1EW0A

Crystal structure analysis of the sensor domain of rmfixl(ferrous form)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
130
structure length
130
Chain Sequence
GSHMLETEDVVRARDAHLRSILDTVPDATVVSATDGTIVSFNAAAVRQFGYAEEEVIGQNLRILMPEPYRHEHDGYLQRYMATGEKRIIGIDRVVSGQRKDGSTFPMKLAVGEMRSGGERFFTGFIRDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIXL
publication title Sensory mechanism of oxygen sensor FixL from Rhizobium meliloti: crystallographic, mutagenesis and resonance Raman spectroscopic studies
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Transferase
total genus 37
structure length 130
sequence length 130
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2000-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ew0A00
3FG8A 1LSVA 1TS6A 4H6JA 4HOIA 3A0RA 3E4OA 4GS9A 4LLOB 3PYPA 3UB8A 5HSQA 4K08A 3H9WA 3LIAA 4I3IA 1N9OA 4HJ4A 2QWSA 3EWKA 2VV8A 4R38A 2V0UA 4DJ3A 1S1YA 1LSWA 1S4RA 4I38A 2V0WA 3NJAA 4M4XA 4EESA 3H7WB 1TS7A 2VV7A 3F1PB 3A0SA 2QJ7A 1Y28A 4R70A 4LRZE 5F69A 1ODVA 3K3DA 3B33A 1OTDA 2V9AA 4L9GA 5G4ZA 3FC7A 5F68A 4BBVA 3H7WA 5J7EA 5I5LA 1V9YA 3F1PA 1OT9A 3GECA 4HIAA 3LI8A 1XJ3A 5DKLA 1S4SA 4KUOA 5TBMB 1GSXA 1XJ4A 3G6OA 3NHQA 5AVFA 5HDDA 1DP8A 1N9LA 4HP9A 2YKHA 4MN6A 3NOUC 5KIZA 1T1AA 2A24B 3MR0A 4HJ3A 1UWNX 3EEHA 5EFWA 4HQAA 2EA9A 3IBRA 4NXFA 4NXBA 4HNBA 2K7SA 2B02A 3ULFA 4E04A 2A24A 2L0WA 2L4RA 1DP6A 4BBUA 1TS8A 2QKPA 4GCZA 1V9ZA 5IU1A 3P7NA 1T1CA 3CLOA 3GDIA 2GJ3A 3H82B 2VLGA 3BWLA 3IS2B 1OTIA 4NXGA 5F5YA 1N9NA 3F1OB 3LIBA 2ZOIA 5J3WA 2PDRA 2WKQA 4L9EA 3H82A 3MQOA 1DRMA 4LRXC 3C8CA 3IS2A 2OWJA 1XJ2A 2R78A 1D06A 4LPZA 3MJQA 2QHKA 3F1OA 2V1BA 2Z6CA 1NWZA 4HI4A 4WL9A 1OJGA 2I9VA 4PKYA 1LSXA 1GSWA 3KX0X 3MQQA 2D02A 5F6AA 2WKRA 3E4PA 3VE3A 4EETB 3CAXA 2W0NA 4F3LB 4I3AA 4KUKA 2OWHA 1DP9A 3NOTC 2OOLA 1T1BA 5HD5A 3T50A 2KX6A 3ICYA 1OTEA 3VE4A 3HJIA 2CMNA 4NXEA 3HJKA 2VEAA 1WA9A 3LI9A 5DJTA 1XJ6A 5HDSA 4LRYC 4B9OA 4F3LA 1S66L 1GSVA 3LUQA 4I39A 1S67L 3NOPC 3K3CA 3OLOA 2PYPA 1JNUA 3LYXA 3UMDA 1D7EA 2W27A 5A8BA 2JHEA 4EXOA 3C2WA 5G4YA 5HWWA 4EEPA 2PR5A 2JN7A 3ZQ5A 3UB7A 4DJ2A 3VOLA 3LIFA 4GHIA 4I3JA 3SW1A 1OJ5A 5DKKA 4RQ9A 2INWA 5HD3A 3E4QA 4MN5A 5HZHA 1P0ZA 4HY8A 2QJ5A 3UE6A 1XFNA 2BASA 1EW0A 3A0VA 2J80A 1G28A 4EEUA 4EW7A 2PD8A 1OT6A 5HWTA 3MXQA 4R3AA 1OTAA 4JGPA 2VV6A 3BY8A 1P97A 4JGOA 2Z6DA 1UWPX 3UMEA 2PHYA 5J4EA 4KQDA 4L9FA 4JGRA 1T18A 3RTYA 4XT2B 2WKPA 2PYRA 3UB6A 1TS0A 4R6LA 4I5SA 2HV1A 5HWVA 1F9IA 3BY9A 3CWFA 4XT2A 3F1NB 3LIEA 4HP4A 3PHYA 1BYWA 2P7JA 5IS1A 1S1ZA 2PR6A 4HH2A 1X0OA 4EERA 2M1CA 1F98A 3MFXA 3LICA 2D01A 4GHIB 2L1MA 3F1NA 4HH3A 2V1AA 4HHDA 5HDCA 4WLAA 4JGQA 1MZUA 3UB9A 4YWZA 1OTBA 5TBMA 2KDKA 2YKFA 3RH8B 4WF0A 1LL8A 3D72A 4WUJA 1LT0A 1KOUA 4HJ6A 4H6JB 2PD7A 4GS9B 4WN5A 2ZBBA 4GW9A 3LIDA 4EQ1A 2ZOHA 1T19A 2H28A 5DJUA 4BBTA 1UGUA 1VB6A 4PKYG 1XFQA 5AVEA
chains in the Genus database with same CATH superfamily
2XRNA 3A3DA 3FG8A 5HARA 4GS9A 1XX2A 3PYPA 2J9OA 1PWGA 4K08A 2Q0OA 3SH8A 1N9OA 1NY0A 3IH8A 3ZG5A 2QWSA 5FQIA 1Z09A 2VV8A 4R1GA 5F1GA 1SDEA 4DJ3A 5CTMA 3NJAA 3ZDJA 2IWBA 1TS7A 3F1PB 4OOYA 4S2IA 3PTEA 1Y28A 1BLHA 5F69A 4X69A 3GTCA 2Y2KA 4L9GA 3VP4A 5G4ZA 5M19A 3FC7A 3LR4A 4KQOA 4DRTA 3MZEA 1QMEA 1Y4OA 2O0YA 2XF3A 3WRTA 4IEDA 3GVBA 2JC7A 1NRJA 3WRZA 3F1PA 3VP2A 4DF6A 2QMIA 4ZJ2A 2DRWA 3LCEA 3LEZA 1PNEA 4B88A 3WS5A 1NXYA 4MLLA 3BQAA 3LI8A 4KUOA 4BL2A 3OPPA 3OC2A 5TBMB 2HP6A 3ZVWA 1GSXA 3P09A 1NYMA 3G32A 3U4LP 1HZOA 4ZJ1A 2RCXA 2YKHA 4MN6A 1PWCA 4LV1A 3QNBA 4RYEA 3O3VA 4FH2A 2ZM0A 4CJNA 4KZ6A 3QP5A 1N4OA 2B95A 3OCLA 4HNBA 1JVJA 2V1ZA 4IHQA 5F82A 4S2PA 4WMCA 2L0WA 5KZHA 3K2NA 3OPLA 1MWTA 5M1AA 1YLWA 3QP4A 3DAVA 3S1YA 3GDIA 2GJ3A 3H82B 3HLCA 1OTIA 2OLUA 2JKTI 4Y5FA 4DKIA 1YM1A 1N9NA 3IWOA 3CITA 3F1OB 5DTKA 2ZOIA 1ES2A 4ZTKA 3HREA 3O88A 2PDRA 2WUQA 2NUTC 1SDNA 3MBZA 3H82A 1F5MA 1K4EA 1J9MA 1FQGA 2HDSA 4KENB 1XJ2A 3DTEA 1ES5A 1PZPA 1D06A 3GRJA 4LPZA 3RXWA 2QHKA 3F1OA 3LGOA 4DN0A 3CMZA 5KSCA 5DFXA 2UV0E 3B3XA 3A3EA 2Z6CA 1NWZA 4HI4A 4WL9A 4ARZB 4Y0TA 3IHAA 1SZVA 4NETA 3DTKA 3VE3A 2WZZA 3CAXA 4E3LA 4F3LB 4KUKA 3S7PA 2OWHA 1W63Q 1PI5A 1LL5A 3QP6A 4ARZA 3IF6B 2PBDP 2WKHA 4QY5A 3MXSA 3BFEA 4N1HA 4DE2A 5CEBA 3LEQA 3LI9A 3ISGA 4GDNA 4UA9A 5HDSA 1YQSA 4F3LA 1K56A 2EFXA 2GNXA 3V3SA 4I39A 4UAAA 3OLOA 4OOMA 2V8CA 2P04A 3IF6A 2Y2IA 1J3WA 5FA7A 1BLPA 1CEGA 4EXOA 3OZHA 3PXPA 2M7VA 4K0XA 5HL6A 3V67A 3ZQ5A 3NDEA 3LR5A 5TJJA 4GHIA 2O9CA 5FQQA 4IVKA 3EEAA 4FCFA 4MBHA 2HP9A 3P98A 4I3JA 1L0GA 4UQIS 1OJ5A 4IBRA 2J9PA 5HD3A 2XDMA 4ME4A 4MN5A 4JXSA 1DJAA 2V8FA 4IUHA 5FATA 3ITBA 1P0ZA 4GZBA 4NK3A 4OKPA 1KVMA 4MBFA 5L07A 2Q9MA 5FDHA 3Q07A 3OPRA 4LCLA 4ZAMA 3HLDA 5L8MA 1CQAA 5FAPA 4UA7A 2O99A 4R3AA 2VGLM 3HL9A 3VSKA 3T4KA 3BY8A 1NZUA 3C7VA 3JPUA 2W3GA 3HUOA 2ZC6B 3PBTA 4XXRA 4L9FA 4BD1A 3RTYA 4XT2B 4L0LA 3MQ0A 4HBTA 1BLSA 2XROA 3LO7A 5GHXA 4I5SA 2HV1A 5FI2A 2ZQ8A 4JBFA 3BY9A 2Z2LB 3NIAA 4P6ZM 1SCWA 3F1NB 4XT2A 1XXMA 3BM6A 3HLEA 3KYQA 1S1ZA 4IJGA 1YMXA 2K31A 3BLMA 4HH2A 3NC8A 4BJPA 3CPTB 3SH9A 4CLCC 2D01A 3RFBA 2L1MA 3F1NA 3CJMA 4HH3A 2V1AA 3BFGA 