQ0A 3VP4A 4I3IA 3OZHA 4RA7A 1ES3A 4PM6A 1EROA 3H7WA 4UA6A 1FQGA 5FQMA 1K54C 1VETB 3A3JA 3KYZA 4WYYA 5D3OA 1W79A 4UA7A 2EX9A 5F1GA 1XKZA 2WK0A 4LCMA 5FQQA 4DE0A 2BTFP 1WYBA 3V3RA 3Q81A 4NXBA 4A5RA 3U4LP 2ZC4B 3PAGA 1UWNX 4Q0IA 2PR6A 1YSPA 3BJNA 3VOLA 1YM1A 3LEQA 1I5QA 4Y17A 1CEGA 4IUKA 5CGWA 3Q07A 4DJ2A 4HBUA 4HI4A 3GTCA 3PHYA 3S7QA 3C4PA 4HESA 1FCNA 4MBKA 2H10A 1K55A 3SZTA 3FYZA 3G2YA 4GS9B 1X0OA 1YLWA 1ZTUA 1NYYA 5DKLA 1O7EA 4OPQA 4DJ3A 1S4RA 1P97A 2DCFA 2KX6A 4G3WA 2W0NA 3SS5A 3T1XA 2JKFA 4YWZA 3HUMA 4NKPA 4R3AA 4Y2FA 4EETB 5J8XA 1DP9A 4QWOA 5HZHA 1NZOA 4XT2A 2ZC6B 1NRFA 4WELA 2XFTA 3GSGA 2GX5A 4HIAA 1HD8A 2QZ6A 4K91A 3KSGA 3HVFA 2PD7A 3DTIA 5I94A 4QJGA 2ZC3B 4GJ4A 4QPRA 2I9VA 2WYXA 4B93A 2QYBA 1IYOA 2JC7A 3WS2A 5HD5A 1FR1A 2L0WA 4Z9QA 3LI8A 2R9WA 5F68A 1PI5A 5HW3A 4ID4A 3DW0A 3LY4A 3G6OA 1QMEA 3GV9A 1YKDA 4LRYC 5CHMA 5FAPA 3MBZA 3IH9A 3E98A 3Q82A 3HLFA 2HP5A 4MN5A 3GDIA 3HLCA 2Z2LB 4WMCA 5AQ9A 1OTIA 2W3FA 5DF7A 4C3QA 4ZJ1A 3SH9A 4JKTA 4AFIA 1GHPA 1PW8A 4JGRA 3C7VA 3UY6A 5FQJA 1K56D 5K5BA 1Y54A 3IF6C 1BLCA 4RYEA 1JNUA 2A24A 3NCKA 3VE3A 1D7EA 2FZ0A 4JXWA 3K2NA 4ZTKA 2ZM8A 2V0UA 3MQ0A 1BLSA 4DN0A 4YNRA 5FI2A 1OMEA 3T4OA 3VSKA 5GLAA 2Y2NA 2EFUA 2YKHA 3IHBA 3ZDJA 2QMIA 1KGGA 1KE0A 2PAVP 3ZHHA 2M7UA 3ITAA 2WGWB 1BTLA 3HLBA 3B42A 5DTKA 5EOEA 3M2JA 5EV0A 1UGUA 2WAEA 3IXDA 1DP6A 1CF0A 5DFXA 3G2ZA 2XA7M
chains in the Genus database with same CATH topology
3UMDA 4UQIM 4K08A 1KOUA 1VB6A 3MQQA 3S7PA 3RTYA 3LFVA 4JGOA 1STZA 4Z1WA 2PR5A 1GSXA 2Z6DA 3FG8A 2O9BA 3JVUA 5HWTA 4BMWA 5IS1A 4FOFA 3NOPC 4NXGA 4MMNA 4EXOA 2V1BA 1ZHHB 1D06A 3TW8A 1S4SA 1WA9A 3HJIA 3PBTA 3BWLA 2M7VA 2WKRA 2W3GA 3DBAA 3IBRA 3PBRA 4GS9A 2W3HA 3CI6A 2VLGA 2GJ3A 1LL8A 2P04A 4PKYG 3H9WA 3UE3A 1XFQA 3A0RA 5G4YA 1P9WA 2XROA 5KSHA 4JGPA 3ZQ5A 1TS8A 3RFBA 4YOFA 2G7UA 3CUEC 2DMWA 1F5MA 3LYXA 2V0WA 2QHKA 3PR6A 3TRCA 1OT9A 4EQ1A 3LIFA 5FL3A 3ULFA 3EEAA 3IS2A 4CLCE 1OT6A 4R6LA 1T1AA 3CWFA 1OTBA 5AVEA 3H82B 1Y28A 4GW9A 4EESA 4I3JA 4HJ3A 3T4TA 3BW6A 4B9OA 3PXPA 3T4KA 2M1CA 2JKTM 3O5YA 3NOTC 5HDCA 2VKSA 2IA2A 2B02A 2OWHA 2O9CA 3R7WB 5HWVA 2W3DA 4CLCB 2VX8A 4BJPA 5I5LA 2B18A 3EEHA 2V1AA 2JKRI 2VA0A 3P01A 2VV6A 3KX0X 3HCYA 2CMNA 2R78A 4L9EA 3NJAA 1H3QA 2QWSA 4BBVA 4MN7A 3OC2A 1NRJA 4HNBA 1TS0A 2XA7S 5TBMA 2NUTC 3ZYTA 4JGQA 4EUVA 3GECA 1T19A 3UMEA 2EA9A 4WEJA 5IT5A 1XJ3A 4ZRRA 4GHIA 4O0PA 4R38A 3F1PB 1F9IA 4Q0HA 1G6OA 1LSXA 3KSFA 2V9AA 2VZWA 2OAQ1 2W1TA 4NXEA 3LIEA 4WL9A 4EEUA 1LSVA 2J3TD 1S1YA 5CX7A 5KIZA 3C30A 4WLAA 2VGLM 3UB6A 1TD5A 2ZMVA 4IHQA 3IBJA 3MJQA 3BY8A 5F5YA 1DRMA 3KSHA 3LUQA 3UB9A 2K2NA 1V9ZA 2L4RA 2MJ6A 5TJJA 3T4JA 3VV4A 3OLOA 2J3TC 3LR4A 2K7SA 3KSIA 2HJEA 3B33A 1IFQA 3F1NA 4KUKA 3OCLA 4CLCD 1MC0A 5MC7A 3RH8B 3C38A 2JN7A 5C5KA 2VV8A 3IS2B 2NUPC 3D72A 4LRZE 5J4EA 2ZMFA 4OOMA 2PYRA 3D3OA 3MXQA 4CLCC 3LI9A 3KO6A 2KLIA 3CUEA 4HP4A 3T4QA 4I5SA 3LICA 4P6ZM 1NLZA 1W63M 4MDZA 1V9YA 5F69A 5HD3A 1S66L 4G3KA 3E0YA 1OTAA 1NLYA 2Z6CA 3BY9A 5AJGA 2O0YA 3V67A 3PBSA 4DMZA 3BQ8A 3LIAA 3LIDA 3F1OA 2ZOIA 2A24B 1XJ2A 3FPVA 2WKPA 1H8MA 4F3LB 2EWVA 3T4LA 4II7A 5DJTA 4EU0A 4Y5FA 2LB5A 3BQAA 3C8CA 4LPZA 5TBMB 1XFNA 1TS6A 2JKTI 1OJGA 4I3AA 3T4SA 2WKQA 2PD8A 2Y79A 4UEYA 4NXFA 4I3IA 2PDRA 4LRXC 4FSFA 5IU1A 2ZOHA 5HWWA 3TJZC 4GHIB 3H7WA 1TF1A 2QJ5A 2W3EA 3KYZA 2HF6A 3EGXC 1F98A 3VE4A 4BBUA 5J7EA 2QKPA 2VEAA 3T50A 3TE8A 3MR0A 5AVFA 3NOUC 4RQ9A 1T1BA 2D02A 5L8MA 3CAXA 4L9GA 4EW7A 5G4ZA 2HV1A 4O01A 4UQIS 2OOLA 4E04A 5J3WA 5DFYA 1OTEA 3EOIA 5HDSA 4NXBA 2VV7A 1N9NA 4GCZA 4H6JA 1W63Q 4G3VA 1UWNX 4Q0IA 3UB8A 2PR6A 1YSPA 4ARZA 1GSVA 3BJNA 5DF9A 3VOLA 3FC7A 4IUKA 4DJ2A 4HI4A 2PT7A 