1EW0A

Crystal structure analysis of the sensor domain of rmfixl(ferrous form)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
130
structure length
130
Chain Sequence
b'GSHMLETEDVVRARDAHLRSILDTVPDATVVSATDGTIVSFNAAAVRQFGYAEEEVIGQNLRILMPEPYRHEHDGYLQRYMATGEKRIIGIDRVVSGQRKDGSTFPMKLAVGEMRSGGERFFTGFIRDLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIXL
molecule tags Transferase
source organism Sinorhizobium meliloti
publication title Sensory mechanism of oxygen sensor FixL from Rhizobium meliloti: crystallographic, mutagenesis and resonance Raman spectroscopic studies
pubmed doi rcsb
total genus 37
structure length 130
sequence length 130
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2000-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ew0A00
3UB6A 4PKYA 4WN5A 3PYPA 3MR0A 3LI8A 4HQAA 3LICA 4GW9A 4L9FA 4PKYG 3C8CA 5F5YA 3F1NA 1DP6A 3E4OA 4EXOA 1LL8A 2WKPA 4HIAA 2WKQA 5HZHA 2R78A 1BYWA 4HJ3A 3H7WA 5DJTA 3LUQA 4NXBA 5F6AA 1XJ3A 3H9WA 4WL9A 4NXFA 5J4EA 4I38A 4GCZA 4HP9A 1OTEA 1S4RA 3P7NA 2VV6A 4HHDA 4JGPA 1D06A 1T18A 4I3JA 5KIZA 4LPZA 5DKLA 3F1PB 4JGOA 1NWZA 4R3AA 4EEUA 2EA9A 1X0OA 1OJGA 1GSVA 1KOUA 1S1ZA 1UWNX 2L1MA 1T1CA 3H82B 4GHIB 4I3IA 5HDCA 3RH8B 4GS9A 1ODVA 2Z6DA 3NHQA 2PDRA 1N9LA 1TS8A 1WA9A 2YKHA 2CMNA 3IBRA 1DP9A 3NJAA 3OLOA 4JGQA 1V9YA 2PD8A 2PYPA 2GJ3A 5AVEA 2J80A 2K7SA 2L4RA 4WF0A 4XT2B 3UB8A 3BY9A 5TBMA 3UB7A 5IS1A 3VE3A 4EQ1A 4M4XA 4NXEA 1UWPX 2Z6CA 4H6JA 2KX6A 3GECA 4YWZA 3ZQ5A 3F1NB 3KX0X 1OTBA 3NOPC 4EESA 2PR6A 2OWJA 3VOLA 3E4PA 1TS0A 1JNUA 1P97A 3MFXA 3E4QA 4LRXC 4LRYC 3NOUC 5HD5A 4LLOB 3RTYA 1S1YA 2D01A 4KUKA 4BBTA 5J3WA 3F1OB 1G28A 1LSWA 4HJ4A 5HWVA 1GSWA 3NOTC 2ZOIA 4HJ6A 5IU1A 2BASA 2V1AA 2V9AA 3EWKA 1D7EA 4EETB 1XJ4A 3FG8A 3MQOA 4R38A 4R70A 4XT2A 1OTIA 5F69A 3H82A 3ICYA 3UE6A 3G6OA 1P0ZA 4MN5A 3T50A 4BBUA 1OTAA 4GS9B 3A0VA 4L9EA 4HOIA 3MJQA 4DJ2A 5AVFA 2WKRA 4K08A 1XJ2A 2QWSA 5HDSA 3ULFA 3D72A 3MQQA 5G4ZA 5HWTA 4E04A 4EW7A 3K3CA 1EW0A 3BY8A 4NXGA 1Y28A 5TBMB 2QJ7A 1VB6A 3GDIA 3IS2A 3LIAA 1XFNA 1MZUA 5EFWA 1LSXA 2ZOHA 4H6JB 4HNBA 2VV7A 1T19A 1OT6A 1V9ZA 3F1OA 4F3LA 5J7EA 1N9OA 2OWHA 3PHYA 5HDDA 3VE4A 2QKPA 2A24B 5HWWA 4RQ9A 1GSXA 1LSVA 2JN7A 3LIFA 2W27A 2V0UA 5DJUA 1DP8A 3LIDA 3A0SA 4WUJA 5F68A 4B9OA 2QJ5A 4BBVA 4EERA 4KUOA 1OTDA 4L9GA 3LIEA 3MXQA 2L0WA 1N9NA 2PD7A 2V0WA 4HP4A 3EEHA 1XJ6A 3HJKA 4DJ3A 3K3DA 4EEPA 5HSQA 2D02A 3LI9A 1F9IA 1T1AA 3SW1A 2JHEA 3A0RA 4I39A 2I9VA 2ZBBA 3CWFA 4JGRA 2PYRA 4I5SA 4HH2A 2H28A 4F3LB 5G4YA 1S66L 1TS7A 2PR5A 2VLGA 1S67L 3HJIA 4HY8A 1TS6A 2YKFA 4WLAA 3H7WB 1XFQA 3F1PA 4LRZE 2PHYA 2A24A 2W0NA 5DKKA 5A8BA 2M1CA 4HI4A 3IS2B 4HH3A 3C2WA 1S4SA 3UB9A 4GHIA 5I5LA 2B02A 1F98A 1OJ5A 2VV8A 3BWLA 4KQDA 1LT0A 5HD3A 3CLOA 1DRMA 4R6LA 2VEAA 3UMEA 3CAXA 2QHKA 3B33A 3FC7A 3LIBA 3LYXA 1UGUA 2KDKA 1OT9A 4I3AA 3UMDA 2OOLA 2INWA 2P7JA 2HV1A 1T1BA 2V1BA 4MN6A
chains in the Genus database with same CATH superfamily
4WN5A 2KOIA 2Y2OA 1YKDA 4H8RA 2W1RA 2DCFA 1W79A 5FL3A 3FKVA 1XGIA 3HLGA 1XGJA 4Z9QA 1GA0A 4R3AA 3WS0A 2XEPA 3UY6A 2Y2KA 5GLBA 3P09A 2YKHA 3T12B 1GA9A 2XLNA 3CPTA 2G7UA 3NI9A 4HEFA 1OTBA 3NOPC 3CMZA 4Y7PA 4KUKA 4HJ6A 5IU1A 2EX6A 3UE6A 3WS2A 5AQ7A 3T50A 4CLCD 3LEZA 4EWFA 3RXXA 5AVFA 4N1XA 1MXOA 5GLDA 3O87A 5CTMA 2X02A 3ZVTA 3RFBA 3MS6A 5HL1A 5CHUA 4H6JB 1GHPA 1HVBA 1H3QA 1VHMA 1CF0A 3LY4A 4UA6A 2ZQ9A 3LI9A 4DF6A 2BG1A 4KZ8A 3A0RA 3CWFA 2PR5A 2LB5A 4LV1A 3T4OA 2V8FA 3F1PA 5JYOA 2B02A 3UE3A 1F98A 3PXPA 1SKOB 3OPHA 1VEUB 5HX9A 5DFXA 1P9RA 1PW8A 1OT9A 3HUNA 2OOLA 3FG8A 4N1HA 4NEED 3PYPA 4BMWA 3E4OA 3GTCA 1MY8A 5GHZA 5F6AA 3BFFA 3SS4A 1ES5A 1OTEA 2OLVA 3UE1A 4X68A 2P04A 2VGKA 2EX8A 1UWNX 5HDCA 3C4OA 1PIOA 2Y2HA 3OLOA 2PYPA 4Y5FA 3V3RA 5CX7A 3W4PA 1GHIA 4NXEA 3D9YA 3D3OA 2MJ6A 2WZZA 5GLCA 4WEJA 2D01A 4BBTA 2R9WA 4XT2A 3D4FA 3H82A 3G6OA 3A0VA 3V39A 4S2LA 3EGDC 4QJGA 4OH0A 1MKMA 1BULA 2RCXA 4FTXA 1Y28A 3LR0A 2Y8HA 3TJZC 3FPWA 3V50A 5FAOA 2ZQAA 3LIFA 3FKWA 1CQAA 3A0SA 3HLBA 5FQJA 1OTDA 4L9GA 1NLZA 2IWDA 2P08A 1PWCA 4O7DA 2DMWA 2Y2PA 5FATA 2I9VA 2ZBBA 5EE8A 1LL5A 1FCMA 1TF1A 1XX2A 4BL3A 2WGWA 4HI4A 3GSGA 3IS2B 4KG2A 4GHIA 3ITBA 4E3OA 5HW3A 3LYXA 3QP8A 3NECA 2WKRA 5TGFA 1KGFA 1DY6A 3LI8A 3Q07A 2O99A 3MKFA 4GN2A 3VP0A 5EECA 2HP9A 1ESIA 4GCZA 1KGGA 3AGEA 3MZDA 3OPPA 4KQRA 4PHTA 2J8YA 4LPZA 1GSVA 3FYZA 3PAEA 1MPLA 1TS8A 3BFCA 3C5AA 3IH8A 4JGQA 1ES4A 3E2KA 5AVEA 1A0KA 5TBMA 4OOMA 4EQ1A 5TJJA 3EEAA 4YWZA 4NETA 2WUQA 3GECA 4UQIM 2XGNA 3HLEA 4XUZA 1FOFA 1CI9A 1JNUA 1SKFA 4HBUA 1KDWA 4RVAA 2O9CA 4BENA 2K2NA 3VP1A 5J3WA 5CTNA 2Q9NA 1H8YA 4MN5A 4BBUA 4WMCD 2QPNA 4HOIA 3MJQA 2JKRM 4Y0OA 1XA1A 1OMEA 1PW1A 3TSGA 1F2KA 5EFWA 3JYIA 4E6XA 2Y2IA 1P9WA 3VE4A 2P9VB 3LY3A 1GSXA 1VM1A 4YFMA 5DJUA 3TW8A 1ES3A 4KUOA 1JWVA 3MXQA 2L0WA 4Q8IA 4DJ3A 1XA7A 4X53A 3KSIA 2B5RA 4ID4A 2O9AA 1I2WA 5DVAA 4ARZA 3L9KA 5M1AA 1AWIA 4L0LA 2YKFA 1LI9A 1S4SA 2OLUA 4S2IA 3BFGA 3KSGA 2V20A 1DRMA 3FPVA 5L09A 5HAQA 4JF6A 4MN6A 3B3XA 2J7VA 3VMAA 2R78A 3IXDA 3VP4A 4O01A 1BLSA 4YNRA 3SOIA 3BRMA 4R38A 3WS4A 1T1CA 3E0YA 3T4TA 3VFFA 1NYYA 4R4SA 3KYEA 2XSSA 