4OH0A

Crystal structure of oxa-58 carbapenemase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
243
structure length
242
Chain Sequence
b'SIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFIANALIGLENHKATSTEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSGWGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase OXA-58
publication title Crystal Structure of Carbapenemase OXA-58 from Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 72
structure length 242
sequence length 243
ec nomenclature
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oh0A00
2J8YA 1GCEA 4GDBA 4ZJ2A 3DWZA 3VSLA 5M19A 5DTKA 1L0FA 3G30A 4Y0TA 4OPRA 4DKIA 4EQIA 1Q2PA 2XR0A 3QHYA 4JF6A 4KZ5A 4YFMA 3IHBA 5FQJA 2H0TA 2WZZA 4N92A 2CC1A 3RXWA 2HP9A 1BTLA 1K25A 4WMCA 3UN7A 1FR6A 1WYBA 4KZ9A 1NZOA 2XD5A 4S2JA 3FWLA 4Y0OA 3O88A 4XUZA 4JXGA 1BLPA 3BRMA 3AGEA 1W7FA 5TGFA 1YLYA 4IBRA 1Y54A 4UA6A 1LI9A 2OLUA 3GR2A 5EVID 2Y2MA 2GDNA 1ALQA 1YMSA 1PWDA 1PYYA 4U3TA 4S2MA 3GMWA 1HZOA 2ZC6B 5J8XA 3NY4A 5KSHA 2WADA 4DDYA 3EQVA 5FI7A 5EECA 4EBLA 2VGJA 2HDSA 3NDGA 2XEPA 1TDLA 2WK0A 4QD4A 3ITAA 4WELA 5CECA 4XXRA 1BLHA 3UPPA 1HTZA 4LCLA 4MBHA 1ES5A 1N4OA 3ZVTA 1TEMA 3HLEA 4N9KA 1RCJA 3LY4A 1HVBA 1K54A 3MFDA 4E6WA 4KZAA 3ZNYA 4OQ0A 2BLSA 1YLWA 3A3EA 1GHMA 1NRFA 1BZAA 4OOMA 4C3QA 4EBPA 1ONHA 4BLMA 4L0LA 2XDMA 1MWSA 4RX3A 5DF8A 3V50A 3WS0A 4GNUA 3QNBA 1FR1A 2J7VA 3AGFA 2XFSA 2FFYA 3LY3A 3VP4A 1BLCA 2H0YA 4OH0A 2ZD8A 4XUXA 5CHUA 4E3KA 3G2YA 5DTSA 1NXYA 2X02A 1MXOA 2EXAA 4P85A 4LENA 4EV4A 1G6AA 2XQZA 2Y2HA 5E2GA 4DE3A 1VM1A 3LCEA 4Z9QA 1MWUA 2Q9NA 5KZHA 5AQBA 1W8YA 3C4PA 3WS5A 2H5SA 1NZUA 2EX9A 2RL3A 3Q7ZA 3N8SA 3ZG0A 5HARA 3IXBA 4KZ4A 4PM8A 3S1YA 4DE1A 1E25A 3IH9A 5FQIA 5FQKA 1NYMA 3UE0A 1DJCA 2Y4AA 1KE0A 4JXSA 4IVKA 4PM9A 1FSYA 2EXBA 2VGKA 5GLCA 5EVLA 4PM6A 3BEBA 3PBTA 1MPLA 5GL9A 1ONGA 2ZM8A 3BFDA 3G32A 1QMFA 3W4QA 1CI9A 1N9BA 1IYOA 5CGWA 3PBOA 3SS5A 4C75A 1PZPA 4Y0UA 4BD0A 4S2LA 4E6XA 2IWDA 4B88A 1WYCA 3IT9A 1K57C 2DNSA 1KVMA 5DF9A 5F83A 4OQHA 1ERMA 4P0MA 2Z2LB 2WUQA 3LO7A 2HDUA 2PU2A 4GZBA 4MLLA 4WZ5C 5A91A 2XF3A 5FAOA 5GHYA 3NIAA 3Q7VB 4OPZA 2BG1A 1RGYA 2Y55A 5FASA 4E3MA 2Y2IA 1KVLA 4KZ3A 2ZQCA 1NY0A 4DE2A 4N1HA 4UA9A 3QNCA 2IWBA 5FAQA 4OKPA 1LLBA 3MKFA 1JVJA 3M6HA 5CXWA 3IWOA 4GKUA 3VOZA 1PIOA 1XA7A 2ZQ7A 3HLDA 3SH9A 4EWFA 3D4FA 4MBFA 