4BWIA 4OOLA 4MCWA 3PHYA 3S7QA 1S1ZA 3H82A 2LB9A 2HGVA 2O9AA 1ODVA 3E4OA 2ZBBA 3MQOA 4KUOA 1YAXA 4GS9B 3OCNA 1G28A 1OPXA 1X0OA 1ZTUA 5DKLA 4L9FA 3S7OA 2A2LA 4DJ3A 1S4RA 1P97A 5A8BA 3MFXA 3OBFA 2KX6A 3R7WA 4G3WA 3LR5A 4CLCA 4HP9A 4HJ6A 2W0NA 4EERA 4YWZA 4NKPA 5HL6A 4PKYA 5HPFA 4R3AA 4HH3A 1LT0A 1MKMA 4Y2FA 1LSWA 5LBRA 4EETB 4EEPA 4IJGA 1DP9A 4KQDA 2J80A 2JHEA 4WF0A 3P7NA 1N9LA 5HZHA 3R4KA 1P9RA 3CITA 3UB7A 5F6AA 4WUJA 3ICYA 2P08A 4HY8A 4XT2A 3H7WB 4KQOA 4WELA 3PYPA 1UWPX 3LR3A 3F1PA 3JVVA 3FPWA 2GX5A 4HIAA 4ETXA 2H28A 3KSGA 2PD7A 3LIBA 1P0ZA 4MN6A 3EWKA 1XJ4A 4GJ4A 4QPRA 2I9VA 1OTDA 4B93A 1NWZA 5DKKA 3K3DA 4BBTA 2QYBA 2GNXA 5HD5A 2QJ7A 2L0WA 2YKFA 3LI8A 1BYWA 3MMHA 4H6JB 2XRNA 5F68A 4HQAA 3E4PA 2Y8HA 3A0VA 4L0LA 3G6OA 4ARZB 2FH5A 4LLOB 2K31A 2J3WA 4LRYC 1YKDA 3W2ZA 3NHQA 3E98A 3A0SA 3SW1A 2W1TB 5DJUA 4HJ4A 3KYQA 4MN5A 5HSQA 2VGLS 4GLQA 3GDIA 1T1CA 1VHMA 4CQHA 5HDDA 1OTIA 2W1RA 3E4QA 3MF0A 4NEED 2W3FA 5HPIA 4O8GA 3OOVA 3S7NA 1OJ5A 2OWJA 2D01A 4AFIA 2GZAA 3LR0A 4ME4A 3CLOA 1IOUA 4HH2A 4JGRA 3C2WA 2W27A 2XSSA 3EQVA 2KOIA 3PBQA 4WEKA 2BASA 2KDKA 5K5BA 3F1NB 1JNUA 2EWWA 1DP8A 2A24A 4PHTA 3VE3A 1D7EA 5EFWA 2FZ0A 4Y3IA 1S67L 2L1MA 4F3LA 2JKRM 4HHDA 1MZUA 3K2NA 2V0UA 3MQ0A 4DN0A 4IUHA 4YNRA 3PBOA 4P6ZS 4XT2B 3T4OA 4I39A 3U2AA 4PAUA 2YKHA 4Q0JA 2OAP1 2PYPA 3HJKA 2PHYA 1EW0A 2HJ9C 2P7JA 2INWA 3EGDC 4WN5A 2M7UA 4M4XA 2VJWA 4I38A 4ETZA 3B47A 3F1OB 1GSWA 1YSQA 3EQUA 1XJ6A 3B42A 2O99A 1UGUA 4HOIA 1N9OA 1TS7A 1T18A 1DP6A 4R70A 3K3CA 3UE6A 3PBNA 5DFXA 2XA7M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UMD A;  4K08 A;  1KOU A;  1VB6 A;  3MQQ A;  3RTY A;  4JGO A;  2PR5 A;  1GSX A;  2Z6D A;  3FG8 A;  5HWT A;  5IS1 A;  4NXG A;  3NOP C;  4EXO A;  2V1B A;  1D06 A;  1S4S A;  1WA9 A;  3HJI A;  3BWL A;  2WKR A;  3IBR A;  4GS9 A;  2VLG A;  2GJ3 A;  1LL8 A;  4PKY G;  3H9W A;  1XFQ A;  3A0R A;  5G4Y A;  4JGP A;  3ZQ5 A;  1TS8 A;  3LYX A;  2V0W A;  2QHK A;  1OT9 A;  4EQ1 A;  3LIF A;  3ULF A;  3IS2 A;  1OT6 A;  4R6L A;  1T1A A;  3CWF A;  1OTB A;  5AVE A;  3H82 B;  1Y28 A;  4GW9 A;  4EES A;  4I3J A;  4HJ3 A;  4B9O A;  2M1C A;  3NOT C;  5HDC A;  2B02 A;  2OWH A;  5HWV A;  5I5L A;  3EEH A;  2V1A A;  2VV6 A;  3KX0 X;  2CMN A;  2R78 A;  4L9E A;  3NJA A;  2QWS A;  4BBV A;  4HNB A;  1TS0 A;  5TBM A;  4JGQ A;  3GEC A;  1T19 A;  3UME A;  2EA9 A;  1XJ3 A;  4GHI A;  4R38 A;  3F1P B;  1F9I A;  1LSX A;  2V9A A;  4NXE A;  3LIE A;  4WL9 A;  4EEU A;  1LSV A;  1S1Y A;  5KIZ A;  4WLA A;  3UB6 A;  3MJQ A;  5F5Y A;  3BY8 A;  1DRM A;  3LUQ A;  3UB9 A;  1V9Z A;  2L4R A;  3OLO A;  2K7S A;  3B33 A;  3F1N A;  4KUK A;  3RH8 B;  2JN7 A;  2VV8 A;  3IS2 B;  3D72 A;  4LRZ E;  5J4E A;  2PYR A;  3MXQ A;  3LI9 A;  4HP4 A;  4I5S A;  3LIC A;  1V9Y A;  5HD3 A;  5F69 A;  1S66 L;  1OTA A;  2Z6C A;  3BY9 A;  3LIA A;  3LID A;  3F1O A;  2ZOI A;  2A24 B;  1XJ2 A;  2WKP A;  4F3L B;  5DJT A;  5TBM B;  4LPZ A;  3C8C A;  1XFN A;  1TS6 A;  1OJG A;  4I3A A;  2WKQ A;  2PD8 A;  4NXF A;  4I3I A;  2PDR A;  4LRX C;  5HWW A;  5IU1 A;  2ZOH A;  4GHI B;  3H7W A;  2QJ5 A;  1F98 A;  3VE4 A;  4BBU A;  5J7E A;  2QKP A;  2VEA A;  3T50 A;  3MR0 A;  5AVF A;  3NOU C;  4RQ9 A;  1T1B A;  2D02 A;  3CAX A;  4L9G A;  4EW7 A;  5G4Z A;  2HV1 A;  2OOL A;  4E04 A;  5J3W A;  1OTE A;  5HDS A;  4NXB A;  2VV7 A;  1N9N A;  4GCZ A;  4H6J A;  1UWN X;  3UB8 A;  2PR6 A;  1GSV A;  3VOL A;  3FC7 A;  4DJ2 A;  4HI4 A;  3PHY A;  1S1Z A;  3H82 A;  1ODV A;  3E4O A;  4KUO A;  2ZBB A;  3MQO A;  4GS9 B;  1G28 A;  1X0O A;  5DKL A;  4L9F A;  4DJ3 A;  1S4R A;  1P97 A;  5A8B A;  3MFX A;  2KX6 A;  4HP9 A;  4HJ6 A;  2W0N