3B42A 1FILA 3RXWA 3F1NB 3QHYA 2PR6A 3O86A 2XFTA 4R4RA 4JPMA 5FA7A 2Y59A 4DDYA 3MQOA 5A93A 5HL6A 1QMEA 5EV0A 1KE4A 3S1YA 2PT7A 3BM6A 4RYEA 1MWTA 1MWRA 3PHYA 2QYBA 3IXGA 3AGFA 2W3GA 4KZ4A 2VGLM 2J3TC 1N9NA 3K3DA 3CUEA 3NDEA 2M7VA 4F3LB 1S66L 2VLGA 1XFQA 3G32A 2A24A 5BOHA 3MFDA 3IXHA 4MMNA 4WELA 2XA7S 3Q7ZA 1SHVA 1W63Q 2XD1A 2JKTI 3M6BA 3LR4A 5EVIA 4PKYA 5G18A 3LICA 2WKPA 1GCEA 2WKHA 4JXVA 3N6IA 3HREA 4QD4A 4DE3A 1T18A 4FH4A 4OQ0A 4Y15A 3F1PB 3T4QA 5FI2A 4QPRA 2CMNA 3NJAA 2XF3A 1V9YA 1FSYA 1IELA 1IYSA 2VX8A 3ZQ5A 5HAIA 3C7UA 4IEDA 5DTSA 1IKIA 1EI5A 1FIKA 2WK0A 1HLUP 1PZPA 4S2NA 3EWKA 1H8MA 2XRNA 3E98A 3S7PA 2NUTC 1KDSA 3M6HA 4K08A 4GDNA 1C3BA 1LL9A 3ISGA 3VV4A 4E6WA 3BY8A 2ZQ7A 2QJ7A 3LIAA 3FWLA 3HVFA 4OLGA 4LCMA 3ZCZA 4MDZA 2OWHA 4OLDA 3KSFA 4EV4A 3MMHA 4WUJA 1W5DA 2Z2LB 3SZTA 4OONA 4JF5A 4HY8A 1YAXA 5DKKA 3VP2A 3T4SA 1CEFA 3MXRA 2Y2QA 4XXRA 4BD1A 3UMDA 4DE2A 1K0KA 4GW9A 3T4JA 3IX4A 4QU3A 4HJ3A 3LUQA 2JE5A 2PRFA 2OSUA 1S6RA 4PM9A 4DXBA 3P7NA 2VV6A 4I3JA 3B47A 5DKLA 3S7QA 2WGWB 1ODVA 1CK3A 4S2JA 1YSPA 3UE0A 4CQHA 2EFUA 2Z6CA 1YMXA 2KX6A 4GDBA 2GDNA 1LLBA 2HZ5A 1LSWA 3MSHA 3PBOA 4B93A 2ZM0A 3BFDA 3CUEC 4EETB 3A3IA 3UDFA 3ICYA 3HUMA 1P0ZA 2XD5A 4MNRA 3T4LA 2EWVA 2XH9A 3ZG9B 1L3LA 2Y91A 3UPPA 2V1ZA 3V5MA 4LV3A 5TFQA 3UPNA 1HZOA 3Q7VB 1LSXA 1DJBA 1YM1A 4GD8A 4ZJ1A 4IUHA 1PRQA 5CGXA 2QKPA 2ZL1B 3PBNA 1VETB 2EWWA 4MBHA 1PWDA 1H0MA 1VEUA 3VOZA 4E3JA 1YLYA 3R7WB 5DF7A 1Y54A 3OOVA 4Y0UA 3MF0A 4RA7A 4FH2A 3QP6A 1PFLA 2H5SA 4LRZE 4PAUA 4HH3A 1K4EA 2H0TA 4K91A 1OJ5A 2VV8A 1YLPA 2Y79A 2LB9A 5HFOA 1FQGA 1G6OA 2GNXA 1TDLA 4B4XA 2ZMAA 4JGOA 1X0OA 4UEYA 1ONGA 4E3IA 5FQMA 4MBFA 4WYYA 2PBDP 2J80A 4XT2B 5GL9A 3UB7A 1L0FA 5EVEA 4OOLA 3S7NA 2XFSA 5AQ9A 4D60A 3VSLA 2W1TB 3DAVA 1KVMA 1M6KA 2FFFB 2ZM2A 1K55A 1ERMA 2V9AA 1L0DA 1O07A 3TOIA 3HLCA 3EQVA 2QWSA 2HGVA 3CHWP 3K3CA 1EW0A 4G3WA 1XFNA 4CLCE 2ZOHA 2WKIA 1NY0A 1OT6A 1V9ZA 3I7JA 3VP3A 1PNEA 4X55A 1N9OA 3SS3A 3SS5A 2WZXA 1H5XA 2PD7A 3EEHA 1XJ6A 4DE1A 2DNSA 5GLAA 3VFHA 3Q81A 1RGZA 4LV2A 4ETXA 4HH2A 5G4YA 4GJ4A 4EU0A 2G2WA 2W0NA 3DTEA 3UB9A 1BTLA 4KQDA 3N8RA 3BWLA 3FZCA 4KZ7A 3TRCA 4P6ZM 1UGUA 4OP8A 4IVKA 2KDKA 4UA7A 3T1XA 3N8LA 5EUAA 1T1BA 3GMWA 2XK1A 1JWZA 4DRTA 1LL8A 1SDEA 4ZDXA 4NXBA 4ZJ3A 3P98A 3MZFA 3O88A 4WL9A 1S4RA 4X1LA 3P01A 4FD8A 3JPUA 2ZC4B 3M2JA 5AJGA 1N9LA 2KLIA 5F1GA 4DE0A 4D2OA 2L4RA 4OQHA 3VE3A 4EUVA 4M4XA 4M3KA 1UWPX 3UN7A 4UQIS 2BLSA 3UO9A 3PBTA 2I72A 2OAP1 4OP5A 1G28A 2WADA 2V1AA 2P9VA 2HF6A 5F69A 4Q0HA 1XPBA 5IHVA 1XJ2A 4X69A 2EX2A 4CLCB 3MQQA 5G4ZA 3VSKA 3ZVWA 1IEMA 4G3VA 3G30A 1FCOA 4ZTKA 1MBLA 1K56A 4DN0A 3DBAA 3S7OA 2JKFA 3W4QA 2H10A 4KZ6A 3T1QB 4IJGA 3OPLA 5CHJA 3LIEA 2HDUA 1RP5A 3SH7A 4R0QA 4FSFA 3KSHA 5DF9A 1M40A 2IWCA 4I5SA 1TS6A 2M1CA 2WAFA 4K0XA 4NG2A 1SCWA 3ZDJA 3OZHA 4HESA 1K57C 5EM1A 5F5YA 4YOFA 3UNWA 1BYWA 2HP6A 3H7WA 3BLSA 3E2LA 3IXBA 2W3HA 5FQKA 3T1RA 1OPXA 1NXYA 1IKGA 4Q0IA 5EVLA 4WMCA 2EA9A 5J4EA 1KOUA 4GHIB 2G2UA 4GS9A 3GV9A 4BWIA 2PDRA 5K5BA 3NC8A 3G34A 2VGJA 2R9XA 1Z6FA 3QNCA 2OWJA 4WBGA 4E3LA 4O8GA 1K55C 3RTYA 3IF6C 1K57A 4KG5A 4B88A 1FR6A 1OTAA 5FEGA 3K2NA 1HTZA 2A3UA 4QY6A 2ZQCA 4PMAA 5TBMB 1JTDA 5AQAA 2JC7A 3IQAA 4JBFA 1ZKJA 2M7UA 4ME4A 3HLFA 3A3DA 3WRZA 4PM8A 2A24B 2VA0A 5EPHA 2ZQ8A 2JN7A 3PAGA 2V0UA 4KZAA 3IWIA 1I5QA 4X1MA 3BLMA 2ZMVA 4GLQA 2VJWA 4KG6A 4R3JA 5TR7A 2PYRA 3QNBA 3UPOA 5FQ9A 2J9OA 2ZC5B 3PR6A 4DDSA 1JWPA 2Z2MB 2VEAA 2ZL1A 2W3FA 4I3AA 2INWA 3HBRA 4Y0TA 1G6AA 5A90A 4OKPA 4F94A 5CRFA 4WZ4A 3G31A 4HHDA 4CLCC 4LV0A 1NWZA 3ZG8B 4B9OA 3RH8B 1IYQA 1K38A 4OQGA 4C3QA 5DFYA 5KSHA 3Q82A 5DF8A 2K7SA 4S2NC 4WF0A 1MWUA 3KYZA 1RCJA 4EQIA 1PWGA 4XUXA 5CEBA 3LFVA 3KYQA 1TS0A 4EBNA 2HJEA 2BTFP 3E4QA 3NOUC 1YSQA 4JXSA 1S1YA 3L7HA 4PM6A 1IFQA 2ZMFA 1D7EA 1XJ4A 5FAPA 1YLJA 2IWBA 1H8ZA 5CGSA 1TEMA 2JKRI 1W63M 2VKSA 3FV7A 5EOEA 3GDIA 1BSGA 3LGOA 3PBRA 1T19A 3F1OA 4FUWA 5CGWA 5EVID 3S22A 2Q0OA 1Y4OA 5F68A 1NRJA 4UHUA 3HJKA 5FEFA 2D02A 3W8KA 1F9IA 4KQQA 1NJ4A 3V3SA 3HJIA 2PHYA 4KZBA 1K56D 5I5LA 3CLOA 4OVDA 3IT9A 3C30A 3UMEA 2QHKA 3U2AA 3U4LP 5A91A 4EBPA 3UB6A 4BD0A 4HQAA 3MR0A 4PKYG 3CPTB 1KVLA 3ITAA 2Y4AA 2XROA 4NXFA 1J9MA 4JGPA 1D06A 2E8JA 2WGIA 3UB5P 5FI6A 1OJGA 3EOIA 1IYOA 1S1ZA 2FFYA 1VQQA 2ZC3B 5FDSA 2ZJ9A 5IS1A 3IWQA 4KZ3A 4ETZA 4H6JA 4KQOA 3CJMA 3G35A 1QMFA 3GRJA 4KZ9A 5FI7A 3HL9A 4Y17A 1YT4A 2JBFA 4WEKA 5J8XA 3HLWA 3HCYA 4U3TA 5HWTA 3TE8A 3IF5A 3NCKA 4NKPA 5DTTA 3IBJA 1L0EA 5FAQA 5M19A 3ZYTA 5KSCA 4RQ9A 3G4PA 3OC2A 5E2GA 3ZNYA 4PM5A 2GZAA 2K31A 4IHQA 2A2LA 5L10A 1ZC2A 4CLCA 1TS7A 3N7WA 4P6ZS 4E3NA 2Y2LA 4G3KA 2WKEA 3CAXA 4GNUA 3MZEA 2EFXA 1LI0A 4EESA 4ARZB 5HD5A 2OAQ1 3C8CA 1DP6A 4X25A 4GZBA 1N4OA 2WKQA 3BFEA 3CITA 5HZHA 1BT5A 2PAVP 1MC0A 3MKEA 3H9WA 4LGWA 3NIAA 3A3FA 2EXBA 3UDXA 1I2SA 2PBYA 1G5UA 3VOYA 4KZ5A 2L1MA 1ACFA 1YLTA 4U0TA 1J3WA 2Z6DA 3NHQA 2Y2GA 1BZAA 3IBRA 1YQSA 3Q1FA 5L07A 2PD8A 3C38A 4QWOA 2RL3A 4ZBEA 5CXWA 4P85A 2Y2NA 1BLCA 4BLMA 4RX2A 1ZG6A 3QP2A 1FCNA 5L2FA 4YINA 4E3KA 3MXSA 5DTKA 1GSWA 5F1FA 3SH9A 1KE3A 1OTIA 1K25A 3AGDA 5A92A 2Y2JA 3GVBA 5EVIC 3WS1A 4UAAA 1MKIA 4NXGA 