4EETB

Crystal structure of ilov
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
111
structure length
111
Chain Sequence
b'FIEKNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFIGVQLDGSDHV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phototropin-2
publication title Structural Tuning of the Fluorescent Protein iLOV for Improved Photostability.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein, flavoprotein
total genus 34
structure length 111
sequence length 111
chains with identical sequence D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4eetB00
3LICA 4RQ9A 2V1BA 4HOIA 1WA9A 2J80A 4HH2A 3UMEA 3HJIA 5IS1A 3HJKA 2L4RA 3F1NA 1T1BA 2K7SA 4GCZA 2B02A 3G6OA 5HWWA 1S1YA 4HP9A 1S4RA 2OWJA 4I3AA 5TBMA 5KIZA 1GSXA 3E4QA 4HH3A 2OOLA 1N9LA 1T19A 1XFQA 1V9YA 3NOUC 3CAXA 1F9IA 4LRYC 2V9AA 1Y28A 1XJ2A 4R38A 3H82B 1UGUA 1OJ5A 3BY9A 2QJ7A 2GJ3A 3FC7A 1KOUA 3H9WA 5F5YA 4EW7A 5HD5A 1XFNA 1V9ZA 5HDCA 3P7NA 1GSWA 4LRZE 2KX6A 4I3IA 4LRXC 5HD3A 4WLAA 4EXOA 1X0OA 4NXEA 4EQ1A 3F1OA 3E4PA 5F68A 5G4ZA 3RTYA 5HWVA 1OT9A 3UB9A 1S67L 3IS2A 2ZOHA 2M1CA 2V0UA 2V0WA 4NXGA 3RH8B 2INWA 3NOTC 2CMNA 3D72A 4WUJA 2YKFA 4R3AA 3VE3A 3F1NB 1TS0A 3LIBA 4F3LA 3LIAA 3LI9A 3MFXA 4H6JB 5DJUA 1XJ3A 1VB6A 4B9OA 1EW0A 5TBMB 5AVFA 4YWZA 2PYPA 4JGRA 3B33A 3LYXA 3UB6A 1JNUA 1DP8A 2VV6A 5F6AA 5J3WA 4I5SA 4HQAA 4I39A 4H6JA 4BBVA 3ULFA 3PHYA 4GHIA 4LLOB 2H28A 1TS6A 1D06A 3EEHA 2D02A 4GS9A 3NHQA 2JHEA 4L9FA 2PHYA 1OTBA 5HZHA 2KDKA 2VV7A 4MN5A 4HY8A 3F1OB 2QJ5A 4NXFA 1UWNX 3IS2B 4WF0A 1P0ZA 2P7JA 4WN5A 3EWKA 4PKYG 2V1AA 5HSQA 3LUQA 4JGQA 1T1AA 2VEAA 4BBUA 4XT2A 1OTDA 3LIEA 4F3LB 3MXQA 1OTAA 4DJ2A 3VOLA 3H7WA 3LIDA 3NJAA 5IU1A 2ZBBA 4BBTA 2WKPA 3KX0X 1DP6A 4NXBA 2L0WA 4JGOA 1LSWA 1LT0A 5DKKA 2D01A 3MJQA 2Z6DA 4L9EA 3C2WA 1NWZA 3E4OA 2W27A 5EFWA 1OTIA 1BYWA 4GHIB 4EEPA 4R70A 3F1PA 5HWTA 2VLGA 3MQQA 3GECA 4LPZA 3C8CA 4GS9B 3LIFA 5AVEA 3UE6A 2I9VA 3K3DA 2W0NA 4MN6A 1LSVA 1DRMA 1S66L 1T18A 2JN7A 4K08A 2PR6A 4EERA 4L9GA 3UMDA 1D7EA 4XT2B 2PR5A 1N9NA 2PYRA 3NOPC 5G4YA 1DP9A 4PKYA 3A0RA 3CLOA 4DJ3A 3H7WB 3FG8A 5HDDA 3MQOA 1UWPX 1ODVA 4KUKA 4EESA 3IBRA 2PD7A 3BY8A 2QHKA 3UB7A 1T1CA 3ZQ5A 4R6LA 1P97A 3PYPA 3SW1A 2A24A 5J7EA 4EEUA 5A8BA 2QKPA 1G28A 4KQDA 2WKQA 4M4XA 2YKHA 1N9OA 4EETB 1TS7A 2OWHA 3F1PB 3ICYA 1OT6A 3VE4A 5HDSA 4HNBA 1XJ6A 4I38A 1OJGA 4HJ3A 2R78A 4HIAA 1S4SA 3K3CA 4WL9A 3H82A 3BWLA 4JGPA 2PDRA 4I3JA 4HP4A 4HJ4A 2L1MA 4HJ6A 3CWFA 5J4EA 2VV8A 1OTEA 2HV1A 2WKRA 5I5LA 4HHDA 4GW9A 1TS8A 2QWSA 3LI8A 5DKLA 4HI4A 4KUOA 4E04A 1MZUA 3MR0A 2ZOIA 5DJTA 1LL8A 2Z6CA 1S1ZA 2EA9A 5F69A 2PD8A 3UB8A 3A0VA 1LSXA 1GSVA 1F98A 3A0SA 3GDIA 2BASA 2A24B 3OLOA 3T50A 1XJ4A
chains in the Genus database with same CATH superfamily
1A0KA 1CEGA 4RQ9A 1JWVA 4QU3A 2XA7M 3C4PA 4RX2A 1KE3A 3HJIA 5IS1A 2L4RA 4N1XA 3U2AA 1T1BA 5GHZA 3SH8A 1NYMA 2B02A 2MJ6A 1XA7A 4E3IA 2ZQ8A 5DTSA 5GHYA 3D4FA 4A5RA 2Y2MA 3DAVA 1S4RA 2E8JA 3PXPA 5FEGA 4CLCA 2ZQ7A 1RGYA 5HL6A 2IWBA 2V9AA 3GMWA 3MZDA 5L10A 3SH9A 3TE8A 2WZXA 5JYOA 3BY9A 1GHIA 2QJ7A 4S2MA 2K31A 1IEMA 2O9CA 2GJ3A 4BQMA 3ZVTA 5FASA 3FC7A 2B5RA 1HVBA 2WGWA 3UPOA 3ITBA 1GA9A 5F5YA 4YINA 3IWOA 4EU0A 2O0YA 5HD5A 4EW7A 2QMIA 2VGLM 1ERMA 3JYIA 1PWCA 2Q9NA 4GDBA 2C5WB 4Q0IA 5EVIB 3R4KA 2P08A 3GVBA 3T1RA 1BLHA 4EXOA 2RCXA 4R4RA 3F1OA 3BLMA 5F1GA 3BYDA 1H8ZA 2Y2PA 1FQGA 4UA6A 5L2FA 2XSSA 3IS2A 2ZOHA 1ONGA 2M1CA 3TSGA 1YMSA 1TDLA 4QY6A 4P6ZM 1K55C 3UE1A 3LFVA 2Y55A 3MMHA 1SKOA 2YKFA 2ZQDA 5KMWA 3LIAA 3UDXA 5HW3A 4S2NC 4KENB 2LB9A 3LGOA 2HP6A 4B9OA 2PT7A 2Y2NA 4QD4A 1XP4A 1RCJA 5CECA 5TBMB 4DE3A 4YWZA 2ZM0A 3G2ZA 2AVXA 3LYXA 3UB6A 2W1TA 3P98A 4UQIS 4X1LA 4R3BA 5J3WA 5L09A 4P87A 4HQAA 1K38A 4I39A 2HJEA 1EI5A 3HLEA 5FAQA 2JKTM 3HLGA 3DWZA 3R7WB 2HGVA 2PAVP 1N9BA 3FKWA 5CERA 3KSFA 5CTNA 1BLSA 1MKIA 2Z2MB 3NHQA 2JHEA 4L9FA 3IXBA 2VV7A 5FI2A 1ZG4A 4MN5A 4HY8A 3BECA 3ZFZA 1H3QA 4Y0TA 2J3TD 3P01A 4EUZA 2V8CA 1BSGA 2ZL1A 2GDNA 4LCMA 4WN5A 3EWKA 2V1AA 4ZBEA 5HPIA 3T4SA 3NCKA 1M40A 3T4JA 4JGQA 2O9BA 2HF6A 4S2JA 1OTDA 5HAPA 2JCHA 2PRFA 2J7VA 4ME4A 3ZNTA 4S2IA 5EVIC 4MEZA 3NJAA 2HP9A 5CXWA 1HLUP 5G18A 4BBTA 4B4ZA 4EWFA 2J8YA 4LENA 2L0WA 1PYYA 2ZM8A 3MJQA 2Z6DA 4E3NA 4GNUA 4BL2A 1W7FA 1DJCA 1YQSA 3GRJA 4OVDA 3BW6A 2ZC3B 4JXVA 4EV4A 1P9WA 2X02A 2X71A 5HARA 4EEPA 5HWTA 2VLGA 3IBJA 1KGGA 3MQQA 1P9RA 2JKRI 3VP2A 3NECA 4LPZA 3NBLA 3O87A 3TW8A 1ZTUA 3S7OA 4FH4A 2I9VA 2JC7A 2WKEA 5FDHA 3VP4A 3T12B 4EBNA 4Y2FA 5CRFA 5KSCA 3IF6A 4N92A 1U60A 1BZAA 1S66L 2JN7A 2ZMAA 4WMCA 4BENA 4MBFA 1IELA 4K08A 1PZOA 2W3HA 4EERA 2WKIA 4R4SA 5AQAA 4PM6A 3UPPA 3PBRA 4PHTA 1FCMA 3HLCA 3CLOA 4DJ3A 3H7WB 3FG8A 5HDDA 3MQOA 3UB5P 1MPLA 5FAOA 4ARZB 1T1CA 2BLSA 4X69A 4R6LA 3ZVWA 2HJ9C 5CTMA 1GCEA 3BQAA 1PW8A 1G28A 1AXBA 3AGFA 2WKQA 3QP5A 2WAEA 3TOIA 2WGVA 1I2SA 4EETB 3F1PB 3M2KA 5CGSA 1CQAA 3KO6A 5HL1A 4GD6A 1NYYA 3NDEA 1YM1A 1OJGA 3MS6A 4IUKA 5TFQA 2HDQA 5FL3A 1RP5A 4MNRA 4AFIA 1K25A 1VEUB 3DTIA 1QMEA 4WL9A 4K0XA 2LB5A 3H82A 3GSGA 4DE1A 3GTCA 2JBFA 4HJ4A 2L1MA 5CEBA 4Y17A 2W3DA 2XQZA 3IH8A 2HV1A 2WKRA 