4EETB

Crystal structure of ilov
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
111
structure length
111
Chain Sequence
FIEKNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFIGVQLDGSDHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein, flavoprotein
molecule keywords Phototropin-2
publication title Structural Tuning of the Fluorescent Protein iLOV for Improved Photostability.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 34
structure length 111
sequence length 111
chains with identical sequence D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4eetB00
4B9OA 1G28A 3UMDA 4HOIA 3UMEA 2P7JA 1OJ5A 3K3DA 2WKPA 1N9OA 2A24B 4WLAA 3HJKA 2PYRA 2JHEA 4BBVA 3BWLA 3GECA 2ZBBA 4HJ3A 4JGRA 4BBTA 4L9GA 3EWKA 3VOLA 1MZUA 3MR0A 5KIZA 5F69A 2V9AA 4RQ9A 5IS1A 1TS6A 4L9FA 2VEAA 2QWSA 1UWNX 2HV1A 4LLOB 3FC7A 3H9WA 4NXEA 1S67L 1LL8A 4GCZA 5F5YA 5AVEA 3G6OA 3SW1A 4GS9A 3T50A 2PHYA 1T1AA 3H7WB 2EA9A 3PHYA 1UGUA 5J7EA 3FG8A 2QKPA 3MXQA 4PKYA 1DP8A 1DRMA 5HDCA 4WUJA 4HJ4A 1P97A 3MJQA 3B33A 5F68A 1GSXA 1Y28A 1S4SA 2PD7A 2I9VA 5G4ZA 3IS2A 2VV7A 3MQOA 3C2WA 3E4QA 3LIBA 5A8BA 5G4YA 3PYPA 1ODVA 1N9LA 1LSWA 1T1CA 3NHQA 1KOUA 3LI8A 5DJTA 4EW7A 4L9EA 1JNUA 1XFNA 1S4RA 4HI4A 4H6JA 2H28A 1OT9A 3BY8A 4GHIA 4M4XA 2ZOIA 1GSVA 3P7NA 1EW0A 2PR6A 2Z6CA 2WKRA 4I3JA 3MQQA 1GSWA 3EEHA 4K08A 4YWZA 4HNBA 1WA9A 3F1PA 4EETB 3E4OA 3F1PB 5TBMA 4EEUA 2PYPA 4LRXC 3D72A 3F1NB 3LIAA 1OTBA 5HD3A 5HWWA 5TBMB 4JGOA 1T18A 3ICYA 2KDKA 2L1MA 1XJ4A 3H7WA 3RH8B 3BY9A 2L4RA 1BYWA 2PDRA 4KUKA 3LICA 3A0RA 2VLGA 5F6AA 3NOPC 4R3AA 1P0ZA 2D01A 3CWFA 4EQ1A 4F3LB 3NOTC 3GDIA 3NJAA 2WKQA 4R6LA 1V9YA 4PKYG 1XJ2A 3F1OA 3UB7A 3H82B 5J4EA 1NWZA 1TS7A 4R70A 3UB9A 4HHDA 1X0OA 2YKHA 3F1OB 3E4PA 5DKKA 3UB6A 4HP9A 3CAXA 4LRZE 2INWA 4MN5A 1OTIA 1OTAA 5HSQA 4WL9A 4EERA 4NXFA 2PR5A 1S1YA 3K3CA 1XFQA 2L0WA 2QJ7A 1D7EA 4LRYC 3OLOA 4WN5A 2D02A 4XT2B 4HH3A 2OWJA 2YKFA 4EEPA 1D06A 3RTYA 2V0WA 2W27A 2KX6A 2B02A 2OOLA 3HJIA 2GJ3A 1N9NA 1T1BA 2R78A 3F1NA 4HP4A 3IBRA 4HY8A 5DJUA 4KQDA 1V9ZA 2VV6A 3NOUC 3A0VA 5DKLA 5HWVA 2BASA 1XJ6A 3C8CA 3LUQA 3LIDA 1TS8A 1DP9A 2CMNA 3CLOA 2W0NA 3ZQ5A 1DP6A 4HH2A 5I5LA 2JN7A 4F3LA 4HJ6A 1F9IA 5HZHA 3LYXA 3A0SA 1OT6A 4I39A 5HDDA 4HIAA 3H82A 4EESA 4JGQA 4MN6A 1XJ3A 5HWTA 4GW9A 4I5SA 2M1CA 4KUOA 4LPZA 3ULFA 2J80A 2QHKA 1OTEA 4GS9B 3KX0X 3LIEA 4NXBA 1F98A 3LIFA 4I3AA 5AVFA 5HDSA 1S66L 3UE6A 2V0UA 2Z6DA 4EXOA 3UB8A 1LT0A 1OJGA 5J3WA 4I3IA 2V1BA 4E04A 5EFWA 1TS0A 4I38A 3MFXA 4R38A 1LSXA 4XT2A 2K7SA 1T19A 1LSVA 2V1AA 3VE3A 1UWPX 4BBUA 3IS2B 2OWHA 1S1ZA 4HQAA 4JGPA 3LI9A 4DJ3A 4NXGA 3VE4A 4WF0A 4DJ2A 5HD5A 5IU1A 2QJ5A 2VV8A 4H6JB 2PD8A 1VB6A 1OTDA 2ZOHA 4GHIB 2A24A
chains in the Genus database with same CATH superfamily
4B9OA 1G28A 5FA7A 1YLTA 2P7JA 4KQQA 5DTTA 3Q81A 2IA2A 2WKPA 4JXGA 2A24B 1MWRA 5L09A 3N7WA 2JHEA 3BWLA 3GECA 3MZDA 2PAVP 3KSGA 5KSCA 4RVAA 3VOLA 4QWOA 3MR0A 3WS4A 3LR0A 2V9AA 4KZBA 2H0TA 5IS1A 1HLUP 5M18A 3MBZA 2QWSA 2O9AA 2HV1A 3Q7ZA 4XUXA 3N8RA 4Y0TA 3IF6C 2ZQAA 4CQHA 5IHVA 3T50A 1LI9A 2PHYA 3SS4A 1QMEA 5EOEA 1K4EA 4R3JA 2EA9A 4BQMA 1VEUB 4KZAA 5FQIA 2QKPA 4WYYA 2XD5A 5HARA 5HDCA 2DMWA 2PRFA 5FSRA 3HVFA 3W4QA 3GRJA 3MJQA 1L3LA 3OZHA 1GSXA 1M40A 4ETZA 3KSHA 1ESUA 2I9VA 3IBJA 3NULA 3V3SA 2VV7A 3B3XA 3E4QA 4X68A 2IWBA 5GLAA 4LFUA 3A3DA 1HD8A 4PAUA 3UDIA 1N9LA 3TJZC 1KOUA 2HDSA 2ZC3B 4M3KA 4PPRA 1JNUA 1XFNA 3QP4A 2HJ9C 4OH0A 1MKMA 1YQSA 5E2HA 2C5WB 1PNEA 3VOZA 3P98A 1W79A 4YFMA 3Q7VA 4Y5FA 1ERMA 1GSVA 4I3JA 1K4FA 3PR6A 3MQQA 4FOFA 4DE2A 4KZ5A 3EEHA 3TW8A 4JXSA 4RA7A 3GSGA 3UPOA 1DJCA 3F1PB 2W3HA 1ZC2A 1OTBA 1SDEA 2PU4A 5HD3A 2ZQ7A 5TBMB 3I7JA 3K2NA 1H5XA 1W63M 3ICYA 2L1MA 4OPRA 2P9VB 4E3LA 2WKHA 2JBFA 3SH8A 1HZOA 2ZQ8A 4EBPA 4KUKA 1BSGA 3A0RA 4GKUA 4R23A 3ZVWA 1Q2QA 4QHCA 3NCKA 4GD8A 3NOPC 5F6AA 3DWKA 3GDIA 5CTNA 1NRJA 2EX2A 2HDQA 3CPTB 2J3TC 1V9YA 1IYQA 1YKDA 3UB7A 2P74A 4R70A 3Q07A 2Y2GA 3UDXA 4ZBEA 5A92A 5CX7A 3UB6A 5IT5A 2WADA 3CAXA 5TGFA 2Y2PA 4LRZE 3BFEA 4MN5A 2WUQA 5HL1A 1GA9A 1XP4A 4NXFA 1S1YA 1KDWA 1KVLA 5F83A 1NZOA 1MWSA 2OSUA 2W1TB 3TOIA 3VV4A 1ONHA 2OWJA 4U0XA 4WMCA 1BLCA 4FD8A 1ES4A 1FQGA 4QB8A 1G6AA 2BLSA 4E6WA 3QP5A 3IQAA 3QNBA 3F1NA 2JC7A 3FV7A 4C75A 2XQZA 3N8SA 4FCFA 4MBFA 2OLVA 5DJUA 4N1HA 5TFQA 4KQDA 3ZCZA 3GMWA 2VV6A 4OPYA 1ES5A 4QD4A 2ZL1B 4DMZA 2J3WA 3A0VA 1LHYA 4UEYA 4F94A 3VSLA 4LV0A 3C8CA 4DN0A 3V39A 1HTZA 3CUEC 3LIDA 2EFUA 2VJWA 3BQ8A 2EFXA 1NYMA 3LR5A 3PBTA 1DP6A 2A2LA 1L0EA 4QPRA 3DAVA 3FKVA 1SCWA 2JN7A 4F3LA 1YT4A 3IF6B 4HJ6A 1VETA 4BMWA 5AJGA 1BLPA 4BLMA 5EOOA 3UY6A 1IKGA 2JKGA 2M7VA 4HBTA 4I39A 1RCJA 4RYEA 4ZTKA 2Y2OA 3BLMA 1XJ3A 4R4SA 3PBNA 2M1CA 3TSGA 3R4KA 3BFCA 4IUHA 3LIEA 2XD1A 2K31A 4MBKA 1F98A 3ZVTA 5AVFA 3S4XA 4EBLA 2VGJA 3L7HA 3MQ0A 5KSHA 3UE6A 3WS5A 1LT0A 3RXXA 5L07A 4S2OA 1G6OA 1VM1A 3V5MA 4E04A 2ZQ9A 2W3FA 3OCNA 4R38A 2ZMVA 4GLQA 4IJGA 4S2PA 4MBHA 3AGDA 4XT2A 1T19A 3EQUA 3WRTA 3MKEA 2V1AA 5DVAA 1UWPX 4BBUA 1S6RA 3EOIA 2OWHA 4Q0JA 2OV5A 2W3DA 3T1QB 4R3BA 1KGEA 3VE4A 1K6SA 1CF0A 4DJ2A 2QZ6A 5A91A 3ZG9B 2Q0OA 4DDSA 