1EW0A

Crystal structure analysis of the sensor domain of rmfixl(ferrous form)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
130
structure length
130
Chain Sequence
GSHMLETEDVVRARDAHLRSILDTVPDATVVSATDGTIVSFNAAAVRQFGYAEEEVIGQNLRILMPEPYRHEHDGYLQRYMATGEKRIIGIDRVVSGQRKDGSTFPMKLAVGEMRSGGERFFTGFIRDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords FIXL
publication title Sensory mechanism of oxygen sensor FixL from Rhizobium meliloti: crystallographic, mutagenesis and resonance Raman spectroscopic studies
pubmed doi rcsb
source organism Sinorhizobium meliloti
total genus 37
structure length 130
sequence length 130
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2000-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ew0A00
3C8CA 1DP8A 3P7NA 1S66L 3E4PA 3PYPA 3F1NA 1LSVA 3F1OA 3K3CA 3UE6A 4PKYG 5TBMA 4WF0A 3FG8A 3LIBA 3OLOA 3LI8A 3NHQA 4R6LA 2VEAA 3E4QA 5DKLA 1OTDA 4YWZA 4HY8A 3H7WA 4I39A 1GSXA 1OTEA 2VV8A 1GSVA 3B33A 3MFXA 3UMDA 5I5LA 2VLGA 1LL8A 3A0VA 1UWNX 1EW0A 3LYXA 2EA9A 1DP9A 5HZHA 5DJUA 2H28A 4M4XA 1DRMA 2JHEA 1N9NA 4I3JA 5TBMB 2VV7A 3F1PB 2J80A 1S67L 5HDSA 1OTAA 1S4SA 5HDDA 2A24B 4JGRA 4R38A 3LIDA 3A0RA 4KUOA 2M1CA 4HP4A 3NOUC 1OT6A 2KX6A 4BBVA 4E04A 2VV6A 2INWA 5HWVA 4WLAA 3UMEA 4LRYC 4I38A 2W27A 4XT2B 3UB9A 4H6JB 3C2WA 2WKPA 5IS1A 4JGQA 3K3DA 2QJ7A 2W0NA 5G4YA 4K08A 3LIFA 4HJ3A 4HOIA 4JGPA 2D02A 2PYRA 3ULFA 2JN7A 2Z6CA 4HH2A 5F6AA 5F5YA 2PDRA 4DJ2A 4BBTA 4GHIB 2PR6A 3NJAA 2OWHA 1XFQA 2QKPA 2Z6DA 4LLOB 4I5SA 5KIZA 3F1PA 4KQDA 1F98A 3HJKA 4DJ3A 4L9GA 2YKFA 2L4RA 2A24A 3EWKA 2CMNA 5HWWA 3PHYA 4EXOA 1UWPX 3MQOA 4L9FA 3VOLA 4B9OA 4R3AA 2WKQA 4HJ6A 4XT2A 1MZUA 4H6JA 3NOTC 4GCZA 3KX0X 2P7JA 1S4RA 3IBRA 3EEHA 4HHDA 2PD7A 1XJ4A 1KOUA 5G4ZA 3CWFA 2QWSA 1OTBA 2V0UA 1LSWA 3H9WA 4HNBA 3G6OA 1WA9A 1XFNA 2L0WA 4HP9A 5F68A 3SW1A 2GJ3A 3D72A 5EFWA 3MQQA 4EERA 4GHIA 1BYWA 2PHYA 1T1CA 4EQ1A 1S1YA 4GS9B 1TS8A 1LSXA 3IS2B 4I3IA 1T19A 3GECA 4NXGA 4KUKA 2I9VA 4WL9A 4I3AA 2V0WA 5DKKA 4LRXC 1XJ6A 3UB6A 5J3WA 4RQ9A 1TS0A 2YKHA 1TS7A 2V1BA 5HDCA 2PD8A 4MN6A 3RTYA 1XJ3A 3H82B 5IU1A 4HQAA 4WUJA 1P0ZA 2ZOHA 3BY8A 5J4EA 1F9IA 2OWJA 4L9EA 3ZQ5A 3UB7A 2PYPA 3CAXA 3LIAA 5AVEA 3LUQA 2V9AA 4EW7A 3BY9A 4F3LB 4EEUA 2V1AA 4WN5A 1ODVA 4NXBA 4BBUA 4GS9A 2WKRA 1V9ZA 1OJGA 2L1MA 3UB8A 3IS2A 1LT0A 2K7SA 1OTIA 4PKYA 2PR5A 1X0OA 3RH8B 5DJTA 1V9YA 2D01A 4HIAA 2B02A 4R70A 4HJ4A 5HD3A 1UGUA 1NWZA 3CLOA 2HV1A 4EESA 5J7EA 4HI4A 1S1ZA 3LI9A 3NOPC 2KDKA 1T1AA 1OT9A 3LICA 3T50A 5F69A 4HH3A 3HJIA 3VE4A 1DP6A 3H82A 3ICYA 1Y28A 3F1NB 2R78A 3MJQA 3F1OB 2BASA 1N9LA 3FC7A 4LRZE 5AVFA 3A0SA 1OJ5A 2ZBBA 3GDIA 4F3LA 2QJ5A 5HD5A 3MXQA 3VE3A 3H7WB 1D06A 4GW9A 1T18A 2QHKA 4NXEA 2OOLA 1T1BA 1G28A 1GSWA 3BWLA 1TS6A 2ZOIA 5HWTA 3MR0A 3E4OA 4EEPA 4JGOA 3LIEA 1XJ2A 4EETB 4NXFA 5HSQA 1D7EA 1P97A 5A8BA 4MN5A 1VB6A 4LPZA 1N9OA 1JNUA
chains in the Genus database with same CATH superfamily
3MKEA 3LGOA 2H10A 3OZHA 3PXPA 3K3CA 2ZQ7A 2P08A 4PKYG 4WF0A 3GMWA 3T1SA 3LI8A 1L3LA 3NHQA 2VEAA 4ETZA 5DKLA 3SH8A 3SS4A 3PBSA 3LY4A 3O87A 4KZ7A 4Q0JA 4BQMA 3UDFA 3H7WA 3PAEA 2FZ0A 1HD8A 4C3QA 1ZHHB 3ZVTA 1IYPA 1OTEA 4CPKA 5KMWA 2A49A 3DWKA 3E2KA 3A0VA 4YINA 2V2FF 4HBTA 2WGIA 3LYXA 4R3JA 2K2NA 3C4OA 3T4SA 3T1XA 1PYYA 2P74A 2Y2LA 2E8JA 3EGXC 4KENB 3IXDA 3ZDJA 2XR0A 4I3JA 4K0XA 2BG1A 5F1FA 2VGLS 2A24B 4JGRA 1FCOA 1AXBA 4S2IA 4EU0A 2FFFB 3NOUC 4N1HA 4HESA 3OCLA 4E04A 5DTSA 2INWA 4WLAA 2JKTI 3QP4A 4I38A 2W27A 4XT2B 5EVLA 3M2KA 1VEUB 5GL9A 3ZG8B 4K08A 4LV0A 5CGXA 1KVMA 1W63Q 3Q1FA 4JGPA 1CQAA 3EOIA 5A93A 1CI9A 4IJGA 4S2NA 3V39A 2Y91A 3HLCA 4FSFA 4DKIA 1U60A 1XGJA 4GDBA 3WS0A 3IXHA 1FQGA 5F5YA 4X1LA 3OC2A 1BLPA 2C5WB 2PR6A 3L7HA 3B3XA 1XA7A 5KIZA 4MDZA 3F1PA 2HZ5A 1I2WA 4DJ3A 2DNSA 2WGWB 2CMNA 3N6IA 2XQZA 1TDGA 3VP3A 3IWOA 2O99A 3N8RA 4R3AA 3ZNTA 2WZXA 5GLAA 2WKQA 4RX2A 2A3UA 2WZZA 1K38A 4PM9A 3Q7VA 3VV4A 5EE8A 2ACGA 4C75A 4O7DA 3LCEA 4E3IA 3EQUA 4GB7A 4GCZA 5FI7A 4KZ5A 1IKGA 2PRFA 4X1MA 5FATA 1YSQA 2ZQ9A 4GZBA 5EOEA 2Y4AA 1XJ4A 4KZAA 3CWFA 4PPRA 4OPRA 2V0UA 1ALQA 4HNBA 2L0WA 3WS4A 4AFIA 2XH9A 4HP9A 1BLSA 5HARA 3VP2A 3V5MA 4EWFA 1MC0A 2Q9MA 3NY4A 4S2NC 2XA7M 3BRMA 1BYWA 5HFOA 1MWUA 2PBDP 1LL9A 1NRFA 4ZTKA 1IKIA 3C30A 4FD8A 3DAVA 1K6SA 4X6TA 4OOMA 3C7UA 3IX4A 1PWCA 1TS8A 3DTEA 4B93A 4MBKA 1LSXA 5K5BA 4Y5FA 1Y54A 1ONGA 3UPNA 4I3IA 2ZJ9A 5EOOA 2HP6A 1PWGA 4OONA 4WL9A 4I3AA 1FCMA 3VSKA 4BJPA 4QHCA 4CQHA 1KGGA 5HX9A 3G2ZA 5AQ7A 2HGVA 1WYBA 1XKZA 5J3WA 1IYQA 5E43A 1TS0A 1TS7A 2V1BA 1K4FA 3O88A 4LGWA 3LR3A 2PD8A 4MN6A 2EFUA 3P01A 5IU1A 1E25A 3EGDC 1XXMA 1K54C 2ZOHA 2J8YA 3R4KA 3BECA 1F9IA 2Q0OA 2ZMVA 4K91A 3UB7A 3N4IA 2HF6A 3GR2A 3LIAA 4WBGA 5AVEA 4KQQA 4BL3A 3LUQA 5KZHA 5FQKA 4EW7A 4P6ZS 4F3LB 5A92A 1FR6A 4WMCD 4FCFA 5CGSA 1K55A 4UA9A 1NLYA 4ZJ3A 1F2KA 4WN5A 2W3GA 1ODVA 4N9LA 4S2KA 3IF6A 1W63M 3AGDA 3BYDA 3ZG0A 4OLGA 3Q82A 5CEBA 5AQ9A 2L1MA 5L09A 1RP5A 3HLBA 4YOFA 3ZG7B 3W8KA 4HIAA 4R70A 4RX3A 4GDNA 3FV7A 1UGUA 1NWZA 4EESA 5E2FA 3PTEA 3HLWA 1WE4A 3BW6A 3LI9A 3NDGA 5M18A 1S0WA 1IEMA 1YLWA 5DVAA 3T50A 3HJIA 4PMAA 3VE4A 1DP6A 