5I5LA 3QP6A 2XGNA 2E8IA 2H0YA 3B47A 1CF0A 4B4XA 4E04A 3PBTA 4WZ4A 3SS4A 1MWTA 1ZG6A 4NETA 3UNWA 2I72A 5F69A 2DMWA 3HLBA 4Q0JA 3A0VA 4S2LA 1FSYA 4E6XA 1CI9A 2BASA 2CC1A 3BFDA 4E3JA 2R9XA 5CGWA 2HDRA 1XX2A 3LICA 1NY0A 3ITAA 3OPHA 3LCEA 3UMEA 3VP0A 1YAXA 3M6HA 3WRZA 3HJKA 1IKIA 4GCZA 3O86A 1XKZA 3Q81A 4DKIA 4XXRA 2XD1A 5EE8A 3UPNA 2B95A 4WMCD 2RL3A 3WWXA 5HFOA 1NRJA 4BL3A 2OWJA 3VSKA 4I3AA 4JPMA 1GSXA 4OLGA 3E4QA 5EOEA 2OOLA 2M7UA 1V9YA 1LL5A 3CAXA 3A3DA 2Y4AA 4LRYC 1FCOA 1HD8A 2WAFA 3GV9A 4QPRA 5E43A 2HDUA 3QP1A 1XA1A 1IYSA 5CHJA 5EVEA 4EUVA 1XXMA 3IX4A 1SKFA 1AWIA 3BFCA 2ZQ9A 1KOUA 4M3KA 4WZ5A 3H9WA 3KSHA 3BFGA 1ONHA 4GJ4A 3ZG0A 5FQQA 4HEFA 1SCWA 4OQ0A 1I5QA 3P7NA 3HUNA 2W1RA 1VETA 4LRXC 3HCYA 2Z2LB 3T4QA 4EQ1A 4E3KA 3E4PA 5M18A 3RTYA 2J9PA 3T4TA 4OKPA 1S67L 3E98A 4P0MA 3MKEA 2V0UA 3BEBA 4CJNA 2DRWA 2P9VA 3OPRA 3FPVA 2XF3A 2INWA 3NOTC 3D72A 3JPUA 3OOVA 1TF1A 4OP8A 3VE3A 3F1NB 3LIBA 4F3LA 5EV0A 3V39A 3MFXA 3O3VA 2IWDA 4N9KA 4B88A 1XJ3A 4E3LA 4R0QA 1DY6A 5M1AA 1EW0A 4Y7PA 4P6BA 3UE0A 3CPTA 4JGRA 4CLCC 1QMFA 3S7PA 3HBRA 3KYQA 5U47A 4Q8IA 1DP8A 2GZAA 2EX2A 3EQVA 4OPRA 4H8RA 2QYBA 3L7HA 2XA7S 4ZJ1A 4H6JA 1Z09A 3HUOA 4KZ4A 4BBVA 1MBLA 3O5YA 3A3EA 3Q7ZA 2H28A 3CITA 5KSHA 1YMXA 1TS6A 4RX3A 3GR2A 1D06A 3PBSA 4MDZA 2JKRM 2FZ0A 1KDWA 2WADA 3A3FA 2D02A 4EBPA 4DN0A 4GS9A 4II7A 2XFSA 4WEJA 5L07A 2PHYA 5K5BA 1ALQA 2KDKA 4DDSA 1IYPA 2NUPC 2A2LA 3HLDA 3SS5A 1UWNX 3MZEA 1NRFA 4PKYG 4C3QA 3V3RA 5HSQA 1YSPA 4E3MA 2WK0A 3CJMA 5FQJA 3LIEA 1K56A 3IX3A 2VA0A 3MXQA 1OTAA 1FILA 4QHCA 4DJ2A 4ZTKA 3ZG7B 4LGWA 4ZDXA 2W3EA 4KZ9A 2Y2JA 4DDYA 5FI6A 2WKPA 2V1ZA 1DP6A 1LT0A 3WS4A 2ZC6B 3D9YA 3SS3A 4QJGA 3E2LA 4ZAMA 1NWZA 3N7WA 2JKFA 4P6ZS 4MBHA 5FQMA 1FIKA 5EFWA 1KE4A 1BYWA 1SHVA 3KYEA 4GHIB 3TJZC 4KQRA 2IWCA 5L8MA 3GECA 1FR6A 1JWZA 5FI7A 2VZWA 4ETXA 3C8CA 3Q7VB 4JXGA 3ZGAB 3K3DA 1JTDA 3EEAA 1SZVA 4K0WA 5M19A 5GL9A 1W79A 1K57A 2O99A 4R3JA 1YSQA 2VJWA 3S22A 1JTGA 4DE0A 4BWIA 4GKUA 5HAQA 3VP3A 1Q2PA 1K55A 1E3UA 2PR6A 1SDNA 1BULA 2XLNA 3QP8A 3UMDA 1D7EA 4XT2B 4ETZA 2EFXA 3B42A 2PYRA 2J9OA 4S2NA 1DP9A 2H0TA 1SDEA 3A0RA 1KE0A 5JYPA 4PM9A 3O88A 3M6BA 3IBRA 1LHYA 2QHKA 3GQZA 4LV2A 3UB7A 3EQUA 2DNSA 2ZD8A 5FEFA 1P97A 3PYPA 1E4DA 2A24A 5GLCA 1LLBA 2ZC4B 4EEUA 2HPBA 5A8BA 4IEDA 4Y13A 4G3VA 2V20A 4KZAA 5DVAA 4OP5A 2A49A 1N9OA 1TS7A 4D60A 3V5MA 4DRTA 5CEDA 3LR0A 4GDNA 5HDSA 4JF5A 1OMEA 4KZ3A 4HNBA 4PMAA 3PAEA 3IQAA 4JF4A 4YOFA 1K56D 2WUQA 1HTZA 5HPFA 2PU4A 3IXHA 3BFEA 1H0MA 1S4SA 2KLIA 2Y2QA 4FH2A 5EPHA 3SZTA 4JGPA 4U0TA 1PW1A 4HP4A 2HZ5A 3IF6C 3CWFA 2HP5A 3D3OA 3MFDA 2Y2LA 2ZMFA 3V67A 3UY6A 5J4EA 1L0GA 2Y91A 4WYYA 1OTEA 3A3JA 4E3OA 4GW9A 1TS8A 2QWSA 3HREA 4IVIA 1BTLA 4JXSA 2Y2KA 4UA7A 3FKVA 1S1ZA 5GLAA 5D3OA 5EVIA 2EA9A 3UB8A 3B3XA 5EM1A 1GSVA 1NZOA 1F98A 3A0SA 3RXWA 1ESUA 3T50A 2XEPA 1O7EA 5I94A 2V1BA 1L0FA 1WA9A 2J80A 4HH2A 1GHMA 2X01A 4OQIA 5E2EA 4O01A 3G6OA 5HWWA 1K54A 1G68A 4B93A 4OOYA 1E3UD 5TBMA 1KVLA 1N9LA 1XFQA 4ZJ2A 1VETB 4G3WA 2P04A 1NXYA 4CPKA 4GD8A 1OJ5A 1TEMA 2B18A 3UN7A 2FH5A 1L3LA 3T4LA 1ES4A 3BJNA 4P85A 4IVKA 3BQ8A 3R7WA 1JVJA 1XFNA 5CHMA 2VGKA 5A90A 4WBGA 1V9ZA 1GSWA 3NDGA 4JKTA 4N1HA 2VK3A 2OLUA 2PBYA 4LRZE 4I3IA 4QWOA 1BLPA 3IHBA 4R1GA 1X0OA 5F68A 5HWVA 2O9AA 2EX6A 3UB9A 1M6KA 2G2UA 3EOIA 3G4PA 5KZHA 2V0WA 4ZJ3A 4NXGA 1S0WA 3W4PA 4BLMA 4WUJA 4FTXA 4G3KA 1MKMA 1K6RA 3WS1A 5DJUA 4H6JB 3QHYA 3NI9A 3N8RA 1VB6A 1N4OA 5FA7A 1LI0A 3G35A 1HZOA 2Q9MA 3MSHA 3S7QA 4KQQA 5AVFA 4CLCB 3VP1A 3IWIA 1NLZA 4X25A 3B33A 4RVAA 1JNUA 3OBFA 1ZKJA 5LBRA 2WZZA 1FR1A 5EVID 5F6AA 4I5SA 1K0KA 4DE2A 2GX5A 4N9LA 3ZG9B 2EXBA 4DMZA 3T1SA 2Y79A 2NUTC 1ZHHB 3PHYA 2WGWB 2EX9A 4JLFA 2BG1A 4WZ5C 4S2OA 3NULA 3EEHA 2VKSA 1CK3A 1L2SA 2V8FA 3HLFA 3K2NA 3F1OB 3KSGA 2QJ5A 3N8SA 4NXFA 3IS2B 4LFUA 1P0ZA 4U0XA 5C5KA 1XGIA 3ZCZA 3IF5A 2EX8A 2HDSA 4HESA 4OPYA 1T1AA 2VEAA 1E25A 4ID4A 4BBUA 1SKOB 3C7UA 1CEFA 5CHUA 2V2FF 2VX8A 3LO7A 1YKDA 4MMNA 4FSFA 3WS0A 3HL9A 2ZC5B 3LR5A 3VOLA 3H7WA 2OV5A 4PAUA 5IU1A 3S7NA 1MWSA 1XGJA 3MXRA 4WELA 1PFLA 1ZC2A 3KX0X 4NXBA 2ZMVA 1XPBA 5FSRA 5DKKA 2W1TB 4YNRA 5FATA 3IWQA 1DJAA 3L9KA 1F2KA 4KQOA 1GHPA 3E4OA 1IFQA 1FCNA 4CQHA 4R70A 3F1PA 5A92A 1K4EA 2A3UA 3IH9A 2J3TC 1RGZA 4FD8A 3IXDA 4UEYA 5AVEA 2JE5A 3UE6A 2XFTA 3ZDJA 1MWUA 5CGXA 2W0NA 4FOFA 1VEUA 4OPZA 3MZFA 1YLZA 4OQHA 5FQ9A 1G6AA 3Q1FA 4GLQA 3BM6A 1LSVA 3SOIA 2ZL1B 1DRMA 3FPWA 4HBTA 4L9GA 1G5UA 3W8KA 1NLYA 3CUEA 5AQBA 5IT5A 1KVMA 1N9NA 3KYZA 5DTKA 1K4FA 2EXAA 4LV1A 1L0DA 4IBRA 2EWWA 1UWPX 1ODVA 4IUHA 4KUKA 1F5MA 1IYQA 2IA2A 3IX8A 4PM7A 2QPNA 1D1JA 1W8YA 3DTKA 3Q82A 4MLLA 3NIAA 1KGFA 3SW1A 3M2JA 3FWLA 4FUWA 2Q0OA 3TRCA 2Y2OA 3IT9A 3OCLA 3PTEA 3OPPA 5CX7A 2QKPA 2VGLS 4KQDA 4QY5A 1PI5A 1YLJA 1H5XA 2YKHA 4LCLA 2P74A 3JVVA 4CLCE 3VOYA 3ICYA 2K2NA 5A91A 3VE4A 4MBKA 1XJ6A 4Y15A 3V50A 3ZG8B 5E2GA 5J8XA 1L0EA 3N6IA 1FSWA 3P09A 5IHVA 2R78A 1Y54A 2EFUA 4HIAA 1PWDA 1H8MA 5TR7A 4JF6A 4Q0HA 4O8GA 3DBAA 3IF6B 3KSIA 1K57C 2PDRA 3BFFA 5F83A 1W8QA 5AQ7A 3MBZA 4HJ6A 4NKPA 2PBDP 4EBLA 2UV0E 2OAQ1 5AQ9A 5TGFA 2VV8A 5FQKA 4IHQA 4HBUA 1MY8A 