3C4OA 4R23A 5HDCA 2J3WA 1E3UA 1CEFA 1MKMA 1YMSA 3UB9A 1CI9A 1OTBA 1GA9A 1AXBA 3CPTA 2KDKA 2YKFA 3T4QA 4WF0A 1W79A 5HAIA 3WS2A 4GDBA 2PD7A 3Q7ZA 1QMFA 5JYPA 5HL1A 3T1RA 2O9AA 1T19A 4GD6A 2H28A 5FQJA 2ZJ9A 1S0WA 4PKYG 4QD4A 3OBFA 2VGJA 4PHTA 2ZL1B 3R4KA 1KGEA 1O07A 3UB8A 3MS6A 2WKEA 1ERMA 2K2NA 5FQKA 2Y8HA 5HPIA 1EWZA 2MJ6A 3EWKA 3AGEA 3WS4A 4RA7A 1SHVA 1LSWA 1D1JA 2V0WA 4EESA 3IX8A 2XA7M 5A90A 2VV7A 2EFUA 3MKFA 2ZC4B 4JKTA 2H5SA 2QJ7A 4R70A 3T4LA 1ODVA 3CI6A 1TD5A 2V9AA 2JKRM 2WADA 1HTZA 1RP5A 2O9BA 4G3KA 4BLMA 1Y54A 5J7EA 4OPZA 1W5DA 2Y2MA 4X68A 3TW8A 1IOUA 4KZAA 1VETB 4DE3A 2ZQCA 3G6OA 3WWXA 3NHQA 1IELA 3UDIA 2UWXA 3G2YA 3ZYTA 1K6RA 1PZOA 1LLBA 5FQMA 2QZ6A 3NOUC 5A92A 5KIZA 2W3HA 1T1AA 1VETA 1SKOB 4YFMA 4R3BA 5TR7A 3JVUA 4GB7A 2OSUA 4HQAA 1G5UA 4PAUA 3IBRA 4KZBA 1IYPA 1IFQA 1A0KA 5DTSA 5HAPA 4CPKA 2A49A 1JWVA 3ULFA 4DDSA 5L09A 1JTGA 4GKUA 1OMEA 1SKOA 1FOFA 2X02A 4O0PA 1KGFA 4CLCB 1AWIA 4O8GA 3W4QA 4MEZA 4GCZA 1I2WA 3CLOA 4Z9QA 3IS2B 3NULA 4NXGA 3L9KA 5MC7A 1WYBA 4CLCA 1BT5A 3DTMA 1Q2QA 3DBAA 2G7UA 5J3WA 4KQQA 3V39A 2VX8A 3MQOA 4E3OA 5FI7A 3C8CA 3IS2A 1ESUA 1G6AA 3PR6A 4PM8A 3IF6C 4HEFA 2NUPC 4PM9A 5L2FA 2R9WA 1YSPA 2QYBA 4PMAA 3ZFZA 1SKFA 2Y2PA 4HBUA 4G3WA 3ZG8B 3D3OA 1XA7A 4Y13A 4P6BA 1LSXA 4OQIA 3MQQA 5DTTA 4N9LA 2WKRA 4PPRA 5EVID 4I3AA 1L0DA 5FAQA 1K55C 3G34A 3NOTC 3OOVA 3NCKA 1T1BA 2EWVA 3KSGA 2HDRA 2ZMFA 5FQ9A 3CUEC 1H8YA 4B4XA 1XKZA 5K5BA 5GL9A 3D9YA 3SS4A 3VE4A 2J7VA 3V50A 4Z1WA 3QP2A 4OQ0A 3PBNA 5DJTA 3TJZC 1XJ6A 4B9OA 1S66L 4KZ7A 1ESIA 3ZG0A 3VOYA 1FR1A 2C5WB 1JNUA 3LYXA 4E3JA 4NKPA 2VK3A 1XA1A 1MWRA 2BTFP 4GOGA 2W3DA 1ZG6A 4ETZA 4N9KA 3UO9A 3HLWA 5A8BA 1MY8A 3HUMA 5DVAA 2AVXA 3C2WA 5G4YA 5HWWA 2EX8A 3V3RA 1OPXA 2PR5A 2WAEA 4FUWA 3UPOA 3N8LA 4JF4A 4KZ3A 3VOLA 1XPBA 3ZNYA 3S7OA 4YOFA 5CERA 3W4PA 1JWZA 5E43A 5CEDA 3SW1A 3C4PA 4B93A 3GMWA 4ZRRA 5FL3A 3TRCA 1FSWA 4P85A 3GV9A 4Y7PA 2IWDA 2XFSA 5TFQA 5CXWA 2W1TA 1LL9A 4EEUA 1G6OA 4EW7A 2PRFA 3EQVA 1N9BA 2DNSA 3VP3A 4ETXA 3MXQA 3OCNA 2RL3A 2VV6A 4QY6A 5GLAA 5FSRA 2J3TD 1IEMA 2OAP1 3UY6A 4WYYA 1H0MA 5J4EA 3BFFA 1CI8A 1T18A 1U60A 2E8JA 4OONA 4GNUA 1L3LA 1WE4A 3KYEA 2Y59A 1GCEA 1L0EA 4CLCE 2PYRA 3HVFA 5IHVA 3QP8A 3T4TA 3UB6A 4A5RA 1TS0A 4KZ9A 3S7NA 3FV7A 4PM7A 2Y2LA 4C75A 1F9IA 3UDFA 4S2MA 3FYZA 3LIEA 2H0YA 2V2FF 5E2FA 2ZQ9A 5IS1A 4O7DA 4EBPA 2Y2HA 3EOIA 1HVBA 2PU4A 4UA6A 4EERA 2M1CA 4QWOA 5CGSA 4KG2A 1FSYA 1MWSA 2EXAA 4GHIB 3VV4A 4U0TA 4KG5A 4R4SA 4UEYA 3ZVTA 1YLTA 4WMCD 4BQMA 2ZMAA 4ZJ3A 3FZCA 4OPRA 1KE3A 4MDZA 1KOUA 3WS1A 2KLIA 1K55A 4HJ6A 1YAXA 4MNRA 4C6YA 4WZ4A 2OV5A 3CUEA 2VZWA 3TE8A 1PW8A 2FZ0A 4RX3A 4S2KA 5DJUA 4R4RA 4PM6A 2A2LA 2EX9A 2HDUA 5AVEA 1ZKJA 4MCWA 5EOOA 3ZHHA 1TS6A 4HOIA 3A0RA 3E4OA 2WGVA 4LLOB 4EUZA 5HSQA 4UQIM 3H9WA 3LIAA 4I3IA 3BJNA 4JF5A 4R38A 1ERQA 3G30A 2P74A 2VKSA 3SS5A 3U2AA 1S1YA 1S4RA 3QHYA 4I38A 3OPHA 3MSHA 4Y0OA 5LBRA 3A0SA 3E2LA 2VA0A 5EUAA 3HLGA 2HP5A 1TVFA 1TEMA 1OTDA 2LB5A 4NG2A 2IA2A 1CJFA 4NEED 5G18A 4BBVA 4F94A 3N8RA 2B5RA 4KG6A 3FPWA 1V9YA 1ALQA 4OP5A 3GECA 4HIAA 4OOLA 3VSLA 2XGNA 4EQIA 3T12B 1K56D 1C3BA 1XJ3A 3G35A 3MFDA 5DKLA 5AQ7A 4ZBEA 5DFYA 4B4ZA 3CHWP 1S4SA 2PT7A 3C38A 4Q0JA 3G2ZA 3I7JA 4FTXA 5HDDA 1KE4A 1NLYA 4LV0A 4MN7A 2BLSA 2XK1A 1H8MA 3P01A 1YLZA 4UHUA 1K57C 4QPRA 4XUXA 1UWNX 5EFWA 1RGZA 1PYYA 3JVVA 4OVDA 2EA9A 5BOHA 4NXBA 2K7SA 4FD8A 5CX7A 3A3FA 5FI6A 2Y79A 3D4FA 1PW1A 4E04A 4X53A 1EROA 4JXGA 1TS8A 2QKPA 3HLBA 3ZG7B 4LV3A 1TDGA 4BENA 2X71A 3T4JA 4XUZA 4X1LA 1NZOA 3HCYA 5E2HA 5F1FA 2WGWB 3G31A 2X01A 4JXVA 5TGFA 2P9VA 3T4OA 5KSHA 3LIBA 2XA7S 3MZDA 3Q1FA 1DJBA 4L9EA 1K4FA 4DXCA 4LRXC 2WGWA 2OWJA 1VQQA 2R78A 2A3UA 2B18A 3E98A 1HLUP 2HGVA 4P0MA 2IWCA 1MXOA 5CTNA 5L10A 1STZA 1OJGA 2ACGA 2Y2NA 1ZTUA 2I9VA 1VHMA 3KX0X 3E4PA 3KO6A 4EETB 5HAQA 2W0NA 3PBSA 1G68A 3NDGA 1BZAA 3B47A 1EI5A 2OOLA 1L0FA 4MMNA 5HD5A 2XH9A 1HD8A 2JKGA 2KX6A 5JYOA 5IT5A 2Y2QA 3ICYA 4ID4A 3CZDA 1BUEA 4X55A 2CMNA 4NXEA 3HJKA 2VEAA 4N1XA 1WA9A 5FEGA 5GLCA 4LRYC 4Q8IA 4GD8A 1GSVA 1E3UD 3VOZA 3SS3A 4P87A 5EVLA 3UMDA 1S6RA 2XD5A 4KZ4A 3AGFA 4E3MA 1D7EA 2EX2A 5CHUA 2W3FA 4S2NC 1YKDA 2JHEA 4N92A 4EEPA 1YLYA 1KGGA 2JN7A 5FEFA 3TOIA 3UB7A 1GHIA 1GHPA 3LIFA 3GQZA 3HLFA 2Y4AA 4D2OA 3SZTA 3DWZA 2JKTM 5DKKA 4DDYA 1I2SA 2INWA 3IT9A 2LB9A 3E4QA 5HX9A 1XGJA 3PBRA 4JLFA 1BSGA 2QPNA 5U47A 4HY8A 1PFLA 2WZXA 3ZG9B 4D60A 2BASA 3A0VA 4ZDXA 1YLPA 3BEBA 1GA0A 2FH5A 3BW6A 4CQHA 2HF6A 3VP1A 5HWTA 3VMAA 1K57A 2WGIA 4GN2A 2GZAA 4JGOA 3UMEA 4YNRA 3IXGA 2PHYA 1TF1A 1W8YA 3RXXA 4JGRA 1MC0A 1K6SA 4FSFA 5GHZA 4X56A 3CG5A 3NECA 4O01A 5AQ9A 1M6KA 4IBXA 2JKRI 3AGDA 3T4SA 5HWVA 2EXBA 5CRFA 5A93A 1ZC2A 2HJEA 5EOEA 1BYWA 2XFTA 4IVIA 2XD1A 5F83A 2PR6A 5E2EA 5AJGA 5E2GA 3R7WB 1F98A 3MFXA 3E0YA 3N8SA 4AFIA 4II7A 5EE8A 2R9XA 3LICA 1ONGA 1M40A 1MPLA 3EGXC 1FCNA 4HHDA 1IYSA 2OLVA 1PIOA 4WLAA 4JGQA 1MZUA 4U0XA 3IXHA 1H3QA 2C6WB 2FFYA 2Y2OA 5TBMA 3R7WA 2WKIA 4U3TA 4E3KA 3RH8B 1ACFA 2VJWA 3D72A 4WUJA 3GSGA 1LT0A 2V20A 3IH9A 2W1TB 3KSFA 3S7QA 4H6JB 4QU3A 1P9WA 4WN5A 3C7UA 3LIDA 3BQ8A 4X1MA 4EQ1A 1FIKA 1ES3A 2ZOHA 4YINA 5EPHA 4CLCD 