A;  4EER A;  4YWZ A;  4PKY A;  4R3A A;  4HH3 A;  1LT0 A;  1LSW A;  4EET B;  4EEP A;  1DP9 A;  4KQD A;  2J80 A;  4WF0 A;  3P7N A;  1N9L A;  5HZH A;  3UB7 A;  5F6A A;  4WUJ A;  3ICY A;  4HY8 A;  4XT2 A;  3H7W B;  3PYP A;  1UWP X;  3F1P A;  4HIA A;  2H28 A;  2PD7 A;  3LIB A;  1P0Z A;  4MN6 A;  3EWK A;  1XJ4 A;  2I9V A;  1OTD A;  1NWZ A;  5DKK A;  3K3D A;  4BBT A;  5HD5 A;  2QJ7 A;  2L0W A;  2YKF A;  3LI8 A;  1BYW A;  4H6J B;  5F68 A;  4HQA A;  3E4P A;  3A0V A;  3G6O A;  4LLO B;  4LRY C;  3NHQ A;  3A0S A;  3SW1 A;  5DJU A;  4HJ4 A;  4MN5 A;  5HSQ A;  3GDI A;  1T1C A;  5HDD A;  1OTI A;  3E4Q A;  1OJ5 A;  2OWJ A;  2D01 A;  3CLO A;  4HH2 A;  4JGR A;  3C2W A;  2W27 A;  2BAS A;  2KDK A;  3F1N B;  1JNU A;  1DP8 A;  2A24 A;  3VE3 A;  1D7E A;  5EFW A;  1S67 L;  2L1M A;  4F3L A;  4HHD A;  1MZU A;  2V0U A;  4XT2 B;  4I39 A;  2YKH A;  2PYP A;  3HJK A;  2PHY A;  1EW0 A;  2P7J A;  2INW A;  4WN5 A;  4M4X A;  4I38 A;  3F1O B;  1GSW A;  1XJ6 A;  1UGU A;  4HOI A;  1N9O A;  1TS7 A;  1T18 A;  1DP6 A;  4R70 A;  3K3C A;  3UE6 A;  2JHE A; 
#chains in the Genus database with same CATH topology
 3CZD A;  5HL1 A;  4K08 A;  1VB6 A;  4HBT A;  4JLF A;  5A93 A;  1GSX A;  2Z6D A;  2O9B A;  3JVU A;  5IS1 A;  3AGE A;  4FOF A;  4EXO A;  3CHW P;  1D06 A;  5L10 A;  1K57 A;  3HJI A;  3E2K A;  2ZM0 A;  5FEG A;  2XD1 A;  1M6K A;  3DBA A;  2W3H A;  2VLG A;  2GJ3 A;  2HDR A;  4IVI A;  2HZ5 A;  3A0R A;  3FZC A;  2XRO A;  5KSH A;  1HLU P;  3ZQ5 A;  3RFB A;  4YOF A;  2G7U A;  4P0M A;  5CXW A;  1BZA A;  3PR6 A;  5EOO A;  1KVM A;  5M1A A;  3EEA A;  1IYQ A;  1JWZ A;  4FD8 A;  5AVE A;  5CER A;  2ZQ8 A;  1IEM A;  4WM9 A;  2HDS A;  4GW9 A;  2WGV A;  4JF6 A;  3BW6 A;  4S2N C;  3G4P A;  1PIO A;  1YLJ A;  5EE8 A;  4WZ5 C;  2OWH A;  1NYM A;  1PWD A;  5I5L A;  2VGJ A;  4S2J A;  2V1A A;  4OLG A;  2R78 A;  4L9E A;  2Q0O A;  3V3S A;  4OQG A;  4OP8 A;  1H3Q A;  1NXY A;  4X53 A;  4BBV A;  3VP0 A;  5TBM A;  1J3W A;  4JGQ A;  1BUE A;  2J8Y A;  1MWS A;  1FCM A;  1T19 A;  4S2L A;  1GHM A;  4WEJ A;  3HLE A;  5F82 A;  5IT5 A;  1SHV A;  1GA0 A;  4O0P A;  1F9I A;  2WKE A;  5EVE A;  4Q0H A;  1LSX A;  3KSF A;  2V9A A;  3HLW A;  3ZG8 B;  2OAQ 1;  3SS4 A;  2XQZ A;  3LIE A;  4EEU A;  2HDU A;  3LEZ A;  2J3T D;  3BFF A;  3C30 A;  3UB6 A;  3GR2 A;  4C6Y A;  3VMA A;  5GLB A;  3O87 A;  2P9V A;  4IHQ A;  3G30 A;  3FWL A;  3T4J A;  3VV4 A;  3OLO A;  2K7S A;  3KSI A;  3MXS A;  4MLL A;  2Y2O A;  4KQR A;  1IFQ A;  3A3I A;  3F1N A;  2WZX A;  2XLN A;  3RH8 B;  3C38 A;  4FTX A;  4R3B A;  5FA7 A;  3IS2 B;  4LRZ E;  4GD8 A;  2ZQD A;  2PBY A;  1CI9 A;  1LL5 A;  2Y2K A;  1ES5 A;  2EXA A;  3AGD A;  3D3O A;  3LI9 A;  2KLI A;  3DWZ A;  4P6Z M;  1W63 M;  1V9Y A;  5EVI D;  5F69 A;  1S66 L;  3V50 A;  1DY6 A;  1OTA A;  1ES4 A;  4S2K A;  3PBS A;  4BQM A;  2DRW A;  2A24 B;  4MBH A;  4NK3 A;  4Y5F A;  1XX2 A;  1XFN A;  1TS6 A;  1OJG A;  4BL3 A;  1BUL A;  1QMF A;  3G31 A;  4UEY A;  4NXF A;  4FSF A;  2ZOH A;  5DF8 A;  4FH2 A;  2V1Z A;  2OSU A;  1Z09 A;  2QJ5 A;  2ZL1 B;  3UNW A;  1EI5 A;  3FKV A;  2HF6 A;  1F98 A;  5GLC A;  4QY6 A;  3NY4 A;  3Q7V A;  4RQ9 A;  4FCF A;  3ZG9 B;  2D02 A;  3QP4 A;  4WMC D;  2XF3 A;  3CAX A;  4L9G A;  5G4Z A;  5U47 A;  3VP3 A;  4O01 A;  2UWX A;  4E3I A;  3EOI A;  4GZB A;  2VV7 A;  4GCZ A;  2ZM2 A;  4MEZ A;  1ESU A;  2ZQ7 A;  5DF9 A;  5HAI A;  1TDL A;  3FC7 A;  2PT7 A;  4UHU A;  2HPB A;  4MBF A;  4MCW A;  3VSL A;  3RJU A;  1S1Z A;  3H82 A;  2J9P A;  2JCH A;  1W8Y A;  2LB9 A;  1MBL A;  2HGV A;  3CJM A;  3E4O A;  1E4D A;  1YAX A;  4R0Q A;  3OCN A;  3JYI A;  5FQ9 A;  4GDN A;  4NG2 