4OH0A

Crystal structure of oxa-58 carbapenemase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
243
structure length
242
Chain Sequence
SIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFIANALIGLENHKATSTEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSGWGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase OXA-58
publication title Crystal Structure of Carbapenemase OXA-58 from Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 72
structure length 242
sequence length 243
ec nomenclature
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oh0A00
1K55C 3BRMA 4U0TA 3IF6C 4JF6A 3VP0A 1K25A 3PBSA 2XLNA 3AGFA 3G31A 4HBUA 4X68A 4XUZA 3SH7A 4E6XA 5BOHA 3PBRA 3BFEA 2B5RA 4OP8A 3ZVWA 3W4QA 1EI5A 4R4SA 5GHZA 5CGSA 4HEFA 2EXBA 1XP4A 3IXDA 3MBZA 4QB8A 1XKZA 1PWDA 1YT4A 4QU3A 4XXRA 1PW1A 5CGWA 5FI7A 1VM1A 3M6BA 5TFQA 1ES3A 4KQOA 5FASA 1KGEA 4K0WA 4ZJ3A 1DJCA 1AXBA 3SS4A 2RCXA 5GLCA 3IWOA 3PAEA 4O7DA 4JBFA 3IF6A 2R9XA 4EUZA 2WUQA 4GNUA 2XEPA 2Y2JA 2ZC4B 4P87A 3WS0A 3VSKA 5CEBA 4QY6A 4WBGA 4WELA 1O07A 2G2WA 3PAGA 5EOEA 3DWKA 3GV9A 4ZJ1A 3LY4A 4OQIA 2C6WB 3ZNYA 4DE2A 3SS3A 3Q1FA 1H8YA 1BLHA 2HP9A 2Y55A 3A3DA 4B4XA 1IYOA 5CTNA 3S22A 4WM9A 4X6TA 4DXCA 1BSGA 1I2SA 2J9OA 4UA9A 3VOYA 5I94A 2Z2LB 5DTTA 3HL9A 3LO7A 4P0MA 3LEZA 4MBKA 4KZ6A 4KZ8A 4DKIA 3NBLA 4NETA 2XH9A 3FKVA 2QZ6A 3IT9A 3MXRA 4JF5A 4WMCA 3TG9A 4RVAA 1CEGA 3G35A 3P09A 4E3OA 5A93A 1NZOA 2P9VB 3HLEA 4GDBA 5CECA 4OP5A 3UNWA 3VOZA 4WZ4A 1LLBA 5HAIA 5J8XA 1YLWA 1NYMA 4MBHA 4N92A 1CEFA 3BFCA 3G30A 4KZBA 4OKPA 4WZ5A 4DE3A 4GB7A 3GSGA 2ZMAA 4JKTA 3PBNA 4P85A 4S2NC 4WMCD 1L0DA 2C5WB 4KZ9A 5EVIC 2ZQAA 1BUEA 3WS2A 3V39A 3G32A 4PM7A 4CJNA 3N8RA 2BG1A 4KG2A 3VMAA 1CI8A 1BT5A 1E25A 2ZM2A 5CHJA 4EQIA 2V1ZA 1ESUA 1YM1A 2Y4AA 4X69A 1K57C 2WK0A 2XFTA 3UO9A 4DRTA 2XGNA 4KZ3A 5E2FA 3V3RA 2FFFB 1L0GA 3ZG8B 1YLTA 2XF3A 1ZKJA 5DF7A 1YMXA 3S1YA 2ZC5B 1TDGA 1S0WA 1YLPA 5CRFA 3HLGA 5EVIA 1K54A 4ZJ2A 2ZC7A 4KZAA 2WGWB 2Z2MB 3FZCA 3WRZA 5KMWA 3UPNA 5AQAA 4OOLA 1KGGA 4OOYA 2X01A 2Y59A 2G2UA 4OPYA 3RJUA 4HESA 4QHCA 3V50A 3HLCA 3ZVTA 4C6YA 4OVDA 4XUXA 4MEZA 4KG6A 4Q8IA 3LCEA 1IEMA 3G2YA 4BD0A 3ISGA 4OQ0A 4YFMA 5EVID 4B4ZA 4LCMA 4S2LA 3CJMA 2HDUA 4Y0UA 1S6RA 3LY3A 4DE1A 3GMWA 1N9BA 1FCMA 4MNRA 2Y2MA 4BQMA 4OH0A 1BLPA 2DCFA 3PBOA 3VP4A 3A3FA 2WAEA 2WZZA 4BENA 2UWXA 5CTMA 4C3QA 2XDMA 1NZUA 4WYYA 1IYSA 2CC1A 3VFHA 1EROA 1ZC2A 1KDSA 2J7VA 3W8KA 2IWCA 1DJAA 3C4OA 3NDGA 3E2LA 4S2JA 3N4IA 1L0EA 4ZBEA 3RXXA 4JXSA 3IH8A 1GHMA 4YINA 3BLSA 1G68A 4EWFA 1ES5A 1PZPA 4GZBA 3D4FA 1LHYA 1O7EA 4R4RA 4IVKA 1HTZA 2BLSA 4LV3A 4JXGA 2HDSA 1LL9A 2PBYA 3ZG5A 2FFYA 4ID4A 4E3MA 2P9VA 2PU4A 2ZM0A 4HBTA 4S2KA 3UE1A 2J8YA 2Y91A 4PM6A 2Y2PA 3CMZA 4KZ4A 3IWIA 5FQJA 2Y2LA 3HUMA 1PI5A 3N7WA 1RGZA 2JBFA 2OSUA 4E3KA 3HVFA 4IEDA 5M19A 4FH2A 1ONHA 3Q82A 4L0LA 1PZOA 1MWRA 3A3JA 1L0FA 1W79A 3BYDA 4X56A 2H0TA 4RX3A 1PWGA 1DJBA 1U60A 3MKEA 4IVIA 4QD4A 3WS4A 4QJGA 3EQVA 2WAFA 4M3KA 2ZQCA 4OPRA 3ZCZA 3IHAA 4RA7A 4PM8A 1GHIA 5GLDA 2Q9MA 1NY0A 4KQQA 1JWPA 2ZQ8A 5GLBA 1MWTA 3GR2A 1NRFA 1YLZA 2WADA 4NK3A 2EFUA 3TSGA 1RP5A 3BM6A 4BL3A 4WZ5C 4PM5A 4RX2A 1IELA 1K6RA 1N4OA 4P6BA 1ZG6A 2DRWA 3MZFA 3UDIA 2Q9NA 3W4PA 5KSHA 1IKIA 5A92A 1E4DA 3PBQA 4N9LA 1RCJA 2WGWA 3E2KA 5GHXA 4OOMA 3FKWA 3W4OA 4E3JA 5HL1A 3IXGA 2HDQA 4LV2A 3S4XA 5CERA 5DTSA 1CI9A 5FQMA 5L2FA 3BFGA 1JTDA 3HLFA 3O86A 3IH9A 3N8SA 3N6IA 5IHVA 2XFSA 1PIOA 2H5SA 1MXOA 3UN7A 1M40A 5GHYA 1XX2A 5KSCA 1ERQA 1MY8A 5FI2A 2VGKA 2VGJA 2EX6A 1K54C 5HX9A 1KE3A 5EPHA 2HP5A 1PYYA 4R3JA 2WZXA 2I72A 1FR1A 3G34A 3OPRA 4KG5A 4EBPA 2ZC3B 3UY6A 5F83A 3NIAA 4LV1A 2ZD8A 5FQIA 4E3IA 2QMIA 4Y0OA 2QPNA 4N9KA 1MBLA 4OQHA 1PI4A 4S2MA 4UHUA 3ZNTA 3OPHA 3M2KA 4KENB 2XR0A 1VQQA 2V2FF 4IBRA 2Y2HA 4FSFA 1W7FA 1JWVA 5CGXA 3FYZA 4FCFA 1Y54A 3HLBA 1BZAA 5FATA 4ZTKA 5U47A 3SH9A 3VSLA 5E2GA 4JXWA 1FCNA 2EX2A 1NJ4A 1FQGA 4LENA 4OONA 4JXVA 5EOOA 3VP2A 1XA1A 2WKIA 4LV0A 3MZEA 1FSYA 1C3BA 1LI0A 5TR7A 1GA9A 2Y2OA 4UA6A 3Q07A 1MPLA 1JVJA 3C7UA 3UPPA 2A3UA 4PPRA 5GLAA 2OLVA 3ZDJA 3ZG0A 4BD1A 5DF8A 5M18A 3ITBA 2ZQ9A 1J9MA 3PTEA 3IWQA 3HUNA 1BTLA 3C4PA 3UPOA 2GDNA 4IBXA 1TEMA 4FH4A 1TDLA 3ITAA 2P74A 4E3LA 4R1GA 1FCOA 3FV7A 1WE4A 1FR6A 2WKEA 3HBRA 5CEDA 1GA0A 1KE0A 2DNSA 1K56A 2A49A 5E2EA 3SOIA 3WS5A 5AQBA 3ZHHA 2WGIA 4Z9QA 5HARA 4S2OA 3UDXA 1MWUA 4S2IA 3IQAA 1XGJA 4MBFA 5FAQA 1XA7A 5JYOA 4GD8A 1BLCA 1OMEA 3UE0A 2EFXA 3GRJA 2X02A 1K56D 1SKFA 2PU2A 5EVLA 3SH8A 1I5QA 4EV4A 4WEKA 3O88A 4A5RA 2EX8A 3M2JA 1Z6FA 1WYBA 3UE3A 2E8IA 3OPPA 4UAAA 5JYPA 3N8LA 4OPQA 3B3XA 3OZHA 5CXWA 4KZ7A 3HLWA 4DDYA 1KVMA 1GCEA 3ZG7B 2XK1A 4R0QA 2Y2NA 1JTGA 1TVFA 2Y2GA 4EBNA 4B88A 3MFDA 1M6KA 1JWZA 4PMAA 4Y7PA 1G6AA 1K6SA 3ZG9B 1SDNA 3BFFA 3O3VA 3V3SA 4GOGA 4R23A 5DVAA 3HUOA 4E3NA 5FA7A 5GL9A 1BLSA 5HAPA 5A91A 4GN2A 3P98A 2H10A 1IYPA 2ZQDA 3Q7VA 1K55A 3NC8A 5FDHA 2XQZA 2Y2KA 2JE5A 3HLDA 3NY4A 4MLLA 4BJPA 3AGDA 5G18A 1MKIA 5CHUA 2RL3A 4H8RA 3QNCA 5AQ7A 3G2ZA 3NDEA 3DTMA 4LCLA 4D2OA 2EXAA 3G4PA 4GD6A 1XXMA 1QMFA 2X71A 1W5DA 5FQQA 4KQRA 1W8YA 1YQSA 2WKHA 4U3TA 3IXBA 4X55A 5EUAA 5FQ9A 1I2WA 3GVBA 1H5XA 4DF6A 3BECA 3Q81A 2Y2IA 1HZOA 3UDFA 1ERMA 4E6WA 4FD8A 1MWSA 3GTCA 4DDSA 5A90A 4C75A 1ES2A 5F1GA 1SDEA 2ZLYA 1BULA 1L2SA 1XGIA 2JCHA 3BEBA 3PBTA 1IKGA 3QHYA 1FOFA 3A3IA 3WWXA 3VP1A 3ZFZA 1ESIA 1PWCA 2ZC6B 3MKFA 3BFDA 1KGFA 3OC2A 4UA7A 5D3OA 5HW3A 1LL5A 1SCWA 3Q7VB 3CG5A 1ONGA 3TOIA 3IF6B 4K0XA 1K38A 3C7VA 5EECA 1KDWA 5F82A 3C5AA 4ZDXA 3OCNA 3VP3A 2HPBA 2ZJ9A 5FAOA 3HREA 4U0XA 4OLDA 1CK3A 1H8ZA 4BL2A 5HAQA 5FSRA 1YLYA 3IXHA 3JYIA 3OCLA 3A3EA 3SS5A 4RYEA 1W8QA 1E3UA 5E2HA 3RXWA 4EBLA 1ALQA 5TGFA 1PW8A 4S2NA 1NYYA 1KE4A 1RGYA 3BLMA 3IHBA 3FWLA 3Q7ZA 1ZG4A 5AQ9A 4X53A 4DXBA 1WYCA 2HP6A 3OPLA 5KZHA 2ZQ7A 4JLFA 1K4FA 2IWBA 4K91A 1QMEA 2HDRA 3ZGAB 1SHVA 2IWDA 1HVBA 1KVLA 1YLJA 1E3UD 1K57A 3NI9A 4N1XA 4OPZA 1HD8A 1EWZA 1YMSA 4GDNA 1K4EA 5FQKA 3O87A 3AGEA 3NCKA 4R3BA 1GHPA 5DF9A 4OQGA 4ZAMA 2OLUA 4BLMA 4F94A 1Q2PA 4GKUA 2Y2QA 4DE0A 4CPKA 2H0YA 2WYXA 4WEJA 1NXYA 2R9WA 4JF4A 1ES4A 1XPBA 5M1AA 3WS1A 3CZDA 2XD5A 5CHMA 5DTKA 1LI9A 2V20A 5FI6A 3GQZA 1DY6A 3M6HA 3V5MA 2WGVA 2JC7A 2ZM8A 4KZ5A 3VFFA 2XD1A 3QNBA 4PM9A 4OLGA 4QY5A 4Y0TA 3MXSA 3MZDA 4N1HA 4S2PA 3DWZA 5E43A 1IYQA 5EVIB 3WRTA 1FSWA 5FAPA 3DW0A 5F1FA 2J9PA 2EX9A 3EQUA 5EE8A 5HFOA 3I7JA 4JPMA 2OV5A 1Q2QA 3IF5A
chains in the Genus database with same CATH superfamily
