4OH0A

Crystal structure of oxa-58 carbapenemase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
243
structure length
242
Chain Sequence
SIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFIANALIGLENHKATSTEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSGWGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase OXA-58
publication title Crystal Structure of Carbapenemase OXA-58 from Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 72
structure length 242
sequence length 243
ec nomenclature
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oh0A00
1KE0A 2JE5A 3G4PA 3WS2A 4PM5A 2HDQA 4XUZA 2XD5A 3V3RA 1I5QA 1ERMA 4GD6A 3M6HA 4QU3A 3BFEA 2HPBA 3UE0A 4BL2A 4IVKA 4UHUA 4QY6A 3Q82A 5FASA 1BSGA 2C5WB 3AGFA 4PMAA 2EX9A 3EQUA 3MZDA 1MWTA 4KG5A 5FAPA 4B4ZA 3A3IA 1KGEA 1XX2A 3UN7A 1FCNA 1JWZA 1XP4A 1SKFA 3JYIA 1ONHA 3BFFA 3HBRA 1E3UD 5E43A 2E8IA 4JF5A 2FFFB 3IHBA 1MWSA 3GMWA 5GHZA 1JWPA 3Q1FA 4N92A 1FOFA 1ZKJA 1MY8A 2WGWA 5HAPA 1PYYA 4KQOA 3UPPA 5E2HA 4FCFA 5TGFA 1DJAA 1K25A 4R3JA 2XDMA 3N4IA 2WADA 5EPHA 2ZQCA 2ZQ7A 1BZAA 2OV5A 4KZ5A 1DJBA 3LY3A 2XK1A 3D4FA 4U0XA 3HVFA 5M19A 3OPHA 1ES3A 4KG6A 4N9KA 5BOHA 2EXBA 4N1HA 2ZQAA 3IH8A 4X55A 2XFSA 1CI9A 1DY6A 1MXOA 4LENA 2XGNA 3BRMA 3G2ZA 3PAEA 2DCFA 1W79A 2WGVA 4PM8A 4UAAA 5FDHA 4KZBA 3N6IA 5AQBA 1E4DA 1CI8A 4OPRA 2G2UA 3IH9A 4S2OA 5GLCA 4UA6A 3DW0A 5FAQA 4QJGA 4DE2A 4BL3A 3P09A 1E3UA 1EROA 2IWCA 2XFTA 3NDEA 3MKEA 3DWZA 3TOIA 1YLWA 3CG5A 4RX3A 1FR1A 4LCLA 1IYSA 3ITAA 3Q81A 4MBHA 5CHJA 1N4OA 1K57A 2HDSA 4LV1A 2QMIA 2A3UA 1ZG6A 1ERQA 1PZOA 1O07A 2FFYA 3VMAA 3M2JA 5CTNA 1FSYA 2ZMAA 4K91A 1OMEA 4OONA 4YINA 5AQ9A 3NC8A 1H8YA 1JWVA 3IWQA 4JBFA 3GVBA 4GDNA 5CHUA 1GHPA 2EXAA 1FSWA 1BLCA 1XKZA 3LEZA 5CEBA 2UWXA 1FCMA 5DF7A 3FWLA 2Y4AA 4JKTA 3VP2A 3UNWA 1LI9A 4QD4A 2RCXA 4DE0A 2WAFA 5EE8A 1LI0A 4E6XA 1G6AA 3WS1A 1G68A 4S2IA 1VQQA 2Y2IA 3C4PA 1LLBA 3OZHA 4WZ4A 3M2KA 5G18A 4EV4A 5HARA 2ZM2A 1CEGA 4OKPA 4JF6A 3OCNA 3FKWA 4ID4A 5KSCA 2BLSA 3IT9A 1PZPA 3E2KA 3S4XA 3BLMA 3AGEA 4KQRA 3SH8A 3PBOA 2RL3A 5JYOA 5JYPA 4DRTA 4ZTKA 1SDEA 4S2PA 1MKIA 2ZC7A 1ES2A 3A3JA 1Q2QA 5AQAA 1K6SA 2IWDA 1YLPA 5A91A 2P9VA 2OSUA 5HL1A 3HUNA 1IYPA 1CEFA 1NZOA 1HZOA 4C6YA 4ZJ1A 5FA7A 4OPQA 5EVID 4X53A 1K55A 1LL5A 4MLLA 3IF5A 5FI7A 3GRJA 5CXWA 2PBYA 1GHIA 4MNRA 1W8YA 1BTLA 1K54C 4LV3A 4P6BA 4QB8A 1ALQA 1YLZA 4GKUA 2I72A 1XA1A 2ZM0A 2WUQA 1TEMA 3CMZA 3PBSA 3MXRA 3ZNTA 1ONGA 3MKFA 2Y55A 1TVFA 2J7VA 5FATA 3BFDA 3ZG9B 2H5SA 4OP8A 3DTMA 4KG2A 2WGWB 5GLAA 2JC7A 1IYOA 3PBRA 4B4XA 3LCEA 5GLDA 4JXWA 5TFQA 1HVBA 4KQQA 1PI4A 3UPNA 5HX9A 2WKEA 3N8SA 3FYZA 4E3IA 5GHYA 4ZJ2A 2V20A 4U3TA 2X71A 1LL9A 4ZAMA 1RGYA 3GR2A 4B88A 2ZQDA 5FI6A 4EBPA 4P85A 4JPMA 3ZDJA 2WGIA 3UO9A 2IWBA 1WYBA 1XA7A 1FR6A 3HREA 3BEBA 4RVAA 5EVIA 2Y2QA 1NYMA 3EQVA 4F94A 5L2FA 1SCWA 3NY4A 1H8ZA 3ZG5A 1ESIA 2PU4A 3M6BA 4Z9QA 3UDXA 2Y2GA 4EBNA 1ES5A 2ZQ8A 4QY5A 5I94A 1CK3A 1WYCA 1GCEA 4HBUA 4OPYA 1BLHA 3IWOA 5F83A 1YLTA 1ZC2A 3CZDA 3C5AA 4H8RA 4RA7A 3FZCA 4D2OA 2EX2A 1TDGA 3IHAA 4OOYA 3LO7A 4L0LA 2B5RA 1GHMA 1HTZA 1NJ4A 2ZC6B 1MPLA 4OOMA 4R0QA 5FQQA 5E2EA 2R9WA 3IQAA 2PU2A 4E3LA 1WE4A 4IBXA 2G2WA 5F1GA 5FQKA 4XUXA 5DVAA 3HLBA 2Y2MA 3ZG8B 2EX8A 2ZC5B 3VOYA 3W4PA 2ZJ9A 5KZHA 4OP5A 2DRWA 3HLWA 2HP6A 3HUOA 3OPRA 4GZBA 4WZ5C 5FQJA 3A3FA 2EFXA 4JXGA 4PM9A 1YMXA 1W8QA 3BLSA 1I2WA 4YFMA 3PAGA 4LV2A 3G31A 4ZDXA 4OPZA 3NDGA 4BD1A 3RJUA 3IF6C 4JXVA 1KDSA 3MBZA 2BG1A 1XPBA 1KDWA 4S2NC 3NIAA 1PW8A 4N1XA 3W8KA 3OPPA 4LCMA 4KZ4A 4BD0A 1K55C 4JXSA 4GDBA 3SOIA 1TDLA 3ZCZA 1NRFA 1PI5A 3O86A 4IEDA 5TR7A 1KVLA 4PM7A 1PW1A 3V50A 3MZFA 2ZC3B 3TG9A 3N8LA 4FD8A 3V39A 4M3KA 5EUAA 5FAOA 4WELA 3WRTA 3G32A 2XH9A 1HD8A 3IF6B 2R9XA 2X01A 2WZZA 1PWCA 3S1YA 3VP1A 2XLNA 5AQ7A 4UA9A 5FSRA 1QMFA 5KSHA 5CERA 5HAQA 3PBTA 2HDUA 5DF9A 1K56D 3C4OA 3HLFA 3C7VA 4NK3A 4WBGA 5FQ9A 3UE3A 3V5MA 4E3KA 4GB7A 3VFFA 3GQZA 4BJPA 4E3NA 4X56A 1KE4A 4E3OA 4QHCA 4JLFA 3PBNA 4EUZA 3G35A 4WMCD 3DWKA 3HLDA 4X68A 4E6WA 2Y2HA 3W4OA 3GSGA 1IYQA 3ZNYA 3VOZA 2WKIA 4Y0TA 4CPKA 3ZHHA 5DF8A 2GDNA 1XGJA 1RCJA 5CGWA 3UE1A 4X6TA 3OCLA 2ZLYA 4E3JA 5A93A 4OH0A 3N8RA 3OC2A 3Q07A 1EI5A 1M40A 2Q9MA 2Z2MB 3O3VA 5E2GA 5GL9A 2X02A 1MWUA 1FQGA 5M18A 2ZD8A 1KE3A 4WYYA 3NCKA 3IXDA 5EECA 4CJNA 4K0XA 3O87A 2XR0A 1K6RA 3BFCA 3VP3A 1YLYA 4MBFA 3WWXA 5M1AA 3Q7VA 3IXGA 2Y2JA 2HDRA 2WKHA 5F82A 1YMSA 5A92A 5F1FA 2ZQ9A 4N9LA 4Y7PA 1NY0A 4UA7A 5U47A 4KZ3A 1K56A 3NI9A 3SS4A 3SS5A 3UY6A 4GOGA 1N9BA 4R4RA 3IXHA 1XXMA 5CGSA 2V2FF 3P98A 2JBFA 5CGXA 4HESA 3ZG7B 1RGZA 1W5DA 2ZC4B 4C75A 4WMCA 3ISGA 3W4QA 1K57C 1KGFA 4DE3A 1GA0A 2QPNA 1IKIA 4JF4A 5CECA 4OQIA 3O88A 3AGDA 4OVDA 1K38A 1AXBA 1RP5A 4Y0UA 5GHXA 3UDIA 1U60A 3A3EA 1BUEA 5CRFA 3ZFZA 1I2SA 1XGIA 4MEZA 4EQIA 3WRZA 1KGGA 3HUMA 1IEMA 5EVLA 2Y59A 1YM1A 3OPLA 1M6KA 2OLUA 1KVMA 1O7EA 1Z6FA 3WS0A 1IKGA 3I7JA 1L0FA 1DJCA 3VFHA 3LY4A 2EFUA 4RX2A 1L2SA 5GLBA 5DTSA 3SH7A 4HBTA 3WS5A 5KMWA 2H0TA 2Y91A 2V1ZA 2XF3A 4KZ7A 1NZUA 3A3DA 3NBLA 5DTTA 4EWFA 4PPRA 4GN2A 2C6WB 3VSKA 3HLEA 4Q8IA 4K0WA 4Y0OA 1BLPA 4DF6A 4DDSA 1BULA 4FH2A 5DTKA 4DE1A 4A5RA 1K54A 3TSGA 3FV7A 1ZG4A 2WK0A 1MWRA 4WEJA 3B3XA 2Z2LB 1JTGA 2DNSA 4S2MA 1PWDA 3ITBA 2P74A 3HL9A 4FSFA 4DKIA 1L0GA 1IELA 4IVIA 4NETA 5HW3A 3MXSA 5EOOA 4KENB 2VGJA 5CEDA 4R23A 5FQIA 5D3OA 4ZJ3A 1L0EA 1K4FA 3MFDA 5FI2A 2Y2NA 1EWZA 1VM1A 5FQMA 2Y2KA 2VGKA 2EX6A 3Q7ZA 4O7DA 4P0MA 3C7UA 1PWGA 4DXBA 3GTCA 2QZ6A 4S2KA 4BENA 1QMEA 3QHYA 3HLGA 5EOEA 4DDYA 2Q9NA 3G2YA 2Y2PA 1H5XA 1Y54A 1JTDA 4KZ8A 1YT4A 4WEKA 4ZBEA 1J9MA 4BQMA 1W7FA 4OLDA 3BYDA 3IXBA 4HEFA 4WM9A 3VSLA 3G30A 5HFOA 1S6RA 1NYYA 2HP5A 5A90A 3FKVA 3ZG0A 1L0DA 4R4SA 1Q2PA 4MBKA 2XEPA 1FCOA 4R3BA 4GD8A 2P9VB 1BLSA 1E25A 1NXYA 2XQZA 3UPOA 5E2FA 2JCHA 4BLMA 4X69A 3WS4A 4E3MA 3MZEA 4S2JA 5IHVA 2J8YA 1SHVA 1SDNA 2WAEA 2A49A 3SH9A 4C3QA 4OQHA 4KZ6A 4KZAA 3HLCA 4IBRA 4RYEA 4FH4A 3BECA 4DXCA 3VP4A 3QNCA 2Y2OA 3BFGA 4R1GA 4XXRA 2WZXA 1YQSA 3CJMA 4P87A 2OLVA 5CTMA 5EVIC 2ZM8A 1YLJA 3BM6A 1JVJA 4WZ5A 1MBLA 1PIOA 3PTEA 3PBQA 3Q7VB 4PM6A 4EBLA 4OLGA 4GNUA 3SS3A 3E2LA 3N7WA 1LHYA 2J9PA 2WYXA 3G34A 3S22A 5J8XA 3V3SA 1ESUA 4LV0A 3UDFA 3ZVWA 2XD1A 3RXWA 3ZGAB 2J9OA 1S0WA 3QNBA 4S2LA 5CHMA 3IF6A 3ZVTA 3IWIA 1C3BA 2H10A 4OOLA 2CC1A 4S2NA 1K4EA 5HAIA 3VP0A 2H0YA 1GA9A 4OQGA 2Y2LA 3GV9A 4KZ9A 1BT5A 5EVIB 4OQ0A 4U0TA 2HP9A 3RXXA 1ES4A
chains in the Genus database with same CATH superfamily