3IS2A 1GHMA 3IF6A 1MZUA 2VV7A 5IT5A 3NDGA 2XQZA 1L0GA 4F3LA 4JF4A 5HDDA 3R4KA 4WM9A 4QY5A 3S4XA 4K0WA 3W2ZA 2V0WA 2E8IA 2JHEA 3JVUA 3LR5A 1W7FA 4OPZA 2JKTM 2JKGA 4C6YA 3GR2A 5GHYA 4WLAA 4CPKA 3C2WA 1BLHA 1LT0A 2C5WB 2WYXA 4P6BA 4R6LA 3W4OA 5E2HA 2CC1A 2HDRA 3LIBA 1EROA 1XP4A 1K54A 3CG5A 4L9FA 4N9KA 3DTIA 3G2YA 3CZDA 1F5MA 3ZG0A 3QP5A 1YPRA 1SKOA 5EOOA 4CJNA 3NULA 5KIZA 1ONHA 3LCEA 3DTMA 3ZGAB 4R3BA 1DP9A 3QP1A 1TD5A 5F82A 4Z1WA 4IBXA 4B4ZA 1CEGA 4LRXC 1WE4A 4RX3A 3IH9A 5FDHA 2XR0A 4X6TA 2XDMA 3TG9A 4R70A 1E4DA 4OPQA 1Q2PA 2IA2A 2W3EA 4BJPA 3BQ8A 1K6SA 5HWWA 4DJ2A 4MLLA 5HSQA 3WWXA 4LFUA 1N9BA 3PBQA 1ES2A 1KGEA 2V2FF 3OCNA 1S67L 4N92A 1NZOA 2J3WA 5A8BA 4AFIA 3GQZA 5C5KA 3N8SA 5HD3A 1YLWA 3DTKA 4S2PA 3DWZA 2PU4A 2UV0E 4MCWA 1PZOA 2O9BA 3BW6A 3OCLA 3F1NA 4LCLA 4MBKA 2ZQDA 3NY4A 4II7A 4A5RA 3V67A 2NUPC 5FSRA 1Q2QA 1U60A 4IUKA 4UA9A 3IHAA 1EWZA 1XKZA 1PI4A 4OPYA 1WA9A 5E2FA 1PYYA 3BY9A 5CECA 3SH8A 1PI5A 4GB7A 4PM7A 1L2SA 1P97A 4P0MA 3ZG5A 2ZC6B 4LLOB 3QP4A 3NBLA 3EQUA 4HJ4A 5HWVA 3NOTC 3G2ZA 3KO6A 3PBSA 4E3MA 5HDSA 3D72A 2ZC7A 4EW7A 2P74A 2J9PA 4WZ5A 5FQIA 4JLFA 5E2EA 4NK3A 2UWXA 3A3EA 1BUEA 3MQ0A 4R23A 5F83A 1LSVA 2B18A 1SDNA 2W27A 3LIDA 2ACGA 3DW0A 5EVIB 2V8CA 2W3DA 1FSWA 4EEPA 1DJAA 3SW1A 3BYDA 5D3OA 4ESPA 4IBRA 2H28A 3WRTA 1JVJA 1ALQA 1VETA 4DXCA 1ZG4A 5HARA 5GHXA 1KE0A 1K54C 1BLPA 3B33A 3DWKA 3R7WA 2P7JA 3ZFZA 1DJCA 1WYCA 5CERA 1HD8A 1O7EA 4OOYA 4HIAA 1ZHHB 4IVIA 5DJTA 3IHBA 1MWSA 2O0YA 5L8MA 1XJ3A 1K4FA 4JXWA 1CJFA 4I38A 4R1GA 3BEBA 4JKTA 1XXMA 1YLZA 4EEUA 3H82B 4I3IA 4BQMA 5FQQA 5M18A 2X01A 4GKUA 1IOUA 2GJ3A 1STZA 1K6RA 1IYPA 2H0YA 2VZWA 4MEZA 4U0XA 2HJ9C 3KX0X 4QB8A 2A49A 3VOLA 3ZNTA 5MC7A 1CI8A 2QZ6A 3MFXA 5KZHA 3OPRA 2PU2A 4OPRA 4Y3IA 3F1OB 4DMZA 3M2KA 3BQAA 2XA7M 5AQBA 1G68A 3WS5A 4GS9B 4L9EA 4LENA 1ESUA 1NLYA 2J3TD 4ZRRA 2Y55A 4E04A 2WGVA 5JYPA 2QMIA 4DKIA 2W1TA 4QHCA 1NRFA 1FR1A 4Y2FA 1VB6A 4HNBA 3OBFA 2EX9A 5E43A 1ERQA 1W8QA 4O0PA 3PTEA 3C4PA 1DP8A 1YMSA 4N9LA 3T4KA 1AXBA 4P87A 1T1AA 3T1SA 2VGLS 4JGRA 2C6WB 4EBLA 3IX3A 3ZHHA 1D1JA 1ZTUA 1E3UD 1S0WA 1W8YA 4FOFA 3IF6B 5I94A 2JCHA 4ZJ2A 3BJNA 4EUZA 2HV1A 2ZD8A 2V1BA 1TDGA 1E3UA 3BECA 5CHMA 4EXOA 2ZLYA 3CI6A 2GX5A 1RGYA 5KMWA 4BL2A 1JTGA 4HP9A 4GOGA 5CEDA 3O3VA 4Y13A 2WAEA 2FH5A 5HAPA 4MN7A 3RJUA 4FCFA 3UB8A 2EXAA 3Q7VA 5LBRA 3IX8A 4WZ5C 3JVVA 4X56A 2ZM8A 3UDIA 3E4PA 2AVXA 2B95A 2HPBA 2DRWA 4LRYC 2HDSA 5U47A 3O5YA 1E25A 1LHYA 2ZOIA 2BASA 3A3JA 2VK3A 3ZG7B 4PPRA 3LEQA 3ULFA 2FZ0A 4S2KA 3LR3A 1TVFA 4S2MA 4Q0JA 2Y2MA 1SZVA 5J7EA 1NZUA 3HUOA 4ZAMA 3IWOA 4BBVA 2QJ5A 4JXGA 3EGXC 4EERA 3N4IA 4HP4A 2HP5A 3LO7A 5EM0A 4I39A 1WYBA 3C7VA 1NYMA 2Q9MA 4KENB 5HPFA 2HDQA 3H7WB 5FASA 4OQIA 2OV5A 5HPIA 3HLDA 4GD6A 3MBZA 1Z09A 3FC7A 4HBTA 4S2OA 4C75A 2X71A
chains in the Genus database with same CATH topology
4PKYA 4WN5A 2KOIA 3LICA 4L9FA 5F5YA 1YKDA 2WKPA 4YOFA 2W1RA 1BYWA 3H7WA 1F5MA 5FL3A 2W3HA 1OPXA 1T18A 5KIZA 4Q0IA 3F1PB 4R3AA 3T4QA 2EA9A 5J4EA 1KOUA 4GHIB 4GS9A 4QPRA 4BWIA 2PDRA 2YKHA 2CMNA 3NJAA 1DP9A 5K5BA 1V9YA 1TD5A 4Z1WA 2VX8A 3ZQ5A 2G7UA 1OTBA 3NOPC 2OWJA 4O8GA 4LRXC 3RTYA 4KUKA 4HJ6A 5IU1A 3EWKA 1H8MA 2XRNA 3UE6A 3E98A 4R70A 3S7PA 2NUTC 3T50A 1OTAA 4CLCD 5AVFA 4K08A 3K2NA 2IA2A 3VV4A 3BY8A 3RFBA 2W3EA 5TBMB 2QJ7A 3LIAA 4H6JB 2M7UA 4ME4A 4BJPA 3BQ8A 4MDZA 2OWHA 3KSFA 2A24B 5HWWA 2VA0A 3MMHA 2JN7A 1H3QA 2V0UA 4WUJA 1VHMA 4DJ2A 2ZMVA 5HSQA 3LI9A 4GLQA 2VJWA 3A0RA 3CWFA 2PYRA 3PBQA 3OCNA 2PR5A 1S67L 2LB5A 4HY8A 1YAXA 3T4OA 2J3WA 3F1PA 5A8BA 5DKKA 4AFIA 3T4SA 3PR6A 2B02A 3UE3A 1F98A 5C5KA 3PXPA 5HD3A 5DFXA 1P9RA 2VEAA 2W3FA 1OT9A 4I3AA 3UMDA 2OOLA 2INWA 3FG8A 4MCWA 4NEED 2O9BA 3BW6A 3OCLA 3PYPA 4GW9A 4BMWA 3T4JA 3F1NA 3E4OA 4II7A 4HJ3A 3LUQA 3V67A 5F6AA 2NUPC 1OTEA 3P7NA 2VV6A 4HHDA 4IUKA 4I3JA 2P04A 4CLCC 3B47A 5DKLA 1NWZA 3S7QA 4B9OA 1UWNX 3RH8B 5HDCA 1ODVA 3OLOA 1WA9A 1YSPA 5DFYA 5KSHA 2PYPA 4Y5FA 2K7SA 4CQHA 4WF0A 3BY9A 5CX7A 3KYZA 4NXEA 2Z6CA 2KX6A 3D3OA 3LFVA 2MJ6A 3KYQA 1TS0A 1P97A 2HJEA 3E4QA 3NOUC 1YSQA 4LLOB 4WEJA 1S1YA 2D01A 4BBTA 3EQUA 1LSWA 4HJ4A 1IFQA 3PBOA 3NOTC 5HWVA 4B93A 2ZMFA 1D7EA 3CUEC 4EETB 3KO6A 1XJ4A 3PBSA 4XT2A 3H82A 3ICYA 3G6OA 1P0ZA 3T4LA 3A0VA 2EWVA 3EGDC 5HDSA 3D72A 2JKRI 4EW7A 1MKMA 1W63M 2VKSA 1Y28A 3LR0A 3GDIA 2Y8HA 3TJZC 1LSXA 3FPWA 3PBRA 1T19A 3F1OA 4IUHA 3MQ0A 2QKPA 3PBNA 1LSVA 2B18A 3LIFA 2EWWA 2W27A 3LIDA 3A0SA 5F68A 1OTDA 2W3DA 1NRJA 4L9GA 1NLZA 4EEPA 3HJKA 2D02A 2P08A 1F9IA 3SW1A 3R7WB 2DMWA 3OOVA 2I9VA 2ZBBA 3MF0A 2H28A 3HJIA 1TF1A 4LRZE 2PHYA 4PAUA 4HI4A 3IS2B 4HH3A 4GHIA 5I5LA 1OJ5A 2VV8A 3CLOA 3C30A 3UMEA 2QHKA 3U2AA 3B33A 2Y79A 2LB9A 3LYXA 3R7WA 2P7JA 2WKRA 3UB6A 4HQAA 3MR0A 3LI8A 4PKYG 2O99A 4HIAA 1G6OA 2GNXA 1ZHHB 5DJTA 2O0YA 5L8MA 1XJ3A 2XROA 4NXFA 4I38A 4GCZA 4JGPA 4PHTA 1D06A 4LPZA 4JGOA 4EEUA 1OJGA 1X0OA 1GSVA 3EOIA 4UEYA 1S1ZA 3H82B 4I3IA 1TS8A 4JGQA 1IOUA 2GJ3A 5AVEA 2J80A 4XT2B 1STZA 3UB7A 5TBMA 5IS1A 4OOLA 4OOMA 4EQ1A 5TJJA 3EEAA 4YWZA 4H6JA 2VZWA 4ETZA 3GECA 3S7NA 4UQIM 4KQOA 2HJ9C 3KX0X 3VOLA 5MC7A 2W1TB 1JNUA 3MFXA 2O9CA 4Y3IA 2K2NA 5J3WA 3F1OB 4DMZA 