3BRMA 3VP0A 3IF6C 4JF6A 3QP5A 3SH7A 3MJQA 3BFEA 3ZVWA 1VB6A 5GHZA 4EU0A 5CGSA 5M19A 1YT4A 3GECA 4QU3A 1PW1A 2W1RA 2ZMFA 2Z6DA 4KQOA 2HJ9C 4K0WA 4ZJ3A 3EOIA 5GLCA 3PAEA 2XEPA 3VSKA 5CEBA 4WELA 1O07A 4GJ4A 3GV9A 4ZJ1A 1DRMA 4OQIA 4DE2A 2M1CA 4WM9A 4UA9A 3VOYA 2J9OA 3T1XA 4HJ3A 3LO7A 2KDKA 2ZOIA 4KZ8A 4DKIA 2XH9A 3TG9A 2A24B 3E4PA 2P9VB 2XRNA 3B42A 4GDBA 5CECA 3UNWA 2GJ3A 3BWLA 5J8XA 1NYMA 3UB8A 2VK3A 1CEFA 3BFCA 4WMCD 2ZQAA 3BY9A 1BUEA 2INWA 4EQIA 1E25A 3A0SA 2V1ZA 4X1LA 1ESUA 1YM1A 2Y4AA 5L8MA 4KQDA 2WK0A 4IJGA 3UO9A 4KZ3A 5E2FA 2PD7A 3BQ8A 3NJAA 3HLGA 2PBDP 5KMWA 3UPNA 4OOYA 3KSIA 4OPYA 2M7UA 4C6YA 3CHWP 3HLCA 5F6AA 4KG6A 4Q8IA 3G2YA 2O9BA 3ISGA 5EVID 3KO6A 3LY3A 3GMWA 4CQHA 2R78A 2Y2MA 4QPRA 3VP4A 3A3FA 2WAEA 4BENA 3D9YA 2UWXA 5CTMA 5L10A 3H9WA 2HGVA 2JKFA 4S2JA 4ZBEA 3IBJA 3LGOA 4YINA 4G3VA 2FH5A 1ES5A 3D4FA 3T4OA 3CI6A 4IVKA 1HTZA 4LV3A 3LFVA 3ZG5A 4E3MA 4PM6A 3LIAA 4KZ4A 5FQJA 3HUMA 2JBFA 4EW7A 1ONHA 1MWRA 4Y3IA 1BYWA 1L0FA 3BYDA 4X56A 1TS8A 2H0TA 1U60A 4QD4A 3LIFA 4PM8A 1GHIA 5GLDA 1MC0A 1JWPA 5GLBA 4R70A 2WADA 3TSGA 3BM6A 3LIEA 2O9AA 4PM5A 1ZG6A 2DRWA 2Q9NA 3W4PA 5KSHA 1IKIA 2ZBBA 4WL9A 2WGWA 2J3WA 4OOMA 4E3JA 5HL1A 3IXGA 3S4XA 4QWOA 5CERA 3BFGA 1JTDA 3EWKA 4EQ1A 3N6IA 5DJTA 1L3LA 1M40A 1OT9A 1DP6A 1PYYA 2I72A 3G34A 5F83A 5FQIA 4Q0JA 3MFXA 4E3IA 1TS0A 2QPNA 4S2MA 4UHUA 3UB9A 3SW1A 2XR0A 1VQQA 2V2FF 4FSFA 2VV7A 1XFQA 1Y54A 1DP8A 5E2GA 4HJ6A 1FCNA 2BTFP 4LENA 1FQGA 3VP2A 4JXVA 4LV0A 3MZEA 3S7PA 1GA9A 1CJFA 5GLAA 3P01A 2OWJA 3UPOA 1AWIA 4H6JA 3O5YA 3FV7A 5HWVA 1OTBA 1GA0A 2J3TD 2A49A 5E2EA 3K2NA 2QWSA 5HARA 1UGUA 4KUOA 2VX8A 1XA7A 4I5SA 1GSWA 3VE3A 1OMEA 2X02A 1K56D 1SKFA 2PDRA 3SH8A 4A5RA 1WYBA 2E8IA 1SZVA 4OPQA 3RFBA 5CXWA 3JPUA 4R0QA 1JTGA 4EBNA 2Y2GA 3MFDA 4MN5A 1JWZA 5J3WA 1G6AA 3T4SA 1K6SA 4GOGA 4MMNA 5GL9A 3H7WA 3GDIA 2Y2KA 3HLDA 4HOIA 2I9VA 1MKIA 5CHUA 2RL3A 4GHIA 3G2ZA 2QYBA 4D2OA 2EXAA 4GD6A 1QMFA 2H28A 1N9NA 1YQSA 4U3TA 4BMWA 3IXBA 5FQ9A 1H5XA 4DN0A 3BECA 2VEAA 4GS9B 3NULA 1IKGA 1FOFA 3A3IA 4I3AA 2WKRA 1GSXA 3OC2A 3MKFA 3BFDA 5HWWA 5D3OA 4NXFA 4FTXA 1ONGA 4PKYA 4Z1WA 4ZDXA 3OCNA 3VP3A 2ZJ9A 1H8ZA 5HAQA 1YLYA 3OCLA 3CPTB 2QJ5A 1E3UA 3RXWA 5TGFA 3UB6A 4ZRRA 4X53A 3ULFA 3BY8A 3T4JA 4K91A 4I3JA 3C2WA 4OPZA 1YLJA 5DFYA 1YMSA 3AGEA 4OQGA 4WF0A 4F94A 1S1ZA 1MKMA 1OTAA 4UQIM 2R9WA 1XPBA 2GNXA 3CZDA 5L07A 3GQZA 3KX0X 3V5MA 2XROA 1P9RA 1W63Q 2D02A 2XD1A 3QNBA 4S2PA 1FSWA 4X25A 3DW0A 2J9PA 2EX9A 5EE8A 4JPMA 3NHQA 3LR0A 1K25A 4HBUA 3G31A 2JKRI 4HHDA 4XT2A 4OP8A 2V1AA 1EI5A 4HEFA 2EXBA 5CGWA 1T1BA 5FI7A 1VM1A 1Z09A 5TFQA 1ES3A 1KGEA 1OTDA 4RQ9A 3C8CA 4O7DA 4EUZA 4GNUA 2Y2JA 2K7SA 3SZTA 3HJKA 4Q0HA 1BLHA 5J4EA 2Y55A 3A3DA 3OOVA 4KUKA 1S4SA 1VEUA 5I94A 2Z2LB 2V1BA 5HDSA 4MBKA 4KZ6A 3FKVA 3IT9A 1G6OA 2Y79A 5A93A 1NZOA 1XJ2A 3CUEC 3HLEA 5A8BA 5MC7A 4I3IA 4OP5A 1D06A 3VOZA 3E98A 3P7NA 4MBHA 4OKPA 4KZBA 4DE3A 3GSGA 5HDDA 1XJ4A 4KZ9A 4CLCC 5EVIC 1H3QA 3R7WB 3V39A 4CJNA 3BQAA 4NKPA 3VMAA 1CI8A 2ZM2A 4X69A 2XFTA 4DRTA 3IBRA 3V3RA 2FFFB 3D3OA 3S1YA 4ZJ2A 3UB7A 3EEHA 3DTEA 2WGWB 4KZAA 4NXGA 3WRZA 4OOLA 2X01A 2Y59A 3T4TA 2G2UA 2W27A 4OVDA 2HJEA 4XUXA 4Y17A 3LCEA 4Y5FA 4B4ZA 4Y0UA 1S6RA 2GZAA 4OH0A 5EM1A 1VETA 3MSHA 4C3QA 1KDSA 2IWCA 3FPWA 3N4IA 3RXXA 2JKTI 3LEQA 4UQIS 2GX5A 4GZBA 1N9OA 1LL9A 2FFYA 4ID4A 3QP2A 4EESA 4S2KA 1XFNA 2Y91A 1LSWA 1PI5A 3LUQA 5LBRA 3B33A 1PZOA 4H6JB 3DAVA 3A3JA 1W79A 1H8MA 4F3LA 1PWGA 1DJBA 4IVIA 3WS4A 3T4LA 4CLCE 2ZQ8A 1MWTA 4G3KA 1LT0A 4NK3A 4WZ5C 4RX2A 1K6RA 2V8FA 3UDIA 5A92A 1E4DA 5AJGA 3MR0A 4GLQA 1Y4OA 3W4OA 5FL3A 3FC7A 1T19A 5FQMA 4IHQA 3O86A 3IH9A 3N8SA 3JVUA 1NRJA 2XFSA 1XX2A 1ERQA 5FI2A 4WLAA 2VGJA 2EX6A 1KE3A 5EPHA 4WUJA 4LV1A 4NEED 2EA9A 3ZNTA 1T1AA 2Y2HA 3EGXC 4BWIA 4FCFA 2J3TC 1BZAA 5FATA 5IT5A 3A0RA 4JXWA 4GHIB 2AVXA 2EX2A 1IOUA 5EOOA 1XA1A 4JGPA 2Y2OA 1JVJA 1P0ZA 2O99A 4BD1A 3ITBA 2GDNA 4FH4A 1F5MA 1G28A 4B93A 3HBRA 1KE0A 1T1CA 3T4QA 3TRCA 3ICYA 4Z9QA 4LPZA 1TS7A 3UDXA 1MWUA 2MJ6A 3IQAA 1X0OA 4MBFA 4O0PA 4GD8A 2EFXA 3GRJA 2PU2A 1I5QA 1F2KA 3NOUC 3O88A 2EX8A 3M2JA 1Z6FA 3UE3A 2XA7M 3K3DA 1PNEA 1K0KA 4DJ3A 3A0VA 2XK1A 2Y2NA 4B88A 1VHMA 4PMAA 4LFUA 4D60A 3HUOA 5FA7A 1BLSA 3P98A 2H10A 2ZOHA 3C38A 1IYPA 2ZQDA 4IUHA 5FDHA 2JE5A 4YOFA 4MLLA 4BJPA 3JVVA 5IU1A 5G18A 2Q0OA 2JKRM 4H8RA 3QNCA 1TD5A 3PHYA 2P7JA 3NOPC 2OAP1 3G4PA 2W3FA 5TBMA 4MN6A 3ZYTA 5EFWA 2PR6A 5G4YA 1I2WA 3GVBA 1P97A 4E6WA 1MWSA 1ES2A 3PBTA 2HZ5A 3QHYA 3WWXA 1ESIA 1D1JA 2PR5A 4UA7A 1SCWA 3Q7VB 3CG5A 3V67A 1KDWA 2DMWA 2W3EA 4WN5A 1UWNX 3IX4A 2HPBA 2VKSA 2V8CA 3IXHA 4DJ2A 2B02A 1W8QA 5TJJA 2PRFA 1ALQA 3CWFA 3MQ0A 1PW8A 1KE4A 4CLCA 5AQ9A 3LYXA 4DXBA 1S4RA 2HP6A 1K4FA 2IWBA 1QMEA 1KVLA 1E3UD 1EWZA 4GDNA 1K4EA 3NCKA 5AVFA 1GHPA 2OLUA 4GKUA 1EW0A 3IS2B 2KX6A 4DE0A 2H0YA 4BBUA 4G3WA 2WYXA 3HJIA 4JF4A 1ES4A 5M1AA 2JKGA 1LI9A 1YSQA 4YNRA 3S7NA 4OLGA 4QY5A 3NOTC 2J80A 2CMNA 1P9WA 5FAPA 4MCWA 5F1FA 5FEGA 1OTIA 3I7JA 2OV5A 2VJWA 1OJ5A 2XLNA 3AGFA 4XUZA 5BOHA 2VLGA 3F1PB 3IXDA 1XKZA 4XXRA 4Y13A 2OWHA 3M6BA 3F1NB 2XA7S 2KLIA 3UB5P 1PRQA 1AXBA 2RCXA 2JKTM 4JBFA 2LB5A 3IF6A 1VETB 2ZC4B 4P87A 1T18A 3BJNA 3ZQ5A 2PT7A 4WBGA 2G2WA 2PHYA 3PAGA 5EOEA 4EEPA 1GSVA 5FEFA 3LY4A 2C6WB 2K2NA 2LB9A 3SS3A 3S7QA 1SKOB 4UEYA 1H8YA 3H82B 2HP9A 3QP1A 4B4XA 3LR5A 3S22A 1MZUA 2JN7A 1BSGA 1I2SA 1F9IA 3HL9A 3CITA 4NETA 4JGQA 3P09A 1UWPX 4WZ4A 1LLBA 5HAIA 1YLWA 4N92A 3G30A 4WZ5A 4GB7A 2EWWA 2L4RA 4S2NC 3T4KA 4F3LB 3G32A 3G6OA 4KG2A 5CHJA 3F1OA 1ODVA 5FDSA 1K57C 1L0GA 3ZG8B 3T1SA 4R6LA 1ZKJA 2XF3A 5DF7A 2B95A 2ZC5B 1YLPA 1JNUA 2Z2MB 3FZCA 3QP4A 1ZTUA 5AQAA 4BBVA 1KGGA 4HESA 4QHCA 3V50A 2VGLM 3LR4A 4OQ0A 4LCMA 4S2LA 3E4OA 2HDUA 1XJ3A 3DBAA 3OBFA 1FCMA 2WKPA 4BQMA 2OAQ1 1BLPA 3EGDC 1Y28A 2WZZA 1IYSA 3L9KA 1ZC2A 1DJAA 3NDGA 3E2LA 3LR3A 4EUVA 2WKQA 4JXSA 1GHMA 1G68A 1PZPA 1LHYA 1O7EA 4HJ4A 3T50A 2PBYA 1OJGA 3DTKA 2VV8A 2PU4A 1NLYA 2ZM0A 2D01A 4HBTA 2J8YA 3IWIA 2W3DA 2OSUA 3HVFA 4NXEA 4FH2A 3Q82A 3T1QB 1LSVA 2IA2A 4QJGA 3EQVA 2WAFA 5AVEA 4OPRA 5DFXA 2Q9MA 4KQQA 4HIAA 2QJ7A 1NRFA 1YLZA 2EFUA 3W2ZA 1IELA 1N4OA 4P6BA 5EM0A 4HP4A 1RCJA 3E2KA 2B18A 2HDQA 4LV2A 2L0WA 5L2FA 3HLFA 5IHVA 2H5SA 5GHYA 1K54C 4KG5A 4EBPA 2ZC3B 3UY6A 2E8JA 2ZD8A 4N9KA 1MBLA 4E04A 3M2KA 4IBRA 1CF0A 1W7FA 3FYZA 4ETZA 1YAXA 3UMEA 1STZA 4K08A 1FSYA 1C3BA 5DKLA 1OTEA 5TBMB 5TR7A 4UA6A 3Q07A 3C7UA 3UPPA 4PPRA 3ZDJA 2OLVA 5M18A 2YKFA 1NLZA 2ZQ9A 4R3AA 1J9MA 3PTEA 3HUNA 3C4PA 3TW8A 3OLOA 1CQAA 1TDLA 4AFIA 2P74A 4R1GA 2PAVP 3CAXA 4ME4A 1WE4A 2VGLS 2O0YA 2V9AA 2WKEA 2EWVA 3LICA 4PHTA 3SOIA 5AQBA 2BASA 2WGIA 4S2IA 3KSHA 5FAQA 5JYOA 3UE0A 4EV4A 1DP9A 4WEKA 3IX3A 3OPPA 2OOLA 4UAAA 3N8LA 3PYPA 3B3XA 3OZHA 4KZ7A 3E0YA 1KVMA 1GCEA 4PKYG 4GS9A 1TVFA 2G7UA 4LGWA 1M6KA 4Y7PA 3ZG9B 3O3VA 3BFFA 3V3SA 5DVAA 4E3NA 2ZL1A 4GN2A 3NC8A 1LL8A 2NUPC 5AQ7A 3NDEA 4ARZA 3DTMA 2X71A 3CPTA 1W5DA 2M7VA 5FQQA 1W8YA 2WKHA 1TS6A 2Y2IA 1HZOA 5HWTA 1YPRA 4FD8A 3GTCA 1FILA 5A90A 4C75A 5F1GA 1SDEA 2ZLYA 1BULA 4E3OA 3BEBA 3VP1A 1ZHHB 1PWCA 2ZC6B 3H7WB 1KGFA 3KYEA 5HW3A 1LL5A 3TOIA 3IF6B 4K0XA 5HD5A 1W63M 3BW6A 3C7VA 5EECA 1FIKA 4Y2FA 5FAOA 3UE6A 3HREA 4U0XA 5G4ZA 3JYIA 3SS5A 4RYEA 4EBLA 4S2NA 1NYYA 3IHBA 2P08A 3KSGA 3DTIA 3ZGAB 2K31A 2IWDA 4N1XA 5HSQA 1K57A 1HD8A 5FQKA 4R3BA 4CLCD 4EXOA 4L9EA 2Y2QA 