4EETB

Crystal structure of ilov
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
111
structure length
111
Chain Sequence
FIEKNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFIGVQLDGSDHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phototropin-2
publication title Structural Tuning of the Fluorescent Protein iLOV for Improved Photostability.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein, flavoprotein
total genus 34
structure length 111
sequence length 111
chains with identical sequence D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4eetB00
5HDSA 2BASA 2WKQA 3E4QA 1N9NA 5J3WA 3UMEA 1OTIA 3G6OA 4JGOA 4HI4A 4I39A 5F69A 1BYWA 1P97A 1T1AA 3BWLA 2KX6A 1MZUA 4MN6A 3LIAA 3EWKA 1F9IA 1TS8A 4HY8A 1LT0A 4E04A 3H7WB 2Z6CA 1F98A 1KOUA 3LIFA 3IBRA 1T1CA 5EFWA 3KX0X 4L9FA 2L0WA 1ODVA 4LRYC 2PYPA 4BBUA 5HSQA 2Z6DA 4R6LA 2VLGA 4WF0A 3NJAA 2A24B 2EA9A 4BBTA 3H7WA 4HP4A 4GS9B 5HZHA 4EESA 2PD8A 3UB7A 5IU1A 4WN5A 4EERA 3LIBA 1P0ZA 3NHQA 3NOPC 2A24A 4NXFA 3EEHA 4PKYA 1TS0A 2H28A 1DP8A 4GS9A 4RQ9A 4EW7A 2OOLA 5F6AA 4DJ3A 2L1MA 4L9GA 1N9LA 2PD7A 4WUJA 2V0UA 3HJKA 1OTBA 4HQAA 4WLAA 3NOUC 1T1BA 4LRZE 1JNUA 2V0WA 3OLOA 5IS1A 4H6JB 1S4RA 2PR6A 2J80A 5HDCA 4HH2A 1S1ZA 4I3JA 1XJ2A 4GCZA 2PYRA 3F1NB 3MXQA 4HP9A 5TBMB 2HV1A 3LIDA 4I3AA 5AVFA 4H6JA 4HJ3A 3GDIA 4DJ2A 1D06A 3P7NA 5AVEA 3F1NA 5TBMA 3CWFA 5HD5A 4I38A 3SW1A 2CMNA 5DKLA 5DJTA 4YWZA 3ULFA 3E4OA 3A0SA 3MR0A 1OJ5A 2VEAA 3IS2B 2INWA 2QJ7A 3LYXA 3MFXA 2B02A 1V9ZA 3FG8A 3BY8A 5J7EA 1LSVA 1V9YA 3VE4A 1XJ4A 3FC7A 5DJUA 2K7SA 3IS2A 1OT9A 3CAXA 2D01A 2ZBBA 2PHYA 3BY9A 3RTYA 5J4EA 1WA9A 1NWZA 4PKYG 2VV7A 3H9WA 4LLOB 3MJQA 2W0NA 4KQDA 5I5LA 2D02A 3PYPA 4L9EA 1S1YA 1G28A 1S66L 3ZQ5A 2JHEA 1OTEA 3VE3A 2ZOHA 4LRXC 3MQQA 2VV8A 3PHYA 4F3LB 4XT2B 5G4ZA 1EW0A 2WKPA 5HWVA 1LSWA 3K3CA 1OT6A 3D72A 1Y28A 4KUOA 3LICA 1TS6A 1GSVA 4F3LA 5G4YA 4XT2A 3H82B 4GHIB 1LSXA 2V9AA 4HH3A 2W27A 2QKPA 1OJGA 5HDDA 4BBVA 3K3DA 1VB6A 2QJ5A 4I5SA 4NXEA 4EEUA 1GSXA 5HWWA 4KUKA 4HHDA 3LUQA 3H82A 4GHIA 4HJ4A 4MN5A 2KDKA 1UWNX 5F68A 2I9VA 4I3IA 3A0RA 4HIAA 4EEPA 2OWJA 2P7JA 1DP9A 3UB8A 3MQOA 4HOIA 4HNBA 3NOTC 4R70A 5DKKA 2QWSA 4GW9A 3UE6A 3UB9A 4WL9A 2M1CA 3C2WA 4JGRA 1XFNA 5A8BA 1D7EA 1LL8A 1T19A 3F1OB 1DP6A 3LI9A 3C8CA 3A0VA 1UWPX 4R38A 4K08A 1GSWA 2V1AA 2WKRA 2V1BA 3T50A 5HD3A 4B9OA 3F1OA 4NXGA 2R78A 2PR5A 4JGPA 2GJ3A 4HJ6A 4LPZA 4EQ1A 3CLOA 1S67L 3HJIA 3LI8A 4M4XA 3LIEA 1XFQA 1UGUA 2ZOIA 5KIZA 3VOLA 1OTAA 1OTDA 3UMDA 3F1PB 3UB6A 5HWTA 3B33A 2OWHA 1XJ3A 4EETB 4NXBA 2L4RA 2YKFA 2VV6A 3ICYA 3F1PA 1S4SA 3RH8B 1N9OA 3E4PA 2QHKA 1DRMA 2JN7A 1T18A 2YKHA 4EXOA 4JGQA 1TS7A 5F5YA 1XJ6A 1X0OA 2PDRA 4R3AA 3GECA
chains in the Genus database with same CATH superfamily
3HLGA 2J8YA 3A3FA 4S2JA 2E8JA 2ZM0A 3BLSA 5JYPA 3IF6B 3G32A 2ZC5B 1MC0A 1YQSA 5GHXA 4I39A 3KSIA 1HZOA 5FAQA 1P97A 3L9KA 1T1AA 3BWLA 3LIAA 3EWKA 1D1JA 2ZQCA 3LR0A 2O9BA 4HY8A 2PBDP 1L0EA 1GHMA 4G3VA 3LIFA 1T1CA 4C3QA 1C3BA 2XGNA 2Y91A 3HBRA 1EI5A 2L0WA 1KGFA 2HDQA 1ODVA 5CXWA 5AQBA 4P6ZS 4OOYA 1YKDA 4GZBA 1ZKJA 2QPNA 3TSGA 4OQ0A 4WF0A 3NJAA 2A24B 4QU3A 2OSUA 4R3JA 1W5DA 4GS9B 3T1RA 3U2AA 3WRZA 5MC7A 1PNEA 1XKZA 3D4FA 4EESA 2Y59A 5IU1A 3VOYA 5EVIA 1ZC2A 1MKIA 1RCJA 3PXPA 4ZDXA 1TS0A 2J9PA 4PMAA 1DP8A 3V3RA 1DY6A 3UE3A 5F6AA 4DJ3A 3C7VA 3MZFA 5CERA 4WUJA 3HJKA 1BZAA 3S7OA 4P6BA 2QYBA 5CGXA 5DFYA 4EBLA 3OPPA 3QP2A 4LRZE 4C6YA 1JNUA 5GLCA 1CF0A 1K55C 5DF8A 4JXGA 1S4RA 2V20A 3UY6A 3HUNA 3EGXC 1XJ2A 1IYPA 2PYRA 3F1NB 4HP9A 3CITA 2HV1A 2G2UA 3BM6A 3CJMA 2VA0A 4P0MA 3SOIA 4K0WA 1D06A 2JKRM 1DJAA 5AVEA 5TBMA 3S7NA 3CWFA 2Y2MA 4I38A 3SW1A 1TEMA 2CMNA 5DKLA 3HLBA 4X6TA 3E4OA 5HARA 4OPRA 5I94A 3W8KA 2EX9A 1NXYA 1XPBA 4P85A 2INWA 4HBUA 2QJ7A 2OLVA 3MFXA 4DN0A 3IX4A 5J7EA 1BLHA 3D9YA 4E3OA 1LSVA 1OPXA 4JPMA 5CGWA 1XJ4A 3WS1A 1N9BA 2K7SA 4ZTKA 4CLCA 1NLYA 4MEZA 1ES3A 1QMFA 3BQ8A 1BTLA 4PM9A 5J4EA 2G2WA 4KQQA 1GCEA 2WAFA 3G4PA 5EOEA 1NWZA 3U4LP 3H9WA 4KQDA 5GLAA 3UE1A 4NETA 3PYPA 3KYZA 3A3EA 3VP2A 2Y8HA 1G28A 4IHQA 1LHYA 1H8MA 2JKTM 3ZQ5A 2XA7S 3ZG8B 2JHEA 1OTEA 4O7DA 2XA7M 3VP1A 4GNUA 3NI9A 1O07A 3MQQA 1YAXA 1GA0A 5EVID 1FCOA 4U0TA 3VSKA 3DTEA 5EPHA 5HFOA 2WKPA 3BW6A 4GLQA 2WYXA 2XEPA 1PIOA 1TS6A 4ARZA 3GVBA 4LGWA 1GSVA 5G4YA 4P87A 1CI9A 3ZG9B 3IHAA 2MJ6A 3ZGAB 3TOIA 4ZAMA 1K54C 1LSXA 4HH3A 4DE0A 2W27A 2W3DA 4N1XA 3T4JA 4BBVA 3NY4A 2V2FF 3T12B 1VB6A 3IWQA 4EEUA 5HWWA 2JBFA 5EV0A 3A3DA 4MBHA 4HJ4A 5HW3A 4OOMA 5CRFA 3DTMA 4WBGA 4BQMA 3GQZA 3T1SA 2OV5A 4KG6A 1TVFA 4S2LA 1UWNX 2I9VA 4HIAA 1VEUA 2H0YA 1PZOA 3TRCA 5HL1A 3PTEA 1S0WA 4HNBA 3GRJA 3FPVA 5FEGA 2Q0OA 4KZBA 4R70A 2J9OA 3ZVWA 3EGDC 4Y15A 3SS3A 1NJ4A 1XGIA 3GR2A 4RX3A 4JGRA 2JCHA 2Q9MA 1YLWA 2XF3A 4Q0IA 5IT5A 4BWIA 5CTNA 3B42A 4WELA 2XFTA 3LI9A 1I5QA 4DE1A 4YINA 3A0VA 1NZUA 3UDXA 3ZCZA 1AXBA 4E6WA 1GSWA 4B4XA 4BJPA 1XA7A 3Q81A 1ZHHB 1L0FA 5CX7A 3F1OA 1IFQA 3P98A 3N8RA 2ZQDA 3BLMA 2P9VA 3CLOA 3N8LA 4MBKA 3HJIA 4MDZA 2FZ0A 4FSFA 1UGUA 3CUEA 1VM1A 4LENA 2FFYA 3M2KA 4GDNA 1E25A 2I72A 4ME4A 3UMDA 1TDGA 3CHWP 2C5WB 3PBNA 5EOOA 