1JVJA 2C6WB 2WYXA 3I7JA 2EFXA 3F1NB 4KZ3A 2R78A 1GCEA 3MJQA 1CEGA 3CUEA 3F1OB 5FI2A 4M3KA 2RL3A 3A0SA 3HUMA 3CZDA 2ZBBA 2ZL1A 4JF5A 2GZAA 2NUPC 3MXQA 3UO9A 1M6KA 2UWXA 1VM1A 2XF3A 1PI4A 4Q0HA 1K55C 1PNEA 1AWIA 1XPBA 4Z9QA 4BENA 4XXRA 1YLPA 1TS6A 2ZOIA 5TFQA 3IF6C 4JPMA 5G18A 3LIEA 2XEPA 4EETB 3KO6A 4IUHA 3U4LP 5J8XA 4QJGA 1VHMA 2ZLYA 1JWZA 3QP2A 3D4FA 3A3DA 5LBRA 4DXBA 5HL1A 3K2NA 1GHMA 1MWSA 4ETXA 3TE8A 2DMWA 1DP8A 1YLZA 3P7NA 3ISGA 1GHIA 3PYPA 3UNWA 5C5KA 3WS2A 1NY0A 3FG8A 4EBPA 3C5AA 2V1ZA 3S4XA 3IWIA 3GVBA 4R6LA 3HBRA 1XGIA 2XRNA 3GSGA 1RGYA 4U3TA 4HY8A 2WKHA 2LB9A 2AVXA 3R7WA 2VKSA 3BEBA 4IHQA 4DE3A 3MZEA 3HLDA 1GSVA 3B33A 2H0YA 5EV0A 4B4ZA 2JE5A 3KYEA 2IWBA 5CXWA 2JC7A 2VLGA 4S2PA 5IHVA 1YLTA 3DW0A 4D2OA 3ZVWA 3HLFA 3FPWA 3T1RA 1RCJA 5DJUA 4E6XA 3LEZA 3GTCA 2JKTM 3ZG5A 1PW8A 4GLQA 2X02A 2JHEA 4UQIS 4IVIA 4FOFA 3G30A 2ZM0A 1TVFA 1PIOA 3IXBA 3DBAA 1S67L 2XLNA 2UV0E 1KDSA 5CTNA 1S4SA 4R38A 5CRFA 2OAQ1 4B4XA 2KX6A 4BBVA 2K31A 2VV6A 5HWVA 3LR5A 3IXGA 4ZJ1A 2P9VB 3OOVA 3C4PA 1OMEA 3UB9A 4H6JB 5FAPA 2WKPA 1A0KA 3N7WA 5IS1A 3K3DA 2QJ7A 5G4YA 2OLVA 4HJ3A 4OOLA 4HOIA 5DF8A 1SHVA 3DWZA 4D60A 3HREA 2D02A 3TG9A 2PBYA 3HLGA 3D3OA 1NZOA 5KSCA 5GHZA 3KYZA 5F6AA 3BM6A 2JKFA 2PDRA 1SKOB 4BBTA 4Y0UA 3S7OA 1KGEA 3NJAA 1XFQA 4WEKA 5GLCA 4OPYA 1HTZA 4KQDA 1F98A 1K56A 4Y0OA 4WELA 3HJKA 1P9RA 4L9GA 4OQHA 2A24A 3EWKA 4UA6A 1UWPX 3VOLA 4B9OA 2EXAA 1L0GA 1MWTA 2HJEA 3L9KA 4G3VA 3G32A 4HJ6A 4XT2A 5L8MA 1MZUA 2B5RA 1VEUA 3KX0X 1S4RA 3IBRA 1EWZA 2M7UA 3ZGAB 4MEZA 4X53A 1RGZA 1BZAA 1FCNA 3PBNA 3KSHA 4OOYA 1LL5A 4JXSA 2ZQCA 2Y2HA 2B18A 1ERMA 3H9WA 3G6OA 2PT7A 4Y7PA 5F68A 2GJ3A 3D72A 2XGNA 3MQQA 3CG5A 3T12B 4DDSA 4IUKA 3MBZA 4BD1A 2PHYA 4O8GA 1T1CA 2W3DA 4E3JA 3BFCA 1JWVA 4PAUA 1YT4A 1SCWA 3BFDA 3ZFZA 5AQAA 1NLZA 4L0LA 3CI6A 2XK1A 3FPVA 2WGWA 1T19A 3A3IA 2HDRA 3QP8A 2Y2GA 4Y13A 4BMWA 1H8YA 2JKGA 1D1JA 1MY8A 5JYOA 5L2FA 4LRXC 3UB6A 3V3SA 4S2OA 3M2JA 1BT5A 2JKRI 4RQ9A 3OPHA 3BLSA 5DF9A 5HDCA 5A91A 3M6HA 3BLMA 3H82B 3IH8A 4HQAA 3ZCZA 4JF6A 3EQVA 5DFYA 3VP4A 3MZFA 2BLSA 4ZJ2A 5J4EA 2OWJA 3SS3A 3ZQ5A 1S6RA 1ESIA 4R1GA 2V9AA 3BY9A 1XA1A 5GHYA 2WUQA 2XD5A 4MBHA 4GD8A 3Q81A 2W1TB 5FDHA 2HJ9C 4E3MA 3V3RA 2H0TA 5HPFA 2WKRA 3UPPA 1E4DA 3A3JA 2GNXA 2G2UA 3Q7ZA 2K7SA 4IEDA 4RA7A 1OTIA 4PKYA 2O0YA 2FH5A 2PR5A 1X0OA 3RH8B 4HEFA 1K54A 5CHJA 3TRCA 2B02A 5A90A 4KG6A 1M40A 3CITA 4FH2A 5J7EA 3TOIA 2Z2LB 1Q2QA 1L2SA 1YKDA 3MXSA 3NDEA 1MPLA 1OT9A 1T1AA 5EUAA 3LICA 2W3EA 4OPZA 1HLUP 3Q07A 5L07A 3OBFA 4OH0A 3BQ8A 3LFVA 3NC8A 2G7UA 1BULA 2WKIA 2BASA 1N9LA 2KOIA 2X71A 3FC7A 3D9YA 1ES2A 1G6AA 5E2GA 3GDIA 4F3LA 2QJ5A 3CPTB 2PU4A 3BFGA 5L10A 4EUZA 2LB5A 4GW9A 2W3FA 4Y17A 4NXEA 2Y79A 2ZC6B 4PHTA 4U0TA 5EVID 2Y2MA 3NCKA 4EEPA 4JGOA 1FILA 4KZ9A 1ZKJA 1XJ2A 4UAAA 3QP5A 4NXFA 1BUEA 1ONHA 1D7EA 1GA9A 2G2WA 4P6BA 2ZQAA 2Z2MB 2ZC4B 3O86A 4X55A 4MN5A 1BLCA 4LPZA 4QPRA 3SS5A 1BLHA 4RYEA 2OSUA 1PWDA 3OCNA 3C8CA 4JXVA 5F83A 1EROA 1S66L 3E4PA 4ZRRA 3S7QA 4NEED 1PFLA 3A3EA 3F1NA 1K0KA 1LSVA 3F1OA 1QMFA 3ZYTA 2MJ6A 3T4TA 1TEMA 2IWCA 3W2ZA 4UHUA 4LCLA 3IT9A 2A2LA 4Q8IA 4R4SA 5CHUA 3G2YA 4ZDXA 1OTDA 4WMCA 3VFHA 4FH4A 4I39A 4QY6A 1PRQA 5HAIA 2Y2QA 1GSXA 3BJNA 3AGFA 2VV8A 1IELA 2OLUA 5M1AA 1K6RA 3M6BA 5EVIB 4EUVA 2B95A 1UWNX 3E98A 1EW0A 3IHBA 2OV5A 3C7VA 3QNCA 2EA9A 1DP9A 3P98A 5HZHA 2V8FA 4ZAMA 2WKEA 4R3BA 3T4QA 2H28A 1DRMA 3UE3A 2O9AA 2ZM8A 4QY5A 4X25A 2ZMAA 5BOHA 5EVIC 4ID4A 5HDSA 2QMIA 5HAPA 2O9BA 3JPUA 3DTIA 3FKWA 4KUOA 2XA7S 3VP1A 4HP4A 3OPRA 1Z09A 2WAEA 1YM1A 2HDUA 5TGFA 4O01A 2XSSA 5DTTA 3UMEA 2R9XA 4II7A 4OLDA 2XROA 3T4JA 4LRYC 5HAQA 1KE0A 2VJWA 3RXXA 4JGQA 1YMXA 3LIFA 3LR0A 5CHMA 4BLMA 1FSWA 1H8ZA 1YAXA 1Y4OA 4O0PA 1CI8A 5DFXA 2PYRA 3VOYA 5FSRA 1VETB 2JN7A 1ACFA 1LI9A 1G5UA 2FFYA 3UY6A 3JYIA 4HH2A 1FSYA 3E0YA 2QPNA 3NI9A 3U2AA 1Z6FA 2V20A 3OPPA 3HVFA 3IWQA 1NRJA 4GHIB 4YFMA 1I5QA 2OWHA 4KZ8A 3QHYA 4ARZB 3S22A 1L0FA 3RXWA 2QKPA 4PM5A 2Z6DA 3MMHA 4S2MA 1JTGA 5M19A 2HPBA 4MBFA 3NULA 3LO7A 3V67A 4EXOA 3IQAA 4KQRA 3WRTA 4ME4A 2J9PA 2Y59A 2P9VA 4NG2A 4H6JA 3NOTC 2VA0A 2P7JA 4E3KA 3MKFA 3EEHA 4HHDA 2PD7A 3SOIA 2W3HA 1K4EA 4KG2A 1IFQA 4E3LA 4K0WA 5G4ZA 2QWSA 1OTBA 1K25A 1LSWA 1L0DA 5GHXA 3UE0A 1WA9A 3S7NA 1XFNA 1NJ4A 5HW3A 3T4KA 3SW1A 3O3VA 5EFWA 1E3UD 1H8MA 2VGLM 3G31A 1SKOA 3A3FA 4F94A 5TR7A 5KSHA 3PAGA 4PM8A 1IOUA 4FUWA 3P09A 4OP8A 4GS9B 4B88A 2J7VA 4JLFA 4CLCD 1GHPA 3IS2B 2V8CA 2Q9NA 4LENA 4NXGA 1VQQA 4KG5A 1W8YA 2I9VA 3C38A 3B47A 3VOZA 1DJBA 1ZG4A 1LHYA 3NBLA 4C6YA 5FL3A 1IYSA 1XJ6A 5E2HA 4FTXA 2Y2OA 2JBFA 4KQOA 4R4RA 1F5MA 1MKMA 2WK0A 3FKVA 2EWWA 3RTYA 1NZUA 4WUJA 4EBNA 2EXBA 3BY8A 3PBRA 3HUNA 4ESPA 2PYPA 4S2JA 5DTKA 2XFTA 4MN7A 4PM6A 2V1AA 4R23A 2E8IA 2VGJA 1N4OA 4NXBA 1OPXA 3WWXA 1YPRA 4CLCB 1OJGA 3UB5P 1LT0A 2WADA 3RFBA 4DE1A 3N8LA 5AJGA 4GNUA 3LEQA 5FAQA 3HLEA 4X69A 5DJTA 1I2SA 1SZVA 1V9YA 3G4PA 4HJ4A 1ZG6A 2O9CA 4U0XA 1KVLA 3CLOA 2HV1A 1S1ZA 2Y2IA 3NOPC 2KDKA 3TJZC 1CK3A 1W7FA 3B42A 4CLCC 3IH9A 4WZ5C 1PI5A 1C3BA 3H82A 3ICYA 1ES5A 2XFSA 4NKPA 3O5YA 2P04A 4MNRA 3DTMA 1MKIA 4CLCE 1MXOA 1CF0A 1FOFA 2GDNA 5JYPA 5AVFA 