5CHUA 4R0QA 2JKTI 4GN2A 4WM9A 3O86A 1SKOA 4H6JB 2PD8A 2ZOHA 2R9XA 2ZQDA 5D3OA 1VHMA 4CLCC 4GHIB 2X02A 2M7UA 2A24A 1G68A 1ONGA 3T4KA 2R9WA 4KZ7A 3T4SA 4IEDA 1OJ5A 4OOLA 2LB5A 5EPHA 3CITA 3VP2A 1PWCA 2WGWA 3BRMA 4WLAA 3HJKA 4BBVA 2ZBBA 4BBTA 3SZTA 3EWKA 3OCLA 2HGVA 3T4TA 2B18A 5KIZA 5F69A 3S1YA 3HCYA 2EX8A 5CGXA 3DTKA 1KE4A 4L9FA 4BL2A 2VK3A 3IT9A 4KZ3A 4FH4A 3S7NA 5FAPA 4B4ZA 1EWZA 3SS5A 3ISGA 4P0MA 1LLBA 1NY0A 1S67L 3Q1FA 2ZQCA 3SH9A 4GCZA 5F5YA 2V20A 1T1AA 5CGWA 1PI4A 4WEKA 5EM0A 4OONA 2HP9A 1XX2A 3H7WB 5FDSA 1ALQA 3A3FA 2BTFP 1CK3A 4PKYA 2Y2IA 1DRMA 3MFDA 2ZLYA 4Y3IA 1C3BA 1K54A 2HPBA 4KG5A 4PM8A 2EWVA 3VFFA 5G4ZA 2ACGA 4S2IA 3MQOA 3NI9A 4LV1A 3JYIA 4KG2A 4BENA 4Z9QA 1TDLA 1ODVA 1NJ4A 3CMZA 1LSWA 2LB9A 3NHQA 5FQKA 5DJTA 5JYOA 1S4RA 1OT9A 1D1JA 3PAGA 2XF3A 3B42A 2XR0A 1GHIA 1M6KA 5E2FA 3T4JA 2ZOIA 4Y15A 1FIKA 2VGLS 1BULA 3KYQA 1EW0A 2Z6CA 2WKRA 3MZFA 3HLWA 2H5SA 1CJFA 1GSWA 3LO7A 1BT5A 2GX5A 4YWZA 3T1XA 1E4DA 4HESA 1WA9A 5FASA 3F1PA 3PBQA 2XRNA 4DE3A 5CGSA 4ZJ2A 3ZNYA 3G31A 1CEFA 5TBMA 2PYPA 3UN7A 1PW8A 3GQZA 5DF9A 3HLBA 4S2JA 1MKIA 3LIAA 4DRTA 3MMHA 2HP5A 1WE4A 3MXSA 5HWWA 4JGOA 3BFFA 2O9BA 2HZ5A 4OQ0A 3ITBA 4H8RA 4JF4A 2KDKA 2G2WA 3U2AA 1SZVA 2L4RA 2PBDP 2O9CA 3LICA 3N4IA 4LENA 4OPQA 3G30A 1H8MA 4OP8A 1W63Q 3NIAA 4LCMA 1BLHA 1EROA 4R3AA 3CWFA 2WKQA 3T12B 1FCOA 3HLFA 5EVIC 4OQHA 2OAP1 2HDRA 1W7FA 4BD0A 4IBXA 4KZ6A 1MC0A 4KQOA 1TS7A 3O3VA 1TEMA 4D60A 3F1OB 5DKKA 5HAQA 3C4OA 1RGZA 3OPHA 2PBYA 1YMSA 5TR7A 4II7A 3NY4A 1OTIA 4KG6A 1PW1A 2W1TA 2EXAA 5GL9A 5CECA 1W8YA 1BTLA 3LEQA 1K55C 2ZMFA 1YPRA 2D02A 4HH3A 2WKEA 4YOFA 4E3OA 3WS0A 4RX2A 1K57A 2Y2NA 3G32A 4JPMA 3UO9A 3ZG7B 2FFYA 1U60A 3RTYA 2W27A 3PAEA 3RFBA 1O07A 5GLCA 3IWQA 2XEPA 4B88A 4CLCB 1ES2A 2B02A 2VGLM 1FCMA 3VFHA 3A3EA 3BFGA 1IELA 2O99A 2ZL1A 2G7UA 4UA7A 4Y0OA 1L0GA 1XA1A 4AFIA 4EWFA 1JWPA 1MXOA 4N1XA 4CPKA 5HWVA 1IYPA 5FQJA 3A3JA 3EGDC 4DE0A 1IYOA 1YLYA 4IHQA 3C4PA 5M1AA 1GA0A 5FL3A 3ZYTA 2WGVA 4ESPA 2W0NA 3ZNTA 3IF6A 3S7QA 4HH2A 4ZAMA 5I5LA 3IX4A 4GNUA 1F9IA 3GTCA 1YLWA 1JTGA 4P87A 3IWIA 3A0SA 1YLZA 4KZ9A 2XROA 4P85A 2WAEA 4HIAA 3H82A 5HAPA 1L2SA 4JGQA 1H0MA 4CLCE 4I5SA 4MDZA 4LPZA 3ULFA 2E8IA 1OTEA 1MPLA 5FI2A 2J7VA 1XA7A 4U0TA 3KX0X 4NXBA 2XK1A 5CHJA 2DCFA 4KZ8A 3VSKA 5DTSA 3LIFA 5HDSA 4PHTA 3T4OA 1S66L 5BOHA 4S2NC 4EXOA 2O0YA 1YSPA 1GHPA 3D9YA 2WZXA 3CZDA 3G35A 3BYDA 2JKTM 3R7WA 3M2JA 3DTIA 4QY5A 1LSXA 1FSWA 3T4LA 3LR3A 3VE3A 4ZDXA 5FQQA 3C7VA 1LI0A 1JWVA 2H10A 3DW0A 1TDGA 4LCLA 4E3KA 2XSSA 1NLZA 2CC1A 3AGEA 2ZJ9A 4WF0A 4G3VA 3ZG8B 4Q0HA 5IU1A 3NDEA 1K56A 1FR1A 1ZG4A 2ZC4B 1SDNA 2X01A 2ZD8A 1OTDA 1FOFA 4Q0IA 1H3QA 3FPVA 5EM1A 3TRCA 3ZG0A 1XPBA 4ZRRA 2Q9NA 3A3IA 3Q7VB 3EQVA 4QY6A 3K3DA 3MKFA 3DTEA 5KMWA 4JGRA 1S0WA 4L9GA 1YM1A 1YLJA 1PRQA 4A5RA 1L0FA 4KENB 4RQ9A 4Z1WA 1TS6A 5C5KA 4ETXA 5CXWA 2VEAA 3GVBA 1JVJA 4MEZA 2XLNA 3N8LA 3PBOA 3FC7A 4LLOB 5GLDA 1I5QA 1TVFA 3HBRA 4JLFA 1F5MA 4C6YA 4EUVA 5AVEA 3LEZA 3G6OA 4XXRA 1BLSA 2C6WB 4GS9A 4BWIA 4OP5A 1ZKJA 5CEDA 1MWTA 4OOMA 5GHXA 3SOIA 2XA7S 1WYBA 3TG9A 5J7EA 5EVIB 3MXQA 1DP8A 2Y2QA 4Q8IA 2Y55A 4ZJ3A 2K2NA 2HF6A 4HJ4A 1P97A 3B33A 3E2LA 5CHMA 1Y28A 3BJNA 2PD7A 4DF6A 1TF1A 2VGKA 3IS2A 5GLBA 3WS1A 3C2WA 3NBLA 3LIBA 3E98A 1IEMA 3UDFA 4ARZB 3PYPA 1E25A 5DFYA 4EU0A 1ZTUA 1T1CA 3KYZA 3LI8A 2UWXA 3E0YA 2GZAA 3HLEA 5FAQA 3BW6A 1Z09A 4HI4A 2H28A 1K25A 2Z2LB 1A0KA 3PBSA 4G3WA 1K6RA 3BY8A 2G2UA 3NECA 5FDHA 4UA9A 3UNWA 1IFQA 4LGWA 4KQRA 2PR6A 2V8FA 3MS6A 1PWDA 3P09A 2W1RA 1L0DA 3NC8A 4KZ4A 3VOYA 3BQAA 1AXBA 5F1FA 2Q9MA 3EEAA 3KYEA 5FEFA 3C7UA 2IWDA 4HBUA 2OLUA 4E3IA 3CUEA 4X1LA 3QP8A 2E8JA 2BG1A 2JKRI 2WZZA 3E2KA 3NDGA 1YMXA 3E4OA 4UHUA 3ZHHA 4OVDA 4LRXC 3FYZA 3D72A 5AQBA 3F1NB 3C30A 4JXWA 4S2KA 1XGJA 4BD1A 3OBFA 5DFXA 3ZDJA 3T1SA 5J8XA 4N9KA 2V1ZA 4CJNA 3S7PA 3C38A 1XJ4A 1ZG6A 4UA6A 4ZJ1A 3RH8B 5E2GA 1VEUA 4IUKA 5JYPA 3BY9A 4P6BA 1BYWA 1OPXA 3Q82A 4X69A 2PDRA 3UPPA 4K0XA 5AQAA 3VP1A 3SH7A 4DXCA 5EVEA 4S2MA 4F3LB 3NJAA 5FI7A 4R6LA 5EV0A 2XA7M 3DWZA 2OAQ1 3GR2A 4PKYG 1XJ2A 3F1OA 4O8GA 5K5BA 3G4PA 1MBLA 3UB9A 1X0OA 2YKHA 3E4PA 2ZC5B 2INWA 2WKIA 4YNRA 1O7EA 3HUMA 5HSQA 1KGFA 2HJEA 2WAFA 4K91A 4EERA 5LBRA 2PR5A 5L2FA 2WGIA 3K3CA 3ZFZA 2WK0A 1XFQA 2L0WA 1K56D 4LRYC 3ITAA 3OLOA 4MLLA 4JBFA 1FILA 4DXBA 3M6HA 4N9LA 1GHMA 4XT2B 3DTMA 3IH9A 2YKFA 4EEPA 2XH9A 3FWLA 3LY3A 4GD6A 2EX6A 5FATA 2W3EA 4GDBA 1KGGA 1P9RA 3IH8A 1YLPA 2OOLA 3HJIA 4WBGA 3T4QA 2GJ3A 1N9NA 1AWIA 1RP5A 4HP4A 3UE1A 3IBRA 1SKOB 2UV0E 3IX3A 1V9ZA 1LL9A 2ZM0A 4IVIA 3L9KA 3MZEA 5DKLA 5FQ9A 4MN7A 2V8CA 4JKTA 2BASA 2P9VA 4L0LA 3IXGA 3LUQA 2X71A 1DP9A 2WGWB 2KOIA 5MC7A 3VP3A 3ZQ5A 3ZGAB 2EX9A 3SS3A 2J3TD 4O7DA 3LFVA 4LV2A 2VA0A 4R4RA 5HZHA 3KSIA 3UB5P 3CPTA 3LYXA 1OT6A 1CQAA 4NKPA 3W8KA 4RX3A 3IX8A 4UQIS 4GW9A 5HWTA 2DRWA 5KZHA 4KUOA 2J80A 1HVBA 2QHKA 4EUZA 3MF0A 4GDNA 1K0KA 4WZ5A 2IWCA 3BECA 2P08A 3G2YA 3M2KA 1OJGA 3QP6A 5J3WA 4OLGA 2Y59A 2I72A 1JWZA 3MFXA 1W8QA 4JXVA 4PMAA 2Y2MA 4FTXA 4NEED 2K7SA 3WWXA 2PU2A 3VP0A 2QYBA 3IXDA 4S2LA 2FH5A 2QPNA 3O87A 5HPFA 5I94A 2J8YA 2Y2HA 4FSFA 4ID4A 