1PRQA 4HHDA 2XK1A 3N8LA 1KDSA 5DKLA 3NY4A 4KUOA 5GLDA 3MR0A 2ZOIA 2XH9A 3QNCA 5DJTA 4WEKA 2Z6CA 4KZ6A 2Y2HA 5FAPA 1TVFA 3CHWP 4PM5A 2PD8A 1YLYA 2GNXA 3GDIA 3VV4A 4UQIM 5AJGA 1WYCA 4OH0A 2W3GA 3I7JA 1YLTA 3BLSA 2R9WA 5EUAA 4RA7A 4HOIA 5EECA 5HX9A 3VOZA 4BD1A 5DF9A 3G2YA 3F1NA 2K7SA 1BT5A 2XROA 1ES3A 4XUXA 4PM8A 1S1YA 1I2WA 3WS5A 4HP9A 4C6YA 4RYEA 2ZQAA 4OONA 3TG9A 4F94A 4JXWA 5KIZA 3MXSA 3RXXA 4HH3A 1T19A 3T4OA 1VHMA 2ZJ9A 5GLBA 3NOUC 1F9IA 4X6TA 1NJ4A 1Y28A 1XJ2A 2J3WA 4R38A 4K91A 3H82B 1BLCA 1UGUA 3LEZA 4S2KA 4R23A 1LL9A 3JVUA 1J9MA 4X55A 3G30A 4MN7A 5E2HA 4X68A 4CLCD 3ZG5A 4QB8A 1PIOA 1W63M 3PBNA 5HDCA 3IHAA 2PU2A 4KZ7A 4DXCA 1O07A 2KX6A 3C5AA 5HD3A 4WLAA 3MQ0A 1Z6FA 4NXEA 4GZBA 5G4ZA 3FZCA 1OT9A 3LEQA 4FCFA 2G2WA 4DXBA 2ZQCA 1IKGA 4JBFA 3RH8B 3WS2A 2CMNA 3SH7A 1YT4A 1K6SA 1KGEA 4R3AA 2Y8HA 1LI9A 1TS0A 3QNBA 3LI9A 3OPLA 2WGIA 3LR3A 1W5DA 1TD5A 3ISGA 2KOIA 2G7UA 4IBXA 1K54C 3VMAA 4O0PA 4BD0A 1Y4OA 3OC2A 3MKFA 3CI6A 4Y5FA 2PYPA 3E2KA 1BUEA 1EROA 2VV6A 1CJFA 5BOHA 3DW0A 4KZ5A 4ESPA 2WYXA 1GA0A 1ACFA 3CMZA 3ULFA 1FOFA 2DCFA 4GHIA 4LLOB 4WM9A 3VSLA 3LR4A 4Y0OA 4LV0A 2FFYA 3UDFA 3DTEA 2VGJA 4KZBA 4OLDA 3Q7VA 3AGEA 1PI4A 4OOMA 1OTBA 5HZHA 1G6OA 4EQIA 2C6WB 3OZHA 4WF0A 1DJBA 1MWRA 4X1MA 3OCNA 2P7JA 3T1XA 1YLPA 2P9VB 2Y2GA 2OAP1 5EM0A 2XRNA 4O7DA 1ES5A 4Z9QA 4D2OA 3LUQA 2WKHA 3PBOA 4XT2A 5MC7A 4F3LB 3WRTA 3Q07A 3C4OA 3C30A 1W63Q 1IYOA 3CZDA 2ZLYA 4UA9A 3W2ZA 3LIDA 1YPRA 2ZBBA 4NG2A 3CPTB 3NC8A 4JGOA 1LSWA 3G31A 3S1YA 2D01A 4GOGA 4IJGA 4L9EA 3C2WA 4X53A 3RJUA 2EWVA 3VFHA 3V3SA 3LY3A 2W27A 3E0YA 1WYBA 2JKTI 3HLWA 1OTIA 3T4KA 2OLVA 5F82A 1TDGA 3W4OA 2UWXA 3EGDC 4DF6A 4BMWA 4OOLA 4GS9B 3N4IA 3LIFA 4KZ8A 1CI8A 4BJPA 3CG5A 1ES2A 1VM1A 4KG5A 4MN6A 1IOUA 5DF8A 2ZM2A 4UHUA 3BRMA 4PPRA 3PR6A 1YLWA 3PBQA 1WE4A 4GB7A 4E6WA 1T18A 1PZPA 3C7VA 3ZNYA 4MCWA 5DTTA 5DF7A 4XUZA 4S2PA 1ESIA 4KG6A 5HAIA 2PR5A 1PNEA 3NOPC 1Q2QA 5G4YA 1J3WA 3HVFA 4PKYA 3ZYTA 3T1QB 4GN2A 4LV3A 2Y2IA 4KG2A 4EESA 1PWGA 2PD7A 3BY8A 2ZC7A 3A3IA 5A93A 2XDMA 1STZA 3ZQ5A 5J7EA 3DWKA 3EGXC 4NK3A 5FDSA 4Y3IA 3UO9A 2M7VA 4M4XA 1OPXA 1C3BA 3LY4A 3W4QA 2ACGA 2OWHA 5DFYA 3G34A 1MC0A 1MXOA 1OT6A 5DFXA 4ZRRA 2OSUA 3QP2A 4C75A 5FQIA 1H8YA 1NZUA 2BTFP 5GHXA 4ARZA 4I38A 4YFMA 3UDIA 4Y0UA 3UE3A 3QP4A 4HJ3A 4NEED 3ZHHA 2QZ6A 3K3CA 2JKGA 3FYZA 3BWLA 4I3JA 5EOOA 1VQQA 5F1FA 2FFFB 1S6RA 4OPQA 4OQGA 3HUMA 1ERQA 4U3TA 2Y59A 3S4XA 4UAAA 1EWZA 1JWPA 3PAGA 2H10A 3LI8A 3DTMA 2XD5A 4HI4A 3CUEC 4L0LA 1MZUA 4Z1WA 2XR0A 1LL8A 3C38A 3FV7A 5TJJA 3U4LP 3G32A 2H5SA 3VFFA 1LSXA 3MF0A 5E2FA 4X56A 3RFBA 2W3FA 2A24B 3OLOA 3AGDA 5EVLA 3IXGA 1XJ4A
chains in the Genus database with same CATH topology
3LICA 4RQ9A 2V1BA 4HOIA 1WA9A 2J80A 2XA7M 4HH2A 3UMEA 3HJIA 5DF9A 1YAXA 5IS1A 3HJKA 2L4RA 3F1NA 3U2AA 1T1BA 2K7SA 4GCZA 4O01A 2MJ6A 2B02A 2XROA 3G6OA 5HWWA 1S1YA 4B93A 4HP9A 1NRJA 1S4RA 3PXPA 2OWJA 4I3AA 5TBMA 5KIZA 4CLCA 1GSXA 3E4QA 4HH3A 2OOLA 2M7UA 1N9LA 1T19A 1XFQA 1V9YA 3T4OA 1VHMA 3NOUC 3CAXA 5HL6A 1F9IA 4G3WA 4LRYC 2V9AA 4QPRA 1Y28A 1XJ2A 2J3WA 2P04A 4R38A 3TE8A 3H82B 1UGUA 1OJ5A 3BY9A 2B18A 2QJ7A 4EUVA 2FH5A 2K31A 3JVUA 2O9CA 4MN7A 3T4LA 2GJ3A 3BJNA 4CLCD 3FC7A 1KOUA 3BQ8A 3H9WA 3R7WA 5F5YA 3KSHA 4EU0A 4EW7A 2O0YA 5HD5A 1W63M 1XFNA 4GJ4A 2VGLM 3PBNA 1V9ZA 5HDCA 3P7NA 1GSWA 4LRZE 2KX6A 2W1RA 4I3IA 4LRXC 5HD3A 4WLAA 3HCYA 4Q0IA 3MQ0A 3R4KA 2P08A 3T4QA 4EXOA 1X0OA 4NXEA 4EQ1A 3F1OA 3E4PA 5F68A 5G4ZA 3RTYA 5HWVA 2O9AA 1OT9A 3T4TA 3UB9A 1S67L 2XSSA 3IS2A 3EOIA 2ZOHA 3E98A 2M1CA 2V0UA 2V0WA 3FPVA 4NXGA 4P6ZM 3RH8B 2INWA 3NOTC 2CMNA 3D72A 3LFVA 3OOVA 1TF1A 4WUJA 3MMHA 4G3KA 1MKMA 2YKFA 4R3AA 3VE3A 2Y8HA 3F1NB 1TS0A 3LIBA 4F3LA 3LIAA 3LI9A 3MFXA 4H6JB 5DJUA 3LR3A 1TD5A 1XJ3A 1VB6A 2KOIA 2LB9A 4B9OA 2G7UA 2PT7A 1EW0A 4O0PA 3OC2A 3S7QA 5TBMB 5AVFA 4CLCB 3CI6A 4YWZA 4Y5FA 1NLZA 2PYPA 4JGRA 4CLCC 3B33A 3LYXA 3UB6A 1JNUA 3OBFA 2W1TA 3S7PA 3KYQA 1DP8A 2GZAA 4UQIS 5LBRA 2VV6A 3EQVA 5F6AA 5J3WA 4I5SA 4HQAA 4I39A 2GX5A 2QYBA 2HJEA 4DMZA 2XA7S 2Y79A 4H6JA 4BBVA 2JKTM 3ULFA 2NUTC 1ZHHB 3O5YA 3PHYA 4GHIA 4LLOB 3LR4A 2H28A 3R7WB 3CITA 2HGVA 5KSHA 1TS6A 1D06A 3PBSA 4MDZA 3EEHA 2VKSA 2JKRM 3KSFA 2FZ0A 2D02A 4DN0A 4GS9A 4II7A 4WEJA 3NHQA 4OOMA 2JHEA 4L9FA 2PHYA 5K5BA 1OTBA 5HZHA 2KDKA 1G6OA 2VV7A 4MN5A 4HY8A 3K2NA 3F1OB 2NUPC 1H3QA 2A2LA 3KSGA 2QJ5A 2J3TD 3P01A 4NXFA 1UWNX 3IS2B 4WF0A 1P0ZA 5C5KA 3OCNA 2P7JA 4WN5A 3EWKA 4PKYG 2V1AA 5HSQA 5HPIA 1YSPA 2OAP1 3T4SA 2XRNA 3T4JA 3LUQA 4JGQA 1T1AA 3PBOA 2O9BA 2VEAA 2HF6A 4BBUA 4XT2A 1OTDA 5MC7A 3LIEA 4F3LB 2VX8A 2VA0A 1YKDA 4MMNA 3MXQA 4FSFA 1OTAA 3C30A 4ME4A 4DJ2A 3LR5A 3VOLA 3H7WA 1W63Q 3W2ZA 3LIDA 4PAUA 2W3EA 3NJAA 5IU1A 3S7NA 2ZBBA 4BBTA 2WKPA 4WELA 3KX0X 1DP6A 4NXBA 2ZMVA 2L0WA 4JGOA 1LSWA 1LT0A 5DKKA 2D01A 2W1TB 3MJQA 2Z6DA 4YNRA 4IJGA 4L9EA 3C2WA 1NWZA 4P6ZS 2EWVA 4KQOA 3BW6A 3E4OA 2W27A 3E0YA 1P9WA 2JKTI 1IFQA 5EFWA 1OTIA 1BYWA 3T4KA 4CQHA 4GHIB 4EEPA 4R70A 3TJZC 3F1PA 5HWTA 2VLGA 3IBJA 3EGDC 1P9RA 3MQQA 2JKRI 5L8MA 3GECA 4BMWA 4LPZA 2VZWA 4OOLA 2J3TC 4ETXA 3C8CA 4GS9B 3TW8A 1ZTUA 3S7OA 