2JHEA 4CPKA 1J3WA 4WEJA 4MN7A 3KYZA 1NXYA 2XD5A 5CHMA 3UMDA 3F1OB 2V20A 1DY6A 5L09A 2JC7A 3LI9A 2ZM8A 4KZ5A 1YSPA 3VFFA 4PM9A 4HNBA 3QP6A 4N1HA 3DWZA 5E43A 1G5UA 3EQUA 1Q2QA 1K55C 4U0TA 3PBSA 4X68A 4E6XA 3PBRA 2B5RA 5I5LA 5DJUA 3W4QA 4R4SA 4HY8A 3MBZA 1XP4A 4QB8A 1PWDA 5FASA 1DJCA 3SS4A 3TJZC 3IWOA 2VZWA 1YKDA 3K3CA 3MQOA 2R9XA 2WUQA 2W1TA 3WS0A 3R7WA 4QY6A 3DWKA 3ZNYA 3Q1FA 1IYOA 4Y15A 5CTNA 4DXCA 4X6TA 3KYQA 1OPXA 5DTTA 4P0MA 3LEZA 3NBLA 4XT2B 3MXRA 2QZ6A 4WMCA 4JF5A 4ESPA 4RVAA 1CEGA 3G35A 2V0UA 2ZMVA 2FZ0A 2ZMAA 4JKTA 3PBNA 4P85A 1L0DA 2C5WB 1OT6A 2W0NA 3WS2A 4PM7A 3N8RA 2BG1A 1BT5A 3CUEA 4HQAA 2W3GA 2XGNA 2QKPA 1VEUB 1YLTA 3LI8A 5HDCA 5HZHA 1YMXA 1TDGA 1S0WA 5CRFA 5EVIA 1K54A 2ZC7A 3MXQA 4NXBA 3VV4A 3RJUA 3ZVTA 3VE4A 4MEZA 1IEMA 4BD0A 4YFMA 3CJMA 4DE1A 1N9BA 1LSXA 4LRXC 5HL6A 3IX8A 4MNRA 4DMZA 2DCFA 3PBOA 5EV0A 4R38A 5HD3A 2XDMA 1NZUA 4WYYA 2CC1A 3FG8A 3VFHA 1EROA 2J7VA 3W8KA 3C4OA 2PYPA 1L0EA 3B47A 3IH8A 4X1MA 3BLSA 3CLOA 4EWFA 4R4RA 2BLSA 4JXGA 2HDSA 3C30A 2A24A 2P9VA 3UE1A 4JGRA 2Y2PA 3CMZA 2Y2LA 1S67L 3N7WA 1RGZA 4E3KA 4IEDA 3MF0A 4L0LA 4FUWA 2L1MA 3QP8A 1WA9A 3NECA 4RX3A 3MKEA 3RH8B 1IFQA 4M3KA 2ZQCA 3ZCZA 3IHAA 4RA7A 1TF1A 1NY0A 1S1YA 4I39A 4JGOA 3GR2A 1S66L 1RP5A 4BL3A 4IUKA 2YKHA 3L7HA 3MZFA 3PBQA 4N9LA 5GHXA 4II7A 3FKWA 5DTSA 1CI9A 5F68A 4HH3A 4Q0IA 2A2LA 4LRZE 1PIOA 1MXOA 3UN7A 5KSCA 1MY8A 3KSFA 2VGKA 5HX9A 4EETB 2HP5A 4R3JA 2WZXA 4B9OA 1FR1A 3OPRA 3NIAA 2QMIA 4Y0OA 4OQHA 1PI4A 2ZL1B 1NWZA 3MQQA 3OPHA 4KENB 4O01A 5IS1A 1JWVA 5CGXA 3HLBA 5U47A 4ZTKA 3SH9A 3VSLA 1NJ4A 4OONA 4P6ZM 4ARZB 2WKIA 2W3HA 4L9GA 4PAUA 1LI0A 1MPLA 2UV0E 2A3UA 3ZG0A 5DF8A 1A0KA 3IWQA 1BTLA 2HV1A 4IBXA 1TEMA 3LIBA 3R4KA 3ITAA 4LLOB 4E3LA 4MDZA 1FCOA 4BBTA 4ETXA 4GW9A 1FR6A 5CEDA 2DNSA 1K56A 3PR6A 3PXPA 3WS5A 3ZHHA 4S2OA 1XGJA 2O9CA 1BLCA 4L9FA 5EVLA 3TE8A 2HF6A 1ACFA 4M4XA 4NG2A 3MS6A 5JYPA 1N9LA 3HLWA 5K5BA 1HLUP 4DDYA 2PD8A 3ZG7B 5HPFA 3HCYA 2Z6CA 2NUTC 1SDNA 4R23A 1F98A 5HAPA 5A91A 3Q7VA 1K55A 1XJ6A 2XQZA 3NY4A 4I38A 3AGDA 1V9YA 4LCLA 4EEUA 3U4LP 1XXMA 3LIDA 5F5YA 4X55A 5KIZA 5EUAA 4HI4A 1D7EA 4DF6A 3Q81A 3D72A 3UDFA 1ERMA 5F69A 2VV6A 4DDSA 4KQRA 4LRYC 1L2SA 1XGIA 2JCHA 5EVEA 3ZFZA 4HH2A 5CX7A 1V9ZA 3MMHA 2VA0A 1K38A 2XSSA 3EEAA 3T1RA 2W1TB 3IS2A 5F82A 3C5AA 5DKKA 4HP9A 4OLDA 4YWZA 1CK3A 4BL2A 5C5KA 5FSRA 3A3EA 5E2HA 4EERA 5HPIA 1RGYA 2P04A 3BLMA 3FWLA 3Q7ZA 4O8GA 1ZG4A 1WYCA 3OPLA 2Y8HA 5KZHA 2ZQ7A 4JLFA 4P6ZS 2HDRA 1SHVA 1HVBA 3NI9A 2ACGA 3RTYA 1H0MA 4GCZA 3F1PA 3O87A 3S7OA 5DF9A 4ZAMA 4BLMA 1Q2PA 3T12B 2V0WA 3FPVA 3F1NA 2KOIA 3WS1A 5DTKA 1KOUA 5FI6A 3M6HA 2WGVA 5J7EA 3U2AA 4FOFA 3VOLA 1PFLA 2PYRA 4Y0TA 3MXSA 3MZDA 3WRTA 2QHKA 4CLCB 1IYQA 1SKOA 5EVIB 3H82A 3E4QA 5HFOA 3IF5A
chains in the Genus database with same CATH topology
1K55C 3BRMA 4U0TA 3IF6C 4JF6A 3VP0A 1K25A 3PBSA 2XLNA 3AGFA 3G31A 4HBUA 4X68A 4XUZA 3SH7A 4E6XA 5BOHA 3PBRA 3BFEA 2B5RA 4OP8A 3ZVWA 3W4QA 1EI5A 4R4SA 5GHZA 5CGSA 4HEFA 2EXBA 1XP4A 3IXDA 3MBZA 4QB8A 1XKZA 1PWDA 1YT4A 4QU3A 4XXRA 1PW1A 5CGWA 5FI7A 1VM1A 3M6BA 5TFQA 1ES3A 4KQOA 5FASA 1KGEA 4K0WA 4ZJ3A 1DJCA 1AXBA 3SS4A 2RCXA 5GLCA 3IWOA 3PAEA 4O7DA 4JBFA 3IF6A 2R9XA 4EUZA 2WUQA 4GNUA 2XEPA 2Y2JA 2ZC4B 4P87A 3WS0A 3VSKA 5CEBA 4QY6A 4WBGA 4WELA 1O07A 2G2WA 3PAGA 5EOEA 3DWKA 3GV9A 4ZJ1A 3LY4A 4OQIA 2C6WB 3ZNYA 4DE2A 3SS3A 3Q1FA 1H8YA 1BLHA 2HP9A 2Y55A 3A3DA 4B4XA 1IYOA 5CTNA 3S22A 4WM9A 4X6TA 4DXCA 1BSGA 1I2SA 2J9OA 4UA9A 3VOYA 5I94A 2Z2LB 5DTTA 3HL9A 3LO7A 4P0MA 3LEZA 4MBKA 4KZ6A 4KZ8A 4DKIA 3NBLA 4NETA 2XH9A 3FKVA 2QZ6A 3IT9A 3MXRA 4JF5A 4WMCA 3TG9A 4RVAA 1CEGA 3G35A 3P09A 4E3OA 5A93A 1NZOA 2P9VB 3HLEA 4GDBA 5CECA 4OP5A 3UNWA 3VOZA 4WZ4A 1LLBA 5HAIA 5J8XA 1YLWA 1NYMA 4MBHA 4N92A 1CEFA 3BFCA 3G30A 4KZBA 4OKPA 4WZ5A 4DE3A 4GB7A 3GSGA 2ZMAA 4JKTA 3PBNA 4P85A 4S2NC 4WMCD 1L0DA 2C5WB 4KZ9A 5EVIC 2ZQAA 1BUEA 3WS2A 3V39A 3G32A 4PM7A 4CJNA 3N8RA 2BG1A 4KG2A 3VMAA 1CI8A 1BT5A 1E25A 2ZM2A 5CHJA 4EQIA 2V1ZA 1ESUA 1YM1A 2Y4AA 4X69A 1K57C 2WK0A 2XFTA 3UO9A 4DRTA 2XGNA 4KZ3A 5E2FA 3V3RA 2FFFB 1L0GA 3ZG8B 1YLTA 2XF3A 1ZKJA 5DF7A 1YMXA 3S1YA 2ZC5B 1TDGA 1S0WA 1YLPA 5CRFA 3HLGA 5EVIA 1K54A 4ZJ2A 2ZC7A 4KZAA 2WGWB 2Z2MB 3FZCA 3WRZA 5KMWA 3UPNA 5AQAA 4OOLA 1KGGA 4OOYA 2X01A 2Y59A 2G2UA 4OPYA 3RJUA 4HESA 4QHCA 3V50A 3HLCA 3ZVTA 4C6YA 4OVDA 4XUXA 4MEZA 4KG6A 4Q8IA 3LCEA 1IEMA 3G2YA 4BD0A 3ISGA 4OQ0A 4YFMA 5EVID 4B4ZA 4LCMA 4S2LA 3CJMA 2HDUA 4Y0UA 1S6RA 3LY3A 4DE1A 3GMWA 1N9BA 1FCMA 4MNRA 2Y2MA 4BQMA 4OH0A 1BLPA 2DCFA 3PBOA 3VP4A 3A3FA 2WAEA 2WZZA 4BENA 2UWXA 5CTMA 4C3QA 2XDMA 1NZUA 4WYYA 1IYSA 2CC1A 3VFHA 1EROA 1ZC2A 1KDSA 2J7VA 3W8KA 2IWCA 1DJAA 3C4OA 3NDGA 3E2LA 4S2JA 3N4IA 1L0EA 4ZBEA 3RXXA 4JXSA 3IH8A 1GHMA 4YINA 3BLSA 1G68A 4EWFA 1ES5A 1PZPA 4GZBA 3D4FA 1LHYA 1O7EA 4R4RA 4IVKA 1HTZA 2BLSA 4LV3A 4JXGA 2HDSA 1LL9A 2PBYA 3ZG5A 2FFYA 4ID4A 4E3MA 2P9VA 2PU4A 2ZM0A 4HBTA 4S2KA 3UE1A 2J8YA 2Y91A 4PM6A 2Y2PA 3CMZA 4KZ4A 3IWIA 5FQJA 2Y2LA 3HUMA 1PI5A 3N7WA 1RGZA 2JBFA 2OSUA 4E3KA 3HVFA 4IEDA 5M19A 4FH2A 1ONHA 3Q82A 4L0LA 1PZOA 1MWRA 3A3JA 1L0FA 1W79A 3BYDA 4X56A 2H0TA 4RX3A 1PWGA 1DJBA 1U60A 3MKEA 4IVIA 4QD4A 3WS4A 4QJGA 3EQVA 2WAFA 4M3KA 2ZQCA 4OPRA 3ZCZA 3IHAA 4RA7A 4PM8A 1GHIA 5GLDA 2Q9MA 1NY0A 4KQQA 1JWPA 2ZQ8A 5GLBA 1MWTA 3GR2A 1NRFA 1YLZA 2WADA 4NK3A 2EFUA 3TSGA 1RP5A 3BM6A 4BL3A 4WZ5C 4PM5A 4RX2A 1IELA 1K6RA 1N4OA 4P6BA 1ZG6A 2DRWA 3MZFA 3UDIA 2Q9NA 3W4PA 5KSHA 1IKIA 5A92A 1E4DA 3PBQA 4N9LA 1RCJA 2WGWA 3E2KA 5GHXA 4OOMA 3FKWA 3W4OA 4E3JA 5HL1A 3IXGA 2HDQA 4LV2A 3S4XA 5CERA 5DTSA 1CI9A 5FQMA 5L2FA 3BFGA 1JTDA 3HLFA 3O86A 3IH9A 3N8SA 3N6IA 5IHVA 2XFSA 1PIOA 2H5SA 1MXOA 3UN7A 1M40A 5GHYA 1XX2A 5KSCA 1ERQA 1MY8A 5FI2A 2VGKA 2VGJA 2EX6A 1K54C 5HX9A 1KE3A 5EPHA 2HP5A 1PYYA 4R3JA 2WZXA 2I72A 1FR1A 3G34A 3OPRA 4KG5A 4EBPA 2ZC3B 3UY6A 5F83A 3NIAA 4LV1A 2ZD8A 5FQIA 4E3IA 2QMIA 4Y0OA 2QPNA 4N9KA 1MBLA 4OQHA 1PI4A 4S2MA 4UHUA 3ZNTA 3OPHA 3M2KA 4KENB 2XR0A 1VQQA 2V2FF 4IBRA 2Y2HA 4FSFA 1W7FA 1JWVA 5CGXA 3FYZA 4FCFA 1Y54A 3HLBA 1BZAA 5FATA 4ZTKA 5U47A 3SH9A 3VSLA 5E2GA 4JXWA 1FCNA 2EX2A 1NJ4A 1FQGA 4LENA 4OONA 4JXVA 5EOOA 3VP2A 1XA1A 2WKIA 4LV0A 3MZEA 1FSYA 1C3BA 1LI0A 5TR7A 1GA9A 2Y2OA 4UA6A 3Q07A 1MPLA 1JVJA 3C7UA 3UPPA 2A3UA 4PPRA 5GLAA 2OLVA 3ZDJA 3ZG0A 4BD1A 5DF8A 5M18A 3ITBA 2ZQ9A 1J9MA 3PTEA 3IWQA 3HUNA 1BTLA 3C4PA 3UPOA 2GDNA 4IBXA 1TEMA 4FH4A 1TDLA 3ITAA 2P74A 4E3LA 4R1GA 1FCOA 3FV7A 1WE4A 1FR6A 2WKEA 3HBRA 5CEDA 1GA0A 1KE0A 2DNSA 1K56A 2A49A 5E2EA 3SOIA 3WS5A 5AQBA 3ZHHA 2WGIA 4Z9QA 5HARA 4S2OA 3UDXA 1MWUA 4S2IA 3IQAA 1XGJA 4MBFA 5FAQA 1XA7A 5JYOA 4GD8A 1BLCA 1OMEA 3UE0A 2EFXA 3GRJA 2X02A 1K56D 1SKFA 2PU2A 5EVLA 3SH8A 1I5QA 4EV4A 4WEKA 3O88A 4A5RA 2EX8A 3M2JA 1Z6FA 1WYBA 3UE3A 2E8IA 3OPPA 4UAAA 5JYPA 3N8LA 4OPQA 3B3XA 3OZHA 5CXWA 4KZ7A 3HLWA 4DDYA 1KVMA 1GCEA 3ZG7B 2XK1A 4R0QA 2Y2NA 