1J3WA 4IBXA 4LCMA 4EQIA 3H7WB 1D06A 1T18A 2W1TA 5HPIA 2QHKA 3NECA 1HZOA 1YLJA 4LFUA 1T1BA 3W4PA 5FA7A 3HL9A 3WS5A 5FQQA 4JXWA 2J3TD 1XP4A 4DMZA 3SZTA 5HWTA 3LR4A 2DCFA 1W5DA 2Y2JA 4OPQA 1N9BA 1MBLA 5HSQA 3VSLA 2JCHA 3T4OA 4CJNA 1YMSA 4E3NA 4LV1A 3WS1A 4GOGA 1DJCA 4BL2A 1TDLA 4G3KA 1KGFA 3IF5A 4P6ZM 2OAP1 4Y0TA 4X68A 1Q2PA 1MWRA 4JKTA 1J9MA 4E3OA 3V50A 4S2LA 2NUTC 5IT5A 3UE6A 5TBMA 1CEFA 1PW1A 3LIBA 1KE3A 3OLOA 1SDEA 5CECA 3S7PA 4Y2FA 4P87A 3E4QA 4N1XA 1STZA 3PBOA 3CPTA 4YWZA 2Y55A 4OQGA 1FR1A 4P0MA 3BQAA 3UPOA 3KSGA 2WAFA 3FWLA 4GN2A 4LV2A 4E6WA 1GA0A 3MFXA 3UMDA 5I5LA 2IA2A 3CMZA 1LL8A 4OVDA 3QP6A 5CTMA 1G68A 5EPHA 3CHWP 3KYQA 4M4XA 1WYCA 1N9NA 2ZM2A 1KE4A 4NK3A 5CGWA 3CJMA 2HDSA 5TBMB 2VV7A 3F1PB 2W1RA 2J3TC 5FAOA 2J80A 4OQIA 1OTAA 4G3WA 5HDDA 1ERQA 4XUXA 3LIDA 3UDIA 3A0RA 3RJUA 2M1CA 1OT6A 5FI6A 3ZHHA 3Q7VB 4MLLA 2J3WA 2H5SA 3VMAA 3C2WA 3IHAA 1NXYA 1PZPA 1H5XA 4YNRA 2QZ6A 4GJ4A 2CC1A 2W0NA 3WRZA 4KZ6A 4DE2A 2EWVA 4N92A 3UE1A 2VZWA 5EVIA 3IBJA 3ULFA 4Q0IA 3UN7A 2Z6CA 4KZBA 5I94A 3AGEA 3NIAA 4DJ2A 2EX6A 5AQBA 2IWDA 3E2LA 4WEJA 1PZOA 2PU2A 4LLOB 4I5SA 3ITBA 1NYYA 1G6OA 5GLBA 3PBTA 2YKFA 3BFEA 2L4RA 4UA7A 2EX2A 3MSHA 2HP9A 4IBRA 5HWWA 5EVEA 3PHYA 3MQOA 2XD1A 3JVUA 4L9FA 3GQZA 3HCYA 1K57A 4DE0A 3MFDA 3FYZA 5FQIA 5FQ9A 1O7EA 3MQ0A 4MMNA 2J9OA 5EECA 5FQMA 5U47A 3T1QB 1BSGA 1ES3A 3HUOA 5DF7A 2PAVP 3W4QA 1JTDA 1KOUA 3EEAA 4UQIM 4DDYA 1ES4A 2XDMA 1VETA 2X01A 4HBUA 2M7VA 4EERA 4KZ4A 5EM1A 1BTLA 4JF4A 1H3QA 1XX2A 4QD4A 1JWPA 2Y2KA 1ZTUA 4GHIA 2KLIA 2ZD8A 4ARZA 3TSGA 1YSPA 3DTKA 4A5RA 2R9WA 3IF6B 1LI0A 4EQ1A 1S1YA 1SDNA 2Y8HA 3W4OA 1P9WA 5CX7A 4QB8A 5TJJA 3G35A 3GECA 2ZC7A 4KUKA 3TW8A 5E2EA 3ITAA 2V0WA 5DKKA 3T4LA 4QWOA 3VP0A 4N9KA 4OP5A 3UDXA 3ZNYA 1HVBA 4IVKA 3MS6A 1K57C 3MXRA 1SKFA 2YKHA 1FIKA 4JXGA 3BFFA 1QMEA 5FEGA 5FQJA 1XJ3A 3SH9A 1TF1A 1P0ZA 4UEYA 3MF0A 5D3OA 1EI5A 2Y2PA 3VFFA 1LLBA 4L9EA 2VGKA 1YLYA 5GLDA 3CAXA 4Z1WA 1DY6A 2EX9A 2ZL1B 1IYOA 2RCXA 1KDWA 1ZC2A 4JBFA 4DN0A 4EEUA 3OPLA 3KSFA 4Y15A 5F82A 3G34A 4DRTA 2VX8A 4BBUA 5CERA 3KSIA 5FDSA 4GS9A 1V9ZA 3CUEC 2I72A 2ZMFA 4GKUA 3UB8A 3IS2A 3LY3A 3SH7A 2EX8A 5MC7A 4H8RA 4GD6A 2D01A 4ZBEA 1NYMA 5HD3A 1ESUA 1DJAA 1H0MA 4DXCA 5HL6A 4HI4A 5CEDA 3IX3A 4MCWA 2HDQA 3ZG9B 4BD0A 4RVAA 2ZC3B 3GV9A 4X56A 5F69A 2BTFP 4HH3A 4OKPA 5EM0A 3PR6A 1Y28A 3JVVA 2WGVA 2GX5A 2JKRM 2ZQDA 4LRZE 1TD5A 3PBQA 5FEFA 1E3UA 1YQSA 4OQ0A 1OJ5A 4NETA 3IX8A 5HD5A 4BWIA 3VE3A 3R7WB 1W79A 2ZQ8A 5F1GA 2OOLA 4WM9A 3QP1A 1G28A 4PM7A 1GSWA 3MZDA 4EBLA 3BWLA 4CLCA 2DRWA 4WZ5A 3S1YA 1L0EA 3MR0A 3E4OA 3N8SA 2HP5A 3QNBA 3GRJA 4Y3IA 4WYYA 1O07A 2Y2NA 1P97A 2ZC5B 4LV3A 4EV4A 5A8BA 4WZ4A 1W8QA 3FZCA 4P85A 4XUZA 4R0QA 1VB6A 2VK3A 1N9OA 4QU3A 2QYBA 1CJFA 4DF6A 1JNUA 1K56D 5FASA
chains in the Genus database with same CATH topology
3C8CA 4ETXA 3TE8A 4P6ZM 2DMWA 2OAP1 1DP8A 3P7NA 1S66L 3E4PA 4ZRRA 3S7QA 3PYPA 4NEED 3F1NA 3PXPA 5C5KA 1LSVA 3F1OA 3ZYTA 3K3CA 2MJ6A 2NUTC 2P08A 5IT5A 3T4TA 3UE6A 4PKYG 5TBMA 4WF0A 3FG8A 3LIBA 3W2ZA 3OLOA 3LI8A 3S7PA 2A2LA 3NHQA 4Y2FA 4R6LA 2VEAA 3E4QA 4ETZA 5DKLA 2XRNA 1STZA 3PBOA 1OTDA 4YWZA 3PBSA 4HY8A 4Q0JA 2LB9A 3R7WA 3H7WA 4I39A 2FZ0A 2VKSA 1ZHHB 1GSXA 4IHQA 3BJNA 1OTEA 2VV8A 1GSVA 3BQAA 3KSGA 3B33A 4EUVA 3MFXA 3UMDA 5I5LA 2IA2A 2VLGA 1LL8A 3A0VA 1UWNX 3E98A 1EW0A 3LYXA 2K2NA 3FPWA 2EA9A 1DP9A 5HZHA 5DJUA 3T4SA 3T4QA 2JKTM 2H28A 3KYQA 4M4XA 3EGXC 1DRMA 3UE3A 4GLQA 2O9AA 2JHEA 4UQIS 1N9NA 4I3JA 4FOFA 5TBMB 2VV7A 3F1PB 2W1RA 2J3TC 2J80A 3DBAA 1S67L 5HDSA 1OTAA 4G3WA 1S4SA 2O9BA 2VGLS 5HDDA 2A24B 4JGRA 4R38A 3LIDA 2OAQ1 3A0RA 4KUOA 2XA7S 4EU0A 2M1CA 4HP4A 3NOUC 1OT6A 3OCLA 2KX6A 4BBVA 2K31A 4E04A 2VV6A 2INWA 5HWVA 4O01A 2XSSA 4WLAA 2JKTI 3LR5A 3UMEA 4II7A 2XROA 3T4JA 4LRYC 4I38A 3OOVA 2W27A 4XT2B 2J3WA 4H6JB 3UB9A 3C2WA 2VJWA 2WKPA 4YNRA 5IS1A 4JGQA 3K3DA 4GJ4A 2QJ7A 2W0NA 5G4YA 4K08A 3LIFA 3LR0A 2EWVA 4HJ3A 4OOLA 4HOIA 1YAXA 1W63Q 2VZWA 4JGPA 4O0PA 3EOIA 5DFXA 2D02A 3IBJA 2PYRA 3ULFA 2JN7A 4Q0IA 4IJGA 3D3OA 4FSFA 2Z6CA 4HH2A 3KYZA 5F6AA 3E0YA 3U2AA 5F5YA 2PDRA 4DJ2A 4BBTA 4WEJA 3OC2A 3S7OA 1NRJA 4GHIB 2PR6A 3NJAA 2OWHA 4ARZB 1XFQA 2QKPA 2Z6DA 4WEKA 3MMHA 4LLOB 4I5SA 5KIZA 4MDZA 3F1PA 1G6OA 4KQDA 1F98A 3PBTA 4WELA 3HJKA 1P9RA 4DJ3A 4L9GA 2YKFA 2L4RA 2A24A 3EWKA 2CMNA 5HWWA 3V67A 3PHYA 4EXOA 1UWPX 3MQOA 3JVUA 4L9FA 2O99A 3VOLA 3HCYA 4ME4A 4B9OA 4R3AA 2HJEA 2WKQA 4G3VA 4HJ6A 4XT2A 5L8MA 1MZUA 3VV4A 3MQ0A 4MMNA 4H6JA 3NOTC 3EQUA 4GCZA 2VA0A 2P7JA 3KX0X 1S4RA 3IBRA 3EEHA 2M7UA 4HHDA 2PD7A 1YSQA 2W3HA 3PBNA 3KSHA 1IFQA 1XJ4A 1KOUA 5G4ZA 3CWFA 2QWSA 1OTBA 3EEAA 2V0UA 2B18A 4UQIM 1LSWA 3H9WA 4HNBA 3G6OA 1WA9A 3S7NA 1XFNA 2PT7A 2L0WA 4AFIA 3T4KA 4HP9A 5F68A 3SW1A 2GJ3A 3D72A 5EFWA 3MQQA 2M7VA 4EERA 2VGLM 1H8MA 1H3QA 1MC0A 4IUKA 1ZTUA 4GHIA 2XA7M 1BYWA 2KLIA 2PHYA 4O8GA 1T1CA 5KSHA 2W3DA 4ARZA 4PAUA 1IOUA 1YSPA 3C30A 4EQ1A 4OOMA 1S1YA 4GS9B 2Y8HA 1NLZA 4L0LA 3CI6A 1TS8A 4B93A 1P9WA 3FPVA 4CLCD 1LSXA 5K5BA 4Y5FA 5CX7A 3IS2B 4I3IA 5TJJA 1T19A 3GECA 4NXGA 4KUKA 2I9VA 3C38A 3B47A 4BMWA 3TW8A 4WL9A 4I3AA 2V0WA 5DKKA 5FL3A 3T4LA 4BJPA 