2V9AA 3BQAA 2XA7M 4MN5A 4BBUA 4GS9B 4L9EA 4HOIA 3MJQA 4ZRRA 1NLYA 2J3TD 4WEKA 3EQVA 2JKRM 2QWSA 3HCYA 4E04A 5HWTA 2HGVA 3TE8A 2W1TA 3K3CA 1EW0A 4G3WA 4Y2FA 1VB6A 4NKPA 1XFNA 5EFWA 4CLCE 2ZOHA 4HNBA 3OBFA 1OT6A 1V9ZA 3IBJA 1N9OA 3ZYTA 1P9WA 3VE4A 4RQ9A 4O0PA 1GSXA 5DJUA 3OC2A 3TW8A 1DP8A 4KUOA 3T4KA 3MXQA 2L0WA 2PD7A 4DJ3A 3EEHA 1XJ6A 1T1AA 2GZAA 3KSIA 2VGLS 2K31A 2O9AA 4IHQA 4JGRA 4ARZA 2A2LA 4ETXA 4HH2A 4CLCA 5G4YA 1TS7A 1ZTUA 4GJ4A 4L0LA 4EU0A 2YKFA 4P6ZS 2W0NA 3UB9A 4FOFA 1S4SA 4G3KA 4KQDA 3BWLA 3KSGA 1DRMA 3FPVA 3TRCA 3CAXA 4P6ZM 3BJNA 1UGUA 2KDKA 2HV1A 1T1BA 2V1BA 4MN6A 4ARZB 4EESA 5HD5A 2OAQ1 3C8CA 4EXOA 1DP6A 1LL8A 2WKQA 3CITA 5HZHA 2R78A 3CI6A 2GX5A 1MC0A 4NXBA 4O01A 4YNRA 3H9WA 4WL9A 4HP9A 1S4RA 3P01A 4R38A 2L1MA 1T1CA 2Z6DA 3NHQA 5AJGA 1N9LA 3E0YA 2KLIA 3IBRA 2FH5A 3T4TA 4MN7A 2PD8A 3C38A 3UB8A 2L4RA 2XSSA 3B42A 5LBRA 3VE3A 3JVVA 4EUVA 4M4XA 1UWPX 3F1NB 4UQIS 2PR6A 3PBTA 3E4PA 4LRYC 2OAP1 3O5YA 1G28A 1GSWA 2ZOIA 2BASA 2V1AA 3MQOA 2HF6A 1OTIA 5F69A 4Q0HA 1XJ2A 5HL6A 4CLCB 3ULFA 3MQQA 2FZ0A 5G4ZA 4NXGA 4G3VA 3LR3A 3IS2A 1MZUA 2VV7A 4Q0JA 5IT5A 4F3LA 5J7EA 2PT7A 3PHYA 4DN0A 3DBAA 5HDDA 3S7OA 3R4KA 2QYBA 2W3GA 2VGLM 2J3TC 4BBVA 2QJ5A 4IJGA 3EGXC 3W2ZA 4EERA 3LIEA 1N9NA 2V0WA 4HP4A 3K3DA 4FSFA 3KSHA 2JHEA 3JVUA 3LR5A 3CUEA 4I39A 5DF9A 4I5SA 2JKTM 2M7VA 4F3LB 1S66L 2VLGA 5HPFA 1TS6A 4WLAA 3H7WB 1XFQA 2A24A 2M1CA 3C2WA 5HPIA 1LT0A 4MMNA 4WELA 2XA7S 4R6LA 3LIBA 1W63Q 3FC7A 2JKTI 3LR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UB6 A;  4PKY A;  4WN5 A;  3PYP A;  3MR0 A;  3LI8 A;  4HQA A;  3LIC A;  4GW9 A;  4L9F A;  4PKY G;  3C8C A;  5F5Y A;  3F1N A;  1DP6 A;  3E4O A;  4EXO A;  1LL8 A;  2WKP A;  4HIA A;  2WKQ A;  5HZH A;  2R78 A;  1BYW A;  4HJ3 A;  3H7W A;  5DJT A;  3LUQ A;  4NXB A;  5F6A A;  1XJ3 A;  3H9W A;  4WL9 A;  4NXF A;  5J4E A;  4I38 A;  4GCZ A;  4HP9 A;  1OTE A;  1S4R A;  3P7N A;  2VV6 A;  4HHD A;  4JGP A;  1D06 A;  1T18 A;  4I3J A;  5KIZ A;  4LPZ A;  5DKL A;  3F1P B;  4JGO A;  1NWZ A;  4R3A A;  4EEU A;  2EA9 A;  1X0O A;  1OJG A;  1GSV A;  1KOU A;  1S1Z A;  1UWN X;  2L1M A;  1T1C A;  3H82 B;  4GHI B;  4I3I A;  5HDC A;  3RH8 B;  4GS9 A;  1ODV A;  2Z6D A;  3NHQ A;  2PDR A;  1N9L A;  1TS8 A;  1WA9 A;  2YKH A;  2CMN A;  3IBR A;  1DP9 A;  3NJA A;  3OLO A;  4JGQ A;  1V9Y A;  2PD8 A;  2PYP A;  2GJ3 A;  5AVE A;  2J80 A;  2K7S A;  2L4R A;  4WF0 A;  4XT2 B;  3UB8 A;  3BY9 A;  5TBM A;  3UB7 A;  5IS1 A;  3VE3 A;  4EQ1 A;  4M4X A;  4NXE A;  1UWP X;  2Z6C A;  4H6J A;  2KX6 A;  3GEC A;  4YWZ A;  3ZQ5 A;  3F1N B;  3KX0 X;  1OTB A;  3NOP C;  4EES A;  2PR6 A;  2OWJ A;  3VOL A;  3E4P A;  1TS0 A;  1JNU A;  1P97 A;  3MFX A;  3E4Q A;  4LRX C;  4LRY C;  3NOU C;  5HD5 A;  4LLO B;  3RTY A;  1S1Y A;  2D01 A;  4KUK A;  4BBT A;  5J3W A;  3F1O B;  1G28 A;  1LSW A;  4HJ4 A;  5HWV A;  1GSW A;  3NOT C;  2ZOI A;  4HJ6 A;  5IU1 A;  2BAS A;  2V1A A;  2V9A A;  3EWK A;  1D7E A;  4EET B;  1XJ4 A;  3FG8 A;  3MQO A;  4R38 A;  4R70 A;  4XT2 A;  1OTI A;  5F69 A;  3H82 A;  3ICY A;  3UE6 A;  3G6O A;  1P0Z A;  4MN5 A;  3T50 A;  4BBU A;  1OTA A;  4GS9 B;  3A0V A;  4L9E A;  4HOI A;  3MJQ A;  4DJ2 A;  5AVF A;  2WKR A;  4K08 A;  1XJ2 A;  2QWS A;  5HDS A;  3ULF A;  3D72 A;  3MQQ A;  5G4Z A;  5HWT A;  4E04 A;  4EW7 A;  3K3C A;  1EW0 A;  3BY8 A;  4NXG A;  1Y28 A;  5TBM B;  2QJ7 A;  1VB6 A;  3GDI A;  3IS2 A;  3LIA A;  1XFN A;  1MZU A;  5EFW A;  1LSX A;  2ZOH A;  4H6J B;  4HNB A;  2VV7 A;  1T19 A;  1OT6 A;  1V9Z A;  3F1O A;  4F3L A;  5J7E A;  1N9O A;  2OWH A;  3PHY A;  5HDD A;  3VE4 A;  2QKP A;  2A24 B;  5HWW A;  4RQ9 A;  1GSX A;  1LSV A;  2JN7 A;  3LIF A;  2W27 A;  2V0U A;  5DJU A;  1DP8 A;  3LID A;  3A0S A;  4WUJ A;  5F68 A;  4B9O A;  2QJ5 A;  4BBV A;  4EER A;  4KUO A;  1OTD A;  4L9G A;  3LIE A;  3MXQ A;  2L0W A;  1N9N A;  2PD7 A;  2V0W A;  4HP4 A;  3EEH A;  1XJ6 A;  3HJK A;  4DJ3 A;  3K3D A;  4EEP A;  5HSQ A;  2D02 A;  3LI9 A;  1F9I A;  1T1A A;  3SW1 A;  2JHE A;  3A0R A;  4I39 A;  2I9V A;  2ZBB A;  3CWF A;  4JGR A;  2PYR A;  4I5S A;  4HH2 A;  2H28 A;  4F3L B;  5G4Y A;  1S66 L;  1TS7 A;  2PR5 A;  2VLG A;  1S67 L;  3HJI A;  4HY8 A;  1TS6 A;  2YKF A;  4WLA A;  3H7W B;  1XFQ A;  3F1P A;  4LRZ E;  2PHY A;  2A24 A;  2W0N A;  5DKK A;  5A8B A;  2M1C A;  4HI4 A;  3IS2 B;  4HH3 A;  3C2W A;  1S4S A;  3UB9 A;  4GHI A;  5I5L A;  2B02 A;  1F98 A;  1OJ5 A;  2VV8 A;  3BWL A;  4KQD A;  1LT0 A;  5HD3 A;  3CLO A;  1DRM A;  4R6L A;  2VEA A;  3UME A;  3CAX A;  2QHK A;  3B33 A;  3FC7 A;  3LIB A;  3LYX A;  1UGU A;  2KDK A;  1OT9 A;  4I3A A;  3UMD A;  2OOL A;  2INW A;  2P7J A;  2HV1 A;  1T1B A;  2V1B A;  4MN6 A; 
#chains in the Genus database with same CATH topology