3LIFA 4UEYA 5AVEA 3UE6A 4BJPA 2I9VA 3K3DA 3EEAA 2W0NA 4FOFA 2O99A 4MN6A 4Y2FA 1IOUA 1YSQA 2VJWA 3PR6A 4GLQA 4BWIA 1LSVA 3PBQA 1DRMA 1S66L 1T18A 2JN7A 3FPWA 4MCWA 4K08A 2W3HA 2PR6A 4EERA 4L9GA 3UMDA 1D7EA 1NLYA 3CUEA 4XT2B 4ETZA 2PR5A 3B42A 5IT5A 1N9NA 2PYRA 3NOPC 5G4YA 3KYZA 1DP9A 3PBRA 4PHTA 4PKYA 3ZYTA 3CLOA 3A0RA 4DJ3A 3H7WB 3FG8A 5HDDA 2EWWA 3MQOA 1UWPX 1ODVA 4IUHA 4KUKA 4EESA 3IBRA 2PD7A 1F5MA 3BY8A 2IA2A 2QHKA 3UB7A 3EQUA 4ARZB 1STZA 1T1CA 3ZQ5A 4R6LA 1P97A 3PYPA 3SW1A 2HJ9C 2A24A 5J7EA 3TRCA 3BQAA 3EGXC 3OCLA 4EEUA 4Y3IA 5A8BA 4G3VA 5CX7A 2QKPA 2VGLS 1G28A 2M7VA 4KQDA 2WKQA 4M4XA 1OPXA 2YKHA 1N9OA 3JVVA 4EETB 1TS7A 2OWHA 3F1PB 4CLCE 5DFYA 3ICYA 1MC0A 1OT6A 2K2NA 3LR0A 5HDSA 3VE4A 5DFXA 4HNBA 3KO6A 4ZRRA 1XJ6A 4ARZA 4YOFA 4I38A 1OJGA 4IUKA 5FL3A 3UE3A 4HJ3A 5HPFA 4NEED 4AFIA 2R78A 4HIAA 1H8MA 1S4SA 3K3CA 4WL9A 4Q0HA 2LB5A 2KLIA 3DBAA 3H82A 4O8GA 3KSIA 3BWLA 4JGPA 2PDRA 4I3JA 4HP4A 4HJ4A 2L1MA 4HJ6A 4NKPA 3CWFA 3D3OA 2OAQ1 2ZMFA 3V67A 2W3DA 5J4EA 2VV8A 4IHQA 1OTEA 2HV1A 2WKRA 5I5LA 4HHDA 4GW9A 1TS8A 2QWSA 3LI8A 5DKLA 3B47A 4HI4A 4KUOA 4E04A 3CUEC 3PBTA 4L0LA 1MZUA 3MR0A 2ZOIA 4Z1WA 5DJTA 1LL8A 4WEKA 2Z6CA 3C38A 1S1ZA 5TJJA 2EA9A 5F69A 2DMWA 2PD8A 3UB8A 4Q0JA 3A0VA 1LSXA 1GSVA 3MF0A 1F98A 2GNXA 3A0SA 3GDIA 3RFBA 3VV4A 2BASA 4UQIM 2W3FA 5AJGA 2A24B 2W3GA 3OLOA 3T50A 1XJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIC A;  4RQ9 A;  2V1B A;  4HOI A;  1WA9 A;  2J80 A;  4HH2 A;  3UME A;  3HJI A;  5IS1 A;  3HJK A;  2L4R A;  3F1N A;  1T1B A;  2K7S A;  4GCZ A;  2B02 A;  3G6O A;  5HWW A;  1S1Y A;  4HP9 A;  1S4R A;  2OWJ A;  4I3A A;  5TBM A;  5KIZ A;  1GSX A;  3E4Q A;  4HH3 A;  2OOL A;  1N9L A;  1T19 A;  1XFQ A;  1V9Y A;  3NOU C;  3CAX A;  1F9I A;  4LRY C;  2V9A A;  1Y28 A;  1XJ2 A;  4R38 A;  3H82 B;  1UGU A;  1OJ5 A;  3BY9 A;  2QJ7 A;  2GJ3 A;  3FC7 A;  1KOU A;  3H9W A;  5F5Y A;  4EW7 A;  5HD5 A;  1XFN A;  1V9Z A;  5HDC A;  3P7N A;  1GSW A;  4LRZ E;  2KX6 A;  4I3I A;  4LRX C;  5HD3 A;  4WLA A;  4EXO A;  1X0O A;  4NXE A;  4EQ1 A;  3F1O A;  3E4P A;  5F68 A;  5G4Z A;  3RTY A;  5HWV A;  1OT9 A;  3UB9 A;  1S67 L;  3IS2 A;  2ZOH A;  2M1C A;  2V0U A;  2V0W A;  4NXG A;  3RH8 B;  2INW A;  3NOT C;  2CMN A;  3D72 A;  4WUJ A;  2YKF A;  4R3A A;  3VE3 A;  3F1N B;  1TS0 A;  3LIB A;  4F3L A;  3LIA A;  3LI9 A;  3MFX A;  4H6J B;  5DJU A;  1XJ3 A;  1VB6 A;  4B9O A;  1EW0 A;  5TBM B;  5AVF A;  4YWZ A;  2PYP A;  4JGR A;  3B33 A;  3LYX A;  3UB6 A;  1JNU A;  1DP8 A;  2VV6 A;  5F6A A;  5J3W A;  4I5S A;  4HQA A;  4I39 A;  4H6J A;  4BBV A;  3ULF A;  3PHY A;  4GHI A;  4LLO B;  2H28 A;  1TS6 A;  1D06 A;  3EEH A;  2D02 A;  4GS9 A;  3NHQ A;  2JHE A;  4L9F A;  2PHY A;  1OTB A;  5HZH A;  2KDK A;  2VV7 A;  4MN5 A;  4HY8 A;  3F1O B;  2QJ5 A;  4NXF A;  1UWN X;  3IS2 B;  4WF0 A;  1P0Z A;  2P7J A;  4WN5 A;  3EWK A;  4PKY G;  2V1A A;  5HSQ A;  3LUQ A;  4JGQ A;  1T1A A;  2VEA A;  4BBU A;  4XT2 A;  1OTD A;  3LIE A;  4F3L B;  3MXQ A;  1OTA A;  4DJ2 A;  3VOL A;  3H7W A;  3LID A;  3NJA A;  5IU1 A;  2ZBB A;  4BBT A;  2WKP A;  3KX0 X;  1DP6 A;  4NXB A;  2L0W A;  4JGO A;  1LSW A;  1LT0 A;  5DKK A;  2D01 A;  3MJQ A;  2Z6D A;  4L9E A;  3C2W A;  1NWZ A;  3E4O A;  2W27 A;  5EFW A;  1OTI A;  1BYW A;  4GHI B;  4EEP A;  4R70 A;  3F1P A;  5HWT A;  2VLG A;  3MQQ A;  3GEC A;  4LPZ A;  3C8C A;  4GS9 B;  3LIF A;  5AVE A;  3UE6 A;  2I9V A;  3K3D A;  2W0N A;  4MN6 A;  1LSV A;  1DRM A;  1S66 L;  1T18 A;  2JN7 A;  4K08 A;  2PR6 A;  4EER A;  4L9G A;  3UMD A;  1D7E A;  4XT2 B;  2PR5 A;  1N9N A;  2PYR A;  3NOP C;  5G4Y A;  1DP9 A;  4PKY A;  3A0R A;  3CLO A;  4DJ3 A;  3H7W B;  3FG8 A;  5HDD A;  3MQO A;  1UWP X;  1ODV A;  4KUK A;  4EES A;  3IBR A;  2PD7 A;  3BY8 A;  2QHK A;  3UB7 A;  1T1C A;  3ZQ5 A;  4R6L A;  1P97 A;  3PYP A;  3SW1 A;  2A24 A;  5J7E A;  4EEU A;  5A8B A;  2QKP A;  1G28 A;  4KQD A;  2WKQ A;  4M4X A;  2YKH A;  1N9O A;  4EET B;  1TS7 A;  2OWH A;  3F1P B;  3ICY A;  1OT6 A;  3VE4 A;  5HDS A;  4HNB A;  1XJ6 A;  4I38 A;  1OJG A;  4HJ3 A;  2R78 A;  4HIA A;  1S4S A;  3K3C A;  4WL9 A;  3H82 A;  3BWL A;  4JGP A;  2PDR A;  4I3J A;  4HP4 A;  4HJ4 A;  2L1M A;  4HJ6 A;  3CWF A;  5J4E A;  2VV8 A;  1OTE A;  2HV1 A;  2WKR A;  5I5L A;  4HHD A;  4GW9 A;  1TS8 A;  2QWS A;  3LI8 A;  5DKL A;  4HI4 A;  4KUO A;  4E04 A;  1MZU A;  3MR0 A;  2ZOI A;  5DJT A;  1LL8 A;  2Z6C A;  1S1Z A;  2EA9 A;  5F69 A;  2PD8 A;  3UB8 A;  3A0V A;  1LSX A;  1GSV A;  1F98 A;  3A0S A;  3GDI A;  2BAS A;  2A24 B;  3OLO A;  3T50 A;  1XJ4 A; 
#chains in the Genus database with same CATH topology