4CQHA 4LRXC 1XJ6A 2HGVA 3UB6A 5J3WA 2JKRI 4RQ9A 1TS0A 2YKHA 4KQOA 1TS7A 2V1BA 5DF9A 5HDCA 1F5MA 1MKMA 3LR3A 2PD8A 4MN6A 2EWWA 3RTYA 1XJ3A 3H82B 3P01A 5IU1A 4HQAA 1TF1A 3EGDC 4WUJA 1P0ZA 3EQVA 4UEYA 3MF0A 5DFYA 2ZOHA 3R4KA 3BY8A 5J4EA 1F9IA 2OWJA 2ZMVA 3PBRA 4L9EA 3ZQ5A 3UB7A 2HF6A 2PYPA 3CAXA 4Z1WA 3LIAA 5AVEA 3LUQA 2V9AA 4EW7A 4P6ZS 3BY9A 4MN7A 4F3LB 4EEUA 4DN0A 1NLYA 2V1AA 3KSFA 4WN5A 2W1TB 2HJ9C 2W3GA 1ODVA 4NXBA 1OPXA 2VX8A 4BBUA 1W63M 3KSIA 5HPFA 4GS9A 2WKRA 1V9ZA 3CUEC 4CLCB 1OJGA 2ZMFA 2GNXA 2L1MA 3UB8A 3IS2A 1LT0A 2K7SA 3RFBA 1OTIA 5AJGA 4PKYA 2O0YA 2FH5A 2PR5A 1X0OA 3RH8B 5MC7A 4YOFA 3TRCA 5DJTA 1V9YA 2D01A 4HIAA 2B02A 4R70A 4HJ4A 5HD3A 2O9CA 1UGUA 1NWZA 3CITA 3CLOA 2HV1A 4EESA 5J7EA 5HL6A 4HI4A 1S1ZA 3LI9A 3BW6A 3NOPC 1YKDA 2KDKA 1T1AA 1OT9A 3LICA 4MCWA 2W3EA 3TJZC 3OBFA 3B42A 4CLCC 3BQ8A 3T50A 5F69A 4HH3A 3HJIA 3VE4A 1DP6A 3LFVA 3H82A 3ICYA 3PR6A 1Y28A 2G7UA 3F1NB 4NKPA 3JVVA 2R78A 3O5YA 2P04A 3MJQA 4CLCE 3CUEA 3F1OB 2BASA 1N9LA 2KOIA 3FC7A 2GX5A 2JKRM 4LRZE 5AVFA 1TD5A 3PBQA 3A0SA 1OJ5A 2ZBBA 3GDIA 2GZAA 2NUPC 4F3LA 2QJ5A 5HD5A 4BWIA 3MXQA 3VE3A 3R7WB 3H7WB 1D06A 2LB5A 1T18A 2W1TA 4GW9A 2W3FA 5HPIA 2QHKA 4NXEA 2Y79A 2OOLA 1T1BA 4PHTA 1G28A 1GSWA 4Q0HA 3BWLA 4CLCA 2J3TD 1TS6A 2ZOIA 4DMZA 5HWTA 3MR0A 3E4OA 3LR4A 4EEPA 4JGOA 3LIEA 1XJ2A 4EETB 4NXFA 3KO6A 5HSQA 4Y3IA 1D7EA 4IUHA 1P97A 1VHMA 3T4OA 5A8BA 4MN5A 1VB6A 4LPZA 4QPRA 5LBRA 1N9OA 2QYBA 4G3KA 3K2NA 1JNUA 3OCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C8C A;  1DP8 A;  3P7N A;  1S66 L;  3E4P A;  3PYP A;  3F1N A;  1LSV A;  3F1O A;  3K3C A;  3UE6 A;  4PKY G;  5TBM A;  4WF0 A;  3FG8 A;  3LIB A;  3OLO A;  3LI8 A;  3NHQ A;  4R6L A;  2VEA A;  3E4Q A;  5DKL A;  1OTD A;  4YWZ A;  4HY8 A;  3H7W A;  4I39 A;  1GSX A;  1OTE A;  2VV8 A;  1GSV A;  3B33 A;  3MFX A;  3UMD A;  5I5L A;  2VLG A;  1LL8 A;  3A0V A;  1UWN X;  1EW0 A;  3LYX A;  2EA9 A;  1DP9 A;  5HZH A;  5DJU A;  2H28 A;  4M4X A;  1DRM A;  2JHE A;  1N9N A;  4I3J A;  5TBM B;  2VV7 A;  3F1P B;  2J80 A;  1S67 L;  5HDS A;  1OTA A;  1S4S A;  5HDD A;  2A24 B;  4JGR A;  4R38 A;  3LID A;  3A0R A;  4KUO A;  2M1C A;  4HP4 A;  3NOU C;  1OT6 A;  2KX6 A;  4BBV A;  4E04 A;  2VV6 A;  2INW A;  5HWV A;  4WLA A;  3UME A;  4LRY C;  4I38 A;  2W27 A;  4XT2 B;  3UB9 A;  4H6J B;  3C2W A;  2WKP A;  5IS1 A;  4JGQ A;  3K3D A;  2QJ7 A;  2W0N A;  5G4Y A;  4K08 A;  3LIF A;  4HJ3 A;  4HOI A;  4JGP A;  2D02 A;  2PYR A;  3ULF A;  2JN7 A;  2Z6C A;  4HH2 A;  5F6A A;  5F5Y A;  2PDR A;  4DJ2 A;  4BBT A;  4GHI B;  2PR6 A;  3NJA A;  2OWH A;  1XFQ A;  2QKP A;  2Z6D A;  4LLO B;  4I5S A;  5KIZ A;  3F1P A;  4KQD A;  1F98 A;  3HJK A;  4DJ3 A;  4L9G A;  2YKF A;  2L4R A;  2A24 A;  3EWK A;  2CMN A;  5HWW A;  3PHY A;  4EXO A;  1UWP X;  3MQO A;  4L9F A;  3VOL A;  4B9O A;  4R3A A;  2WKQ A;  4HJ6 A;  4XT2 A;  1MZU A;  4H6J A;  3NOT C;  4GCZ A;  3KX0 X;  2P7J A;  1S4R A;  3IBR A;  3EEH A;  4HHD A;  2PD7 A;  1XJ4 A;  1KOU A;  5G4Z A;  3CWF A;  2QWS A;  1OTB A;  2V0U A;  1LSW A;  3H9W A;  4HNB A;  3G6O A;  1WA9 A;  1XFN A;  2L0W A;  4HP9 A;  5F68 A;  3SW1 A;  2GJ3 A;  3D72 A;  5EFW A;  3MQQ A;  4EER A;  4GHI A;  1BYW A;  2PHY A;  1T1C A;  4EQ1 A;  1S1Y A;  4GS9 B;  1TS8 A;  1LSX A;  3IS2 B;  4I3I A;  1T19 A;  3GEC A;  4NXG A;  4KUK A;  2I9V A;  4WL9 A;  4I3A A;  2V0W A;  5DKK A;  4LRX C;  1XJ6 A;  3UB6 A;  5J3W A;  4RQ9 A;  1TS0 A;  2YKH A;  1TS7 A;  2V1B A;  5HDC A;  2PD8 A;  4MN6 A;  3RTY A;  1XJ3 A;  3H82 B;  5IU1 A;  4HQA A;  4WUJ A;  1P0Z A;  2ZOH A;  3BY8 A;  5J4E A;  1F9I A;  2OWJ A;  4L9E A;  3ZQ5 A;  3UB7 A;  2PYP A;  3CAX A;  3LIA A;  5AVE A;  3LUQ A;  2V9A A;  4EW7 A;  3BY9 A;  4F3L B;  4EEU A;  2V1A A;  4WN5 A;  1ODV A;  4NXB A;  4BBU A;  4GS9 A;  2WKR A;  1V9Z A;  1OJG A;  2L1M A;  3UB8 A;  3IS2 A;  1LT0 A;  2K7S A;  1OTI A;  4PKY A;  2PR5 A;  1X0O A;  3RH8 B;  5DJT A;  1V9Y A;  2D01 A;  4HIA A;  2B02 A;  4R70 A;  4HJ4 A;  5HD3 A;  1UGU A;  1NWZ A;  3CLO A;  2HV1 A;  4EES A;  5J7E A;  4HI4 A;  1S1Z A;  3LI9 A;  3NOP C;  2KDK A;  1T1A A;  1OT9 A;  3LIC A;  3T50 A;  5F69 A;  4HH3 A;  3HJI A;  3VE4 A;  1DP6 A;  3H82 A;  3ICY A;  1Y28 A;  3F1N B;  2R78 A;  3MJQ A;  3F1O B;  2BAS A;  1N9L A;  3FC7 A;  4LRZ E;  5AVF A;  3A0S A;  1OJ5 A;  2ZBB A;  3GDI A;  4F3L A;  2QJ5 A;  5HD5 A;  3MXQ A;  3VE3 A;  3H7W B;  1D06 A;  4GW9 A;  1T18 A;  2QHK A;  4NXE A;  2OOL A;  1T1B A;  1G28 A;  1GSW A;  3BWL A;  1TS6 A;  2ZOI A;  5HWT A;  3MR0 A;  3E4O A;  4EEP A;  4JGO A;  3LIE A;  1XJ2 A;  4EET B;  4NXF A;  5HSQ A;  1D7E A;  1P97 A;  5A8B A;  4MN5 A;  1VB6 A;  4LPZ A;  1N9O A;  1JNU A; 
#chains in the Genus database with same CATH topology