 4WN5 A;  2KOI A;  2Y2O A;  1YKD A;  4H8R A;  2W1R A;  2DCF A;  1W79 A;  5FL3 A;  3FKV A;  1XGI A;  3HLG A;  1XGJ A;  4Z9Q A;  1GA0 A;  4R3A A;  3WS0 A;  2XEP A;  3UY6 A;  2Y2K A;  5GLB A;  3P09 A;  2YKH A;  3T12 B;  1GA9 A;  2XLN A;  3CPT A;  2G7U A;  3NI9 A;  4HEF A;  1OTB A;  3NOP C;  3CMZ A;  4Y7P A;  4KUK A;  4HJ6 A;  5IU1 A;  2EX6 A;  3UE6 A;  3WS2 A;  5AQ7 A;  3T50 A;  4CLC D;  3LEZ A;  4EWF A;  3RXX A;  5AVF A;  4N1X A;  1MXO A;  5GLD A;  3O87 A;  5CTM A;  2X02 A;  3ZVT A;  3RFB A;  3MS6 A;  5HL1 A;  5CHU A;  4H6J B;  1GHP A;  1HVB A;  1H3Q A;  1VHM A;  1CF0 A;  3LY4 A;  4UA6 A;  2ZQ9 A;  3LI9 A;  4DF6 A;  2BG1 A;  4KZ8 A;  3A0R A;  3CWF A;  2PR5 A;  2LB5 A;  4LV1 A;  3T4O A;  2V8F A;  3F1P A;  5JYO A;  2B02 A;  3UE3 A;  1F98 A;  3PXP A;  1SKO B;  3OPH A;  1VEU B;  5HX9 A;  5DFX A;  1P9R A;  1PW8 A;  1OT9 A;  3HUN A;  2OOL A;  3FG8 A;  4N1H A;  4NEE D;  3PYP A;  4BMW A;  3E4O A;  3GTC A;  1MY8 A;  5GHZ A;  5F6A A;  3BFF A;  3SS4 A;  1ES5 A;  1OTE A;  2OLV A;  3UE1 A;  4X68 A;  2P04 A;  2VGK A;  2EX8 A;  1UWN X;  5HDC A;  3C4O A;  1PIO A;  2Y2H A;  3OLO A;  2PYP A;  4Y5F A;  3V3R A;  5CX7 A;  3W4P A;  1GHI A;  4NXE A;  3D9Y A;  3D3O A;  2MJ6 A;  2WZZ A;  5GLC A;  4WEJ A;  2D01 A;  4BBT A;  2R9W A;  4XT2 A;  3D4F A;  3H82 A;  3G6O A;  3A0V A;  3V39 A;  4S2L A;  3EGD C;  4QJG A;  4OH0 A;  1MKM A;  1BUL A;  2RCX A;  4FTX A;  1Y28 A;  3LR0 A;  2Y8H A;  3TJZ C;  3FPW A;  3V50 A;  5FAO A;  2ZQA A;  3LIF A;  3FKW A;  1CQA A;  3A0S A;  3HLB A;  5FQJ A;  1OTD A;  4L9G A;  1NLZ A;  2IWD A;  2P08 A;  1PWC A;  4O7D A;  2DMW A;  2Y2P A;  5FAT A;  2I9V A;  2ZBB A;  5EE8 A;  1LL5 A;  1FCM A;  1TF1 A;  1XX2 A;  4BL3 A;  2WGW A;  4HI4 A;  3GSG A;  3IS2 B;  4KG2 A;  4GHI A;  3ITB A;  4E3O A;  5HW3 A;  3LYX A;  3QP8 A;  3NEC A;  2WKR A;  5TGF A;  1KGF A;  1DY6 A;  3LI8 A;  3Q07 A;  2O99 A;  3MKF A;  4GN2 A;  3VP0 A;  5EEC A;  2HP9 A;  1ESI A;  4GCZ A;  1KGG A;  3AGE A;  3MZD A;  3OPP A;  4KQR A;  4PHT A;  2J8Y A;  4LPZ A;  1GSV A;  3FYZ A;  3PAE A;  1MPL A;  1TS8 A;  3BFC A;  3C5A A;  3IH8 A;  4JGQ A;  1ES4 A;  3E2K A;  5AVE A;  1A0K A;  5TBM A;  4OOM A;  4EQ1 A;  5TJJ A;  3EEA A;  4YWZ A;  4NET A;  2WUQ A;  3GEC A;  4UQI M;  2XGN A;  3HLE A;  4XUZ A;  1FOF A;  1CI9 A;  1JNU A;  1SKF A;  4HBU A;  1KDW A;  4RVA A;  2O9C A;  4BEN A;  2K2N A;  3VP1 A;  5J3W A;  5CTN A;  2Q9N A;  1H8Y A;  4MN5 A;  4BBU A;  4WMC D;  2QPN A;  4HOI A;  3MJQ A;  2JKR M;  4Y0O A;  1XA1 A;  1OME A;  1PW1 A;  3TSG A;  1F2K A;  5EFW A;  3JYI A;  4E6X A;  2Y2I A;  1P9W A;  3VE4 A;  2P9V B;  3LY3 A;  1GSX A;  1VM1 A;  4YFM A;  5DJU A;  3TW8 A;  1ES3 A;  4KUO A;  1JWV A;  3MXQ A;  2L0W A;  4Q8I A;  4DJ3 A;  1XA7 A;  4X53 A;  3KSI A;  2B5R A;  4ID4 A;  2O9A A;  1I2W A;  5DVA A;  4ARZ A;  3L9K A;  5M1A A;  1AWI A;  4L0L A;  2YKF A;  1LI9 A;  1S4S A;  2OLU A;  4S2I A;  3BFG A;  3KSG A;  2V20 A;  1DRM A;  3FPV A;  5L09 A;  5HAQ A;  4JF6 A;  4MN6 A;  3B3X A;  2J7V A;  3VMA A;  2R78 A;  3IXD A;  3VP4 A;  4O01 A;  1BLS A;  4YNR A;  3SOI A;  3BRM A;  4R38 A;  3WS4 A;  1T1C A;  3E0Y A;  3T4T A;  3VFF A;  1NYY A;  4R4S A;  3KYE A;  2XSS A;  3B42 A;  1FIL A;  3RXW A;  3F1N B;  3QHY A;  2PR6 A;  3O86 A;  2XFT A;  4R4R A;  4JPM A;  5FA7 A;  2Y59 A;  4DDY A;  3MQO A;  5A93 A;  5HL6 A;  1QME A;  5EV0 A;  1KE4 A;  3S1Y A;  2PT7 A;  3BM6 A;  4RYE A;  1MWT A;  1MWR A;  3PHY A;  2QYB A;  3IXG A;  3AGF A;  2W3G A;  4KZ4 A;  2VGL M;  2J3T C;  1N9N A;  3K3D A;  3CUE A;  3NDE A;  2M7V A;  4F3L B;  1S66 L;  2VLG A;  1XFQ A;  3G32 A;  2A24 A;  5BOH A;  3MFD A;  3IXH A;  4MMN A;  4WEL A;  2XA7 S;  3Q7Z A;  1SHV A;  1W63 Q;  2XD1 A;  2JKT I;  3M6B A;  3LR4 A;  5EVI A;  4PKY A;  5G18 A;  3LIC A;  2WKP A;  1GCE A;  2WKH A;  4JXV A;  3N6I A;  3HRE A;  4QD4 A;  4DE3 A;  1T18 A;  4FH4 A;  4OQ0 A;  4Y15 A;  3F1P B;  3T4Q A;  5FI2 A;  4QPR A;  2CMN A;  3NJA A;  2XF3 A;  1V9Y A;  1FSY A;  1IEL A;  1IYS A;  2VX8 A;  3ZQ5 A;  5HAI A;  3C7U A;  4IED A;  5DTS A;  1IKI A;  1EI5 A;  1FIK A;  2WK0 A;  1HLU P;  1PZP A;  4S2N A;  3EWK A;  1H8M A;  2XRN A;  3E98 A;  3S7P A;  2NUT C;  1KDS A;  3M6H A;  4K08 A;  4GDN A;  1C3B A;  1LL9 A;  3ISG A;  3VV4 A;  4E6W A;  3BY8 A;  2ZQ7 A;  2QJ7 A;  3LIA A;  3FWL A;  3HVF A;  4OLG A;  4LCM A;  3ZCZ A;  4MDZ A;  2OWH A;  4OLD A;  3KSF A;  4EV4 A;  3MMH A;  4WUJ A;  1W5D A;  2Z2L B;  3SZT A;  4OON A;  4JF5 A;  4HY8 A;  1YAX A;  5DKK A;  3VP2 A;  3T4S A;  1CEF A;  3MXR A;  2Y2Q A;  4XXR A;  4BD1 A;  3UMD A;  4DE2 A;  1K0K A;  4GW9 A;  3T4J A;  3IX4 A;  4QU3 A;  4HJ3 A;  3LUQ A;  2JE5 A;  2PRF A;  2OSU A;  1S6R A;  4PM9 A;  4DXB A;  3P7N A;  2VV6 A;  4I3J A;  3B47 A;  5DKL A;  3S7Q A;  2WGW B;  1ODV A;  1CK3 A;  4S2J A;  1YSP A;  3UE0 A;  4CQH A;  2EFU A;  2Z6C A;  1YMX A;  2KX6 A;  4GDB A;  2GDN A;  1LLB A;  2HZ5 A;  1LSW A;  3MSH A;  3PBO A;  4B93 A;  2ZM0 A;  3BFD A;  3CUE C;  4EET B;  3A3I A;  3UDF A;  3ICY A;  3HUM A;  1P0Z A;  2XD5 A;  4MNR A;  3T4L A;  2EWV A;  2XH9 A;  3ZG9 B;  1L3L A;  2Y91 A;  3UPP A;  2V1Z A;  3V5M A;  4LV3 A;  5TFQ A;  3UPN A;  1HZO A;  3Q7V B;  1LSX A;  1DJB A;  1YM1 A;  4GD8 A;  4ZJ1 A;  4IUH A;  1PRQ A;  5CGX A;  2QKP A;  2ZL1 B;  3PBN A;  1VET B;  2EWW A;  4MBH A;  1PWD A;  1H0M A;  1VEU A;  3VOZ A;  4E3J A;  1YLY A;  3R7W B;  5DF7 A;  1Y54 A;  3OOV A;  4Y0U A;  3MF0 A;  4RA7 A;  4FH2 A;  3QP6 A;  1PFL A;  