1VQQA 4WMCD 4YINA 4KENB 2HDQA 1XGIA 3B3XA 4D2OA 3C7VA 4DXCA 3E2LA 2PU4A 3IF6C 3V5MA 1LI0A 5GHXA 4P87A 1JWPA 3MXRA 3OCNA 2V1ZA 4IVIA 4K0XA 4R3JA 4JPMA 4U0TA 2XD1A 3UDIA 5DVAA 3V39A 2WGIA 4N9LA 4OPYA 4KZ7A 1ZG4A 3UE3A 5EUAA 5FATA 3N8RA 2RCXA 2UWXA 1JWVA 1HD8A 3CMZA 4CJNA 1DY6A 2JBFA 4OP8A 4JXVA 3FKVA 2G2UA 3MZEA 1K57A 4HEFA 1KDSA 1DJBA 3W4OA 5F82A 1BT5A 3C7UA 4LCMA 2P9VA 2HP6A 4PM7A 4IBXA 1JWZA 3ZVWA 3P09A 2XFTA 4KG6A 5F1FA 3ZG9B 4QY6A 1MKIA 5GLAA 3SOIA 4WZ5A 3GSGA 1Q2QA 2EFXA 3SS3A 2P9VB 1L0EA 5FA7A 1FCOA 3VP0A 1I2WA 3HBRA 3HREA 3M2JA 3PAEA 1RGZA 3OZHA 3PBSA 4GDNA 3BFGA 1KE4A 3DTMA 4X69A 5FQ9A 2X01A 4JKTA 1KGEA 2ZC4B 2J9PA 1AXBA 3A3JA 1RP5A 1IYQA 2C5WB 3M2KA 4Q8IA 1PW8A 1PZOA 1DJAA 2WAFA 5HL1A 4HBTA 4PPRA 3ZDJA 4RYEA 4E3OA 1XGJA 1KE3A 2Y2GA 2ZC3B 3WWXA 3UY6A 3WRTA 2ZQAA 1KGGA 3GQZA 4KQRA 4GD6A 3FZCA 1MWRA 1JTGA 3ZHHA 3OPHA 5A93A 4UAAA 2FFFB 3ITBA 4QU3A 3IF6B 3M6BA 4RA7A 5GLDA 5CERA 4RX2A 3MXSA 3UPOA 3AGDA 1TVFA 5CGSA 3BFFA 3IH8A 2Y59A 3PTEA 1S6RA 3OPRA 5E2FA 3VP2A 4PM5A 4B4XA 4LV2A 1GA9A 1WE4A 1CEFA 1E3UA 4P6BA 1W8QA 4S2OA 5L2FA 1PWCA 1QMEA 3PBQA 2OLVA 3ZCZA 3V3RA 3IQAA 3N8LA 3MKEA 4RVAA 5GHZA 3BM6A 1PI4A 3E2KA 1KDWA 3N4IA 3FV7A 5E2HA 2V20A 4WBGA 3VOYA 4C6YA 3SH7A 1YLTA 1Z6FA 2WGWA 3S22A 3UDFA 3N7WA 1CEGA 5KMWA 1H5XA 4QY5A 3ZGAB 3ZG5A 1ESIA 1YT4A 4N1XA 2WYXA 3IXHA 5EOEA 4ZDXA 3JYIA 3IXDA 4ZJ3A 2WGWB 3O3VA 3OPLA 4BD1A 1K4EA 3UO9A 4OOLA 3IXGA 3A3DA 4R4SA 4FH2A 2J9OA 1C3BA 5EOOA 5A92A 1XX2A 4OLDA 5CHMA 3BLSA 3HUMA 3IHAA 5EPHA 4E3IA 3WRZA 3HUNA 3N6IA 3Q1FA 3Q81A 2JC7A 2ZM0A 3NBLA 1XKZA 3ZG7B 1O07A 4BL2A 5HFOA 2JE5A 4OP5A 2EX6A 2EFUA 4R23A 2Y2KA 4PMAA 3G35A 4WEJA 3OC2A 3Q7VA 4LV3A 4ZAMA 5CTNA 3O86A 1GA0A 5CHJA 3TG9A 4UHUA 4ID4A 4R1GA 4R3BA 2X71A 3EQUA 5HAQA 1K4FA 1XPBA 4KZ8A 3WS4A 1IEMA 5AQ9A 4GB7A 1PW1A 2Y2NA 1LHYA 5GLBA 3DWKA 2ZC7A 3G4PA 5AQAA 2A3UA 1FQGA 4FH4A 4KQQA 3W4PA 3RJUA 1CI8A 4WYYA 3GV9A 1CK3A 2ZQDA 4X53A 1GHPA 4GN2A 2ZMAA 1XP4A 1SHVA 1W79A 1W5DA 5E2EA 2WKEA 4U0XA 3NI9A 2I72A 4ZJ1A 4QB8A 4LV0A 5FI2A 5HAPA 4QHCA 1MY8A 5JYPA 3BECA 4K91A 2HPBA 3MZDA 1ZG6A 4X6TA 1YLPA 4DDSA 4OVDA 5EVIC 5AQ7A 3VSKA 4A5RA 1BSGA 2XLNA 4WM9A 5BOHA 1EWZA 4S2IA 3WS1A 1FCNA 4OLGA 4BQMA 4BL3A 1JTDA 2C6WB 1ZKJA 1ES4A 2HP5A 2HDRA 4EUZA 3G2ZA 2P74A 5I94A 2A49A 5D3OA 1YQSA 1K54C 3UPNA 4OQIA 4S2PA 3CG5A 2XK1A 4JBFA 5CRFA 5EE8A 