2FFFB 2KLIA 4NXGA 3KO6A 5HD5A 2QJ5A 3BLSA 5HW3A 1STZA 3CG5A 4OQIA 1PYYA 5M19A 2EXBA 3BM6A 3CHWP 1I2WA 3UMDA 4HOIA 1XXMA 3UMEA 4WEJA 2XFTA 1ACFA 5DF8A 2HP6A 1N9OA 5HFOA 1G5UA 1P9WA 2PYRA 4E3NA 4FH2A 4HJ3A 4N92A 1W5DA 1VQQA 4GZBA 1KE0A 4B4XA 1MZUA 2QMIA 1E3UA 2HDUA 1ERQA 4GJ4A 3D4FA 3IHBA 4X1MA 4X56A 3FKWA 3QNCA 1F2KA 1UWNX 2XFSA 2ZM2A 3H9WA 4QU3A 4NXEA 4FUWA 3WS2A 2J9PA 2W3GA 1LL8A 4X55A 4R1GA 5EE8A 5HL6A 3SW1A 3EGXC 1SHVA 1BUEA 4Y0UA 5EVIA 4WZ4A 5FQMA 4NG2A 5E2EA 1N4OA 3PHYA 4P6ZS 1UGUA 3FG8A 4PM6A 4UQIM 3PBRA 4WUJA 3LY4A 1SKFA 3FPWA 5TJJA 1PI5A 1DJAA 5F68A 1ZHHB 1S4SA 5AQ9A 3FZCA 4YINA 3AGFA 3CJMA 4ARZA 5F82A 3JVVA 3LGOA 1FCNA 4BL3A 5A8BA 1DJBA 5G4YA 1K55A 5CERA 4Y7PA 3UE3A 1PWGA 3LCEA 3HUOA 5DTKA 2GNXA 2H0YA 4EW7A 1N9BA 4L9EA 2A49A 2ZM8A 3CI6A 3O88A 2Y2JA 4CLCD 1RGYA 4WELA 4H6JA 2JKRM 3U4LP 1H8YA 3MSHA 4GHIA 4NK3A 4M4XA 2JCHA 1KVMA 3RXWA 3VMAA 3P7NA 4EQIA 1NXYA 3HUNA 4K08A 4DDYA 4X6TA 3G2ZA 4HNBA 2Y2LA 1CI9A 4EETB 1CEGA 3PXPA 2ZC6B 1YAXA 4HEFA 1FSYA 3OPPA 2JE5A 2MJ6A 2A3UA 4EEUA 4IVKA 3HLGA 3OOVA 4C3QA 4OQGA 2WYXA 1NYYA 1IKIA 3M6BA 2EWWA 5FAOA 3HREA 4PM5A 4IBRA 4OOYA 4UAAA 1T18A 1TD5A 2PT7A 3V67A 1IOUA 1EI5A 2JKFA 4O01A 1Q2PA 1J9MA 1Y54A 1NLYA 3BFDA 4DKIA 4GOGA 3H7WA 4K0WA 5HAIA 2ZMAA 5F1GA 2VLGA 5EECA 2Y91A 2VKSA 5G18A 1P0ZA 2D01A 4EQ1A 3NOTC 1MWUA 2Z2MB 2J9OA 2B5RA 1FR6A 4S2NA 4P6ZM 1JTDA 2GDNA 4E6XA 3KSFA 5CEBA 4MCWA 3IHAA 5A90A 1GCEA 3H82B 5J4EA 1NWZA 4HHDA 1NZUA 3HLDA 2VZWA 5E43A 4HP9A 3WRZA 5FI6A 1IYSA 3PTEA 1K54C 1OTAA 4E3MA 4WL9A 5L10A 1CI8A 1BZAA 1PFLA 1K38A 3JVUA 3MXRA 3UPNA 2QJ7A 1D7EA 3R7WB 3JPUA 2P04A 4WN5A 5GHZA 3GV9A 5EUAA 3V3RA 1D06A 3W2ZA 2V0WA 2KX6A 1XKZA 4GB7A 4BJPA 3LR4A 4PM9A 2V2FF 3S7OA 1ES3A 4DE1A 1T1BA 4EBNA 2B95A 3VP4A 2R78A 3V50A 2XDMA 2FZ0A 1KE3A 3HL9A 1Z6FA 1Y4OA 2ZC7A 4MNRA 3OC2A 4HY8A 3UE0A 5L8MA 2NUTC 1I2SA 1E3UD 4NETA 3ZG5A 2Y4AA 3NOUC 1PZPA 1YSQA 5HX9A 4XUZA 4B93A 3B47A 3T1RA 1XJ6A 3O5YA 4LV3A 1TS8A 3HLCA 1NRFA 1KDSA 2CMNA 1QMFA 3CLOA 5GHYA 3OPLA 2XGNA 4D2OA 3BEBA 2Y8HA 5DF7A 5EVID 3N6IA 1PZOA 4E3JA 3IXBA 4X53A 2RL3A 3W4PA 2Y79A 2NUPC 5EVLA 4Y13A 1VETB 3OPRA 5HDDA 3D3OA 4EESA 4MN6A 4U3TA 3DBAA 4GS9B 4X25A 1H8ZA 4I3AA 4EV4A 2AVXA 2V0UA 1ESIA 3RJUA 2Z6DA 1OMEA 3UB8A 1XGIA 5AQ7A 4I3IA 2V1BA 5HPIA 3IWOA 5EFWA 4QJGA 1TS0A 1DY6A 4I38A 4JF5A 4WZ5C 3C5AA 4G3KA 1LSVA 3QP1A 2Y2KA 1WYCA 3IF5A 5FEGA 3W4OA 3IS2B 4Y2FA 1PIOA 3P01A 1J3WA 3S22A 3G34A 1S1ZA 4HQAA 3TE8A 3QHYA 2VX8A 4ME4A 4JGPA 3LI9A 5U47A 4CLCA 4DJ3A 4O0PA 4WMCD 1LL5A 2DNSA 2RCXA 3QP2A 4PM7A 3IXHA 5CTMA 5A93A 2VV8A 4JF6A 4MMNA 4OKPA 4Y17A 5CRFA 1MY8A 4OPZA 1VB6A 4OLDA 1K57C
chains in the Genus database with same CATH topology
4B9OA 1G28A 3UMDA 3EQVA 4HOIA 3UMEA 3T4SA 2P7JA 1OJ5A 3K3DA 4OOLA 4WEJA 2LB5A 3CITA 2IA2A 2WKPA 1N9OA 2A24B 4WLAA 3HJKA 1P9WA 2PYRA 2JHEA 4BBVA 3BWLA 3GECA 2ZBBA 4HJ3A 4JGRA 4BBTA 3KSGA 4L9GA 3EWKA 3OCLA 3VOLA 2HGVA 1MZUA 3MR0A 3T4TA 2B18A 4GJ4A 3LR0A 5F69A 5KIZA 2V9AA 3HCYA 4RQ9A 5IS1A 4Z1WA 1TS6A 5C5KA 4ETXA 4L9FA 2VEAA 2QWSA 2O9AA 1UWNX 2HV1A 3PBOA 3FC7A 4LLOB 3S7NA 3H9WA 4NXEA 1F5MA 2W3GA 1S67L 1LL8A 4GCZA 4EUVA 5F5YA 5AVEA 3G6OA 4CQHA 5HL6A 3SW1A 4GS9A 3T50A 3EGXC 2PHYA 1T1AA 4WEKA 4BWIA 4OOMA 3H7WB 2XA7S 2EA9A 3PHYA 4P6ZS 1UGUA 5J7EA 3FG8A 2QKPA 3MXQA 4PKYA 1DP8A 1DRMA 4UQIM 3PBRA 5HDCA 4WUJA 2DMWA 2K2NA 3FPWA 4Y3IA 5TJJA 2HF6A 4HJ4A 1P97A 3MJQA 3B33A 5F68A 1GSXA 1Y28A 1ZHHB 4ETZA 2EWVA 1S4SA 2PD7A 3BJNA 3KSHA 2I9VA 1TF1A 3IBJA 5G4ZA 4ARZA 3IS2A 2VV7A 3MQOA 3C2WA 3E4QA 3LIBA 3JVVA 5A8BA 3E98A 5G4YA 4ARZB 3PYPA 4PAUA 3UE3A 1ODVA 5DFYA 4EU0A 1N9LA 1LSWA 1ZTUA 2LB9A 1T1CA 3NHQA 1KOUA 3KYZA 3TJZC 2GNXA 3LI8A 5DJTA 4EW7A 4L9EA 3CI6A 2GZAA 3E0YA 4CLCD 3BW6A 1JNUA 1XFNA 1S4RA 2HJ9C 4WELA 4HI4A 4H6JA 2H28A 1OT9A 3PBSA 4G3WA 1MKMA 2JKRM 3BY8A 3B42A 4GHIA 4M4XA 4Y5FA 3T4JA 2ZOIA 1IFQA 1GSVA 2VGLS 3P7NA 3KYQA 1EW0A 2PR6A 2Z6CA 2WKRA 4I3JA 3PR6A 3MQQA 4FOFA 1GSWA 2W1RA 3EEHA 3TW8A 4K08A 2GX5A 4YWZA 3BQAA 3EEAA 4HNBA 1WA9A 3F1PA 4EETB 3PBQA 2XRNA 3PXPA 1YAXA 3CUEA 2JKRI 3E4OA 2MJ6A 3F1PB 5TBMA 2W3HA 2PYPA 4EEUA 4LRXC 3D72A 3OOVA 3F1NB 3C30A 5DF9A 3LIAA 1OTBA 3MMHA 5HD3A 2EWWA 3OBFA 5DFXA 5HWWA 5TBMB 4JGOA 1T18A 1TD5A 2O9BA 2PT7A 3V67A 3K2NA 1IOUA 4O01A 3S7PA 1W63M 3ICYA 2KDKA 2L1MA 3C38A 1NLYA 1XJ4A 3U2AA 3H7WA 3RH8B 4IUKA 3BY9A 2L4RA 1BYWA 1OPXA 2PDRA 4KUKA 2O9CA 3LICA 3A0RA 2VLGA 1H8MA 1W63Q 5F6AA 3NOPC 2VKSA 4R3AA 1P0ZA 2D01A 3CWFA 4EQ1A 4F3LB 3NOTC 3GDIA 3NJAA 1NRJA 2WKQA 4R6LA 2XA7M 4P6ZM 2J3TC 2OAQ1 1V9YA 4PKYG 2OAP1 3KSFA 1XJ2A 3F1OA 1YKDA 4O8GA 3UB7A 5K5BA 4MCWA 1MC0A 3H82B 5J4EA 1NWZA 4KQOA 1TS7A 4R70A 3UB9A 4HHDA 1X0OA 2YKHA 3F1OB 3E4PA 2VZWA 5CX7A 5DKKA 3UB6A 4HP9A 5IT5A 3CAXA 4LRZE 2INWA 4II7A 4YNRA 4MN5A 1OTIA 1OTAA 5HSQA 2HJEA 4WL9A 4EERA 4NXFA 5LBRA 2PR5A 1S1YA 2W1TA 3K3CA 1XFQA 3JVUA 2L0WA 2QJ7A 1D7EA 3R7WB 4LRYC 2ZMFA 2W1TB 3OLOA 2P04A 4WN5A 2D02A 4XT2B 4HH3A 3VV4A 2OWJA 2YKFA 4EEPA 4YOFA 1D06A 3W2ZA 3RTYA 2V0WA 2W27A 2KX6A 3RFBA 2W3EA 4BJPA 3LR4A 1P9RA 3S7OA 2B02A 2OOLA 3HJIA 4CLCB 2VGLM 3T4QA 2GJ3A 1N9NA 1T1BA 