2H5S A;  4LRZ E;  4PAU A;  4HH3 A;  1K4E A;  2H0T A;  4K91 A;  1OJ5 A;  2VV8 A;  1YLP A;  2Y79 A;  2LB9 A;  5HFO A;  1FQG A;  1G6O A;  2GNX A;  1TDL A;  4B4X A;  2ZMA A;  4JGO A;  1X0O A;  4UEY A;  1ONG A;  4E3I A;  5FQM A;  4MBF A;  4WYY A;  2PBD P;  2J80 A;  4XT2 B;  5GL9 A;  3UB7 A;  1L0F A;  5EVE A;  4OOL A;  3S7N A;  2XFS A;  5AQ9 A;  4D60 A;  3VSL A;  2W1T B;  3DAV A;  1KVM A;  1M6K A;  2FFF B;  2ZM2 A;  1K55 A;  1ERM A;  2V9A A;  1L0D A;  1O07 A;  3TOI A;  3HLC A;  3EQV A;  2QWS A;  2HGV A;  3CHW P;  3K3C A;  1EW0 A;  4G3W A;  1XFN A;  4CLC E;  2ZOH A;  2WKI A;  1NY0 A;  1OT6 A;  1V9Z A;  3I7J A;  3VP3 A;  1PNE A;  4X55 A;  1N9O A;  3SS3 A;  3SS5 A;  2WZX A;  1H5X A;  2PD7 A;  3EEH A;  1XJ6 A;  4DE1 A;  2DNS A;  5GLA A;  3VFH A;  3Q81 A;  1RGZ A;  4LV2 A;  4ETX A;  4HH2 A;  5G4Y A;  4GJ4 A;  4EU0 A;  2G2W A;  2W0N A;  3DTE A;  3UB9 A;  1BTL A;  4KQD A;  3N8R A;  3BWL A;  3FZC A;  4KZ7 A;  3TRC A;  4P6Z M;  1UGU A;  4OP8 A;  4IVK A;  2KDK A;  4UA7 A;  3T1X A;  3N8L A;  5EUA A;  1T1B A;  3GMW A;  2XK1 A;  1JWZ A;  4DRT A;  1LL8 A;  1SDE A;  4ZDX A;  4NXB A;  4ZJ3 A;  3P98 A;  3MZF A;  3O88 A;  4WL9 A;  1S4R A;  4X1L A;  3P01 A;  4FD8 A;  3JPU A;  2ZC4 B;  3M2J A;  5AJG A;  1N9L A;  2KLI A;  5F1G A;  4DE0 A;  4D2O A;  2L4R A;  4OQH A;  3VE3 A;  4EUV A;  4M4X A;  4M3K A;  1UWP X;  3UN7 A;  4UQI S;  2BLS A;  3UO9 A;  3PBT A;  2I72 A;  2OAP 1;  4OP5 A;  1G28 A;  2WAD A;  2V1A A;  2P9V A;  2HF6 A;  5F69 A;  4Q0H A;  1XPB A;  5IHV A;  1XJ2 A;  4X69 A;  2EX2 A;  4CLC B;  3MQQ A;  5G4Z A;  3VSK A;  3ZVW A;  1IEM A;  4G3V A;  3G30 A;  1FCO A;  4ZTK A;  1MBL A;  1K56 A;  4DN0 A;  3DBA A;  3S7O A;  2JKF A;  3W4Q A;  2H10 A;  4KZ6 A;  3T1Q B;  4IJG A;  3OPL A;  5CHJ A;  3LIE A;  2HDU A;  1RP5 A;  3SH7 A;  4R0Q A;  4FSF A;  3KSH A;  5DF9 A;  1M40 A;  2IWC A;  4I5S A;  1TS6 A;  2M1C A;  2WAF A;  4K0X A;  4NG2 A;  1SCW A;  3ZDJ A;  3OZH A;  4HES A;  1K57 C;  5EM1 A;  5F5Y A;  4YOF A;  3UNW A;  1BYW A;  2HP6 A;  3H7W A;  3BLS A;  3E2L A;  3IXB A;  2W3H A;  5FQK A;  3T1R A;  1OPX A;  1NXY A;  1IKG A;  4Q0I A;  5EVL A;  4WMC A;  2EA9 A;  5J4E A;  1KOU A;  4GHI B;  2G2U A;  4GS9 A;  3GV9 A;  4BWI A;  2PDR A;  5K5B A;  3NC8 A;  3G34 A;  2VGJ A;  2R9X A;  1Z6F A;  3QNC A;  2OWJ A;  4WBG A;  4E3L A;  4O8G A;  1K55 C;  3RTY A;  3IF6 C;  1K57 A;  4KG5 A;  4B88 A;  1FR6 A;  1OTA A;  5FEG A;  3K2N A;  1HTZ A;  2A3U A;  4QY6 A;  2ZQC A;  4PMA A;  5TBM B;  1JTD A;  5AQA A;  2JC7 A;  3IQA A;  4JBF A;  1ZKJ A;  2M7U A;  4ME4 A;  3HLF A;  3A3D A;  3WRZ A;  4PM8 A;  2A24 B;  2VA0 A;  5EPH A;  2ZQ8 A;  2JN7 A;  3PAG A;  2V0U A;  4KZA A;  3IWI A;  1I5Q A;  4X1M A;  3BLM A;  2ZMV A;  4GLQ A;  2VJW A;  4KG6 A;  4R3J A;  5TR7 A;  2PYR A;  3QNB A;  3UPO A;  5FQ9 A;  2J9O A;  2ZC5 B;  3PR6 A;  4DDS A;  1JWP A;  2Z2M B;  2VEA A;  2ZL1 A;  2W3F A;  4I3A A;  2INW A;  3HBR A;  4Y0T A;  1G6A A;  5A90 A;  4OKP A;  4F94 A;  5CRF A;  4WZ4 A;  3G31 A;  4HHD A;  4CLC C;  4LV0 A;  1NWZ A;  3ZG8 B;  4B9O A;  3RH8 B;  1IYQ A;  1K38 A;  4OQG A;  4C3Q A;  5DFY A;  5KSH A;  3Q82 A;  5DF8 A;  2K7S A;  4S2N C;  4WF0 A;  1MWU A;  3KYZ A;  1RCJ A;  4EQI A;  1PWG A;  4XUX A;  5CEB A;  3LFV A;  3KYQ A;  1TS0 A;  4EBN A;  2HJE A;  2BTF P;  3E4Q A;  3NOU C;  1YSQ A;  4JXS A;  1S1Y A;  3L7H A;  4PM6 A;  1IFQ A;  2ZMF A;  1D7E A;  1XJ4 A;  5FAP A;  1YLJ A;  2IWB A;  1H8Z A;  5CGS A;  1TEM A;  2JKR I;  1W63 M;  2VKS A;  3FV7 A;  5EOE A;  3GDI A;  1BSG A;  3LGO A;  3PBR A;  1T19 A;  3F1O A;  4FUW A;  5CGW A;  5EVI D;  3S22 A;  2Q0O A;  1Y4O A;  5F68 A;  1NRJ A;  4UHU A;  3HJK A;  5FEF A;  2D02 A;  3W8K A;  1F9I A;  4KQQ A;  1NJ4 A;  3V3S A;  3HJI A;  2PHY A;  4KZB A;  1K56 D;  5I5L A;  3CLO A;  4OVD A;  3IT9 A;  3C30 A;  3UME A;  2QHK A;  3U2A A;  3U4L P;  5A91 A;  4EBP A;  3UB6 A;  4BD0 A;  4HQA A;  3MR0 A;  4PKY G;  3CPT B;  1KVL A;  3ITA A;  2Y4A A;  2XRO A;  4NXF A;  1J9M A;  4JGP A;  1D06 A;  2E8J A;  2WGI A;  3UB5 P;  5FI6 A;  1OJG A;  3EOI A;  1IYO A;  1S1Z A;  2FFY A;  1VQQ A;  2ZC3 B;  5FDS A;  2ZJ9 A;  5IS1 A;  3IWQ A;  4KZ3 A;  4ETZ A;  4H6J A;  4KQO A;  3CJM A;  3G35 A;  1QMF A;  3GRJ A;  4KZ9 A;  5FI7 A;  3HL9 A;  4Y17 A;  1YT4 A;  2JBF A;  4WEK A;  5J8X A;  3HLW A;  3HCY A;  4U3T A;  5HWT A;  3TE8 A;  3IF5 A;  3NCK A;  4NKP A;  5DTT A;  3IBJ A;  1L0E A;  5FAQ A;  5M19 A;  3ZYT A;  5KSC A;  4RQ9 A;  3G4P A;  3OC2 A;  5E2G A;  3ZNY A;  4PM5 A;  2GZA A;  2K31 A;  4IHQ A;  2A2L A;  5L10 A;  1ZC2 A;  4CLC A;  1TS7 A;  3N7W A;  4P6Z S;  4E3N A;  2Y2L A;  4G3K A;  2WKE A;  3CAX A;  4GNU A;  3MZE A;  2EFX A;  1LI0 A;  4EES A;  4ARZ B;  5HD5 A;  2OAQ 1;  3C8C A;  1DP6 A;  4X25 A;  4GZB A;  1N4O A;  2WKQ A;  3BFE A;  3CIT A;  5HZH A;  1BT5 A;  2PAV P;  1MC0 A;  3MKE A;  3H9W A;  4LGW A;  3NIA A;  3A3F A;  2EXB A;  3UDX A;  1I2S A;  2PBY A;  1G5U A;  3VOY A;  4KZ5 A;  2L1M A;  1ACF A;  1YLT A;  4U0T A;  1J3W A;  2Z6D A;  3NHQ A;  2Y2G A;  1BZA A;  3IBR A;  1YQS A;  3Q1F A;  5L07 A;  2PD8 A;  3C38 A;  4QWO A;  