2WKHA 1XA1A 4NETA 4DF6A 4KQOA 1K56D 2B5RA 5FQMA 1FOFA 2PBYA 4F94A 4BENA 4MNRA 2Z2MB 3NCKA 1ESUA 5FQQA 4MBKA 2QMIA 5CEDA 4KZ6A 3A3IA 3O87A 3C4OA 3FKWA 1K56A 3HLGA 3IF5A 1EI5A 2IWCA 3MZFA 1YLZA 2Y2JA 4FD8A 3RXXA 4FCFA 1PWGA 1IYPA 1BULA 1K38A 3GVBA 3C5AA 3ZFZA 5M1AA 1H8YA 3IF6A 4JF4A 3BYDA 5FAPA 5M18A 2H10A 3ZNTA 2R9WA 4DXBA 2Y2OA 2JCHA 3SS4A 1XXMA 5EVIA 1IYSA 3HLWA 3HLBA 3SH8A 1E3UD 2ZC5B 1K55C 4E3LA 1M6KA 2V2FF 4GD8A 4JXWA 1FSWA 3G31A 5EVIB 2OSUA 1NJ4A 3VMAA 3I7JA 3DW0A 3PBRA 1H8ZA 5DF7A 1IKIA 2DCFA 1ES3A 2E8IA 5U47A 5HX9A 3FYZA 3IWIA 1GHIA 2G2WA 3W8KA 3PBNA 3TSGA 3CJMA 1YMXA 4LV1A 1YM1A 2EX2A 3HLCA 5CGXA 3OPPA 1BLSA 3LEZA 1EROA 5JYOA 3BFCA 5F1GA 3IWQA 4S2NC 1L0DA 1PI5A 4ZTKA 2Y2PA 1E4DA 2WKIA 3PAGA 4ZBEA 1TDGA 2EX8A 5TR7A 3S4XA 4IEDA 5CTMA 4X55A 4CPKA 2Q9MA 4R4RA 5E43A 3BLMA 3CZDA 3VFHA 2OV5A 1SDEA 2QPNA 3HL9A 4HESA 4WEKA 4KG2A 3V3SA 5A90A 1K6RA 3VP1A 1LL9A 4JLFA 3OCLA 1L0GA 5KSCA 3NDEA 1MBLA 4UA7A 3VFFA 5DTTA 2Y2LA 1M40A 4OOYA 1O7EA 4HBUA 4KZBA 5HAIA 1I5QA 4DRTA 2XGNA 5HW3A 5FI6A 3HUOA 4B4ZA 4KG5A 3HVFA 1MWTA 1K55A 2WZXA 5CEBA 1YLJA 3HLFA 3VP3A 4X56A 4GOGA 1L2SA 1K6SA 4S2KA 3WS2A 3UDXA 1ZC2A 4H8RA 4K0WA 1U60A 4R0QA 1KGFA 2ZLYA 1IKGA 1G68A 4QJGA 4M3KA 2ZM2A 4WZ4A 2QZ6A 4NK3A 1IELA 1FCMA 2XH9A 4Y7PA 5G18A 3MBZA 2ZQ8A 3P98A 3TOIA 2R9XA 3UNWA 4S2NA 3Q82A 2ZJ9A 1ES2A 1NYYA 3BFEA 5TFQA 3UE1A 4EBNA 4FSFA 3A3FA 3ZG8B 4E3JA 2WGVA 2ZQ9A 3Q07A 1BUEA 2Y91A 1S0WA 1ERQA 4OQGA 1I2SA 2DRWA 4OONA 3G34A 4JF5A 2Y2QA 4MEZA 4DE0A 3NC8A 1OMEA 1SCWA 2WAEA 5FDHA 3GTCA 4X68A 1SDNA 5IHVA 4OPQA 5FSRA 1SKFA 4O7DA 3ISGA 4BJPA 1J9MA 3GRJA 4E3NA 1LL5A
chains in the Genus database with same CATH superfamily
2ACGA 1EW0A 1F5MA 3VSLA 5M19A 5DTKA 1L0FA 4OPRA 3EOIA 1OTAA 4EQIA 1Q2PA 4KZ5A 4EU0A 2VV8A 4CLCE 4JGQA 4WMCA 1WYBA 3FWLA 4JXGA 1BLPA 3AGEA 5TGFA 1YLYA 4UA6A 2W3FA 5HPIA 1F9IA 3HJIA 1DP6A 2KLIA 2Y2MA 2GDNA 1YMSA 2VV7A 3MF0A 4MN5A 2ZC6B 5J8XA 4DDYA 3EQVA 4EBLA 2HDSA 1CQAA 2K31A 3ITAA 4WELA 2FH5A 3LI8A 1BLHA 3UPPA 1HTZA 1N4OA 1TEMA 3MFDA 2W0NA 3A3EA 1ONHA 2AVXA 1MWSA 4GLQA 2J7VA 3LIFA 2FFYA 4PHTA 1BLCA 4XUXA 4JGOA 5DTSA 3LR5A 1MXOA 3BQAA 2VK3A 1VM1A 1W8YA 3IXBA 4DE1A 3PR6A 1E25A 5FQIA 1NYMA 2W1RA 4IVKA 4PM9A 3JVUA 2L1MA 4KUOA 2HJ9C 5GL9A 1H3QA 3BFDA 1QMFA 1N9BA 3T4QA 3PBOA 2GX5A 3W2ZA 1ERMA 5C5KA 2GNXA 2Z2LB 3T1QB 3F1OB 2PD7A 1KVLA 