2O99A 2R78A 3F1NA 2FZ0A 4HP4A 2G7UA 3IBRA 3OC2A 4HY8A 5DJUA 4KQDA 5L8MA 2NUTC 1V9ZA 4AFIA 2VV6A 4DMZA 3NOUC 2J3WA 3A0VA 1YSQA 5DKLA 4B93A 4UEYA 4MN7A 5HWVA 3B47A 2BASA 1XJ6A 4L0LA 3O5YA 3C8CA 3EGDC 4DN0A 3LUQA 3LIDA 3CUEC 4IHQA 1TS8A 1DP9A 2VJWA 3BQ8A 5FL3A 3ZYTA 2CMNA 2KOIA 5MC7A 3CLOA 2W0NA 3LR5A 3PBTA 3ZQ5A 1DP6A 2A2LA 3S7QA 4QPRA 4HH2A 5I5LA 2JN7A 2Y8HA 2J3TD 4F3LA 3LFVA 4HJ6A 1F9IA 2VA0A 5HZHA 3KSIA 4BMWA 5AJGA 3LYXA 3A0SA 1OT6A 2Y79A 2NUPC 2M7VA 2XROA 4I39A 5HDDA 3D3OA 4NKPA 4HIAA 3H82A 4EESA 4JGQA 4MN6A 1XJ3A 4UQIS 4CLCE 4GW9A 5HWTA 4I5SA 3PBNA 4MDZA 2M1CA 4KUOA 4LPZA 3ULFA 2J80A 3DBAA 3R4KA 2QHKA 1OTEA 4GS9B 3MF0A 4IUHA 3KX0X 3LIEA 4NXBA 2K31A 1F98A 3LIFA 4I3AA 5AVFA 5HDSA 3MQ0A 4PHTA 3T4OA 5KSHA 2P08A 1S66L 3UE6A 2V0UA 2Z6DA 4EXOA 3UB8A 1LT0A 1OJGA 2O0YA 1YSPA 5J3WA 1G6OA 4I3IA 2V1BA 4E04A 5HPIA 2JKTM 3OCNA 2W3FA 5EFWA 3R7WA 1TS0A 4I38A 3MFXA 4R38A 2ZMVA 4GLQA 4IJGA 4NEED 1LSXA 4XT2A 2K7SA 1T19A 4G3KA 1LSVA 3T4LA 3EQUA 3LR3A 2V1AA 3VE3A 1UWPX 2QYBA 4BBUA 3EOIA 3IS2B 2FH5A 4Y2FA 3P01A 2OWHA 1S1ZA 4HQAA 4Q0JA 5HPFA 3TE8A 2VX8A 4ME4A 2XSSA 2W3DA 4JGPA 3LI9A 4FSFA 4CLCA 4DJ3A 2KLIA 4O0PA 4NXGA 1NLZA 3VE4A 3KO6A 4WF0A 4G3VA 4Q0HA 4DJ2A 5HD5A 5IU1A 2QJ5A 2VV8A 4MMNA 2JKTI 1STZA 4H6JB 2PD8A 1VB6A 1OTDA 2ZOHA 4Q0IA 1H3QA 3FPVA 3TRCA 1VHMA 4CLCC 4GHIB 2M7UA 2A24A 3T4KA 4ZRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B9O A;  1G28 A;  3UMD A;  4HOI A;  3UME A;  2P7J A;  1OJ5 A;  3K3D A;  2WKP A;  1N9O A;  2A24 B;  4WLA A;  3HJK A;  2PYR A;  2JHE A;  4BBV A;  3BWL A;  3GEC A;  2ZBB A;  4HJ3 A;  4JGR A;  4BBT A;  4L9G A;  3EWK A;  3VOL A;  1MZU A;  3MR0 A;  5KIZ A;  5F69 A;  2V9A A;  4RQ9 A;  5IS1 A;  1TS6 A;  4L9F A;  2VEA A;  2QWS A;  1UWN X;  2HV1 A;  4LLO B;  3FC7 A;  3H9W A;  4NXE A;  1S67 L;  1LL8 A;  4GCZ A;  5F5Y A;  5AVE A;  3G6O A;  3SW1 A;  4GS9 A;  3T50 A;  2PHY A;  1T1A A;  3H7W B;  2EA9 A;  3PHY A;  1UGU A;  5J7E A;  3FG8 A;  2QKP A;  3MXQ A;  4PKY A;  1DP8 A;  1DRM A;  5HDC A;  4WUJ A;  4HJ4 A;  1P97 A;  3MJQ A;  3B33 A;  5F68 A;  1GSX A;  1Y28 A;  1S4S A;  2PD7 A;  2I9V A;  5G4Z A;  3IS2 A;  2VV7 A;  3MQO A;  3C2W A;  3E4Q A;  3LIB A;  5A8B A;  5G4Y A;  3PYP A;  1ODV A;  1N9L A;  1LSW A;  1T1C A;  3NHQ A;  1KOU A;  3LI8 A;  5DJT A;  4EW7 A;  4L9E A;  1JNU A;  1XFN A;  1S4R A;  4HI4 A;  4H6J A;  2H28 A;  1OT9 A;  3BY8 A;  4GHI A;  4M4X A;  2ZOI A;  1GSV A;  3P7N A;  1EW0 A;  2PR6 A;  2Z6C A;  2WKR A;  4I3J A;  3MQQ A;  1GSW A;  3EEH A;  4K08 A;  4YWZ A;  4HNB A;  1WA9 A;  3F1P A;  4EET B;  3E4O A;  3F1P B;  5TBM A;  4EEU A;  2PYP A;  4LRX C;  3D72 A;  3F1N B;  3LIA A;  1OTB A;  5HD3 A;  5HWW A;  5TBM B;  4JGO A;  1T18 A;  3ICY A;  2KDK A;  2L1M A;  1XJ4 A;  3H7W A;  3RH8 B;  3BY9 A;  2L4R A;  1BYW A;  2PDR A;  4KUK A;  3LIC A;  3A0R A;  2VLG A;  5F6A A;  3NOP C;  4R3A A;  1P0Z A;  2D01 A;  3CWF A;  4EQ1 A;  4F3L B;  3NOT C;  3GDI A;  3NJA A;  2WKQ A;  4R6L A;  1V9Y A;  4PKY G;  1XJ2 A;  3F1O A;  3UB7 A;  3H82 B;  5J4E A;  1NWZ A;  1TS7 A;  4R70 A;  3UB9 A;  4HHD A;  1X0O A;  2YKH A;  3F1O B;  3E4P A;  5DKK A;  3UB6 A;  4HP9 A;  3CAX A;  4LRZ E;  2INW A;  4MN5 A;  1OTI A;  1OTA A;  5HSQ A;  4WL9 A;  4EER A;  4NXF A;  2PR5 A;  1S1Y A;  3K3C A;  1XFQ A;  2L0W A;  2QJ7 A;  1D7E A;  4LRY C;  3OLO A;  4WN5 A;  2D02 A;  4XT2 B;  4HH3 A;  2OWJ A;  2YKF A;  4EEP A;  1D06 A;  3RTY A;  2V0W A;  2W27 A;  2KX6 A;  2B02 A;  2OOL A;  3HJI A;  2GJ3 A;  1N9N A;  1T1B A;  2R78 A;  3F1N A;  4HP4 A;  3IBR A;  4HY8 A;  5DJU A;  4KQD A;  1V9Z A;  2VV6 A;  3NOU C;  3A0V A;  5DKL A;  5HWV A;  2BAS A;  1XJ6 A;  3C8C A;  3LUQ A;  3LID A;  1TS8 A;  1DP9 A;  2CMN A;  3CLO A;  2W0N A;  3ZQ5 A;  1DP6 A;  4HH2 A;  5I5L A;  2JN7 A;  4F3L A;  4HJ6 A;  1F9I A;  5HZH A;  3LYX A;  3A0S A;  1OT6 A;  4I39 A;  5HDD A;  4HIA A;  3H82 A;  4EES A;  4JGQ A;  4MN6 A;  1XJ3 A;  5HWT A;  4GW9 A;  4I5S A;  2M1C A;  4KUO A;  4LPZ A;  3ULF A;  2J80 A;  2QHK A;  1OTE A;  4GS9 B;  3KX0 X;  3LIE A;  4NXB A;  1F98 A;  3LIF A;  4I3A A;  5AVF A;  5HDS A;  1S66 L;  3UE6 A;  2V0U A;  2Z6D A;  4EXO A;  3UB8 A;  1LT0 A;  1OJG A;  5J3W A;  4I3I A;  2V1B A;  4E04 A;  5EFW A;  1TS0 A;  4I38 A;  3MFX A;  4R38 A;  1LSX A;  4XT2 A;  2K7S A;  1T19 A;  1LSV A;  2V1A A;  3VE3 A;  1UWP X;  4BBU A;  3IS2 B;  2OWH A;  1S1Z A;  4HQA A;  4JGP A;  3LI9 A;  4DJ3 A;  4NXG A;  3VE4 A;  4WF0 A;  4DJ2 A;  5HD5 A;  5IU1 A;  2QJ5 A;  2VV8 A;  4H6J B;  2PD8 A;  1VB6 A;  1OTD A;  2ZOH A;  4GHI B;  2A24 A; 
#chains in the Genus database with same CATH topology