2RL3 A;  4ZBE A;  5CXW A;  4P85 A;  2Y2N A;  1BLC A;  4BLM A;  4RX2 A;  1ZG6 A;  3QP2 A;  1FCN A;  5L2F A;  4YIN A;  4E3K A;  3MXS A;  5DTK A;  1GSW A;  5F1F A;  3SH9 A;  1KE3 A;  1OTI A;  1K25 A;  3AGD A;  5A92 A;  2Y2J A;  3GVB A;  5EVI C;  3WS1 A;  4UAA A;  1MKI A;  4NXG A;  3IS2 A;  1GHM A;  3IF6 A;  1MZU A;  2VV7 A;  5IT5 A;  3NDG A;  2XQZ A;  1L0G A;  4F3L A;  4JF4 A;  5HDD A;  3R4K A;  4WM9 A;  4QY5 A;  3S4X A;  4K0W A;  3W2Z A;  2V0W A;  2E8I A;  2JHE A;  3JVU A;  3LR5 A;  1W7F A;  4OPZ A;  2JKT M;  2JKG A;  4C6Y A;  3GR2 A;  5GHY A;  4WLA A;  4CPK A;  3C2W A;  1BLH A;  1LT0 A;  2C5W B;  2WYX A;  4P6B A;  4R6L A;  3W4O A;  5E2H A;  2CC1 A;  2HDR A;  3LIB A;  1ERO A;  1XP4 A;  1K54 A;  3CG5 A;  4L9F A;  4N9K A;  3DTI A;  3G2Y A;  3CZD A;  1F5M A;  3ZG0 A;  3QP5 A;  1YPR A;  1SKO A;  5EOO A;  4CJN A;  3NUL A;  5KIZ A;  1ONH A;  3LCE A;  3DTM A;  3ZGA B;  4R3B A;  1DP9 A;  3QP1 A;  1TD5 A;  5F82 A;  4Z1W A;  4IBX A;  4B4Z A;  1CEG A;  4LRX C;  1WE4 A;  4RX3 A;  3IH9 A;  5FDH A;  2XR0 A;  4X6T A;  2XDM A;  3TG9 A;  4R70 A;  1E4D A;  4OPQ A;  1Q2P A;  2IA2 A;  2W3E A;  4BJP A;  3BQ8 A;  1K6S A;  5HWW A;  4DJ2 A;  4MLL A;  5HSQ A;  3WWX A;  4LFU A;  1N9B A;  3PBQ A;  1ES2 A;  1KGE A;  2V2F F;  3OCN A;  1S67 L;  4N92 A;  1NZO A;  2J3W A;  5A8B A;  4AFI A;  3GQZ A;  5C5K A;  3N8S A;  5HD3 A;  1YLW A;  3DTK A;  4S2P A;  3DWZ A;  2PU4 A;  2UV0 E;  4MCW A;  1PZO A;  2O9B A;  3BW6 A;  3OCL A;  3F1N A;  4LCL A;  4MBK A;  2ZQD A;  3NY4 A;  4II7 A;  4A5R A;  3V67 A;  2NUP C;  5FSR A;  1Q2Q A;  1U60 A;  4IUK A;  4UA9 A;  3IHA A;  1EWZ A;  1XKZ A;  1PI4 A;  4OPY A;  1WA9 A;  5E2F A;  1PYY A;  3BY9 A;  5CEC A;  3SH8 A;  1PI5 A;  4GB7 A;  4PM7 A;  1L2S A;  1P97 A;  4P0M A;  3ZG5 A;  2ZC6 B;  4LLO B;  3QP4 A;  3NBL A;  3EQU A;  4HJ4 A;  5HWV A;  3NOT C;  3G2Z A;  3KO6 A;  3PBS A;  4E3M A;  5HDS A;  3D72 A;  2ZC7 A;  4EW7 A;  2P74 A;  2J9P A;  4WZ5 A;  5FQI A;  4JLF A;  5E2E A;  4NK3 A;  2UWX A;  3A3E A;  1BUE A;  3MQ0 A;  4R23 A;  5F83 A;  1LSV A;  2B18 A;  1SDN A;  2W27 A;  3LID A;  2ACG A;  3DW0 A;  5EVI B;  2V8C A;  2W3D A;  1FSW A;  4EEP A;  1DJA A;  3SW1 A;  3BYD A;  5D3O A;  4ESP A;  4IBR A;  2H28 A;  3WRT A;  1JVJ A;  1ALQ A;  1VET A;  4DXC A;  1ZG4 A;  5HAR A;  5GHX A;  1KE0 A;  1K54 C;  1BLP A;  3B33 A;  3DWK A;  3R7W A;  2P7J A;  3ZFZ A;  1DJC A;  1WYC A;  5CER A;  1HD8 A;  1O7E A;  4OOY A;  4HIA A;  1ZHH B;  4IVI A;  5DJT A;  3IHB A;  1MWS A;  2O0Y A;  5L8M A;  1XJ3 A;  1K4F A;  4JXW A;  1CJF A;  4I38 A;  4R1G A;  3BEB A;  4JKT A;  1XXM A;  1YLZ A;  4EEU A;  3H82 B;  4I3I A;  4BQM A;  5FQQ A;  5M18 A;  2X01 A;  4GKU A;  1IOU A;  2GJ3 A;  1STZ A;  1K6R A;  1IYP A;  2H0Y A;  2VZW A;  4MEZ A;  4U0X A;  2HJ9 C;  3KX0 X;  4QB8 A;  2A49 A;  3VOL A;  3ZNT A;  5MC7 A;  1CI8 A;  2QZ6 A;  3MFX A;  5KZH A;  3OPR A;  2PU2 A;  4OPR A;  4Y3I A;  3F1O B;  4DMZ A;  3M2K A;  3BQA A;  2XA7 M;  5AQB A;  1G68 A;  3WS5 A;  4GS9 B;  4L9E A;  4LEN A;  1ESU A;  1NLY A;  2J3T D;  4ZRR A;  2Y55 A;  4E04 A;  2WGV A;  5JYP A;  2QMI A;  4DKI A;  2W1T A;  4QHC A;  1NRF A;  1FR1 A;  4Y2F A;  1VB6 A;  4HNB A;  3OBF A;  2EX9 A;  5E43 A;  1ERQ A;  1W8Q A;  4O0P A;  3PTE A;  3C4P A;  1DP8 A;  1YMS A;  4N9L A;  3T4K A;  1AXB A;  4P87 A;  1T1A A;  3T1S A;  2VGL S;  4JGR A;  2C6W B;  4EBL A;  3IX3 A;  3ZHH A;  1D1J A;  1ZTU A;  1E3U D;  1S0W A;  1W8Y A;  4FOF A;  3IF6 B;  5I94 A;  2JCH A;  4ZJ2 A;  3BJN A;  4EUZ A;  2HV1 A;  2ZD8 A;  2V1B A;  1TDG A;  1E3U A;  3BEC A;  5CHM A;  4EXO A;  2ZLY A;  3CI6 A;  2GX5 A;  1RGY A;  5KMW A;  4BL2 A;  1JTG A;  4HP9 A;  4GOG A;  5CED A;  3O3V A;  4Y13 A;  2WAE A;  2FH5 A;  5HAP A;  4MN7 A;  3RJU A;  4FCF A;  3UB8 A;  2EXA A;  3Q7V A;  5LBR A;  3IX8 A;  4WZ5 C;  3JVV A;  4X56 A;  2ZM8 A;  3UDI A;  3E4P A;  2AVX A;  2B95 A;  2HPB A;  2DRW A;  4LRY C;  2HDS A;  5U47 A;  3O5Y A;  1E25 A;  1LHY A;  2ZOI A;  2BAS A;  3A3J A;  2VK3 A;  3ZG7 B;  4PPR A;  3LEQ A;  3ULF A;  2FZ0 A;  4S2K A;  3LR3 A;  1TVF A;  4S2M A;  4Q0J A;  2Y2M A;  1SZV A;  5J7E A;  1NZU A;  3HUO A;  4ZAM A;  3IWO A;  4BBV A;  2QJ5 A;  4JXG A;  3EGX C;  4EER A;  3N4I A;  4HP4 A;  2HP5 A;  3LO7 A;  5EM0 A;  4I39 A;  1WYB A;  3C7V A;  1NYM A;  2Q9M A;  4KEN B;  5HPF A;  2HDQ A;  3H7W B;  5FAS A;  4OQI A;  2OV5 A;  5HPI A;  3HLD A;  4GD6 A;  3MBZ A;  1Z09 A;  3FC7 A;  4HBT A;  4S2O A;  4C75 A;  2X71 A; 
#chains in the Genus database with same CATH homology