1G5UA 4DE2A 5FAQA 1PRQA 1S67L 1PIOA 2ZQ7A 3SH9A 3D4FA 4R38A 4GHIA 3MXRA 5L09A 2V1ZA 4O0PA 4R3JA 4U0TA 2XD1A 4GHIB 4N9LA 3IX4A 3D9YA 3E4QA 1HD8A 1DY6A 4OP8A 4EXOA 4JXVA 4HEFA 4BBVA 2JKTM 3SOIA 1Q2QA 1FCOA 3PAEA 5J3WA 4HIAA 3CAXA 4G3KA 2W1TB 2X01A 4UEYA 4JKTA 2J9PA 3HJKA 1AXBA 3IBJA 4Q8IA 1DJAA 4HBTA 4RYEA 4E3OA 1XGJA 1KE3A 2Y2GA 2ZC3B 1VB6A 2PYPA 2ZQAA 3H7WA 3WRTA 4GD6A 3B33A 3OPHA 2FFFB 1LSXA 2VV6A 4RX2A 1AWIA 3IH8A 3PTEA 5E2FA 4B4XA 3ZQ5A 1WE4A 3NECA 3IQAA 4L9EA 4NG2A 5GHZA 1PI4A 5E2HA 3LGOA 3SH7A 1Z6FA 1YKDA 3N7WA 1CEGA 3ZG5A 5EOEA 1OPXA 4ZJ3A 3R7WA 1K4EA 2A24A 1C3BA 5A92A 3IHAA 4E3IA 3N6IA 3Q1FA 5HSQA 2JC7A 4BL2A 3QP6A 5HWTA 4R23A 3MFXA 4M4XA 5DFYA 5CTNA 4YNRA 5CHJA 4R1GA 5HAQA 1PW1A 5GLBA 4KQQA 3FPVA 2JKRM 1GHPA 1XP4A 3S7PA 2M7UA 1SHVA 2Y79A 1F2KA 4U0XA 3NI9A 4QB8A 4X6TA 1ZG6A 1OT6A 5BOHA 1ZKJA 1ES4A 2PD8A 5D3OA 2VGLM 5EVEA 4Y3IA 3CG5A 2XK1A 4JBFA 4NKPA 4KQOA 2B5RA 2BTFP 5FQMA 3NCKA 1A0KA 1ESUA 2QMIA 3KYEA 2DMWA 2B95A 1K56A 3KSGA 4FOFA 3IF5A 2Y2JA 2G7UA 2R78A 3GVBA 3C5AA 3EEAA 2K2NA 3IF6A 4I3AA 4DXBA 2Y2OA 3SS4A 1E3UD 2ZC5B 1K55C 3MJQA 1VHMA 1M6KA 4DN0A 1FSWA 2HF6A 1OTEA 1ES3A 3DTEA 2QWSA 3IS2A 3CJMA 4LV1A 4H6JA 5F1GA 1NLYA 3IS2B 2J3TC 2PHYA 2ZBBA 5CTMA 4X55A 2Q9MA 1SDEA 4ESPA 5IU1A 4WEKA 3V3SA 3VP1A 1LL9A 4EEUA 3OCLA 5KSCA 3VFFA 4BBTA 4HBUA 5HAIA 3UMEA 1P9RA 4KG5A 1K55A 3HLFA 4EQ1A 3WS2A 4FUWA 4K0WA 1U60A 3E4PA 3P7NA 2ZM2A 2QZ6A 1OTDA 2J80A 2ZQ8A 1NLZA 3TOIA 2ZJ9A 1TD5A 3UE1A 4EBNA 4E3JA 1BUEA 3U2AA 1S0WA 1I2SA 2PT7A 3G34A 4HOIA 4JF5A 4DE0A 3A0SA 1OMEA 1SCWA 3NHQA 3ISGA 2JKTI 1J9MA 3GRJA 3CITA 1L3LA 4ZJ2A 4Y0TA 2XR0A 3LR4A 4JF6A 4YFMA 4N92A 2ZOHA 4EW7A 1BTLA 3UN7A 2VZWA 1FR6A 3CHWP 1NZOA 4Y0OA 1N9OA 1MZUA 5EM1A 2H28A 4IBRA 1LI9A 3NULA 4F3LB 3K2NA 1ALQA 1PYYA 4S2MA 3GMWA 2Q0OA 5FI7A 5EECA 3MQOA 2VGJA 3MSHA 5CECA 4XXRA 1LT0A 3HLEA 1T1AA 1K54A 4Q0JA 4E6WA 4KZAA 1SZVA 4OQ0A 4NXBA 2BLSA 5TJJA 4OOMA 4RX3A 3V50A 3AGFA 2XFSA 3LY3A 1DP9A 3G2YA 1NXYA 5F6AA 4I5SA 2EXAA 2P08A 2FZ0A 1G6AA 2Y2HA 4DE3A 5AJGA 3C4PA 2H5SA 1S66L 2EX9A 3Q7ZA 5HARA 4KZ4A 2O9AA 5FQKA 2Y4AA 1ACFA 1FSYA 2EXBA 5GLCA 1LSVA 3PBTA 4PAUA 2Z6DA 3FPWA 2JKRI 3UB6A 5CGWA 2QKPA 4Y0UA 5EV0A 4BD0A 3B42A 4WLAA 1K57C 5F83A 4OQHA 4P0MA 2LB5A 2ZMVA 4MLLA 1XJ3A 5GHYA 3Q7VB 4OPZA 2Y55A 1RGYA 5FASA 4E3MA 1X0OA 3B47A 4KZ3A 1OT9A 4UA9A 3QNCA 1LLBA 1JVJA 3IWOA 