 4B9O A;  1G28 A;  5FA7 A;  1YLT A;  2P7J A;  4KQQ A;  5DTT A;  3Q81 A;  2IA2 A;  2WKP A;  4JXG A;  2A24 B;  1MWR A;  5L09 A;  3N7W A;  2JHE A;  3BWL A;  3GEC A;  3MZD A;  2PAV P;  3KSG A;  5KSC A;  4RVA A;  3VOL A;  4QWO A;  3MR0 A;  3WS4 A;  3LR0 A;  2V9A A;  4KZB A;  2H0T A;  5IS1 A;  1HLU P;  5M18 A;  3MBZ A;  2QWS A;  2O9A A;  2HV1 A;  3Q7Z A;  4XUX A;  3N8R A;  4Y0T A;  3IF6 C;  2ZQA A;  4CQH A;  5IHV A;  3T50 A;  1LI9 A;  2PHY A;  3SS4 A;  1QME A;  5EOE A;  1K4E A;  4R3J A;  2EA9 A;  4BQM A;  1VEU B;  4KZA A;  5FQI A;  2QKP A;  4WYY A;  2XD5 A;  5HAR A;  5HDC A;  2DMW A;  2PRF A;  5FSR A;  3HVF A;  3W4Q A;  3GRJ A;  3MJQ A;  1L3L A;  3OZH A;  1GSX A;  1M40 A;  4ETZ A;  3KSH A;  1ESU A;  2I9V A;  3IBJ A;  3NUL A;  3V3S A;  2VV7 A;  3B3X A;  3E4Q A;  4X68 A;  2IWB A;  5GLA A;  4LFU A;  3A3D A;  1HD8 A;  4PAU A;  3UDI A;  1N9L A;  3TJZ C;  1KOU A;  2HDS A;  2ZC3 B;  4M3K A;  4PPR A;  1JNU A;  1XFN A;  3QP4 A;  2HJ9 C;  4OH0 A;  1MKM A;  1YQS A;  5E2H A;  2C5W B;  1PNE A;  3VOZ A;  3P98 A;  1W79 A;  4YFM A;  3Q7V A;  4Y5F A;  1ERM A;  1GSV A;  4I3J A;  1K4F A;  3PR6 A;  3MQQ A;  4FOF A;  4DE2 A;  4KZ5 A;  3EEH A;  3TW8 A;  4JXS A;  4RA7 A;  3GSG A;  3UPO A;  1DJC A;  3F1P B;  2W3H A;  1ZC2 A;  1OTB A;  1SDE A;  2PU4 A;  5HD3 A;  2ZQ7 A;  5TBM B;  3I7J A;  3K2N A;  1H5X A;  1W63 M;  3ICY A;  2L1M A;  4OPR A;  2P9V B;  4E3L A;  2WKH A;  2JBF A;  3SH8 A;  1HZO A;  2ZQ8 A;  4EBP A;  4KUK A;  1BSG A;  3A0R A;  4GKU A;  4R23 A;  3ZVW A;  1Q2Q A;  4QHC A;  3NCK A;  4GD8 A;  3NOP C;  5F6A A;  3DWK A;  3GDI A;  5CTN A;  1NRJ A;  2EX2 A;  2HDQ A;  3CPT B;  2J3T C;  1V9Y A;  1IYQ A;  1YKD A;  3UB7 A;  2P74 A;  4R70 A;  3Q07 A;  2Y2G A;  3UDX A;  4ZBE A;  5A92 A;  5CX7 A;  3UB6 A;  5IT5 A;  2WAD A;  3CAX A;  5TGF A;  2Y2P A;  4LRZ E;  3BFE A;  4MN5 A;  2WUQ A;  5HL1 A;  1GA9 A;  1XP4 A;  4NXF A;  1S1Y A;  1KDW A;  1KVL A;  5F83 A;  1NZO A;  1MWS A;  2OSU A;  2W1T B;  3TOI A;  3VV4 A;  1ONH A;  2OWJ A;  4U0X A;  4WMC A;  1BLC A;  4FD8 A;  1ES4 A;  1FQG A;  4QB8 A;  1G6A A;  2BLS A;  4E6W A;  3QP5 A;  3IQA A;  3QNB A;  3F1N A;  2JC7 A;  3FV7 A;  4C75 A;  2XQZ A;  3N8S A;  4FCF A;  4MBF A;  2OLV A;  5DJU A;  4N1H A;  5TFQ A;  4KQD A;  3ZCZ A;  3GMW A;  2VV6 A;  4OPY A;  1ES5 A;  4QD4 A;  2ZL1 B;  4DMZ A;  2J3W A;  3A0V A;  1LHY A;  4UEY A;  4F94 A;  3VSL A;  4LV0 A;  3C8C A;  4DN0 A;  3V39 A;  1HTZ A;  3CUE C;  3LID A;  2EFU A;  2VJW A;  3BQ8 A;  2EFX A;  1NYM A;  3LR5 A;  3PBT A;  1DP6 A;  2A2L A;  1L0E A;  4QPR A;  3DAV A;  3FKV A;  1SCW A;  2JN7 A;  4F3L A;  1YT4 A;  3IF6 B;  4HJ6 A;  1VET A;  4BMW A;  5AJG A;  1BLP A;  4BLM A;  5EOO A;  3UY6 A;  1IKG A;  2JKG A;  2M7V A;  4HBT A;  4I39 A;  1RCJ A;  4RYE A;  4ZTK A;  2Y2O A;  3BLM A;  1XJ3 A;  4R4S A;  3PBN A;  2M1C A;  3TSG A;  3R4K A;  3BFC A;  4IUH A;  3LIE A;  2XD1 A;  2K31 A;  4MBK A;  1F98 A;  3ZVT A;  5AVF A;  3S4X A;  4EBL A;  2VGJ A;  3L7H A;  3MQ0 A;  5KSH A;  3UE6 A;  3WS5 A;  1LT0 A;  3RXX A;  5L07 A;  4S2O A;  1G6O A;  1VM1 A;  3V5M A;  4E04 A;  2ZQ9 A;  2W3F A;  3OCN A;  4R38 A;  2ZMV A;  4GLQ A;  4IJG A;  4S2P A;  4MBH A;  3AGD A;  4XT2 A;  1T19 A;  3EQU A;  3WRT A;  3MKE A;  2V1A A;  5DVA A;  1UWP X;  4BBU A;  1S6R A;  3EOI A;  2OWH A;  4Q0J A;  2OV5 A;  2W3D A;  3T1Q B;  4R3B A;  1KGE A;  3VE4 A;  1K6S A;  1CF0 A;  4DJ2 A;  2QZ6 A;  5A91 A;  3ZG9 B;  2Q0O A;  4DDS A;  5CHU A;  4R0Q A;  2JKT I;  4GN2 A;  4WM9 A;  3O86 A;  1SKO A;  4H6J B;  2PD8 A;  2ZOH A;  2R9X A;  2ZQD A;  5D3O A;  1VHM A;  4CLC C;  4GHI B;  2X02 A;  2M7U A;  2A24 A;  1G68 A;  1ONG A;  3T4K A;  2R9W A;  4KZ7 A;  3T4S A;  4IED A;  1OJ5 A;  4OOL A;  2LB5 A;  5EPH A;  3CIT A;  3VP2 A;  1PWC A;  2WGW A;  3BRM A;  4WLA A;  3HJK A;  4BBV A;  2ZBB A;  4BBT A;  3SZT A;  3EWK A;  3OCL A;  2HGV A;  3T4T A;  2B18 A;  5KIZ A;  5F69 A;  3S1Y A;  3HCY A;  2EX8 A;  5CGX A;  3DTK A;  1KE4 A;  4L9F A;  4BL2 A;  2VK3 A;  3IT9 A;  4KZ3 A;  4FH4 A;  3S7N A;  5FAP A;  4B4Z A;  1EWZ A;  3SS5 A;  3ISG A;  4P0M A;  1LLB A;  1NY0 A;  1S67 L;  3Q1F A;  2ZQC A;  3SH9 A;  4GCZ A;  5F5Y A;  2V20 A;  1T1A A;  5CGW A;  1PI4 A;  4WEK A;  5EM0 A;  4OON A;  2HP9 A;  1XX2 A;  3H7W B;  5FDS A;  1ALQ A;  3A3F A;  2BTF P;  1CK3 A;  4PKY A;  2Y2I A;  1DRM A;  3MFD A;  2ZLY A;  4Y3I A;  1C3B A;  1K54 A;  2HPB A;  4KG5 A;  4PM8 A;  2EWV A;  3VFF A;  5G4Z A;  2ACG A;  4S2I A;  3MQO A;  3NI9 A;  4LV1 A;  3JYI A;  4KG2 A;  4BEN A;  4Z9Q A;  1TDL A;  1ODV A;  1NJ4 A;  3CMZ A;  1LSW A;  2LB9 A;  3NHQ A;  5FQK A;  5DJT A;  5JYO A;  1S4R A;  1OT9 A;  1D1J A;  3PAG A;  2XF3 A;  3B42 A;  2XR0 A;  1GHI A;  1M6K A;  5E2F A;  3T4J A;  2ZOI A;  4Y15 A;  1FIK A;  2VGL S;  1BUL A;  3KYQ A;  1EW0 A;  2Z6C A;  2WKR A;  3MZF A;  3HLW A;  2H5S A;  1CJF A;  1GSW A;  3LO7 A;  1BT5 A;  2GX5 A;  4YWZ A;  3T1X A;  1E4D A;  4HES A;  1WA9 A;  5FAS A;  3F1P A;  3PBQ A;  2XRN A;  4DE3 A;  5CGS A;  4ZJ2 A;  3ZNY A;  3G31 A;  1CEF A;  5TBM A;  2PYP A;  3UN7 A;  1PW8 A;  3GQZ A;  5DF9 A;  3HLB A;  4S2J A;  1MKI A;  3LIA A;  4DRT A;  3MMH A;  2HP5 A;  1WE4 A;  3MXS A;  5HWW A;  4JGO A;  3BFF A;  2O9B A;  2HZ5 A;  4OQ0 A;  3ITB A;  4H8R A;  4JF4 A;  2KDK A;  2G2W A;  3U2A A;  1SZV A;  2L4R A;  2PBD P;  2O9C A;  3LIC A;  3N4I A;  4LEN A;  4OPQ A;  3G30 A;  1H8M A;  4OP8 A;  1W63 Q;  3NIA A;  4LCM A;  1BLH A;  1ERO A;  4R3A A;  3CWF A;  2WKQ A;  3T12 B;  1FCO A;  3HLF A;  5EVI C;  4OQH A;  2OAP 1;  2HDR A;  