3M2KA 4BBTA 1XP4A 3ZNTA 1XFQA 4BD0A 3KYZA 1LSVA 3O87A 4H6JA 2E8IA 1H5XA 4DXBA 5HW3A 1PI4A 4QJGA 3PBQA 4QHCA 3PAEA 4HESA 4HJ4A 3UE0A 3UPPA 3T1SA 5KMWA 2V0UA 4M3KA 3VFHA 2EX6A 5FDSA 3N6IA 2ZM2A 1NYYA 4M4XA 1KE0A 4OQGA 3H7WB 4S2NA 2P08A 4EV4A 3BLSA 2H0TA 4E3IA 3S4XA 4KQRA 3BFDA 5EV0A 4OPQA 4LRZE 3S22A 3K3DA 3B33A 3IQAA 4OLGA 1FR6A 4Y2FA 3T1XA 3T1QB 5J8XA 5FAOA 1MWUA 3ZCZA 4ESPA 5F68A 1E25A 3C5AA 2ZC3B 2Y2GA 5CHMA 3H7WA 3M2JA 3IXDA 2H10A 5I5LA 3UE1A 2WAFA 3UE3A 4IUKA 1LHYA 3EGDC 1OT9A 2JCHA 1DJCA 2OAQ1 3IF5A 5GLDA 2W1RA 4PM5A 3G4PA 5C5KA 1W63M 4S2OA 2PAVP 1JWPA 3LY3A 4LGWA 4LENA 1XJ4A 5M18A 3IXBA 1P9RA 5AVFA 3KSHA 1DP8A 1N9LA 1CF0A 4HP9A 1FCOA 3M6HA 4WEKA 1ES4A 4Y17A 4JXWA 4DMZA 5EM0A 2A24B 4X6TA 3MR0A 4HJ3A 2HDQA 3EEHA 3UN7A 2HZ5A 4NXFA 3VP0A 2B02A 1CK3A 1I5QA 1VEUB 4GJ4A 1TDLA 4OQHA 2A24A 2EWWA 2L4RA 1DP6A 1Z6FA 3FWLA 4BBUA 4FH4A 2XR0A 5EM1A 1V9ZA 3JYIA 5IU1A 2JBFA 3P7NA 1T1CA 2ZMVA 3QNCA 2HJ9C 2VLGA 1K54C 3BWLA 3A3JA 2GX5A 4GLQA 2BG1A 2VGLS 1VEUA 5EECA 4E6WA 5F5YA 1JTDA 2Y2JA 3MKEA 3N4IA 5EVIC 5AQAA 4H8RA 3A3IA 3O5YA 4DE0A 1ZHHB 1BTLA 2WKQA 4WEJA 1K0KA 4K91A 4BWIA 1DRMA 3ITAA 4FOFA 5DF7A 3VFFA 3MXRA 2G2UA 1O7EA 3IWQA 3MJQA 2WK0A 2V1BA 4EBLA 3DWKA 1NLZA 3W8KA 1DY6A 1PRQA 3Q7VB 4P6ZS 1FCMA 2FFFB 4WZ5C 4PKYA 5GLBA 1GSWA 2XEPA 1XGIA 2D02A 4EBNA 5F6AA 4BL3A 3IBJA 1RCJA 3SOIA 3QP1A 1DP9A 3O86A 1GHMA 3FKVA 4R0QA 3T50A 3Q7VA 1F2KA 3MZFA 1OTEA 1IYQA 3ZGAB 5FASA 4WELA 3HJIA 3LFVA 1BLCA 1ONHA 2Q9NA 1Q2PA 3L7HA 2PBYA 4C3QA 1YSQA 3LUQA 4OPYA 4JPMA 3MMHA 4K0WA 1S67L 4MBKA 3NOPC 3FKWA 3K3CA 4E6XA 3NBLA 3IWIA 3KSIA 2J8YA 2PU2A 2PYPA 4BMWA 3BECA 3UDXA 3B42A 2VGKA 3GR2A 1LI9A 4LV2A 3IX4A 4R3JA 3LR3A 3N7WA 5DF9A 2W27A 3LR0A 1IYOA 1ZG4A 1PWDA 1KDWA 1NJ4A 2ZC5B 4EWFA 1W8QA 4DJ2A 2W3EA 2P9VB 5EVEA 5A91A 4KZ8A 3PBOA 1NRFA 1YPRA 3BYDA 2ZC7A 5CGXA 5CGWA 2J3TC 2JE5A 1L2SA 3IX3A 4RQ9A 5GHYA 3WS0A 3DW0A 5CECA 3BRMA 5HZHA 3TG9A 2ZQAA 5I94A 2QJ5A 3UE6A 1XFNA 3HBRA 1EW0A 4G3VA 2J80A 1K38A 2Y91A 1G28A 3BFCA 2GDNA 4RX2A 1IKIA 4QB8A 2PD8A 1OT6A 2XSSA 5HPFA 2KOIA 1VM1A 1OTAA 1KDSA 4OLDA 4JGPA 1P97A 2Z6DA 4WBGA 1UWPX 3W4OA 3SH7A 4OH0A 5HFOA 2ZL1A 2Z2MB 3V5MA 4KQDA 1YLJA 3UB5P 4LFUA 3LY4A 1W7FA 4EUVA 2Y55A 3E2KA 2WKPA 5EVIB 5AQBA 3C30A 2ZQ7A 2HPBA 4Q0HA 4EU0A 4R6LA 4KZ5A 2DCFA 3TSGA 5CHJA 1BULA 4Y15A 1MKIA 1K54A 4RVAA 2XLNA 3IHBA 4Y0UA 2WYXA 3UPNA 3CWFA 4Y3IA 2DMWA 2I72A 4HP4A 3PHYA 5EVIA 2XQZA 2P7JA 3EQUA 2ZD8A 1MBLA 4X25A 4Q0IA 5D3OA 2CC1A 1X0OA 1WYCA 1FILA 3NI9A 2ZLYA 2ZQDA 4E3NA 3DTIA 4OP8A 2G2WA 3PAGA 1KVLA 1LI0A 4YWZA 1YT4A 3HUNA 3Q81A 1H8ZA 4WZ5A 1LL8A 1E4DA 2M7UA 3Q82A 1K25A 3FPVA 3NY4A 4S2JA 4GS9B 2ZBBA 4GW9A 3UNWA 3M6BA 4S2LA 3W2ZA 4DE1A 4WM9A 4LCMA 1IKGA 4JF6A 2ZM8A 5DF8A 1UGUA 1RGYA 2JKFA 3MF0A 1VB6A 3RJUA
chains in the Genus database with same CATH topology
2XRNA 3FG8A 4MCWA 1LSVA 4PHTA 1TS6A 4H6JA 3R4KA 4HOIA 3A0RA 3E4OA 4GS9A 4LLOB 3PYPA 3UB8A 2K2NA 5HSQA 4K08A 4UQIM 3H9WA 3LIAA 4I3IA 2Y8HA 1N9OA 3PBQA 5HPIA 3BJNA 4HJ4A 2QWSA 2MJ6A 3EWKA 2VV8A 4R38A 2V0UA 4DJ3A 2VKSA 3U2AA 1S1YA 1LSWA 1S4RA 4I38A 2V0WA 3NJAA 4M4XA 4EESA 3H7WB 2P08A 1TS7A 2XA7M 2VV7A 3F1PB 3A0SA 5LBRA 2VA0A 2QJ7A 1Y28A 4R70A 3T4LA 4LRZE 5F69A 1ODVA 3K3DA 3B33A 3CI6A 1OTDA 1TD5A 2V9AA 4L9GA 2JKRM 5G4ZA 2LB5A 4Y2FA 3FC7A 3LR4A 4KQOA 2IA2A 4NEED 2O9BA 4G3KA 5F68A 4BBVA 2O0YA 3H7WA 1NRJA 3FPWA 5J7EA 5I5LA 1V9YA 3F1PA 3UE3A 4IUKA 3EGDC 1OT9A 3GECA 4HIAA 4OOLA 3TW8A 2OAQ1 3BQAA 2W1RA 3LI8A 5C5KA 1IOUA 1W63M 1XJ3A 5DKLA 5DFYA 1S4SA 4KUOA 2PT7A 3OC2A 5TBMB 3C38A 1GSXA 4Q0JA 1XJ4A 3G6OA 1P9RA 3NHQA 5AVFA 3KSHA 5HDDA 1DP8A 1N9LA 4HP9A 1NLYA 3ZYTA 4MN7A 2YKHA 4WEKA 4MN6A 3NOUC 1H8MA 5KIZA 3P01A 2W3HA 4DMZA 1T1AA 2A24B 3MR0A 4HJ3A 4QPRA 1UWNX 3JVUA 3EEHA 5EFWA 4HQAA 4PAUA 3JVVA 2EA9A 3OCLA 3IBRA 4NXFA 4NXBA 4HNBA 2K7SA 5CX7A 1IFQA 2B02A 2Y79A 4IHQA 3ULFA 4E04A 4GJ4A 2A24A 2EWWA 2L0WA 3K2NA 2L4RA 1DP6A 4O0PA 4BBUA 4CLCB 4O8GA 1TS8A 2QKPA 4GCZA 1V9ZA 5IU1A 3P7NA 1T1CA 2ZMVA 3CLOA 3GDIA 2GJ3A 3H82B 2HJ9C 3T4JA 2VLGA 3BWLA 2GX5A 3HCYA 4GLQA 2VGLS 3IS2B 1OTIA 2JKTI 4NXGA 4Y5FA 5F5YA 1N9NA 5MC7A 3CITA 3F1OB 4CLCA 3T4OA 5KSHA 3LIBA 2XA7S 2ZOIA 3DBAA 3O5YA 2G7UA 1ZHHB 5J3WA 2PDRA 2WKQA 2NUTC 4L9EA 2VX8A 4WEJA 3H82A 3MQOA 1F5MA 4BWIA 1DRMA 4LRXC 4FOFA 3C8CA 3IS2A 3PR6A 2OWJA 1XJ2A 2R78A 2NUPC 1D06A 4LPZA 3MJQA 2QHKA 1YSPA 2B18A 3F1OA 2V1BA 4DN0A 2QYBA 3E98A 5DFXA 1NLZA 2HGVA 2Z6CA 1NWZA 4HI4A 4WL9A 4ARZB 4P6ZS 4G3WA 3D3OA 1STZA 1OJGA 1ZTUA 2I9VA 1VHMA 4PKYA 1LSXA 1GSWA 3KX0X 3MQQA 2D02A 5F6AA 2WKRA 3E4PA 3VE3A 3KO6A 4EETB 3CAXA 2W0NA 3IBJA 4F3LB 4I3AA 4KUKA 3PBSA 2OWHA 1DP9A 3S7PA 3B47A 3NOTC 2OOLA 3OOVA 1W63Q 4MMNA 1T1BA 2EWVA 5HD5A 3KSGA 3T50A 2ZMFA 2KX6A 3CUEC 4ARZA 5IT5A 5K5BA 3ICYA 1OTEA 3VE4A 4WELA 4Z1WA 3HJIA 2CMNA 3LFVA 4NXEA 3HJKA 2VEAA 1WA9A 3LI9A 3PBNA 5DJTA 3TJZC 1XJ6A 5HDSA 4LRYC 4B9OA 4F3LA 1YSQA 1S66L 2GNXA 1GSVA 3LUQA 4I39A 3MMHA 1S67L 3NOPC 3K3CA 3OLOA 4OOMA 3KSIA 2PYPA 1JNUA 3LYXA 4NKPA 4BMWA 2P04A 3UMDA 3B42A 1D7EA 2W3DA 3LR3A 5DF9A 2W3FA 4ETZA 2W27A 5A8BA 1YKDA 3LR0A 2JHEA 4EXOA 3C2WA 3PXPA 2M7VA 5G4YA 5HWWA 