A;  3S7O A;  5A8B A;  3OBF A;  3LGO A;  2Y59 A;  4UA9 A;  2A3U A;  3IXG A;  4HP9 A;  4EER A;  1PYY A;  5EM1 A;  5HL6 A;  2C5W B;  3SH8 A;  1LT0 A;  1L2S A;  4GB7 A;  2OV5 A;  3P7N A;  3UB7 A;  4WUJ A;  3ICY A;  1SKF A;  3WS0 A;  4Y0U A;  3NBL A;  3HUO A;  1KE4 A;  3LR3 A;  3UPN A;  3G32 A;  3M6H A;  3IH8 A;  4E6X A;  2WAF A;  1RP5 A;  1E25 A;  3W8K A;  4GD6 A;  2I72 A;  4DKI A;  4ZBE A;  3P98 A;  1K54 A;  5DKK A;  2GNX A;  3MSH A;  2QJ7 A;  1BYW A;  1K0K A;  4XUZ A;  3WS5 A;  3A0V A;  4L0L A;  4ARZ B;  1H0M A;  2J3W A;  5KZH A;  2C6W B;  1MWU A;  4DE2 A;  1ZKJ A;  1YMS A;  4HJ4 A;  1L0E A;  4GLQ A;  5HDD A;  3E4Q A;  4NEE D;  2B95 A;  2CC1 A;  2H5S A;  3S7N A;  2P9V B;  1K6S A;  1EWZ A;  1OJ5 A;  3DWK A;  3CLO A;  3L7H A;  1YMX A;  2XSS A;  3HLD A;  5DVA A;  4FUW A;  3F1N B;  4DXC A;  4ESP A;  1DP8 A;  3C4O A;  3QNC A;  2L1M A;  5JYO A;  4F3L A;  3QP5 A;  2JKR M;  1XGI A;  5EM0 A;  3BRM A;  3V5M A;  4IUH A;  4OPZ A;  4P6Z S;  4LV3 A;  3OPL A;  4PPR A;  1SZV A;  4U0T A;  4X25 A;  4B4Z A;  2J9O A;  3HJK A;  1EW0 A;  2P7J A;  3QP2 A;  4WN5 A;  2DNS A;  4M4X A;  4I38 A;  1BT5 A;  3B47 A;  3NUL A;  2EXB A;  4BEN A;  3MZF A;  4OVD A;  4E3L A;  1M40 A;  1TS7 A;  4IVK A;  4BLM A;  1LI9 A;  4R70 A;  2Y2P A;  3K3C A;  2AVX A;  3RXW A;  3UE6 A;  4QHC A;  4OPR A;  1KDW A;  2QPN A;  3UMD A;  4UQI M;  3MQQ A;  3S7P A;  3QP8 A;  3RTY A;  1STZ A;  1Y4O A;  4Z1W A;  2PR5 A;  3FG8 A;  5HWT A;  4GNU A;  2V8C A;  1F2K A;  2XH9 A;  3NOP C;  2V20 A;  4MMN A;  3TW8 A;  3Q7V B;  4OP5 A;  1YQS A;  1S4S A;  5KSC A;  3PBT A;  3BWL A;  3WS1 A;  3PBR A;  5CGS A;  3CI6 A;  1IYS A;  4P85 A;  1LL8 A;  2P04 A;  3ZCZ A;  3H9W A;  2G2U A;  5G4Y A;  5CTM A;  5F83 A;  4R3J A;  3BFC A;  5GHY A;  4JGP A;  4IBX A;  3IWQ A;  3CUE C;  1W5D A;  2UV0 E;  3Q7Z A;  1F5M A;  3ZG0 A;  4YIN A;  3IS2 A;  1T1A A;  4P87 A;  3VFF A;  1YLY A;  1L3L A;  3H82 B;  4EES A;  3IF6 A;  3NDE A;  4B9O A;  3PXP A;  2M1C A;  2JKT M;  3BM6 A;  4MNR A;  2VKS A;  5HDC A;  1KE3 A;  1FR6 A;  3SOI A;  2O9C A;  1LLB A;  2VX8 A;  1WE4 A;  4BJP A;  3EEH A;  4LFU A;  4BD0 A;  5F1F A;  2JKR I;  3P01 A;  2VV6 A;  3HCY A;  3ZG5 A;  3BFE A;  3N4I A;  2QWS A;  4MN7 A;  1NRJ A;  1TS0 A;  4LCL A;  5E2E A;  2NUT C;  5FDS A;  5GLD A;  4EUV A;  3GEC A;  4PM8 A;  1YLT A;  1XJ3 A;  2ZL1 A;  1SKO B;  2W1T A;  3BFG A;  4NXE A;  4WL9 A;  1XA7 A;  3C5A A;  5AQ7 A;  2VGL M;  4ZDX A;  2EFX A;  4K0X A;  3SS3 A;  3I7J A;  1YPR A;  3IBJ A;  3BY8 A;  1DRM A;  3LUQ A;  3UB9 A;  2MJ6 A;  2H0Y A;  2XFS A;  1CK3 A;  3LR4 A;  4N1H A;  4WBG A;  1G68 A;  4OKP A;  1MC0 A;  2EX8 A;  4KZ5 A;  4KZ3 A;  1XA1 A;  3WRT A;  4OOM A;  3MXQ A;  4P6B A;  5FAQ A;  4CLC C;  3UE0 A;  4HP4 A;  4I5S A;  1G6A A;  1NLZ A;  5L2F A;  3E0Y A;  3N8R A;  2O0Y A;  4N1X A;  2E8I A;  3RXX A;  5GL9 A;  4X6T A;  3LID A;  4S2N A;  1XJ2 A;  2V8F A;  4F3L B;  2EWV A;  4EU0 A;  2LB5 A;  3C8C A;  1W8Q A;  4WZ5 A;  2JKT I;  4E3K A;  1K25 A;  3A3E A;  2WKQ A;  2Y79 A;  4R23 A;  2PDR A;  5IU1 A;  3M6B A;  3TJZ C;  4GHI B;  4LV2 A;  3N7W A;  2W3E A;  2EX2 A;  1NJ4 A;  1GCE A;  4GN2 A;  3VE4 A;  4X56 A;  3T50 A;  3TE8 A;  1MXO A;  1Q2Q A;  1T1B A;  5L8M A;  1E3U A;  4D2O A;  1PRQ A;  3N8S A;  3LY3 A;  2HV1 A;  4UQI S;  4E04 A;  1JWP A;  4S2M A;  1CI8 A;  1AWI A;  4YFM A;  1OTE A;  4E3M A;  1N9N A;  3ITB A;  2IWC A;  4CPK A;  3UB8 A;  4OQI A;  4ARZ A;  1ONH A;  1GSV A;  1L0F A;  4BWI A;  4OOL A;  3UO9 A;  4Y7P A;  3Q1F A;  3QNB A;  1HZO A;  2FFY A;  3BEC A;  2P74 A;  4KUO A;  3MQO A;  4Y0T A;  1G28 A;  1OPX A;  1KDS A;  1D1J A;  1MWR A;  4JXS A;  1YLZ A;  3R7W A;  5L09 A;  3ZVT A;  1S0W A;  4E3O A;  1FOF A;  1I2W A;  3GMW A;  3QP1 A;  5FSR A;  5FAT A;  3CMZ A;  2Y55 A;  1LHY A;  1LSW A;  4EEP A;  4KQD A;  2J80 A;  3IF6 B;  3N8L A;  4WF0 A;  4F94 A;  4Y13 A;  1P9R A;  3CIT A;  4KZ8 A;  5F6A A;  3S1Y A;  1DJB A;  2G2W A;  4HY8 A;  3UE1 A;  5CHJ A;  3ZNY A;  3P09 A;  4KQO A;  4X68 A;  3F1P A;  4X1L A;  3ISG A;  4N9K A;  2VGK A;  1W7F A;  5CGX A;  3DTE A;  3LIB A;  1P0Z A;  3VP2 A;  1S6R A;  1XJ4 A;  1OTD A;  3UB5 P;  3K3D A;  2JKG A;  2YKF A;  3S4X A;  3MMH A;  4H6J B;  4HQA A;  3E4P A;  2Y8H A;  1NY0 A;  2FH5 A;  4B88 A;  2K31 A;  4PM5 A;  3MFD A;  3W2Z A;  3NHQ A;  3A0S A;  1GHI A;  2W1T B;  4E3N A;  5TFQ A;  5HSQ A;  2VGL S;  3BEB A;  1T1C A;  5E2H A;  3UN7 A;  2W1R A;  4O8G A;  4KEN B;  1IKI A;  2D01 A;  2GZA A;  1JTD A;  3LR0 A;  4ME4 A;  3A3F A;  1ONG A;  1IOU A;  4PM9 A;  3MS6 A;  2KDK A;  3ZNT A;  3T12 B;  4DDS A;  5TR7 A;  3G34 A;  2Y2L A;  4M3K A;  2EWW A;  5EFW A;  1CJF A;  1FIK A;  1S67 L;  2E8J A;  5FI7 A;  2WUQ A;  2Y91 A;  1MZU A;  2X01 A;  4IED A;  4E3J A;  5EVL A;  3PBO A;  3VOZ A;  2PBD P;  1K38 A;  4OOY A;  4OQH A;  3U2A A;  4OLD A;  3DAV A;  2OAP 1;  1SCW A;  2PHY A;  2HJ9 C;  3EGD C;  4QU3 A;  1VQQ A;  2VJW A;  3D9Y A;  5EEC A;  4ETZ A;  4KG2 A;  1YSQ A;  3LCE A;  3EQU A;  5FDH A;  3IHA A;  5JYP A;  1N9O A;  2BLS A;  1T18 A;  2ZQ9 A;  2ZQC A;  4EWF A;  2Q9M A;  1TEM A;  1PI4 A;  2JHE A;  4Y15 A;  1KOU A;  1Z6F A;  4GOG A;  2HDQ A;  4QD4 A;  4ZAM A;  3TSG A;  1KGE A;  4S2O A;  3O3V A;  4BMW A;  4NXG A;  4XXR A;  4R1G A;  1SKO A;  3NI9 A;  3IF5 A;  2M7V A;  2W3G A;  3NDG A;  3IBR A;  2XD5 A;  2RL3 A;  5GHZ A;  3AGF A;  3UPO A;  4EBN A;  1TS8 A;  1FSY A;  1PFL A;  2DMW A;  3LYX A;  2QHK A;  4S2I A;  3TRC A;  3IQA A;  3LIF A;  1H8Y A;  4OPY A;  1OT6 A;  1BSG A;  1U60 A;  1OTB A;  1ES2 A;  1H8Z A;  3M2K A;  4I3J A;  4NET A;  3T4T A;  3E2L A;  4Q8I A;  1IYP A;  3T4K A;  3NEC A;  3NOT C;  2ZJ9 A;  2H0T A;  3VFH A;  3R7W B;  4KZB A;  4RX2 A;  2B18 A;  3IWO A;  2VA0 A;  2CMN A;  3NJA A;  2HP9 A;  3UDX A;  3OC2 A;  3OPR A;  2GDN A;  4HNB A;  1E3U D;  4R4S A;  3ZGA B;  1BLH A;  3WRZ A;  2RCX A;  1WYC A;  1ZC2 A;  4EV4 A;  2EA9 A;  5E2G A;  4GHI A;  4B4X A;  3DTM A;  3F1P B;  3PAE A;  1G6O A;  4DDY A;  4DXB A;  2VZW A;  4JXV A;  2X71 A;  5KIZ A;  5HX9 A;  1TD5 A;  3JPU A;  1MWT A;  5FAO A;  4U0X A;  3G35 A;  2K2N A;  2L4R A;  4ZJ3 A;  4O7D A;  5TJJ A;  1HTZ A;  2J3T C;  4KQQ A;  2HJE A;  4Y0O A;  4BL2 A;  1K55 C;  4KUK A;  3OCL A;  1L0G A;  5MC7 A;  1N4O A;  2JN7 A;  5C5K A;  2VV8 A;  3BFD A;  3W4P A;  2NUP C;  5CED A;  1K6R A;  5J4E A;  1ESI A;  2PYR A;  1BLP A;  5GHX A;  3S22 A;  2R9X A;  3HRE A;  3CUE A;  5EVI A;  2ZQA A;  3T4Q A;  5CHU A;  3C7U A;  3LIC A;  2J7V A;  4MDZ A;  3N6I A;  3OPP A;  4KZA A;  1NLY A;  1ERQ A;  1CQA A;  3V67 A;  4DMZ A;  3BQ8 A;  5EVI C;  3LIA A;  1CEF A;  3F1O A;  3FPV A;  1PWC A;  1G5U A;  3QHY A;  4OH0 A;  1H8M A;  1TVF A;  3BQA A;  5A92 A;  1RGY A;  2Y2Q A;  2ZMA A;  2Y2H A;  4LRX C;  5HWW A;  1SDE A;  1TF1 A;  5FQK A;  5E43 A;  1DJC A;  3HL9 A;  5HAQ A;  3EGX C;  4LEN A;  1KGF A;  1MPL A;  4BBU A;  5J7E A;  2QKP A;  2VEA A;  3MR0 A;  5AVF A;  3NOU C;  5TGF A;  4X1M A;  1IEL A;  4DE1 A;  3B3X A;  4XUX A;  4FH4 A;  1FIL A;  4EW7 A;  4JF4 A;  3QP6 A;  4JBF A;  3KYE A;  2IWD A;  2OOL A;  2Q9N A;  3CPT A;  5J3W A;  5DFY A;  5HDS A;  3MZE A;  4H6J A;  1W63 Q;  3PTE A;  4G3V A;  3A3D A;  5KMW A;  3FV7 A;  2OLV A;  1ZG4 A;  4EBP A;  4IBR A;  1PWG A;  1C3B A;  5DTT A;  5IHV A;  1TDG A;  2O9A A;  1ODV A;  2FFF