 3MKE A;  3LGO A;  2H10 A;  3OZH A;  3PXP A;  3K3C A;  2ZQ7 A;  2P08 A;  4PKY G;  4WF0 A;  3GMW A;  3T1S A;  3LI8 A;  1L3L A;  3NHQ A;  2VEA A;  4ETZ A;  5DKL A;  3SH8 A;  3SS4 A;  3PBS A;  3LY4 A;  3O87 A;  4KZ7 A;  4Q0J A;  4BQM A;  3UDF A;  3H7W A;  3PAE A;  2FZ0 A;  1HD8 A;  4C3Q A;  1ZHH B;  3ZVT A;  1IYP A;  1OTE A;  4CPK A;  5KMW A;  2A49 A;  3DWK A;  3E2K A;  3A0V A;  4YIN A;  2V2F F;  4HBT A;  2WGI A;  3LYX A;  4R3J A;  2K2N A;  3C4O A;  3T4S A;  3T1X A;  1PYY A;  2P74 A;  2Y2L A;  2E8J A;  3EGX C;  4KEN B;  3IXD A;  3ZDJ A;  2XR0 A;  4I3J A;  4K0X A;  2BG1 A;  5F1F A;  2VGL S;  2A24 B;  4JGR A;  1FCO A;  1AXB A;  4S2I A;  4EU0 A;  2FFF B;  3NOU C;  4N1H A;  4HES A;  3OCL A;  4E04 A;  5DTS A;  2INW A;  4WLA A;  2JKT I;  3QP4 A;  4I38 A;  2W27 A;  4XT2 B;  5EVL A;  3M2K A;  1VEU B;  5GL9 A;  3ZG8 B;  4K08 A;  4LV0 A;  5CGX A;  1KVM A;  1W63 Q;  3Q1F A;  4JGP A;  1CQA A;  3EOI A;  5A93 A;  1CI9 A;  4IJG A;  4S2N A;  3V39 A;  2Y91 A;  3HLC A;  4FSF A;  4DKI A;  1U60 A;  1XGJ A;  4GDB A;  3WS0 A;  3IXH A;  1FQG A;  5F5Y A;  4X1L A;  3OC2 A;  1BLP A;  2C5W B;  2PR6 A;  3L7H A;  3B3X A;  1XA7 A;  5KIZ A;  4MDZ A;  3F1P A;  2HZ5 A;  1I2W A;  4DJ3 A;  2DNS A;  2WGW B;  2CMN A;  3N6I A;  2XQZ A;  1TDG A;  3VP3 A;  3IWO A;  2O99 A;  3N8R A;  4R3A A;  3ZNT A;  2WZX A;  5GLA A;  2WKQ A;  4RX2 A;  2A3U A;  2WZZ A;  1K38 A;  4PM9 A;  3Q7V A;  3VV4 A;  5EE8 A;  2ACG A;  4C75 A;  4O7D A;  3LCE A;  4E3I A;  3EQU A;  4GB7 A;  4GCZ A;  5FI7 A;  4KZ5 A;  1IKG A;  2PRF A;  4X1M A;  5FAT A;  1YSQ A;  2ZQ9 A;  4GZB A;  5EOE A;  2Y4A A;  1XJ4 A;  4KZA A;  3CWF A;  4PPR A;  4OPR A;  2V0U A;  1ALQ A;  4HNB A;  2L0W A;  3WS4 A;  4AFI A;  2XH9 A;  4HP9 A;  1BLS A;  5HAR A;  3VP2 A;  3V5M A;  4EWF A;  1MC0 A;  2Q9M A;  3NY4 A;  4S2N C;  2XA7 M;  3BRM A;  1BYW A;  5HFO A;  1MWU A;  2PBD P;  1LL9 A;  1NRF A;  4ZTK A;  1IKI A;  3C30 A;  4FD8 A;  3DAV A;  1K6S A;  4X6T A;  4OOM A;  3C7U A;  3IX4 A;  1PWC A;  1TS8 A;  3DTE A;  4B93 A;  4MBK A;  1LSX A;  5K5B A;  4Y5F A;  1Y54 A;  1ONG A;  3UPN A;  4I3I A;  2ZJ9 A;  5EOO A;  2HP6 A;  1PWG A;  4OON A;  4WL9 A;  4I3A A;  1FCM A;  3VSK A;  4BJP A;  4QHC A;  4CQH A;  1KGG A;  5HX9 A;  3G2Z A;  5AQ7 A;  2HGV A;  1WYB A;  1XKZ A;  5J3W A;  1IYQ A;  5E43 A;  1TS0 A;  1TS7 A;  2V1B A;  1K4F A;  3O88 A;  4LGW A;  3LR3 A;  2PD8 A;  4MN6 A;  2EFU A;  3P01 A;  5IU1 A;  1E25 A;  3EGD C;  1XXM A;  1K54 C;  2ZOH A;  2J8Y A;  3R4K A;  3BEC A;  1F9I A;  2Q0O A;  2ZMV A;  4K91 A;  3UB7 A;  3N4I A;  2HF6 A;  3GR2 A;  3LIA A;  4WBG A;  5AVE A;  4KQQ A;  4BL3 A;  3LUQ A;  5KZH A;  5FQK A;  4EW7 A;  4P6Z S;  4F3L B;  5A92 A;  1FR6 A;  4WMC D;  4FCF A;  5CGS A;  1K55 A;  4UA9 A;  1NLY A;  4ZJ3 A;  1F2K A;  4WN5 A;  2W3G A;  1ODV A;  4N9L A;  4S2K A;  3IF6 A;  1W63 M;  3AGD A;  3BYD A;  3ZG0 A;  4OLG A;  3Q82 A;  5CEB A;  5AQ9 A;  2L1M A;  5L09 A;  1RP5 A;  3HLB A;  4YOF A;  3ZG7 B;  3W8K A;  4HIA A;  4R70 A;  4RX3 A;  4GDN A;  3FV7 A;  1UGU A;  1NWZ A;  4EES A;  5E2F A;  3PTE A;  3HLW A;  1WE4 A;  3BW6 A;  3LI9 A;  3NDG A;  5M18 A;  1S0W A;  1IEM A;  1YLW A;  5DVA A;  3T50 A;  3HJI A;  4PMA A;  3VE4 A;  1DP6 A;  1JVJ A;  2C6W B;  2WYX A;  3I7J A;  2EFX A;  3F1N B;  4KZ3 A;  2R78 A;  1GCE A;  3MJQ A;  1CEG A;  3CUE A;  3F1O B;  5FI2 A;  4M3K A;  2RL3 A;  3A0S A;  3HUM A;  3CZD A;  2ZBB A;  2ZL1 A;  4JF5 A;  2GZA A;  2NUP C;  3MXQ A;  3UO9 A;  1M6K A;  2UWX A;  1VM1 A;  2XF3 A;  1PI4 A;  4Q0H A;  1K55 C;  1PNE A;  1AWI A;  1XPB A;  4Z9Q A;  4BEN A;  4XXR A;  1YLP A;  1TS6 A;  2ZOI A;  5TFQ A;  3IF6 C;  4JPM A;  5G18 A;  3LIE A;  2XEP A;  4EET B;  3KO6 A;  4IUH A;  3U4L P;  5J8X A;  4QJG A;  1VHM A;  2ZLY A;  1JWZ A;  3QP2 A;  3D4F A;  3A3D A;  5LBR A;  4DXB A;  5HL1 A;  3K2N A;  1GHM A;  1MWS A;  4ETX A;  3TE8 A;  2DMW A;  1DP8 A;  1YLZ A;  3P7N A;  3ISG A;  1GHI A;  3PYP A;  3UNW A;  5C5K A;  3WS2 A;  1NY0 A;  3FG8 A;  4EBP A;  3C5A A;  2V1Z A;  3S4X A;  3IWI A;  3GVB A;  4R6L A;  3HBR A;  1XGI A;  2XRN A;  3GSG A;  1RGY A;  4U3T A;  4HY8 A;  2WKH A;  2LB9 A;  2AVX A;  3R7W A;  2VKS A;  3BEB A;  4IHQ A;  4DE3 A;  3MZE A;  3HLD A;  1GSV A;  3B33 A;  2H0Y A;  5EV0 A;  4B4Z A;  2JE5 A;  3KYE A;  2IWB A;  5CXW A;  2JC7 A;  2VLG A;  4S2P A;  5IHV A;  1YLT A;  3DW0 A;  4D2O A;  3ZVW A;  3HLF A;  3FPW A;  3T1R A;  1RCJ A;  5DJU A;  4E6X A;  3LEZ A;  3GTC A;  2JKT M;  3ZG5 A;  1PW8 A;  4GLQ A;  2X02 A;  2JHE A;  4UQI S;  4IVI A;  4FOF A;  3G30 A;  2ZM0 A;  1TVF A;  1PIO A;  3IXB A;  3DBA A;  1S67 L;  2XLN A;  2UV0 E;  1KDS A;  5CTN A;  1S4S A;  4R38 A;  5CRF A;  2OAQ 1;  4B4X A;  2KX6 A;  4BBV A;  2K31 A;  2VV6 A;  5HWV A;  3LR5 A;  3IXG A;  4ZJ1 A;  2P9V B;  3OOV A;  3C4P A;  1OME A;  3UB9 A;  4H6J B;  5FAP A;  2WKP A;  1A0K A;  3N7W A;  5IS1 A;  3K3D A;  2QJ7 A;  5G4Y A;  2OLV A;  4HJ3 A;  4OOL A;  4HOI A;  5DF8 A;  1SHV A;  3DWZ A;  4D60 A;  3HRE A;  2D02 A;  3TG9 A;  2PBY A;  3HLG A;  3D3O A;  1NZO A;  5KSC A;  5GHZ A;  3KYZ A;  5F6A A;  3BM6 A;  2JKF A;  2PDR A;  1SKO B;  4BBT A;  4Y0U A;  3S7O A;  1KGE A;  3NJA A;  1XFQ A;  4WEK A;  5GLC A;  4OPY A;  1HTZ A;  4KQD A;  1F98 A;  1K56 A;  4Y0O A;  4WEL A;  3HJK A;  1P9R A;  4L9G A;  4OQH A;  2A24 A;  3EWK A;  4UA6 A;  1UWP X;  3VOL A;  4B9O A;  2EXA A;  1L0G A;  1MWT A;  2HJE A;  3L9K A;  4G3V A;  3G32 A;  4HJ6 A;  4XT2 A;  5L8M A;  1MZU A;  2B5R A;  