1JTGA 1TVFA 2Y2GA 4EBNA 4B88A 3MFDA 1M6KA 1JWZA 4PMAA 4Y7PA 1G6AA 1K6SA 3ZG9B 1SDNA 3BFFA 3O3VA 3V3SA 4GOGA 4R23A 5DVAA 3HUOA 4E3NA 5FA7A 5GL9A 1BLSA 5HAPA 5A91A 4GN2A 3P98A 2H10A 1IYPA 2ZQDA 3Q7VA 1K55A 3NC8A 5FDHA 2XQZA 2Y2KA 2JE5A 3HLDA 3NY4A 4MLLA 4BJPA 3AGDA 5G18A 1MKIA 5CHUA 2RL3A 4H8RA 3QNCA 5AQ7A 3G2ZA 3NDEA 3DTMA 4LCLA 4D2OA 2EXAA 3G4PA 4GD6A 1XXMA 1QMFA 2X71A 1W5DA 5FQQA 4KQRA 1W8YA 1YQSA 2WKHA 4U3TA 3IXBA 4X55A 5EUAA 5FQ9A 1I2WA 3GVBA 1H5XA 4DF6A 3BECA 3Q81A 2Y2IA 1HZOA 3UDFA 1ERMA 4E6WA 4FD8A 1MWSA 3GTCA 4DDSA 5A90A 4C75A 1ES2A 5F1GA 1SDEA 2ZLYA 1BULA 1L2SA 1XGIA 2JCHA 3BEBA 3PBTA 1IKGA 3QHYA 1FOFA 3A3IA 3WWXA 3VP1A 3ZFZA 1ESIA 1PWCA 2ZC6B 3MKFA 3BFDA 1KGFA 3OC2A 4UA7A 5D3OA 5HW3A 1LL5A 1SCWA 3Q7VB 3CG5A 1ONGA 3TOIA 3IF6B 4K0XA 1K38A 3C7VA 5EECA 1KDWA 5F82A 3C5AA 4ZDXA 3OCNA 3VP3A 2HPBA 2ZJ9A 5FAOA 3HREA 4U0XA 4OLDA 1CK3A 1H8ZA 4BL2A 5HAQA 5FSRA 1YLYA 3IXHA 3JYIA 3OCLA 3A3EA 3SS5A 4RYEA 1W8QA 1E3UA 5E2HA 3RXWA 4EBLA 1ALQA 5TGFA 1PW8A 4S2NA 1NYYA 1KE4A 1RGYA 3BLMA 3IHBA 3FWLA 3Q7ZA 1ZG4A 5AQ9A 4X53A 4DXBA 1WYCA 2HP6A 3OPLA 5KZHA 2ZQ7A 4JLFA 1K4FA 2IWBA 4K91A 1QMEA 2HDRA 3ZGAB 1SHVA 2IWDA 1HVBA 1KVLA 1YLJA 1E3UD 1K57A 3NI9A 4N1XA 4OPZA 1HD8A 1EWZA 1YMSA 4GDNA 1K4EA 5FQKA 3O87A 3AGEA 3NCKA 4R3BA 1GHPA 5DF9A 4OQGA 4ZAMA 2OLUA 4BLMA 4F94A 1Q2PA 4GKUA 2Y2QA 4DE0A 4CPKA 2H0YA 2WYXA 4WEJA 1NXYA 2R9WA 4JF4A 1ES4A 1XPBA 5M1AA 3WS1A 3CZDA 2XD5A 5CHMA 5DTKA 1LI9A 2V20A 5FI6A 3GQZA 1DY6A 3M6HA 3V5MA 2WGVA 2JC7A 2ZM8A 4KZ5A 3VFFA 2XD1A 3QNBA 4PM9A 4OLGA 4QY5A 4Y0TA 3MXSA 3MZDA 4N1HA 4S2PA 3DWZA 5E43A 1IYQA 5EVIB 3WRTA 1FSWA 5FAPA 3DW0A 5F1FA 2J9PA 2EX9A 3EQUA 5EE8A 5HFOA 3I7JA 4JPMA 2OV5A 1Q2QA 3IF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K55 C;  3BRM A;  4U0T A;  3IF6 C;  4JF6 A;  3VP0 A;  1K25 A;  3PBS A;  2XLN A;  3AGF A;  3G31 A;  4HBU A;  4X68 A;  4XUZ A;  3SH7 A;  4E6X A;  5BOH A;  3PBR A;  3BFE A;  2B5R A;  4OP8 A;  3ZVW A;  3W4Q A;  1EI5 A;  4R4S A;  5GHZ A;  5CGS A;  4HEF A;  2EXB A;  1XP4 A;  3IXD A;  3MBZ A;  4QB8 A;  1XKZ A;  1PWD A;  1YT4 A;  4QU3 A;  4XXR A;  1PW1 A;  5CGW A;  5FI7 A;  1VM1 A;  3M6B A;  5TFQ A;  1ES3 A;  4KQO A;  5FAS A;  1KGE A;  4K0W A;  4ZJ3 A;  1DJC A;  1AXB A;  3SS4 A;  2RCX A;  5GLC A;  3IWO A;  3PAE A;  4O7D A;  4JBF A;  3IF6 A;  2R9X A;  4EUZ A;  2WUQ A;  4GNU A;  2XEP A;  2Y2J A;  2ZC4 B;  4P87 A;  3WS0 A;  3VSK A;  5CEB A;  4QY6 A;  4WBG A;  4WEL A;  1O07 A;  2G2W A;  3PAG A;  5EOE A;  3DWK A;  3GV9 A;  4ZJ1 A;  3LY4 A;  4OQI A;  2C6W B;  3ZNY A;  4DE2 A;  3SS3 A;  3Q1F A;  1H8Y A;  1BLH A;  2HP9 A;  2Y55 A;  3A3D A;  4B4X A;  1IYO A;  5CTN A;  3S22 A;  4WM9 A;  4X6T A;  4DXC A;  1BSG A;  1I2S A;  2J9O A;  4UA9 A;  3VOY A;  5I94 A;  2Z2L B;  5DTT A;  3HL9 A;  3LO7 A;  4P0M A;  3LEZ A;  4MBK A;  4KZ6 A;  4KZ8 A;  4DKI A;  3NBL A;  4NET A;  2XH9 A;  3FKV A;  2QZ6 A;  3IT9 A;  3MXR A;  4JF5 A;  4WMC A;  3TG9 A;  4RVA A;  1CEG A;  3G35 A;  3P09 A;  4E3O A;  5A93 A;  1NZO A;  2P9V B;  3HLE A;  4GDB A;  5CEC A;  4OP5 A;  3UNW A;  3VOZ A;  4WZ4 A;  1LLB A;  5HAI A;  5J8X A;  1YLW A;  1NYM A;  4MBH A;  4N92 A;  1CEF A;  3BFC A;  3G30 A;  4KZB A;  4OKP A;  4WZ5 A;  4DE3 A;  4GB7 A;  3GSG A;  2ZMA A;  4JKT A;  3PBN A;  4P85 A;  4S2N C;  4WMC D;  1L0D A;  2C5W B;  4KZ9 A;  5EVI C;  2ZQA A;  1BUE A;  3WS2 A;  3V39 A;  3G32 A;  4PM7 A;  4CJN A;  3N8R A;  2BG1 A;  4KG2 A;  3VMA A;  1CI8 A;  1BT5 A;  1E25 A;  2ZM2 A;  5CHJ A;  4EQI A;  2V1Z A;  1ESU A;  1YM1 A;  2Y4A A;  4X69 A;  1K57 C;  2WK0 A;  2XFT A;  3UO9 A;  4DRT A;  2XGN A;  4KZ3 A;  5E2F A;  3V3R A;  2FFF B;  1L0G A;  3ZG8 B;  1YLT A;  2XF3 A;  1ZKJ A;  5DF7 A;  1YMX A;  3S1Y A;  2ZC5 B;  1TDG A;  1S0W A;  1YLP A;  5CRF A;  3HLG A;  5EVI A;  1K54 A;  4ZJ2 A;  2ZC7 A;  4KZA A;  2WGW B;  2Z2M B;  3FZC A;  3WRZ A;  5KMW A;  3UPN A;  5AQA A;  4OOL A;  1KGG A;  4OOY A;  2X01 A;  2Y59 A;  2G2U A;  4OPY A;  3RJU A;  4HES A;  4QHC A;  3V50 A;  3HLC A;  3ZVT A;  4C6Y A;  4OVD A;  4XUX A;  4MEZ A;  4KG6 A;  4Q8I A;  3LCE A;  1IEM A;  3G2Y A;  4BD0 A;  3ISG A;  4OQ0 A;  4YFM A;  5EVI D;  4B4Z A;  4LCM A;  4S2L A;  3CJM A;  2HDU A;  4Y0U A;  1S6R A;  3LY3 A;  4DE1 A;  3GMW A;  1N9B A;  1FCM A;  4MNR A;  2Y2M A;  4BQM A;  4OH0 A;  1BLP A;  2DCF A;  3PBO A;  3VP4 A;  3A3F A;  2WAE A;  2WZZ A;  4BEN A;  2UWX A;  5CTM A;  4C3Q A;  2XDM A;  1NZU A;  4WYY A;  1IYS A;  2CC1 A;  3VFH A;  1ERO A;  1ZC2 A;  1KDS A;  2J7V A;  3W8K A;  2IWC A;  1DJA A;  3C4O A;  3NDG A;  3E2L A;  4S2J A;  3N4I A;  1L0E A;  4ZBE A;  3RXX A;  4JXS A;  3IH8 A;  1GHM A;  4YIN A;  3BLS A;  1G68 A;  4EWF A;  1ES5 A;  1PZP A;  4GZB A;  3D4F A;  1LHY A;  1O7E A;  4R4R A;  4IVK A;  1HTZ A;  2BLS A;  4LV3 A;  4JXG A;  2HDS A;  1LL9 A;  2PBY A;  3ZG5 A;  2FFY A;  4ID4 A;  4E3M A;  2P9V A;  2PU4 A;  2ZM0 A;  4HBT A;  4S2K A;  3UE1 A;  2J8Y A;  2Y91 A;  4PM6 A;  2Y2P A;  3CMZ A;  4KZ4 A;  3IWI A;  5FQJ A;  2Y2L A;  3HUM A;  1PI5 A;  3N7W A;  1RGZ A;  2JBF A;  2OSU A;  4E3K A;  3HVF A;  4IED A;  5M19 A;  4FH2 A;  1ONH A;  3Q82 A;  4L0L A;  1PZO A;  1MWR A;  3A3J A;  1L0F A;  1W79 A;  3BYD A;  4X56 A;  2H0T A;  4RX3 A;  1PWG A;  1DJB A;  1U60 A;  3MKE A;  4IVI A;  4QD4 A;  3WS4 A;  4QJG A;  3EQV A;  2WAF A;  4M3K A;  2ZQC A;  4OPR A;  3ZCZ A;  3IHA A;  4RA7 A;  4PM8 A;  1GHI A;  5GLD A;  2Q9M A;  1NY0 A;  4KQQ A;  1JWP A;  2ZQ8 A;  5GLB A;  1MWT A;  3GR2 A;  1NRF A;  1YLZ A;  2WAD A;  4NK3 A;  2EFU A;  3TSG A;  1RP5 A;  3BM6 A;  4BL3 A;  4WZ5 C;  4PM5 A;  4RX2 A;  1IEL A;  1K6R A;  1N4O A;  4P6B A;  1ZG6 A;  2DRW A;  3MZF A;  3UDI A;  2Q9N A;  3W4P A;  5KSH A;  1IKI A;  5A92 A;  1E4D A;  3PBQ A;  4N9L A;  1RCJ A;  2WGW A;  3E2K A;  5GHX A;  4OOM A;  3FKW A;  3W4O A;  4E3J A;  5HL1 A;  3IXG A;  2HDQ A;  4LV2 A;  3S4X A;  5CER A;  5DTS A;  1CI9 A;  5FQM A;  5L2F A;  3BFG A;  1JTD A;  3HLF A;  3O86 A;  3IH9 A;  3N8S A;  3N6I A;  5IHV A;  2XFS A;  1PIO A;  2H5S A;  1MXO A;  3UN7 A;  1M40 A;  5GHY A;  1XX2 A;  5KSC A;  1ERQ A;  1MY8 A;  5FI2 A;  2VGK A;  2VGJ A;  2EX6 A;  1K54 C;  5HX9 A;  1KE3 A;  5EPH A;  2HP5 A;  1PYY A;  4R3J A;  2WZX A;  2I72 A;  1FR1 A;  3G34 A;  3OPR A;  4KG5 A;  4EBP A;  2ZC3 B;  3UY6 A;  5F83 A;  3NIA A;  4LV1 A;  2ZD8 A;  5FQI A;  4E3I A;  2QMI A;  4Y0O A;  2QPN A;  4N9K A;  1MBL A;  4OQH A;  1PI4 A;  4S2M A;  4UHU A;  3ZNT A;  3OPH A;  3M2K A;  4KEN B;  2XR0 A;  1VQQ A;  2V2F F;  4IBR A;  2Y2H A;  4FSF A;  1W7F A;  1JWV A;  5CGX A;  3FYZ A;  4FCF A;  1Y54 A;  3HLB A;  1BZA A;  5FAT A;  4ZTK A;  5U47 A;  3SH9 A;  3VSL A;  5E2G A;  4JXW A;  1FCN A;  2EX2 A;  1NJ4 A;  1FQG A;  4LEN A;  4OON A;  4JXV A;  5EOO A;  3VP2 A;  1XA1 A;  2WKI A;  4LV0 A;  3MZE A;  1FSY A;  1C3B A;  1LI0 A;  5TR7 A;  1GA9 A;  2Y2O A;  4UA6 