2JE5A 3WS2A 4PM5A 2HDQA 3V3RA 1ERMA 4GD6A 4HY8A 3M6HA 4QU3A 3BFEA 4IVKA 4UHUA 3Q82A 3S7QA 3BWLA 4KG5A 1MWTA 4B4ZA 3UN7A 3L9KA 3JYIA 4HOIA 3KSHA 2OOLA 3IHBA 3Q1FA 1FOFA 1SKOA 4G3KA 4ESPA 1K25A 4R3JA 4EESA 1MC0A 2WADA 5EPHA 3D4FA 1VHMA 1XJ3A 4WF0A 4N9KA 1DY6A 4HI4A 2XGNA 2DCFA 2WGVA 4UAAA 5GLCA 3DW0A 2CMNA 1E3UA 2P08A 2XFTA 1CF0A 1ODVA 4O01A 1K57A 2O99A 2A3UA 1PZOA 5C5KA 1O07A 3VMAA 2E8JA 1FSYA 3IWQA 5EFWA 1UGUA 2HZ5A 1FSWA 1XKZA 2VV8A 1NRJA 1S1YA 5CEBA 4HIAA 2UWXA 3MSHA 2W3DA 4I39A 3FWLA 2VGLM 1N9LA 1X0OA 1MKMA 5EE8A 3NECA 1VQQA 3C4PA 3FG8A 3OZHA 4WZ4A 1UWPX 4EV4A 3OCNA 4NXGA 3IT9A 1PZPA 4Q0HA 4KQRA 1YKDA 3ICYA 5JYOA 5JYPA 4ZTKA 5TJJA 4S2PA 2L1MA 2ZC7A 3TRCA 4P6ZS 5AJGA 3IX4A 3KSGA 4GS9A 5HL6A 2W1TA 1CEFA 1DP9A 4C6YA 5FA7A 5EVID 4X53A 1LL5A 4MLLA 3IF5A 4MNRA 1K54C 3CMZA 1TEMA 3MXRA 3CAXA 3ZNTA 2J7VA 4KG2A 3PBRA 4B4XA 1SKOB 3OLOA 5DJTA 4U3TA 3CLOA 1KOUA 2X71A 4ZAMA 1RGYA 2K7SA 1YSQA 1YAXA 2ZQDA 4IHQA 1G5UA 4EBPA 4P85A 2IWBA 2B95A 4EUVA 4RVAA 5DKLA 3RFBA 2V0WA 3VE4A 3LR0A 3NY4A 3CUEA 3ZG5A 3LR5A 2Y2GA 4G3WA 4QY5A 1BLHA 2R78A 4I3IA 3U4LP 4H8RA 3C5AA 4RA7A 1D06A 4L0LA 2B5RA 1GHMA 1HTZA 3MQOA 4R0QA 4CLCA 2Y8HA 3LUQA 2R9WA 3UB6A 1T18A 4XUXA 3LFVA 2EX8A 2ZC5B 2ZJ9A 4WZ5C 3K3CA 2HP6A 4GZBA 4PM9A 2EFXA 3BLSA 3RJUA 4LRYC 1XPBA 2WKQA 4WN5A 3NIAA 3BJNA 2O9BA 1P0ZA 4X25A 3SOIA 1NRFA 1KVLA 5HDSA 3MZFA 1SZVA 2GX5A 2PT7A 2X01A 2Y79A 4GS9B 3S1YA 2XLNA 4EU0A 2W1TB 4UA9A 3PBTA 1K56D 2VV7A 4GB7A 3T4QA 4L9FA 4E3NA 4QHCA 3PBNA 4WMCD 4WUJA 3HLDA 4X68A 4E6WA 3W4OA 3GSGA 2PDRA 3ZNYA 3ZHHA 1XGJA 5CGWA 2A24A 2XA7S 4E3JA 2Q9MA 1FQGA 2LB5A 2VZWA 2ZD8A 4WYYA 2ZBBA 5EECA 3UMDA 2P04A 2XR0A 3T1XA 5M1AA 3Q7VA 2D02A 5IT5A 4BBTA 5F82A 1D7EA 4N9LA 1S66L 4UA7A 2IA2A 3NI9A 3UY6A 4GOGA 5IU1A 4PHTA 5CGSA 3ZG7B 5F68A 1W5DA 4I5SA 3W4QA 1GA0A 1IKIA 5CECA 4QWOA 2QHKA 4Y0UA 4D60A 5EM1A 4CLCB 4Y15A 3OBFA 3F1NA 1Z6FA 3F1OA 1IKGA 3CPTA 3B47A 1DJCA 4KZ7A 3NBLA 4PPRA 3UB9A 3VSKA 2INWA 4DF6A 1BULA 4FH2A 1XFNA 1K54A 5EM0A 1HLUP 1ZG4A 4WEJA 2DNSA 2I9VA 2P74A 2V8CA 4FSFA 3MQ0A 1L0GA 5FEGA 5FQIA 3UB5P 2D01A 2V9AA 3LR3A 2VGKA 2EX6A 1IFQA 4Q0IA 4O7DA 2B18A 3IS2A 1Y4OA 2Y2PA 1JTDA 1T1BA 4WEKA 1J9MA 5J3WA 4ARZA 4MCWA 4OLDA 1S4RA 4HEFA 4WM9A 1CQAA 1S6RA 1NYYA 2HF6A 3FKVA 3MJQA 1Q2PA 1OJGA 3LYXA 2XEPA 1E25A 1NXYA 3QP1A 3UPOA 2JCHA 4E3MA 2J3TD 4DN0A 3MZEA 4S2JA 5IHVA 1SDNA 2HJ9C 3IBRA 4DMZA 2OWHA 3HLCA 4FH4A 4DXCA 3V67A 1YQSA 1XJ2A 4WZ5A 3E0YA 3Q7VB 3PBQA 4FOFA 3C8CA 2J9PA 5J8XA 3ZVWA 3F1PB 2ZL1A 2J9OA 1S0WA 1H0MA 3IWIA 5HSQA 2H10A 5FL3A 5HPFA 4OOLA 5HAIA 2M7UA 5EVIB 2HP9A 1KE0A 4I3AA 2VK3A 1VETB 2HPBA 3UE0A 4DJ3A 5FASA 3F1NB 3EQUA 5FAPA 4XT2A 1KGEA 1JWZA 4O0PA 1SKFA 3BFFA 1E3UD 2E8IA 2FFFB 4N92A 2WGWA 5HAPA 1PFLA 2H28A 1ACFA 5E2HA 4FUWA 5TGFA 1OTDA 1BZAA 4HJ3A 4I38A 4U0XA 3HVFA 5M19A 1ES3A 4N1HA 3IH8A 2JKGA 4II7A 3N6IA 2PR6A 5AQBA 4OPRA 1GSXA 3IH9A 4S2OA 4ARZB 4BL3A 4HP4A 2IWCA 5HD3A 1YLWA 3CG5A 3ZYTA 1FR1A 4QPRA 3Q81A 5G4ZA 2HDSA 2QMIA 1NWZA 2VEAA 1OMEA 1A0KA 4RQ9A 5HWTA 4JBFA 3GVBA 2GZAA 1GHPA 4Y13A 1BLCA 3LEZA 2XA7M 1FCMA 5DF7A 2VJWA 3H7WA 3CI6A 3VP2A 1T1CA 4QD4A 3KSIA 2RCXA 4PKYG 1LI0A 1G6AA 3WS1A 1TS7A 4PKYA 3JPUA 3M2KA 5G18A 2K2NA 3FKWA 2ZL1B 2BLSA 2L0WA 3R7WA 2JKRI 3SH8A 2RL3A 3LR4A 3QP2A 4DRTA 1SDEA 1G28A 1T19A 3A3JA 1Q2QA 5AQAA 5A91A 2P9VA 4BWIA 3HUNA 1IYPA 3C38A 4ZJ1A 4JGOA 4OPQA 2VV6A 3GRJA 5CXWA 4XT2B 5HZHA 1W8YA 1BTLA 4P6BA 5AVFA 1YLZA 2I72A 2WUQA 3MKFA 2Q0OA 5FATA 3BFDA 2WGWB 2O9CA 2OAQ1 3LCEA 4JXWA 2M1CA 5TFQA 1HVBA 4KQQA 4CLCD 2WKEA 4I3JA 3FYZA 4E3IA 4ETZA 1LL9A 2YKHA 3RH8B 4X1MA 3EGDC 4JGQA 4B88A 3EEHA 5FI6A 2WGIA 1XA7A 1BYWA 3BEBA 4E04A 1NYMA 5L2FA 1IOUA 2A2LA 1H8ZA 1ESIA 2ZOIA 3HCYA 5L10A 1ES5A 1GCEA 3DTEA 5F83A 1ZC2A 3CZDA 4D2OA 1TDGA 1OT6A 3BQ8A 5HDCA 2ZC6B 4CQHA 5E2EA 4E3LA 3IQAA 3A0VA 4IBXA 5F1GA 3UMEA 3HLBA 3ZG8B 1MZUA 3W4PA 4OP5A 2DRWA 4JXGA 1YMXA 1W8QA 1I2WA 4G3VA 3G31A 3IF6C 1KDSA 2BG1A 1KDWA 2ZOHA 5L09A 4LCMA 3S7PA 4BD0A 3U2AA 1K55C 4GDBA 3LI8A 1PI5A 1ZHHB 4IEDA 3MXQA 1PW1A 2ZC3B 2WKPA 3N8LA 4M3KA 5FAOA 3WRTA 5F6AA 3G32A 1HD8A 2WZZA 2JKTM 5AQ7A 5FSRA 1QMFA 3C4OA 4WBGA 4NK3A 3VFFA 4X56A 4E3OA 1J3WA 4JLFA 2DMWA 3VOZA 2WKIA 2P7JA 1EI5A 3O3VA 1MWUA 4Y3IA 3IXDA 2J3WA 2HGVA 1W63M 3BFCA 1YLYA 2Y2JA 2WKHA 1YMSA 4ME4A 2W27A 4Y7PA 1NY0A 4KZ3A 3PHYA 3SS5A 1N9BA 3P7NA 4O8GA 4R4RA 1XXMA 2JBFA 4C75A 1KGFA 1S4SA 4OVDA 3NULA 1RP5A 2VA0A 5GHXA 5CRFA 3WRZA 2Y59A 3OPLA 2PAVP 5FDSA 2OLUA 3WS0A 1L0FA 4JGRA 4H6JA 5DTSA 3SH7A 4HBTA 3WS5A 5KMWA 2XF3A 5HDDA 3A3DA 3KX0X 4EWFA 4Q8IA 3LIDA 5DTKA 4DE1A 3T4OA 1MWRA 3E98A 3B3XA 3EEAA 2PD7A 4S2MA 2O9AA 4DKIA 4NETA 5EOOA 5CEDA 4ZJ3A 4HNBA 3MFDA 4DXBA 1PWGA 3HLGA 4LFUA 1H5XA 1W7FA 2W3GA 4LPZA 3LI9A 3OOVA 1D1JA 4HH3A 4R4SA 4MBKA 1G6OA 1FCOA 1YPRA 4GD8A 2XQZA 1N9NA 4X69A 3WS4A 3S7OA 4EETB 4HHDA 2WAEA 4LRXC 5EV0A 4GJ4A 5HWVA 2Y2OA 3BFGA 4R1GA 4M4XA 3CJMA 2W0NA 5CTMA 1H8MA 4GW9A 4OLGA 3B33A 4PAUA 4EBLA 3E2LA 4UQIS 3ZGAB 4S2LA 3IF6A 4EXOA 1K4EA 2H0YA 2QKPA 4KZ9A 1VEUA 4OQ0A 4U0TA 3RXXA 1ES4A 3MF0A 1I5QA 2WKRA 3W2ZA 4ETXA 5I5LA 2VX8A 4BL2A 4R3AA 2C5WB 3QP4A 3AGFA 1XX2A 1FCNA 1XP4A 1P9RA 3HBRA 5AVEA 4JF5A 3GMWA 1ZKJA 1MY8A 2ZMVA 1PYYA 3KO6A 3MQQA 2M7VA 3UPPA 3KSFA 1DJAA 2Z6DA 3D3OA 2ZQCA 4KZ5A 1DJBA 3LY3A 4R6LA 3OPHA 3K3DA 5BOHA 2EXBA 1TD5A 1CI9A 1MXOA 4LENA 3BRMA 5FDHA 3IX3A 4PM8A 4KZBA 1CI8A 3EGXC 2G2UA 3KYEA 4QJGA 4DE2A 5HPIA 3P09A 1EROA 4Y5FA 3NDEA 3TOIA 3DWZA 1VB6A 3BW6A 3LIBA 4RX3A 4LCLA 3ITAA 3T4SA 4MBHA 1N4OA 4LV1A 2FFYA 5CTNA 1LL8A 4P6ZM 3NC8A 1H8YA 4YOFA 5CHUA 3BQAA 4Q0JA 4KQDA 4AFIA 1DP8A 3D9YA 1H3QA 2L4RA 2Y4AA 4JKTA 1JNUA 1LI9A 2WAFA 2A24B 1S67L 3NOUC 3E4PA 4S2IA 3PYPA 1LLBA 3TJZC 1T1AA 1CEGA 1OTIA 4JF6A 4ID4A 5KSCA 3S7NA 3E2KA 3VV4A 3S4XA 3BLMA 3AGEA 5HWWA 2PR5A 3A0SA 3T12B 3C2WA 1MKIA 1K6SA 2IWDA 1YLPA 1TS6A 1HZOA 2QWSA 4LLOB 1GHIA 4QB8A 4GKUA 1TS0A 3PBSA 1OTBA 4OP8A 5GLAA 3LGOA 2JC7A 1IYOA 3MMHA 3UE6A 3E4OA 3F1OB 1PNEA 3CPTB 4GCZA 3UPNA 4ZJ2A 4GLQA 1TF1A 3ZQ5A 3T1QB 3GR2A 2FZ0A 1WA9A 3BY9A 1FR6A 3HREA 4F3LA 4KUOA 3EQVA 1SCWA 3T50A 1NLYA 2JN7A 3M6BA 3UDXA 4OPYA 2AVXA 1YSPA 3IWOA 3FZCA 2EX2A 4OOYA 3LO7A 3IS2B 3UB7A 3NOTC 1NJ4A 4OOMA 5FQQA 3DAVA 3HJKA 5K5BA 4DJ2A 2G2WA 2LB9A 1LSVA 3BY8A 3HLWA 3LIAA 3HUOA 2JHEA 3A3FA 3JVVA 3PAGA 4LV2A 3NDGA 4BD1A 4MN7A 4NXBA 4WLAA 1V9YA 4MN6A 1PW8A 3W8KA 4K08A 4UQIM 4JXSA 3ZCZA 4X1LA 5TR7A 4PM7A 3V50A 3TG9A 4NXFA 4FD8A 3RTYA 5EUAA 4WELA 2KOIA 2XH9A 3K2NA 4NG2A 1UWNX 1PWCA 5KSHA 5CERA 1ZTUA 2GNXA 2HDUA 5DF9A 5FQ9A 3V5MA 3HLFA 3C7VA 4E3KA 3ULFA 3T4LA 1KE4A 2G7UA 3G35A 2Y2HA 1IYQA 4CPKA 2GDNA 4EEPA 4X6TA 3OCLA 3UB8A 3CUEC 4OH0A 5GL9A 1L3LA 2X02A 4HQAA 1FIKA 1KE3A 3NCKA 5EVEA 4CJNA 2BTFP 4NXEA 1K6RA 3VP3A 3WWXA 2HDRA 5A92A 2ZQ9A 2ACGA 4F3LB 3IXHA 1GSVA 2V2FF 3P98A 5CGXA 4HESA 1RGZA 2NUPC 3LIFA 4DE3A 3L7HA 2QPNA 4OQIA 2PBDP 2V1AA 3FPVA 3UDIA 1DRMA 1U60A 1BUEA 1I2SA 4EQIA 3HUMA 3DTIA 3KYZA 3NJAA 1KVMA 2V1BA 3I7JA 3QP5A 3VFHA 2EFUA 1L2SA 5GLBA 4HH2A 2H0TA 2OAP1 1NZUA 5DTTA 4GN2A 3IBJA 4K0WA 1BLPA 4DDSA 2YKFA 3TSGA 3FV7A 2WK0A 5DJUA 2HJEA 2Z2LB 3HL9A 4IVIA 3H7WB 3MXSA 4KENB 4MDZA 4R23A 4HP9A 1W63Q 2Y2NA 5CX7A 3E4QA 4P0MA 2QZ6A 1OTEA 4S2KA 4BENA 3QHYA 2XROA 3G2YA 4ZBEA 3CWFA 3R7WB 1F2KA 2V0UA 3KYQA 1FILA 2HP5A 5A90A 4ZRRA 4R3BA 1CJFA 1BLSA 2P9VB 3LIEA 5E2FA 