 1A0K A;  1CEG A;  4RQ9 A;  1JWV A;  4QU3 A;  2XA7 M;  3C4P A;  4RX2 A;  1KE3 A;  3HJI A;  5IS1 A;  2L4R A;  4N1X A;  3U2A A;  1T1B A;  5GHZ A;  3SH8 A;  1NYM A;  2B02 A;  2MJ6 A;  1XA7 A;  4E3I A;  2ZQ8 A;  5DTS A;  5GHY A;  3D4F A;  4A5R A;  2Y2M A;  3DAV A;  1S4R A;  2E8J A;  3PXP A;  5FEG A;  4CLC A;  2ZQ7 A;  1RGY A;  5HL6 A;  2IWB A;  2V9A A;  3GMW A;  3MZD A;  5L10 A;  3SH9 A;  3TE8 A;  2WZX A;  5JYO A;  3BY9 A;  1GHI A;  2QJ7 A;  4S2M A;  2K31 A;  1IEM A;  2O9C A;  2GJ3 A;  4BQM A;  3ZVT A;  5FAS A;  3FC7 A;  2B5R A;  1HVB A;  2WGW A;  3UPO A;  3ITB A;  1GA9 A;  5F5Y A;  4YIN A;  3IWO A;  4EU0 A;  2O0Y A;  5HD5 A;  4EW7 A;  2QMI A;  2VGL M;  1ERM A;  3JYI A;  1PWC A;  2Q9N A;  4GDB A;  2C5W B;  4Q0I A;  5EVI B;  3R4K A;  2P08 A;  3GVB A;  3T1R A;  1BLH A;  4EXO A;  2RCX A;  4R4R A;  3F1O A;  3BLM A;  5F1G A;  3BYD A;  1H8Z A;  2Y2P A;  1FQG A;  4UA6 A;  5L2F A;  2XSS A;  3IS2 A;  2ZOH A;  1ONG A;  2M1C A;  3TSG A;  1YMS A;  1TDL A;  4QY6 A;  4P6Z M;  1K55 C;  3UE1 A;  3LFV A;  2Y55 A;  3MMH A;  1SKO A;  2YKF A;  2ZQD A;  5KMW A;  3LIA A;  3UDX A;  5HW3 A;  4S2N C;  4KEN B;  2LB9 A;  3LGO A;  2HP6 A;  4B9O A;  2PT7 A;  2Y2N A;  4QD4 A;  1XP4 A;  1RCJ A;  5CEC A;  5TBM B;  4DE3 A;  4YWZ A;  2ZM0 A;  3G2Z A;  2AVX A;  3LYX A;  3UB6 A;  2W1T A;  3P98 A;  4UQI S;  4X1L A;  4R3B A;  5J3W A;  5L09 A;  4P87 A;  4HQA A;  1K38 A;  4I39 A;  2HJE A;  1EI5 A;  3HLE A;  5FAQ A;  2JKT M;  3HLG A;  3DWZ A;  3R7W B;  2HGV A;  2PAV P;  1N9B A;  3FKW A;  5CER A;  3KSF A;  5CTN A;  1BLS A;  1MKI A;  2Z2M B;  3NHQ A;  2JHE A;  4L9F A;  3IXB A;  2VV7 A;  5FI2 A;  1ZG4 A;  4MN5 A;  4HY8 A;  3BEC A;  3ZFZ A;  1H3Q A;  4Y0T A;  2J3T D;  3P01 A;  4EUZ A;  2V8C A;  1BSG A;  2ZL1 A;  2GDN A;  4LCM A;  4WN5 A;  3EWK A;  2V1A A;  4ZBE A;  5HPI A;  3T4S A;  3NCK A;  1M40 A;  3T4J A;  4JGQ A;  2O9B A;  2HF6 A;  4S2J A;  1OTD A;  5HAP A;  2JCH A;  2PRF A;  2J7V A;  4ME4 A;  3ZNT A;  4S2I A;  5EVI C;  4MEZ A;  3NJA A;  2HP9 A;  5CXW A;  1HLU P;  5G18 A;  4BBT A;  4B4Z A;  4EWF A;  2J8Y A;  4LEN A;  2L0W A;  1PYY A;  2ZM8 A;  3MJQ A;  2Z6D A;  4E3N A;  4GNU A;  4BL2 A;  1W7F A;  1DJC A;  1YQS A;  3GRJ A;  4OVD A;  3BW6 A;  2ZC3 B;  4JXV A;  4EV4 A;  1P9W A;  2X02 A;  2X71 A;  5HAR A;  4EEP A;  5HWT A;  2VLG A;  3IBJ A;  1KGG A;  3MQQ A;  1P9R A;  2JKR I;  3VP2 A;  3NEC A;  4LPZ A;  3NBL A;  3O87 A;  3TW8 A;  1ZTU A;  3S7O A;  4FH4 A;  2I9V A;  2JC7 A;  2WKE A;  5FDH A;  3VP4 A;  3T12 B;  4EBN A;  4Y2F A;  5CRF A;  5KSC A;  3IF6 A;  4N92 A;  1U60 A;  1BZA A;  1S66 L;  2JN7 A;  2ZMA A;  4WMC A;  4BEN A;  4MBF A;  1IEL A;  4K08 A;  1PZO A;  2W3H A;  4EER A;  2WKI A;  4R4S A;  5AQA A;  4PM6 A;  3UPP A;  3PBR A;  4PHT A;  1FCM A;  3HLC A;  3CLO A;  4DJ3 A;  3H7W B;  3FG8 A;  5HDD A;  3MQO A;  3UB5 P;  1MPL A;  5FAO A;  4ARZ B;  1T1C A;  2BLS A;  4X69 A;  4R6L A;  3ZVW A;  2HJ9 C;  5CTM A;  1GCE A;  3BQA A;  1PW8 A;  1G28 A;  1AXB A;  3AGF A;  2WKQ A;  3QP5 A;  2WAE A;  3TOI A;  2WGV A;  1I2S A;  4EET B;  3F1P B;  3M2K A;  5CGS A;  1CQA A;  3KO6 A;  5HL1 A;  4GD6 A;  1NYY A;  3NDE A;  1YM1 A;  1OJG A;  3MS6 A;  4IUK A;  5TFQ A;  2HDQ A;  5FL3 A;  1RP5 A;  4MNR A;  4AFI A;  1K25 A;  1VEU B;  3DTI A;  1QME A;  4WL9 A;  4K0X A;  2LB5 A;  3H82 A;  3GSG A;  4DE1 A;  3GTC A;  2JBF A;  4HJ4 A;  2L1M A;  5CEB A;  4Y17 A;  2W3D A;  2XQZ A;  3IH8 A;  2HV1 A;  2WKR A;  5I5L A;  3QP6 A;  2XGN A;  2E8I A;  2H0Y A;  3B47 A;  1CF0 A;  4B4X A;  4E04 A;  3PBT A;  4WZ4 A;  3SS4 A;  1MWT A;  1ZG6 A;  4NET A;  3UNW A;  2I72 A;  5F69 A;  2DMW A;  3HLB A;  4Q0J A;  3A0V A;  4S2L A;  1FSY A;  4E6X A;  1CI9 A;  2BAS A;  2CC1 A;  3BFD A;  4E3J A;  2R9X A;  5CGW A;  2HDR A;  1XX2 A;  3LIC A;  1NY0 A;  3ITA A;  3OPH A;  3LCE A;  3UME A;  3VP0 A;  1YAX A;  3M6H A;  3WRZ A;  3HJK A;  1IKI A;  4GCZ A;  3O86 A;  1XKZ A;  3Q81 A;  4DKI A;  4XXR A;  2XD1 A;  5EE8 A;  3UPN A;  2B95 A;  4WMC D;  2RL3 A;  3WWX A;  5HFO A;  1NRJ A;  4BL3 A;  2OWJ A;  3VSK A;  4I3A A;  4JPM A;  1GSX A;  4OLG A;  3E4Q A;  5EOE A;  2OOL A;  2M7U A;  1V9Y A;  1LL5 A;  3CAX A;  3A3D A;  2Y4A A;  4LRY C;  1FCO A;  1HD8 A;  2WAF A;  3GV9 A;  4QPR A;  5E43 A;  2HDU A;  3QP1 A;  1XA1 A;  1IYS A;  5CHJ A;  5EVE A;  4EUV A;  1XXM A;  3IX4 A;  1SKF A;  1AWI A;  3BFC A;  2ZQ9 A;  1KOU A;  4M3K A;  4WZ5 A;  3H9W A;  3KSH A;  3BFG A;  1ONH A;  4GJ4 A;  3ZG0 A;  5FQQ A;  4HEF A;  1SCW A;  4OQ0 A;  1I5Q A;  3P7N A;  3HUN A;  2W1R A;  1VET A;  4LRX C;  3HCY A;  2Z2L B;  3T4Q A;  4EQ1 A;  4E3K A;  3E4P A;  5M18 A;  3RTY A;  2J9P A;  3T4T A;  4OKP A;  1S67 L;  3E98 A;  4P0M A;  3MKE A;  2V0U A;  3BEB A;  4CJN A;  2DRW A;  2P9V A;  3OPR A;  3FPV A;  2XF3 A;  2INW A;  3NOT C;  3D72 A;  3JPU A;  3OOV A;  1TF1 A;  4OP8 A;  3VE3 A;  3F1N B;  3LIB A;  4F3L A;  5EV0 A;  3V39 A;  3MFX A;  3O3V A;  2IWD A;  4N9K A;  4B88 A;  1XJ3 A;  4E3L A;  4R0Q A;  1DY6 A;  5M1A A;  1EW0 A;  4Y7P A;  4P6B A;  3UE0 A;  3CPT A;  4JGR A;  4CLC C;  1QMF A;  3S7P A;  3HBR A;  3KYQ A;  5U47 A;  4Q8I A;  1DP8 A;  2GZA A;  2EX2 A;  3EQV A;  4OPR A;  4H8R A;  2QYB A;  3L7H A;  2XA7 S;  4ZJ1 A;  4H6J A;  1Z09 A;  3HUO A;  4KZ4 A;  4BBV A;  1MBL A;  3O5Y A;  3A3E A;  3Q7Z A;  2H28 A;  3CIT A;  5KSH A;  1YMX A;  1TS6 A;  4RX3 A;  3GR2 A;  1D06 A;  3PBS A;  4MDZ A;  2JKR M;  2FZ0 A;  1KDW A;  2WAD A;  3A3F A;  2D02 A;  4EBP A;  4DN0 A;  4GS9 A;  4II7 A;  2XFS A;  4WEJ A;  5L07 A;  2PHY A;  5K5B A;  