 4PKY A;  4WN5 A;  2KOI A;  3LIC A;  4L9F A;  5F5Y A;  1YKD A;  2WKP A;  4YOF A;  2W1R A;  1BYW A;  3H7W A;  1F5M A;  5FL3 A;  2W3H A;  1OPX A;  1T18 A;  5KIZ A;  4Q0I A;  3F1P B;  4R3A A;  3T4Q A;  2EA9 A;  5J4E A;  1KOU A;  4GHI B;  4GS9 A;  4QPR A;  4BWI A;  2PDR A;  2YKH A;  2CMN A;  3NJA A;  1DP9 A;  5K5B A;  1V9Y A;  1TD5 A;  4Z1W A;  2VX8 A;  3ZQ5 A;  2G7U A;  1OTB A;  3NOP C;  2OWJ A;  4O8G A;  4LRX C;  3RTY A;  4KUK A;  4HJ6 A;  5IU1 A;  3EWK A;  1H8M A;  2XRN A;  3UE6 A;  3E98 A;  4R70 A;  3S7P A;  2NUT C;  3T50 A;  1OTA A;  4CLC D;  5AVF A;  4K08 A;  3K2N A;  2IA2 A;  3VV4 A;  3BY8 A;  3RFB A;  2W3E A;  5TBM B;  2QJ7 A;  3LIA A;  4H6J B;  2M7U A;  4ME4 A;  4BJP A;  3BQ8 A;  4MDZ A;  2OWH A;  3KSF A;  2A24 B;  5HWW A;  2VA0 A;  3MMH A;  2JN7 A;  1H3Q A;  2V0U A;  4WUJ A;  1VHM A;  4DJ2 A;  2ZMV A;  5HSQ A;  3LI9 A;  4GLQ A;  2VJW A;  3A0R A;  3CWF A;  2PYR A;  3PBQ A;  3OCN A;  2PR5 A;  1S67 L;  2LB5 A;  4HY8 A;  1YAX A;  3T4O A;  2J3W A;  3F1P A;  5A8B A;  5DKK A;  4AFI A;  3T4S A;  3PR6 A;  2B02 A;  3UE3 A;  1F98 A;  5C5K A;  3PXP A;  5HD3 A;  5DFX A;  1P9R A;  2VEA A;  2W3F A;  1OT9 A;  4I3A A;  3UMD A;  2OOL A;  2INW A;  3FG8 A;  4MCW A;  4NEE D;  2O9B A;  3BW6 A;  3OCL A;  3PYP A;  4GW9 A;  4BMW A;  3T4J A;  3F1N A;  3E4O A;  4II7 A;  4HJ3 A;  3LUQ A;  3V67 A;  5F6A A;  2NUP C;  1OTE A;  3P7N A;  2VV6 A;  4HHD A;  4IUK A;  4I3J A;  2P04 A;  4CLC C;  3B47 A;  5DKL A;  1NWZ A;  3S7Q A;  4B9O A;  1UWN X;  3RH8 B;  5HDC A;  1ODV A;  3OLO A;  1WA9 A;  1YSP A;  5DFY A;  5KSH A;  2PYP A;  4Y5F A;  2K7S A;  4CQH A;  4WF0 A;  3BY9 A;  5CX7 A;  3KYZ A;  4NXE A;  2Z6C A;  2KX6 A;  3D3O A;  3LFV A;  2MJ6 A;  3KYQ A;  1TS0 A;  1P97 A;  2HJE A;  3E4Q A;  3NOU C;  1YSQ A;  4LLO B;  4WEJ A;  1S1Y A;  2D01 A;  4BBT A;  3EQU A;  1LSW A;  4HJ4 A;  1IFQ A;  3PBO A;  3NOT C;  5HWV A;  4B93 A;  2ZMF A;  1D7E A;  3CUE C;  4EET B;  3KO6 A;  1XJ4 A;  3PBS A;  4XT2 A;  3H82 A;  3ICY A;  3G6O A;  1P0Z A;  3T4L A;  3A0V A;  2EWV A;  3EGD C;  5HDS A;  3D72 A;  2JKR I;  4EW7 A;  1MKM A;  1W63 M;  2VKS A;  1Y28 A;  3LR0 A;  3GDI A;  2Y8H A;  3TJZ C;  1LSX A;  3FPW A;  3PBR A;  1T19 A;  3F1O A;  4IUH A;  3MQ0 A;  2QKP A;  3PBN A;  1LSV A;  2B18 A;  3LIF A;  2EWW A;  2W27 A;  3LID A;  3A0S A;  5F68 A;  1OTD A;  2W3D A;  1NRJ A;  4L9G A;  1NLZ A;  4EEP A;  3HJK A;  2D02 A;  2P08 A;  1F9I A;  3SW1 A;  3R7W B;  2DMW A;  3OOV A;  2I9V A;  2ZBB A;  3MF0 A;  2H28 A;  3HJI A;  1TF1 A;  4LRZ E;  2PHY A;  4PAU A;  4HI4 A;  3IS2 B;  4HH3 A;  4GHI A;  5I5L A;  1OJ5 A;  2VV8 A;  3CLO A;  3C30 A;  3UME A;  2QHK A;  3U2A A;  3B33 A;  2Y79 A;  2LB9 A;  3LYX A;  3R7W A;  2P7J A;  2WKR A;  3UB6 A;  4HQA A;  3MR0 A;  3LI8 A;  4PKY G;  2O99 A;  4HIA A;  1G6O A;  2GNX A;  1ZHH B;  5DJT A;  2O0Y A;  5L8M A;  1XJ3 A;  2XRO A;  4NXF A;  4I38 A;  4GCZ A;  4JGP A;  4PHT A;  1D06 A;  4LPZ A;  4JGO A;  4EEU A;  1OJG A;  1X0O A;  1GSV A;  3EOI A;  4UEY A;  1S1Z A;  3H82 B;  4I3I A;  1TS8 A;  4JGQ A;  1IOU A;  2GJ3 A;  5AVE A;  2J80 A;  4XT2 B;  1STZ A;  3UB7 A;  5TBM A;  5IS1 A;  4OOL A;  4OOM A;  4EQ1 A;  5TJJ A;  3EEA A;  4YWZ A;  4H6J A;  2VZW A;  4ETZ A;  3GEC A;  3S7N A;  4UQI M;  4KQO A;  2HJ9 C;  3KX0 X;  3VOL A;  5MC7 A;  2W1T B;  1JNU A;  3MFX A;  2O9C A;  4Y3I A;  2K2N A;  5J3W A;  3F1O B;  4DMZ A;  2V9A A;  3BQA A;  2XA7 M;  4MN5 A;  4BBU A;  4GS9 B;  4L9E A;  4HOI A;  3MJQ A;  4ZRR A;  1NLY A;  2J3T D;  4WEK A;  3EQV A;  2JKR M;  2QWS A;  3HCY A;  4E04 A;  5HWT A;  2HGV A;  3TE8 A;  2W1T A;  3K3C A;  1EW0 A;  4G3W A;  4Y2F A;  1VB6 A;  4NKP A;  1XFN A;  5EFW A;  4CLC E;  2ZOH A;  4HNB A;  3OBF A;  1OT6 A;  1V9Z A;  3IBJ A;  1N9O A;  3ZYT A;  1P9W A;  3VE4 A;  4RQ9 A;  4O0P A;  1GSX A;  5DJU A;  3OC2 A;  3TW8 A;  1DP8 A;  4KUO A;  3T4K A;  3MXQ A;  2L0W A;  2PD7 A;  4DJ3 A;  3EEH A;  1XJ6 A;  1T1A A;  2GZA A;  3KSI A;  2VGL S;  2K31 A;  2O9A A;  4IHQ A;  4JGR A;  4ARZ A;  2A2L A;  4ETX A;  4HH2 A;  4CLC A;  5G4Y A;  1TS7 A;  1ZTU A;  4GJ4 A;  4L0L A;  4EU0 A;  2YKF A;  4P6Z S;  2W0N A;  3UB9 A;  4FOF A;  1S4S A;  4G3K A;  4KQD A;  3BWL A;  3KSG A;  1DRM A;  3FPV A;  3TRC A;  3CAX A;  4P6Z M;  3BJN A;  1UGU A;  2KDK A;  2HV1 A;  1T1B A;  2V1B A;  4MN6 A;  4ARZ B;  4EES A;  5HD5 A;  2OAQ 1;  3C8C A;  4EXO A;  1DP6 A;  1LL8 A;  2WKQ A;  3CIT A;  5HZH A;  2R78 A;  3CI6 A;  2GX5 A;  1MC0 A;  4NXB A;  4O01 A;  4YNR A;  3H9W A;  4WL9 A;  4HP9 A;  1S4R A;  3P01 A;  4R38 A;  2L1M A;  1T1C A;  2Z6D A;  3NHQ A;  5AJG A;  1N9L A;  3E0Y A;  2KLI A;  3IBR A;  2FH5 A;  3T4T A;  4MN7 A;  2PD8 A;  3C38 A;  3UB8 A;  2L4R A;  2XSS A;  3B42 A;  5LBR A;  3VE3 A;  3JVV A;  4EUV A;  4M4X A;  1UWP X;  3F1N B;  4UQI S;  2PR6 A;  3PBT A;  3E4P A;  4LRY C;  2OAP 1;  3O5Y A;  1G28 A;  1GSW A;  2ZOI A;  2BAS A;  2V1A A;  3MQO A;  2HF6 A;  1OTI A;  5F69 A;  4Q0H A;  1XJ2 A;  5HL6 A;  4CLC B;  3ULF A;  3MQQ A;  2FZ0 A;  5G4Z A;  4NXG A;  4G3V A;  3LR3 A;  3IS2 A;  1MZU A;  2VV7 A;  4Q0J A;  5IT5 A;  4F3L A;  5J7E A;  2PT7 A;  3PHY A;  4DN0 A;  3DBA A;  5HDD A;  3S7O A;  3R4K A;  2QYB A;  2W3G A;  2VGL M;  2J3T C;  4BBV A;  2QJ5 A;  4IJG A;  3EGX C;  3W2Z A;  4EER A;  3LIE A;  1N9N A;  2V0W A;  4HP4 A;  3K3D A;  4FSF A;  3KSH A;  2JHE A;  3JVU A;  3LR5 A;  3CUE A;  4I39 A;  5DF9 A;  4I5S A;  2JKT M;  2M7V A;  4F3L B;  1S66 L;  2VLG A;  5HPF A;  1TS6 A;  4WLA A;  3H7W B;  1XFQ A;  2A24 A;  2M1C A;  3C2W A;  5HPI A;  1LT0 A;  4MMN A;  4WEL A;  2XA7 S;  4R6L A;  3LIB A;  1W63 Q;  3FC7 A;  2JKT I;  3LR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...