B;  2ZBB A;  2ZD8 A;  4H8R A;  4X55 A;  3UDI A;  4L9F A;  4ZJ2 A;  1L0D A;  2OLU A;  2A2L A;  3MFX A;  1RGZ A;  3GQZ A;  3LR5 A;  4CLC A;  4HJ6 A;  2WGI A;  4KZ9 A;  4PKY A;  1ALQ A;  4KZ7 A;  5HPF A;  4HH3 A;  3IX4 A;  3GVB A;  1MKM A;  4DRT A;  5L07 A;  1YLP A;  4N92 A;  5LBR A;  4IJG A;  2XR0 A;  1N9L A;  2HP6 A;  3R4K A;  5E2F A;  2P08 A;  4BD1 A;  1VM1 A;  3H7W B;  4LV1 A;  3PYP A;  1UWP X;  5HAP A;  3JVV A;  3FPW A;  2X02 A;  3IX3 A;  3T1S A;  4ETX A;  1FSW A;  2H28 A;  4OON A;  3HLG A;  3NC8 A;  4MN6 A;  3EWK A;  1NWZ A;  4BBT A;  5EUA A;  3GRJ A;  1K57 C;  2XRN A;  5FEF A;  4LLO B;  1IKG A;  2XGN A;  3ZG7 B;  4KG6 A;  3SW1 A;  5DJU A;  3KYQ A;  3ZVW A;  4R4R A;  4K0W A;  1PZP A;  1VHM A;  4CQH A;  2A49 A;  3MF0 A;  3IXB A;  5HPI A;  1O07 A;  3OOV A;  5CRF A;  4LV0 A;  2WKH A;  2OWJ A;  4HH2 A;  1LL9 A;  2W27 A;  3C2W A;  3EQV A;  2KOI A;  3PBQ A;  4WEK A;  2BAS A;  4KZ6 A;  2Y2G A;  5EPH A;  3WWX A;  1J9M A;  2XDM A;  2VK3 A;  2ZC7 A;  5DTS A;  4EUZ A;  5HFO A;  4PHT A;  4Y3I A;  2Y4A A;  4HHD A;  4EBL A;  4JPM A;  5CEC A;  1VEU A;  5CEB A;  2JBF A;  5EVI B;  2Z2M B;  4E6W A;  4XT2 B;  5AQA A;  4I39 A;  1ERM A;  1JTG A;  3IX8 A;  4PAU A;  1GA9 A;  1VET A;  4Q0J A;  2PYP A;  4U3T A;  3MZD A;  5CTN A;  4JXG A;  5G18 A;  3OPH A;  3TG9 A;  3W4Q A;  3BLM A;  1Q2P A;  3MKE A;  2INW A;  3HUN A;  3F1O B;  3BLS A;  1GSW A;  1XJ6 A;  2O99 A;  1K4E A;  3SH7 A;  4N9L A;  5AQB A;  4HOI A;  1RCJ A;  4PM7 A;  3DTK A;  3PBN A;  1PZO A;  4UAA A;  1XPB A;  2XEP A;  2Y2I A;  5M19 A;  5A90 A;  4DF6 A;  2IWB A;  4C75 A;  1I2S A;  3LFV A;  4JGO A;  3W4O A;  4QB8 A;  4GKU A;  1FCO A;  2V1B A;  1ZHH B;  4KZ4 A;  2XK1 A;  4EQI A;  1WA9 A;  4PMA A;  5M18 A;  2WKR A;  5FI6 A;  4GS9 A;  4PKY G;  3O86 A;  3CPT B;  3UE3 A;  1XFQ A;  1N9B A;  1P9W A;  3VP1 A;  3WS4 A;  2V0W A;  1OT9 A;  4EQ1 A;  5FL3 A;  3ULF A;  3HBR A;  4CLC E;  3UDF A;  4R6L A;  3CWF A;  2PU4 A;  1Y28 A;  4HJ3 A;  4S2P A;  1DJA A;  3O5Y A;  1YT4 A;  1K4F A;  3IT9 A;  1K56 A;  2IA2 A;  1XP4 A;  2B02 A;  3IWI A;  5HWV A;  3T1R A;  4RX3 A;  2W3D A;  4CLC B;  3NIA A;  3KX0 X;  1JWV A;  1MKI A;  4GDB A;  4X69 A;  3TOI A;  2XA7 S;  1LI0 A;  3ZYT A;  2JE5 A;  1A0K A;  2ZLY A;  3FKW A;  3UME A;  3CG5 A;  1PNE A;  4ZRR A;  4R38 A;  4LGW A;  2PU2 A;  3O88 A;  4HEF A;  2V2F F;  4WZ4 A;  1LSV A;  5FQI A;  1ZG6 A;  2ACG A;  2WAD A;  3UPP A;  1S1Y A;  5CX7 A;  4KG5 A;  4WLA A;  4RVA A;  2ZMV A;  1AXB A;  3MJQ A;  5F5Y A;  3KSH A;  1HVB A;  1V9Z A;  4DE3 A;  1MY8 A;  3BYD A;  2B5R A;  3LO7 A;  3B33 A;  3L9K A;  4CLC D;  5FAS A;  3MXR A;  3T1Q B;  4QY5 A;  1JVJ A;  1KVL A;  3D72 A;  2WZZ A;  4CJN A;  3IXH A;  1NZU A;  2ZMF A;  4D60 A;  2WKI A;  3KO6 A;  4JF5 A;  1ACF A;  1PW1 A;  2EX6 A;  5HD3 A;  3VOY A;  4G3K A;  1XGJ A;  2Z6C A;  1SDN A;  3BY9 A;  5AJG A;  2PRF A;  2BG1 A;  2Y2M A;  3D4F A;  2WGW A;  2ZOI A;  5BOH A;  2WKP A;  2ZC5 B;  3V39 A;  3T4L A;  1H5X A;  4II7 A;  5DJT A;  3MKF A;  5HAR A;  3ZFZ A;  4LPZ A;  5TBM B;  1VEU B;  4I3A A;  5A91 A;  2Y2J A;  3T4S A;  2PD8 A;  1XXM A;  4OQ0 A;  3VP4 A;  4I3I A;  3OZH A;  4RA7 A;  1ES3 A;  4PM6 A;  1ERO A;  3H7W A;  4UA6 A;  1FQG A;  5FQM A;  1K54 C;  1VET B;  3A3J A;  3KYZ A;  4WYY A;  5D3O A;  1W79 A;  4UA7 A;  2EX9 A;  5F1G A;  1XKZ A;  2WK0 A;  4LCM A;  5FQQ A;  4DE0 A;  2BTF P;  1WYB A;  3V3R A;  3Q81 A;  4NXB A;  4A5R A;  3U4L P;  2ZC4 B;  3PAG A;  1UWN X;  4Q0I A;  2PR6 A;  1YSP A;  3BJN A;  3VOL A;  1YM1 A;  3LEQ A;  1I5Q A;  4Y17 A;  1CEG A;  4IUK A;  5CGW A;  3Q07 A;  4DJ2 A;  4HBU A;  4HI4 A;  3GTC A;  3PHY A;  