1VEU A;  3KX0 X;  1S4R A;  3IBR A;  1EWZ A;  2M7U A;  3ZGA B;  4MEZ A;  4X53 A;  1RGZ A;  1BZA A;  1FCN A;  3PBN A;  3KSH A;  4OOY A;  1LL5 A;  4JXS A;  2ZQC A;  2Y2H A;  2B18 A;  1ERM A;  3H9W A;  3G6O A;  2PT7 A;  4Y7P A;  5F68 A;  2GJ3 A;  3D72 A;  2XGN A;  3MQQ A;  3CG5 A;  3T12 B;  4DDS A;  4IUK A;  3MBZ A;  4BD1 A;  2PHY A;  4O8G A;  1T1C A;  2W3D A;  4E3J A;  3BFC A;  1JWV A;  4PAU A;  1YT4 A;  1SCW A;  3BFD A;  3ZFZ A;  5AQA A;  1NLZ A;  4L0L A;  3CI6 A;  2XK1 A;  3FPV A;  2WGW A;  1T19 A;  3A3I A;  2HDR A;  3QP8 A;  2Y2G A;  4Y13 A;  4BMW A;  1H8Y A;  2JKG A;  1D1J A;  1MY8 A;  5JYO A;  5L2F A;  4LRX C;  3UB6 A;  3V3S A;  4S2O A;  3M2J A;  1BT5 A;  2JKR I;  4RQ9 A;  3OPH A;  3BLS A;  5DF9 A;  5HDC A;  5A91 A;  3M6H A;  3BLM A;  3H82 B;  3IH8 A;  4HQA A;  3ZCZ A;  4JF6 A;  3EQV A;  5DFY A;  3VP4 A;  3MZF A;  2BLS A;  4ZJ2 A;  5J4E A;  2OWJ A;  3SS3 A;  3ZQ5 A;  1S6R A;  1ESI A;  4R1G A;  2V9A A;  3BY9 A;  1XA1 A;  5GHY A;  2WUQ A;  2XD5 A;  4MBH A;  4GD8 A;  3Q81 A;  2W1T B;  5FDH A;  2HJ9 C;  4E3M A;  3V3R A;  2H0T A;  5HPF A;  2WKR A;  3UPP A;  1E4D A;  3A3J A;  2GNX A;  2G2U A;  3Q7Z A;  2K7S A;  4IED A;  4RA7 A;  1OTI A;  4PKY A;  2O0Y A;  2FH5 A;  2PR5 A;  1X0O A;  3RH8 B;  4HEF A;  1K54 A;  5CHJ A;  3TRC A;  2B02 A;  5A90 A;  4KG6 A;  1M40 A;  3CIT A;  4FH2 A;  5J7E A;  3TOI A;  2Z2L B;  1Q2Q A;  1L2S A;  1YKD A;  3MXS A;  3NDE A;  1MPL A;  1OT9 A;  1T1A A;  5EUA A;  3LIC A;  2W3E A;  4OPZ A;  1HLU P;  3Q07 A;  5L07 A;  3OBF A;  4OH0 A;  3BQ8 A;  3LFV A;  3NC8 A;  2G7U A;  1BUL A;  2WKI A;  2BAS A;  1N9L A;  2KOI A;  2X71 A;  3FC7 A;  3D9Y A;  1ES2 A;  1G6A A;  5E2G A;  3GDI A;  4F3L A;  2QJ5 A;  3CPT B;  2PU4 A;  3BFG A;  5L10 A;  4EUZ A;  2LB5 A;  4GW9 A;  2W3F A;  4Y17 A;  4NXE A;  2Y79 A;  2ZC6 B;  4PHT A;  4U0T A;  5EVI D;  2Y2M A;  3NCK A;  4EEP A;  4JGO A;  1FIL A;  4KZ9 A;  1ZKJ A;  1XJ2 A;  4UAA A;  3QP5 A;  4NXF A;  1BUE A;  1ONH A;  1D7E A;  1GA9 A;  2G2W A;  4P6B A;  2ZQA A;  2Z2M B;  2ZC4 B;  3O86 A;  4X55 A;  4MN5 A;  1BLC A;  4LPZ A;  4QPR A;  3SS5 A;  1BLH A;  4RYE A;  2OSU A;  1PWD A;  3OCN A;  3C8C A;  4JXV A;  5F83 A;  1ERO A;  1S66 L;  3E4P A;  4ZRR A;  3S7Q A;  4NEE D;  1PFL A;  3A3E A;  3F1N A;  1K0K A;  1LSV A;  3F1O A;  1QMF A;  3ZYT A;  2MJ6 A;  3T4T A;  1TEM A;  2IWC A;  3W2Z A;  4UHU A;  4LCL A;  3IT9 A;  2A2L A;  4Q8I A;  4R4S A;  5CHU A;  3G2Y A;  4ZDX A;  1OTD A;  4WMC A;  3VFH A;  4FH4 A;  4I39 A;  4QY6 A;  1PRQ A;  5HAI A;  2Y2Q A;  1GSX A;  3BJN A;  3AGF A;  2VV8 A;  1IEL A;  2OLU A;  5M1A A;  1K6R A;  3M6B A;  5EVI B;  4EUV A;  2B95 A;  1UWN X;  3E98 A;  1EW0 A;  3IHB A;  2OV5 A;  3C7V A;  3QNC A;  2EA9 A;  1DP9 A;  3P98 A;  5HZH A;  2V8F A;  4ZAM A;  2WKE A;  4R3B A;  3T4Q A;  2H28 A;  1DRM A;  3UE3 A;  2O9A A;  2ZM8 A;  4QY5 A;  4X25 A;  2ZMA A;  5BOH A;  5EVI C;  4ID4 A;  5HDS A;  2QMI A;  5HAP A;  2O9B A;  3JPU A;  3DTI A;  3FKW A;  4KUO A;  2XA7 S;  3VP1 A;  4HP4 A;  3OPR A;  1Z09 A;  2WAE A;  1YM1 A;  2HDU A;  5TGF A;  4O01 A;  2XSS A;  5DTT A;  3UME A;  2R9X A;  4II7 A;  4OLD A;  2XRO A;  3T4J A;  4LRY C;  5HAQ A;  1KE0 A;  2VJW A;  3RXX A;  4JGQ A;  1YMX A;  3LIF A;  3LR0 A;  5CHM A;  4BLM A;  1FSW A;  1H8Z A;  1YAX A;  1Y4O A;  4O0P A;  1CI8 A;  5DFX A;  2PYR A;  3VOY A;  5FSR A;  1VET B;  2JN7 A;  1ACF A;  1LI9 A;  1G5U A;  2FFY A;  3UY6 A;  3JYI A;  4HH2 A;  1FSY A;  3E0Y A;  2QPN A;  3NI9 A;  3U2A A;  1Z6F A;  2V20 A;  3OPP A;  3HVF A;  3IWQ A;  1NRJ A;  4GHI B;  4YFM A;  1I5Q A;  2OWH A;  4KZ8 A;  3QHY A;  4ARZ B;  3S22 A;  1L0F A;  3RXW A;  2QKP A;  4PM5 A;  2Z6D A;  3MMH A;  4S2M A;  1JTG A;  5M19 A;  2HPB A;  4MBF A;  3NUL A;  3LO7 A;  3V67 A;  4EXO A;  3IQA A;  4KQR A;  3WRT A;  4ME4 A;  2J9P A;  2Y59 A;  2P9V A;  4NG2 A;  4H6J A;  3NOT C;  2VA0 A;  2P7J A;  4E3K A;  3MKF A;  3EEH A;  4HHD A;  2PD7 A;  3SOI A;  2W3H A;  1K4E A;  4KG2 A;  1IFQ A;  4E3L A;  4K0W A;  5G4Z A;  2QWS A;  1OTB A;  1K25 A;  1LSW A;  1L0D A;  5GHX A;  3UE0 A;  1WA9 A;  3S7N A;  1XFN A;  1NJ4 A;  5HW3 A;  3T4K A;  3SW1 A;  3O3V A;  5EFW A;  1E3U D;  1H8M A;  2VGL M;  3G31 A;  1SKO A;  3A3F A;  4F94 A;  5TR7 A;  5KSH A;  3PAG A;  4PM8 A;  1IOU A;  4FUW A;  3P09 A;  4OP8 A;  4GS9 B;  4B88 A;  2J7V A;  4JLF A;  4CLC D;  1GHP A;  3IS2 B;  2V8C A;  2Q9N A;  4LEN A;  4NXG A;  1VQQ A;  4KG5 A;  1W8Y A;  2I9V A;  3C38 A;  3B47 A;  3VOZ A;  1DJB A;  1ZG4 A;  1LHY A;  3NBL A;  4C6Y A;  5FL3 A;  1IYS A;  1XJ6 A;  5E2H A;  4FTX A;  2Y2O A;  2JBF A;  4KQO A;  4R4R A;  1F5M A;  1MKM A;  2WK0 A;  3FKV A;  2EWW A;  3RTY A;  1NZU A;  4WUJ A;  4EBN A;  2EXB A;  3BY8 A;  3PBR A;  3HUN A;  4ESP A;  2PYP A;  4S2J A;  5DTK A;  2XFT A;  4MN7 A;  4PM6 A;  2V1A A;  4R23 A;  2E8I A;  2VGJ A;  1N4O A;  4NXB A;  1OPX A;  3WWX A;  1YPR A;  4CLC B;  1OJG A;  3UB5 P;  1LT0 A;  2WAD A;  3RFB A;  4DE1 A;  3N8L A;  5AJG A;  4GNU A;  3LEQ A;  5FAQ A;  3HLE A;  4X69 A;  5DJT A;  1I2S A;  1SZV A;  1V9Y A;  3G4P A;  4HJ4 A;  1ZG6 A;  2O9C A;  4U0X