A;  3Q07 A;  1MPL A;  1JVJ A;  3C7U A;  3UPP A;  2A3U A;  4PPR A;  5GLA A;  2OLV A;  3ZDJ A;  3ZG0 A;  4BD1 A;  5DF8 A;  5M18 A;  3ITB A;  2ZQ9 A;  1J9M A;  3PTE A;  3IWQ A;  3HUN A;  1BTL A;  3C4P A;  3UPO A;  2GDN A;  4IBX A;  1TEM A;  4FH4 A;  1TDL A;  3ITA A;  2P74 A;  4E3L A;  4R1G A;  1FCO A;  3FV7 A;  1WE4 A;  1FR6 A;  2WKE A;  3HBR A;  5CED A;  1GA0 A;  1KE0 A;  2DNS A;  1K56 A;  2A49 A;  5E2E A;  3SOI A;  3WS5 A;  5AQB A;  3ZHH A;  2WGI A;  4Z9Q A;  5HAR A;  4S2O A;  3UDX A;  1MWU A;  4S2I A;  3IQA A;  1XGJ A;  4MBF A;  5FAQ A;  1XA7 A;  5JYO A;  4GD8 A;  1BLC A;  1OME A;  3UE0 A;  2EFX A;  3GRJ A;  2X02 A;  1K56 D;  1SKF A;  2PU2 A;  5EVL A;  3SH8 A;  1I5Q A;  4EV4 A;  4WEK A;  3O88 A;  4A5R A;  2EX8 A;  3M2J A;  1Z6F A;  1WYB A;  3UE3 A;  2E8I A;  3OPP A;  4UAA A;  5JYP A;  3N8L A;  4OPQ A;  3B3X A;  3OZH A;  5CXW A;  4KZ7 A;  3HLW A;  4DDY A;  1KVM A;  1GCE A;  3ZG7 B;  2XK1 A;  4R0Q A;  2Y2N A;  1JTG A;  1TVF A;  2Y2G A;  4EBN A;  4B88 A;  3MFD A;  1M6K A;  1JWZ A;  4PMA A;  4Y7P A;  1G6A A;  1K6S A;  3ZG9 B;  1SDN A;  3BFF A;  3O3V A;  3V3S A;  4GOG A;  4R23 A;  5DVA A;  3HUO A;  4E3N A;  5FA7 A;  5GL9 A;  1BLS A;  5HAP A;  5A91 A;  4GN2 A;  3P98 A;  2H10 A;  1IYP A;  2ZQD A;  3Q7V A;  1K55 A;  3NC8 A;  5FDH A;  2XQZ A;  2Y2K A;  2JE5 A;  3HLD A;  3NY4 A;  4MLL A;  4BJP A;  3AGD A;  5G18 A;  1MKI A;  5CHU A;  2RL3 A;  4H8R A;  3QNC A;  5AQ7 A;  3G2Z A;  3NDE A;  3DTM A;  4LCL A;  4D2O A;  2EXA A;  3G4P A;  4GD6 A;  1XXM A;  1QMF A;  2X71 A;  1W5D A;  5FQQ A;  4KQR A;  1W8Y A;  1YQS A;  2WKH A;  4U3T A;  3IXB A;  4X55 A;  5EUA A;  5FQ9 A;  1I2W A;  3GVB A;  1H5X A;  4DF6 A;  3BEC A;  3Q81 A;  2Y2I A;  1HZO A;  3UDF A;  1ERM A;  4E6W A;  4FD8 A;  1MWS A;  3GTC A;  4DDS A;  5A90 A;  4C75 A;  1ES2 A;  5F1G A;  1SDE A;  2ZLY A;  1BUL A;  1L2S A;  1XGI A;  2JCH A;  3BEB A;  3PBT A;  1IKG A;  3QHY A;  1FOF A;  3A3I A;  3WWX A;  3VP1 A;  3ZFZ A;  1ESI A;  1PWC A;  2ZC6 B;  3MKF A;  3BFD A;  1KGF A;  3OC2 A;  4UA7 A;  5D3O A;  5HW3 A;  1LL5 A;  1SCW A;  3Q7V B;  3CG5 A;  1ONG A;  3TOI A;  3IF6 B;  4K0X A;  1K38 A;  3C7V A;  5EEC A;  1KDW A;  5F82 A;  3C5A A;  4ZDX A;  3OCN A;  3VP3 A;  2HPB A;  2ZJ9 A;  5FAO A;  3HRE A;  4U0X A;  4OLD A;  1CK3 A;  1H8Z A;  4BL2 A;  5HAQ A;  5FSR A;  1YLY A;  3IXH A;  3JYI A;  3OCL A;  3A3E A;  3SS5 A;  4RYE A;  1W8Q A;  1E3U A;  5E2H A;  3RXW A;  4EBL A;  1ALQ A;  5TGF A;  1PW8 A;  4S2N A;  1NYY A;  1KE4 A;  1RGY A;  3BLM A;  3IHB A;  3FWL A;  3Q7Z A;  1ZG4 A;  5AQ9 A;  4X53 A;  4DXB A;  1WYC A;  2HP6 A;  3OPL A;  5KZH A;  2ZQ7 A;  4JLF A;  1K4F A;  2IWB A;  4K91 A;  1QME A;  2HDR A;  3ZGA B;  1SHV A;  2IWD A;  1HVB A;  1KVL A;  1YLJ A;  1E3U D;  1K57 A;  3NI9 A;  4N1X A;  4OPZ A;  1HD8 A;  1EWZ A;  1YMS A;  4GDN A;  1K4E A;  5FQK A;  3O87 A;  3AGE A;  3NCK A;  4R3B A;  1GHP A;  5DF9 A;  4OQG A;  4ZAM A;  2OLU A;  4BLM A;  4F94 A;  1Q2P A;  4GKU A;  2Y2Q A;  4DE0 A;  4CPK A;  2H0Y A;  2WYX A;  4WEJ A;  1NXY A;  2R9W A;  4JF4 A;  1ES4 A;  1XPB A;  5M1A A;  3WS1 A;  3CZD A;  2XD5 A;  5CHM A;  5DTK A;  1LI9 A;  2V20 A;  5FI6 A;  3GQZ A;  1DY6 A;  3M6H A;  3V5M A;  2WGV A;  2JC7 A;  2ZM8 A;  4KZ5 A;  3VFF A;  2XD1 A;  3QNB A;  4PM9 A;  4OLG A;  4QY5 A;  4Y0T A;  3MXS A;  3MZD A;  4N1H A;  4S2P A;  3DWZ A;  5E43 A;  1IYQ A;  5EVI B;  3WRT A;  1FSW A;  5FAP A;  3DW0 A;  5F1F A;  2J9P A;  2EX9 A;  3EQU A;  5EE8 A;  5HFO A;  3I7J A;  4JPM A;  2OV5 A;  1Q2Q A;  3IF5 A; 
#chains in the Genus database with same CATH topology
 3BRM A;  3VP0 A;  3IF6 C;  4JF6 A;  3QP5 A;  3SH7 A;  3MJQ A;  3BFE A;  3ZVW A;  1VB6 A;  5GHZ A;  4EU0 A;  5CGS A;  5M19 A;  1YT4 A;  3GEC A;  4QU3 A;  1PW1 A;  2W1R A;  2ZMF A;  2Z6D A;  4KQO A;  2HJ9 C;  4K0W A;  4ZJ3 A;  3EOI A;  5GLC A;  3PAE A;  2XEP A;  3VSK A;  5CEB A;  4WEL A;  1O07 A;  4GJ4 A;  3GV9 A;  4ZJ1 A;  1DRM A;  4OQI A;  4DE2 A;  2M1C A;  4WM9 A;  4UA9 A;  3VOY A;  2J9O A;  3T1X A;  4HJ3 A;  3LO7 A;  2KDK A;  2ZOI A;  4KZ8 A;  4DKI A;  2XH9 A;  3TG9 A;  2A24 B;  3E4P A;  2P9V B;  2XRN A;  3B42 A;  4GDB A;  5CEC A;  3UNW A;  2GJ3 A;  3BWL A;  5J8X A;  1NYM A;  3UB8 A;  2VK3 A;  1CEF A;  3BFC A;  4WMC D;  2ZQA A;  3BY9 A;  1BUE A;  2INW A;  4EQI A;  1E25 A;  3A0S A;  2V1Z A;  4X1L A;  1ESU A;  1YM1 A;  2Y4A A;  5L8M A;  4KQD A;  2WK0 A;  4IJG A;  3UO9 A;  4KZ3 A;  5E2F A;  2PD7 A;  3BQ8 A;  3NJA A;  3HLG A;  2PBD P;  5KMW A;  3UPN A;  4OOY A;  3KSI A;  4OPY A;  2M7U A;  4C6Y A;  3CHW P;  3HLC A;  5F6A A;  4KG6 A;  4Q8I A;  3G2Y A;  2O9B A;  3ISG A;  5EVI D;  3KO6 A;  3LY3 A;  3GMW A;  4CQH A;  2R78 A;  2Y2M A;  4QPR A;  3VP4 A;  3A3F A;  2WAE A;  4BEN A;  3D9Y A;  2UWX A;  5CTM A;  5L10 A;  3H9W A;  2HGV A;  2JKF A;  4S2J A;  4ZBE A;  3IBJ A;  3LGO A;  4YIN A;  4G3V A;  2FH5 A;  1ES5 A;  3D4F A;  3T4O A;  3CI6 A;  4IVK A;  1HTZ A;  4LV3 A;  3LFV A;  3ZG5 A;  4E3M A;  4PM6 A;  3LIA A;  4KZ4 A;  5FQJ A;  3HUM A;  2JBF A;  4EW7 A;  1ONH A;  1MWR A;  4Y3I A;  1BYW A;  1L0F A;  3BYD A;  4X56 A;  1TS8 A;  2H0T A;  1U60 A;  4QD4 A;  3LIF A;  4PM8 A;  1GHI A;  5GLD A;  1MC0 A;  1JWP A;  5GLB A;  4R70 A;  2WAD A;  3TSG A;  3BM6 A;  3LIE A;  2O9A A;  4PM5 A;  1ZG6 A;  2DRW A;  2Q9N A;  3W4P A;  5KSH A;  1IKI A;  2ZBB A;  4WL9 A;  2WGW A;  2J3W A;  4OOM A;  4E3J A;  5HL1 A;  3IXG A;  3S4X A;  4QWO A;  5CER A;  3BFG A;  1JTD A;  3EWK A;  4EQ1 A;  3N6I A;  5DJT A;  1L3L A;  1M40 A;  1OT9 A;  1DP6 A;  1PYY A;  2I72 A;  3G34 A;  5F83 A;  5FQI A;  4Q0J A;  3MFX A;  4E3I A;  1TS0 A;  2QPN A;  4S2M A;  4UHU A;  3UB9 A;  3SW1 A;  2XR0 A;  1VQQ A;  2V2F F;  4FSF A;  2VV7 A;  1XFQ A;  1Y54 A;  1DP8 A;  5E2G A;  4HJ6 A;  1FCN A;  2BTF P;  4LEN A;  1FQG A;  3VP2 A;  4JXV A;  4LV0 A;  3MZE A;  3S7P A;  1GA9 A;  1CJF A;  5GLA A;  3P01 A;  2OWJ A;  3UPO A;  1AWI A;  4H6J A;  3O5Y A;  3FV7 A;  5HWV A;  1OTB A;  1GA0 A;  2J3T D;  2A49 A;  5E2E A;  3K2N A;  2QWS A;  5HAR A;  1UGU A;  4KUO A;  2VX8 A;  1XA7 A;  4I5S A;  1GSW A;  3VE3 A;  1OME A;  2X02 A;  1K56 D;  1SKF A;  2PDR A;  3SH8 A;  4A5R A;  1WYB A;  2E8I A;  1SZV A;  4OPQ A;  3RFB A;  5CXW A;  3JPU A;  4R0Q A;  1JTG A;  4EBN A;  2Y2G A;  3MFD A;  4MN5 A;  1JWZ A;  5J3W A;  1G6A A;  3T4S A;  1K6S A;  4GOG A;  4MMN A;  5GL9 A;  3H7W A;  3GDI A;  2Y2K A;  3HLD A;  4HOI A;  2I9V A;  1MKI A;  5CHU A;  2RL3 A;  4GHI A;  3G2Z A;  2QYB A;  4D2O A;  2EXA A;  4GD6 A;  1QMF A;  2H28 A;  1N9N A;  1YQS A;  4U3T A;  4BMW A;  3IXB A;  5FQ9 A;  1H5X A;  4DN0 A;  3BEC A;  2VEA A;  4GS9 B;  3NUL A;  1IKG A;  1FOF A;  3A3I A;  4I3A A;  2WKR A;  1GSX A;  3OC2 A;  3MKF A;  3BFD A;  5HWW A;  5D3O A;  4NXF A;  4FTX A;  1ONG A;  4PKY A;  4Z1W A;  4ZDX A;  3OCN A;  3VP3 A;  2ZJ9 A;  1H8Z A;  5HAQ A;  1YLY A;  3OCL A;  3CPT B;  2QJ5 A;  1E3U A;  3RXW A;  5TGF A;  3UB6 A;  4ZRR A;  4X53 A;  3ULF A;  3BY8 A;  3T4J A;  4K91 A;  4I3J A;  3C2W A;  4OPZ A;  1YLJ A;  5DFY A;  1YMS A;  3AGE A;  4OQG A;  4WF0 A;  4F94 A;  1S1Z A;  1MKM A;  1OTA A;  4UQI M;  2R9W A;  1XPB A;  2GNX A;  3CZD A;  5L07 A;  3GQZ A;  3KX0 X;  3V5M A;  2XRO A;  1P9R A;  1W63 Q;  2D02 A;  2XD1 A;  3QNB A;  4S2P A;  1FSW A;  4X25 A;  3DW0 A;  2J9P A;  2EX9 A;  5EE8 A;  4JPM A;  3NHQ A;  3LR0 A;  1K25 A;  4HBU A;  3G31 A;  2JKR I;  4HHD A;  4XT2 A;  4OP8 A;  2V1A A;  1EI5 A;  4HEF A;  2EXB A;  5CGW A;  1T1B A;  5FI7 A;  1VM1 A;  1Z09 A;  5TFQ A;  1ES3 A;  1KGE A;  1OTD A;  4RQ9 A;  3C8C A;  4O7D A;  4EUZ A;  4GNU A;  2Y2J A;  2K7S A;  3SZT A;  3HJK A;  4Q0H A;  1BLH A;  5J4E A;  2Y55 A;  3A3D A;  3OOV A;  4KUK A;  1S4S A;  1VEU A;  5I94 A;  2Z2L B;  2V1B A;  5HDS A;  4MBK A;  4KZ6 A;  3FKV A;  3IT9 A;  1G6O A;  2Y79 A;  5A93 A;  1NZO A;  1XJ2 A;  3CUE C;  3HLE A;  5A8B A;  5MC7 A;  4I3I A;  4OP5 A;  1D06 A;  3VOZ A;  3E98 A;  3P7N A;  4MBH A;  4OKP A;  4KZB A;  4DE3 A;  3GSG A;  5HDD A;  1XJ4 A;  4KZ9 A;  4CLC C;  5EVI C;  1H3Q A;  3R7W B;  3V39 A;  4CJN A;  3BQA A;  4NKP A;  3VMA A;  1CI8 A;  2ZM2 A;  4X69 A;  2XFT A;  4DRT A;  3IBR A;  3V3R A;  2FFF B;  3D3O A;  3S1Y A;  4ZJ2 A;  3UB7 A;  3EEH A;  3DTE A;  2WGW B;  4KZA A;  4NXG A;  3WRZ A;  4OOL A;  2X01 A;  2Y59 A;  3T4T A;  2G2U A;  2W27 A;  4OVD A;  2HJE A;  4XUX A;  4Y17 A;  3LCE A;  4Y5F A;  4B4Z A;  4Y0U A;  1S6R A;  2GZA A;  4OH0 A;  5EM1 A;  1VET A;  3MSH A;  4C3Q A;  1KDS A;  2IWC A;  3FPW A;  3N4I A;  3RXX A;  2JKT I;  3LEQ A;  4UQI S;  2GX5 A;  4GZB A;  1N9O A;  1LL9 A;  2FFY A;  4ID4 A;  3QP2 A;  4EES A;  4S2K A;  1XFN A;  2Y91 A;  1LSW A;  1PI5 A;  3LUQ A;  5LBR A;  3B33 A;  1PZO A;  4H6J B;  3DAV A;  3A3J A;  1W79 A;  1H8M A;  4F3L A;  1PWG A;  1DJB A;  4IVI A;  3WS4 A;  3T4L A;  4CLC E;  2ZQ8 A;  1MWT A;  4G3K A;  1LT0 A;  4NK3 A;  4WZ5 C;  4RX2 A;  1K6R A;  2V8F A;  3UDI A;  5A92 A;  1E4D A;  5AJG A;  3MR0 A;  4GLQ A;  1Y4O A;  3W4O A;  5FL3 A;  3FC7 A;  1T19 A;  5FQM A;  4IHQ A;  3O86 A;  3IH9 A;  3N8S A;  3JVU A;  1NRJ A;  2XFS A;  1XX2 A;  1ERQ A;  5FI2 A;  4WLA A;  2VGJ A;  2EX6 A;  1KE3 A;  5EPH A;  4WUJ A;  4LV1 A;  4NEE D;  2EA9 A;  3ZNT A;  1T1A A;  2Y2H A;  3EGX C;  4BWI A;  4FCF A;  2J3T C;  1BZA A;  5FAT A;  5IT5 A;  3A0R A;  4JXW A;  4GHI B;  2AVX A;  2EX2 A;  1IOU A;  5EOO A;  1XA1 A;  4JGP A;  2Y2O A;  1JVJ A;  1P0Z A;  2O99 A;  4BD1 A;  3ITB A;  2GDN A;  4FH4 A;  1F5M A;  1G28 A;  4B93 A;  3HBR A;  1KE0 A;  1T1C A;  3T4Q A;  3TRC A;  3ICY A;  4Z9Q A;  4LPZ A;  1TS7 A;  3UDX A;  1MWU A;  2MJ6 A;  3IQA A;  1X0O A;  4MBF A;  4O0P A;  4GD8 A;  2EFX A;  3GRJ A;  2PU2 A;  1I5Q A;  1F2K A;  3NOU C;  3O88 A;  2EX8 A;  3M2J A;  1Z6F A;  3UE3 A;  2XA7 M;  3K3D A;  1PNE A;  1K0K A;  4DJ3 A;  3A0V A;  2XK1 A;  2Y2N A;  4B88 A;  1VHM A;  4PMA A;  4LFU A;  4D60 A;  3HUO A;  5FA7 A;  1BLS A;  3P98 A;  2H10 A;  2ZOH A;  3C38 A;  1IYP A;  2ZQD A;  4IUH A;  5FDH A;  2JE5 A;  4YOF A;  4MLL A;  4BJP A;  3JVV A;  5IU1 A;  5G18 A;  2Q0O A;  2JKR M;  4H8R A;  3QNC A;  1TD5 A;  3PHY A;  2P7J A;  3NOP C;  2OAP 1;  3G4P A;  2W3F A;  5TBM A;  4MN6 A;  3ZYT A;  5EFW A;  2PR6 A;  5G4Y A;  1I2W A;  3GVB A;  1P97 A;  4E6W A;  1MWS A;  1ES2 A;  3PBT A;  2HZ5 A;  3QHY A;  3WWX A;  1ESI A;  1D1J A;  2PR5 A;  4UA7 A;  1SCW A;  3Q7V B;  3CG5 A;  3V67 A;  1KDW A;  2DMW A;  2W3E A;  4WN5 A;  1UWN X;  3IX4 A;  2HPB A;  2VKS A;  2V8C A;  3IXH A;  4DJ2 A;  2B02 A;  1W8Q A;  5TJJ A;  2PRF A;  1ALQ A;  3CWF A;  3MQ0 A;  1PW8 A;  1KE4 A;  4CLC A;  5AQ9 A;  3LYX A;  4DXB A;  1S4R A;  2HP6 A;  1K4F A;  2IWB A;  1QME A;  1KVL A;  1E3U D;  1EWZ A;  4GDN A;  1K4E A;  3NCK A;  5AVF A;  1GHP A;  2OLU A;  4GKU A;  1EW0 A;  3IS2 B;  2KX6 A;  4DE0 A;  2H0Y A;  4BBU A;  4G3W A;  2WYX A;  3HJI A;  4JF4 A;  1ES4 A;  5M1A A;  2JKG A;  1LI9 A;  1YSQ A;  4YNR A;  3S7N A;  4OLG A;  4QY5 A;  3NOT C;  2J80 A;  2CMN A;  1P9W A;  5FAP A;  4MCW A;  5F1F A;  5FEG A;  1OTI A;  3I7J A;  2OV5 A;  2VJW A;  1OJ5 A;  2XLN A;  3AGF A;  4XUZ A;  5BOH A;  2VLG A;  3F1P B;  3IXD A;  1XKZ A;  4XXR A;  4Y13 A;  2OWH A;  3M6B A;  3F1N B;  2XA7 S;  2KLI A;  3UB5 P;  1PRQ A;  1AXB A;  2RCX A;  2JKT M;  4JBF A;  2LB5 A;  3IF6 A;  1VET B;  2ZC4 B;  4P87 A;  1T18 A;  3BJN A;  3ZQ5 A;  2PT7 A;  4WBG A;  2G2W A;  2PHY A;  3PAG A;  5EOE A;  4EEP A;  1GSV A;  5FEF A;  3LY4 A;  2C6W B;  2K2N A;  2LB9 A;  3SS3 A;  3S7Q A;  1SKO B;  4UEY A;  1H8Y A;  3H82 B;  2HP9 A;  3QP1 A;  4B4X A;  3LR5 A;  3S22 A;  1MZU A;  2JN7 A;  1BSG A;  1I2S A;  1F9I A;  3HL9 A;  3CIT A;  4NET A;  4JGQ A;  3P09 A;  1UWP X;  4WZ4 A;  1LLB A;  5HAI A;  1YLW A;  4N92 A;  3G30 A;  4WZ5 A;  4GB7 A;  2EWW A;  2L4R A;  4S2N C;  3T4K A;  4F3L B;  3G32 A;  3G6O A;  4KG2 A;  5CHJ A;  3F1O A;  1ODV A;  5FDS A;  1K57 C;  1L0G A;  3ZG8 B;  3T1S A;  4R6L A;  1ZKJ A;  2XF3 A;  5DF7 A;  2B95 A;  2ZC5 B;  1YLP A;  1JNU A;  2Z2M B;  3FZC A;  3QP4 A;  1ZTU A;  5AQA A;  4BBV A;  1KGG A;  4HES A;  4QHC A;  3V50 A;  2VGL M;  3LR4 A;  4OQ0 A;  4LCM A;  4S2L A;  3E4O A;  2HDU A;  1XJ3 A;  3DBA A;  3OBF A;  1FCM A;  2WKP A;  4BQM A;  2OAQ 1;  1BLP A;  3EGD C;  1Y28 A;  2WZZ A;  1IYS A;  3L9K A;  1ZC2 A;  1DJA A;  3NDG A;  3E2L A;  3LR3 A;  4EUV A;  2WKQ A;  4JXS A;  1GHM A;  1G68 A;  1PZP A;  1LHY A;  1O7E A;  4HJ4 A;  3T50 A;  2PBY A;  1OJG A;  3DTK A;  2VV8 A;  2PU4 A;  1NLY A;  2ZM0 A;  2D01 A;  4HBT A;  2J8Y A;  3IWI A;  2W3D A;  2OSU A;  3HVF A;  4NXE A;  4FH2 A;  3Q82 A;  3T1Q B;  1LSV A;  2IA2 A;  4QJG A;  3EQV A;  2WAF A;  5AVE A;  4OPR A;  5DFX A;  2Q9M A;  4KQQ A;  4HIA A;  2QJ7 A;  1NRF A;  1YLZ A;  2EFU A;  3W2Z A;  1IEL A;  1N4O A;  4P6B A;  5EM0 A;  4HP4 A;  1RCJ A;  3E2K A;  2B18 A;  2HDQ A;  4LV2 A;  2L0W A;  5L2F A;  3HLF A;  5IHV A;  2H5S A;  5GHY A;  1K54 C;  4KG5 A;  4EBP A;  2ZC3 B;  3UY6 A;  2E8J A;  2ZD8 A;  4N9K A;  1MBL A;  4E04 A;  3M2K A;  4IBR A;  1CF0 A;  1W7F A;  3FYZ A;  4ETZ A;  1YAX A;  3UME A;  1STZ A;  4K08 A;  1FSY A;  1C3B A;  5DKL A;  1OTE A;  5TBM B;  5TR7 A;  4UA6 A;  3Q07 A;  3C7U A;  3UPP A;  4PPR A;  3ZDJ A;  2OLV A;  5M18 A;  2YKF A;  1NLZ A;  2ZQ9 A;  4R3A A;  1J9M A;  3PTE A;  3HUN A;  3C4P A;  3TW8 A;  3OLO A;  1CQA A;  1TDL A;  4AFI A;  2P74 A;  4R1G A;  2PAV P;  3CAX A;  4ME4 A;  1WE4 A;  2VGL S;  2O0Y A;  2V9A A;  2WKE A;  2EWV A;  3LIC A;  4PHT A;  3SOI A;  5AQB A;  2BAS A;  2WGI A;  4S2I A;  3KSH A;  5FAQ A;  5JYO A;  3UE0 A;  4EV4 A;  1DP9 A;  4WEK A;  3IX3 A;  3OPP A;  2OOL A;  4UAA A;  3N8L A;  3PYP A;  3B3X A;  3OZH A;  4KZ7 A;  3E0Y A;  1KVM A;  1GCE A;  4PKY G;  4GS9 A;  1TVF A;  2G7U A;  4LGW A;  