4BLMA 4LGWA 1SHVA 2HV1A 3LEQA 3H9WA 1EW0A 1DP6A 3P01A 4IBRA 4RYEA 1OJ5A 3VP4A 3EOIA 3QNCA 4P87A 5EVIC 2ZM8A 1YLJA 1JVJA 1MBLA 2W3EA 1STZA 4L9EA 4GNUA 4Y17A 1LHYA 3G34A 3S22A 3T4TA 3V3SA 1ESUA 4LV0A 4EEUA 1GSWA 3RXWA 1Y28A 1C3BA 5A8BA 2W3FA 3VP0A 3IX8A 4OQGA 2Y2LA 3GV9A 1BT5A 3G4PA 4XUZA 2XD5A 3H82A 1N9OA 2KDKA 4IUHA 4IJGA 2EWWA 1TS8A 4QY6A 1BSGA 3G6OA 4PMAA 3VOLA 2EX9A 3MZDA 2PRFA 3A3IA 2PHYA 4HJ4A 1ONHA 5DKKA 5E43A 5KIZA 1S1ZA 3R4KA 1MWSA 5GHZA 1JWPA 5F69A 4KQOA 4FCFA 3GDIA 4UEYA 2XDMA 3N4IA 2JKFA 2OV5A 2ZQ7A 2XK1A 3PR6A 4WL9A 4KG6A 2ZMFA 2ZQAA 4X55A 1OTAA 2XFSA 4BMWA 1F9IA 3G2ZA 3PAEA 1W79A 1LSWA 1E4DA 3MFXA 4UA6A 2JKRM 3CITA 5FAQA 3PXPA 3MKEA 2UV0E 3FC7A 3T1SA 1IYSA 5CHJA 1XJ4A 3NOPC 1P97A 3B42A 1ZG6A 1ERQA 4JGPA 2O0YA 3M2JA 2ZMAA 4K91A 4OONA 5AQ9A 4YINA 1JWVA 4GDNA 2EXAA 4KUKA 3DTKA 1F98A 4R38A 3UNWA 4DE0A 4E6XA 2PYRA 1G68A 5L8MA 2Y2IA 5L07A 2XRNA 3DBAA 5HARA 2ZM2A 4OKPA 2W3HA 4R70A 5HD5A 3PBOA 1ES2A 3TE8A 3H82B 2OSUA 5HL1A 3VE3A 1NZOA 1K55A 5FI7A 2XSSA 2PBYA 4YNRA 4LV3A 5J4EA 4YWZA 4BBVA 1ALQA 4NKPA 1XA1A 2ZM0A 1OT9A 1ONGA 2Y55A 1TVFA 3ZG9B 2H5SA 4BBUA 2PYPA 3DTMA 5GLDA 1K0KA 4L9GA 1PI4A 3EWKA 5HX9A 3N8SA 4H6JB 5GHYA 2V20A 3F1PA 4CLCE 3ZDJA 4JPMA 3UO9A 1WYBA 3MR0A 5EVIA 2Y2QA 3C30A 4F94A 2PU4A 4Z9QA 4EBNA 1VETA 2ZQ8A 5I94A 1CK3A 1WYCA 2EWVA 4HBUA 1YLTA 5F5YA 2FH5A 5J7EA 3IHAA 3FPWA 4Y2FA 1MPLA 2PU2A 2OWJA 5IS1A 1WE4A 5FQKA 2VLGA 5DVAA 2Y2MA 3VOYA 5KZHA 3HJIA 2K31A 5FQJA 4YFMA 2VKSA 2Z6CA 4ZDXA 4OPZA 4JXVA 3MBZA 4S2NC 4N1XA 3OPPA 4KZ4A 2J3TC 4GHIA 1LT0A 1TDLA 3O86A 2GJ3A 1P9WA 3V39A 3O5YA 3SZTA 3T4KA 3JVUA 3IF6B 2BASA 1OPXA 2R9XA 4EQ1A 4IUKA 3VP1A 5HAQA 5TBMA 3UE3A 1VEUB 5DFXA 4B93A 2W1RA 3GQZA 4BJPA 4EUZA 3QP8A 3DWKA 2KLIA 4Y0TA 1AWIA 5MC7A 5DF8A 1RCJA 3UE1A 3SW1A 2ZLYA 5A93A 2VGLS 3N8RA 3OC2A 3Q07A 2Z2MB 1M40A 5E2GA 2QJ7A 5M18A 3GECA 4K0XA 3O87A 3D72A 4MBFA 3IXGA 4EW7A 5F1FA 5U47A 1K56A 3SS4A 1NLZA 2ZC4B 4WMCA 3ISGA 2JKTI 1K57C 4JF4A 2EA9A 3O88A 3AGDA 1K38A 4FTXA 1AXBA 2B02A 2MJ6A 3A3EA 3ZFZA 1XGIA 4MEZA 4Z1WA 1KGGA 1IEMA 5G4YA 5EVLA 1YM1A 1M6KA 1O7EA 3LY4A 2QYBA 4RX2A 5FEFA 1F5MA 2KX6A 2V1ZA 2Y91A 4MN5A 2C6WB 3HLEA 4Y0OA 4EERA 4A5RA 3T4JA 2QJ5A 5DFYA 4LRZE 1JTGA 1PWDA 3ITBA 1IELA 5HW3A 4GHIB 2VGJA 3QP6A 5D3OA 1L0EA 1K4FA 5FI2A 1EWZA 1VM1A 5FQMA 2Y2KA 3Q7ZA 3C7UA 3LICA 3GTCA 2PD8A 1QMEA 5EOEA 4DDYA 2Q9NA 1Y54A 4KZ8A 1YT4A 4B9OA 4BQMA 3CHWP 4MMNA 3BYDA 3IXBA 3VSLA 3G30A 5TBMB 5HFOA 3NHQA 1Z09A 2V8FA 3TW8A 3ZG0A 1L0DA 1XFQA 2J8YA 3MS6A 2A49A 3SH9A 4C3QA 1PRQA 4OQHA 4KZ6A 4KZAA 2NUTC 3BECA 5LBRA 4XXRA 2WZXA 3A0RA 2OLVA 4NEED 1V9ZA 3BM6A 1PIOA 4PM6A 3PTEA 3SS3A 3N7WA 2WYXA 3T1RA 3UDFA 2XD1A 5CHMA 3QNBA 3ZVTA 2J80A 4HJ6A 2CC1A 4S2NA 1LSXA 4CLCC 1GA9A 1XJ6A 3OPRA
chains in the Genus database with same CATH topology
1KE0A 2JE5A 3G4PA 3WS2A 4PM5A 2HDQA 4XUZA 2XD5A 3V3RA 1I5QA 1ERMA 4GD6A 3M6HA 4QU3A 3BFEA 2HPBA 3UE0A 4BL2A 4IVKA 4UHUA 4QY6A 3Q82A 5FASA 1BSGA 2C5WB 3AGFA 4PMAA 2EX9A 3EQUA 3MZDA 1MWTA 4KG5A 5FAPA 4B4ZA 3A3IA 1KGEA 1XX2A 3UN7A 1FCNA 1JWZA 1XP4A 1SKFA 3JYIA 1ONHA 3BFFA 3HBRA 1E3UD 5E43A 2E8IA 4JF5A 2FFFB 3IHBA 1MWSA 3GMWA 5GHZA 1JWPA 3Q1FA 4N92A 1FOFA 1ZKJA 1MY8A 2WGWA 5HAPA 1PYYA 4KQOA 3UPPA 5E2HA 4FCFA 5TGFA 1DJAA 1K25A 4R3JA 2XDMA 3N4IA 2WADA 5EPHA 2ZQCA 2ZQ7A 1BZAA 2OV5A 4KZ5A 1DJBA 3LY3A 2XK1A 3D4FA 4U0XA 3HVFA 5M19A 3OPHA 1ES3A 4KG6A 4N9KA 5BOHA 2EXBA 4N1HA 2ZQAA 3IH8A 4X55A 2XFSA 1CI9A 1DY6A 1MXOA 4LENA 2XGNA 3BRMA 3G2ZA 3PAEA 2DCFA 1W79A 2WGVA 4PM8A 4UAAA 5FDHA 4KZBA 3N6IA 5AQBA 1E4DA 1CI8A 4OPRA 2G2UA 3IH9A 4S2OA 5GLCA 4UA6A 3DW0A 5FAQA 4QJGA 4DE2A 4BL3A 3P09A 1E3UA 1EROA 2IWCA 2XFTA 3NDEA 3MKEA 3DWZA 3TOIA 1YLWA 3CG5A 4RX3A 1FR1A 4LCLA 1IYSA 3ITAA 3Q81A 4MBHA 5CHJA 1N4OA 1K57A 2HDSA 4LV1A 2QMIA 2A3UA 1ZG6A 1ERQA 1PZOA 1O07A 2FFYA 3VMAA 3M2JA 5CTNA 1FSYA 2ZMAA 4K91A 1OMEA 4OONA 4YINA 5AQ9A 3NC8A 1H8YA 1JWVA 3IWQA 4JBFA 3GVBA 4GDNA 5CHUA 1GHPA 2EXAA 1FSWA 1BLCA 1XKZA 3LEZA 5CEBA 2UWXA 1FCMA 5DF7A 3FWLA 2Y4AA 4JKTA 3VP2A 3UNWA 1LI9A 4QD4A 2RCXA 4DE0A 2WAFA 5EE8A 1LI0A 4E6XA 1G6AA 3WS1A 1G68A 4S2IA 1VQQA 2Y2IA 3C4PA 1LLBA 3OZHA 4WZ4A 3M2KA 5G18A 4EV4A 5HARA 2ZM2A 1CEGA 4OKPA 4JF6A 3OCNA 3FKWA 4ID4A 5KSCA 2BLSA 3IT9A 1PZPA 3E2KA 3S4XA 3BLMA 3AGEA 4KQRA 3SH8A 3PBOA 2RL3A 5JYOA 5JYPA 4DRTA 4ZTKA 1SDEA 4S2PA 1MKIA 2ZC7A 1ES2A 3A3JA 1Q2QA 5AQAA 1K6SA 2IWDA 1YLPA 5A91A 2P9VA 2OSUA 5HL1A 3HUNA 1IYPA 1CEFA 1NZOA 1HZOA 4C6YA 4ZJ1A 5FA7A 4OPQA 5EVID 4X53A 1K55A 1LL5A 4MLLA 3IF5A 5FI7A 3GRJA 5CXWA 2PBYA 1GHIA 4MNRA 1W8YA 1BTLA 1K54C 4LV3A 4P6BA 4QB8A 1ALQA 1YLZA 4GKUA 2I72A 1XA1A 2ZM0A 2WUQA 1TEMA 3CMZA 3PBSA 3MXRA 3ZNTA 1ONGA 3MKFA 2Y55A 1TVFA 2J7VA 5FATA 3BFDA 3ZG9B 2H5SA 4OP8A 3DTMA 4KG2A 2WGWB 5GLAA 2JC7A 1IYOA 3PBRA 4B4XA 3LCEA 5GLDA 4JXWA 5TFQA 1HVBA 4KQQA 1PI4A 3UPNA 5HX9A 2WKEA 3N8SA 3FYZA 4E3IA 5GHYA 4ZJ2A 2V20A 4U3TA 2X71A 1LL9A 4ZAMA 1RGYA 3GR2A 4B88A 2ZQDA 5FI6A 4EBPA 4P85A 4JPMA 3ZDJA 2WGIA 3UO9A 2IWBA 1WYBA 1XA7A 1FR6A 3HREA 3BEBA 4RVAA 5EVIA 2Y2QA 1NYMA 3EQVA 4F94A 5L2FA 1SCWA 3NY4A 1H8ZA 3ZG5A 1ESIA 2PU4A 3M6BA 4Z9QA 3UDXA 2Y2GA 4EBNA 1ES5A 2ZQ8A 4QY5A 5I94A 1CK3A 1WYCA 1GCEA 4HBUA 4OPYA 1BLHA 3IWOA 5F83A 1YLTA 1ZC2A 3CZDA 3C5AA 4H8RA 4RA7A 3FZCA 4D2OA 2EX2A 1TDGA 3IHAA 4OOYA 3LO7A 4L0LA 2B5RA 1GHMA 1HTZA 1NJ4A 2ZC6B 1MPLA 4OOMA 4R0QA 5FQQA 5E2EA 2R9WA 3IQAA 2PU2A 4E3LA 1WE4A 4IBXA 2G2WA 5F1GA 5FQKA 4XUXA 5DVAA 3HLBA 2Y2MA 3ZG8B 2EX8A 2ZC5B 3VOYA 3W4PA 2ZJ9A 5KZHA 4OP5A 2DRWA 3HLWA 2HP6A 3HUOA 3OPRA 4GZBA 4WZ5C 5FQJA 3A3FA 2EFXA 4JXGA 4PM9A 1YMXA 1W8QA 3BLSA 1I2WA 4YFMA 3PAGA 4LV2A 3G31A 4ZDXA 4OPZA 3NDGA 4BD1A 3RJUA 3IF6C 4JXVA 1KDSA 3MBZA 2BG1A 1XPBA 1KDWA 4S2NC 3NIAA 1PW8A 4N1XA 3W8KA 3OPPA 4LCMA 4KZ4A 4BD0A 1K55C 4JXSA 4GDBA 3SOIA 1TDLA 3ZCZA 1NRFA 1PI5A 3O86A 4IEDA 5TR7A 1KVLA 4PM7A 1PW1A 3V50A 3MZFA 2ZC3B 3TG9A 3N8LA 4FD8A 3V39A 4M3KA 5EUAA 5FAOA 4WELA 3WRTA 3G32A 2XH9A 1HD8A 3IF6B 2R9XA 2X01A 2WZZA 1PWCA 3S1YA 3VP1A 2XLNA 5AQ7A 4UA9A 5FSRA 1QMFA 5KSHA 5CERA 5HAQA 3PBTA 2HDUA 5DF9A 1K56D 3C4OA 3HLFA 3C7VA 4NK3A 4WBGA 5FQ9A 3UE3A 3V5MA 4E3KA 4GB7A 3VFFA 3GQZA 4BJPA 4E3NA 4X56A 1KE4A 4E3OA 4QHCA 4JLFA 3PBNA 4EUZA 3G35A 4WMCD 3DWKA 3HLDA 4X68A 4E6WA 2Y2HA 3W4OA 3GSGA 1IYQA 3ZNYA 3VOZA 2WKIA 4Y0TA 4CPKA 3ZHHA 5DF8A 2GDNA 1XGJA 1RCJA 5CGWA 3UE1A 4X6TA 3OCLA 2ZLYA 4E3JA 5A93A 4OH0A 3N8RA 3OC2A 3Q07A 1EI5A 1M40A 2Q9MA 2Z2MB 3O3VA 5E2GA 5GL9A 2X02A 1MWUA 1FQGA 5M18A 2ZD8A 1KE3A 4WYYA 3NCKA 3IXDA 5EECA 4CJNA 4K0XA 3O87A 2XR0A 1K6RA 3BFCA 3VP3A 1YLYA 4MBFA 3WWXA 5M1AA 3Q7VA 3IXGA 2Y2JA 2HDRA 2WKHA 5F82A 1YMSA 5A92A 5F1FA 2ZQ9A 4N9LA 4Y7PA 1NY0A 4UA7A 5U47A 4KZ3A 1K56A 3NI9A 3SS4A 3SS5A 3UY6A 4GOGA 1N9BA 4R4RA 3IXHA 1XXMA 5CGSA 2V2FF 3P98A 2JBFA 5CGXA 4HESA 3ZG7B 1RGZA 1W5DA 2ZC4B 4C75A 4WMCA 3ISGA 3W4QA 1K57C 1KGFA 4DE3A 1GA0A 2QPNA 1IKIA 4JF4A 5CECA 