1W7F A;  4BD0 A;  4IBX A;  4KZ6 A;  1MC0 A;  4KQO A;  1TS7 A;  3O3V A;  1TEM A;  4D60 A;  3F1O B;  5DKK A;  5HAQ A;  3C4O A;  1RGZ A;  3OPH A;  2PBY A;  1YMS A;  5TR7 A;  4II7 A;  3NY4 A;  1OTI A;  4KG6 A;  1PW1 A;  2W1T A;  2EXA A;  5GL9 A;  5CEC A;  1W8Y A;  1BTL A;  3LEQ A;  1K55 C;  2ZMF A;  1YPR A;  2D02 A;  4HH3 A;  2WKE A;  4YOF A;  4E3O A;  3WS0 A;  4RX2 A;  1K57 A;  2Y2N A;  3G32 A;  4JPM A;  3UO9 A;  3ZG7 B;  2FFY A;  1U60 A;  3RTY A;  2W27 A;  3PAE A;  3RFB A;  1O07 A;  5GLC A;  3IWQ A;  2XEP A;  4B88 A;  4CLC B;  1ES2 A;  2B02 A;  2VGL M;  1FCM A;  3VFH A;  3A3E A;  3BFG A;  1IEL A;  2O99 A;  2ZL1 A;  2G7U A;  4UA7 A;  4Y0O A;  1L0G A;  1XA1 A;  4AFI A;  4EWF A;  1JWP A;  1MXO A;  4N1X A;  4CPK A;  5HWV A;  1IYP A;  5FQJ A;  3A3J A;  3EGD C;  4DE0 A;  1IYO A;  1YLY A;  4IHQ A;  3C4P A;  5M1A A;  1GA0 A;  5FL3 A;  3ZYT A;  2WGV A;  4ESP A;  2W0N A;  3ZNT A;  3IF6 A;  3S7Q A;  4HH2 A;  4ZAM A;  5I5L A;  3IX4 A;  4GNU A;  1F9I A;  3GTC A;  1YLW A;  1JTG A;  4P87 A;  3IWI A;  3A0S A;  1YLZ A;  4KZ9 A;  2XRO A;  4P85 A;  2WAE A;  4HIA A;  3H82 A;  5HAP A;  1L2S A;  4JGQ A;  1H0M A;  4CLC E;  4I5S A;  4MDZ A;  4LPZ A;  3ULF A;  2E8I A;  1OTE A;  1MPL A;  5FI2 A;  2J7V A;  1XA7 A;  4U0T A;  3KX0 X;  4NXB A;  2XK1 A;  5CHJ A;  2DCF A;  4KZ8 A;  3VSK A;  5DTS A;  3LIF A;  5HDS A;  4PHT A;  3T4O A;  1S66 L;  5BOH A;  4S2N C;  4EXO A;  2O0Y A;  1YSP A;  1GHP A;  3D9Y A;  2WZX A;  3CZD A;  3G35 A;  3BYD A;  2JKT M;  3R7W A;  3M2J A;  3DTI A;  4QY5 A;  1LSX A;  1FSW A;  3T4L A;  3LR3 A;  3VE3 A;  4ZDX A;  5FQQ A;  3C7V A;  1LI0 A;  1JWV A;  2H10 A;  3DW0 A;  1TDG A;  4LCL A;  4E3K A;  2XSS A;  1NLZ A;  2CC1 A;  3AGE A;  2ZJ9 A;  4WF0 A;  4G3V A;  3ZG8 B;  4Q0H A;  5IU1 A;  3NDE A;  1K56 A;  1FR1 A;  1ZG4 A;  2ZC4 B;  1SDN A;  2X01 A;  2ZD8 A;  1OTD A;  1FOF A;  4Q0I A;  1H3Q A;  3FPV A;  5EM1 A;  3TRC A;  3ZG0 A;  1XPB A;  4ZRR A;  2Q9N A;  3A3I A;  3Q7V B;  3EQV A;  4QY6 A;  3K3D A;  3MKF A;  3DTE A;  5KMW A;  4JGR A;  1S0W A;  4L9G A;  1YM1 A;  1YLJ A;  1PRQ A;  4A5R A;  1L0F A;  4KEN B;  4RQ9 A;  4Z1W A;  1TS6 A;  5C5K A;  4ETX A;  5CXW A;  2VEA A;  3GVB A;  1JVJ A;  4MEZ A;  2XLN A;  3N8L A;  3PBO A;  3FC7 A;  4LLO B;  5GLD A;  1I5Q A;  1TVF A;  3HBR A;  4JLF A;  1F5M A;  4C6Y A;  4EUV A;  5AVE A;  3LEZ A;  3G6O A;  4XXR A;  1BLS A;  2C6W B;  4GS9 A;  4BWI A;  4OP5 A;  1ZKJ A;  5CED A;  1MWT A;  4OOM A;  5GHX A;  3SOI A;  2XA7 S;  1WYB A;  3TG9 A;  5J7E A;  5EVI B;  3MXQ A;  1DP8 A;  2Y2Q A;  4Q8I A;  2Y55 A;  4ZJ3 A;  2K2N A;  2HF6 A;  4HJ4 A;  1P97 A;  3B33 A;  3E2L A;  5CHM A;  1Y28 A;  3BJN A;  2PD7 A;  4DF6 A;  1TF1 A;  2VGK A;  3IS2 A;  5GLB A;  3WS1 A;  3C2W A;  3NBL A;  3LIB A;  3E98 A;  1IEM A;  3UDF A;  4ARZ B;  3PYP A;  1E25 A;  5DFY A;  4EU0 A;  1ZTU A;  1T1C A;  3KYZ A;  3LI8 A;  2UWX A;  3E0Y A;  2GZA A;  3HLE A;  5FAQ A;  3BW6 A;  1Z09 A;  4HI4 A;  2H28 A;  1K25 A;  2Z2L B;  1A0K A;  3PBS A;  4G3W A;  1K6R A;  3BY8 A;  2G2U A;  3NEC A;  5FDH A;  4UA9 A;  3UNW A;  1IFQ A;  4LGW A;  4KQR A;  2PR6 A;  2V8F A;  3MS6 A;  1PWD A;  3P09 A;  2W1R A;  1L0D A;  3NC8 A;  4KZ4 A;  3VOY A;  3BQA A;  1AXB A;  5F1F A;  2Q9M A;  3EEA A;  3KYE A;  5FEF A;  3C7U A;  2IWD A;  4HBU A;  2OLU A;  4E3I A;  3CUE A;  4X1L A;  3QP8 A;  2E8J A;  2BG1 A;  2JKR I;  2WZZ A;  3E2K A;  3NDG A;  1YMX A;  3E4O A;  4UHU A;  3ZHH A;  4OVD A;  4LRX C;  3FYZ A;  3D72 A;  5AQB A;  3F1N B;  3C30 A;  4JXW A;  4S2K A;  1XGJ A;  4BD1 A;  3OBF A;  5DFX A;  3ZDJ A;  3T1S A;  5J8X A;  4N9K A;  2V1Z A;  4CJN A;  3S7P A;  3C38 A;  1XJ4 A;  1ZG6 A;  4UA6 A;  4ZJ1 A;  3RH8 B;  5E2G A;  1VEU A;  4IUK A;  5JYP A;  3BY9 A;  4P6B A;  1BYW A;  1OPX A;  3Q82 A;  4X69 A;  2PDR A;  3UPP A;  4K0X A;  5AQA A;  3VP1 A;  3SH7 A;  4DXC A;  5EVE A;  4S2M A;  4F3L B;  3NJA A;  5FI7 A;  4R6L A;  5EV0 A;  2XA7 M;  3DWZ A;  2OAQ 1;  3GR2 A;  4PKY G;  1XJ2 A;  3F1O A;  4O8G A;  5K5B A;  3G4P A;  1MBL A;  3UB9 A;  1X0O A;  2YKH A;  3E4P A;  2ZC5 B;  2INW A;  2WKI A;  4YNR A;  1O7E A;  3HUM A;  5HSQ A;  1KGF A;  2HJE A;  2WAF A;  4K91 A;  4EER A;  5LBR A;  2PR5 A;  5L2F A;  2WGI A;  3K3C A;  3ZFZ A;  2WK0 A;  1XFQ A;  2L0W A;  1K56 D;  4LRY C;  3ITA A;  3OLO A;  4MLL A;  4JBF A;  1FIL A;  4DXB A;  3M6H A;  4N9L A;  1GHM A;  4XT2 B;  3DTM A;  3IH9 A;  2YKF A;  4EEP A;  2XH9 A;  3FWL A;  3LY3 A;  4GD6 A;  2EX6 A;  5FAT A;  2W3E A;  4GDB A;  1KGG A;  1P9R A;  3IH8 A;  1YLP A;  2OOL A;  3HJI A;  4WBG A;  3T4Q A;  2GJ3 A;  1N9N A;  1AWI A;  1RP5 A;  4HP4 A;  3UE1 A;  3IBR A;  1SKO B;  2UV0 E;  3IX3 A;  1V9Z A;  1LL9 A;  2ZM0 A;  4IVI A;  3L9K A;  3MZE A;  5DKL A;  5FQ9 A;  4MN7 A;  2V8C A;  4JKT A;  2BAS A;  2P9V A;  4L0L A;  3IXG A;  3LUQ A;  2X71 A;  1DP9 A;  2WGW B;  2KOI A;  5MC7 A;  3VP3 A;  3ZQ5 A;  3ZGA B;  2EX9 A;  3SS3 A;  2J3T D;  4O7D A;  3LFV A;  4LV2 A;  2VA0 A;  4R4R A;  5HZH A;  3KSI A;  3UB5 P;  3CPT A;  3LYX A;  1OT6 A;  1CQA A;  4NKP A;  3W8K A;  4RX3 A;  3IX8 A;  