3S7Q A;  3C4P A;  4HES A;  1FCN A;  4MBK A;  2H10 A;  1K55 A;  3SZT A;  3FYZ A;  3G2Y A;  4GS9 B;  1X0O A;  1YLW A;  1ZTU A;  1NYY A;  5DKL A;  1O7E A;  4OPQ A;  4DJ3 A;  1S4R A;  1P97 A;  2DCF A;  2KX6 A;  4G3W A;  2W0N A;  3SS5 A;  3T1X A;  2JKF A;  4YWZ A;  3HUM A;  4NKP A;  4R3A A;  4Y2F A;  4EET B;  5J8X A;  1DP9 A;  4QWO A;  5HZH A;  1NZO A;  4XT2 A;  2ZC6 B;  1NRF A;  4WEL A;  2XFT A;  3GSG A;  2GX5 A;  4HIA A;  1HD8 A;  2QZ6 A;  4K91 A;  3KSG A;  3HVF A;  2PD7 A;  3DTI A;  5I94 A;  4QJG A;  2ZC3 B;  4GJ4 A;  4QPR A;  2I9V A;  2WYX A;  4B93 A;  2QYB A;  1IYO A;  2JC7 A;  3WS2 A;  5HD5 A;  1FR1 A;  2L0W A;  4Z9Q A;  3LI8 A;  2R9W A;  5F68 A;  1PI5 A;  5HW3 A;  4ID4 A;  3DW0 A;  3LY4 A;  3G6O A;  1QME A;  3GV9 A;  1YKD A;  4LRY C;  5CHM A;  5FAP A;  3MBZ A;  3IH9 A;  3E98 A;  3Q82 A;  3HLF A;  2HP5 A;  4MN5 A;  3GDI A;  3HLC A;  2Z2L B;  4WMC A;  5AQ9 A;  1OTI A;  2W3F A;  5DF7 A;  4C3Q A;  4ZJ1 A;  3SH9 A;  4JKT A;  4AFI A;  1GHP A;  1PW8 A;  4JGR A;  3C7V A;  3UY6 A;  5FQJ A;  1K56 D;  5K5B A;  1Y54 A;  3IF6 C;  1BLC A;  4RYE A;  1JNU A;  2A24 A;  3NCK A;  3VE3 A;  1D7E A;  2FZ0 A;  4JXW A;  3K2N A;  4ZTK A;  2ZM8 A;  2V0U A;  3MQ0 A;  1BLS A;  4DN0 A;  4YNR A;  5FI2 A;  1OME A;  3T4O A;  3VSK A;  5GLA A;  2Y2N A;  2EFU A;  2YKH A;  3IHB A;  3ZDJ A;  2QMI A;  1KGG A;  1KE0 A;  2PAV P;  3ZHH A;  2M7U A;  3ITA A;  2WGW B;  1BTL A;  3HLB A;  3B42 A;  5DTK A;  5EOE A;  3M2J A;  5EV0 A;  1UGU A;  2WAE A;  3IXD A;  1DP6 A;  1CF0 A;  5DFX A;  3G2Z A;  2XA7 M; 
#chains in the Genus database with same CATH homology
 3UMD A;  4UQI M;  4K08 A;  1KOU A;  1VB6 A;  3MQQ A;  3S7P A;  3RTY A;  3LFV A;  4JGO A;  1STZ A;  4Z1W A;  2PR5 A;  1GSX A;  2Z6D A;  3FG8 A;  2O9B A;  3JVU A;  5HWT A;  4BMW A;  5IS1 A;  4FOF A;  3NOP C;  4NXG A;  4MMN A;  4EXO A;  2V1B A;  1ZHH B;  1D06 A;  3TW8 A;  1S4S A;  1WA9 A;  3HJI A;  3PBT A;  3BWL A;  2M7V A;  2WKR A;  2W3G A;  3DBA A;  3IBR A;  3PBR A;  4GS9 A;  2W3H A;  3CI6 A;  2VLG A;  2GJ3 A;  1LL8 A;  2P04 A;  4PKY G;  3H9W A;  3UE3 A;  1XFQ A;  3A0R A;  5G4Y A;  1P9W A;  2XRO A;  5KSH A;  4JGP A;  3ZQ5 A;  1TS8 A;  3RFB A;  4YOF A;  2G7U A;  3CUE C;  2DMW A;  1F5M A;  3LYX A;  2V0W A;  2QHK A;  3PR6 A;  3TRC A;  1OT9 A;  4EQ1 A;  3LIF A;  5FL3 A;  3ULF A;  3EEA A;  3IS2 A;  4CLC E;  1OT6 A;  4R6L A;  1T1A A;  3CWF A;  1OTB A;  5AVE A;  3H82 B;  1Y28 A;  4GW9 A;  4EES A;  4I3J A;  4HJ3 A;  3T4T A;  3BW6 A;  4B9O A;  3PXP A;  3T4K A;  2M1C A;  2JKT M;  3O5Y A;  3NOT C;  5HDC A;  2VKS A;  2IA2 A;  2B02 A;  2OWH A;  2O9C A;  3R7W B;  5HWV A;  2W3D A;  4CLC B;  2VX8 A;  4BJP A;  5I5L A;  2B18 A;  3EEH A;  2V1A A;  2JKR I;  2VA0 A;  3P01 A;  2VV6 A;  3KX0 X;  3HCY A;  2CMN A;  2R78 A;  4L9E A;  3NJA A;  1H3Q A;  2QWS A;  4BBV A;  4MN7 A;  3OC2 A;  1NRJ A;  4HNB A;  1TS0 A;  2XA7 S;  5TBM A;  2NUT C;  3ZYT A;  4JGQ A;  4EUV A;  3GEC A;  1T19 A;  3UME A;  2EA9 A;  4WEJ A;  5IT5 A;  1XJ3 A;  4ZRR A;  4GHI A;  4O0P A;  4R38 A;  3F1P B;  1F9I A;  4Q0H A;  1G6O A;  1LSX A;  3KSF A;  2V9A A;  2VZW A;  2OAQ 1;  2W1T A;  4NXE A;  3LIE A;  4WL9 A;  4EEU A;  1LSV A;  2J3T D;  1S1Y A;  5CX7 A;  5KIZ A;  3C30 A;  4WLA A;  2VGL M;  3UB6 A;  1TD5 A;  2ZMV A;  4IHQ A;  3IBJ A;  3MJQ A;  3BY8 A;  5F5Y A;  1DRM A;  3KSH A;  3LUQ A;  3UB9 A;  2K2N A;  1V9Z A;  2L4R A;  2MJ6 A;  5TJJ A;  3T4J A;  3VV4 A;  3OLO A;  2J3T C;  3LR4 A;  2K7S A;  3KSI A;  2HJE A;  3B33 A;  1IFQ A;  3F1N A;  4KUK A;  3OCL A;  4CLC D;  1MC0 A;  5MC7 A;  3RH8 B;  3C38 A;  2JN7 A;  5C5K A;  2VV8 A;  3IS2 B;  2NUP C;  3D72 