4OONA 2WZZA 4IVKA 2J3TD 2L4RA 2Y2JA 4IBRA 5L8MA 2WGVA 4S2PA 1FILA 2JKFA 4S2NC 3Q7VA 3RH8B 2QHKA 1MBLA 5CHJA 3SH7A 3PAGA 3VP0A 2E8IA 3V50A 1YM1A 3PBOA 5HX9A 5KZHA 3N4IA 5EVEA 1SDEA 5FL3A 4OP5A 3LY4A 4MMNA 2DNSA 1MWSA 1BLCA 3MBZA 5E2EA 2BASA 2WKQA 3E4QA 1CEFA 3NIAA 2J7VA 3FYZA 2Y2GA 1VHMA 4HBTA 4OP8A 2X02A 3G6OA 1YSQA 4QD4A 1WYBA 1ALQA 2EWWA 4LV3A 3DTKA 5F1FA 4N9LA 2KX6A 2VKSA 1MZUA 4MN6A 1W63Q 5D3OA 1F9IA 2JKGA 1TS8A 2KLIA 4QY6A 2DMWA 1F98A 1P9WA 1KOUA 3IBRA 3UNWA 5FEFA 3UE0A 2R9WA 4IEDA 1IYOA 4Y3IA 2Z6DA 1ONGA 5EVIB 2AVXA 3H7WA 1PI4A 1WYCA 2EX2A 2BG1A 3HLEA 2Y2QA 5F82A 1O7EA 4KZ5A 4EERA 3LIBA 4II7A 1E3UA 4JXSA 3Q07A 3EEHA 2H28A 3PBSA 3LR5A 3UPOA 5HAQA 4RQ9A 1BLPA 1Q2PA 5LBRA 4FUWA 2OOLA 5CEBA 1FOFA 4NKPA 3T4KA 2PD7A 4X1LA 4Q0JA 5CTMA 2V0UA 3T4OA 2XRNA 2W3HA 3NOUC 3MZDA 1T1BA 2ZC7A 1QMEA 2HGVA 5M19A 3TW8A 5KSCA 1U60A 3O88A 1GHIA 4QJGA 2WZXA 2VGLS 5HDCA 2ZMAA 1S1ZA 3T4LA 4D60A 4GCZA 2Y2PA 3C5AA 4X53A 5TBMB 1ESUA 3LIDA 4BD1A 1EROA 3E98A 1HTZA 2VGKA 2EFXA 3LEQA 5HL6A 4H6JA 3RXXA 3IBJA 4HJ3A 4CPKA 1MY8A 2GDNA 3HUOA 3LCEA 1BT5A 1SDNA 4OQIA 1WE4A 4LCMA 4Q0HA 5HAPA 3SS5A 3ULFA 3BFDA 3A0SA 3G30A 3MR0A 3MS6A 2VEAA 2PT7A 5FA7A 4CLCB 2ZQAA 1H8YA 3BYDA 4PHTA 1YLJA 3JPUA 3E2LA 3MFDA 2WGIA 4Y13A 3FG8A 2P04A 2HP9A 3VMAA 5FAPA 5TFQA 1V9YA 4JF5A 2BTFP 3VE4A 1ES2A 3BECA 4YOFA 2C6WB 3HUMA 4KZAA 1LL9A 2RCXA 4S2MA 5FATA 3IS2A 1OT9A 3CAXA 2D01A 2FFFB 1MWRA 4X25A 3BY9A 5FQJA 5EE8A 3C4OA 2WADA 1G68A 2ZLYA 1WA9A 2VV7A 4BD0A 3MJQA 5I5LA 3QP1A 1S1YA 4L9EA 2O9CA 2PBYA 4GJ4A 1SKOA 3UPPA 4CLCE 4PAUA 1KE0A 3VE3A 2ZOHA 4LRXC 4ARZB 1W79A 2VV8A 3PHYA 4Y2FA 3OCLA 4ESPA 2J3WA 2OAP1 3VFFA 1E3UD 2HJ9C 4E3LA 2V8CA 5HWVA 3K3CA 3LGOA 1XA1A 4KUOA 4FH4A 3LICA 1H3QA 4HESA 5F83A 4XT2A 2ZJ9A 2V9AA 3CZDA 2QKPA 1XXMA 5HDDA 3C4PA 3BRMA 1YLZA 4OOLA 1VEUB 3DW0A 3R7WA 4E3KA 1GSXA 4QPRA 1XGJA 2PAVP 3KYEA 1SZVA 4UA6A 4GHIA 4MN5A 1EWZA 4GD6A 5IHVA 1KVMA 3LR4A 4I3IA 5HAIA 1LI9A 3UB8A 4R4RA 3NECA 4ZRRA 4BL2A 3IXDA 1PZPA 5A90A 4HOIA 3MMHA 2O0YA 4JXWA 3NOTC 4BENA 1PRQA 5DF9A 4GD8A 5DKKA 3IXGA 4O01A 4LFUA 3IHBA 1J9MA 3C7UA 2V1ZA 4GW9A 3HL9A 3OZHA 3UB9A 2JE5A 2M1CA 4GN2A 4G3KA 1JTGA 2W1RA 3RXWA 3QNBA 3C38A 4MNRA 4DRTA 2HP6A 1KDSA 2UV0E 4EUZA 3HLFA 3F1OB 1ACFA 3S7PA 1JTDA 3NDGA 2P9VB 4DDSA 3SH8A 1BSGA 1CJFA 2Y2KA 1ES5A 3BJNA 2ZQ7A 3VFHA 2R78A 2OAQ1 4Y0UA 2VZWA 4F94A 3LI8A 4G3WA 1YMSA 1VQQA 5EM1A 4XXRA 5EM0A 5KIZA 3VOLA 1PWDA 1OTAA 2JKRI 4XUXA 3EQVA 3A3IA 4KZ8A 1OTDA 3Q7VB 1NZOA 2B5RA 2OWHA 1XJ3A 2YKFA 4EU0A 3DAVA 2XH9A 1VETA 3T1XA 3QP6A 4S2KA 2P08A 3MZEA 2O99A 2XR0A 3KYQA 2VV6A 1K6SA 3ICYA 3F1PA 1YPRA 2JC7A 2B18A 1F5MA 2FH5A 1DRMA 2WK0A 2YKHA 4KZ9A 4EXOA 3UDIA 5FI2A 1XJ6A 1I2SA 1X0OA 1IOUA 4IBXA 4X56A 1YT4A 4X68A 4R3AA 5HDSA 4WZ5A 3IF6C 2Z2MB 2JKTI 4Q8IA 1SKFA 3ZG5A 4Y0TA 3NULA 4B93A 5J3WA 2VX8A 2ZMFA 1OTIA 4LV1A 4JGOA 4HI4A 3WRTA 5AJGA 4KENB 3T4TA 4CLCC 5F69A 4DXBA 1K4EA 5FDSA 3N7WA 2K31A 2EXBA 3LFVA 3VOZA 1CEGA 2VGJA 3ITBA 3DWKA 3H7WB 4E04A 5EFWA 1MWUA 2HPBA 4L9FA 2W3GA 5AQAA 4JKTA 5HPIA 1W7FA 2ZC3B 4LRYC 2PYPA 4Y7PA 3E2KA 3UPNA 2XD1A 1MWTA 5HSQA 4GOGA 3MXRA 5EUAA 3MQ0A 2EA9A 4BBTA 4GKUA 4HP4A 4D2OA 2OLUA 1M40A 4M3KA 1PW1A 3G31A 5FDHA 4R1GA 2A2LA 3UB7A 4WN5A 4QHCA 1P0ZA 3NHQA 1CI8A 3NOPC 3N8SA 5FASA 4PKYA 4O8GA 4UQIM 1FCNA 2B95A 1RGZA 3B47A 5CEDA 3CPTA 1FSYA 5KSHA 3I7JA 2L1MA 3FV7A 2ZM8A 1FQGA 3ZFZA 1IKGA 2XDMA 3HLDA 3Q82A 1L3LA 3G35A 3OCNA 4ZJ2A 2K2NA 2V0WA 1P9RA 5IS1A 2WKEA 4H6JB 2PR6A 2J80A 1DJBA 4I3JA 1K57C 5GHYA 1DJCA 2Y55A 4KG2A 5M18A 4I3AA 2M7VA 5FQMA 1H5XA 2RL3A 3EEAA 2IWBA 3BFEA 5E2GA 4RA7A 4R23A 3GDIA 3CG5A 1YMXA 4JLFA 1FIKA 1RP5A 3TG9A 4KQRA 3T4QA 1H0MA 5DJTA 3JVUA 4LV2A 2ZC6B 3V3SA 1Q2QA 1HVBA 4U0XA 1OJ5A 3IS2B 3LYXA 4E3IA 1V9ZA 3O3VA 3AGFA 3BY8A 3ZG0A 2VJWA 3FC7A 3SS4A 2Y4AA 4PPRA 3ZYTA 4EWFA 4E3MA 3MXSA 1SKOB 2ZBBA 2PHYA 1IEMA 3QNCA 4K0XA 4A5RA 3PBTA 4PKYG 2EWVA 2R9XA 3CUEC 2W3EA 3Q7ZA 4MBFA 3W4PA 5FQ9A 3BFGA 3ITAA 4LCLA 4N92A 2W1TA 4ID4A 2A49A 4XT2B 4UHUA 3TJZC 3WWXA 1EW0A 3OOVA 2ZL1A 3VV4A 1LSWA 1OT6A 3R7WB 5AQ7A 1Y28A 3IWIA 4OH0A 1L2SA 2Y2HA 4F3LA 1BLSA 2UWXA 4GHIB 2CC1A 1Z6FA 3K3DA 2GX5A 4IUKA 2QJ5A 4EBPA 4KUKA 4HHDA 3VP3A 5FAOA 3LUQA 3H82A 2PU4A 2Z2LB 5BOHA 1XP4A 5DFXA 1YLYA 1ZG4A 3FZCA 1K55A 1W8YA 2EFUA 5F68A 3IXHA 3A0RA 3ZNYA 3PR6A 2QZ6A 4EEPA 2OWJA 2P7JA 1DP9A 4WEKA 3KSGA 5HPFA 1MKMA 2V8FA 3OPRA 2XLNA 1ES4A 2WGWA 3WS4A 4NG2A 3KSFA 1PFLA 1FR6A 5L10A 1J3WA 1BUEA 2G7UA 2ZD8A 1FSWA 4U3TA 2HF6A 2IA2A 4KG5A 3UE6A 4WL9A 3C2WA 4ZJ1A 3MSHA 4FOFA 3ZDJA 1TD5A 2EXAA 3ZNTA 3UN7A 1DP6A 4OQHA 1ZG6A 2H10A 4AFIA 1PI5A 5GL9A 4OLGA 1LI0A 1W63M 3C8CA 3IH8A 3K2NA 2PU2A 4EQIA 2DCFA 3CMZA 2W3FA 2XK1A 3E0YA 3IH9A 1K25A 2H0TA 4R38A 3JVVA 4K08A 1SCWA 4P6ZM 4OQGA 4WZ4A 3JYIA 1MXOA 2WKRA 4UAAA 2V1BA 1F2KA 3T50A 3M6HA 4B9OA 3W4OA 4N9KA 2PR5A 2XQZA 4JGPA 3IT9A 2GJ3A 4FH2A 1PWGA 2WKIA 3VSLA 5E2FA 2WUQA 4DKIA 3LIEA 1YLTA 1VETB 4NEED 2ZOIA 3N6IA 5GLBA 1LL5A 1PWCA 4KQOA 2HDSA 3F1PB 5DTTA 4Y5FA 1ONHA 3UB6A 5FQQA 5HWTA 1SHVA 2XD5A 3B33A 3FKWA 5DF7A 3SH9A 4FD8A 1K56A 3R4KA 5K5BA 3IWOA 3PBQA 5FI7A 4X55A 