4UQI S;  4GW9 A;  5HWT A;  2DRW A;  5KZH A;  4KUO A;  2J80 A;  1HVB A;  2QHK A;  4EUZ A;  3MF0 A;  4GDN A;  1K0K A;  4WZ5 A;  2IWC A;  3BEC A;  2P08 A;  3G2Y A;  3M2K A;  1OJG A;  3QP6 A;  5J3W A;  4OLG A;  2Y59 A;  2I72 A;  1JWZ A;  3MFX A;  1W8Q A;  4JXV A;  4PMA A;  2Y2M A;  4FTX A;  4NEE D;  2K7S A;  3WWX A;  2PU2 A;  3VP0 A;  2QYB A;  3IXD A;  4S2L A;  2FH5 A;  2QPN A;  3O87 A;  5HPF A;  5I94 A;  2J8Y A;  2Y2H A;  4FSF A;  4ID4 A;  2FFF B;  2KLI A;  4NXG A;  3KO6 A;  5HD5 A;  2QJ5 A;  3BLS A;  5HW3 A;  1STZ A;  3CG5 A;  4OQI A;  1PYY A;  5M19 A;  2EXB A;  3BM6 A;  3CHW P;  1I2W A;  3UMD A;  4HOI A;  1XXM A;  3UME A;  4WEJ A;  2XFT A;  1ACF A;  5DF8 A;  2HP6 A;  1N9O A;  5HFO A;  1G5U A;  1P9W A;  2PYR A;  4E3N A;  4FH2 A;  4HJ3 A;  4N92 A;  1W5D A;  1VQQ A;  4GZB A;  1KE0 A;  4B4X A;  1MZU A;  2QMI A;  1E3U A;  2HDU A;  1ERQ A;  4GJ4 A;  3D4F A;  3IHB A;  4X1M A;  4X56 A;  3FKW A;  3QNC A;  1F2K A;  1UWN X;  2XFS A;  2ZM2 A;  3H9W A;  4QU3 A;  4NXE A;  4FUW A;  3WS2 A;  2J9P A;  2W3G A;  1LL8 A;  4X55 A;  4R1G A;  5EE8 A;  5HL6 A;  3SW1 A;  3EGX C;  1SHV A;  1BUE A;  4Y0U A;  5EVI A;  4WZ4 A;  5FQM A;  4NG2 A;  5E2E A;  1N4O A;  3PHY A;  4P6Z S;  1UGU A;  3FG8 A;  4PM6 A;  4UQI M;  3PBR A;  4WUJ A;  3LY4 A;  1SKF A;  3FPW A;  5TJJ A;  1PI5 A;  1DJA A;  5F68 A;  1ZHH B;  1S4S A;  5AQ9 A;  3FZC A;  4YIN A;  3AGF A;  3CJM A;  4ARZ A;  5F82 A;  3JVV A;  3LGO A;  1FCN A;  4BL3 A;  5A8B A;  1DJB A;  5G4Y A;  1K55 A;  5CER A;  4Y7P A;  3UE3 A;  1PWG A;  3LCE A;  3HUO A;  5DTK A;  2GNX A;  2H0Y A;  4EW7 A;  1N9B A;  4L9E A;  2A49 A;  2ZM8 A;  3CI6 A;  3O88 A;  2Y2J A;  4CLC D;  1RGY A;  4WEL A;  4H6J A;  2JKR M;  3U4L P;  1H8Y A;  3MSH A;  4GHI A;  4NK3 A;  4M4X A;  2JCH A;  1KVM A;  3RXW A;  3VMA A;  3P7N A;  4EQI A;  1NXY A;  3HUN A;  4K08 A;  4DDY A;  4X6T A;  3G2Z A;  4HNB A;  2Y2L A;  1CI9 A;  4EET B;  1CEG A;  3PXP A;  2ZC6 B;  1YAX A;  4HEF A;  1FSY A;  3OPP A;  2JE5 A;  2MJ6 A;  2A3U A;  4EEU A;  4IVK A;  3HLG A;  3OOV A;  4C3Q A;  4OQG A;  2WYX A;  1NYY A;  1IKI A;  3M6B A;  2EWW A;  5FAO A;  3HRE A;  4PM5 A;  4IBR A;  4OOY A;  4UAA A;  1T18 A;  1TD5 A;  2PT7 A;  3V67 A;  1IOU A;  1EI5 A;  2JKF A;  4O01 A;  1Q2P A;  1J9M A;  1Y54 A;  1NLY A;  3BFD A;  4DKI A;  4GOG A;  3H7W A;  4K0W A;  5HAI A;  2ZMA A;  5F1G A;  2VLG A;  5EEC A;  2Y91 A;  2VKS A;  5G18 A;  1P0Z A;  2D01 A;  4EQ1 A;  3NOT C;  1MWU A;  2Z2M B;  2J9O A;  2B5R A;  1FR6 A;  4S2N A;  4P6Z M;  1JTD A;  2GDN A;  4E6X A;  3KSF A;  5CEB A;  4MCW A;  3IHA A;  5A90 A;  1GCE A;  3H82 B;  5J4E A;  1NWZ A;  4HHD A;  1NZU A;  3HLD A;  2VZW A;  5E43 A;  4HP9 A;  3WRZ A;  5FI6 A;  1IYS A;  3PTE A;  1K54 C;  1OTA A;  4E3M A;  4WL9 A;  5L10 A;  1CI8 A;  1BZA A;  1PFL A;  1K38 A;  3JVU A;  3MXR A;  3UPN A;  2QJ7 A;  1D7E A;  3R7W B;  3JPU A;  2P04 A;  4WN5 A;  5GHZ A;  3GV9 A;  5EUA A;  3V3R A;  1D06 A;  3W2Z A;  2V0W A;  2KX6 A;  1XKZ A;  4GB7 A;  4BJP A;  3LR4 A;  4PM9 A;  2V2F F;  3S7O A;  1ES3 A;  4DE1 A;  1T1B A;  4EBN A;  2B95 A;  3VP4 A;  2R78 A;  3V50 A;  2XDM A;  2FZ0 A;  1KE3 A;  3HL9 A;  1Z6F A;  1Y4O A;  2ZC7 A;  4MNR A;  3OC2 A;  4HY8 A;  3UE0 A;  5L8M A;  2NUT C;  1I2S A;  1E3U D;  4NET A;  3ZG5 A;  2Y4A A;  3NOU C;  1PZP A;  1YSQ A;  5HX9 A;  4XUZ A;  4B93 A;  3B47 A;  3T1R A;  1XJ6 A;  3O5Y A;  4LV3 A;  1TS8 A;  3HLC A;  1NRF A;  1KDS A;  2CMN A;  1QMF A;  3CLO A;  5GHY A;  3OPL A;  2XGN A;  4D2O A;  3BEB A;  2Y8H A;  5DF7 A;  5EVI D;  3N6I A;  1PZO A;  4E3J A;  3IXB A;  4X53 A;  2RL3 A;  3W4P A;  2Y79 A;  2NUP C;  5EVL A;  4Y13 A;  1VET B;  3OPR A;  5HDD A;  3D3O A;  4EES A;  4MN6 A;  4U3T A;  3DBA A;  4GS9 B;  4X25 A;  1H8Z A;  4I3A A;  4EV4 A;  2AVX A;  2V0U A;  1ESI A;  3RJU A;  2Z6D A;  1OME A;  3UB8 A;  1XGI A;  5AQ7 A;  4I3I A;  2V1B A;  5HPI A;  3IWO A;  5EFW A;  4QJG A;  1TS0 A;  1DY6 A;  4I38 A;  4JF5 A;  4WZ5 C;  3C5A A;  4G3K A;  1LSV A;  3QP1 A;  2Y2K A;  1WYC A;  3IF5 A;  5FEG A;  3W4O A;  3IS2 B;  4Y2F A;  1PIO A;  3P01 A;  1J3W A;  3S22 A;  3G34 A;  1S1Z A;  4HQA A;  3TE8 A;  3QHY A;  2VX8 A;  4ME4 A;  4JGP A;  3LI9 A;  5U47 A;  4CLC A;  4DJ3 A;  4O0P A;  4WMC D;  1LL5 A;  2DNS A;  2RCX A;  3QP2 A;  4PM7 A;  3IXH A;  5CTM A;  5A93 A;  2VV8 A;  4JF6 A;  4MMN A;  4OKP A;  4Y17 A;  5CRF A;  1MY8 A;  4OPZ A;  1VB6 A;  4OLD A;  1K57 C; 
#chains in the Genus database with same CATH homology