A;  4LRZ E;  5J4E A;  2ZMF A;  4OOM A;  2PYR A;  3D3O A;  3MXQ A;  4CLC C;  3LI9 A;  3KO6 A;  2KLI A;  3CUE A;  4HP4 A;  3T4Q A;  4I5S A;  3LIC A;  4P6Z M;  1NLZ A;  1W63 M;  4MDZ A;  1V9Y A;  5F69 A;  5HD3 A;  1S66 L;  4G3K A;  3E0Y A;  1OTA A;  1NLY A;  2Z6C A;  3BY9 A;  5AJG A;  2O0Y A;  3V67 A;  3PBS A;  4DMZ A;  3BQ8 A;  3LIA A;  3LID A;  3F1O A;  2ZOI A;  2A24 B;  1XJ2 A;  3FPV A;  2WKP A;  1H8M A;  4F3L B;  2EWV A;  3T4L A;  4II7 A;  5DJT A;  4EU0 A;  4Y5F A;  2LB5 A;  3BQA A;  3C8C A;  4LPZ A;  5TBM B;  1XFN A;  1TS6 A;  2JKT I;  1OJG A;  4I3A A;  3T4S A;  2WKQ A;  2PD8 A;  2Y79 A;  4UEY A;  4NXF A;  4I3I A;  2PDR A;  4LRX C;  4FSF A;  5IU1 A;  2ZOH A;  5HWW A;  3TJZ C;  4GHI B;  3H7W A;  1TF1 A;  2QJ5 A;  2W3E A;  3KYZ A;  2HF6 A;  3EGX C;  1F98 A;  3VE4 A;  4BBU A;  5J7E A;  2QKP A;  2VEA A;  3T50 A;  3TE8 A;  3MR0 A;  5AVF A;  3NOU C;  4RQ9 A;  1T1B A;  2D02 A;  5L8M A;  3CAX A;  4L9G A;  4EW7 A;  5G4Z A;  2HV1 A;  4O01 A;  4UQI S;  2OOL A;  4E04 A;  5J3W A;  5DFY A;  1OTE A;  3EOI A;  5HDS A;  4NXB A;  2VV7 A;  1N9N A;  4GCZ A;  4H6J A;  1W63 Q;  4G3V A;  1UWN X;  4Q0I A;  3UB8 A;  2PR6 A;  1YSP A;  4ARZ A;  1GSV A;  3BJN A;  5DF9 A;  3VOL A;  3FC7 A;  4IUK A;  4DJ2 A;  4HI4 A;  2PT7 A;  4BWI A;  4OOL A;  4MCW A;  3PHY A;  3S7Q A;  1S1Z A;  3H82 A;  2LB9 A;  2HGV A;  2O9A A;  1ODV A;  3E4O A;  2ZBB A;  3MQO A;  4KUO A;  1YAX A;  4GS9 B;  3OCN A;  1G28 A;  1OPX A;  1X0O A;  1ZTU A;  5DKL A;  4L9F A;  3S7O A;  2A2L A;  4DJ3 A;  1S4R A;  1P97 A;  5A8B A;  3MFX A;  3OBF A;  2KX6 A;  3R7W A;  4G3W A;  3LR5 A;  4CLC A;  4HP9 A;  4HJ6 A;  2W0N A;  4EER A;  4YWZ A;  4NKP A;  5HL6 A;  4PKY A;  5HPF A;  4R3A A;  4HH3 A;  1LT0 A;  1MKM A;  4Y2F A;  1LSW A;  5LBR A;  4EET B;  4EEP A;  4IJG A;  1DP9 A;  4KQD A;  2J80 A;  2JHE A;  4WF0 A;  3P7N A;  1N9L A;  5HZH A;  3R4K A;  1P9R A;  3CIT A;  3UB7 A;  5F6A A;  4WUJ A;  3ICY A;  2P08 A;  4HY8 A;  4XT2 A;  3H7W B;  4KQO A;  4WEL A;  3PYP A;  1UWP X;  3LR3 A;  3F1P A;  3JVV A;  3FPW A;  2GX5 A;  4HIA A;  4ETX A;  2H28 A;  3KSG A;  2PD7 A;  3LIB A;  1P0Z A;  4MN6 A;  3EWK A;  1XJ4 A;  4GJ4 A;  4QPR A;  2I9V A;  1OTD A;  4B93 A;  1NWZ A;  5DKK A;  3K3D A;  4BBT A;  2QYB A;  2GNX A;  5HD5 A;  2QJ7 A;  2L0W A;  2YKF A;  3LI8 A;  1BYW A;  3MMH A;  4H6J B;  2XRN A;  5F68 A;  4HQA A;  3E4P A;  2Y8H A;  3A0V A;  4L0L A;  3G6O A;  4ARZ B;  2FH5 A;  4LLO B;  2K31 A;  2J3W A;  4LRY C;  1YKD A;  3W2Z A;  3NHQ A;  3E98 A;  3A0S A;  3SW1 A;  2W1T B;  5DJU A;  4HJ4 A;  3KYQ A;  4MN5 A;  5HSQ A;  2VGL S;  4GLQ A;  3GDI A;  1T1C A;  1VHM A;  4CQH A;  5HDD A;  1OTI A;  2W1R A;  3E4Q A;  3MF0 A;  4NEE D;  2W3F A;  5HPI A;  4O8G A;  3OOV A;  3S7N A;  1OJ5 A;  2OWJ A;  2D01 A;  4AFI A;  2GZA A;  3LR0 A;  4ME4 A;  3CLO A;  1IOU A;  4HH2 A;  4JGR A;  3C2W A;  2W27 A;  2XSS A;  3EQV A;  2KOI A;  3PBQ A;  4WEK A;  2BAS A;  2KDK A;  5K5B A;  3F1N B;  1JNU A;  2EWW A;  1DP8 A;  2A24 A;  4PHT A;  3VE3 A;  1D7E A;  5EFW A;  2FZ0 A;  4Y3I A;  1S67 L;  2L1M A;  4F3L A;  2JKR M;  4HHD A;  1MZU A;  3K2N A;  2V0U A;  3MQ0 A;  4DN0 A;  4IUH A;  4YNR A;  3PBO A;  4P6Z S;  4XT2 B;  3T4O A;  4I39 A;  3U2A A;  4PAU A;  2YKH A;  4Q0J A;  2OAP 1;  2PYP A;  3HJK A;  2PHY A;  1EW0 A;  2HJ9 C;  2P7J A;  2INW A;  3EGD C;  4WN5 A;  2M7U A;  4M4X A;  2VJW A;  4I38 A;  4ETZ A;  3B47 A;  3F1O B;  1GSW A;  1YSQ A;  3EQU A;  1XJ6 A;  3B42 A;  2O99 A;  1UGU A;  4HOI A;  1N9O A;  1TS7 A;  1T18 A;  1DP6 A;  4R70 A;  3K3C A;  3UE6 A;  3PBN A;  5DFX A;  2XA7 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...