4EEPA 5HL6A 3V67A 1OPXA 2JN7A 2PR5A 3ZQ5A 3UB7A 4DJ2A 2W3EA 3VOLA 3LIFA 3LR5A 3PBOA 5TJJA 4GHIA 2O9CA 3S7OA 3EEAA 4YOFA 2J3TC 4I3JA 4UQIS 2JKTM 3SW1A 1OJ5A 5DKKA 4RQ9A 2INWA 4B93A 4ZRRA 5HD3A 2LB9A 3E4QA 4ME4A 4MN5A 5FL3A 3TRCA 3PBRA 5HZHA 4IUHA 1P0ZA 4HY8A 2QJ5A 3UE6A 2W1TA 1XFNA 1EW0A 2BASA 3A0VA 4G3VA 2J80A 1G28A 4EEUA 2FH5A 3BW6A 1G6OA 4CQHA 4EW7A 2PD8A 2HF6A 1OT6A 5HWTA 5L8MA 2XSSA 3EQVA 5HPFA 2KOIA 4ETXA 2O99A 3MXQA 4R3AA 2VGLM 3OCNA 1OTAA 4JGPA 2VV6A 2GZAA 3BY8A 3T4KA 1P97A 4JGOA 2Z6DA 1UWPX 3UMEA 2J3TD 4YNRA 2OAP1 2W3GA 2PHYA 1TF1A 3PBTA 5J4EA 4KQDA 4L9FA 4JGRA 1T18A 1MC0A 4FSFA 3RTYA 4XT2B 4L0LA 4EUVA 2WKPA 4O01A 4CLCE 2PYRA 3C30A 3MQ0A 3T4TA 4Q0HA 3UB6A 2XROA 1TS0A 3S7NA 2JKRI 4EU0A 4R6LA 3T4SA 4I5SA 2HV1A 5HWVA 1F9IA 3BY9A 3CWFA 4Y3IA 2DMWA 4P6ZM 2HJEA 3F1NB 4XT2A 3LIEA 4HP4A 3PHYA 1BYWA 2P7JA 3EQUA 5IS1A 3KYQA 3EOIA 1S1ZA 2PR6A 4IJGA 4Q0IA 2K31A 4HH2A 5AJGA 1X0OA 4EERA 2M1CA 4BJPA 3R7WB 1F98A 3MFXA 3E0YA 4AFIA 4II7A 3LICA 4CLCC 2D01A 4GHIB 3RFBA 2L1MA 3VV4A 3F1NA 3EGXC 4HH3A 2V1AA 4HHDA 5HDCA 2J3WA 4UEYA 4WLAA 4JGQA 1MKMA 1MZUA 3UB9A 4YWZA 1OTBA 1H3QA 5TBMA 3R7WA 2KDKA 2YKFA 3RH8B 3T4QA 4WF0A 1LL8A 2VJWA 3D72A 4WUJA 2M7UA 4MDZA 1LT0A 3KSFA 2W1TB 1KOUA 2KLIA 4HJ6A 4H6JB 3S7QA 2PD7A 3FPVA 1YAXA 1P9WA 4GS9B 4WN5A 2ZBBA 4GW9A 3LIDA 3CUEA 2VZWA 3BQ8A 3W2ZA 3TE8A 4EQ1A 2O9AA 2ZOHA 2FZ0A 1T19A 2H28A 4CLCD 5DJUA 4BBTA 2A2LA 1UGUA 3MF0A 1VB6A 4PKYG 3OBFA 1XFQA 3KYZA 5AVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FG8 A;  1LSV A;  1TS6 A;  4H6J A;  4HOI A;  3A0R A;  3E4O A;  4GS9 A;  4LLO B;  3PYP A;  3UB8 A;  5HSQ A;  4K08 A;  3H9W A;  3LIA A;  4I3I A;  1N9O A;  4HJ4 A;  2QWS A;  3EWK A;  2VV8 A;  4R38 A;  2V0U A;  4DJ3 A;  1S1Y A;  1LSW A;  1S4R A;  4I38 A;  2V0W A;  3NJA A;  4M4X A;  4EES A;  3H7W B;  1TS7 A;  2VV7 A;  3F1P B;  3A0S A;  2QJ7 A;  1Y28 A;  4R70 A;  4LRZ E;  5F69 A;  1ODV A;  3K3D A;  3B33 A;  1OTD A;  2V9A A;  4L9G A;  5G4Z A;  3FC7 A;  5F68 A;  4BBV A;  3H7W A;  5J7E A;  5I5L A;  1V9Y A;  3F1P A;  1OT9 A;  3GEC A;  4HIA A;  3LI8 A;  1XJ3 A;  5DKL A;  1S4S A;  4KUO A;  5TBM B;  1GSX A;  1XJ4 A;  3G6O A;  3NHQ A;  5AVF A;  5HDD A;  1DP8 A;  1N9L A;  4HP9 A;  2YKH A;  4MN6 A;  3NOU C;  5KIZ A;  1T1A A;  2A24 B;  3MR0 A;  4HJ3 A;  1UWN X;  3EEH A;  5EFW A;  4HQA A;  2EA9 A;  3IBR A;  4NXF A;  4NXB A;  4HNB A;  2K7S A;  2B02 A;  3ULF A;  4E04 A;  2A24 A;  2L0W A;  2L4R A;  1DP6 A;  4BBU A;  1TS8 A;  2QKP A;  4GCZ A;  1V9Z A;  5IU1 A;  3P7N A;  1T1C A;  3CLO A;  3GDI A;  2GJ3 A;  3H82 B;  2VLG A;  3BWL A;  3IS2 B;  1OTI A;  4NXG A;  5F5Y A;  1N9N A;  3F1O B;  3LIB A;  2ZOI A;  5J3W A;  2PDR A;  2WKQ A;  4L9E A;  3H82 A;  3MQO A;  1DRM A;  4LRX C;  3C8C A;  3IS2 A;  2OWJ A;  1XJ2 A;  2R78 A;  1D06 A;  4LPZ A;  3MJQ A;  2QHK A;  3F1O A;  2V1B A;  2Z6C A;  1NWZ A;  4HI4 A;  4WL9 A;  1OJG A;  2I9V A;  4PKY A;  1LSX A;  1GSW A;  3KX0 X;  3MQQ A;  2D02 A;  5F6A A;  2WKR A;  3E4P A;  3VE3 A;  4EET B;  3CAX A;  2W0N A;  4F3L B;  4I3A A;  4KUK A;  2OWH A;  1DP9 A;  3NOT C;  2OOL A;  1T1B A;  5HD5 A;  3T50 A;  2KX6 A;  3ICY A;  1OTE A;  3VE4 A;  3HJI A;  2CMN A;  4NXE A;  3HJK A;  2VEA A;  1WA9 A;  3LI9 A;  5DJT A;  1XJ6 A;  5HDS A;  4LRY C;  4B9O A;  4F3L A;  1S66 L;  1GSV A;  3LUQ A;  4I39 A;  1S67 L;  3NOP C;  3K3C A;  3OLO A;  2PYP A;  1JNU A;  3LYX A;  3UMD A;  1D7E A;  2W27 A;  5A8B A;  2JHE A;  4EXO A;  3C2W A;  5G4Y A;  5HWW A;  4EEP A;  2PR5 A;  2JN7 A;  3ZQ5 A;  3UB7 A;  4DJ2 A;  3VOL A;  3LIF A;  4GHI A;  4I3J A;  3SW1 A;  1OJ5 A;  5DKK A;  4RQ9 A;  2INW A;  5HD3 A;  3E4Q A;  4MN5 A;  5HZH A;  1P0Z A;  4HY8 A;  2QJ5 A;  3UE6 A;  1XFN A;  2BAS A;  1EW0 A;  3A0V A;  2J80 A;  1G28 A;  4EEU A;  4EW7 A;  2PD8 A;  1OT6 A;  5HWT A;  3MXQ A;  4R3A A;  1OTA A;  4JGP A;  2VV6 A;  3BY8 A;  1P97 A;  4JGO A;  2Z6D A;  1UWP X;  3UME A;  2PHY A;  5J4E A;  4KQD A;  4L9F A;  4JGR A;  1T18 A;  3RTY A;  4XT2 B;  2WKP A;  2PYR A;  3UB6 A;  1TS0 A;  4R6L A;  4I5S A;  2HV1 A;  5HWV A;  1F9I A;  3BY9 A;  3CWF A;  4XT2 A;  3F1N B;  3LIE A;  4HP4 A;  3PHY A;  1BYW A;  2P7J A;  5IS1 A;  1S1Z A;  2PR6 A;  4HH2 A;  1X0O A;  4EER A;  2M1C A;  1F98 A;  3MFX A;  3LIC A;  2D01 A;  4GHI B;  2L1M A;  3F1N A;  4HH3 A;  2V1A A;  4HHD A;  5HDC A;  4WLA A;  4JGQ A;  1MZU A;  3UB9 A;  4YWZ A;  1OTB A;  5TBM A;  2KDK A;  2YKF A;  3RH8 B;  4WF0 A;  1LL8 A;  3D72 A;  4WUJ A;  1LT0 A;  1KOU A;  4HJ6 A;  4H6J B;  2PD7 A;  4GS9 B;  4WN5 A;  2ZBB A;  4GW9 A;  3LID A;  4EQ1 A;  2ZOH A;  1T19 A;  2H28 A;  5DJU A;  4BBT A;  1UGU A;  1VB6 A;  4PKY G;  1XFQ A;  5AVE A; 
#chains in the Genus database with same CATH topology