4OQIA 3O88A 3AGDA 4OVDA 1K38A 1AXBA 1RP5A 4Y0UA 5GHXA 3UDIA 1U60A 3A3EA 1BUEA 5CRFA 3ZFZA 1I2SA 1XGIA 4MEZA 4EQIA 3WRZA 1KGGA 3HUMA 1IEMA 5EVLA 2Y59A 1YM1A 3OPLA 1M6KA 2OLUA 1KVMA 1O7EA 1Z6FA 3WS0A 1IKGA 3I7JA 1L0FA 1DJCA 3VFHA 3LY4A 2EFUA 4RX2A 1L2SA 5GLBA 5DTSA 3SH7A 4HBTA 3WS5A 5KMWA 2H0TA 2Y91A 2V1ZA 2XF3A 4KZ7A 1NZUA 3A3DA 3NBLA 5DTTA 4EWFA 4PPRA 4GN2A 2C6WB 3VSKA 3HLEA 4Q8IA 4K0WA 4Y0OA 1BLPA 4DF6A 4DDSA 1BULA 4FH2A 5DTKA 4DE1A 4A5RA 1K54A 3TSGA 3FV7A 1ZG4A 2WK0A 1MWRA 4WEJA 3B3XA 2Z2LB 1JTGA 2DNSA 4S2MA 1PWDA 3ITBA 2P74A 3HL9A 4FSFA 4DKIA 1L0GA 1IELA 4IVIA 4NETA 5HW3A 3MXSA 5EOOA 4KENB 2VGJA 5CEDA 4R23A 5FQIA 5D3OA 4ZJ3A 1L0EA 1K4FA 3MFDA 5FI2A 2Y2NA 1EWZA 1VM1A 5FQMA 2Y2KA 2VGKA 2EX6A 3Q7ZA 4O7DA 4P0MA 3C7UA 1PWGA 4DXBA 3GTCA 2QZ6A 4S2KA 4BENA 1QMEA 3QHYA 3HLGA 5EOEA 4DDYA 2Q9NA 3G2YA 2Y2PA 1H5XA 1Y54A 1JTDA 4KZ8A 1YT4A 4WEKA 4ZBEA 1J9MA 4BQMA 1W7FA 4OLDA 3BYDA 3IXBA 4HEFA 4WM9A 3VSLA 3G30A 5HFOA 1S6RA 1NYYA 2HP5A 5A90A 3FKVA 3ZG0A 1L0DA 4R4SA 1Q2PA 4MBKA 2XEPA 1FCOA 4R3BA 4GD8A 2P9VB 1BLSA 1E25A 1NXYA 2XQZA 3UPOA 5E2FA 2JCHA 4BLMA 4X69A 3WS4A 4E3MA 3MZEA 4S2JA 5IHVA 2J8YA 1SHVA 1SDNA 2WAEA 2A49A 3SH9A 4C3QA 4OQHA 4KZ6A 4KZAA 3HLCA 4IBRA 4RYEA 4FH4A 3BECA 4DXCA 3VP4A 3QNCA 2Y2OA 3BFGA 4R1GA 4XXRA 2WZXA 1YQSA 3CJMA 4P87A 2OLVA 5CTMA 5EVIC 2ZM8A 1YLJA 3BM6A 1JVJA 4WZ5A 1MBLA 1PIOA 3PTEA 3PBQA 3Q7VB 4PM6A 4EBLA 4OLGA 4GNUA 3SS3A 3E2LA 3N7WA 1LHYA 2J9PA 2WYXA 3G34A 3S22A 5J8XA 3V3SA 1ESUA 4LV0A 3UDFA 3ZVWA 2XD1A 3RXWA 3ZGAB 2J9OA 1S0WA 3QNBA 4S2LA 5CHMA 3IF6A 3ZVTA 3IWIA 1C3BA 2H10A 4OOLA 2CC1A 4S2NA 1K4EA 5HAIA 3VP0A 2H0YA 1GA9A 4OQGA 2Y2LA 3GV9A 4KZ9A 1BT5A 5EVIB 4OQ0A 4U0TA 2HP9A 3RXXA 1ES4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KE0 A;  2JE5 A;  3G4P A;  3WS2 A;  4PM5 A;  2HDQ A;  4XUZ A;  2XD5 A;  3V3R A;  1I5Q A;  1ERM A;  4GD6 A;  3M6H A;  4QU3 A;  3BFE A;  2HPB A;  3UE0 A;  4BL2 A;  4IVK A;  4UHU A;  4QY6 A;  3Q82 A;  5FAS A;  1BSG A;  2C5W B;  3AGF A;  4PMA A;  2EX9 A;  3EQU A;  3MZD A;  1MWT A;  4KG5 A;  5FAP A;  4B4Z A;  3A3I A;  1KGE A;  1XX2 A;  3UN7 A;  1FCN A;  1JWZ A;  1XP4 A;  1SKF A;  3JYI A;  1ONH A;  3BFF A;  3HBR A;  1E3U D;  5E43 A;  2E8I A;  4JF5 A;  2FFF B;  3IHB A;  1MWS A;  3GMW A;  5GHZ A;  1JWP A;  3Q1F A;  4N92 A;  1FOF A;  1ZKJ A;  1MY8 A;  2WGW A;  5HAP A;  1PYY A;  4KQO A;  3UPP A;  5E2H A;  4FCF A;  5TGF A;  1DJA A;  1K25 A;  4R3J A;  2XDM A;  3N4I A;  2WAD A;  5EPH A;  2ZQC A;  2ZQ7 A;  1BZA A;  2OV5 A;  4KZ5 A;  1DJB A;  3LY3 A;  2XK1 A;  3D4F A;  4U0X A;  3HVF A;  5M19 A;  3OPH A;  1ES3 A;  4KG6 A;  4N9K A;  5BOH A;  2EXB A;  4N1H A;  2ZQA A;  3IH8 A;  4X55 A;  2XFS A;  1CI9 A;  1DY6 A;  1MXO A;  4LEN A;  2XGN A;  3BRM A;  3G2Z A;  3PAE A;  2DCF A;  1W79 A;  2WGV A;  4PM8 A;  4UAA A;  5FDH A;  4KZB A;  3N6I A;  5AQB A;  1E4D A;  1CI8 A;  4OPR A;  2G2U A;  3IH9 A;  4S2O A;  5GLC A;  4UA6 A;  3DW0 A;  5FAQ A;  4QJG A;  4DE2 A;  4BL3 A;  3P09 A;  1E3U A;  1ERO A;  2IWC A;  2XFT A;  3NDE A;  3MKE A;  3DWZ A;  3TOI A;  1YLW A;  3CG5 A;  4RX3 A;  1FR1 A;  4LCL A;  1IYS A;  3ITA A;  3Q81 A;  4MBH A;  5CHJ A;  1N4O A;  1K57 A;  2HDS A;  4LV1 A;  2QMI A;  2A3U A;  1ZG6 A;  1ERQ A;  1PZO A;  1O07 A;  2FFY A;  3VMA A;  3M2J A;  5CTN A;  1FSY A;  2ZMA A;  4K91 A;  1OME A;  4OON A;  4YIN A;  5AQ9 A;  3NC8 A;  1H8Y A;  1JWV A;  3IWQ A;  4JBF A;  3GVB A;  4GDN A;  5CHU A;  1GHP A;  2EXA A;  1FSW A;  1BLC A;  1XKZ A;  3LEZ A;  5CEB A;  2UWX A;  1FCM A;  5DF7 A;  3FWL A;  2Y4A A;  4JKT A;  3VP2 A;  3UNW A;  1LI9 A;  4QD4 A;  2RCX A;  4DE0 A;  2WAF A;  5EE8 A;  1LI0 A;  4E6X A;  1G6A A;  3WS1 A;  1G68 A;  4S2I A;  1VQQ A;  2Y2I A;  3C4P A;  1LLB A;  3OZH A;  4WZ4 A;  3M2K A;  5G18 A;  4EV4 A;  5HAR A;  2ZM2 A;  1CEG A;  4OKP A;  4JF6 A;  3OCN A;  3FKW A;  4ID4 A;  5KSC A;  2BLS A;  3IT9 A;  1PZP A;  3E2K A;  3S4X A;  3BLM A;  3AGE A;  4KQR A;  3SH8 A;  3PBO A;  2RL3 A;  5JYO A;  5JYP A;  4DRT A;  4ZTK A;  1SDE A;  4S2P A;  1MKI A;  2ZC7 A;  1ES2 A;  3A3J A;  1Q2Q A;  5AQA A;  1K6S A;  2IWD A;  1YLP A;  5A91 A;  2P9V A;  2OSU A;  5HL1 A;  3HUN A;  1IYP A;  1CEF A;  1NZO A;  1HZO A;  4C6Y A;  4ZJ1 A;  5FA7 A;  4OPQ A;  5EVI D;  4X53 A;  1K55 A;  1LL5 A;  4MLL A;  3IF5 A;  5FI7 A;  3GRJ A;  5CXW A;  2PBY A;  1GHI A;  4MNR A;  1W8Y A;  1BTL A;  1K54 C;  4LV3 A;  4P6B A;  4QB8 A;  1ALQ A;  1YLZ A;  4GKU A;  2I72 A;  1XA1 A;  2ZM0 A;  2WUQ A;  1TEM A;  3CMZ A;  3PBS A;  3MXR A;  3ZNT A;  1ONG A;  3MKF A;  2Y55 A;  1TVF A;  2J7V A;  5FAT A;  3BFD A;  3ZG9 B;  2H5S A;  4OP8 A;  3DTM A;  4KG2 A;  2WGW B;  5GLA A;  2JC7 A;  1IYO A;  3PBR A;  4B4X A;  3LCE A;  5GLD A;  4JXW A;  5TFQ A;  1HVB A;  4KQQ A;  1PI4 A;  3UPN A;  5HX9 A;  2WKE A;  3N8S A;  3FYZ A;  4E3I A;  5GHY A;  4ZJ2 A;  2V20 A;  4U3T A;  2X71 A;  1LL9 A;  4ZAM A;  1RGY A;  3GR2 A;  4B88 A;  2ZQD A;  5FI6 A;  4EBP A;  4P85 A;  4JPM A;  3ZDJ A;  2WGI A;  3UO9 A;  2IWB A;  1WYB A;  1XA7 A;  1FR6 A;  3HRE A;  3BEB A;  4RVA A;  5EVI A;  2Y2Q A;  1NYM A;  3EQV A;  4F94 A;  5L2F A;  1SCW A;  3NY4 A;  1H8Z A;  3ZG5 A;  1ESI A;  2PU4 A;  3M6B A;  4Z9Q A;  3UDX A;  2Y2G A;  4EBN A;  1ES5 A;  2ZQ8 A;  4QY5 A;  5I94 A;  1CK3 A;  1WYC A;  1GCE A;  4HBU A;  4OPY A;  1BLH A;  3IWO A;  5F83 A;  1YLT A;  1ZC2 A;  3CZD A;  3C5A A;  4H8R A;  4RA7 A;  3FZC A;  4D2O A;  2EX2 A;  1TDG A;  3IHA A;  4OOY A;  3LO7 A;  4L0L A;  2B5R A;  1GHM A;  1HTZ A;  1NJ4 A;  2ZC6 B;  1MPL A;  4OOM A;  4R0Q A;  5FQQ A;  5E2E A;  2R9W A;  3IQA A;  2PU2 A;  4E3L A;  1WE4 A;  4IBX A;  2G2W A;  5F1G A;  5FQK A;  4XUX A;  5DVA A;  3HLB A;  2Y2M A;  3ZG8 B;  2EX8 A;  2ZC5 B;  3VOY A;  3W4P A;  2ZJ9 A;  5KZH A;  4OP5 A;  2DRW A;  3HLW A;  2HP6 A;  3HUO A;  3OPR A;  4GZB A;  4WZ5 C;  5FQJ A;  3A3F A;  2EFX A;  4JXG A;  4PM9 A;  1YMX A;  1W8Q A;  3BLS A;  1I2W A;  4YFM A;  3PAG A;  4LV2 A;  3G31 A;  4ZDX A;  4OPZ A;  3NDG A;  4BD1 A;  3RJU A;  3IF6 C;  4JXV A;  1KDS A;  3MBZ A;  2BG1 A;  1XPB A;  1KDW A;  4S2N C;  3NIA A;  1PW8 A;  4N1X A;  3W8K A;  3OPP A;  4LCM A;  4KZ4 A;  4BD0 A;  1K55 C;  4JXS A;  4GDB A;  3SOI A;  1TDL A;  3ZCZ A;  1NRF A;  1PI5 A;  3O86 A;  4IED A;  5TR7 A;  1KVL A;  4PM7 A;  1PW1 A;  3V50 A;  3MZF A;  2ZC3 B;  3TG9 A;  3N8L A;  4FD8 A;  3V39 A;  4M3K A;  5EUA A;  5FAO A;  4WEL A;  3WRT A;  3G32 A;  2XH9 A;  1HD8 A;  3IF6 B;  2R9X A;  2X01 A;  2WZZ A;  1PWC A;  3S1Y A;  3VP1 A;  2XLN A;  5AQ7 A;  4UA9 A;  5FSR A;  1QMF A;  5KSH A;  5CER A;  5HAQ A;  3PBT A;  2HDU A;  5DF9 A;  1K56 D;  3C4O A;  3HLF A;  3C7V A;  4NK3 A;  4WBG A;  5FQ9 A;  3UE3 A;  3V5M A;  4E3K A;  4GB7 A;  3VFF A;  3GQZ A;  4BJP A;  4E3N A;  4X56 A;  1KE4 A;  4E3O A;  4QHC A;  4JLF A;  3PBN A;  4EUZ A;  3G35 A;  4WMC D;  3DWK A;  3HLD A;  4X68 