4OLDA 2Y2NA 4IVIA 3EQUA 4L0LA 4BLMA 1Z09A 1TDLA 1S4SA 1N9OA 2NUPC 1LLBA 5F1GA 3UO9A 4EUVA 1T18A 4MLLA 3L7HA 1G6OA 5E43A 3V67A 1TS7A 3FPWA 2HDRA 1K54A 1K4FA 2ACGA 4RX2A 2BLSA 4ETZA 1JVJA 1K0KA 2HP5A 3CI6A 4E3NA 5U47A 3GECA 3DWZA 1M6KA 5FQKA 2A3UA 3LR3A 3V5MA 4WM9A 2H5SA 1KE3A 1N9NA 3QP5A 4DF6A 4RVAA 3UMEA 4BL3A 4GB7A 4UA9A 2Q9NA 3O87A 4QY5A 4E3JA 3D3OA 3IXBA 1BYWA 3KO6A 3V39A 1KDWA 3DTIA 2XFSA 2DRWA 1LT0A 3IF6A 2Z6CA 3P01A 3KX0X 1HD8A 5EVIC 5GHZA 1IYSA 4LV0A 4X1MA 4BBUA 3ISGA 4DMZA 3LY3A 3WS0A 3BQAA 2VLGA 4R6LA 3WS5A 2GZAA 4WMCA 1TF1A 3IX8A 3A3JA 4KZ6A 3CPTB 2EX8A 4Y17A 5HZHA 2PD8A 4UEYA 3W2ZA 4YNRA 3T1QB 4DDYA 2A24A 3GSGA 4NXFA 1G6AA 4B88A 2VK3A 3S7QA 5L09A 4CJNA 4S2OA 4GS9A 2P74A 5KMWA 4EW7A 3QHYA 3RJUA 4PM8A 4L9GA 1N9LA 3B3XA 3G2YA 4PM6A 4KZ4A 2WAEA 1OTBA 4B4ZA 4HQAA 4WLAA 5TR7A 3C30A 3NDEA 2GNXA 2Y79A 2XROA 1K56D 3OLOA 3UB5P 1NYMA 3QP8A 5CECA 4KZ7A 4HH2A 3MF0A 3HVFA 5FQIA 3MXQA 5M1AA 3AGEA 3HCYA 4OPYA 4MN7A 4S2NA 2QMIA 5AVFA 4E6XA 5CHMA 4ETXA 1AWIA 3M2JA 3ZHHA 1BULA 4DJ2A 1L0DA 3P7NA 5AQ9A 5JYOA 3MKEA 3DBAA 4JXVA 3F1NA 1Y4OA 5HD5A 1ERMA 1N4OA 4Y0OA 4YWZA 4Z9QA 5TJJA 4OPZA 1K57A 5C5KA 3S1YA 2ZMVA 4KZ3A 2B02A 5L2FA 2X01A 4OKPA 3W4QA 3LEZA 1A0KA 5DJUA 1S6RA 3ZVTA 3BEBA 3RTYA 2NUTC 3G34A 1GHPA 2J3TC 1JWVA 1JWPA 3BFCA 3OPLA 4LLOB 2IWDA 2W0NA 4O0PA 2W1TB 2WKHA 1YSPA 4R0QA 2D02A 4UQIS 1S66L 4CLCD 4RYEA 4WMCD 5TGFA 4R3BA 4Z1WA 2ZL1B 3NC8A 4UA7A 1E4DA 4H8RA 2KOIA 4WYYA 2IWCA 1K38A 5DTKA 4F3LB 3O5YA 2HDUA 5G4ZA 5A93A 4JF6A 1IKIA 1PYYA 3VP4A 4EV4A 4S2IA 2M7UA 2Y2IA 1ZTUA 3D72A 4PM7A 1G5UA 1KVLA 4QB8A 5DVAA 2X71A 3H82B 3S4XA 2LB5A 1OJGA 4ZJ3A 4WZ5C 5A91A 1L0GA 4I5SA 4NXEA 5G18A 2WGWB 3TE8A 1STZA 1OMEA 4NK3A 2KDKA 2LB9A 4C75A 3AGDA 4HEFA 4BMWA 1YLPA 3P09A 4EBNA 3MQOA 3GTCA 2PRFA 4DE2A 3G2ZA 1ESIA 3GV9A 4WEJA 3KSHA 3HLCA 4R4SA 2O9AA 4K91A 4X69A 1KGEA 3O86A 4OPQA 2ZQ8A 1NRFA 3IQAA 1PW8A 3EOIA 2QWSA 2EX6A 1HLUP 4DXCA 3UDFA 4CQHA 2ZQ9A 1W8QA 1XFNA 5A8BA 1GA9A 1IYQA 3GMWA 1D7EA 4DE3A 5CGSA 3HLWA 1KGGA 3LO7A 1I2WA 5DTSA 1LL8A 1T19A 1NRJA 2HZ5A 3IF5A 5E2HA 4PM5A 1UWPX 3IX3A 3FWLA 5EECA 3S22A 2V1AA 2XSSA 3OBFA 4OVDA 3OPHA 5HD3A 4IUHA 4NXGA 5EVLA 3Q1FA 3PAEA 2Y2OA 4HJ6A 3OC2A 1CQAA 1FR1A 3FKVA 4LPZA 4EQ1A 1S67L 5L07A 5CHUA 4M4XA 3NCKA 2ZM2A 1RGYA 1XFQA 4QWOA 1CK3A 4JBFA 1IELA 1NLZA 4XUZA 3QP4A 3T4SA 4IJGA 1JWZA 3M6BA 2HJEA 5FSRA 1ERQA 1NYYA 3BFFA 1FCMA 4FTXA 4NXBA 4EETB 1XX2A 5FI6A 4ZBEA 3NBLA 5J8XA 4N1HA 3HREA 1H8ZA 3E4PA 2ZC4B 3PBRA 4GDBA 5GLDA 3ZG7B 1Y54A 2JN7A 5A92A 4JGQA 3MKFA 4FCFA 1KE4A 5F5YA 4YFMA 3RFBA 3SZTA 1K6RA 4JF4A 2VGLM 3WS2A 4MCWA 2PDRA 2Y2LA 1NY0A 1MPLA
chains in the Genus database with same CATH topology
5HDSA 2BASA 2WKQA 3E4QA 2JKTI 3LR3A 1N9NA 1VHMA 4B93A 5J3WA 2VX8A 3UMEA 2ZMFA 1OTIA 3G6OA 1YSQA 4JGOA 1MC0A 4HI4A 4I39A 3KSIA 3D3OA 5AJGA 3T4TA 4CLCC 5F69A 2EWWA 1BYWA 3KO6A 1P97A 1T1AA 3BWLA 2KX6A 2VKSA 1MZUA 2K31A 1W63Q 4MN6A 3LIAA 3EWKA 1F9IA 1TS8A 3LFVA 3LR0A 2KLIA 2O9BA 4HY8A 1LT0A 4E04A 3H7WB 2DMWA 2Z6CA 1F98A 1P9WA 1KOUA 3P01A 4G3VA 3LIFA 3IBRA 1T1CA 5EFWA 3KX0X 4L9FA 2L0WA 2W3GA 5HPIA 1ODVA 4LRYC 2PYPA 4BBUA 4P6ZS 4DMZA 1YKDA 5HSQA 4Y3IA 2Z6DA 3BQAA 2VLGA 4R6LA 4WF0A 2GZAA 3NJAA 2A24B 3MQ0A 1TF1A 2EA9A 4BBTA 3H7WA 4HP4A 4GS9B 3U2AA 5MC7A 5HZHA 4EESA 2PD8A 4UEYA 2A2LA 3W2ZA 4YNRA 3UB7A 5IU1A 4WN5A 4EERA 3LIBA 1P0ZA 4II7A 3NHQA 3NOPC 2A24A 4NXFA 3PXPA 3EEHA 4PKYA 4O8GA 4UQIM 1TS0A 2H28A 3S7QA 3PBSA 3LR5A 3B47A 1DP8A 4GS9A 4RQ9A 5KSHA 5LBRA 4EW7A 3UE3A 2OOLA 5F6AA 4DJ3A 2L1MA 4NKPA 4L9GA 1N9LA 3T4KA 2PD7A 4Q0JA 4WUJA 2V0UA 3T4OA 3HJKA 2XRNA 1OTBA 2W3HA 3S7OA 4HQAA 4WLAA 2QYBA 5DFYA 3NOUC 1T1BA 3C30A 3OCNA 4LRZE 2HGVA 1JNUA 3TW8A 2GNXA 2Y79A 2XROA 2K2NA 2V0WA 1P9RA 3OLOA 5IS1A 4H6JB 1S4RA 2PR6A 2J80A 2VGLS 5HDCA 4HH2A 1S1ZA 4I3JA 3EGXC 3MF0A 3T4LA 1XJ2A 4GCZA 2PYRA 3F1NB 3MXQA 4HP9A 5TBMB 3CITA 3HCYA 2HV1A 3LIDA 3E98A 4MN7A 4I3AA 2M7VA 5AVFA 5HL6A 3EEAA 4ETXA 2VA0A 4H6JA 3IBJA 4HJ3A 3GDIA 4DJ2A 1D06A 2JKRM 3P7NA 5AVEA 3DBAA 3F1NA 5TBMA 3S7NA 3CWFA 5HD5A 4I38A 3SW1A 2CMNA 5DKLA 4Q0HA 3T4QA 5DJTA 3JVUA 4YWZA 3ULFA 3E4OA 5TJJA 3A0SA 3MR0A 1OJ5A 2VEAA 2PT7A 5C5KA 3IS2B 4CLCB 2INWA 2ZMVA 2QJ7A 3LYXA 4PHTA 3MFXA 2B02A 1V9ZA 3FG8A 2P04A 4DN0A 3BY8A 5J7EA 1LSVA 1V9YA 1OPXA 2VJWA 3VE4A 4YOFA 1XJ4A 3FC7A 5DJUA 2K7SA 3IS2A 3ZYTA 4CLCA 1NLYA 1OT9A 3CAXA 2D01A 3BQ8A 2ZBBA 2PHYA 2NUTC 3BY9A 3RTYA 5J4EA 2J3TC 3PBTA 1WA9A 1NWZA 4PKYG 2VV7A 3H9WA 2EWVA 3CUEC 4LLOB 3MJQA 2W0NA 2W3EA 4KQDA 4O0PA 2W1TB 5I5LA 1YSPA 2D02A 3PYPA 3KYZA 4UQIS 4L9EA 1S1YA 2O9CA 2Y8HA 1G28A 1S66L 4IHQA 4CLCD 4GJ4A 1H8MA 2JKTM 4Z1WA 3ZQ5A 2XA7S 2JHEA 4CLCE 1OTEA 4PAUA 3VE3A 2XA7M 2KOIA 2ZOHA 4LRXC 4ARZB 3MQQA 1YAXA 2W1TA 2VV8A 3PHYA 4F3LB 4Y2FA 3O5YA 4XT2B 3OCLA 5G4ZA 2J3WA 2OAP1 3TJZC 2HJ9C 1EW0A 3OOVA 2WKPA 5HWVA 3BW6A 3VV4A 2M7UA 1LSWA 3K3CA 1OT6A 3R7WB 1ZTUA 3D72A 4GLQA 1Y28A 4KUOA 3LICA 1TS6A 4ARZA 1H3QA 1GSVA 4F3LA 5G4YA 4XT2A 2MJ6A 3H82B 4GHIB 1LSXA 2V9AA 4HH3A 2W27A 2W3DA 2QKPA 2LB5A 1OJGA 5HDDA 3T4JA 4BBVA 4OOLA 3K3DA 2GX5A 3R7WA 4IUKA 1VB6A 2QJ5A 4I5SA 4NXEA 