4GKUA 3QP4A 1XA7A 3MXQA 4G3VA 4D2OA 1XGIA 3UB7A 1FILA 2PYRA 4P87A 5HL6A 3OCNA 4K0XA 3UDIA 2MJ6A 5EUAA 2RCXA 3MZEA 1K57A 3W4OA 5EFWA 1BT5A 2GZAA 3C7UA 4LCMA 4IBXA 3ZG9B 4QY6A 3GSGA 1YAXA 2VLGA 3JPUA 3VP0A 1I2WA 1RGZA 3PBSA 1KE4A 3G6OA 4EESA 3LFVA 5F5YA 3L7HA 2ZC4B 4CLCB 1PZOA 1LSWA 3OBFA 2WAFA 4GS9B 4G3WA 2HGVA 3FZCA 1MWRA 1JTGA 4UAAA 2V0WA 3CUEC 3UPOA 3AGDA 3BFFA 4O8GA 2Y59A 1S6RA 4PM5A 3EGXC 2W3DA 4P6BA 1QMEA 4X25A 3PHYA 2O9CA 3V3RA 4RVAA 1ODVA 3T50A 3E2KA 4HQAA 4WBGA 1IFQA 1YLTA 5KMWA 1H5XA 3NOPC 4QY5A 1YSPA 4XT2A 1STZA 3OPLA 2L0WA 2GJ3A 5EOOA 1LL8A 1NWZA 4OLDA 4XT2B 3OLOA 3BLSA 3HUMA 4MN7A 3D3OA 3HUNA 3F1NB 3NBLA 3ZG7B 1O07A 1FIKA 2PR5A 2EFUA 2Y2KA 4PMAA 2BASA 4LV3A 3CUEA 3F1OA 1GA0A 4MDZA 2X71A 3T1XA 1K4FA 4KZ8A 3WS4A 1LHYA 2JKFA 5AQAA 4FH4A 3LIAA 4I3JA 4BWIA 3PXPA 1Z09A 4GN2A 2WKEA 2I72A 4ZJ1A 4RQ9A 5HAPA 3BECA 4K91A 2HPBA 1OTBA 4S2IA 3WS1A 1FCNA 4OLGA 1JTDA 5F68A 4BMWA 2C6WB 3F1PB 2HDRA 3G2ZA 2A49A 1YQSA 1SKOB 3E4OA 2WKHA 2W1TA 2XA7S 1K56D 3CI6A 1FOFA 4F94A 1OTIA 3T1RA 5CEDA 3H82A 4KZ6A 3O87A 3FKWA 3HLGA 3TW8A 3H82B 4FD8A 3RXXA 4FCFA 1TS8A 4JF4A 3BYDA 2H10A 1S4RA 5L07A 1WA9A 3HLWA 4NXEA 4JXWA 3G31A 3BW6A 3VMAA 1H8ZA 3DBAA 2ZOIA 5HX9A 4WF0A 3FYZA 2VX8A 1P0ZA 3S7OA 3PBNA 1YM1A 3LEZA 1EROA 3BFCA 2Y2PA 2WKIA 1TDGA 4HH3A 3CZDA 3VFHA 4HESA 2XRNA 5LBRA 5AVFA 2Y2LA 1M40A 1PFLA 4DRTA 4B4ZA 3HVFA 1MWTA 4Q0IA 2ZL1A 4R3AA 4X56A 4GOGA 1VETA 1K6SA 4S2KA 2V8FA 4R0QA 2ZL1B 1G68A 4WZ4A 1VETB 2XH9A 5G18A 3C38A 4B93A 4I38A 3MBZA 1GSXA 3Q82A 3A3FA 3RFBA 4OQGA 3QP2A 4GW9A 3K3DA 4MEZA 3NC8A 4O01A 3GTCA 2NUTC 5FSRA 4O7DA 4BJPA 2YKFA 3LIBA 1GCEA 3O5YA 3P01A 3UB8A 3G30A 4R70A 1TS7A 3LR3A 5FQJA 2H0TA 2WKPA 2I9VA 2WZZA 3RTYA 3RXWA 3V67A 3GECA 4DMZA 3ZYTA 4KZ9A 2XD5A 4DJ3A 4S2JA 3O88A 4XUZA 2V1AA 1W7FA 1Y54A 3MS6A 2OLUA 3T12B 1BYWA 5EVID 5J7EA 1PWDA 4U3TA 1H8MA 1HZOA 3NY4A 3NDGA 3HCYA 1TDLA 2WK0A 4QD4A 1J3WA 3E0YA 1ES5A 1XFNA 1RCJA 1Y4OA 3LY4A 4DJ2A 1NRFA 4MN6A 4BLMA 3WS0A 1GSWA 3LICA 2PDRA 4GNUA 1FR1A 2K7SA 1S1YA 2H0YA 4HJ4A 2ZD8A 4OH0A 1P9WA 5CHUA 4R6LA 5AVEA 4P85A 1T1BA 1T19A 1XJ6A 4MCWA 1MWUA 2Q9NA 4EERA 5AQBA 2RL3A 3N8SA 3LEQA 5G4YA 1UWPX 2ZMFA 4Y13A 3UE0A 3KO6A 1KE0A 4JXSA 2VGKA 3BEBA 3ICYA 3G32A 3W4QA 1IYOA 1PZPA 1H0MA 3KYZA 2IWDA 1OJGA 3DTIA 3T4KA 2IA2A 1KVMA 4X1MA 4MMNA 3LO7A 1T18A 2PU2A 4WZ5C 3LYXA 4IJGA 1NY0A 4N1HA 