A;  4E6W A;  2Y2H A;  3W4O A;  3GSG A;  1IYQ A;  3ZNY A;  3VOZ A;  2WKI A;  4Y0T A;  4CPK A;  3ZHH A;  5DF8 A;  2GDN A;  1XGJ A;  1RCJ A;  5CGW A;  3UE1 A;  4X6T A;  3OCL A;  2ZLY A;  4E3J A;  5A93 A;  4OH0 A;  3N8R A;  3OC2 A;  3Q07 A;  1EI5 A;  1M40 A;  2Q9M A;  2Z2M B;  3O3V A;  5E2G A;  5GL9 A;  2X02 A;  1MWU A;  1FQG A;  5M18 A;  2ZD8 A;  1KE3 A;  4WYY A;  3NCK A;  3IXD A;  5EEC A;  4CJN A;  4K0X A;  3O87 A;  2XR0 A;  1K6R A;  3BFC A;  3VP3 A;  1YLY A;  4MBF A;  3WWX A;  5M1A A;  3Q7V A;  3IXG A;  2Y2J A;  2HDR A;  2WKH A;  5F82 A;  1YMS A;  5A92 A;  5F1F A;  2ZQ9 A;  4N9L A;  4Y7P A;  1NY0 A;  4UA7 A;  5U47 A;  4KZ3 A;  1K56 A;  3NI9 A;  3SS4 A;  3SS5 A;  3UY6 A;  4GOG A;  1N9B A;  4R4R A;  3IXH A;  1XXM A;  5CGS A;  2V2F F;  3P98 A;  2JBF A;  5CGX A;  4HES A;  3ZG7 B;  1RGZ A;  1W5D A;  2ZC4 B;  4C75 A;  4WMC A;  3ISG A;  3W4Q A;  1K57 C;  1KGF A;  4DE3 A;  1GA0 A;  2QPN A;  1IKI A;  4JF4 A;  5CEC A;  4OQI A;  3O88 A;  3AGD A;  4OVD A;  1K38 A;  1AXB A;  1RP5 A;  4Y0U A;  5GHX A;  3UDI A;  1U60 A;  3A3E A;  1BUE A;  5CRF A;  3ZFZ A;  1I2S A;  1XGI A;  4MEZ A;  4EQI A;  3WRZ A;  1KGG A;  3HUM A;  1IEM A;  5EVL A;  2Y59 A;  1YM1 A;  3OPL A;  1M6K A;  2OLU A;  1KVM A;  1O7E A;  1Z6F A;  3WS0 A;  1IKG A;  3I7J A;  1L0F A;  1DJC A;  3VFH A;  3LY4 A;  2EFU A;  4RX2 A;  1L2S A;  5GLB A;  5DTS A;  3SH7 A;  4HBT A;  3WS5 A;  5KMW A;  2H0T A;  2Y91 A;  2V1Z A;  2XF3 A;  4KZ7 A;  1NZU A;  3A3D A;  3NBL A;  5DTT A;  4EWF A;  4PPR A;  4GN2 A;  2C6W B;  3VSK A;  3HLE A;  4Q8I A;  4K0W A;  4Y0O A;  1BLP A;  4DF6 A;  4DDS A;  1BUL A;  4FH2 A;  5DTK A;  4DE1 A;  4A5R A;  1K54 A;  3TSG A;  3FV7 A;  1ZG4 A;  2WK0 A;  1MWR A;  4WEJ A;  3B3X A;  2Z2L B;  1JTG A;  2DNS A;  4S2M A;  1PWD A;  3ITB A;  2P74 A;  3HL9 A;  4FSF A;  4DKI A;  1L0G A;  1IEL A;  4IVI A;  4NET A;  5HW3 A;  3MXS A;  5EOO A;  4KEN B;  2VGJ A;  5CED A;  4R23 A;  5FQI A;  5D3O A;  4ZJ3 A;  1L0E A;  1K4F A;  3MFD A;  5FI2 A;  2Y2N A;  1EWZ A;  1VM1 A;  5FQM A;  2Y2K A;  2VGK A;  2EX6 A;  3Q7Z A;  4O7D A;  4P0M A;  3C7U A;  1PWG A;  4DXB A;  3GTC A;  2QZ6 A;  4S2K A;  4BEN A;  1QME A;  3QHY A;  3HLG A;  5EOE A;  4DDY A;  2Q9N A;  3G2Y A;  2Y2P A;  1H5X A;  1Y54 A;  1JTD A;  4KZ8 A;  1YT4 A;  4WEK A;  4ZBE A;  1J9M A;  4BQM A;  1W7F A;  4OLD A;  3BYD A;  3IXB A;  4HEF A;  4WM9 A;  3VSL A;  3G30 A;  5HFO A;  1S6R A;  1NYY A;  2HP5 A;  5A90 A;  3FKV A;  3ZG0 A;  1L0D A;  4R4S A;  1Q2P A;  4MBK A;  2XEP A;  1FCO A;  4R3B A;  4GD8 A;  2P9V B;  1BLS A;  1E25 A;  1NXY A;  2XQZ A;  3UPO A;  5E2F A;  2JCH A;  4BLM A;  4X69 A;  3WS4 A;  4E3M A;  3MZE A;  4S2J A;  5IHV A;  2J8Y A;  1SHV A;  1SDN A;  2WAE A;  2A49 A;  3SH9 A;  4C3Q A;  4OQH A;  4KZ6 A;  4KZA A;  3HLC A;  4IBR A;  4RYE A;  4FH4 A;  3BEC A;  4DXC A;  3VP4 A;  3QNC A;  2Y2O A;  3BFG A;  4R1G A;  4XXR A;  2WZX A;  1YQS A;  3CJM A;  4P87 A;  2OLV A;  5CTM A;  5EVI C;  2ZM8 A;  1YLJ A;  3BM6 A;  1JVJ A;  4WZ5 A;  1MBL A;  1PIO A;  3PTE A;  3PBQ A;  3Q7V B;  4PM6 A;  4EBL A;  4OLG A;  4GNU A;  3SS3 A;  3E2L A;  3N7W A;  1LHY A;  2J9P A;  2WYX A;  3G34 A;  3S22 A;  5J8X A;  3V3S A;  1ESU A;  4LV0 A;  3UDF A;  3ZVW A;  2XD1 A;  3RXW A;  3ZGA B;  2J9O A;  1S0W A;  3QNB A;  4S2L A;  5CHM A;  3IF6 A;  3ZVT A;  3IWI A;  1C3B A;  2H10 A;  4OOL A;  2CC1 A;  4S2N A;  1K4E A;  5HAI A;  3VP0 A;  2H0Y A;  1GA9 A;  4OQG A;  2Y2L A;  3GV9 A;  4KZ9 A;  1BT5 A;  5EVI B;  4OQ0 A;  4U0T A;  2HP9 A;  3RXX A;  1ES4 A; 
#chains in the Genus database with same CATH topology
 2JE5 A;  3WS2 A;  4PM5 A;  2HDQ A;  3V3R A;  1ERM A;  4GD6 A;  4HY8 A;  3M6H A;  4QU3 A;  3BFE A;  4IVK A;  4UHU A;  3Q82 A;  3S7Q A;  3BWL A;  4KG5 A;  1MWT A;  4B4Z A;  3UN7 A;  3L9K A;  3JYI A;  4HOI A;  3KSH A;  2OOL A;  3IHB A;  3Q1F A;  1FOF A;  1SKO A;  4G3K A;  4ESP A;  1K25 A;  4R3J A;  4EES A;  1MC0 A;  2WAD A;  5EPH A;  3D4F A;  1VHM A;  1XJ3 A;  4WF0 A;  4N9K A;  1DY6 A;  4HI4 A;  2XGN A;  2DCF A;  2WGV A;  4UAA A;  5GLC A;  3DW0 A;  2CMN A;  1E3U A;  2P08 A;  2XFT A;  1CF0 A;  1ODV A;  4O01 A;  1K57 A;  2O99 A;  2A3U A;  1PZO A;  5C5K A;  1O07 A;  3VMA A;  2E8J A;  1FSY A;  3IWQ A;  5EFW A;  1UGU A;  2HZ5 A;  1FSW A;  1XKZ A;  2VV8 A;  1NRJ A;  1S1Y A;  5CEB A;  4HIA A;  2UWX A;  3MSH A;  2W3D A;  4I39 A;  3FWL A;  2VGL M;  1N9L A;  1X0O A;  1MKM A;  5EE8 A;  3NEC A;  1VQQ A;  3C4P A;  3FG8 A;  3OZH A;  4WZ4 A;  1UWP X;  4EV4 A;  3OCN A;  4NXG A;  3IT9 A;  1PZP A;  4Q0H A;  4KQR A;  1YKD A;  3ICY A;  5JYO A;  5JYP A;  4ZTK A;  5TJJ A;  4S2P A;  2L1M A;  2ZC7 A;  3TRC A;  4P6Z S;  5AJG A;  3IX4 A;  3KSG A;  4GS9 A;  5HL6 A;  2W1T A;  1CEF A;  1DP9 A;  4C6Y A;  5FA7 A;  5EVI D;  4X53 A;  1LL5 A;  4MLL A;  3IF5 A;  4MNR A;  1K54 C;  3CMZ A;  1TEM A;  3MXR A;  3CAX A;  3ZNT A;  2J7V A;  4KG2 A;  3PBR A;  4B4X A;  1SKO B;  3OLO A;  5DJT A;  4U3T A;  3CLO A;  1KOU A;  2X71 A;  4ZAM A;  1RGY A;  2K7S A;  1YSQ A;  1YAX A;  2ZQD A;  4IHQ A;  1G5U A;  4EBP A;  4P85 A;  2IWB A;  2B95 A;  4EUV A;  4RVA A;  5DKL A;  3RFB A;  2V0W A;  3VE4 A;  3LR0 A;  3NY4 A;  3CUE A;  3ZG5 A;  3LR5 A;  2Y2G A;  4G3W A;  4QY5 A;  1BLH A;  2R78 A;  4I3I A;  3U4L P;  4H8R A;  3C5A A;  4RA7 A;  1D06 A;  4L0L A;  2B5R A;  1GHM A;  1HTZ A;  3MQO A;  4R0Q A;  4CLC A;  2Y8H A;  3LUQ A;  2R9W A;  3UB6 A;  1T18 A;  4XUX A;  3LFV A;  2EX8 A;  2ZC5 B;  2ZJ9 A;  4WZ5 C;  3K3C A;  2HP6 A;  4GZB A;  4PM9 A;  2EFX A;  3BLS A;  3RJU A;  4LRY C;  1XPB A;  2WKQ A;  4WN5 A;  3NIA A;  3BJN A;  2O9B A;  1P0Z A;  4X25 A;  3SOI A;  1NRF A;  1KVL A;  5HDS A;  3MZF A;  1SZV A;  2GX5 A;  2PT7 A;  2X01 A;  2Y79 A;  4GS9 B;  3S1Y A;  2XLN A;  4EU0 A;  2W1T B;  4UA9 A;  3PBT A;  1K56 D;  2VV7 A;  4GB7 A;  3T4Q A;  4L9F A;  4E3N A;  4QHC A;  3PBN A;  4WMC D;  4WUJ A;  3HLD A;  4X68 A;  4E6W A;  3W4O A;  3GSG A;  2PDR A;  3ZNY A;  3ZHH A;  1XGJ A;  5CGW A;  2A24 A;  2XA7 S;  4E3J A;  2Q9M A;  1FQG A;  2LB5 A;  2VZW A;  2ZD8 A;  4WYY A;  2ZBB A;  5EEC A;  3UMD A;  2P04 A;  2XR0 A;  3T1X A;  5M1A A;  3Q7V A;  2D02 A;  5IT5 A;  4BBT A;  5F82 A;  1D7E A;  4N9L A;  1S66 L;  4UA7 A;  2IA2 A;  3NI9 A;  3UY6 A;  4GOG A;  5IU1 A;  4PHT A;  5CGS A;  3ZG7 B;  5F68 A;  1W5D A;  4I5S A;  3W4Q A;  1GA0 A;  1IKI A;  5CEC A;  4QWO A;  2QHK A;  4Y0U A;  4D60 A;  5EM1 A;  4CLC B;  4Y15 A;  3OBF A;  3F1N A;  1Z6F A;  3F1O A;  1IKG A;  3CPT A;  3B47 A;  1DJC A;  4KZ7 A;  3NBL A;  4PPR A;  3UB9 A;  3VSK A;  2INW A;  4DF6 A;  1BUL A;  4FH2 A;  1XFN A;  1K54 A;  5EM0 A;  1HLU P;  1ZG4 A;  4WEJ A;  2DNS A;  2I9V A;  2P74 A;  2V8C A;  4FSF A;  3MQ0 A;  1L0G A;  5FEG A;  5FQI A;  3UB5 P;  2D01 A;  2V9A A;  3LR3 A;  2VGK A;  2EX6 A;  1IFQ A;  4Q0I A;  4O7D A;  2B18 A;  3IS2 A;  1Y4O A;  2Y2P