A;  1KVL A;  3CLO A;  2HV1 A;  1S1Z A;  2Y2I A;  3NOP C;  2KDK A;  3TJZ C;  1CK3 A;  1W7F A;  3B42 A;  4CLC C;  3IH9 A;  4WZ5 C;  1PI5 A;  1C3B A;  3H82 A;  3ICY A;  1ES5 A;  2XFS A;  4NKP A;  3O5Y A;  2P04 A;  4MNR A;  3DTM A;  1MKI A;  4CLC E;  1MXO A;  1CF0 A;  1FOF A;  2GDN A;  5JYP A;  5AVF A;  1J3W A;  4IBX A;  4LCM A;  4EQI A;  3H7W B;  1D06 A;  1T18 A;  2W1T A;  5HPI A;  2QHK A;  3NEC A;  1HZO A;  1YLJ A;  4LFU A;  1T1B A;  3W4P A;  5FA7 A;  3HL9 A;  3WS5 A;  5FQQ A;  4JXW A;  2J3T D;  1XP4 A;  4DMZ A;  3SZT A;  5HWT A;  3LR4 A;  2DCF A;  1W5D A;  2Y2J A;  4OPQ A;  1N9B A;  1MBL A;  5HSQ A;  3VSL A;  2JCH A;  3T4O A;  4CJN A;  1YMS A;  4E3N A;  4LV1 A;  3WS1 A;  4GOG A;  1DJC A;  4BL2 A;  1TDL A;  4G3K A;  1KGF A;  3IF5 A;  4P6Z M;  2OAP 1;  4Y0T A;  4X68 A;  1Q2P A;  1MWR A;  4JKT A;  1J9M A;  4E3O A;  3V50 A;  4S2L A;  2NUT C;  5IT5 A;  3UE6 A;  5TBM A;  1CEF A;  1PW1 A;  3LIB A;  1KE3 A;  3OLO A;  1SDE A;  5CEC A;  3S7P A;  4Y2F A;  4P87 A;  3E4Q A;  4N1X A;  1STZ A;  3PBO A;  3CPT A;  4YWZ A;  2Y55 A;  4OQG A;  1FR1 A;  4P0M A;  3BQA A;  3UPO A;  3KSG A;  2WAF A;  3FWL A;  4GN2 A;  4LV2 A;  4E6W A;  1GA0 A;  3MFX A;  3UMD A;  5I5L A;  2IA2 A;  3CMZ A;  1LL8 A;  4OVD A;  3QP6 A;  5CTM A;  1G68 A;  5EPH A;  3CHW P;  3KYQ A;  4M4X A;  1WYC A;  1N9N A;  2ZM2 A;  1KE4 A;  4NK3 A;  5CGW A;  3CJM A;  2HDS A;  5TBM B;  2VV7 A;  3F1P B;  2W1R A;  2J3T C;  5FAO A;  2J80 A;  4OQI A;  1OTA A;  4G3W A;  5HDD A;  1ERQ A;  4XUX A;  3LID A;  3UDI A;  3A0R A;  3RJU A;  2M1C A;  1OT6 A;  5FI6 A;  3ZHH A;  3Q7V B;  4MLL A;  2J3W A;  2H5S A;  3VMA A;  3C2W A;  3IHA A;  1NXY A;  1PZP A;  1H5X A;  4YNR A;  2QZ6 A;  4GJ4 A;  2CC1 A;  2W0N A;  3WRZ A;  4KZ6 A;  4DE2 A;  2EWV A;  4N92 A;  3UE1 A;  2VZW A;  5EVI A;  3IBJ A;  3ULF A;  4Q0I A;  3UN7 A;  2Z6C A;  4KZB A;  5I94 A;  3AGE A;  3NIA A;  4DJ2 A;  2EX6 A;  5AQB A;  2IWD A;  3E2L A;  4WEJ A;  1PZO A;  2PU2 A;  4LLO B;  4I5S A;  3ITB A;  1NYY A;  1G6O A;  5GLB A;  3PBT A;  2YKF A;  3BFE A;  2L4R A;  4UA7 A;  2EX2 A;  3MSH A;  2HP9 A;  4IBR A;  5HWW A;  5EVE A;  3PHY A;  3MQO A;  2XD1 A;  3JVU A;  4L9F A;  3GQZ A;  3HCY A;  1K57 A;  4DE0 A;  3MFD A;  3FYZ A;  5FQI A;  5FQ9 A;  1O7E A;  3MQ0 A;  4MMN A;  2J9O A;  5EEC A;  5FQM A;  5U47 A;  3T1Q B;  1BSG A;  1ES3 A;  3HUO A;  5DF7 A;  2PAV P;  3W4Q A;  1JTD A;  1KOU A;  3EEA A;  4UQI M;  4DDY A;  1ES4 A;  2XDM A;  1VET A;  2X01 A;  4HBU A;  2M7V A;  4EER A;  4KZ4 A;  5EM1 A;  1BTL A;  4JF4 A;  1H3Q A;  1XX2 A;  4QD4 A;  1JWP A;  2Y2K A;  1ZTU A;  4GHI A;  2KLI A;  2ZD8 A;  4ARZ A;  3TSG A;  1YSP A;  3DTK A;  4A5R A;  2R9W A;  3IF6 B;  1LI0 A;  4EQ1 A;  1S1Y A;  1SDN A;  2Y8H A;  3W4O A;  1P9W A;  5CX7 A;  4QB8 A;  5TJJ A;  3G35 A;  3GEC A;  2ZC7 A;  4KUK A;  3TW8 A;  5E2E A;  3ITA A;  2V0W A;  5DKK A;  3T4L A;  4QWO A;  3VP0 A;  4N9K A;  4OP5 A;  3UDX A;  3ZNY A;  1HVB A;  4IVK A;  3MS6 A;  1K57 C;  3MXR A;  1SKF A;  2YKH A;  1FIK A;  4JXG A;  3BFF A;  1QME A;  5FEG A;  5FQJ A;  1XJ3 A;  3SH9 A;  1TF1 A;  1P0Z A;  4UEY A;  3MF0 A;  5D3O A;  1EI5 A;  2Y2P A;  3VFF A;  1LLB A;  4L9E A;  2VGK A;  1YLY A;  5GLD A;  3CAX A;  4Z1W A;  1DY6 A;  2EX9 A;  2ZL1 B;  1IYO A;  2RCX A;  1KDW A;  1ZC2 A;  4JBF A;  4DN0 A;  4EEU A;  3OPL A;  3KSF A;  4Y15 A;  5F82 A;  3G34 A;  4DRT A;  2VX8 A;  4BBU A;  5CER A;  3KSI A;  5FDS A;  4GS9 A;  1V9Z A;  3CUE C;  2I72 A;  2ZMF A;  4GKU A;  3UB8 A;  3IS2 A;  3LY3 A;  3SH7 A;  2EX8 A;  5MC7 A;  4H8R A;  4GD6 A;  2D01 A;  4ZBE A;  1NYM A;  5HD3 A;  1ESU A;  1DJA A;  1H0M A;  4DXC A;  5HL6 A;  4HI4 A;  5CED A;  3IX3 A;  4MCW A;  2HDQ A;  3ZG9 B;  4BD0 A;  4RVA A;  2ZC3 B;  3GV9 A;  4X56 A;  5F69 A;  2BTF P;  4HH3 A;  4OKP A;  5EM0 A;  3PR6 A;  1Y28 A;  3JVV A;  2WGV A;  2GX5 A;  2JKR M;  2ZQD A;  4LRZ E;  1TD5 A;  3PBQ A;  5FEF A;  1E3U A;  1YQS A;  4OQ0 A;  1OJ5 A;  4NET A;  3IX8 A;  5HD5 A;  4BWI A;  3VE3 A;  3R7W B;  1W79 A;  2ZQ8 A;  5F1G A;  2OOL A;  4WM9 A;  3QP1 A;  1G28 A;  4PM7 A;  1GSW A;  3MZD A;  4EBL A;  3BWL A;  4CLC A;  2DRW A;  4WZ5 A;  3S1Y A;  1L0E A;  3MR0 A;  3E4O A;  3N8S A;  2HP5 A;  3QNB A;  3GRJ A;  4Y3I A;  4WYY A;  1O07 A;  2Y2N A;  1P97 A;  2ZC5 B;  4LV3 A;  4EV4 A;  5A8B A;  4WZ4 A;  1W8Q A;  3FZC A;  4P85 A;  4XUZ A;  4R0Q A;  1VB6 A;  2VK3 A;  1N9O A;  4QU3 A;  2QYB A;  1CJF A;  4DF6 A;  1JNU A;  1K56 D;  5FAS A; 
#chains in the Genus database with same CATH homology