1ALQ A;  2KDK A;  4DDS A;  1IYP A;  2NUP C;  2A2L A;  3HLD A;  3SS5 A;  1UWN X;  3MZE A;  1NRF A;  4PKY G;  4C3Q A;  3V3R A;  5HSQ A;  1YSP A;  4E3M A;  2WK0 A;  3CJM A;  5FQJ A;  3LIE A;  1K56 A;  3IX3 A;  2VA0 A;  3MXQ A;  1OTA A;  1FIL A;  4QHC A;  4DJ2 A;  4ZTK A;  3ZG7 B;  4LGW A;  4ZDX A;  2W3E A;  4KZ9 A;  2Y2J A;  4DDY A;  5FI6 A;  2WKP A;  2V1Z A;  1DP6 A;  1LT0 A;  3WS4 A;  2ZC6 B;  3D9Y A;  3SS3 A;  4QJG A;  3E2L A;  4ZAM A;  1NWZ A;  3N7W A;  2JKF A;  4P6Z S;  4MBH A;  5FQM A;  1FIK A;  5EFW A;  1KE4 A;  1BYW A;  1SHV A;  3KYE A;  4GHI B;  3TJZ C;  4KQR A;  2IWC A;  5L8M A;  3GEC A;  1FR6 A;  1JWZ A;  5FI7 A;  2VZW A;  4ETX A;  3C8C A;  3Q7V B;  4JXG A;  3ZGA B;  3K3D A;  1JTD A;  3EEA A;  1SZV A;  4K0W A;  5M19 A;  5GL9 A;  1W79 A;  1K57 A;  2O99 A;  4R3J A;  1YSQ A;  2VJW A;  3S22 A;  1JTG A;  4DE0 A;  4BWI A;  4GKU A;  5HAQ A;  3VP3 A;  1Q2P A;  1K55 A;  1E3U A;  2PR6 A;  1SDN A;  1BUL A;  2XLN A;  3QP8 A;  3UMD A;  1D7E A;  4XT2 B;  4ETZ A;  2EFX A;  3B42 A;  2PYR A;  2J9O A;  4S2N A;  1DP9 A;  2H0T A;  1SDE A;  3A0R A;  1KE0 A;  5JYP A;  4PM9 A;  3O88 A;  3M6B A;  3IBR A;  1LHY A;  2QHK A;  3GQZ A;  4LV2 A;  3UB7 A;  3EQU A;  2DNS A;  2ZD8 A;  5FEF A;  1P97 A;  3PYP A;  1E4D A;  2A24 A;  5GLC A;  1LLB A;  2ZC4 B;  4EEU A;  2HPB A;  5A8B A;  4IED A;  4Y13 A;  4G3V A;  2V20 A;  4KZA A;  5DVA A;  4OP5 A;  2A49 A;  1N9O A;  1TS7 A;  4D60 A;  3V5M A;  4DRT A;  5CED A;  3LR0 A;  4GDN A;  5HDS A;  4JF5 A;  1OME A;  4KZ3 A;  4HNB A;  4PMA A;  3PAE A;  3IQA A;  4JF4 A;  4YOF A;  1K56 D;  2WUQ A;  1HTZ A;  5HPF A;  2PU4 A;  3IXH A;  3BFE A;  1H0M A;  1S4S A;  2KLI A;  2Y2Q A;  4FH2 A;  5EPH A;  3SZT A;  4JGP A;  4U0T A;  1PW1 A;  4HP4 A;  2HZ5 A;  3IF6 C;  3CWF A;  2HP5 A;  3D3O A;  3MFD A;  2Y2L A;  2ZMF A;  3V67 A;  3UY6 A;  5J4E A;  1L0G A;  2Y91 A;  4WYY A;  1OTE A;  3A3J A;  4E3O A;  4GW9 A;  1TS8 A;  2QWS A;  3HRE A;  4IVI A;  1BTL A;  4JXS A;  2Y2K A;  4UA7 A;  3FKV A;  1S1Z A;  5GLA A;  5D3O A;  5EVI A;  2EA9 A;  3UB8 A;  3B3X A;  5EM1 A;  1GSV A;  1NZO A;  1F98 A;  3A0S A;  3RXW A;  1ESU A;  3T50 A;  2XEP A;  1O7E A;  5I94 A;  2V1B A;  1L0F A;  1WA9 A;  2J80 A;  4HH2 A;  1GHM A;  2X01 A;  4OQI A;  5E2E A;  4O01 A;  3G6O A;  5HWW A;  1K54 A;  1G68 A;  4B93 A;  4OOY A;  1E3U D;  5TBM A;  1KVL A;  1N9L A;  1XFQ A;  4ZJ2 A;  1VET B;  4G3W A;  2P04 A;  1NXY A;  4CPK A;  4GD8 A;  1OJ5 A;  1TEM A;  2B18 A;  3UN7 A;  2FH5 A;  1L3L A;  3T4L A;  1ES4 A;  3BJN A;  4P85 A;  4IVK A;  3BQ8 A;  3R7W A;  1JVJ A;  1XFN A;  5CHM A;  2VGK A;  5A90 A;  4WBG A;  1V9Z A;  1GSW A;  3NDG A;  4JKT A;  4N1H A;  2VK3 A;  2OLU A;  2PBY A;  4LRZ E;  4I3I A;  4QWO A;  1BLP A;  3IHB A;  4R1G A;  1X0O A;  5F68 A;  5HWV A;  2O9A A;  2EX6 A;  3UB9 A;  1M6K A;  2G2U A;  3EOI A;  3G4P A;  5KZH A;  2V0W A;  4ZJ3 A;  4NXG A;  1S0W A;  3W4P A;  4BLM A;  4WUJ A;  4FTX A;  4G3K A;  1MKM A;  1K6R A;  3WS1 A;  5DJU A;  4H6J B;  3QHY A;  3NI9 A;  3N8R A;  1VB6 A;  1N4O A;  5FA7 A;  1LI0 A;  3G35 A;  1HZO A;  2Q9M A;  3MSH A;  3S7Q A;  4KQQ A;  5AVF A;  4CLC B;  3VP1 A;  3IWI A;  1NLZ A;  4X25 A;  3B33 A;  4RVA A;  1JNU A;  3OBF A;  1ZKJ A;  5LBR A;  2WZZ A;  1FR1 A;  5EVI D;  5F6A A;  4I5S A;  1K0K A;  4DE2 A;  2GX5 A;  4N9L A;  3ZG9 B;  2EXB A;  4DMZ A;  3T1S A;  2Y79 A;  2NUT C;  1ZHH B;  3PHY A;  2WGW B;  2EX9 A;  4JLF A;  2BG1 A;  4WZ5 C;  4S2O A;  3NUL A;  3EEH A;  2VKS A;  1CK3 A;  1L2S A;  2V8F A;  3HLF A;  3K2N A;  3F1O B;  3KSG A;  2QJ5 A;  3N8S A;  4NXF A;  3IS2 B;  4LFU A;  1P0Z A;  4U0X A;  5C5K A;  1XGI A;  3ZCZ A;  3IF5 A;  2EX8 A;  2HDS A;  4HES A;  4OPY A;  1T1A A;  2VEA A;  1E25 A;  4ID4 A;  4BBU A;  1SKO B;  3C7U A;  1CEF A;  5CHU A;  2V2F F;  2VX8 A;  3LO7 A;  1YKD A;  4MMN A;  4FSF A;  3WS0 A;  3HL9 A;  2ZC5 B;  3LR5 A;  3VOL A;  3H7W A;  2OV5 A;  4PAU A;  5IU1 A;  3S7N A;  1MWS A;  1XGJ A;  3MXR A;  4WEL A;  1PFL A;  1ZC2 A;  3KX0 X;  4NXB A;  2ZMV A;  1XPB A;  5FSR A;  5DKK A;  2W1T B;  4YNR A;  5FAT A;  3IWQ A;  1DJA A;  3L9K A;  1F2K A;  4KQO A;  1GHP A;  3E4O A;  1IFQ A;  1FCN A;  4CQH A;  4R70 A;  3F1P A;  5A92 A;  1K4E A;  2A3U A;  3IH9 A;  2J3T C;  1RGZ A;  4FD8 A;  3IXD A;  4UEY A;  5AVE A;  2JE5 A;  3UE6 A;  2XFT A;  3ZDJ A;  1MWU A;  5CGX A;  2W0N A;  4FOF A;  1VEU A;  4OPZ A;  3MZF A;  1YLZ A;  4OQH A;  5FQ9 A;  1G6A A;  3Q1F A;  4GLQ A;  3BM6 A;  1LSV A;  3SOI A;  2ZL1 B;  1DRM A;  3FPW A;  4HBT A;  4L9G A;  1G5U A;  3W8K A;  1NLY A;  3CUE A;  5AQB A;  5IT5 A;  1KVM A;  1N9N A;  3KYZ A;  5DTK A;  1K4F A;  2EXA A;  4LV1 A;  1L0D A;  4IBR A;  2EWW A;  1UWP X;  1ODV A;  4IUH A;  4KUK A;  1F5M A;  1IYQ A;  2IA2 A;  3IX8 A;  4PM7 A;  2QPN A;  1D1J A;  1W8Y A;  3DTK A;  3Q82 A;  4MLL A;  3NIA A;  1KGF A;  3SW1 A;  3M2J A;  3FWL A;  4FUW A;  2Q0O A;  3TRC A;  2Y2O A;  3IT9 A;  3OCL A;  3PTE A;  3OPP A;  5CX7 A;  2QKP A;  2VGL S;  4KQD A;  4QY5 A;  1PI5 A;  1YLJ A;  1H5X A;  2YKH A;  4LCL A;  2P74 A;  3JVV A;  4CLC E;  3VOY A;  