4OKPA 3MKFA 3PYPA 4UQIS 3HLDA 4EWFA 4DXCA 4WMCD 2PU4A 2KX6A 2EWWA 1LI0A 3A0RA 1JWPA 3DAVA 3V39A 4KZ7A 1ZG4A 5A8BA 5FATA 3N8RA 2M1CA 2JHEA 4F3LA 1JWVA 3CMZA 2G2UA 3T4TA 1KDSA 1DJBA 2P9VA 2HP6A 4PM7A 1JWZA 5HDSA 1MKIA 4NXGA 5GLAA 4WZ5A 2P9VB 3HBRA 3HREA 3M2JA 5EM0A 3TRCA 3ULFA 3OZHA 4X69A 5HD3A 3SW1A 1KGEA 3A3JA 1RP5A 1IYQA 2C5WB 3M2KA 3MR0A 2YKHA 1PW8A 3ZDJA 4BBUA 3KX0X 3UY6A 1XJ2A 3GQZA 5A93A 5HPFA 3ITBA 4QU3A 4ETXA 5GLDA 5CERA 3MXSA 5CGSA 3CPTB 5IT5A 3LI9A 4FTXA 3VP2A 2PAVP 3IBRA 5L2FA 1CEFA 1E3UA 4S2OA 2V8CA 4AFIA 3BM6A 1KDWA 3N4IA 3FV7A 3S22A 4WN5A 4IUHA 1ESIA 2Z6CA 3IXHA 3O3VA 4BD1A 4Y5FA 3IXGA 1N9NA 4K08A 4FH2A 1XX2A 4IHQA 5EPHA 2VA0A 1UWNX 2D02A 1Y28A 2UV0E 3OOVA 5HFOA 2JE5A 1S1ZA 3Q7VA 4E04A 4ZAMA 5G4ZA 3TG9A 2PBDP 4ID4A 4R3BA 1XPBA 4GB7A 3DWKA 4CLCC 4EEPA 1FQGA 3W4PA 4WYYA 5L8MA 2V0UA 2ZQDA 3CWFA 4X53A 3C30A 4D60A 2ZMAA 1W79A 1UGUA 5FI2A 1YLPA 4DDSA 5AQ7A 3VSKA 1BSGA 2XLNA 4WM9A 1D06A 1EWZA 4BQMA 1D7EA 1VEUB 4BL3A 2HP5A 4EUZA 5I94A 1CJFA 3S7QA 2KOIA 4EETB 2XA7M 4S2PA 2EA9A 3GDIA 5CRFA 5EE8A 1XA1A 4NETA 3QP1A 4BENA 4MNRA 2Z2MB 4CLCA 1NRJA 2M7VA 3NOUC 4GS9A 3L9KA 2Y8HA 3T1SA 3MZFA 4YWZA 1W63M 3LIDA 2B02A 1MC0A 1BULA 3SZTA 3ZFZA 2PRFA 1H8YA 5FAPA 2R9WA 1XXMA 1XFQA 4ZRRA 2V2FF 3KSHA 1IOUA 2OOLA 2HJEA 3DW0A 1S4SA 3PBRA 5TBMA 2DCFA 2E8IA 3QP8A 1GHIA 4L9FA 4LRZE 3W8KA 5TBMB 1DRMA 5CGXA 5HWWA 1KOUA 1PI5A 3PAGA 4ZBEA 4IEDA 5E43A 2OAP1 3F1NA 4HNBA 2QPNA 3HL9A 5HWVA 4ETZA 3NDEA 1MBLA 1G6OA 1O7EA 4KZBA 5HW3A 5FI6A 3HUOA 2WZXA 5CEBA 2JKGA 1D1JA 1YLJA 3VP3A 1OJ5A 1L2SA 2V1BA 3UDXA 1KGFA 5L10A 4NEED 2O0YA 1FCMA 4Y7PA 4P6ZM 1F98A 2R9XA 3LIEA 2E8JA 3DTKA 1NYYA 4FSFA 1P97A 3ZG8B 2WGVA 3K3CA 1ERQA 4HP9A 4OONA 2Y2QA 3F1PA 2WAEA 5FDHA 1SDNA 1SKOA 4NXFA 4E3NA 2J8YA 4GDBA 3DWZA 3A0VA 3U4LP 2WKQA 1ZTUA 4DKIA 3QHYA 3IHBA 2CC1A 2HP9A 5DKKA 1K25A 4HHDA 4WL9A 5IS1A 3BQ8A 2PR6A 5FEGA 3FG8A 3BRMA 2VEAA 4PKYA 3GR2A 1XJ4A 3EGDC 3VOLA 5KSHA 3BY8A 2WADA 2XEPA 2A2LA 3E98A 4LCLA 3NOTC 4KQDA 4MBHA 3ZVTA 4N9KA 1HVBA 3ZNYA 2VKSA 4Q0HA 4WUJA 1YLWA 1GHMA 1BZAA 4C3QA 4EBPA 4L0LA 2XDMA 5DF8A 3QNBA 2QHKA 3H7WB 3VP4A 4E3KA 2X02A 4LENA 4EV4A 2XQZA 3NJAA 5E2GA 4Z9QA 3LCEA 5KZHA 4B9OA 3WS5A 1NZUA 3ZG0A 4PM8A 3S1YA 4LRYC 1JNUA 3MQ0A 3IH9A 1DJCA 3BWLA 1MKMA 1G28A 4YOFA 5EVLA 4PM6A 1MPLA 1ONGA 2ZM8A 1CI9A 3SS5A 4C75A 4S2LA 3R7WB 4HJ3A 4LLOB 