4EEUA 1GSXA 4QPRA 5HWWA 4KUKA 4HHDA 3LUQA 3TE8A 1STZA 3H82A 4GHIA 4HJ4A 4MN5A 4OOMA 2KDKA 2LB9A 3LR4A 5DFXA 4BMWA 1UWNX 5F68A 2I9VA 4I3IA 3A0RA 4HIAA 3PR6A 4EEPA 2OWJA 2P7JA 1DP9A 4WEKA 3KSGA 3UB8A 3MQOA 5HPFA 3TRCA 1MKMA 4ZRRA 4HOIA 3MMHA 3KSFA 2O0YA 4HNBA 4WEJA 3KSHA 3FPVA 3NOTC 2O9AA 5DF9A 4R70A 2G7UA 3EGDC 5DKKA 4O01A 2HF6A 3EOIA 2QWSA 2IA2A 4GW9A 3UE6A 3UB9A 4WL9A 2M1CA 3C2WA 4JGRA 4CQHA 4G3KA 2W1RA 4Q0IA 1XFNA 5A8BA 5IT5A 3C38A 4BWIA 4FOFA 1D7EA 1TD5A 3B42A 1LL8A 1T19A 4WELA 3F1OB 1DP6A 1NRJA 4AFIA 3LI9A 3S7PA 1W63M 3C8CA 3A0VA 3K2NA 1UWPX 2W3FA 3E0YA 4R38A 3JVVA 4K08A 1GSWA 2V1AA 4P6ZM 2XSSA 4BJPA 3OBFA 1ZHHB 2WKRA 3BJNA 2V1BA 3T50A 5HD3A 5CX7A 4B9OA 3F1OA 4IUHA 1IFQA 4NXGA 2R78A 2PR5A 2OAQ1 4JGPA 2GJ3A 4HJ6A 2VZWA 3OC2A 4LPZA 4EQ1A 3CLOA 1S67L 3HJIA 3LI8A 4MDZA 4G3WA 2FZ0A 4M4XA 3LIEA 4FSFA 1XFQA 1UGUA 4NEED 2ZOIA 3CUEA 5KIZA 1NLZA 3VOLA 1OTAA 2JKRI 3EQVA 3T4SA 4KQOA 4IJGA 4ME4A 1OTDA 3UMDA 3F1PB 4Y5FA 3UB6A 2HJEA 5HWTA 3PBNA 3B33A 2OWHA 1XJ3A 2J3TD 4EETB 4NXBA 2L4RA 2YKFA 3R4KA 4EU0A 5K5BA 3PBQA 2P08A 5L8MA 2O99A 3EQUA 3KYQA 2VV6A 4L0LA 3ICYA 3F1PA 1S4SA 3RH8B 1N9OA 3E4PA 2NUPC 2B18A 1F5MA 2FH5A 2QHKA 3PBRA 1DRMA 2JN7A 4EUVA 1T18A 2YKHA 4EXOA 3PBOA 4JGQA 1G6OA 3V67A 1TS7A 3FPWA 5F5YA 1XJ6A 3RFBA 1X0OA 5FL3A 4ETZA 1IOUA 2VGLM 3CI6A 4MCWA 4MMNA 2PDRA 4R3AA 3GECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HDS A;  2BAS A;  2WKQ A;  3E4Q A;  1N9N A;  5J3W A;  3UME A;  1OTI A;  3G6O A;  4JGO A;  4HI4 A;  4I39 A;  5F69 A;  1BYW A;  1P97 A;  1T1A A;  3BWL A;  2KX6 A;  1MZU A;  4MN6 A;  3LIA A;  3EWK A;  1F9I A;  1TS8 A;  4HY8 A;  1LT0 A;  4E04 A;  3H7W B;  2Z6C A;  1F98 A;  1KOU A;  3LIF A;  3IBR A;  1T1C A;  5EFW A;  3KX0 X;  4L9F A;  2L0W A;  1ODV A;  4LRY C;  2PYP A;  4BBU A;  5HSQ A;  2Z6D A;  4R6L A;  2VLG A;  4WF0 A;  3NJA A;  2A24 B;  2EA9 A;  4BBT A;  3H7W A;  4HP4 A;  4GS9 B;  5HZH A;  4EES A;  2PD8 A;  3UB7 A;  5IU1 A;  4WN5 A;  4EER A;  3LIB A;  1P0Z A;  3NHQ A;  3NOP C;  2A24 A;  4NXF A;  3EEH A;  4PKY A;  1TS0 A;  2H28 A;  1DP8 A;  4GS9 A;  4RQ9 A;  4EW7 A;  2OOL A;  5F6A A;  4DJ3 A;  2L1M A;  4L9G A;  1N9L A;  2PD7 A;  4WUJ A;  2V0U A;  3HJK A;  1OTB A;  4HQA A;  4WLA A;  3NOU C;  1T1B A;  4LRZ E;  1JNU A;  2V0W A;  3OLO A;  5IS1 A;  4H6J B;  1S4R A;  2PR6 A;  2J80 A;  5HDC A;  4HH2 A;  1S1Z A;  4I3J A;  1XJ2 A;  4GCZ A;  2PYR A;  3F1N B;  3MXQ A;  4HP9 A;  5TBM B;  2HV1 A;  3LID A;  4I3A A;  5AVF A;  4H6J A;  4HJ3 A;  3GDI A;  4DJ2 A;  1D06 A;  3P7N A;  5AVE A;  3F1N A;  5TBM A;  3CWF A;  5HD5 A;  4I38 A;  3SW1 A;  2CMN A;  5DKL A;  5DJT A;  4YWZ A;  3ULF A;  3E4O A;  3A0S A;  3MR0 A;  1OJ5 A;  2VEA A;  3IS2 B;  2INW A;  2QJ7 A;  3LYX A;  3MFX A;  2B02 A;  1V9Z A;  3FG8 A;  3BY8 A;  5J7E A;  1LSV A;  1V9Y A;  3VE4 A;  1XJ4 A;  3FC7 A;  5DJU A;  2K7S A;  3IS2 A;  1OT9 A;  3CAX A;  2D01 A;  2ZBB A;  2PHY A;  3BY9 A;  3RTY A;  5J4E A;  1WA9 A;  1NWZ A;  4PKY G;  2VV7 A;  3H9W A;  4LLO B;  3MJQ A;  2W0N A;  4KQD A;  5I5L A;  2D02 A;  3PYP A;  4L9E A;  1S1Y A;  1G28 A;  1S66 L;  3ZQ5 A;  2JHE A;  1OTE A;  3VE3 A;  2ZOH A;  4LRX C;  3MQQ A;  2VV8 A;  3PHY A;  4F3L B;  4XT2 B;  5G4Z A;  1EW0 A;  2WKP A;  5HWV A;  1LSW A;  3K3C A;  1OT6 A;  3D72 A;  1Y28 A;  4KUO A;  3LIC A;  1TS6 A;  1GSV A;  4F3L A;  5G4Y A;  4XT2 A;  3H82 B;  4GHI B;  1LSX A;  2V9A A;  4HH3 A;  2W27 A;  2QKP A;  1OJG A;  5HDD A;  4BBV A;  3K3D A;  1VB6 A;  2QJ5 A;  4I5S A;  4NXE A;  4EEU A;  1GSX A;  5HWW A;  4KUK A;  4HHD A;  3LUQ A;  3H82 A;  4GHI A;  4HJ4 A;  4MN5 A;  2KDK A;  1UWN X;  5F68 A;  2I9V A;  4I3I A;  3A0R A;  4HIA A;  4EEP A;  2OWJ A;  2P7J A;  1DP9 A;  3UB8 A;  3MQO A;  4HOI A;  4HNB A;  3NOT C;  4R70 A;  5DKK A;  2QWS A;  4GW9 A;  3UE6 A;  3UB9 A;  4WL9 A;  2M1C A;  3C2W A;  4JGR A;  1XFN A;  5A8B A;  1D7E A;  1LL8 A;  1T19 A;  3F1O B;  1DP6 A;  3LI9 A;  3C8C A;  3A0V A;  1UWP X;  4R38 A;  4K08 A;  1GSW A;  2V1A A;  2WKR A;  2V1B A;  3T50 A;  5HD3 A;  4B9O A;  3F1O A;  4NXG A;  2R78 A;  2PR5 A;  4JGP A;  2GJ3 A;  4HJ6 A;  4LPZ A;  4EQ1 A;  3CLO A;  1S67 L;  3HJI A;  3LI8 A;  4M4X A;  3LIE A;  1XFQ A;  1UGU A;  2ZOI A;  5KIZ A;  3VOL A;  1OTA A;  1OTD A;  3UMD A;  3F1P B;  3UB6 A;  5HWT A;  3B33 A;  2OWH A;  1XJ3 A;  4EET B;  4NXB A;  2L4R A;  2YKF A;  2VV6 A;  3ICY A;  3F1P A;  1S4S A;  3RH8 B;  1N9O A;  3E4P A;  2QHK A;  1DRM A;  2JN7 A;  1T18 A;  2YKH A;  4EXO A;  4JGQ A;  1TS7 A;  5F5Y A;  1XJ6 A;  1X0O A;  2PDR A;  4R3A A;  3GEC A; 
#chains in the Genus database with same CATH topology