 3C8C A;  4ETX A;  3TE8 A;  4P6Z M;  2DMW A;  2OAP 1;  1DP8 A;  3P7N A;  1S66 L;  3E4P A;  4ZRR A;  3S7Q A;  3PYP A;  4NEE D;  3F1N A;  3PXP A;  5C5K A;  1LSV A;  3F1O A;  3ZYT A;  3K3C A;  2MJ6 A;  2NUT C;  2P08 A;  5IT5 A;  3T4T A;  3UE6 A;  4PKY G;  5TBM A;  4WF0 A;  3FG8 A;  3LIB A;  3W2Z A;  3OLO A;  3LI8 A;  3S7P A;  2A2L A;  3NHQ A;  4Y2F A;  4R6L A;  2VEA A;  3E4Q A;  4ETZ A;  5DKL A;  2XRN A;  1STZ A;  3PBO A;  1OTD A;  4YWZ A;  3PBS A;  4HY8 A;  4Q0J A;  2LB9 A;  3R7W A;  3H7W A;  4I39 A;  2FZ0 A;  2VKS A;  1ZHH B;  1GSX A;  4IHQ A;  3BJN A;  1OTE A;  2VV8 A;  1GSV A;  3BQA A;  3KSG A;  3B33 A;  4EUV A;  3MFX A;  3UMD A;  5I5L A;  2IA2 A;  2VLG A;  1LL8 A;  3A0V A;  1UWN X;  3E98 A;  1EW0 A;  3LYX A;  2K2N A;  3FPW A;  2EA9 A;  1DP9 A;  5HZH A;  5DJU A;  3T4S A;  3T4Q A;  2JKT M;  2H28 A;  3KYQ A;  4M4X A;  3EGX C;  1DRM A;  3UE3 A;  4GLQ A;  2O9A A;  2JHE A;  4UQI S;  1N9N A;  4I3J A;  4FOF A;  5TBM B;  2VV7 A;  3F1P B;  2W1R A;  2J3T C;  2J80 A;  3DBA A;  1S67 L;  5HDS A;  1OTA A;  4G3W A;  1S4S A;  2O9B A;  2VGL S;  5HDD A;  2A24 B;  4JGR A;  4R38 A;  3LID A;  2OAQ 1;  3A0R A;  4KUO A;  2XA7 S;  4EU0 A;  2M1C A;  4HP4 A;  3NOU C;  1OT6 A;  3OCL A;  2KX6 A;  4BBV A;  2K31 A;  4E04 A;  2VV6 A;  2INW A;  5HWV A;  4O01 A;  2XSS A;  4WLA A;  2JKT I;  3LR5 A;  3UME A;  4II7 A;  2XRO A;  3T4J A;  4LRY C;  4I38 A;  3OOV A;  2W27 A;  4XT2 B;  2J3W A;  4H6J B;  3UB9 A;  3C2W A;  2VJW A;  2WKP A;  4YNR A;  5IS1 A;  4JGQ A;  3K3D A;  4GJ4 A;  2QJ7 A;  2W0N A;  5G4Y A;  4K08 A;  3LIF A;  3LR0 A;  2EWV A;  4HJ3 A;  4OOL A;  4HOI A;  1YAX A;  1W63 Q;  2VZW A;  4JGP A;  4O0P A;  3EOI A;  5DFX A;  2D02 A;  3IBJ A;  2PYR A;  3ULF A;  2JN7 A;  4Q0I A;  4IJG A;  3D3O A;  4FSF A;  2Z6C A;  4HH2 A;  3KYZ A;  5F6A A;  3E0Y A;  3U2A A;  5F5Y A;  2PDR A;  4DJ2 A;  4BBT A;  4WEJ A;  3OC2 A;  3S7O A;  1NRJ A;  4GHI B;  2PR6 A;  3NJA A;  2OWH A;  4ARZ B;  1XFQ A;  2QKP A;  2Z6D A;  4WEK A;  3MMH A;  4LLO B;  4I5S A;  5KIZ A;  4MDZ A;  3F1P A;  1G6O A;  4KQD A;  1F98 A;  3PBT A;  4WEL A;  3HJK A;  1P9R A;  4DJ3 A;  4L9G A;  2YKF A;  2L4R A;  2A24 A;  3EWK A;  2CMN A;  5HWW A;  3V67 A;  3PHY A;  4EXO A;  1UWP X;  3MQO A;  3JVU A;  4L9F A;  2O99 A;  3VOL A;  3HCY A;  4ME4 A;  4B9O A;  4R3A A;  2HJE A;  2WKQ A;  4G3V A;  4HJ6 A;  4XT2 A;  5L8M A;  1MZU A;  3VV4 A;  3MQ0 A;  4MMN A;  4H6J A;  3NOT C;  3EQU A;  4GCZ A;  2VA0 A;  2P7J A;  3KX0 X;  1S4R A;  3IBR A;  3EEH A;  2M7U A;  4HHD A;  2PD7 A;  1YSQ A;  2W3H A;  3PBN A;  3KSH A;  1IFQ A;  1XJ4 A;  1KOU A;  5G4Z A;  3CWF A;  2QWS A;  1OTB A;  3EEA A;  2V0U A;  2B18 A;  4UQI M;  1LSW A;  3H9W A;  4HNB A;  3G6O A;  1WA9 A;  3S7N A;  1XFN A;  2PT7 A;  2L0W A;  4AFI A;  3T4K A;  4HP9 A;  5F68 A;  3SW1 A;  2GJ3 A;  3D72 A;  5EFW A;  3MQQ A;  2M7V A;  4EER A;  2VGL M;  1H8M A;  1H3Q A;  1MC0 A;  4IUK A;  1ZTU A;  4GHI A;  2XA7 M;  1BYW A;  2KLI A;  2PHY A;  4O8G A;  1T1C A;  5KSH A;  2W3D A;  4ARZ A;  4PAU A;  1IOU A;  1YSP A;  3C30 A;  4EQ1 A;  4OOM A;  1S1Y A;  4GS9 B;  2Y8H A;  1NLZ A;  4L0L A;  3CI6 A;  1TS8 A;  4B93 A;  1P9W A;  3FPV A;  4CLC D;  1LSX A;  5K5B A;  4Y5F A;  5CX7 A;  3IS2 B;  4I3I A;  5TJJ A;  1T19 A;  3GEC A;  4NXG A;  4KUK A;  2I9V A;  3C38 A;  3B47 A;  4BMW A;  3TW8 A;  4WL9 A;  4I3A A;  2V0W A;  5DKK A;  5FL3 A;  3T4L A;  4BJP A;  4CQH A;  4LRX C;  1XJ6 A;  2HGV A;  3UB6 A;  5J3W A;  2JKR I;  4RQ9 A;  1TS0 A;  2YKH A;  4KQO A;  1TS7 A;  2V1B A;  5DF9 A;  5HDC A;  1F5M A;  1MKM A;  3LR3 A;  2PD8 A;  4MN6 A;  2EWW A;  3RTY A;  1XJ3 A;  3H82 B;  3P01 A;  5IU1 A;  4HQA A;  1TF1 A;  3EGD C;  4WUJ A;  1P0Z A;  3EQV A;  4UEY A;  3MF0 A;  5DFY A;  2ZOH A;  3R4K A;  3BY8 A;  5J4E A;  1F9I A;  2OWJ A;  2ZMV A;  3PBR A;  4L9E A;  3ZQ5 A;  3UB7 A;  2HF6 A;  2PYP A;  3CAX A;  4Z1W A;  3LIA A;  5AVE A;  3LUQ A;  2V9A A;  4EW7 A;  4P6Z S;  3BY9 A;  4MN7 A;  4F3L B;  4EEU A;  4DN0 A;  1NLY A;  2V1A A;  3KSF A;  4WN5 A;  2W1T B;  2HJ9 C;  2W3G A;  1ODV A;  4NXB A;  1OPX A;  2VX8 A;  4BBU A;  1W63 M;  3KSI A;  5HPF A;  4GS9 A;  2WKR A;  1V9Z A;  3CUE C;  4CLC B;  1OJG A;  2ZMF A;  2GNX A;  2L1M A;  3UB8 A;  3IS2 A;  1LT0 A;  2K7S A;  3RFB A;  1OTI A;  5AJG A;  4PKY A;  2O0Y A;  2FH5 A;  2PR5 A;  1X0O A;  3RH8 B;  5MC7 A;  4YOF A;  3TRC A;  5DJT A;  1V9Y A;  2D01 A;  4HIA A;  2B02 A;  4R70 A;  4HJ4 A;  5HD3 A;  2O9C A;  1UGU A;  1NWZ A;  3CIT A;  3CLO A;  2HV1 A;  4EES A;  5J7E A;  5HL6 A;  4HI4 A;  1S1Z A;  3LI9 A;  3BW6 A;  3NOP C;  1YKD A;  2KDK A;  1T1A A;  1OT9 A;  3LIC A;  4MCW A;  2W3E A;  3TJZ C;  3OBF A;  3B42 A;  4CLC C;  3BQ8 A;  3T50 A;  5F69 A;  4HH3 A;  3HJI A;  3VE4 A;  1DP6 A;  3LFV A;  3H82 A;  3ICY A;  3PR6 A;  1Y28 A;  2G7U A;  3F1N B;  4NKP A;  3JVV A;  2R78 A;  3O5Y A;  2P04 A;  3MJQ A;  4CLC E;  3CUE A;  3F1O B;  2BAS A;  1N9L A;  2KOI A;  3FC7 A;  2GX5 A;  2JKR M;  4LRZ E;  5AVF A;  1TD5 A;  3PBQ A;  3A0S A;  1OJ5 A;  2ZBB A;  3GDI A;  2GZA A;  2NUP C;  4F3L A;  2QJ5 A;  5HD5 A;  4BWI A;  3MXQ A;  3VE3 A;  3R7W B;  3H7W B;  1D06 A;  2LB5 A;  1T18 A;  2W1T A;  4GW9 A;  2W3F A;  5HPI A;  2QHK A;  4NXE A;  2Y79 A;  2OOL A;  1T1B A;  4PHT A;  1G28 A;  1GSW A;  4Q0H A;  3BWL A;  4CLC A;  2J3T D;  1TS6 A;  2ZOI A;  4DMZ A;  5HWT A;  3MR0 A;  3E4O A;  3LR4 A;  4EEP A;  4JGO A;  3LIE A;  1XJ2 A;  4EET B;  4NXF A;  3KO6 A;  5HSQ A;  4Y3I A;  1D7E A;  4IUH A;  1P97 A;  1VHM A;  3T4O A;  5A8B A;  4MN5 A;  1VB6 A;  4LPZ A;  4QPR A;  5LBR A;  1N9O A;  2QYB A;  4G3K A;  3K2N A;  1JNU A;  3OCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...