A;  1JTD A;  1T1B A;  4WEK A;  1J9M A;  5J3W A;  4ARZ A;  4MCW A;  4OLD A;  1S4R A;  4HEF A;  4WM9 A;  1CQA A;  1S6R A;  1NYY A;  2HF6 A;  3FKV A;  3MJQ A;  1Q2P A;  1OJG A;  3LYX A;  2XEP A;  1E25 A;  1NXY A;  3QP1 A;  3UPO A;  2JCH A;  4E3M A;  2J3T D;  4DN0 A;  3MZE A;  4S2J A;  5IHV A;  1SDN A;  2HJ9 C;  3IBR A;  4DMZ A;  2OWH A;  3HLC A;  4FH4 A;  4DXC A;  3V67 A;  1YQS A;  1XJ2 A;  4WZ5 A;  3E0Y A;  3Q7V B;  3PBQ A;  4FOF A;  3C8C A;  2J9P A;  5J8X A;  3ZVW A;  3F1P B;  2ZL1 A;  2J9O A;  1S0W A;  1H0M A;  3IWI A;  5HSQ A;  2H10 A;  5FL3 A;  5HPF A;  4OOL A;  5HAI A;  2M7U A;  5EVI B;  2HP9 A;  1KE0 A;  4I3A A;  2VK3 A;  1VET B;  2HPB A;  3UE0 A;  4DJ3 A;  5FAS A;  3F1N B;  3EQU A;  5FAP A;  4XT2 A;  1KGE A;  1JWZ A;  4O0P A;  1SKF A;  3BFF A;  1E3U D;  2E8I A;  2FFF B;  4N92 A;  2WGW A;  5HAP A;  1PFL A;  2H28 A;  1ACF A;  5E2H A;  4FUW A;  5TGF A;  1OTD A;  1BZA A;  4HJ3 A;  4I38 A;  4U0X A;  3HVF A;  5M19 A;  1ES3 A;  4N1H A;  3IH8 A;  2JKG A;  4II7 A;  3N6I A;  2PR6 A;  5AQB A;  4OPR A;  1GSX A;  3IH9 A;  4S2O A;  4ARZ B;  4BL3 A;  4HP4 A;  2IWC A;  5HD3 A;  1YLW A;  3CG5 A;  3ZYT A;  1FR1 A;  4QPR A;  3Q81 A;  5G4Z A;  2HDS A;  2QMI A;  1NWZ A;  2VEA A;  1OME A;  1A0K A;  4RQ9 A;  5HWT A;  4JBF A;  3GVB A;  2GZA A;  1GHP A;  4Y13 A;  1BLC A;  3LEZ A;  2XA7 M;  1FCM A;  5DF7 A;  2VJW A;  3H7W A;  3CI6 A;  3VP2 A;  1T1C A;  4QD4 A;  3KSI A;  2RCX A;  4PKY G;  1LI0 A;  1G6A A;  3WS1 A;  1TS7 A;  4PKY A;  3JPU A;  3M2K A;  5G18 A;  2K2N A;  3FKW A;  2ZL1 B;  2BLS A;  2L0W A;  3R7W A;  2JKR I;  3SH8 A;  2RL3 A;  3LR4 A;  3QP2 A;  4DRT A;  1SDE A;  1G28 A;  1T19 A;  3A3J A;  1Q2Q A;  5AQA A;  5A91 A;  2P9V A;  4BWI A;  3HUN A;  1IYP A;  3C38 A;  4ZJ1 A;  4JGO A;  4OPQ A;  2VV6 A;  3GRJ A;  5CXW A;  4XT2 B;  5HZH A;  1W8Y A;  1BTL A;  4P6B A;  5AVF A;  1YLZ A;  2I72 A;  2WUQ A;  3MKF A;  2Q0O A;  5FAT A;  3BFD A;  2WGW B;  2O9C A;  2OAQ 1;  3LCE A;  4JXW A;  2M1C A;  5TFQ A;  1HVB A;  4KQQ A;  4CLC D;  2WKE A;  4I3J A;  3FYZ A;  4E3I A;  4ETZ A;  1LL9 A;  2YKH A;  3RH8 B;  4X1M A;  3EGD C;  4JGQ A;  4B88 A;  3EEH A;  5FI6 A;  2WGI A;  1XA7 A;  1BYW A;  3BEB A;  4E04 A;  1NYM A;  5L2F A;  1IOU A;  2A2L A;  1H8Z A;  1ESI A;  2ZOI A;  3HCY A;  5L10 A;  1ES5 A;  1GCE A;  3DTE A;  5F83 A;  1ZC2 A;  3CZD A;  4D2O A;  1TDG A;  1OT6 A;  3BQ8 A;  5HDC A;  2ZC6 B;  4CQH A;  5E2E A;  4E3L A;  3IQA A;  3A0V A;  4IBX A;  5F1G A;  3UME A;  3HLB A;  3ZG8 B;  1MZU A;  3W4P A;  4OP5 A;  2DRW A;  4JXG A;  1YMX A;  1W8Q A;  1I2W A;  4G3V A;  3G31 A;  3IF6 C;  1KDS A;  2BG1 A;  1KDW A;  2ZOH A;  5L09 A;  4LCM A;  3S7P A;  4BD0 A;  3U2A A;  1K55 C;  4GDB A;  3LI8 A;  1PI5 A;  1ZHH B;  4IED A;  3MXQ A;  1PW1 A;  2ZC3 B;  2WKP A;  3N8L A;  4M3K A;  5FAO A;  3WRT A;  5F6A A;  3G32 A;  1HD8 A;  2WZZ A;  2JKT M;  5AQ7 A;  5FSR A;  1QMF A;  3C4O A;  4WBG A;  4NK3 A;  3VFF A;  4X56 A;  4E3O A;  1J3W A;  4JLF A;  2DMW A;  3VOZ A;  2WKI A;  2P7J A;  1EI5 A;  3O3V A;  1MWU A;  4Y3I A;  3IXD A;  2J3W A;  2HGV A;  1W63 M;  3BFC A;  1YLY A;  2Y2J A;  2WKH A;  1YMS A;  4ME4 A;  2W27 A;  4Y7P A;  1NY0 A;  4KZ3 A;  3PHY A;  3SS5 A;  1N9B A;  3P7N A;  4O8G A;  4R4R A;  1XXM A;  2JBF A;  4C75 A;  1KGF A;  1S4S A;  4OVD A;  3NUL A;  1RP5 A;  2VA0 A;  5GHX A;  5CRF A;  3WRZ A;  2Y59 A;  3OPL A;  2PAV P;  5FDS A;  2OLU A;  3WS0 A;  1L0F A;  4JGR A;  4H6J A;  5DTS A;  3SH7 A;  4HBT A;  3WS5 A;  5KMW A;  2XF3 A;  5HDD A;  3A3D A;  3KX0 X;  4EWF A;  4Q8I A;  3LID A;  5DTK A;  4DE1 A;  3T4O A;  1MWR A;  3E98 A;  3B3X A;  3EEA A;  2PD7 A;  4S2M A;  2O9A A;  4DKI A;  4NET A;  5EOO A;  5CED A;  4ZJ3 A;  4HNB A;  3MFD A;  4DXB A;  1PWG A;  3HLG A;  4LFU A;  1H5X A;  1W7F A;  2W3G A;  4LPZ A;  3LI9 A;  3OOV A;  1D1J A;  4HH3 A;  4R4S A;  4MBK A;  1G6O A;  1FCO A;  1YPR A;  4GD8 A;  2XQZ A;  1N9N A;  4X69 A;  3WS4 A;  3S7O A;  4EET B;  4HHD A;  2WAE A;  4LRX C;  5EV0 A;  4GJ4 A;  5HWV A;  2Y2O A;  3BFG A;  4R1G A;  4M4X A;  3CJM A;  2W0N A;  5CTM A;  1H8M A;  4GW9 A;  4OLG A;  3B33 A;  4PAU A;  4EBL A;  3E2L A;  4UQI S;  3ZGA B;  4S2L A;  3IF6 A;  4EXO A;  1K4E A;  2H0Y A;  2QKP A;  4KZ9 A;  1VEU A;  4OQ0 A;  4U0T A;  3RXX A;  1ES4 A;  3MF0 A;  1I5Q A;  2WKR A;  3W2Z A;  4ETX A;  5I5L A;  2VX8 A;  4BL2 A;  4R3A A;  2C5W B;  3QP4 A;  3AGF A;  1XX2 A;  1FCN A;  1XP4 A;  1P9R A;  3HBR A;  5AVE A;  4JF5 A;  3GMW A;  1ZKJ A;  1MY8 A;  2ZMV A;  1PYY A;  3KO6 A;  3MQQ A;  2M7V A;  3UPP A;  3KSF A;  1DJA A;  2Z6D A;  3D3O A;  2ZQC A;  4KZ5 A;  1DJB A;  3LY3 A;  4R6L A;  3OPH A;  3K3D A;  5BOH A;  2EXB A;  1TD5 A;  1CI9 A;  1MXO A;  4LEN A;  3BRM A;  5FDH A;  3IX3 A;  4PM8 A;  4KZB A;  1CI8 A;  3EGX C;  2G2U A;  3KYE A;  4QJG A;  4DE2 A;  5HPI A;  3P09 A;  1ERO A;  4Y5F A;  3NDE A;  3TOI A;  3DWZ A;  1VB6 A;  3BW6 A;  3LIB A;  4RX3 A;  4LCL A;  3ITA A;  3T4S A;  4MBH A;  1N4O A;  4LV1 A;  2FFY A;  5CTN A;  1LL8 A;  4P6Z M;  3NC8 A;  1H8Y A;  4YOF A;  5CHU A;  3BQA A;  4Q0J A;  4KQD A;  4AFI A;  1DP8 A;  3D9Y A;  1H3Q A;  2L4R A;  2Y4A A;  4JKT A;  1JNU A;  1LI9 A;  2WAF A;  2A24 B;  1S67 L;  3NOU C;  3E4P A;  4S2I A;  3PYP A;  1LLB A;  3TJZ C;  1T1A A;  1CEG A;  1OTI A;  4JF6 A;  4ID4 A;  5KSC A;  3S7N A;  3E2K A;  3VV4 A;  3S4X A;  3BLM A;  3AGE A;  5HWW A;  2PR5 A;  3A0S A;  3T12 B;  3C2W A;  1MKI A;  1K6S A;  2IWD A;  1YLP A;  1TS6 A;  1HZO A;  2QWS A;  4LLO B;  1GHI A;  4QB8 A;  4GKU A;  1TS0 A;  3PBS A;  1OTB A;  4OP8 A;  5GLA A;  3LGO A;  2JC7 A;  1IYO A;  3MMH A;  3UE6 A;  3E4O A;  3F1O B;  1PNE A;  3CPT B;  4GCZ A;  3UPN A;  4ZJ2 A;  4GLQ A;  1TF1 A;  3ZQ5 A;  3T1Q B;  3GR2 A;  2FZ0 A;  1WA9 A;  3BY9 A;  1FR6 A;  3HRE A;  4F3L A;  4KUO A;  3EQV A;  1SCW A;  3T50 A;  1NLY A;  2JN7 A;  3M6B A;  3UDX A;  4OPY A;  2AVX A;  1YSP A;  3IWO A;  3FZC A;  2EX2 A;  4OOY A;  3LO7 A;  3IS2 B;  3UB7 A;  3NOT C;  1NJ4 A;  4OOM A;  5FQQ A;  3DAV A;  3HJK A;  5K5B A;  4DJ2 A;  2G2W A;  2LB9 A;  1LSV A;  3BY8 A;  3HLW A;  3LIA A;  3HUO A;  2JHE A;  3A3F A;  3JVV A;  3PAG A;  4LV2 A;  3NDG A;  4BD1 A;  4MN7 A;  4NXB A;  4WLA A;  1V9Y A;  4MN6 A;  1PW8 A;  3W8K A;  4K08 A;  4UQI M;  4JXS A;  3ZCZ A;  4X1L A;  5TR7 A;  4PM7 A;  3V50 A;  3TG9 A;  4NXF A;  4FD8 A;  3RTY A;  5EUA A;  4WEL A;  2KOI A;  2XH9 A;  3K2N A;  4NG2 A;  1UWN X;  1PWC A;  5KSH A;  5CER A;  1ZTU A;  2GNX A;  2HDU A;  5DF9 A;  5FQ9 A;  3V5M A;  3HLF A;  3C7V A;  4E3K A;  3ULF A;  3T4L A;  1KE4 A;  2G7U A;  3G35 A;  2Y2H A;  1IYQ A;  4CPK A;  2GDN A;  4EEP A;  4X6T A;  3OCL A;  3UB8 A;  3CUE C;  4OH0 A;  5GL9 A;  1L3L A;  2X02 A;  4HQA A;  1FIK A;  1KE3 A;  3NCK A;  5EVE A;  4CJN A;  2BTF P;  4NXE A;  1K6R A;  3VP3 A;  3WWX A;  2HDR A;  5A92 A;  2ZQ9 A;  2ACG A;  4F3L B;  