 3HLG A;  2J8Y A;  3A3F A;  4S2J A;  2E8J A;  2ZM0 A;  3BLS A;  5JYP A;  3IF6 B;  3G32 A;  2ZC5 B;  1MC0 A;  1YQS A;  5GHX A;  4I39 A;  3KSI A;  1HZO A;  5FAQ A;  1P97 A;  3L9K A;  1T1A A;  3BWL A;  3LIA A;  3EWK A;  1D1J A;  2ZQC A;  3LR0 A;  2O9B A;  4HY8 A;  2PBD P;  1L0E A;  1GHM A;  4G3V A;  3LIF A;  1T1C A;  4C3Q A;  1C3B A;  2XGN A;  2Y91 A;  3HBR A;  1EI5 A;  2L0W A;  1KGF A;  2HDQ A;  1ODV A;  5CXW A;  5AQB A;  4P6Z S;  4OOY A;  1YKD A;  4GZB A;  1ZKJ A;  2QPN A;  3TSG A;  4OQ0 A;  4WF0 A;  3NJA A;  2A24 B;  4QU3 A;  2OSU A;  4R3J A;  1W5D A;  4GS9 B;  3T1R A;  3U2A A;  3WRZ A;  5MC7 A;  1PNE A;  1XKZ A;  3D4F A;  4EES A;  2Y59 A;  5IU1 A;  3VOY A;  5EVI A;  1ZC2 A;  1MKI A;  1RCJ A;  3PXP A;  4ZDX A;  1TS0 A;  2J9P A;  4PMA A;  1DP8 A;  3V3R A;  1DY6 A;  3UE3 A;  5F6A A;  4DJ3 A;  3C7V A;  3MZF A;  5CER A;  4WUJ A;  3HJK A;  1BZA A;  3S7O A;  4P6B A;  2QYB A;  5CGX A;  5DFY A;  4EBL A;  3OPP A;  3QP2 A;  4LRZ E;  4C6Y A;  1JNU A;  5GLC A;  1CF0 A;  1K55 C;  5DF8 A;  4JXG A;  1S4R A;  2V20 A;  3UY6 A;  3HUN A;  3EGX C;  1XJ2 A;  1IYP A;  2PYR A;  3F1N B;  4HP9 A;  3CIT A;  2HV1 A;  2G2U A;  3BM6 A;  3CJM A;  2VA0 A;  4P0M A;  3SOI A;  4K0W A;  1D06 A;  2JKR M;  1DJA A;  5AVE A;  5TBM A;  3S7N A;  3CWF A;  2Y2M A;  4I38 A;  3SW1 A;  1TEM A;  2CMN A;  5DKL A;  3HLB A;  4X6T A;  3E4O A;  5HAR A;  4OPR A;  5I94 A;  3W8K A;  2EX9 A;  1NXY A;  1XPB A;  4P85 A;  2INW A;  4HBU A;  2QJ7 A;  2OLV A;  3MFX A;  4DN0 A;  3IX4 A;  5J7E A;  1BLH A;  3D9Y A;  4E3O A;  1LSV A;  1OPX A;  4JPM A;  5CGW A;  1XJ4 A;  3WS1 A;  1N9B A;  2K7S A;  4ZTK A;  4CLC A;  1NLY A;  4MEZ A;  1ES3 A;  1QMF A;  3BQ8 A;  1BTL A;  4PM9 A;  5J4E A;  2G2W A;  4KQQ A;  1GCE A;  2WAF A;  3G4P A;  5EOE A;  1NWZ A;  3U4L P;  3H9W A;  4KQD A;  5GLA A;  3UE1 A;  4NET A;  3PYP A;  3KYZ A;  3A3E A;  3VP2 A;  2Y8H A;  1G28 A;  4IHQ A;  1LHY A;  1H8M A;  2JKT M;  3ZQ5 A;  2XA7 S;  3ZG8 B;  2JHE A;  1OTE A;  4O7D A;  2XA7 M;  3VP1 A;  4GNU A;  3NI9 A;  1O07 A;  3MQQ A;  1YAX A;  1GA0 A;  5EVI D;  1FCO A;  4U0T A;  3VSK A;  3DTE A;  5EPH A;  5HFO A;  2WKP A;  3BW6 A;  4GLQ A;  2WYX A;  2XEP A;  1PIO A;  1TS6 A;  4ARZ A;  3GVB A;  4LGW A;  1GSV A;  5G4Y A;  4P87 A;  1CI9 A;  3ZG9 B;  3IHA A;  2MJ6 A;  3ZGA B;  3TOI A;  4ZAM A;  1K54 C;  1LSX A;  4HH3 A;  4DE0 A;  2W27 A;  2W3D A;  4N1X A;  3T4J A;  4BBV A;  3NY4 A;  2V2F F;  3T12 B;  1VB6 A;  3IWQ A;  4EEU A;  5HWW A;  2JBF A;  5EV0 A;  3A3D A;  4MBH A;  4HJ4 A;  5HW3 A;  4OOM A;  5CRF A;  3DTM A;  4WBG A;  4BQM A;  3GQZ A;  3T1S A;  2OV5 A;  4KG6 A;  1TVF A;  4S2L A;  1UWN X;  2I9V A;  4HIA A;  1VEU A;  2H0Y A;  1PZO A;  3TRC A;  5HL1 A;  3PTE A;  1S0W A;  4HNB A;  3GRJ A;  3FPV A;  5FEG A;  2Q0O A;  4KZB A;  4R70 A;  2J9O A;  3ZVW A;  3EGD C;  4Y15 A;  3SS3 A;  1NJ4 A;  1XGI A;  3GR2 A;  4RX3 A;  4JGR A;  2JCH A;  2Q9M A;  1YLW A;  2XF3 A;  4Q0I A;  5IT5 A;  4BWI A;  5CTN A;  3B42 A;  4WEL A;  2XFT A;  3LI9 A;  1I5Q A;  4DE1 A;  4YIN A;  3A0V A;  1NZU A;  3UDX A;  3ZCZ A;  1AXB A;  4E6W A;  1GSW A;  4B4X A;  4BJP A;  1XA7 A;  3Q81 A;  1ZHH B;  1L0F A;  5CX7 A;  3F1O A;  1IFQ A;  3P98 A;  3N8R A;  2ZQD A;  3BLM A;  2P9V A;  3CLO A;  3N8L A;  4MBK A;  3HJI A;  4MDZ A;  2FZ0 A;  4FSF A;  1UGU A;  3CUE A;  1VM1 A;  4LEN A;  2FFY A;  3M2K A;  4GDN A;  1E25 A;  2I72 A;  4ME4 A;  3UMD A;  1TDG A;  3CHW P;  2C5W B;  3PBN A;  5EOO A;  4OON A;  2WZZ A;  4IVK A;  2J3T D;  2L4R A;  2Y2J A;  4IBR A;  5L8M A;  2WGV A;  4S2P A;  1FIL A;  2JKF A;  4S2N C;  3Q7V A;  3RH8 B;  2QHK A;  1MBL A;  5CHJ A;  3SH7 A;  3PAG A;  3VP0 A;  2E8I A;  3V50 A;  1YM1 A;  3PBO A;  5HX9 A;  5KZH A;  3N4I A;  5EVE A;  1SDE A;  5FL3 A;  4OP5 A;  3LY4 A;  4MMN A;  2DNS A;  1MWS A;  1BLC A;  3MBZ A;  5E2E A;  2BAS A;  2WKQ A;  3E4Q A;  1CEF A;  3NIA A;  2J7V A;  3FYZ A;  2Y2G A;  1VHM A;  4HBT A;  4OP8 A;  2X02 A;  3G6O A;  1YSQ A;  4QD4 A;  1WYB A;  1ALQ A;  2EWW A;  4LV3 A;  3DTK A;  5F1F A;  4N9L A;  2KX6 A;  2VKS A;  1MZU A;  4MN6 A;  1W63 Q;  5D3O A;  1F9I A;  2JKG A;  1TS8 A;  2KLI A;  4QY6 A;  2DMW A;  1F98 A;  1P9W A;  1KOU A;  3IBR A;  3UNW A;  5FEF A;  3UE0 A;  2R9W A;  4IED A;  1IYO A;  4Y3I A;  2Z6D A;  1ONG A;  5EVI B;  2AVX A;  3H7W A;  1PI4 A;  1WYC A;  2EX2 A;  2BG1 A;  3HLE A;  2Y2Q A;  5F82 A;  1O7E A;  4KZ5 A;  4EER A;  3LIB A;  4II7 A;  1E3U A;  4JXS A;  3Q07 A;  3EEH A;  2H28 A;  3PBS A;  3LR5 A;  3UPO A;  5HAQ A;  4RQ9 A;  1BLP A;  1Q2P A;  5LBR A;  4FUW A;  2OOL A;  5CEB A;  1FOF A;  4NKP A;  3T4K A;  2PD7 A;  4X1L A;  4Q0J A;  5CTM A;  2V0U A;  3T4O A;  2XRN A;  2W3H A;  3NOU C;  3MZD A;  1T1B A;  2ZC7 A;  1QME A;  2HGV A;  5M19 A;  3TW8 A;  5KSC A;  1U60 A;  3O88 A;  1GHI A;  4QJG A;  2WZX A;  2VGL S;  5HDC A;  2ZMA A;  1S1Z A;  3T4L A;  4D60 A;  4GCZ A;  2Y2P A;  3C5A A;  4X53 A;  5TBM B;  1ESU A;  3LID A;  4BD1 A;  1ERO A;  3E98 A;  1HTZ A;  2VGK A;  2EFX A;  3LEQ A;  5HL6 A;  4H6J A;  3RXX A;  3IBJ A;  4HJ3 A;  4CPK A;  1MY8 A;  2GDN A;  3HUO A;  3LCE A;  1BT5 A;  1SDN A;  4OQI A;  1WE4 A;  4LCM A;  4Q0H A;  5HAP A;  3SS5 A;  3ULF A;  3BFD A;  3A0S A;  3G30 A;  3MR0 A;  3MS6 A;  2VEA A;  2PT7 A;  5FA7 A;  4CLC B;  2ZQA A;  1H8Y A;  3BYD A;  4PHT A;  1YLJ A;  3JPU A;  3E2L A;  3MFD A;  2WGI A;  4Y13 A;  3FG8 A;  2P04 A;  2HP9 A;  3VMA A;  5FAP A;  5TFQ A;  1V9Y A;  4JF5 A;  2BTF P;  3VE4 A;  1ES2 A;  3BEC A;  4YOF A;  2C6W B;  3HUM A;  4KZA A;  1LL9 A;  2RCX A;  