4E6XA 4B88A 3T4JA 2J3TD 1WYCA 3IT9A 2A24B 4II7A 2DNSA 5DF9A 2WUQA 4P6ZS 4KUKA 2HDUA 4GZBA 5A91A 2XF3A 2P04A 5FAOA 3NIAA 4X1LA 2BG1A 2Y2IA 3LR0A 2ZQCA 2WKRA 2LB9A 4UQIM 2IWBA 3M6HA 5CXWA 3UB9A 3VOZA 4MBFA 1VQQA 4YINA 4KENB 2HDQA 3B3XA 4Y15A 3C7VA 5HZHA 3E2LA 1ZHHB 3IF6C 3V5MA 5GHXA 1T1CA 4IVIA 1YPRA 4JPMA 4PKYG 5DVAA 2WGIA 4OPYA 3T4SA 3UE3A 2UWXA 2QYBA 4CJNA 2JBFA 4HJ6A 3FKVA 2HV1A 4HP4A 5F82A 5J4EA 3ZVWA 1TS6A 2XFTA 3P09A 4KG6A 5F1FA 1W63Q 3TE8A 2EFXA 3SS3A 2XSSA 5DFXA 5FA7A 1L0EA 2W3EA 4GDNA 2OWHA 3BFGA 3DTMA 5FQ9A 3UMDA 4HH2A 3BJNA 2NUPC 5HL1A 4PPRA 1TS0A 2EWVA 3WWXA 3T4LA 5HD5A 1KGGA 4KQRA 4QWOA 3ZHHA 3EEHA 3IF6B 3M6BA 4RA7A 3LUQA 1TVFA 3OPRA 4LV2A 3MMHA 1GA9A 1W8QA 2QJ5A 1PWCA 2W3HA 4HY8A 2VJWA 3PBQA 2OLVA 3ZCZA 4L9GA 3N8LA 3MKEA 2V20A 3VOYA 4C6YA 1GSVA 5HDCA 1V9YA 2WGWA 3UDFA 1YSQA 3ZGAB 1YT4A 4N1XA 4ARZA 2WYXA 3MQQA 4H6JB 4ZDXA 3JYIA 3IXDA 2WGWB 1DP8A 5DKLA 3UO9A 4OOLA 4CQHA 4R4SA 3A3DA 4ARZB 2J9OA 4LPZA 5CHMA 1CF0A 3WRZA 4LRXC 3Q81A 2ZM0A 1XKZA 2W27A 4Z1WA 4OP5A 2EX6A 3IX3A 4WEJA 3G35A 5FL3A 3OC2A 5F69A 3VE4A 3O86A 3D72A 4UHUA 3EQUA 4QPRA 1IEMA 5AQ9A 3S7NA 2Y2NA 2ZC7A 3G4PA 2A3UA 2W3GA 3RJUA 1CI8A 3GV9A 1CK3A 2B18A 3EWKA 5HDDA 1N9LA 1W5DA 5E2EA 3R4KA 4LV0A 4QHCA 1MY8A 3FC7A 5JYPA 3MZDA 4HI4A 2D01A 4OVDA 5EVIC 4A5RA 5FEFA 4I3IA 2O9BA 2P74A 2L4RA 3UPNA 1K54C 2P7JA 2OWJA 1PNEA 4OQIA 3RH8B 4CLCD 3C2WA 2VGLS 4Y17A 4DF6A 2JN7A 1V9ZA 4IUKA 2PBYA 5FQQA 4MBKA 1K0KA 3A3IA 3C4OA 1EI5A 2IWCA 5DJTA 2XROA 1YLZA 1PWGA 1IYPA 1K38A 5M1AA 3BY9A 2KDKA 5M18A 3ZNTA 3VV4A 3CPTA 2JCHA 5EVIA 1IYSA 3IX8A 3HLBA 4GJ4A 3SH8A 5DJUA 4JGPA 4E3LA 4GD8A 2QJ7A 4LGWA 5EVIB 2OSUA 1NJ4A 4EUVA 3I7JA 5DF7A 2INWA 4JGRA 1IKIA 5U47A 3H9WA 3IWIA 2G2WA 2V9AA 3TSGA 1YMXA 5FDSA 2EX2A 3HLCA 3OPPA 1BLSA 1HLUP 4LFUA 5JYOA 4ME4A 3IWQA 4S2NC 1L0DA 4ZTKA 1E4DA 5TR7A 2EX8A 3JVVA 2CMNA 3S4XA 5MC7A 2O99A 4CPKA 3CLOA 4R4RA 1TF1A 2HZ5A 3BLMA 2OV5A 5KIZA 5A90A 4KG2A 1K6RA 4JLFA 2OAQ1 1L0GA 3TJZC 3UB5P 4UA7A 5DTTA 4OOYA 1I5QA 2XGNA 3T4OA 3UE6A 3KYQA 4I39A 1ZC2A 4H8RA 5CX7A 2ZLYA 1IKGA 4GCZA 4Y2FA 4QJGA 4M3KA 3C8CA 5I5LA 4NK3A 1IELA 3P98A 3KSFA 3UNWA 3VE3A 4S2NA 1ES2A 3BFEA 5TFQA 3QP5A 2ZQ9A 3Q07A 2Y91A 2DRWA 1VEUA 2J3WA 5K5BA 3KSIA 4X68A 5IHVA 4OPQA 1SKFA 1LL5A
chains in the Genus database with same CATH topology