1M6K A;  4Y7P A;  3ZG9 B;  3O3V A;  3BFF A;  3V3S A;  5DVA A;  4E3N A;  2ZL1 A;  4GN2 A;  3NC8 A;  1LL8 A;  2NUP C;  5AQ7 A;  3NDE A;  4ARZ A;  3DTM A;  2X71 A;  3CPT A;  1W5D A;  2M7V A;  5FQQ A;  1W8Y A;  2WKH A;  1TS6 A;  2Y2I A;  1HZO A;  5HWT A;  1YPR A;  4FD8 A;  3GTC A;  1FIL A;  5A90 A;  4C75 A;  5F1G A;  1SDE A;  2ZLY A;  1BUL A;  4E3O A;  3BEB A;  3VP1 A;  1ZHH B;  1PWC A;  2ZC6 B;  3H7W B;  1KGF A;  3KYE A;  5HW3 A;  1LL5 A;  3TOI A;  3IF6 B;  4K0X A;  5HD5 A;  1W63 M;  3BW6 A;  3C7V A;  5EEC A;  1FIK A;  4Y2F A;  5FAO A;  3UE6 A;  3HRE A;  4U0X A;  5G4Z A;  3JYI A;  3SS5 A;  4RYE A;  4EBL A;  4S2N A;  1NYY A;  3IHB A;  2P08 A;  3KSG A;  3DTI A;  3ZGA B;  2K31 A;  2IWD A;  4N1X A;  5HSQ A;  1K57 A;  1HD8 A;  5FQK A;  4R3B A;  4CLC D;  4EXO A;  4L9E A;  2Y2Q A;  2JHE A;  4CPK A;  1J3W A;  4WEJ A;  4MN7 A;  3KYZ A;  1NXY A;  2XD5 A;  5CHM A;  3UMD A;  3F1O B;  2V20 A;  1DY6 A;  5L09 A;  2JC7 A;  3LI9 A;  2ZM8 A;  4KZ5 A;  1YSP A;  3VFF A;  4PM9 A;  4HNB A;  3QP6 A;  4N1H A;  3DWZ A;  5E43 A;  1G5U A;  3EQU A;  1Q2Q A;  1K55 C;  4U0T A;  3PBS A;  4X68 A;  4E6X A;  3PBR A;  2B5R A;  5I5L A;  5DJU A;  3W4Q A;  4R4S A;  4HY8 A;  3MBZ A;  1XP4 A;  4QB8 A;  1PWD A;  5FAS A;  1DJC A;  3SS4 A;  3TJZ C;  3IWO A;  2VZW A;  1YKD A;  3K3C A;  3MQO A;  2R9X A;  2WUQ A;  2W1T A;  3WS0 A;  3R7W A;  4QY6 A;  3DWK A;  3ZNY A;  3Q1F A;  1IYO A;  4Y15 A;  5CTN A;  4DXC A;  4X6T A;  3KYQ A;  1OPX A;  5DTT A;  4P0M A;  3LEZ A;  3NBL A;  4XT2 B;  3MXR A;  2QZ6 A;  4WMC A;  4JF5 A;  4ESP A;  4RVA A;  1CEG A;  3G35 A;  2V0U A;  2ZMV A;  2FZ0 A;  2ZMA A;  4JKT A;  3PBN A;  4P85 A;  1L0D A;  2C5W B;  1OT6 A;  2W0N A;  3WS2 A;  4PM7 A;  3N8R A;  2BG1 A;  1BT5 A;  3CUE A;  4HQA A;  2W3G A;  2XGN A;  2QKP A;  1VEU B;  1YLT A;  3LI8 A;  5HDC A;  5HZH A;  1YMX A;  1TDG A;  1S0W A;  5CRF A;  5EVI A;  1K54 A;  2ZC7 A;  3MXQ A;  4NXB A;  3VV4 A;  3RJU A;  3ZVT A;  3VE4 A;  4MEZ A;  1IEM A;  4BD0 A;  4YFM A;  3CJM A;  4DE1 A;  1N9B A;  1LSX A;  4LRX C;  5HL6 A;  3IX8 A;  4MNR A;  4DMZ A;  2DCF A;  3PBO A;  5EV0 A;  4R38 A;  5HD3 A;  2XDM A;  1NZU A;  4WYY A;  2CC1 A;  3FG8 A;  3VFH A;  1ERO A;  2J7V A;  3W8K A;  3C4O A;  2PYP A;  1L0E A;  3B47 A;  3IH8 A;  4X1M A;  3BLS A;  3CLO A;  4EWF A;  4R4R A;  2BLS A;  4JXG A;  2HDS A;  3C30 A;  2A24 A;  2P9V A;  3UE1 A;  4JGR A;  2Y2P A;  3CMZ A;  2Y2L A;  1S67 L;  3N7W A;  1RGZ A;  4E3K A;  4IED A;  3MF0 A;  4L0L A;  4FUW A;  2L1M A;  3QP8 A;  1WA9 A;  3NEC A;  4RX3 A;  3MKE A;  3RH8 B;  1IFQ A;  4M3K A;  2ZQC A;  3ZCZ A;  3IHA A;  4RA7 A;  1TF1 A;  1NY0 A;  1S1Y A;  4I39 A;  4JGO A;  3GR2 A;  1S66 L;  1RP5 A;  4BL3 A;  4IUK A;  2YKH A;  3L7H A;  3MZF A;  3PBQ A;  4N9L A;  5GHX A;  4II7 A;  3FKW A;  5DTS A;  1CI9 A;  5F68 A;  4HH3 A;  4Q0I A;  2A2L A;  4LRZ E;  1PIO A;  1MXO A;  3UN7 A;  5KSC A;  1MY8 A;  3KSF A;  2VGK A;  5HX9 A;  4EET B;  2HP5 A;  4R3J A;  2WZX A;  4B9O A;  1FR1 A;  3OPR A;  3NIA A;  2QMI A;  4Y0O A;  4OQH A;  1PI4 A;  2ZL1 B;  1NWZ A;  3MQQ A;  3OPH A;  4KEN B;  4O01 A;  5IS1 A;  1JWV A;  5CGX A;  3HLB A;  5U47 A;  4ZTK A;  3SH9 A;  3VSL A;  1NJ4 A;  4OON A;  4P6Z M;  4ARZ B;  2WKI A;  2W3H A;  4L9G A;  4PAU A;  1LI0 A;  1MPL A;  2UV0 E;  2A3U A;  3ZG0 A;  5DF8 A;  1A0K A;  3IWQ A;  1BTL A;  2HV1 A;  4IBX A;  1TEM A;  3LIB A;  3R4K A;  3ITA A;  4LLO B;  4E3L A;  4MDZ A;  1FCO A;  4BBT A;  4ETX A;  4GW9 A;  1FR6 A;  5CED A;  2DNS A;  1K56 A;  3PR6 A;  3PXP A;  3WS5 A;  3ZHH A;  4S2O A;  1XGJ A;  2O9C A;  1BLC A;  4L9F A;  5EVL A;  3TE8 A;  2HF6 A;  1ACF A;  4M4X A;  4NG2 A;  3MS6 A;  5JYP A;  1N9L A;  3HLW A;  5K5B A;  1HLU P;  4DDY A;  2PD8 A;  3ZG7 B;  5HPF A;  3HCY A;  2Z6C A;  2NUT C;  1SDN A;  4R23 A;  1F98 A;  5HAP A;  5A91 A;  3Q7V A;  1K55 A;  1XJ6 A;  2XQZ A;  3NY4 A;  4I38 A;  3AGD A;  1V9Y A;  4LCL A;  4EEU A;  3U4L P;  1XXM A;  3LID A;  5F5Y A;  4X55 A;  5KIZ A;  5EUA A;  4HI4 A;  1D7E A;  4DF6 A;  3Q81 A;  3D72 A;  3UDF A;  1ERM A;  5F69 A;  2VV6 A;  4DDS A;  4KQR A;  4LRY C;  1L2S A;  1XGI A;  2JCH A;  5EVE A;  3ZFZ A;  4HH2 A;  5CX7 A;  1V9Z A;  3MMH A;  2VA0 A;  1K38 A;  2XSS A;  3EEA A;  3T1R A;  2W1T B;  3IS2 A;  5F82 A;  3C5A A;  5DKK A;  4HP9 A;  4OLD A;  4YWZ A;  1CK3 A;  4BL2 A;  5C5K A;  5FSR A;  3A3E A;  5E2H A;  4EER A;  5HPI A;  1RGY A;  2P04 A;  3BLM A;  3FWL A;  3Q7Z A;  4O8G A;  1ZG4 A;  1WYC A;  3OPL A;  2Y8H A;  5KZH A;  2ZQ7 A;  4JLF A;  4P6Z S;  2HDR A;  1SHV A;  1HVB A;  3NI9 A;  2ACG A;  3RTY A;  1H0M A;  4GCZ A;  3F1P A;  3O87 A;  3S7O A;  5DF9 A;  4ZAM A;  4BLM A;  1Q2P A;  3T12 B;  2V0W A;  3FPV A;  3F1N A;  2KOI A;  3WS1 A;  5DTK A;  1KOU A;  5FI6 A;  3M6H A;  2WGV A;  5J7E A;  3U2A A;  4FOF A;  3VOL A;  1PFL A;  2PYR A;  4Y0T A;  3MXS A;  3MZD A;  3WRT A;  2QHK A;  4CLC B;  1IYQ A;  1SKO A;  5EVI B;  3H82 A;  3E4Q A;  5HFO A;  3IF5 A; 
#chains in the Genus database with same CATH homology
 1K55 C;  3BRM A;  4U0T A;  3IF6 C;  4JF6 A;  3VP0 A;  1K25 A;  3PBS A;  2XLN A;  3AGF A;  3G31 A;  4HBU A;  4X68 A;  4XUZ A;  3SH7 A;  4E6X A;  5BOH A;  3PBR A;  3BFE A;  2B5R A;  4OP8 A;  3ZVW A;  3W4Q A;  1EI5 A;  4R4S A;  5GHZ A;  5CGS A;  4HEF A;  2EXB A;  1XP4 A;  3IXD A;  3MBZ A;  4QB8 A;  1XKZ A;  1PWD A;  1YT4 A;  4QU3 A;  4XXR A;  1PW1 A;  5CGW A;  5FI7 A;  1VM1 A;  3M6B A;  5TFQ A;  1ES3 A;  4KQO A;  5FAS A;  1KGE A;  4K0W A;  4ZJ3 A;  1DJC A;  1AXB A;  3SS4 A;  2RCX A;  5GLC A;  3IWO A;  3PAE A;  4O7D A;  4JBF A;  3IF6 A;  2R9X A;  4EUZ A;  2WUQ A;  4GNU A;  2XEP A;  2Y2J A;  2ZC4 B;  4P87 A;  3WS0 A;  3VSK A;  5CEB A;  4QY6 A;  4WBG A;  4WEL A;  1O07 A;  2G2W A;  3PAG A;  5EOE A;  3DWK A;  3GV9 A;  4ZJ1 A;  3LY4 A;  4OQI A;  2C6W B;  3ZNY A;  4DE2 A;  3SS3 A;  3Q1F A;  1H8Y A;  1BLH A;  2HP9 A;  2Y55 A;  3A3D A;  4B4X A;  1IYO A;  5CTN A;  3S22 A;  4WM9 A;  4X6T A;  4DXC A;  1BSG A;  1I2S A;  2J9O A;  4UA9 A;  3VOY A;  5I94 A;  2Z2L B;  5DTT A;  3HL9 A;  3LO7 A;  4P0M A;  3LEZ A;  4MBK A;  4KZ6 A;  4KZ8 A;  4DKI A;  3NBL A;  4NET A;  2XH9 A;  3FKV A;  2QZ6 A;  3IT9 A;  3MXR A;  4JF5 A;  4WMC A;  3TG9 A;  4RVA A;  1CEG A;  3G35 A;  3P09 A;  4E3O A;  5A93 A;  1NZO A;  2P9V B;  3HLE A;  4GDB A;  5CEC A;  4OP5 A;  3UNW A;  3VOZ A;  4WZ4 A;  1LLB A;  5HAI A;  5J8X A;  1YLW A;  1NYM A;  4MBH A;  4N92 A;  1CEF A;  3BFC A;  3G30 A;  4KZB A;  4OKP A;  4WZ5 A;  4DE3 A;  4GB7 A;  3GSG A;  2ZMA A;  4JKT A;  3PBN A;  4P85 A;  4S2N C;  4WMC D;  1L0D A;  2C5W B;  4KZ9 A;  5EVI C;  2ZQA A;  1BUE A;  3WS2 A;  3V39 A;  3G32 A;  4PM7 A;  4CJN A;  3N8R A;  2BG1 A;  4KG2 A;  3VMA A;  1CI8 A;  1BT5 A;  1E25 A;  2ZM2 A;  5CHJ A;  4EQI A;  2V1Z A;  1ESU A;  1YM1 A;  2Y4A A;  4X69 A;  1K57 C;  2WK0 A;  2XFT A;  3UO9 A;  