3IXH A;  1GSV A;  2V2F F;  3P98 A;  5CGX A;  4HES A;  1RGZ A;  2NUP C;  3LIF A;  4DE3 A;  3L7H A;  2QPN A;  4OQI A;  2PBD P;  2V1A A;  3FPV A;  3UDI A;  1DRM A;  1U60 A;  1BUE A;  1I2S A;  4EQI A;  3HUM A;  3DTI A;  3KYZ A;  3NJA A;  1KVM A;  2V1B A;  3I7J A;  3QP5 A;  3VFH A;  2EFU A;  1L2S A;  5GLB A;  4HH2 A;  2H0T A;  2OAP 1;  1NZU A;  5DTT A;  4GN2 A;  3IBJ A;  4K0W A;  1BLP A;  4DDS A;  2YKF A;  3TSG A;  3FV7 A;  2WK0 A;  5DJU A;  2HJE A;  2Z2L B;  3HL9 A;  4IVI A;  3H7W B;  3MXS A;  4KEN B;  4MDZ A;  4R23 A;  4HP9 A;  1W63 Q;  2Y2N A;  5CX7 A;  3E4Q A;  4P0M A;  2QZ6 A;  1OTE A;  4S2K A;  4BEN A;  3QHY A;  2XRO A;  3G2Y A;  4ZBE A;  3CWF A;  3R7W B;  1F2K A;  2V0U A;  3KYQ A;  1FIL A;  2HP5 A;  5A90 A;  4ZRR A;  4R3B A;  1CJF A;  1BLS A;  2P9V B;  3LIE A;  5E2F A;  4BLM A;  4LGW A;  1SHV A;  2HV1 A;  3LEQ A;  3H9W A;  1EW0 A;  1DP6 A;  3P01 A;  4IBR A;  4RYE A;  1OJ5 A;  3VP4 A;  3EOI A;  3QNC A;  4P87 A;  5EVI C;  2ZM8 A;  1YLJ A;  1JVJ A;  1MBL A;  2W3E A;  1STZ A;  4L9E A;  4GNU A;  4Y17 A;  1LHY A;  3G34 A;  3S22 A;  3T4T A;  3V3S A;  1ESU A;  4LV0 A;  4EEU A;  1GSW A;  3RXW A;  1Y28 A;  1C3B A;  5A8B A;  2W3F A;  3VP0 A;  3IX8 A;  4OQG A;  2Y2L A;  3GV9 A;  1BT5 A;  3G4P A;  4XUZ A;  2XD5 A;  3H82 A;  1N9O A;  2KDK A;  4IUH A;  4IJG A;  2EWW A;  1TS8 A;  4QY6 A;  1BSG A;  3G6O A;  4PMA A;  3VOL A;  2EX9 A;  3MZD A;  2PRF A;  3A3I A;  2PHY A;  4HJ4 A;  1ONH A;  5DKK A;  5E43 A;  5KIZ A;  1S1Z A;  3R4K A;  1MWS A;  5GHZ A;  1JWP A;  5F69 A;  4KQO A;  4FCF A;  3GDI A;  4UEY A;  2XDM A;  3N4I A;  2JKF A;  2OV5 A;  2ZQ7 A;  2XK1 A;  3PR6 A;  4WL9 A;  4KG6 A;  2ZMF A;  2ZQA A;  4X55 A;  1OTA A;  2XFS A;  4BMW A;  1F9I A;  3G2Z A;  3PAE A;  1W79 A;  1LSW A;  1E4D A;  3MFX A;  4UA6 A;  2JKR M;  3CIT A;  5FAQ A;  3PXP A;  3MKE A;  2UV0 E;  3FC7 A;  3T1S A;  1IYS A;  5CHJ A;  1XJ4 A;  3NOP C;  1P97 A;  3B42 A;  1ZG6 A;  1ERQ A;  4JGP A;  2O0Y A;  3M2J A;  2ZMA A;  4K91 A;  4OON A;  5AQ9 A;  4YIN A;  1JWV A;  4GDN A;  2EXA A;  4KUK A;  3DTK A;  1F98 A;  4R38 A;  3UNW A;  4DE0 A;  4E6X A;  2PYR A;  1G68 A;  5L8M A;  2Y2I A;  5L07 A;  2XRN A;  3DBA A;  5HAR A;  2ZM2 A;  4OKP A;  2W3H A;  4R70 A;  5HD5 A;  3PBO A;  1ES2 A;  3TE8 A;  3H82 B;  2OSU A;  5HL1 A;  3VE3 A;  1NZO A;  1K55 A;  5FI7 A;  2XSS A;  2PBY A;  4YNR A;  4LV3 A;  5J4E A;  4YWZ A;  4BBV A;  1ALQ A;  4NKP A;  1XA1 A;  2ZM0 A;  1OT9 A;  1ONG A;  2Y55 A;  1TVF A;  3ZG9 B;  2H5S A;  4BBU A;  2PYP A;  3DTM A;  5GLD A;  1K0K A;  4L9G A;  1PI4 A;  3EWK A;  5HX9 A;  3N8S A;  4H6J B;  5GHY A;  2V20 A;  3F1P A;  4CLC E;  3ZDJ A;  4JPM A;  3UO9 A;  1WYB A;  3MR0 A;  5EVI A;  2Y2Q A;  3C30 A;  4F94 A;  2PU4 A;  4Z9Q A;  4EBN A;  1VET A;  2ZQ8 A;  5I94 A;  1CK3 A;  1WYC A;  2EWV A;  4HBU A;  1YLT A;  5F5Y A;  2FH5 A;  5J7E A;  3IHA A;  3FPW A;  4Y2F A;  1MPL A;  2PU2 A;  2OWJ A;  5IS1 A;  1WE4 A;  5FQK A;  2VLG A;  5DVA A;  2Y2M A;  3VOY A;  5KZH A;  3HJI A;  2K31 A;  5FQJ A;  4YFM A;  2VKS A;  2Z6C A;  4ZDX A;  4OPZ A;  4JXV A;  3MBZ A;  4S2N C;  4N1X A;  3OPP A;  4KZ4 A;  2J3T C;  4GHI A;  1LT0 A;  1TDL A;  3O86 A;  2GJ3 A;  1P9W A;  3V39 A;  3O5Y A;  3SZT A;  3T4K A;  3JVU A;  3IF6 B;  2BAS A;  1OPX A;  2R9X A;  4EQ1 A;  4IUK A;  3VP1 A;  5HAQ A;  5TBM A;  3UE3 A;  1VEU B;  5DFX A;  4B93 A;  2W1R A;  3GQZ A;  4BJP A;  4EUZ A;  3QP8 A;  3DWK A;  2KLI A;  4Y0T A;  1AWI A;  5MC7 A;  5DF8 A;  1RCJ A;  3UE1 A;  3SW1 A;  2ZLY A;  5A93 A;  2VGL S;  3N8R A;  3OC2 A;  3Q07 A;  2Z2M B;  1M40 A;  5E2G A;  2QJ7 A;  5M18 A;  3GEC A;  4K0X A;  3O87 A;  3D72 A;  4MBF A;  3IXG A;  4EW7 A;  5F1F A;  5U47 A;  1K56 A;  3SS4 A;  1NLZ A;  2ZC4 B;  4WMC A;  3ISG A;  2JKT I;  1K57 C;  4JF4 A;  2EA9 A;  3O88 A;  3AGD A;  1K38 A;  4FTX A;  1AXB A;  2B02 A;  2MJ6 A;  3A3E A;  3ZFZ A;  1XGI A;  4MEZ A;  4Z1W A;  1KGG A;  1IEM A;  5G4Y A;  5EVL A;  1YM1 A;  1M6K A;  1O7E A;  3LY4 A;  2QYB A;  4RX2 A;  5FEF A;  1F5M A;  2KX6 A;  2V1Z A;  2Y91 A;  4MN5 A;  2C6W B;  3HLE A;  4Y0O A;  4EER A;  4A5R A;  3T4J A;  2QJ5 A;  5DFY A;  4LRZ E;  1JTG A;  1PWD A;  3ITB A;  1IEL A;  5HW3 A;  4GHI B;  2VGJ A;  3QP6 A;  5D3O A;  1L0E A;  1K4F A;  5FI2 A;  1EWZ A;  1VM1 A;  5FQM A;  2Y2K A;  3Q7Z A;  3C7U A;  3LIC A;  3GTC A;  2PD8 A;  1QME A;  5EOE A;  4DDY A;  2Q9N A;  1Y54 A;  4KZ8 A;  1YT4 A;  4B9O A;  4BQM A;  3CHW P;  4MMN A;  3BYD A;  3IXB A;  3VSL A;  3G30 A;  5TBM B;  5HFO A;  3NHQ A;  1Z09 A;  2V8F A;  3TW8 A;  3ZG0 A;  1L0D A;  1XFQ A;  2J8Y A;  3MS6 A;  2A49 A;  3SH9 A;  4C3Q A;  1PRQ A;  4OQH A;  4KZ6 A;  4KZA A;  2NUT C;  3BEC A;  5LBR A;  4XXR A;  2WZX A;  3A0R A;  2OLV A;  4NEE D;  1V9Z A;  3BM6 A;  1PIO A;  4PM6 A;  3PTE A;  3SS3 A;  3N7W A;  2WYX A;  3T1R A;  3UDF A;  2XD1 A;  5CHM A;  3QNB A;  3ZVT A;  2J80 A;  4HJ6 A;  2CC1 A;  4S2N A;  1LSX A;  4CLC C;  1GA9 A;  1XJ6 A;  3OPR A; 
#chains in the Genus database with same CATH homology
 1KE0 A;  2JE5 A;  3G4P A;  3WS2 A;  4PM5 A;  2HDQ A;  4XUZ A;  2XD5 A;  3V3R A;  1I5Q A;  1ERM A;  4GD6 A;  3M6H A;  4QU3 A;  3BFE A;  2HPB A;  3UE0 A;  4BL2 A;  4IVK A;  4UHU A;  4QY6 A;  3Q82 A;  5FAS A;  1BSG A;  2C5W B;  3AGF A;  4PMA A;  2EX9 A;  3EQU A;  3MZD A;  1MWT A;  4KG5 A;  5FAP A;  4B4Z A;  3A3I A;  1KGE A;  1XX2 A;  3UN7 A;  1FCN A;  1JWZ A;  1XP4 A;  1SKF A;  3JYI A;  1ONH A;  3BFF A;  3HBR A;  1E3U D;  5E43 A;  2E8I A;  4JF5 A;  2FFF B;  3IHB A;  1MWS A;  3GMW A;  5GHZ A;  1JWP A;  3Q1F A;  4N92 A;  1FOF A;  1ZKJ A;  1MY8 A;  2WGW A;  5HAP A;  1PYY A;  4KQO A;  3UPP A;  5E2H A;  4FCF A;  5TGF A;  1DJA A;  1K25 A;  4R3J A;  2XDM A;  3N4I A;  2WAD A;  5EPH A;  2ZQC A;  2ZQ7 A;  1BZA A;  2OV5 A;  4KZ5 A;  1DJB A;  3LY3 A;  2XK1 A;  3D4F A;  4U0X A;  3HVF A;  5M19 A;  3OPH A;  1ES3 A;  4KG6 A;  4N9K A;  5BOH A;  2EXB A;  4N1H A;  2ZQA A;  3IH8 A;  4X55 A;  2XFS A;  1CI9 A;  1DY6 A;  1MXO A;  4LEN A;  2XGN A;  3BRM A;  3G2Z A;  3PAE A;  2DCF A;  1W79 A;  2WGV A;  4PM8 A;  4UAA A;  5FDH A;  4KZB A;  3N6I A;  5AQB A;  1E4D A;  1CI8 A;  4OPR A;  2G2U A;  3IH9 A;  4S2O A;  5GLC A;  4UA6 A;  3DW0 A;  5FAQ A;  4QJG A;  4DE2 A;  4BL3 A;  3P09 A;  1E3U A;  1ERO A;  2IWC A;  2XFT A;  3NDE A;  3MKE A;  3DWZ A;  3TOI A;  1YLW A;  3CG5 A;  4RX3 A;  1FR1 A;  4LCL A;  1IYS A;  3ITA A;  3Q81 A;  4MBH A;  5CHJ A;  1N4O A;  1K57 A;  2HDS A;  4LV1 A;  2QMI A;  2A3U A;  1ZG6 A;  1ERQ A;  1PZO A;  1O07 A;  2FFY A;  3VMA A;  3M2J A;  5CTN A;  1FSY A;  2ZMA A;  4K91 A;  1OME A;  4OON A;  4YIN A;  5AQ9 A;  3NC8 A;  1H8Y A;  1JWV A;  3IWQ A;  4JBF A;  3GVB A;  4GDN A;  5CHU A;  1GHP A;  2EXA A;  1FSW A;  1BLC A;  1XKZ A;  3LEZ A;  5CEB A;  2UWX A;  1FCM A;  5DF7 A;  3FWL A;  2Y4A A;  4JKT A;  3VP2 A;  3UNW A;  1LI9 A;  4QD4 