 2XRN A;  3A3D A;  3FG8 A;  5HAR A;  4GS9 A;  1XX2 A;  3PYP A;  2J9O A;  1PWG A;  4K08 A;  2Q0O A;  3SH8 A;  1N9O A;  1NY0 A;  3IH8 A;  3ZG5 A;  2QWS A;  5FQI A;  1Z09 A;  2VV8 A;  4R1G A;  5F1G A;  1SDE A;  4DJ3 A;  5CTM A;  3NJA A;  3ZDJ A;  2IWB A;  1TS7 A;  3F1P B;  4OOY A;  4S2I A;  3PTE A;  1Y28 A;  1BLH A;  5F69 A;  4X69 A;  3GTC A;  2Y2K A;  4L9G A;  3VP4 A;  5G4Z A;  5M19 A;  3FC7 A;  3LR4 A;  4KQO A;  4DRT A;  3MZE A;  1QME A;  1Y4O A;  2O0Y A;  2XF3 A;  3WRT A;  4IED A;  3GVB A;  2JC7 A;  1NRJ A;  3WRZ A;  3F1P A;  3VP2 A;  4DF6 A;  2QMI A;  4ZJ2 A;  2DRW A;  3LCE A;  3LEZ A;  1PNE A;  4B88 A;  3WS5 A;  1NXY A;  4MLL A;  3BQA A;  3LI8 A;  4KUO A;  4BL2 A;  3OPP A;  3OC2 A;  5TBM B;  2HP6 A;  3ZVW A;  1GSX A;  3P09 A;  1NYM A;  3G32 A;  3U4L P;  1HZO A;  4ZJ1 A;  2RCX A;  2YKH A;  4MN6 A;  1PWC A;  4LV1 A;  3QNB A;  4RYE A;  3O3V A;  4FH2 A;  2ZM0 A;  4CJN A;  4KZ6 A;  3QP5 A;  1N4O A;  2B95 A;  3OCL A;  4HNB A;  1JVJ A;  2V1Z A;  4IHQ A;  5F82 A;  4S2P A;  4WMC A;  2L0W A;  5KZH A;  3K2N A;  3OPL A;  1MWT A;  5M1A A;  1YLW A;  3QP4 A;  3DAV A;  3S1Y A;  3GDI A;  2GJ3 A;  3H82 B;  3HLC A;  1OTI A;  2OLU A;  2JKT I;  4Y5F A;  4DKI A;  1YM1 A;  1N9N A;  3IWO A;  3CIT A;  3F1O B;  5DTK A;  2ZOI A;  1ES2 A;  4ZTK A;  3HRE A;  3O88 A;  2PDR A;  2WUQ A;  2NUT C;  1SDN A;  3MBZ A;  3H82 A;  1F5M A;  1K4E A;  1J9M A;  1FQG A;  2HDS A;  4KEN B;  1XJ2 A;  3DTE A;  1ES5 A;  1PZP A;  1D06 A;  3GRJ A;  4LPZ A;  3RXW A;  2QHK A;  3F1O A;  3LGO A;  4DN0 A;  3CMZ A;  5KSC A;  5DFX A;  2UV0 E;  3B3X A;  3A3E A;  2Z6C A;  1NWZ A;  4HI4 A;  4WL9 A;  4ARZ B;  4Y0T A;  3IHA A;  1SZV A;  4NET A;  3DTK A;  3VE3 A;  2WZZ A;  3CAX A;  4E3L A;  4F3L B;  4KUK A;  3S7P A;  2OWH A;  1W63 Q;  1PI5 A;  1LL5 A;  3QP6 A;  4ARZ A;  3IF6 B;  2PBD P;  2WKH A;  4QY5 A;  3MXS A;  3BFE A;  4N1H A;  4DE2 A;  5CEB A;  3LEQ A;  3LI9 A;  3ISG A;  4GDN A;  4UA9 A;  5HDS A;  1YQS A;  4F3L A;  1K56 A;  2EFX A;  2GNX A;  3V3S A;  4I39 A;  4UAA A;  3OLO A;  4OOM A;  2V8C A;  2P04 A;  3IF6 A;  2Y2I A;  1J3W A;  5FA7 A;  1BLP A;  1CEG A;  4EXO A;  3OZH A;  3PXP A;  2M7V A;  4K0X A;  5HL6 A;  3V67 A;  3ZQ5 A;  3NDE A;  3LR5 A;  5TJJ A;  4GHI A;  2O9C A;  5FQQ A;  4IVK A;  3EEA A;  4FCF A;  4MBH A;  2HP9 A;  3P98 A;  4I3J A;  1L0G A;  4UQI S;  1OJ5 A;  4IBR A;  2J9P A;  5HD3 A;  2XDM A;  4ME4 A;  4MN5 A;  4JXS A;  1DJA A;  2V8F A;  4IUH A;  5FAT A;  3ITB A;  1P0Z A;  4GZB A;  4NK3 A;  4OKP A;  1KVM A;  4MBF A;  5L07 A;  2Q9M A;  5FDH A;  3Q07 A;  3OPR A;  4LCL A;  4ZAM A;  3HLD A;  5L8M A;  1CQA A;  5FAP A;  4UA7 A;  2O99 A;  4R3A A;  2VGL M;  3HL9 A;  3VSK A;  3T4K A;  3BY8 A;  1NZU A;  3C7V A;  3JPU A;  2W3G A;  3HUO A;  2ZC6 B;  3PBT A;  4XXR A;  4L9F A;  4BD1 A;  3RTY A;  4XT2 B;  4L0L A;  3MQ0 A;  4HBT A;  1BLS A;  2XRO A;  3LO7 A;  5GHX A;  4I5S A;  2HV1 A;  5FI2 A;  2ZQ8 A;  4JBF A;  3BY9 A;  2Z2L B;  3NIA A;  4P6Z M;  1SCW A;  3F1N B;  4XT2 A;  1XXM A;  3BM6 A;  3HLE A;  3KYQ A;  1S1Z A;  4IJG A;  1YMX A;  2K31 A;  3BLM A;  4HH2 A;  3NC8 A;  4BJP A;  3CPT B;  3SH9 A;  4CLC C;  2D01 A;  3RFB A;  2L1M A;  3F1N A;  3CJM A;  4HH3 A;  2V1A A;  3BFG A;  3C4O A;  4R23 A;  5HDC A;  2J3W A;  1E3U A;  1CEF A;  1MKM A;  1YMS A;  3UB9 A;  1CI9 A;  1OTB A;  1GA9 A;  1AXB A;  3CPT A;  2KDK A;  2YKF A;  3T4Q A;  4WF0 A;  1W79 A;  5HAI A;  3WS2 A;  4GDB A;  2PD7 A;  3Q7Z A;  1QMF A;  5JYP A;  5HL1 A;  3T1R A;  2O9A A;  1T19 A;  4GD6 A;  2H28 A;  5FQJ A;  2ZJ9 A;  1S0W A;  4PKY G;  4QD4 A;  3OBF A;  2VGJ A;  4PHT A;  2ZL1 B;  3R4K A;  1KGE A;  1O07 A;  3UB8 A;  3MS6 A;  2WKE A;  1ERM A;  2K2N A;  5FQK A;  2Y8H A;  5HPI A;  1EWZ A;  2MJ6 A;  3EWK A;  3AGE A;  3WS4 A;  4RA7 A;  1SHV A;  1LSW A;  1D1J A;  2V0W A;  4EES A;  3IX8 A;  2XA7 M;  5A90 A;  2VV7 A;  2EFU A;  3MKF A;  2ZC4 B;  4JKT A;  2H5S A;  2QJ7 A;  4R70 A;  3T4L A;  1ODV A;  3CI6 A;  1TD5 A;  2V9A A;  2JKR M;  2WAD A;  1HTZ A;  1RP5 A;  2O9B A;  4G3K A;  4BLM A;  1Y54 A;  5J7E A;  4OPZ A;  1W5D A;  2Y2M A;  4X68 A;  3TW8 A;  1IOU A;  4KZA A;  1VET B;  4DE3 A;  2ZQC A;  3G6O A;  3WWX A;  3NHQ A;  1IEL A;  3UDI A;  2UWX A;  3G2Y A;  3ZYT A;  1K6R A;  1PZO A;  1LLB A;  5FQM A;  2QZ6 A;  3NOU C;  5A92 A;  5KIZ A;  2W3H A;  1T1A A;  1VET A;  1SKO B;  4YFM A;  4R3B A;  5TR7 A;  3JVU A;  4GB7 A;  2OSU A;  4HQA A;  1G5U A;  4PAU A;  3IBR A;  4KZB A;  1IYP A;  1IFQ A;  1A0K A;  5DTS A;  5HAP A;  4CPK A;  2A49 A;  1JWV A;  3ULF A;  4DDS A;  5L09 A;  1JTG A;  4GKU A;  1OME A;  1SKO A;  1FOF A;  2X02 A;  4O0P A;  1KGF A;  4CLC B;  1AWI A;  4O8G A;  3W4Q A;  4MEZ A;  4GCZ A;  1I2W A;  3CLO A;  4Z9Q A;  3IS2 B;  3NUL A;  4NXG A;  3L9K A;  5MC7 A;  1WYB A;  4CLC A;  1BT5 A;  3DTM A;  1Q2Q A;  3DBA A;  2G7U A;  5J3W A;  4KQQ A;  3V39 A;  2VX8 A;  3MQO A;  4E3O A;  5FI7 A;  3C8C A;  3IS2 A;  1ESU A;  1G6A A;  3PR6 A;  4PM8 A;  3IF6 C;  4HEF A;  2NUP C;  4PM9 A;  5L2F A;  2R9W A;  1YSP A;  2QYB A;  4PMA A;  3ZFZ A;  1SKF A;  2Y2P A;  4HBU A;  4G3W A;  3ZG8 B;  3D3O A;  1XA7 A;  4Y13 A;  4P6B A;  1LSX A;  4OQI A;  3MQQ A;  5DTT A;  4N9L A;  2WKR A;  4PPR A;  5EVI D;  4I3A A;  1L0D A;  5FAQ A;  1K55 C;  3G34 A;  3NOT C;  3OOV A;  3NCK A;  1T1B A;  2EWV A;  3KSG A;  2HDR A;  2ZMF A;  5FQ9 A;  3CUE C;  1H8Y A;  4B4X A;  1XKZ A;  5K5B A;  5GL9 A;  3D9Y A;  3SS4 A;  3VE4 A;  2J7V A;  3V50 A;  4Z1W A;  3QP2 A;  