4DRT A;  2XGN A;  4KZ3 A;  5E2F A;  3V3R A;  2FFF B;  1L0G A;  3ZG8 B;  1YLT A;  2XF3 A;  1ZKJ A;  5DF7 A;  1YMX A;  3S1Y A;  2ZC5 B;  1TDG A;  1S0W A;  1YLP A;  5CRF A;  3HLG A;  5EVI A;  1K54 A;  4ZJ2 A;  2ZC7 A;  4KZA A;  2WGW B;  2Z2M B;  3FZC A;  3WRZ A;  5KMW A;  3UPN A;  5AQA A;  4OOL A;  1KGG A;  4OOY A;  2X01 A;  2Y59 A;  2G2U A;  4OPY A;  3RJU A;  4HES A;  4QHC A;  3V50 A;  3HLC A;  3ZVT A;  4C6Y A;  4OVD A;  4XUX A;  4MEZ A;  4KG6 A;  4Q8I A;  3LCE A;  1IEM A;  3G2Y A;  4BD0 A;  3ISG A;  4OQ0 A;  4YFM A;  5EVI D;  4B4Z A;  4LCM A;  4S2L A;  3CJM A;  2HDU A;  4Y0U A;  1S6R A;  3LY3 A;  4DE1 A;  3GMW A;  1N9B A;  1FCM A;  4MNR A;  2Y2M A;  4BQM A;  4OH0 A;  1BLP A;  2DCF A;  3PBO A;  3VP4 A;  3A3F A;  2WAE A;  2WZZ A;  4BEN A;  2UWX A;  5CTM A;  4C3Q A;  2XDM A;  1NZU A;  4WYY A;  1IYS A;  2CC1 A;  3VFH A;  1ERO A;  1ZC2 A;  1KDS A;  2J7V A;  3W8K A;  2IWC A;  1DJA A;  3C4O A;  3NDG A;  3E2L A;  4S2J A;  3N4I A;  1L0E A;  4ZBE A;  3RXX A;  4JXS A;  3IH8 A;  1GHM A;  4YIN A;  3BLS A;  1G68 A;  4EWF A;  1ES5 A;  1PZP A;  4GZB A;  3D4F A;  1LHY A;  1O7E A;  4R4R A;  4IVK A;  1HTZ A;  2BLS A;  4LV3 A;  4JXG A;  2HDS A;  1LL9 A;  2PBY A;  3ZG5 A;  2FFY A;  4ID4 A;  4E3M A;  2P9V A;  2PU4 A;  2ZM0 A;  4HBT A;  4S2K A;  3UE1 A;  2J8Y A;  2Y91 A;  4PM6 A;  2Y2P A;  3CMZ A;  4KZ4 A;  3IWI A;  5FQJ A;  2Y2L A;  3HUM A;  1PI5 A;  3N7W A;  1RGZ A;  2JBF A;  2OSU A;  4E3K A;  3HVF A;  4IED A;  5M19 A;  4FH2 A;  1ONH A;  3Q82 A;  4L0L A;  1PZO A;  1MWR A;  3A3J A;  1L0F A;  1W79 A;  3BYD A;  4X56 A;  2H0T A;  4RX3 A;  1PWG A;  1DJB A;  1U60 A;  3MKE A;  4IVI A;  4QD4 A;  3WS4 A;  4QJG A;  3EQV A;  2WAF A;  4M3K A;  2ZQC A;  4OPR A;  3ZCZ A;  3IHA A;  4RA7 A;  4PM8 A;  1GHI A;  5GLD A;  2Q9M A;  1NY0 A;  4KQQ A;  1JWP A;  2ZQ8 A;  5GLB A;  1MWT A;  3GR2 A;  1NRF A;  1YLZ A;  2WAD A;  4NK3 A;  2EFU A;  3TSG A;  1RP5 A;  3BM6 A;  4BL3 A;  4WZ5 C;  4PM5 A;  4RX2 A;  1IEL A;  1K6R A;  1N4O A;  4P6B A;  1ZG6 A;  2DRW A;  3MZF A;  3UDI A;  2Q9N A;  3W4P A;  5KSH A;  1IKI A;  5A92 A;  1E4D A;  3PBQ A;  4N9L A;  1RCJ A;  2WGW A;  3E2K A;  5GHX A;  4OOM A;  3FKW A;  3W4O A;  4E3J A;  5HL1 A;  3IXG A;  2HDQ A;  4LV2 A;  3S4X A;  5CER A;  5DTS A;  1CI9 A;  5FQM A;  5L2F A;  3BFG A;  1JTD A;  3HLF A;  3O86 A;  3IH9 A;  3N8S A;  3N6I A;  5IHV A;  2XFS A;  1PIO A;  2H5S A;  1MXO A;  3UN7 A;  1M40 A;  5GHY A;  1XX2 A;  5KSC A;  1ERQ A;  1MY8 A;  5FI2 A;  2VGK A;  2VGJ A;  2EX6 A;  1K54 C;  5HX9 A;  1KE3 A;  5EPH A;  2HP5 A;  1PYY A;  4R3J A;  2WZX A;  2I72 A;  1FR1 A;  3G34 A;  3OPR A;  4KG5 A;  4EBP A;  2ZC3 B;  3UY6 A;  5F83 A;  3NIA A;  4LV1 A;  2ZD8 A;  5FQI A;  4E3I A;  2QMI A;  4Y0O A;  2QPN A;  4N9K A;  1MBL A;  4OQH A;  1PI4 A;  4S2M A;  4UHU A;  3ZNT A;  3OPH A;  3M2K A;  4KEN B;  2XR0 A;  1VQQ A;  2V2F F;  4IBR A;  2Y2H A;  4FSF A;  1W7F A;  1JWV A;  5CGX A;  3FYZ A;  4FCF A;  1Y54 A;  3HLB A;  1BZA A;  5FAT A;  4ZTK A;  5U47 A;  3SH9 A;  3VSL A;  5E2G A;  4JXW A;  1FCN A;  2EX2 A;  1NJ4 A;  1FQG A;  4LEN A;  4OON A;  4JXV A;  5EOO A;  3VP2 A;  1XA1 A;  2WKI A;  4LV0 A;  3MZE A;  1FSY A;  1C3B A;  1LI0 A;  5TR7 A;  1GA9 A;  2Y2O A;  4UA6 A;  3Q07 A;  1MPL A;  1JVJ A;  3C7U A;  3UPP A;  2A3U A;  4PPR A;  5GLA A;  2OLV A;  3ZDJ A;  3ZG0 A;  4BD1 A;  5DF8 A;  5M18 A;  3ITB A;  2ZQ9 A;  1J9M A;  3PTE A;  3IWQ A;  3HUN A;  1BTL A;  3C4P A;  3UPO A;  2GDN A;  4IBX A;  1TEM A;  4FH4 A;  1TDL A;  3ITA A;  2P74 A;  4E3L A;  4R1G A;  1FCO A;  3FV7 A;  1WE4 A;  1FR6 A;  2WKE A;  3HBR A;  5CED A;  1GA0 A;  1KE0 A;  2DNS A;  1K56 A;  2A49 A;  5E2E A;  3SOI A;  3WS5 A;  5AQB A;  3ZHH A;  2WGI A;  4Z9Q A;  5HAR A;  4S2O A;  3UDX A;  1MWU A;  4S2I A;  3IQA A;  1XGJ A;  4MBF A;  5FAQ A;  1XA7 A;  5JYO A;  4GD8 A;  1BLC A;  1OME A;  3UE0 A;  2EFX A;  3GRJ A;  2X02 A;  1K56 D;  1SKF A;  2PU2 A;  5EVL A;  3SH8 A;  1I5Q A;  4EV4 A;  4WEK A;  3O88 A;  4A5R A;  2EX8 A;  3M2J A;  1Z6F A;  1WYB A;  3UE3 A;  2E8I A;  3OPP A;  4UAA A;  5JYP A;  3N8L A;  4OPQ A;  3B3X A;  3OZH A;  5CXW A;  4KZ7 A;  3HLW A;  4DDY A;  1KVM A;  1GCE A;  3ZG7 B;  2XK1 A;  4R0Q A;  2Y2N A;  1JTG A;  1TVF A;  2Y2G A;  4EBN A;  4B88 A;  3MFD A;  1M6K A;  1JWZ A;  4PMA A;  4Y7P A;  1G6A A;  1K6S A;  3ZG9 B;  1SDN A;  3BFF A;  3O3V A;  3V3S A;  4GOG A;  4R23 A;  5DVA A;  3HUO A;  4E3N A;  5FA7 A;  5GL9 A;  1BLS A;  5HAP A;  5A91 A;  4GN2 A;  3P98 A;  2H10 A;  1IYP A;  2ZQD A;  3Q7V A;  1K55 A;  3NC8 A;  5FDH A;  2XQZ A;  2Y2K A;  2JE5 A;  3HLD A;  3NY4 A;  4MLL A;  4BJP A;  3AGD A;  5G18 A;  1MKI A;  5CHU A;  2RL3 A;  4H8R A;  3QNC A;  5AQ7 A;  3G2Z A;  3NDE A;  3DTM A;  4LCL A;  4D2O A;  2EXA A;  3G4P A;  4GD6 A;  1XXM A;  1QMF A;  2X71 A;  1W5D A;  5FQQ A;  4KQR A;  1W8Y A;  1YQS A;  2WKH A;  4U3T A;  3IXB A;  4X55 A;  5EUA A;  5FQ9 A;  1I2W A;  3GVB A;  1H5X A;  4DF6 A;  3BEC A;  3Q81 A;  2Y2I A;  1HZO A;  3UDF A;  1ERM A;  4E6W A;  4FD8 A;  1MWS A;  3GTC A;  4DDS A;  5A90 A;  4C75 A;  1ES2 A;  5F1G A;  1SDE A;  2ZLY A;  1BUL A;  1L2S A;  1XGI A;  2JCH A;  3BEB A;  3PBT A;  1IKG A;  3QHY A;  1FOF A;  3A3I A;  3WWX A;  3VP1 A;  3ZFZ A;  1ESI A;  1PWC A;  2ZC6 B;  3MKF A;  3BFD A;  1KGF A;  3OC2 A;  4UA7 A;  5D3O A;  5HW3 A;  1LL5 A;  1SCW A;  3Q7V B;  3CG5 A;  1ONG A;  3TOI A;  3IF6 B;  4K0X A;  1K38 A;  3C7V A;  5EEC A;  1KDW A;  5F82 A;  3C5A A;  4ZDX A;  3OCN A;  3VP3 A;  2HPB A;  2ZJ9 A;  5FAO A;  3HRE A;  4U0X A;  4OLD A;  1CK3 A;  1H8Z A;  4BL2 A;  5HAQ A;  5FSR A;  1YLY A;  3IXH A;  3JYI A;  3OCL A;  3A3E A;  3SS5 A;  4RYE A;  1W8Q A;  1E3U A;  5E2H A;  3RXW A;  4EBL A;  1ALQ A;  5TGF A;  1PW8 A;  4S2N A;  1NYY A;  1KE4 A;  1RGY A;  3BLM A;  3IHB A;  3FWL A;  3Q7Z A;  1ZG4 A;  5AQ9 A;  4X53 A;  4DXB A;  1WYC A;  2HP6 A;  3OPL A;  5KZH A;  2ZQ7 A;  4JLF A;  1K4F A;  2IWB A;  4K91 A;  1QME A;  2HDR A;  3ZGA B;  1SHV A;  2IWD A;  1HVB A;  1KVL A;  1YLJ A;  1E3U D;  1K57 A;  3NI9 A;  4N1X A;  4OPZ A;  1HD8 A;  1EWZ A;  1YMS A;  4GDN A;  1K4E A;  5FQK A;  3O87 A;  3AGE A;  3NCK A;  4R3B A;  1GHP A;  5DF9 A;  4OQG A;  4ZAM A;  2OLU A;  4BLM A;  4F94 A;  1Q2P A;  4GKU A;  2Y2Q A;  4DE0 A;  4CPK A;  2H0Y A;  2WYX A;  4WEJ A;  1NXY A;  2R9W A;  4JF4 A;  1ES4 A;  1XPB A;  5M1A A;  3WS1 A;  3CZD A;  2XD5 A;  5CHM A;  5DTK A;  1LI9 A;  2V20 A;  5FI6 A;  3GQZ A;  1DY6 A;  3M6H A;  3V5M A;  2WGV A;  2JC7 A;  2ZM8 A;  4KZ5 A;  3VFF A;  2XD1 A;  3QNB A;  4PM9 A;  4OLG A;  4QY5 A;  4Y0T A;  3MXS A;  3MZD A;  4N1H A;  4S2P A;  3DWZ A;  5E43 A;  1IYQ A;  5EVI B;  3WRT A;  1FSW A;  5FAP A;  3DW0 A;  5F1F A;  2J9P A;  2EX9 A;  3EQU A;  5EE8 A;  5HFO A;  3I7J A;  4JPM A;  2OV5 A;  1Q2Q A;  3IF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...