4S2M A;  5FAT A;  3IS2 A;  1OT9 A;  3CAX A;  2D01 A;  2FFF B;  1MWR A;  4X25 A;  3BY9 A;  5FQJ A;  5EE8 A;  3C4O A;  2WAD A;  1G68 A;  2ZLY A;  1WA9 A;  2VV7 A;  4BD0 A;  3MJQ A;  5I5L A;  3QP1 A;  1S1Y A;  4L9E A;  2O9C A;  2PBY A;  4GJ4 A;  1SKO A;  3UPP A;  4CLC E;  4PAU A;  1KE0 A;  3VE3 A;  2ZOH A;  4LRX C;  4ARZ B;  1W79 A;  2VV8 A;  3PHY A;  4Y2F A;  3OCL A;  4ESP A;  2J3W A;  2OAP 1;  3VFF A;  1E3U D;  2HJ9 C;  4E3L A;  2V8C A;  5HWV A;  3K3C A;  3LGO A;  1XA1 A;  4KUO A;  4FH4 A;  3LIC A;  1H3Q A;  4HES A;  5F83 A;  4XT2 A;  2ZJ9 A;  2V9A A;  3CZD A;  2QKP A;  1XXM A;  5HDD A;  3C4P A;  3BRM A;  1YLZ A;  4OOL A;  1VEU B;  3DW0 A;  3R7W A;  4E3K A;  1GSX A;  4QPR A;  1XGJ A;  2PAV P;  3KYE A;  1SZV A;  4UA6 A;  4GHI A;  4MN5 A;  1EWZ A;  4GD6 A;  5IHV A;  1KVM A;  3LR4 A;  4I3I A;  5HAI A;  1LI9 A;  3UB8 A;  4R4R A;  3NEC A;  4ZRR A;  4BL2 A;  3IXD A;  1PZP A;  5A90 A;  4HOI A;  3MMH A;  2O0Y A;  4JXW A;  3NOT C;  4BEN A;  1PRQ A;  5DF9 A;  4GD8 A;  5DKK A;  3IXG A;  4O01 A;  4LFU A;  3IHB A;  1J9M A;  3C7U A;  2V1Z A;  4GW9 A;  3HL9 A;  3OZH A;  3UB9 A;  2JE5 A;  2M1C A;  4GN2 A;  4G3K A;  1JTG A;  2W1R A;  3RXW A;  3QNB A;  3C38 A;  4MNR A;  4DRT A;  2HP6 A;  1KDS A;  2UV0 E;  4EUZ A;  3HLF A;  3F1O B;  1ACF A;  3S7P A;  1JTD A;  3NDG A;  2P9V B;  4DDS A;  3SH8 A;  1BSG A;  1CJF A;  2Y2K A;  1ES5 A;  3BJN A;  2ZQ7 A;  3VFH A;  2R78 A;  2OAQ 1;  4Y0U A;  2VZW A;  4F94 A;  3LI8 A;  4G3W A;  1YMS A;  1VQQ A;  5EM1 A;  4XXR A;  5EM0 A;  5KIZ A;  3VOL A;  1PWD A;  1OTA A;  2JKR I;  4XUX A;  3EQV A;  3A3I A;  4KZ8 A;  1OTD A;  3Q7V B;  1NZO A;  2B5R A;  2OWH A;  1XJ3 A;  2YKF A;  4EU0 A;  3DAV A;  2XH9 A;  1VET A;  3T1X A;  3QP6 A;  4S2K A;  2P08 A;  3MZE A;  2O99 A;  2XR0 A;  3KYQ A;  2VV6 A;  1K6S A;  3ICY A;  3F1P A;  1YPR A;  2JC7 A;  2B18 A;  1F5M A;  2FH5 A;  1DRM A;  2WK0 A;  2YKH A;  4KZ9 A;  4EXO A;  3UDI A;  5FI2 A;  1XJ6 A;  1I2S A;  1X0O A;  1IOU A;  4IBX A;  4X56 A;  1YT4 A;  4X68 A;  4R3A A;  5HDS A;  4WZ5 A;  3IF6 C;  2Z2M B;  2JKT I;  4Q8I A;  1SKF A;  3ZG5 A;  4Y0T A;  3NUL A;  4B93 A;  5J3W A;  2VX8 A;  2ZMF A;  1OTI A;  4LV1 A;  4JGO A;  4HI4 A;  3WRT A;  5AJG A;  4KEN B;  3T4T A;  4CLC C;  5F69 A;  4DXB A;  1K4E A;  5FDS A;  3N7W A;  2K31 A;  2EXB A;  3LFV A;  3VOZ A;  1CEG A;  2VGJ A;  3ITB A;  3DWK A;  3H7W B;  4E04 A;  5EFW A;  1MWU A;  2HPB A;  4L9F A;  2W3G A;  5AQA A;  4JKT A;  5HPI A;  1W7F A;  2ZC3 B;  4LRY C;  2PYP A;  4Y7P A;  3E2K A;  3UPN A;  2XD1 A;  1MWT A;  5HSQ A;  4GOG A;  3MXR A;  5EUA A;  3MQ0 A;  2EA9 A;  4BBT A;  4GKU A;  4HP4 A;  4D2O A;  2OLU A;  1M40 A;  4M3K A;  1PW1 A;  3G31 A;  5FDH A;  4R1G A;  2A2L A;  3UB7 A;  4WN5 A;  4QHC A;  1P0Z A;  3NHQ A;  1CI8 A;  3NOP C;  3N8S A;  5FAS A;  4PKY A;  4O8G A;  4UQI M;  1FCN A;  2B95 A;  1RGZ A;  3B47 A;  5CED A;  3CPT A;  1FSY A;  5KSH A;  3I7J A;  2L1M A;  3FV7 A;  2ZM8 A;  1FQG A;  3ZFZ A;  1IKG A;  2XDM A;  3HLD A;  3Q82 A;  1L3L A;  3G35 A;  3OCN A;  4ZJ2 A;  2K2N A;  2V0W A;  1P9R A;  5IS1 A;  2WKE A;  4H6J B;  2PR6 A;  2J80 A;  1DJB A;  4I3J A;  1K57 C;  5GHY A;  1DJC A;  2Y55 A;  4KG2 A;  5M18 A;  4I3A A;  2M7V A;  5FQM A;  1H5X A;  2RL3 A;  3EEA A;  2IWB A;  3BFE A;  5E2G A;  4RA7 A;  4R23 A;  3GDI A;  3CG5 A;  1YMX A;  4JLF A;  1FIK A;  1RP5 A;  3TG9 A;  4KQR A;  3T4Q A;  1H0M A;  5DJT A;  3JVU A;  4LV2 A;  2ZC6 B;  3V3S A;  1Q2Q A;  1HVB A;  4U0X A;  1OJ5 A;  3IS2 B;  3LYX A;  4E3I A;  1V9Z A;  3O3V A;  3AGF A;  3BY8 A;  3ZG0 A;  2VJW A;  3FC7 A;  3SS4 A;  2Y4A A;  4PPR A;  3ZYT A;  4EWF A;  4E3M A;  3MXS A;  1SKO B;  2ZBB A;  2PHY A;  1IEM A;  3QNC A;  4K0X A;  4A5R A;  3PBT A;  4PKY G;  2EWV A;  2R9X A;  3CUE C;  2W3E A;  3Q7Z A;  4MBF A;  3W4P A;  5FQ9 A;  3BFG A;  3ITA A;  4LCL A;  4N92 A;  2W1T A;  4ID4 A;  2A49 A;  4XT2 B;  4UHU A;  3TJZ C;  3WWX A;  1EW0 A;  3OOV A;  2ZL1 A;  3VV4 A;  1LSW A;  1OT6 A;  3R7W B;  5AQ7 A;  1Y28 A;  3IWI A;  4OH0 A;  1L2S A;  2Y2H A;  4F3L A;  1BLS A;  2UWX A;  4GHI B;  2CC1 A;  1Z6F A;  3K3D A;  2GX5 A;  4IUK A;  2QJ5 A;  4EBP A;  4KUK A;  4HHD A;  3VP3 A;  5FAO A;  3LUQ A;  3H82 A;  2PU4 A;  2Z2L B;  5BOH A;  1XP4 A;  5DFX A;  1YLY A;  1ZG4 A;  3FZC A;  1K55 A;  1W8Y A;  2EFU A;  5F68 A;  3IXH A;  3A0R A;  3ZNY A;  3PR6 A;  2QZ6 A;  4EEP A;  2OWJ A;  2P7J A;  1DP9 A;  4WEK A;  3KSG A;  5HPF A;  1MKM A;  2V8F A;  3OPR A;  2XLN A;  1ES4 A;  2WGW A;  3WS4 A;  4NG2 A;  3KSF A;  1PFL A;  1FR6 A;  5L10 A;  1J3W A;  1BUE A;  2G7U A;  2ZD8 A;  1FSW A;  4U3T A;  2HF6 A;  2IA2 A;  4KG5 A;  3UE6 A;  4WL9 A;  3C2W A;  4ZJ1 A;  3MSH A;  4FOF A;  3ZDJ A;  1TD5 A;  2EXA A;  3ZNT A;  3UN7 A;  1DP6 A;  4OQH A;  1ZG6 A;  2H10 A;  4AFI A;  1PI5 A;  5GL9 A;  4OLG A;  1LI0 A;  1W63 M;  3C8C A;  3IH8 A;  3K2N A;  2PU2 A;  4EQI A;  2DCF A;  3CMZ A;  2W3F A;  2XK1 A;  3E0Y A;  3IH9 A;  1K25 A;  2H0T A;  4R38 A;  3JVV A;  4K08 A;  1SCW A;  4P6Z M;  4OQG A;  4WZ4 A;  3JYI A;  1MXO A;  2WKR A;  4UAA A;  2V1B A;  1F2K