 4B9O A;  1G28 A;  3UMD A;  3EQV A;  4HOI A;  3UME A;  3T4S A;  2P7J A;  1OJ5 A;  3K3D A;  4OOL A;  4WEJ A;  2LB5 A;  3CIT A;  2IA2 A;  2WKP A;  1N9O A;  2A24 B;  4WLA A;  3HJK A;  1P9W A;  2PYR A;  2JHE A;  4BBV A;  3BWL A;  3GEC A;  2ZBB A;  4HJ3 A;  4JGR A;  4BBT A;  3KSG A;  4L9G A;  3EWK A;  3OCL A;  3VOL A;  2HGV A;  1MZU A;  3MR0 A;  3T4T A;  2B18 A;  4GJ4 A;  3LR0 A;  5F69 A;  5KIZ A;  2V9A A;  3HCY A;  4RQ9 A;  5IS1 A;  4Z1W A;  1TS6 A;  5C5K A;  4ETX A;  4L9F A;  2VEA A;  2QWS A;  2O9A A;  1UWN X;  2HV1 A;  3PBO A;  3FC7 A;  4LLO B;  3S7N A;  3H9W A;  4NXE A;  1F5M A;  2W3G A;  1S67 L;  1LL8 A;  4GCZ A;  4EUV A;  5F5Y A;  5AVE A;  3G6O A;  4CQH A;  5HL6 A;  3SW1 A;  4GS9 A;  3T50 A;  3EGX C;  2PHY A;  1T1A A;  4WEK A;  4BWI A;  4OOM A;  3H7W B;  2XA7 S;  2EA9 A;  3PHY A;  4P6Z S;  1UGU A;  5J7E A;  3FG8 A;  2QKP A;  3MXQ A;  4PKY A;  1DP8 A;  1DRM A;  4UQI M;  3PBR A;  5HDC A;  4WUJ A;  2DMW A;  2K2N A;  3FPW A;  4Y3I A;  5TJJ A;  2HF6 A;  4HJ4 A;  1P97 A;  3MJQ A;  3B33 A;  5F68 A;  1GSX A;  1Y28 A;  1ZHH B;  4ETZ A;  2EWV A;  1S4S A;  2PD7 A;  3BJN A;  3KSH A;  2I9V A;  1TF1 A;  3IBJ A;  5G4Z A;  4ARZ A;  3IS2 A;  2VV7 A;  3MQO A;  3C2W A;  3E4Q A;  3LIB A;  3JVV A;  5A8B A;  3E98 A;  5G4Y A;  4ARZ B;  3PYP A;  4PAU A;  3UE3 A;  1ODV A;  5DFY A;  4EU0 A;  1N9L A;  1LSW A;  1ZTU A;  2LB9 A;  1T1C A;  3NHQ A;  1KOU A;  3KYZ A;  3TJZ C;  2GNX A;  3LI8 A;  5DJT A;  4EW7 A;  4L9E A;  3CI6 A;  2GZA A;  3E0Y A;  4CLC D;  3BW6 A;  1JNU A;  1XFN A;  1S4R A;  2HJ9 C;  4WEL A;  4HI4 A;  4H6J A;  2H28 A;  1OT9 A;  3PBS A;  4G3W A;  1MKM A;  2JKR M;  3BY8 A;  3B42 A;  4GHI A;  4M4X A;  4Y5F A;  3T4J A;  2ZOI A;  1IFQ A;  1GSV A;  2VGL S;  3P7N A;  3KYQ A;  1EW0 A;  2PR6 A;  2Z6C A;  2WKR A;  4I3J A;  3PR6 A;  3MQQ A;  4FOF A;  1GSW A;  2W1R A;  3EEH A;  3TW8 A;  4K08 A;  2GX5 A;  4YWZ A;  3BQA A;  3EEA A;  4HNB A;  1WA9 A;  3F1P A;  4EET B;  3PBQ A;  2XRN A;  3PXP A;  1YAX A;  3CUE A;  2JKR I;  3E4O A;  2MJ6 A;  3F1P B;  5TBM A;  2W3H A;  2PYP A;  4EEU A;  4LRX C;  3D72 A;  3OOV A;  3F1N B;  3C30 A;  5DF9 A;  3LIA A;  1OTB A;  3MMH A;  5HD3 A;  2EWW A;  3OBF A;  5DFX A;  5HWW A;  5TBM B;  4JGO A;  1T18 A;  1TD5 A;  2O9B A;  2PT7 A;  3V67 A;  3K2N A;  1IOU A;  4O01 A;  3S7P A;  1W63 M;  3ICY A;  2KDK A;  2L1M A;  3C38 A;  1NLY A;  1XJ4 A;  3U2A A;  3H7W A;  3RH8 B;  4IUK A;  3BY9 A;  2L4R A;  1BYW A;  1OPX A;  2PDR A;  4KUK A;  2O9C A;  3LIC A;  3A0R A;  2VLG A;  1H8M A;  1W63 Q;  5F6A A;  3NOP C;  2VKS A;  4R3A A;  1P0Z A;  2D01 A;  3CWF A;  4EQ1 A;  4F3L B;  3NOT C;  3GDI A;  3NJA A;  1NRJ A;  2WKQ A;  4R6L A;  2XA7 M;  4P6Z M;  2J3T C;  2OAQ 1;  1V9Y A;  4PKY G;  2OAP 1;  3KSF A;  1XJ2 A;  3F1O A;  1YKD A;  4O8G A;  3UB7 A;  5K5B A;  4MCW A;  1MC0 A;  3H82 B;  5J4E A;  1NWZ A;  4KQO A;  1TS7 A;  4R70 A;  3UB9 A;  4HHD A;  1X0O A;  2YKH A;  3F1O B;  3E4P A;  2VZW A;  5CX7 A;  5DKK A;  3UB6 A;  4HP9 A;  5IT5 A;  3CAX A;  4LRZ E;  2INW A;  4II7 A;  4YNR A;  4MN5 A;  1OTI A;  1OTA A;  5HSQ A;  2HJE A;  4WL9 A;  4EER A;  4NXF A;  5LBR A;  2PR5 A;  1S1Y A;  2W1T A;  3K3C A;  1XFQ A;  3JVU A;  2L0W A;  2QJ7 A;  1D7E A;  3R7W B;  4LRY C;  2ZMF A;  2W1T B;  3OLO A;  2P04 A;  4WN5 A;  2D02 A;  4XT2 B;  4HH3 A;  3VV4 A;  2OWJ A;  2YKF A;  4EEP A;  4YOF A;  1D06 A;  3W2Z A;  3RTY A;  2V0W A;  2W27 A;  2KX6 A;  3RFB A;  2W3E A;  4BJP A;  3LR4 A;  1P9R A;  3S7O A;  2B02 A;  2OOL A;  3HJI A;  4CLC B;  2VGL M;  3T4Q A;  2GJ3 A;  1N9N A;  1T1B A;  2O99 A;  2R78 A;  3F1N A;  2FZ0 A;  4HP4 A;  2G7U A;  3IBR A;  3OC2 A;  4HY8 A;  5DJU A;  4KQD A;  5L8M A;  2NUT C;  1V9Z A;  4AFI A;  2VV6 A;  4DMZ A;  3NOU C;  2J3W A;  3A0V A;  1YSQ A;  5DKL A;  4B93 A;  4UEY A;  4MN7 A;  5HWV A;  3B47 A;  2BAS A;  1XJ6 A;  4L0L A;  3O5Y A;  3C8C A;  3EGD C;  4DN0 A;  3LUQ A;  3LID A;  3CUE C;  4IHQ A;  1TS8 A;  1DP9 A;  2VJW A;  3BQ8 A;  5FL3 A;  3ZYT A;  2CMN A;  2KOI A;  5MC7 A;  3CLO A;  2W0N A;  3LR5 A;  3PBT A;  3ZQ5 A;  1DP6 A;  2A2L A;  3S7Q A;  4QPR A;  4HH2 A;  5I5L A;  2JN7 A;  2Y8H A;  2J3T D;  4F3L A;  3LFV A;  4HJ6 A;  1F9I A;  2VA0 A;  5HZH A;  3KSI A;  4BMW A;  5AJG A;  3LYX A;  3A0S A;  1OT6 A;  2Y79 A;  2NUP C;  2M7V A;  2XRO A;  4I39 A;  5HDD A;  3D3O A;  4NKP A;  4HIA A;  3H82 A;  4EES A;  4JGQ A;  4MN6 A;  1XJ3 A;  4UQI S;  4CLC E;  4GW9 A;  5HWT A;  4I5S A;  3PBN A;  4MDZ A;  2M1C A;  4KUO A;  4LPZ A;  3ULF A;  2J80 A;  3DBA A;  3R4K A;  2QHK A;  1OTE A;  4GS9 B;  3MF0 A;  4IUH A;  3KX0 X;  3LIE A;  4NXB A;  2K31 A;  1F98 A;  3LIF A;  4I3A A;  5AVF A;  5HDS A;  3MQ0 A;  4PHT A;  3T4O A;  5KSH A;  2P08 A;  1S66 L;  3UE6 A;  2V0U A;  2Z6D A;  4EXO A;  3UB8 A;  1LT0 A;  1OJG A;  2O0Y A;  1YSP A;  5J3W A;  1G6O A;  4I3I A;  2V1B A;  4E04 A;  5HPI A;  2JKT M;  3OCN A;  2W3F A;  5EFW A;  3R7W A;  1TS0 A;  4I38 A;  3MFX A;  4R38 A;  2ZMV A;  4GLQ A;  4IJG A;  4NEE D;  1LSX A;  4XT2 A;  2K7S A;  1T19 A;  4G3K A;  1LSV A;  3T4L A;  3EQU A;  3LR3 A;  2V1A A;  3VE3 A;  1UWP X;  2QYB A;  4BBU A;  3EOI A;  3IS2 B;  2FH5 A;  4Y2F A;  3P01 A;  2OWH A;  1S1Z A;  4HQA A;  4Q0J A;  5HPF A;  3TE8 A;  2VX8 A;  4ME4 A;  2XSS A;  2W3D A;  4JGP A;  3LI9 A;  4FSF A;  4CLC A;  4DJ3 A;  2KLI A;  4O0P A;  4NXG A;  1NLZ A;  3VE4 A;  3KO6 A;  4WF0 A;  4G3V A;  4Q0H A;  4DJ2 A;  5HD5 A;  5IU1 A;  2QJ5 A;  2VV8 A;  4MMN A;  2JKT I;  1STZ A;  4H6J B;  2PD8 A;  1VB6 A;  1OTD A;  2ZOH A;  4Q0I A;  1H3Q A;  3FPV A;  3TRC A;  1VHM A;  4CLC C;  4GHI B;  2M7U A;  2A24 A;  3T4K A;  4ZRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...