A;  2RCX A;  4DE0 A;  2WAF A;  5EE8 A;  1LI0 A;  4E6X A;  1G6A A;  3WS1 A;  1G68 A;  4S2I A;  1VQQ A;  2Y2I A;  3C4P A;  1LLB A;  3OZH A;  4WZ4 A;  3M2K A;  5G18 A;  4EV4 A;  5HAR A;  2ZM2 A;  1CEG A;  4OKP A;  4JF6 A;  3OCN A;  3FKW A;  4ID4 A;  5KSC A;  2BLS A;  3IT9 A;  1PZP A;  3E2K A;  3S4X A;  3BLM A;  3AGE A;  4KQR A;  3SH8 A;  3PBO A;  2RL3 A;  5JYO A;  5JYP A;  4DRT A;  4ZTK A;  1SDE A;  4S2P A;  1MKI A;  2ZC7 A;  1ES2 A;  3A3J A;  1Q2Q A;  5AQA A;  1K6S A;  2IWD A;  1YLP A;  5A91 A;  2P9V A;  2OSU A;  5HL1 A;  3HUN A;  1IYP A;  1CEF A;  1NZO A;  1HZO A;  4C6Y A;  4ZJ1 A;  5FA7 A;  4OPQ A;  5EVI D;  4X53 A;  1K55 A;  1LL5 A;  4MLL A;  3IF5 A;  5FI7 A;  3GRJ A;  5CXW A;  2PBY A;  1GHI A;  4MNR A;  1W8Y A;  1BTL A;  1K54 C;  4LV3 A;  4P6B A;  4QB8 A;  1ALQ A;  1YLZ A;  4GKU A;  2I72 A;  1XA1 A;  2ZM0 A;  2WUQ A;  1TEM A;  3CMZ A;  3PBS A;  3MXR A;  3ZNT A;  1ONG A;  3MKF A;  2Y55 A;  1TVF A;  2J7V A;  5FAT A;  3BFD A;  3ZG9 B;  2H5S A;  4OP8 A;  3DTM A;  4KG2 A;  2WGW B;  5GLA A;  2JC7 A;  1IYO A;  3PBR A;  4B4X A;  3LCE A;  5GLD A;  4JXW A;  5TFQ A;  1HVB A;  4KQQ A;  1PI4 A;  3UPN A;  5HX9 A;  2WKE A;  3N8S A;  3FYZ A;  4E3I A;  5GHY A;  4ZJ2 A;  2V20 A;  4U3T A;  2X71 A;  1LL9 A;  4ZAM A;  1RGY A;  3GR2 A;  4B88 A;  2ZQD A;  5FI6 A;  4EBP A;  4P85 A;  4JPM A;  3ZDJ A;  2WGI A;  3UO9 A;  2IWB A;  1WYB A;  1XA7 A;  1FR6 A;  3HRE A;  3BEB A;  4RVA A;  5EVI A;  2Y2Q A;  1NYM A;  3EQV A;  4F94 A;  5L2F A;  1SCW A;  3NY4 A;  1H8Z A;  3ZG5 A;  1ESI A;  2PU4 A;  3M6B A;  4Z9Q A;  3UDX A;  2Y2G A;  4EBN A;  1ES5 A;  2ZQ8 A;  4QY5 A;  5I94 A;  1CK3 A;  1WYC A;  1GCE A;  4HBU A;  4OPY A;  1BLH A;  3IWO A;  5F83 A;  1YLT A;  1ZC2 A;  3CZD A;  3C5A A;  4H8R A;  4RA7 A;  3FZC A;  4D2O A;  2EX2 A;  1TDG A;  3IHA A;  4OOY A;  3LO7 A;  4L0L A;  2B5R A;  1GHM A;  1HTZ A;  1NJ4 A;  2ZC6 B;  1MPL A;  4OOM A;  4R0Q A;  5FQQ A;  5E2E A;  2R9W A;  3IQA A;  2PU2 A;  4E3L A;  1WE4 A;  4IBX A;  2G2W A;  5F1G A;  5FQK A;  4XUX A;  5DVA A;  3HLB A;  2Y2M A;  3ZG8 B;  2EX8 A;  2ZC5 B;  3VOY A;  3W4P A;  2ZJ9 A;  5KZH A;  4OP5 A;  2DRW A;  3HLW A;  2HP6 A;  3HUO A;  3OPR A;  4GZB A;  4WZ5 C;  5FQJ A;  3A3F A;  2EFX A;  4JXG A;  4PM9 A;  1YMX A;  1W8Q A;  3BLS A;  1I2W A;  4YFM A;  3PAG A;  4LV2 A;  3G31 A;  4ZDX A;  4OPZ A;  3NDG A;  4BD1 A;  3RJU A;  3IF6 C;  4JXV A;  1KDS A;  3MBZ A;  2BG1 A;  1XPB A;  1KDW A;  4S2N C;  3NIA A;  1PW8 A;  4N1X A;  3W8K A;  3OPP A;  4LCM A;  4KZ4 A;  4BD0 A;  1K55 C;  4JXS A;  4GDB A;  3SOI A;  1TDL A;  3ZCZ A;  1NRF A;  1PI5 A;  3O86 A;  4IED A;  5TR7 A;  1KVL A;  4PM7 A;  1PW1 A;  3V50 A;  3MZF A;  2ZC3 B;  3TG9 A;  3N8L A;  4FD8 A;  3V39 A;  4M3K A;  5EUA A;  5FAO A;  4WEL A;  3WRT A;  3G32 A;  2XH9 A;  1HD8 A;  3IF6 B;  2R9X A;  2X01 A;  2WZZ A;  1PWC A;  3S1Y A;  3VP1 A;  2XLN A;  5AQ7 A;  4UA9 A;  5FSR A;  1QMF A;  5KSH A;  5CER A;  5HAQ A;  3PBT A;  2HDU A;  5DF9 A;  1K56 D;  3C4O A;  3HLF A;  3C7V A;  4NK3 A;  4WBG A;  5FQ9 A;  3UE3 A;  3V5M A;  4E3K A;  4GB7 A;  3VFF A;  3GQZ A;  4BJP A;  4E3N A;  4X56 A;  1KE4 A;  4E3O A;  4QHC A;  4JLF A;  3PBN A;  4EUZ A;  3G35 A;  4WMC D;  3DWK A;  3HLD A;  4X68 A;  4E6W A;  2Y2H A;  3W4O A;  3GSG A;  1IYQ A;  3ZNY A;  3VOZ A;  2WKI A;  4Y0T A;  4CPK A;  3ZHH A;  5DF8 A;  2GDN A;  1XGJ A;  1RCJ A;  5CGW A;  3UE1 A;  4X6T A;  3OCL A;  2ZLY A;  4E3J A;  5A93 A;  4OH0 A;  3N8R A;  3OC2 A;  3Q07 A;  1EI5 A;  1M40 A;  2Q9M A;  2Z2M B;  3O3V A;  5E2G A;  5GL9 A;  2X02 A;  1MWU A;  1FQG A;  5M18 A;  2ZD8 A;  1KE3 A;  4WYY A;  3NCK A;  3IXD A;  5EEC A;  4CJN A;  4K0X A;  3O87 A;  2XR0 A;  1K6R A;  3BFC A;  3VP3 A;  1YLY A;  4MBF A;  3WWX A;  5M1A A;  3Q7V A;  3IXG A;  2Y2J A;  2HDR A;  2WKH A;  5F82 A;  1YMS A;  5A92 A;  5F1F A;  2ZQ9 A;  4N9L A;  4Y7P A;  1NY0 A;  4UA7 A;  5U47 A;  4KZ3 A;  1K56 A;  3NI9 A;  3SS4 A;  3SS5 A;  3UY6 A;  4GOG A;  1N9B A;  4R4R A;  3IXH A;  1XXM A;  5CGS A;  2V2F F;  3P98 A;  2JBF A;  5CGX A;  4HES A;  3ZG7 B;  1RGZ A;  1W5D A;  2ZC4 B;  4C75 A;  4WMC A;  3ISG A;  3W4Q A;  1K57 C;  1KGF A;  4DE3 A;  1GA0 A;  2QPN A;  1IKI A;  4JF4 A;  5CEC A;  4OQI A;  3O88 A;  3AGD A;  4OVD A;  1K38 A;  1AXB A;  1RP5 A;  4Y0U A;  5GHX A;  3UDI A;  1U60 A;  3A3E A;  1BUE A;  5CRF A;  3ZFZ A;  1I2S A;  1XGI A;  4MEZ A;  4EQI A;  3WRZ A;  1KGG A;  3HUM A;  1IEM A;  5EVL A;  2Y59 A;  1YM1 A;  3OPL A;  1M6K A;  2OLU A;  1KVM A;  1O7E A;  1Z6F A;  3WS0 A;  1IKG A;  3I7J A;  1L0F A;  1DJC A;  3VFH A;  3LY4 A;  2EFU A;  4RX2 A;  1L2S A;  5GLB A;  5DTS A;  3SH7 A;  4HBT A;  3WS5 A;  5KMW A;  2H0T A;  2Y91 A;  2V1Z A;  2XF3 A;  4KZ7 A;  1NZU A;  3A3D A;  3NBL A;  5DTT A;  4EWF A;  4PPR A;  4GN2 A;  2C6W B;  3VSK A;  3HLE A;  4Q8I A;  4K0W A;  4Y0O A;  1BLP A;  4DF6 A;  4DDS A;  1BUL A;  4FH2 A;  5DTK A;  4DE1 A;  4A5R A;  1K54 A;  3TSG A;  3FV7 A;  1ZG4 A;  2WK0 A;  1MWR A;  4WEJ A;  3B3X A;  2Z2L B;  1JTG A;  2DNS A;  4S2M A;  1PWD A;  3ITB A;  2P74 A;  3HL9 A;  4FSF A;  4DKI A;  1L0G A;  1IEL A;  4IVI A;  4NET A;  5HW3 A;  3MXS A;  5EOO A;  4KEN B;  2VGJ A;  5CED A;  4R23 A;  5FQI A;  5D3O A;  4ZJ3 A;  1L0E A;  1K4F A;  3MFD A;  5FI2 A;  2Y2N A;  1EWZ A;  1VM1 A;  5FQM A;  2Y2K A;  2VGK A;  2EX6 A;  3Q7Z A;  4O7D A;  4P0M A;  3C7U A;  1PWG A;  4DXB A;  3GTC A;  2QZ6 A;  4S2K A;  4BEN A;  1QME A;  3QHY A;  3HLG A;  5EOE A;  4DDY A;  2Q9N A;  3G2Y A;  2Y2P A;  1H5X A;  1Y54 A;  1JTD A;  4KZ8 A;  1YT4 A;  4WEK A;  4ZBE A;  1J9M A;  4BQM A;  1W7F A;  4OLD A;  3BYD A;  3IXB A;  4HEF A;  4WM9 A;  3VSL A;  3G30 A;  5HFO A;  1S6R A;  1NYY A;  2HP5 A;  5A90 A;  3FKV A;  3ZG0 A;  1L0D A;  4R4S A;  1Q2P A;  4MBK A;  2XEP A;  1FCO A;  4R3B A;  4GD8 A;  2P9V B;  1BLS A;  1E25 A;  1NXY A;  2XQZ A;  3UPO A;  5E2F A;  2JCH A;  4BLM A;  4X69 A;  3WS4 A;  4E3M A;  3MZE A;  4S2J A;  5IHV A;  2J8Y A;  1SHV A;  1SDN A;  2WAE A;  2A49 A;  3SH9 A;  4C3Q A;  4OQH A;  4KZ6 A;  4KZA A;  3HLC A;  4IBR A;  4RYE A;  4FH4 A;  3BEC A;  4DXC A;  3VP4 A;  3QNC A;  2Y2O A;  3BFG A;  4R1G A;  4XXR A;  2WZX A;  1YQS A;  3CJM A;  4P87 A;  2OLV A;  5CTM A;  5EVI C;  2ZM8 A;  1YLJ A;  3BM6 A;  1JVJ A;  4WZ5 A;  1MBL A;  1PIO A;  3PTE A;  3PBQ A;  3Q7V B;  4PM6 A;  4EBL A;  4OLG A;  4GNU A;  3SS3 A;  3E2L A;  3N7W A;  1LHY A;  2J9P A;  2WYX A;  3G34 A;  3S22 A;  5J8X A;  3V3S A;  1ESU A;  4LV0 A;  3UDF A;  3ZVW A;  2XD1 A;  3RXW A;  3ZGA B;  2J9O A;  1S0W A;  3QNB A;  4S2L A;  5CHM A;  3IF6 A;  3ZVT A;  3IWI A;  1C3B A;  2H10 A;  4OOL A;  2CC1 A;  4S2N A;  1K4E A;  5HAI A;  3VP0 A;  2H0Y A;  1GA9 A;  4OQG A;  2Y2L A;  3GV9 A;  4KZ9 A;  1BT5 A;  5EVI B;  4OQ0 A;  4U0T A;  2HP9 A;  3RXX A;  1ES4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...