4OQ0 A;  3PBN A;  5DJT A;  3TJZ C;  1XJ6 A;  4B9O A;  1S66 L;  4KZ7 A;  1ESI A;  3ZG0 A;  3VOY A;  1FR1 A;  2C5W B;  1JNU A;  3LYX A;  4E3J A;  4NKP A;  2VK3 A;  1XA1 A;  1MWR A;  2BTF P;  4GOG A;  2W3D A;  1ZG6 A;  4ETZ A;  4N9K A;  3UO9 A;  3HLW A;  5A8B A;  1MY8 A;  3HUM A;  5DVA A;  2AVX A;  3C2W A;  5G4Y A;  5HWW A;  2EX8 A;  3V3R A;  1OPX A;  2PR5 A;  2WAE A;  4FUW A;  3UPO A;  3N8L A;  4JF4 A;  4KZ3 A;  3VOL A;  1XPB A;  3ZNY A;  3S7O A;  4YOF A;  5CER A;  3W4P A;  1JWZ A;  5E43 A;  5CED A;  3SW1 A;  3C4P A;  4B93 A;  3GMW A;  4ZRR A;  5FL3 A;  3TRC A;  1FSW A;  4P85 A;  3GV9 A;  4Y7P A;  2IWD A;  2XFS A;  5TFQ A;  5CXW A;  2W1T A;  1LL9 A;  4EEU A;  1G6O A;  4EW7 A;  2PRF A;  3EQV A;  1N9B A;  2DNS A;  3VP3 A;  4ETX A;  3MXQ A;  3OCN A;  2RL3 A;  2VV6 A;  4QY6 A;  5GLA A;  5FSR A;  2J3T D;  1IEM A;  2OAP 1;  3UY6 A;  4WYY A;  1H0M A;  5J4E A;  3BFF A;  1CI8 A;  1T18 A;  1U60 A;  2E8J A;  4OON A;  4GNU A;  1L3L A;  1WE4 A;  3KYE A;  2Y59 A;  1GCE A;  1L0E A;  4CLC E;  2PYR A;  3HVF A;  5IHV A;  3QP8 A;  3T4T A;  3UB6 A;  4A5R A;  1TS0 A;  4KZ9 A;  3S7N A;  3FV7 A;  4PM7 A;  2Y2L A;  4C75 A;  1F9I A;  3UDF A;  4S2M A;  3FYZ A;  3LIE A;  2H0Y A;  2V2F F;  5E2F A;  2ZQ9 A;  5IS1 A;  4O7D A;  4EBP A;  2Y2H A;  3EOI A;  1HVB A;  2PU4 A;  4UA6 A;  4EER A;  2M1C A;  4QWO A;  5CGS A;  4KG2 A;  1FSY A;  1MWS A;  2EXA A;  4GHI B;  3VV4 A;  4U0T A;  4KG5 A;  4R4S A;  4UEY A;  3ZVT A;  1YLT A;  4WMC D;  4BQM A;  2ZMA A;  4ZJ3 A;  3FZC A;  4OPR A;  1KE3 A;  4MDZ A;  1KOU A;  3WS1 A;  2KLI A;  1K55 A;  4HJ6 A;  1YAX A;  4MNR A;  4C6Y A;  4WZ4 A;  2OV5 A;  3CUE A;  2VZW A;  3TE8 A;  1PW8 A;  2FZ0 A;  4RX3 A;  4S2K A;  5DJU A;  4R4R A;  4PM6 A;  2A2L A;  2EX9 A;  2HDU A;  5AVE A;  1ZKJ A;  4MCW A;  5EOO A;  3ZHH A;  1TS6 A;  4HOI A;  3A0R A;  3E4O A;  2WGV A;  4LLO B;  4EUZ A;  5HSQ A;  4UQI M;  3H9W A;  3LIA A;  4I3I A;  3BJN A;  4JF5 A;  4R38 A;  1ERQ A;  3G30 A;  2P74 A;  2VKS A;  3SS5 A;  3U2A A;  1S1Y A;  1S4R A;  3QHY A;  4I38 A;  3OPH A;  3MSH A;  4Y0O A;  5LBR A;  3A0S A;  3E2L A;  2VA0 A;  5EUA A;  3HLG A;  2HP5 A;  1TVF A;  1TEM A;  1OTD A;  2LB5 A;  4NG2 A;  2IA2 A;  1CJF A;  4NEE D;  5G18 A;  4BBV A;  4F94 A;  3N8R A;  2B5R A;  4KG6 A;  3FPW A;  1V9Y A;  1ALQ A;  4OP5 A;  3GEC A;  4HIA A;  4OOL A;  3VSL A;  2XGN A;  4EQI A;  3T12 B;  1K56 D;  1C3B A;  1XJ3 A;  3G35 A;  3MFD A;  5DKL A;  5AQ7 A;  4ZBE A;  5DFY A;  4B4Z A;  3CHW P;  1S4S A;  2PT7 A;  3C38 A;  4Q0J A;  3G2Z A;  3I7J A;  4FTX A;  5HDD A;  1KE4 A;  1NLY A;  4LV0 A;  4MN7 A;  2BLS A;  2XK1 A;  1H8M A;  3P01 A;  1YLZ A;  4UHU A;  1K57 C;  4QPR A;  4XUX A;  1UWN X;  5EFW A;  1RGZ A;  1PYY A;  3JVV A;  4OVD A;  2EA9 A;  5BOH A;  4NXB A;  2K7S A;  4FD8 A;  5CX7 A;  3A3F A;  5FI6 A;  2Y79 A;  3D4F A;  1PW1 A;  4E04 A;  4X53 A;  1ERO A;  4JXG A;  1TS8 A;  2QKP A;  3HLB A;  3ZG7 B;  4LV3 A;  1TDG A;  4BEN A;  2X71 A;  3T4J A;  4XUZ A;  4X1L A;  1NZO A;  3HCY A;  5E2H A;  5F1F A;  2WGW B;  3G31 A;  2X01 A;  4JXV A;  5TGF A;  2P9V A;  3T4O A;  5KSH A;  3LIB A;  2XA7 S;  3MZD A;  3Q1F A;  1DJB A;  4L9E A;  1K4F A;  4DXC A;  4LRX C;  2WGW A;  2OWJ A;  1VQQ A;  2R78 A;  2A3U A;  2B18 A;  3E98 A;  1HLU P;  2HGV A;  4P0M A;  2IWC A;  1MXO A;  5CTN A;  5L10 A;  1STZ A;  1OJG A;  2ACG A;  2Y2N A;  1ZTU A;  2I9V A;  1VHM A;  3KX0 X;  3E4P A;  3KO6 A;  4EET B;  5HAQ A;  2W0N A;  3PBS A;  1G68 A;  3NDG A;  1BZA A;  3B47 A;  1EI5 A;  2OOL A;  1L0F A;  4MMN A;  5HD5 A;  2XH9 A;  1HD8 A;  2JKG A;  2KX6 A;  5JYO A;  5IT5 A;  2Y2Q A;  3ICY A;  4ID4 A;  3CZD A;  1BUE A;  4X55 A;  2CMN A;  4NXE A;  3HJK A;  2VEA A;  4N1X A;  1WA9 A;  5FEG A;  5GLC A;  4LRY C;  4Q8I A;  4GD8 A;  1GSV A;  1E3U D;  3VOZ A;  3SS3 A;  4P87 A;  5EVL A;  3UMD A;  1S6R A;  2XD5 A;  4KZ4 A;  3AGF A;  4E3M A;  1D7E A;  2EX2 A;  5CHU A;  2W3F A;  4S2N C;  1YKD A;  2JHE A;  4N92 A;  4EEP A;  1YLY A;  1KGG A;  2JN7 A;  5FEF A;  3TOI A;  3UB7 A;  1GHI A;  1GHP A;  3LIF A;  3GQZ A;  3HLF A;  2Y4A A;  4D2O A;  3SZT A;  3DWZ A;  2JKT M;  5DKK A;  4DDY A;  1I2S A;  2INW A;  3IT9 A;  2LB9 A;  3E4Q A;  5HX9 A;  1XGJ A;  3PBR A;  4JLF A;  1BSG A;  2QPN A;  5U47 A;  4HY8 A;  1PFL A;  2WZX A;  3ZG9 B;  4D60 A;  2BAS A;  3A0V A;  4ZDX A;  1YLP A;  3BEB A;  1GA0 A;  2FH5 A;  3BW6 A;  4CQH A;  2HF6 A;  3VP1 A;  5HWT A;  3VMA A;  1K57 A;  2WGI A;  4GN2 A;  2GZA A;  4JGO A;  3UME A;  4YNR A;  3IXG A;  2PHY A;  1TF1 A;  1W8Y A;  3RXX A;  4JGR A;  1MC0 A;  1K6S A;  4FSF A;  5GHZ A;  4X56 A;  3CG5 A;  3NEC A;  4O01 A;  5AQ9 A;  1M6K A;  4IBX A;  2JKR I;  3AGD A;  3T4S A;  5HWV A;  2EXB A;  5CRF A;  5A93 A;  1ZC2 A;  2HJE A;  5EOE A;  1BYW A;  2XFT A;  4IVI A;  2XD1 A;  5F83 A;  2PR6 A;  5E2E A;  5AJG A;  5E2G A;  3R7W B;  1F98 A;  3MFX A;  3E0Y A;  3N8S A;  4AFI A;  4II7 A;  5EE8 A;  2R9X A;  3LIC A;  1ONG A;  1M40 A;  1MPL A;  3EGX C;  1FCN A;  4HHD A;  1IYS A;  2OLV A;  1PIO A;  4WLA A;  4JGQ A;  1MZU A;  4U0X A;  3IXH A;  1H3Q A;  2C6W B;  2FFY A;  2Y2O