3ICY A;  2K2N A;  5A91 A;  3VE4 A;  4MBK A;  1XJ6 A;  4Y15 A;  3V50 A;  3ZG8 B;  5E2G A;  5J8X A;  1L0E A;  3N6I A;  1FSW A;  3P09 A;  5IHV A;  2R78 A;  1Y54 A;  2EFU A;  4HIA A;  1PWD A;  1H8M A;  5TR7 A;  4JF6 A;  4Q0H A;  4O8G A;  3DBA A;  3IF6 B;  3KSI A;  1K57 C;  2PDR A;  3BFF A;  5F83 A;  1W8Q A;  5AQ7 A;  3MBZ A;  4HJ6 A;  4NKP A;  2PBD P;  4EBL A;  2UV0 E;  2OAQ 1;  5AQ9 A;  5TGF A;  2VV8 A;  5FQK A;  4IHQ A;  4HBU A;  1MY8 A;  1PRQ A;  4HHD A;  2XK1 A;  3N8L A;  1KDS A;  5DKL A;  3NY4 A;  4KUO A;  5GLD A;  3MR0 A;  2ZOI A;  2XH9 A;  3QNC A;  5DJT A;  4WEK A;  2Z6C A;  4KZ6 A;  2Y2H A;  5FAP A;  1TVF A;  3CHW P;  4PM5 A;  2PD8 A;  1YLY A;  2GNX A;  3GDI A;  3VV4 A;  4UQI M;  5AJG A;  1WYC A;  4OH0 A;  2W3G A;  3I7J A;  1YLT A;  3BLS A;  2R9W A;  5EUA A;  4RA7 A;  4HOI A;  5EEC A;  5HX9 A;  3VOZ A;  4BD1 A;  5DF9 A;  3G2Y A;  3F1N A;  2K7S A;  1BT5 A;  2XRO A;  1ES3 A;  4XUX A;  4PM8 A;  1S1Y A;  1I2W A;  3WS5 A;  4HP9 A;  4C6Y A;  4RYE A;  2ZQA A;  4OON A;  3TG9 A;  4F94 A;  4JXW A;  5KIZ A;  3MXS A;  3RXX A;  4HH3 A;  1T19 A;  3T4O A;  1VHM A;  2ZJ9 A;  5GLB A;  3NOU C;  1F9I A;  4X6T A;  1NJ4 A;  1Y28 A;  1XJ2 A;  2J3W A;  4R38 A;  4K91 A;  3H82 B;  1BLC A;  1UGU A;  3LEZ A;  4S2K A;  4R23 A;  1LL9 A;  3JVU A;  1J9M A;  4X55 A;  3G30 A;  4MN7 A;  5E2H A;  4X68 A;  4CLC D;  3ZG5 A;  4QB8 A;  1PIO A;  1W63 M;  3PBN A;  5HDC A;  3IHA A;  2PU2 A;  4KZ7 A;  4DXC A;  1O07 A;  2KX6 A;  3C5A A;  5HD3 A;  4WLA A;  3MQ0 A;  1Z6F A;  4NXE A;  4GZB A;  5G4Z A;  3FZC A;  1OT9 A;  3LEQ A;  4FCF A;  2G2W A;  4DXB A;  2ZQC A;  1IKG A;  4JBF A;  3RH8 B;  3WS2 A;  2CMN A;  3SH7 A;  1YT4 A;  1K6S A;  1KGE A;  4R3A A;  2Y8H A;  1LI9 A;  1TS0 A;  3QNB A;  3LI9 A;  3OPL A;  2WGI A;  3LR3 A;  1W5D A;  1TD5 A;  3ISG A;  2KOI A;  2G7U A;  4IBX A;  1K54 C;  3VMA A;  4O0P A;  4BD0 A;  1Y4O A;  3OC2 A;  3MKF A;  3CI6 A;  4Y5F A;  2PYP A;  3E2K A;  1BUE A;  1ERO A;  2VV6 A;  1CJF A;  5BOH A;  3DW0 A;  4KZ5 A;  4ESP A;  2WYX A;  1GA0 A;  1ACF A;  3CMZ A;  3ULF A;  1FOF A;  2DCF A;  4GHI A;  4LLO B;  4WM9 A;  3VSL A;  3LR4 A;  4Y0O A;  4LV0 A;  2FFY A;  3UDF A;  3DTE A;  2VGJ A;  4KZB A;  4OLD A;  3Q7V A;  3AGE A;  1PI4 A;  4OOM A;  1OTB A;  5HZH A;  1G6O A;  4EQI A;  2C6W B;  3OZH A;  4WF0 A;  1DJB A;  1MWR A;  4X1M A;  3OCN A;  2P7J A;  3T1X A;  1YLP A;  2P9V B;  2Y2G A;  2OAP 1;  5EM0 A;  2XRN A;  4O7D A;  1ES5 A;  4Z9Q A;  4D2O A;  3LUQ A;  2WKH A;  3PBO A;  4XT2 A;  5MC7 A;  4F3L B;  3WRT A;  3Q07 A;  3C4O A;  3C30 A;  1W63 Q;  1IYO A;  3CZD A;  2ZLY A;  4UA9 A;  3W2Z A;  3LID A;  1YPR A;  2ZBB A;  4NG2 A;  3CPT B;  3NC8 A;  4JGO A;  1LSW A;  3G31 A;  3S1Y A;  2D01 A;  4GOG A;  4IJG A;  4L9E A;  3C2W A;  4X53 A;  3RJU A;  2EWV A;  3VFH A;  3V3S A;  3LY3 A;  2W27 A;  3E0Y A;  1WYB A;  2JKT I;  3HLW A;  1OTI A;  3T4K A;  2OLV A;  5F82 A;  1TDG A;  3W4O A;  2UWX A;  3EGD C;  4DF6 A;  4BMW A;  4OOL A;  4GS9 B;  3N4I A;  3LIF A;  4KZ8 A;  1CI8 A;  4BJP A;  3CG5 A;  1ES2 A;  1VM1 A;  4KG5 A;  4MN6 A;  1IOU A;  5DF8 A;  2ZM2 A;  4UHU A;  3BRM A;  4PPR A;  3PR6 A;  1YLW A;  3PBQ A;  1WE4 A;  4GB7 A;  4E6W A;  1T18 A;  1PZP A;  3C7V A;  3ZNY A;  4MCW A;  5DTT A;  5DF7 A;  4XUZ A;  4S2P A;  1ESI A;  4KG6 A;  5HAI A;  2PR5 A;  1PNE A;  3NOP C;  1Q2Q A;  5G4Y A;  1J3W A;  3HVF A;  4PKY A;  3ZYT A;  3T1Q B;  4GN2 A;  4LV3 A;  2Y2I A;  4KG2 A;  4EES A;  1PWG A;  2PD7 A;  3BY8 A;  2ZC7 A;  3A3I A;  5A93 A;  2XDM A;  1STZ A;  3ZQ5 A;  5J7E A;  3DWK A;  3EGX C;  4NK3 A;  5FDS A;  4Y3I A;  3UO9 A;  2M7V A;  4M4X A;  1OPX A;  1C3B A;  3LY4 A;  3W4Q A;  2ACG A;  2OWH A;  5DFY A;  3G34 A;  1MC0 A;  1MXO A;  1OT6 A;  5DFX A;  4ZRR A;  2OSU A;  3QP2 A;  4C75 A;  5FQI A;  1H8Y A;  1NZU A;  2BTF P;  5GHX A;  4ARZ A;  4I38 A;  4YFM A;  3UDI A;  4Y0U A;  3UE3 A;  3QP4 A;  4HJ3 A;  4NEE D;  3ZHH A;  2QZ6 A;  3K3C A;  2JKG A;  3FYZ A;  3BWL A;  4I3J A;  5EOO A;  1VQQ A;  5F1F A;  2FFF B;  1S6R A;  4OPQ A;  4OQG A;  3HUM A;  1ERQ A;  4U3T A;  2Y59 A;  3S4X A;  4UAA A;  1EWZ A;  1JWP A;  3PAG A;  2H10 A;  3LI8 A;  3DTM A;  2XD5 A;  4HI4 A;  3CUE C;  4L0L A;  1MZU A;  4Z1W A;  2XR0 A;  1LL8 A;  3C38 A;  3FV7 A;  5TJJ A;  3U4L P;  3G32 A;  2H5S A;  3VFF A;  1LSX A;  3MF0 A;  5E2F A;  4X56 A;  3RFB A;  2W3F A;  2A24 B;  3OLO A;  3AGD A;  5EVL A;  3IXG A;  1XJ4 A; 
#chains in the Genus database with same CATH homology