A;  3T50 A;  3M6H A;  4B9O A;  3W4O A;  4N9K A;  2PR5 A;  2XQZ A;  4JGP A;  3IT9 A;  2GJ3 A;  4FH2 A;  1PWG A;  2WKI A;  3VSL A;  5E2F A;  2WUQ A;  4DKI A;  3LIE A;  1YLT A;  1VET B;  4NEE D;  2ZOI A;  3N6I A;  5GLB A;  1LL5 A;  1PWC A;  4KQO A;  2HDS A;  3F1P B;  5DTT A;  4Y5F A;  1ONH A;  3UB6 A;  5FQQ A;  5HWT A;  1SHV A;  2XD5 A;  3B33 A;  3FKW A;  5DF7 A;  3SH9 A;  4FD8 A;  1K56 A;  3R4K A;  5K5B A;  3IWO A;  3PBQ A;  5FI7 A;  4X55 A;  4OLD A;  2Y2N A;  4IVI A;  3EQU A;  4L0L A;  4BLM A;  1Z09 A;  1TDL A;  1S4S A;  1N9O A;  2NUP C;  1LLB A;  5F1G A;  3UO9 A;  4EUV A;  1T18 A;  4MLL A;  3L7H A;  1G6O A;  5E43 A;  3V67 A;  1TS7 A;  3FPW A;  2HDR A;  1K54 A;  1K4F A;  2ACG A;  4RX2 A;  2BLS A;  4ETZ A;  1JVJ A;  1K0K A;  2HP5 A;  3CI6 A;  4E3N A;  5U47 A;  3GEC A;  3DWZ A;  1M6K A;  5FQK A;  2A3U A;  3LR3 A;  3V5M A;  4WM9 A;  2H5S A;  1KE3 A;  1N9N A;  3QP5 A;  4DF6 A;  4RVA A;  3UME A;  4BL3 A;  4GB7 A;  4UA9 A;  2Q9N A;  3O87 A;  4QY5 A;  4E3J A;  3D3O A;  3IXB A;  1BYW A;  3KO6 A;  3V39 A;  1KDW A;  3DTI A;  2XFS A;  2DRW A;  1LT0 A;  3IF6 A;  2Z6C A;  3P01 A;  3KX0 X;  1HD8 A;  5EVI C;  5GHZ A;  1IYS A;  4LV0 A;  4X1M A;  4BBU A;  3ISG A;  4DMZ A;  3LY3 A;  3WS0 A;  3BQA A;  2VLG A;  4R6L A;  3WS5 A;  2GZA A;  4WMC A;  1TF1 A;  3IX8 A;  3A3J A;  4KZ6 A;  3CPT B;  2EX8 A;  4Y17 A;  5HZH A;  2PD8 A;  4UEY A;  3W2Z A;  4YNR A;  3T1Q B;  4DDY A;  2A24 A;  3GSG A;  4NXF A;  1G6A A;  4B88 A;  2VK3 A;  3S7Q A;  5L09 A;  4CJN A;  4S2O A;  4GS9 A;  2P74 A;  5KMW A;  4EW7 A;  3QHY A;  3RJU A;  4PM8 A;  4L9G A;  1N9L A;  3B3X A;  3G2Y A;  4PM6 A;  4KZ4 A;  2WAE A;  1OTB A;  4B4Z A;  4HQA A;  4WLA A;  5TR7 A;  3C30 A;  3NDE A;  2GNX A;  2Y79 A;  2XRO A;  1K56 D;  3OLO A;  3UB5 P;  1NYM A;  3QP8 A;  5CEC A;  4KZ7 A;  4HH2 A;  3MF0 A;  3HVF A;  5FQI A;  3MXQ A;  5M1A A;  3AGE A;  3HCY A;  4OPY A;  4MN7 A;  4S2N A;  2QMI A;  5AVF A;  4E6X A;  5CHM A;  4ETX A;  1AWI A;  3M2J A;  3ZHH A;  1BUL A;  4DJ2 A;  1L0D A;  3P7N A;  5AQ9 A;  5JYO A;  3MKE A;  3DBA A;  4JXV A;  3F1N A;  1Y4O A;  5HD5 A;  1ERM A;  1N4O A;  4Y0O A;  4YWZ A;  4Z9Q A;  5TJJ A;  4OPZ A;  1K57 A;  5C5K A;  3S1Y A;  2ZMV A;  4KZ3 A;  2B02 A;  5L2F A;  2X01 A;  4OKP A;  3W4Q A;  3LEZ A;  1A0K A;  5DJU A;  1S6R A;  3ZVT A;  3BEB A;  3RTY A;  2NUT C;  3G34 A;  1GHP A;  2J3T C;  1JWV A;  1JWP A;  3BFC A;  3OPL A;  4LLO B;  2IWD A;  2W0N A;  4O0P A;  2W1T B;  2WKH A;  1YSP A;  4R0Q A;  2D02 A;  4UQI S;  1S66 L;  4CLC D;  4RYE A;  4WMC D;  5TGF A;  4R3B A;  4Z1W A;  2ZL1 B;  3NC8 A;  4UA7 A;  1E4D A;  4H8R A;  2KOI A;  4WYY A;  2IWC A;  1K38 A;  5DTK A;  4F3L B;  3O5Y A;  2HDU A;  5G4Z A;  5A93 A;  4JF6 A;  1IKI A;  1PYY A;  3VP4 A;  4EV4 A;  4S2I A;  2M7U A;  2Y2I A;  1ZTU A;  3D72 A;  4PM7 A;  1G5U A;  1KVL A;  4QB8 A;  5DVA A;  2X71 A;  3H82 B;  3S4X A;  2LB5 A;  1OJG A;  4ZJ3 A;  4WZ5 C;  5A91 A;  1L0G A;  4I5S A;  4NXE A;  5G18 A;  2WGW B;  3TE8 A;  1STZ A;  1OME A;  4NK3 A;  2KDK A;  2LB9 A;  4C75 A;  3AGD A;  4HEF A;  4BMW A;  1YLP A;  3P09 A;  4EBN A;  3MQO A;  3GTC A;  2PRF A;  4DE2 A;  3G2Z A;  1ESI A;  3GV9 A;  4WEJ A;  3KSH A;  3HLC A;  4R4S A;  2O9A A;  4K91 A;  4X69 A;  1KGE A;  3O86 A;  4OPQ A;  2ZQ8 A;  1NRF A;  3IQA A;  1PW8 A;  3EOI A;  2QWS A;  2EX6 A;  1HLU P;  4DXC A;  3UDF A;  4CQH A;  2ZQ9 A;  1W8Q A;  1XFN A;  5A8B A;  1GA9 A;  1IYQ A;  3GMW A;  1D7E A;  4DE3 A;  5CGS A;  3HLW A;  1KGG A;  3LO7 A;  1I2W A;  5DTS A;  1LL8 A;  1T19 A;  1NRJ A;  2HZ5 A;  3IF5 A;  5E2H A;  4PM5 A;  1UWP X;  3IX3 A;  3FWL A;  5EEC A;  3S22 A;  2V1A A;  2XSS A;  3OBF A;  4OVD A;  3OPH A;  5HD3 A;  4IUH A;  4NXG A;  5EVL A;  3Q1F A;  3PAE A;  2Y2O A;  4HJ6 A;  3OC2 A;  1CQA A;  1FR1 A;  3FKV A;  4LPZ A;  4EQ1 A;  1S67 L;  5L07 A;  5CHU A;  4M4X A;  3NCK A;  2ZM2 A;  1RGY A;  1XFQ A;  4QWO A;  1CK3 A;  4JBF A;  1IEL A;  1NLZ A;  4XUZ A;  3QP4 A;  3T4S A;  4IJG A;  1JWZ A;  3M6B A;  2HJE A;  5FSR A;  1ERQ A;  1NYY A;  3BFF A;  1FCM A;  4FTX A;  4NXB A;  4EET B;  1XX2 A;  5FI6 A;  4ZBE A;  3NBL A;  5J8X A;  4N1H A;  3HRE A;  1H8Z A;  3E4P A;  2ZC4 B;  3PBR A;  4GDB A;  5GLD A;  3ZG7 B;  1Y54 A;  2JN7 A;  5A92 A;  4JGQ A;  3MKF A;  4FCF A;  1KE4 A;  5F5Y A;  4YFM A;  3RFB A;  3SZT A;  1K6R A;  4JF4 A;  2VGL M;  3WS2 A;  4MCW A;  2PDR A;  2Y2L A;  1NY0 A;  1MPL A; 
#chains in the Genus database with same CATH homology