A;  5TBM A;  3R7W A;  2WKI A;  4U3T A;  4E3K A;  3RH8 B;  1ACF A;  2VJW A;  3D72 A;  4WUJ A;  3GSG A;  1LT0 A;  2V20 A;  3IH9 A;  2W1T B;  3KSF A;  3S7Q A;  4H6J B;  4QU3 A;  1P9W A;  4WN5 A;  3C7U A;  3LID A;  3BQ8 A;  4X1M A;  4EQ1 A;  1FIK A;  1ES3 A;  2ZOH A;  4YIN A;  5EPH A;  4CLC D;  3M2K A;  4BBT A;  1XP4 A;  3ZNT A;  1XFQ A;  4BD0 A;  3KYZ A;  1LSV A;  3O87 A;  4H6J A;  2E8I A;  1H5X A;  4DXB A;  5HW3 A;  1PI4 A;  4QJG A;  3PBQ A;  4QHC A;  3PAE A;  4HES A;  4HJ4 A;  3UE0 A;  3UPP A;  3T1S A;  5KMW A;  2V0U A;  4M3K A;  3VFH A;  2EX6 A;  5FDS A;  3N6I A;  2ZM2 A;  1NYY A;  4M4X A;  1KE0 A;  4OQG A;  3H7W B;  4S2N A;  2P08 A;  4EV4 A;  3BLS A;  2H0T A;  4E3I A;  3S4X A;  4KQR A;  3BFD A;  5EV0 A;  4OPQ A;  4LRZ E;  3S22 A;  3K3D A;  3B33 A;  3IQA A;  4OLG A;  1FR6 A;  4Y2F A;  3T1X A;  3T1Q B;  5J8X A;  5FAO A;  1MWU A;  3ZCZ A;  4ESP A;  5F68 A;  1E25 A;  3C5A A;  2ZC3 B;  2Y2G A;  5CHM A;  3H7W A;  3M2J A;  3IXD A;  2H10 A;  5I5L A;  3UE1 A;  2WAF A;  3UE3 A;  4IUK A;  1LHY A;  3EGD C;  1OT9 A;  2JCH A;  1DJC A;  2OAQ 1;  3IF5 A;  5GLD A;  2W1R A;  4PM5 A;  3G4P A;  5C5K A;  1W63 M;  4S2O A;  2PAV P;  1JWP A;  3LY3 A;  4LGW A;  4LEN A;  1XJ4 A;  5M18 A;  3IXB A;  1P9R A;  5AVF A;  3KSH A;  1DP8 A;  1N9L A;  1CF0 A;  4HP9 A;  1FCO A;  3M6H A;  4WEK A;  1ES4 A;  4Y17 A;  4JXW A;  4DMZ A;  5EM0 A;  2A24 B;  4X6T A;  3MR0 A;  4HJ3 A;  2HDQ A;  3EEH A;  3UN7 A;  2HZ5 A;  4NXF A;  3VP0 A;  2B02 A;  1CK3 A;  1I5Q A;  1VEU B;  4GJ4 A;  1TDL A;  4OQH A;  2A24 A;  2EWW A;  2L4R A;  1DP6 A;  1Z6F A;  3FWL A;  4BBU A;  4FH4 A;  2XR0 A;  5EM1 A;  1V9Z A;  3JYI A;  5IU1 A;  2JBF A;  3P7N A;  1T1C A;  2ZMV A;  3QNC A;  2HJ9 C;  2VLG A;  1K54 C;  3BWL A;  3A3J A;  2GX5 A;  4GLQ A;  2BG1 A;  2VGL S;  1VEU A;  5EEC A;  4E6W A;  5F5Y A;  1JTD A;  2Y2J A;  3MKE A;  3N4I A;  5EVI C;  5AQA A;  4H8R A;  3A3I A;  3O5Y A;  4DE0 A;  1ZHH B;  1BTL A;  2WKQ A;  4WEJ A;  1K0K A;  4K91 A;  4BWI A;  1DRM A;  3ITA A;  4FOF A;  5DF7 A;  3VFF A;  3MXR A;  2G2U A;  1O7E A;  3IWQ A;  3MJQ A;  2WK0 A;  2V1B A;  4EBL A;  3DWK A;  1NLZ A;  3W8K A;  1DY6 A;  1PRQ A;  3Q7V B;  4P6Z S;  1FCM A;  2FFF B;  4WZ5 C;  4PKY A;  5GLB A;  1GSW A;  2XEP A;  1XGI A;  2D02 A;  4EBN A;  5F6A A;  4BL3 A;  3IBJ A;  1RCJ A;  3SOI A;  3QP1 A;  1DP9 A;  3O86 A;  1GHM A;  3FKV A;  4R0Q A;  3T50 A;  3Q7V A;  1F2K A;  3MZF A;  1OTE A;  1IYQ A;  3ZGA B;  5FAS A;  4WEL A;  3HJI A;  3LFV A;  1BLC A;  1ONH A;  2Q9N A;  1Q2P A;  3L7H A;  2PBY A;  4C3Q A;  1YSQ A;  3LUQ A;  4OPY A;  4JPM A;  3MMH A;  4K0W A;  1S67 L;  4MBK A;  3NOP C;  3FKW A;  3K3C A;  4E6X A;  3NBL A;  3IWI A;  3KSI A;  2J8Y A;  2PU2 A;  2PYP A;  4BMW A;  3BEC A;  3UDX A;  3B42 A;  2VGK A;  3GR2 A;  1LI9 A;  4LV2 A;  3IX4 A;  4R3J A;  3LR3 A;  3N7W A;  5DF9 A;  2W27 A;  3LR0 A;  1IYO A;  1ZG4 A;  1PWD A;  1KDW A;  1NJ4 A;  2ZC5 B;  4EWF A;  1W8Q A;  4DJ2 A;  2W3E A;  2P9V B;  5EVE A;  5A91 A;  4KZ8 A;  3PBO A;  1NRF A;  1YPR A;  3BYD A;  2ZC7 A;  5CGX A;  5CGW A;  2J3T C;  2JE5 A;  1L2S A;  3IX3 A;  4RQ9 A;  5GHY A;  3WS0 A;  3DW0 A;  5CEC A;  3BRM A;  5HZH A;  3TG9 A;  2ZQA A;  5I94 A;  2QJ5 A;  3UE6 A;  1XFN A;  3HBR A;  1EW0 A;  4G3V A;  2J80 A;  1K38 A;  2Y91 A;  1G28 A;  3BFC A;  2GDN A;  4RX2 A;  1IKI A;  4QB8 A;  2PD8 A;  1OT6 A;  2XSS A;  5HPF A;  2KOI A;  1VM1 A;  1OTA A;  1KDS A;  4OLD A;  4JGP A;  1P97 A;  2Z6D A;  4WBG A;  1UWP X;  3W4O A;  3SH7 A;  4OH0 A;  5HFO A;  2ZL1 A;  2Z2M B;  3V5M A;  4KQD A;  1YLJ A;  3UB5 P;  4LFU A;  3LY4 A;  1W7F A;  4EUV A;  2Y55 A;  3E2K A;  2WKP A;  5EVI B;  5AQB A;  3C30 A;  2ZQ7 A;  2HPB A;  4Q0H A;  4EU0 A;  4R6L A;  4KZ5 A;  2DCF A;  3TSG A;  5CHJ A;  1BUL A;  4Y15 A;  1MKI A;  1K54 A;  4RVA A;  2XLN A;  3IHB A;  4Y0U A;  2WYX A;  3UPN A;  3CWF A;  4Y3I A;  2DMW A;  2I72 A;  4HP4 A;  3PHY A;  5EVI A;  2XQZ A;  2P7J A;  3EQU A;  2ZD8 A;  1MBL A;  4X25 A;  4Q0I A;  5D3O A;  2CC1 A;  1X0O A;  1WYC A;  1FIL A;  3NI9 A;  2ZLY A;  2ZQD A;  4E3N A;  3DTI A;  4OP8 A;  2G2W A;  3PAG A;  1KVL A;  1LI0 A;  4YWZ A;  1YT4 A;  3HUN A;  3Q81 A;  1H8Z A;  4WZ5 A;  1LL8 A;  1E4D A;  2M7U A;  3Q82 A;  1K25 A;  3FPV A;  3NY4 A;  4S2J A;  4GS9 B;  2ZBB A;  4GW9 A;  3UNW A;  3M6B A;  4S2L A;  3W2Z A;  4DE1 A;  4WM9 A;  4LCM A;  1IKG A;  4JF6 A;  2ZM8 A;  5DF8 A;  1UGU A;  1RGY A;  2JKF A;  3MF0 A;  1VB6 A;  3RJU A; 
#chains in the Genus database with same CATH homology