 3LIC A;  4RQ9 A;  2V1B A;  4HOI A;  1WA9 A;  2J80 A;  2XA7 M;  4HH2 A;  3UME A;  3HJI A;  5DF9 A;  1YAX A;  5IS1 A;  3HJK A;  2L4R A;  3F1N A;  3U2A A;  1T1B A;  2K7S A;  4GCZ A;  4O01 A;  2MJ6 A;  2B02 A;  2XRO A;  3G6O A;  5HWW A;  1S1Y A;  4B93 A;  4HP9 A;  1NRJ A;  1S4R A;  3PXP A;  2OWJ A;  4I3A A;  5TBM A;  5KIZ A;  4CLC A;  1GSX A;  3E4Q A;  4HH3 A;  2OOL A;  2M7U A;  1N9L A;  1T19 A;  1XFQ A;  1V9Y A;  3T4O A;  1VHM A;  3NOU C;  3CAX A;  5HL6 A;  1F9I A;  4G3W A;  4LRY C;  2V9A A;  4QPR A;  1Y28 A;  1XJ2 A;  2J3W A;  2P04 A;  4R38 A;  3TE8 A;  3H82 B;  1UGU A;  1OJ5 A;  3BY9 A;  2B18 A;  2QJ7 A;  4EUV A;  2FH5 A;  2K31 A;  3JVU A;  2O9C A;  4MN7 A;  3T4L A;  2GJ3 A;  3BJN A;  4CLC D;  3FC7 A;  1KOU A;  3BQ8 A;  3H9W A;  3R7W A;  5F5Y A;  3KSH A;  4EU0 A;  4EW7 A;  2O0Y A;  5HD5 A;  1W63 M;  1XFN A;  4GJ4 A;  2VGL M;  3PBN A;  1V9Z A;  5HDC A;  3P7N A;  1GSW A;  4LRZ E;  2KX6 A;  2W1R A;  4I3I A;  4LRX C;  5HD3 A;  4WLA A;  3HCY A;  4Q0I A;  3MQ0 A;  3R4K A;  2P08 A;  3T4Q A;  4EXO A;  1X0O A;  4NXE A;  4EQ1 A;  3F1O A;  3E4P A;  5F68 A;  5G4Z A;  3RTY A;  5HWV A;  2O9A A;  1OT9 A;  3T4T A;  3UB9 A;  1S67 L;  2XSS A;  3IS2 A;  3EOI A;  2ZOH A;  3E98 A;  2M1C A;  2V0U A;  2V0W A;  3FPV A;  4NXG A;  4P6Z M;  3RH8 B;  2INW A;  3NOT C;  2CMN A;  3D72 A;  3LFV A;  3OOV A;  1TF1 A;  4WUJ A;  3MMH A;  4G3K A;  1MKM A;  2YKF A;  4R3A A;  3VE3 A;  2Y8H A;  3F1N B;  1TS0 A;  3LIB A;  4F3L A;  3LIA A;  3LI9 A;  3MFX A;  4H6J B;  5DJU A;  3LR3 A;  1TD5 A;  1XJ3 A;  1VB6 A;  2KOI A;  2LB9 A;  4B9O A;  2G7U A;  2PT7 A;  1EW0 A;  4O0P A;  3OC2 A;  3S7Q A;  5TBM B;  5AVF A;  4CLC B;  3CI6 A;  4YWZ A;  4Y5F A;  1NLZ A;  2PYP A;  4JGR A;  4CLC C;  3B33 A;  3LYX A;  3UB6 A;  1JNU A;  3OBF A;  2W1T A;  3S7P A;  3KYQ A;  1DP8 A;  2GZA A;  4UQI S;  5LBR A;  2VV6 A;  3EQV A;  5F6A A;  5J3W A;  4I5S A;  4HQA A;  4I39 A;  2GX5 A;  2QYB A;  2HJE A;  4DMZ A;  2XA7 S;  2Y79 A;  4H6J A;  4BBV A;  2JKT M;  3ULF A;  2NUT C;  1ZHH B;  3O5Y A;  3PHY A;  4GHI A;  4LLO B;  3LR4 A;  2H28 A;  3R7W B;  3CIT A;  2HGV A;  5KSH A;  1TS6 A;  1D06 A;  3PBS A;  4MDZ A;  3EEH A;  2VKS A;  2JKR M;  3KSF A;  2FZ0 A;  2D02 A;  4DN0 A;  4GS9 A;  4II7 A;  4WEJ A;  3NHQ A;  4OOM A;  2JHE A;  4L9F A;  2PHY A;  5K5B A;  1OTB A;  5HZH A;  2KDK A;  1G6O A;  2VV7 A;  4MN5 A;  4HY8 A;  3K2N A;  3F1O B;  2NUP C;  1H3Q A;  2A2L A;  3KSG A;  2QJ5 A;  2J3T D;  3P01 A;  4NXF A;  1UWN X;  3IS2 B;  4WF0 A;  1P0Z A;  5C5K A;  3OCN A;  2P7J A;  4WN5 A;  3EWK A;  4PKY G;  2V1A A;  5HSQ A;  5HPI A;  1YSP A;  2OAP 1;  3T4S A;  2XRN A;  3T4J A;  3LUQ A;  4JGQ A;  1T1A A;  3PBO A;  2O9B A;  2VEA A;  2HF6 A;  4BBU A;  4XT2 A;  1OTD A;  5MC7 A;  3LIE A;  4F3L B;  2VX8 A;  2VA0 A;  1YKD A;  4MMN A;  3MXQ A;  4FSF A;  1OTA A;  3C30 A;  4ME4 A;  4DJ2 A;  3LR5 A;  3VOL A;  3H7W A;  1W63 Q;  3W2Z A;  3LID A;  4PAU A;  2W3E A;  3NJA A;  5IU1 A;  3S7N A;  2ZBB A;  4BBT A;  2WKP A;  4WEL A;  3KX0 X;  1DP6 A;  4NXB A;  2ZMV A;  2L0W A;  4JGO A;  1LSW A;  1LT0 A;  5DKK A;  2D01 A;  2W1T B;  3MJQ A;  2Z6D A;  4YNR A;  4IJG A;  4L9E A;  3C2W A;  1NWZ A;  4P6Z S;  2EWV A;  4KQO A;  3BW6 A;  3E4O A;  2W27 A;  3E0Y A;  1P9W A;  2JKT I;  1IFQ A;  5EFW A;  1OTI A;  1BYW A;  3T4K A;  4CQH A;  4GHI B;  4EEP A;  4R70 A;  3TJZ C;  3F1P A;  5HWT A;  2VLG A;  3IBJ A;  3EGD C;  1P9R A;  3MQQ A;  2JKR I;  5L8M A;  3GEC A;  4BMW A;  4LPZ A;  2VZW A;  4OOL A;  2J3T C;  4ETX A;  3C8C A;  4GS9 B;  3TW8 A;  1ZTU A;  3S7O A;  3LIF A;  4UEY A;  5AVE A;  3UE6 A;  4BJP A;  2I9V A;  3K3D A;  3EEA A;  2W0N A;  4FOF A;  2O99 A;  4MN6 A;  4Y2F A;  1IOU A;  1YSQ A;  2VJW A;  3PR6 A;  4GLQ A;  4BWI A;  1LSV A;  3PBQ A;  1DRM A;  1S66 L;  1T18 A;  2JN7 A;  3FPW A;  4MCW A;  4K08 A;  2W3H A;  2PR6 A;  4EER A;  4L9G A;  3UMD A;  1D7E A;  1NLY A;  3CUE A;  4XT2 B;  4ETZ A;  2PR5 A;  3B42 A;  5IT5 A;  1N9N A;  2PYR A;  3NOP C;  5G4Y A;  3KYZ A;  1DP9 A;  3PBR A;  4PHT A;  4PKY A;  3ZYT A;  3CLO A;  3A0R A;  4DJ3 A;  3H7W B;  3FG8 A;  5HDD A;  2EWW A;  3MQO A;  1UWP X;  1ODV A;  4IUH A;  4KUK A;  4EES A;  3IBR A;  2PD7 A;  1F5M A;  3BY8 A;  2IA2 A;  2QHK A;  3UB7 A;  3EQU A;  4ARZ B;  1STZ A;  1T1C A;  3ZQ5 A;  4R6L A;  1P97 A;  3PYP A;  3SW1 A;  2HJ9 C;  2A24 A;  5J7E A;  3TRC A;  3BQA A;  3EGX C;  3OCL A;  4EEU A;  4Y3I A;  5A8B A;  4G3V A;  5CX7 A;  2QKP A;  2VGL S;  1G28 A;  2M7V A;  4KQD A;  2WKQ A;  4M4X A;  1OPX A;  2YKH A;  1N9O A;  3JVV A;  4EET B;  1TS7 A;  2OWH A;  3F1P B;  4CLC E;  5DFY A;  3ICY A;  1MC0 A;  1OT6 A;  2K2N A;  3LR0 A;  5HDS A;  3VE4 A;  5DFX A;  4HNB A;  3KO6 A;  4ZRR A;  1XJ6 A;  4ARZ A;  4YOF A;  4I38 A;  1OJG A;  4IUK A;  5FL3 A;  3UE3 A;  4HJ3 A;  5HPF A;  4NEE D;  4AFI A;  2R78 A;  4HIA A;  1H8M A;  1S4S A;  3K3C A;  4WL9 A;  4Q0H A;  2LB5 A;  2KLI A;  3DBA A;  3H82 A;  4O8G A;  3KSI A;  3BWL A;  4JGP A;  2PDR A;  4I3J A;  4HP4 A;  4HJ4 A;  2L1M A;  4HJ6 A;  4NKP A;  3CWF A;  3D3O A;  2OAQ 1;  2ZMF A;  3V67 A;  2W3D A;  5J4E A;  2VV8 A;  4IHQ A;  1OTE A;  2HV1 A;  2WKR A;  5I5L A;  4HHD A;  4GW9 A;  1TS8 A;  2QWS A;  3LI8 A;  5DKL A;  3B47 A;  4HI4 A;  4KUO A;  4E04 A;  3CUE C;  3PBT A;  4L0L A;  1MZU A;  3MR0 A;  2ZOI A;  4Z1W A;  5DJT A;  1LL8 A;  4WEK A;  2Z6C A;  3C38 A;  1S1Z A;  5TJJ A;  2EA9 A;  5F69 A;  2DMW A;  2PD8 A;  3UB8 A;  4Q0J A;  3A0V A;  1LSX A;  1GSV A;  3MF0 A;  1F98 A;  2GNX A;  3A0S A;  3GDI A;  3RFB A;  3VV4 A;  2BAS A;  4UQI M;  2W3F A;  5AJG A;  2A24 B;  2W3G A;  3OLO A;  3T50 A;  1XJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...