 5HDS A;  2BAS A;  2WKQ A;  3E4Q A;  2JKT I;  3LR3 A;  1N9N A;  1VHM A;  4B93 A;  5J3W A;  2VX8 A;  3UME A;  2ZMF A;  1OTI A;  3G6O A;  1YSQ A;  4JGO A;  1MC0 A;  4HI4 A;  4I39 A;  3KSI A;  3D3O A;  5AJG A;  3T4T A;  4CLC C;  5F69 A;  2EWW A;  1BYW A;  3KO6 A;  1P97 A;  1T1A A;  3BWL A;  2KX6 A;  2VKS A;  1MZU A;  2K31 A;  1W63 Q;  4MN6 A;  3LIA A;  3EWK A;  1F9I A;  1TS8 A;  3LFV A;  3LR0 A;  2KLI A;  2O9B A;  4HY8 A;  1LT0 A;  4E04 A;  3H7W B;  2DMW A;  2Z6C A;  1F98 A;  1P9W A;  1KOU A;  3P01 A;  4G3V A;  3LIF A;  3IBR A;  1T1C A;  5EFW A;  3KX0 X;  4L9F A;  2L0W A;  2W3G A;  5HPI A;  1ODV A;  4LRY C;  2PYP A;  4BBU A;  4P6Z S;  4DMZ A;  1YKD A;  5HSQ A;  4Y3I A;  2Z6D A;  3BQA A;  2VLG A;  4R6L A;  4WF0 A;  2GZA A;  3NJA A;  2A24 B;  3MQ0 A;  1TF1 A;  2EA9 A;  4BBT A;  3H7W A;  4HP4 A;  4GS9 B;  3U2A A;  5MC7 A;  5HZH A;  4EES A;  2PD8 A;  4UEY A;  2A2L A;  3W2Z A;  4YNR A;  3UB7 A;  5IU1 A;  4WN5 A;  4EER A;  3LIB A;  1P0Z A;  4II7 A;  3NHQ A;  3NOP C;  2A24 A;  4NXF A;  3PXP A;  3EEH A;  4PKY A;  4O8G A;  4UQI M;  1TS0 A;  2H28 A;  3S7Q A;  3PBS A;  3LR5 A;  3B47 A;  1DP8 A;  4GS9 A;  4RQ9 A;  5KSH A;  5LBR A;  4EW7 A;  3UE3 A;  2OOL A;  5F6A A;  4DJ3 A;  2L1M A;  4NKP A;  4L9G A;  1N9L A;  3T4K A;  2PD7 A;  4Q0J A;  4WUJ A;  2V0U A;  3T4O A;  3HJK A;  2XRN A;  1OTB A;  2W3H A;  3S7O A;  4HQA A;  4WLA A;  2QYB A;  5DFY A;  3NOU C;  1T1B A;  3C30 A;  3OCN A;  4LRZ E;  2HGV A;  1JNU A;  3TW8 A;  2GNX A;  2Y79 A;  2XRO A;  2K2N A;  2V0W A;  1P9R A;  3OLO A;  5IS1 A;  4H6J B;  1S4R A;  2PR6 A;  2J80 A;  2VGL S;  5HDC A;  4HH2 A;  1S1Z A;  4I3J A;  3EGX C;  3MF0 A;  3T4L A;  1XJ2 A;  4GCZ A;  2PYR A;  3F1N B;  3MXQ A;  4HP9 A;  5TBM B;  3CIT A;  3HCY A;  2HV1 A;  3LID A;  3E98 A;  4MN7 A;  4I3A A;  2M7V A;  5AVF A;  5HL6 A;  3EEA A;  4ETX A;  2VA0 A;  4H6J A;  3IBJ A;  4HJ3 A;  3GDI A;  4DJ2 A;  1D06 A;  2JKR M;  3P7N A;  5AVE A;  3DBA A;  3F1N A;  5TBM A;  3S7N A;  3CWF A;  5HD5 A;  4I38 A;  3SW1 A;  2CMN A;  5DKL A;  4Q0H A;  3T4Q A;  5DJT A;  3JVU A;  4YWZ A;  3ULF A;  3E4O A;  5TJJ A;  3A0S A;  3MR0 A;  1OJ5 A;  2VEA A;  2PT7 A;  5C5K A;  3IS2 B;  4CLC B;  2INW A;  2ZMV A;  2QJ7 A;  3LYX A;  4PHT A;  3MFX A;  2B02 A;  1V9Z A;  3FG8 A;  2P04 A;  4DN0 A;  3BY8 A;  5J7E A;  1LSV A;  1V9Y A;  1OPX A;  2VJW A;  3VE4 A;  4YOF A;  1XJ4 A;  3FC7 A;  5DJU A;  2K7S A;  3IS2 A;  3ZYT A;  4CLC A;  1NLY A;  1OT9 A;  3CAX A;  2D01 A;  3BQ8 A;  2ZBB A;  2PHY A;  2NUT C;  3BY9 A;  3RTY A;  5J4E A;  2J3T C;  3PBT A;  1WA9 A;  1NWZ A;  4PKY G;  2VV7 A;  3H9W A;  2EWV A;  3CUE C;  4LLO B;  3MJQ A;  2W0N A;  2W3E A;  4KQD A;  4O0P A;  2W1T B;  5I5L A;  1YSP A;  2D02 A;  3PYP A;  3KYZ A;  4UQI S;  4L9E A;  1S1Y A;  2O9C A;  2Y8H A;  1G28 A;  1S66 L;  4IHQ A;  4CLC D;  4GJ4 A;  1H8M A;  2JKT M;  4Z1W A;  3ZQ5 A;  2XA7 S;  2JHE A;  4CLC E;  1OTE A;  4PAU A;  3VE3 A;  2XA7 M;  2KOI A;  2ZOH A;  4LRX C;  4ARZ B;  3MQQ A;  1YAX A;  2W1T A;  2VV8 A;  3PHY A;  4F3L B;  4Y2F A;  3O5Y A;  4XT2 B;  3OCL A;  5G4Z A;  2J3W A;  2OAP 1;  3TJZ C;  2HJ9 C;  1EW0 A;  3OOV A;  2WKP A;  5HWV A;  3BW6 A;  3VV4 A;  2M7U A;  1LSW A;  3K3C A;  1OT6 A;  3R7W B;  1ZTU A;  3D72 A;  4GLQ A;  1Y28 A;  4KUO A;  3LIC A;  1TS6 A;  4ARZ A;  1H3Q A;  1GSV A;  4F3L A;  5G4Y A;  4XT2 A;  2MJ6 A;  3H82 B;  4GHI B;  1LSX A;  2V9A A;  4HH3 A;  2W27 A;  2W3D A;  2QKP A;  2LB5 A;  1OJG A;  5HDD A;  3T4J A;  4BBV A;  4OOL A;  3K3D A;  2GX5 A;  3R7W A;  4IUK A;  1VB6 A;  2QJ5 A;  4I5S A;  4NXE A;  4EEU A;  1GSX A;  4QPR A;  5HWW A;  4KUK A;  4HHD A;  3LUQ A;  3TE8 A;  1STZ A;  3H82 A;  4GHI A;  4HJ4 A;  4MN5 A;  4OOM A;  2KDK A;  2LB9 A;  3LR4 A;  5DFX A;  4BMW A;  1UWN X;  5F68 A;  2I9V A;  4I3I A;  3A0R A;  4HIA A;  3PR6 A;  4EEP A;  2OWJ A;  2P7J A;  1DP9 A;  4WEK A;  3KSG A;  3UB8 A;  3MQO A;  5HPF A;  3TRC A;  1MKM A;  4ZRR A;  4HOI A;  3MMH A;  3KSF A;  2O0Y A;  4HNB A;  4WEJ A;  3KSH A;  3FPV A;  3NOT C;  2O9A A;  5DF9 A;  4R70 A;  2G7U A;  3EGD C;  5DKK A;  4O01 A;  2HF6 A;  3EOI A;  2QWS A;  2IA2 A;  4GW9 A;  3UE6 A;  3UB9 A;  4WL9 A;  2M1C A;  3C2W A;  4JGR A;  4CQH A;  4G3K A;  2W1R A;  4Q0I A;  1XFN A;  5A8B A;  5IT5 A;  3C38 A;  4BWI A;  4FOF A;  1D7E A;  1TD5 A;  3B42 A;  1LL8 A;  1T19 A;  4WEL A;  3F1O B;  1DP6 A;  1NRJ A;  4AFI A;  3LI9 A;  3S7P A;  1W63 M;  3C8C A;  3A0V A;  3K2N A;  1UWP X;  2W3F A;  3E0Y A;  4R38 A;  3JVV A;  4K08 A;  1GSW A;  2V1A A;  4P6Z M;  2XSS A;  4BJP A;  3OBF A;  1ZHH B;  2WKR A;  3BJN A;  2V1B A;  3T50 A;  5HD3 A;  5CX7 A;  4B9O A;  3F1O A;  4IUH A;  1IFQ A;  4NXG A;  2R78 A;  2PR5 A;  2OAQ 1;  4JGP A;  2GJ3 A;  4HJ6 A;  2VZW A;  3OC2 A;  4LPZ A;  4EQ1 A;  3CLO A;  1S67 L;  3HJI A;  3LI8 A;  4MDZ A;  4G3W A;  2FZ0 A;  4M4X A;  3LIE A;  4FSF A;  1XFQ A;  1UGU A;  4NEE D;  2ZOI A;  3CUE A;  5KIZ A;  1NLZ A;  3VOL A;  1OTA A;  2JKR I;  3EQV A;  3T4S A;  4KQO A;  4IJG A;  4ME4 A;  1OTD A;  3UMD A;  3F1P B;  4Y5F A;  3UB6 A;  2HJE A;  5HWT A;  3PBN A;  3B33 A;  2OWH A;  1XJ3 A;  2J3T D;  4EET B;  4NXB A;  2L4R A;  2YKF A;  3R4K A;  4EU0 A;  5K5B A;  3PBQ A;  2P08 A;  5L8M A;  2O99 A;  3EQU A;  3KYQ A;  2VV6 A;  4L0L A;  3ICY A;  3F1P A;  1S4S A;  3RH8 B;  1N9O A;  3E4P A;  2NUP C;  2B18 A;  1F5M A;  2FH5 A;  2QHK A;  3PBR A;  1DRM A;  2JN7 A;  4EUV A;  1T18 A;  2YKH A;  4EXO A;  3PBO A;  4JGQ A;  1G6O A;  3V67 A;  1TS7 A;  3FPW A;  5F5Y A;  1XJ6 A;  3RFB A;  1X0O A;  5FL3 A;  4ETZ A;  1IOU A;  2VGL M;  3CI6 A;  4MCW A;  4MMN A;  2PDR A;  4R3A A;  3GEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...