 2XRN A;  3FG8 A;  4MCW A;  1LSV A;  4PHT A;  1TS6 A;  4H6J A;  3R4K A;  4HOI A;  3A0R A;  3E4O A;  4GS9 A;  4LLO B;  3PYP A;  3UB8 A;  2K2N A;  5HSQ A;  4K08 A;  4UQI M;  3H9W A;  3LIA A;  4I3I A;  2Y8H A;  1N9O A;  3PBQ A;  5HPI A;  3BJN A;  4HJ4 A;  2QWS A;  2MJ6 A;  3EWK A;  2VV8 A;  4R38 A;  2V0U A;  4DJ3 A;  2VKS A;  3U2A A;  1S1Y A;  1LSW A;  1S4R A;  4I38 A;  2V0W A;  3NJA A;  4M4X A;  4EES A;  3H7W B;  2P08 A;  1TS7 A;  2XA7 M;  2VV7 A;  3F1P B;  3A0S A;  5LBR A;  2VA0 A;  2QJ7 A;  1Y28 A;  4R70 A;  3T4L A;  4LRZ E;  5F69 A;  1ODV A;  3K3D A;  3B33 A;  3CI6 A;  1OTD A;  1TD5 A;  2V9A A;  4L9G A;  2JKR M;  5G4Z A;  2LB5 A;  4Y2F A;  3FC7 A;  3LR4 A;  4KQO A;  2IA2 A;  4NEE D;  2O9B A;  4G3K A;  5F68 A;  4BBV A;  2O0Y A;  3H7W A;  1NRJ A;  3FPW A;  5J7E A;  5I5L A;  1V9Y A;  3F1P A;  3UE3 A;  4IUK A;  3EGD C;  1OT9 A;  3GEC A;  4HIA A;  4OOL A;  3TW8 A;  2OAQ 1;  3BQA A;  2W1R A;  3LI8 A;  5C5K A;  1IOU A;  1W63 M;  1XJ3 A;  5DKL A;  5DFY A;  1S4S A;  4KUO A;  2PT7 A;  3OC2 A;  5TBM B;  3C38 A;  1GSX A;  4Q0J A;  1XJ4 A;  3G6O A;  1P9R A;  3NHQ A;  5AVF A;  3KSH A;  5HDD A;  1DP8 A;  1N9L A;  4HP9 A;  1NLY A;  3ZYT A;  4MN7 A;  2YKH A;  4WEK A;  4MN6 A;  3NOU C;  1H8M A;  5KIZ A;  3P01 A;  2W3H A;  4DMZ A;  1T1A A;  2A24 B;  3MR0 A;  4HJ3 A;  4QPR A;  1UWN X;  3JVU A;  3EEH A;  5EFW A;  4HQA A;  4PAU A;  3JVV A;  2EA9 A;  3OCL A;  3IBR A;  4NXF A;  4NXB A;  4HNB A;  2K7S A;  5CX7 A;  1IFQ A;  2B02 A;  2Y79 A;  4IHQ A;  3ULF A;  4E04 A;  4GJ4 A;  2A24 A;  2EWW A;  2L0W A;  3K2N A;  2L4R A;  1DP6 A;  4O0P A;  4BBU A;  4CLC B;  4O8G A;  1TS8 A;  2QKP A;  4GCZ A;  1V9Z A;  5IU1 A;  3P7N A;  1T1C A;  2ZMV A;  3CLO A;  3GDI A;  2GJ3 A;  3H82 B;  2HJ9 C;  3T4J A;  2VLG A;  3BWL A;  2GX5 A;  3HCY A;  4GLQ A;  2VGL S;  3IS2 B;  1OTI A;  2JKT I;  4NXG A;  4Y5F A;  5F5Y A;  1N9N A;  5MC7 A;  3CIT A;  3F1O B;  4CLC A;  3T4O A;  5KSH A;  3LIB A;  2XA7 S;  2ZOI A;  3DBA A;  3O5Y A;  2G7U A;  1ZHH B;  5J3W A;  2PDR A;  2WKQ A;  2NUT C;  4L9E A;  2VX8 A;  4WEJ A;  3H82 A;  3MQO A;  1F5M A;  4BWI A;  1DRM A;  4LRX C;  4FOF A;  3C8C A;  3IS2 A;  3PR6 A;  2OWJ A;  1XJ2 A;  2R78 A;  2NUP C;  1D06 A;  4LPZ A;  3MJQ A;  2QHK A;  1YSP A;  2B18 A;  3F1O A;  2V1B A;  4DN0 A;  2QYB A;  3E98 A;  5DFX A;  1NLZ A;  2HGV A;  2Z6C A;  1NWZ A;  4HI4 A;  4WL9 A;  4ARZ B;  4P6Z S;  4G3W A;  3D3O A;  1STZ A;  1OJG A;  1ZTU A;  2I9V A;  1VHM A;  4PKY A;  1LSX A;  1GSW A;  3KX0 X;  3MQQ A;  2D02 A;  5F6A A;  2WKR A;  3E4P A;  3VE3 A;  3KO6 A;  4EET B;  3CAX A;  2W0N A;  3IBJ A;  4F3L B;  4I3A A;  4KUK A;  3PBS A;  2OWH A;  1DP9 A;  3S7P A;  3B47 A;  3NOT C;  2OOL A;  3OOV A;  1W63 Q;  4MMN A;  1T1B A;  2EWV A;  5HD5 A;  3KSG A;  3T50 A;  2ZMF A;  2KX6 A;  3CUE C;  4ARZ A;  5IT5 A;  5K5B A;  3ICY A;  1OTE A;  3VE4 A;  4WEL A;  4Z1W A;  3HJI A;  2CMN A;  3LFV A;  4NXE A;  3HJK A;  2VEA A;  1WA9 A;  3LI9 A;  3PBN A;  5DJT A;  3TJZ C;  1XJ6 A;  5HDS A;  4LRY C;  4B9O A;  4F3L A;  1YSQ A;  1S66 L;  2GNX A;  1GSV A;  3LUQ A;  4I39 A;  3MMH A;  1S67 L;  3NOP C;  3K3C A;  3OLO A;  4OOM A;  3KSI A;  2PYP A;  1JNU A;  3LYX A;  4NKP A;  4BMW A;  2P04 A;  3UMD A;  3B42 A;  1D7E A;  2W3D A;  3LR3 A;  5DF9 A;  2W3F A;  4ETZ A;  2W27 A;  5A8B A;  1YKD A;  3LR0 A;  2JHE A;  4EXO A;  3C2W A;  3PXP A;  2M7V A;  5G4Y A;  5HWW A;  4EEP A;  5HL6 A;  3V67 A;  1OPX A;  2JN7 A;  2PR5 A;  3ZQ5 A;  3UB7 A;  4DJ2 A;  2W3E A;  3VOL A;  3LIF A;  3LR5 A;  3PBO A;  5TJJ A;  4GHI A;  2O9C A;  3S7O A;  3EEA A;  4YOF A;  2J3T C;  4I3J A;  4UQI S;  2JKT M;  3SW1 A;  1OJ5 A;  5DKK A;  4RQ9 A;  2INW A;  4B93 A;  4ZRR A;  5HD3 A;  2LB9 A;  3E4Q A;  4ME4 A;  4MN5 A;  5FL3 A;  3TRC A;  3PBR A;  5HZH A;  4IUH A;  1P0Z A;  4HY8 A;  2QJ5 A;  3UE6 A;  2W1T A;  1XFN A;  1EW0 A;  2BAS A;  3A0V A;  4G3V A;  2J80 A;  1G28 A;  4EEU A;  2FH5 A;  3BW6 A;  1G6O A;  4CQH A;  4EW7 A;  2PD8 A;  2HF6 A;  1OT6 A;  5HWT A;  5L8M A;  2XSS A;  3EQV A;  5HPF A;  2KOI A;  4ETX A;  2O99 A;  3MXQ A;  4R3A A;  2VGL M;  3OCN A;  1OTA A;  4JGP A;  2VV6 A;  2GZA A;  3BY8 A;  3T4K A;  1P97 A;  4JGO A;  2Z6D A;  1UWP X;  3UME A;  2J3T D;  4YNR A;  2OAP 1;  2W3G A;  2PHY A;  1TF1 A;  3PBT A;  5J4E A;  4KQD A;  4L9F A;  4JGR A;  1T18 A;  1MC0 A;  4FSF A;  3RTY A;  4XT2 B;  4L0L A;  4EUV A;  2WKP A;  4O01 A;  4CLC E;  2PYR A;  3C30 A;  3MQ0 A;  3T4T A;  4Q0H A;  3UB6 A;  2XRO A;  1TS0 A;  3S7N A;  2JKR I;  4EU0 A;  4R6L A;  3T4S A;  4I5S A;  2HV1 A;  5HWV A;  1F9I A;  3BY9 A;  3CWF A;  4Y3I A;  2DMW A;  4P6Z M;  2HJE A;  3F1N B;  4XT2 A;  3LIE A;  4HP4 A;  3PHY A;  1BYW A;  2P7J A;  3EQU A;  5IS1 A;  3KYQ A;  3EOI A;  1S1Z A;  2PR6 A;  4IJG A;  4Q0I A;  2K31 A;  4HH2 A;  5AJG A;  1X0O A;  4EER A;  2M1C A;  4BJP A;  3R7W B;  1F98 A;  3MFX A;  3E0Y A;  4AFI A;  4II7 A;  3LIC A;  4CLC C;  2D01 A;  4GHI B;  3RFB A;  2L1M A;  3VV4 A;  3F1N A;  3EGX C;  4HH3 A;  2V1A A;  4HHD A;  5HDC A;  2J3W A;  4UEY A;  4WLA A;  4JGQ A;  1MKM A;  1MZU A;  3UB9 A;  4YWZ A;  1OTB A;  1H3Q A;  5TBM A;  3R7W A;  2KDK A;  2YKF A;  3RH8 B;  3T4Q A;  4WF0 A;  1LL8 A;  2VJW A;  3D72 A;  4WUJ A;  2M7U A;  4MDZ A;  1LT0 A;  3KSF A;  2W1T B;  1KOU A;  2KLI A;  4HJ6 A;  4H6J B;  3S7Q A;  2PD7 A;  3FPV A;  1YAX A;  1P9W A;  4GS9 B;  4WN5 A;  2ZBB A;  4GW9 A;  3LID A;  3CUE A;  2VZW A;  3BQ8 A;  3W2Z A;  3TE8 A;  4EQ1 A;  2O9A A;  2ZOH A;  2FZ0 A;  1T19 A;  2H28 A;  4CLC D;  5DJU A;  4BBT A;  2A2L A;  1UGU A;  3MF0 A;  1VB6 A;  4PKY G;  3OBF A;  1XFQ A;  3KYZ A;  5AVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...