2J8YA 1GCEA 4GDBA 4ZJ2A 3DWZA 3VSLA 5M19A 5DTKA 1L0FA 3G30A 4Y0TA 4OPRA 4DKIA 4EQIA 1Q2PA 2XR0A 3QHYA 4JF6A 4KZ5A 4YFMA 3IHBA 5FQJA 2H0TA 2WZZA 4N92A 2CC1A 3RXWA 2HP9A 1BTLA 1K25A 4WMCA 3UN7A 1FR6A 1WYBA 4KZ9A 1NZOA 2XD5A 4S2JA 3FWLA 4Y0OA 3O88A 4XUZA 4JXGA 1BLPA 3BRMA 3AGEA 1W7FA 5TGFA 1YLYA 4IBRA 1Y54A 4UA6A 1LI9A 2OLUA 3GR2A 5EVID 2Y2MA 2GDNA 1ALQA 1YMSA 1PWDA 1PYYA 4U3TA 4S2MA 3GMWA 1HZOA 2ZC6B 5J8XA 3NY4A 5KSHA 2WADA 4DDYA 3EQVA 5FI7A 5EECA 4EBLA 2VGJA 2HDSA 3NDGA 2XEPA 1TDLA 2WK0A 4QD4A 3ITAA 4WELA 5CECA 4XXRA 1BLHA 3UPPA 1HTZA 4LCLA 4MBHA 1ES5A 1N4OA 3ZVTA 1TEMA 3HLEA 4N9KA 1RCJA 3LY4A 1HVBA 1K54A 3MFDA 4E6WA 4KZAA 3ZNYA 4OQ0A 2BLSA 1YLWA 3A3EA 1GHMA 1NRFA 1BZAA 4OOMA 4C3QA 4EBPA 1ONHA 4BLMA 4L0LA 2XDMA 1MWSA 4RX3A 5DF8A 3V50A 3WS0A 4GNUA 3QNBA 1FR1A 2J7VA 3AGFA 2XFSA 2FFYA 3LY3A 3VP4A 1BLCA 2H0YA 4OH0A 2ZD8A 4XUXA 5CHUA 4E3KA 3G2YA 5DTSA 1NXYA 2X02A 1MXOA 2EXAA 4P85A 4LENA 4EV4A 1G6AA 2XQZA 2Y2HA 5E2GA 4DE3A 1VM1A 3LCEA 4Z9QA 1MWUA 2Q9NA 5KZHA 5AQBA 1W8YA 3C4PA 3WS5A 2H5SA 1NZUA 2EX9A 2RL3A 3Q7ZA 3N8SA 3ZG0A 5HARA 3IXBA 4KZ4A 4PM8A 3S1YA 4DE1A 1E25A 3IH9A 5FQIA 5FQKA 1NYMA 3UE0A 1DJCA 2Y4AA 1KE0A 4JXSA 4IVKA 4PM9A 1FSYA 2EXBA 2VGKA 5GLCA 5EVLA 4PM6A 3BEBA 3PBTA 1MPLA 5GL9A 1ONGA 2ZM8A 3BFDA 3G32A 1QMFA 3W4QA 1CI9A 1N9BA 1IYOA 5CGWA 3PBOA 3SS5A 4C75A 1PZPA 4Y0UA 4BD0A 4S2LA 4E6XA 2IWDA 4B88A 1WYCA 3IT9A 1K57C 2DNSA 1KVMA 5DF9A 5F83A 4OQHA 1ERMA 4P0MA 2Z2LB 2WUQA 3LO7A 2HDUA 2PU2A 4GZBA 4MLLA 4WZ5C 5A91A 2XF3A 5FAOA 5GHYA 3NIAA 3Q7VB 4OPZA 2BG1A 1RGYA 2Y55A 5FASA 4E3MA 2Y2IA 1KVLA 4KZ3A 2ZQCA 1NY0A 4DE2A 4N1HA 4UA9A 3QNCA 2IWBA 5FAQA 4OKPA 1LLBA 3MKFA 1JVJA 3M6HA 5CXWA 3IWOA 4GKUA 3VOZA 1PIOA 1XA7A 2ZQ7A 3HLDA 3SH9A 4EWFA 3D4FA 4MBFA 1VQQA 4WMCD 4YINA 4KENB 2HDQA 1XGIA 3B3XA 4D2OA 3C7VA 4DXCA 3E2LA 2PU4A 3IF6C 3V5MA 1LI0A 5GHXA 4P87A 1JWPA 3MXRA 3OCNA 2V1ZA 4IVIA 4K0XA 4R3JA 4JPMA 4U0TA 2XD1A 3UDIA 5DVAA 3V39A 2WGIA 4N9LA 4OPYA 4KZ7A 1ZG4A 3UE3A 5EUAA 5FATA 3N8RA 2RCXA 2UWXA 1JWVA 1HD8A 3CMZA 4CJNA 1DY6A 2JBFA 4OP8A 4JXVA 3FKVA 2G2UA 3MZEA 1K57A 4HEFA 1KDSA 1DJBA 3W4OA 5F82A 1BT5A 3C7UA 4LCMA 2P9VA 2HP6A 4PM7A 4IBXA 1JWZA 3ZVWA 3P09A 2XFTA 4KG6A 5F1FA 3ZG9B 4QY6A 1MKIA 5GLAA 3SOIA 4WZ5A 3GSGA 1Q2QA 2EFXA 3SS3A 2P9VB 1L0EA 5FA7A 1FCOA 3VP0A 1I2WA 3HBRA 3HREA 3M2JA 3PAEA 1RGZA 3OZHA 3PBSA 4GDNA 3BFGA 1KE4A 3DTMA 4X69A 5FQ9A 2X01A 4JKTA 1KGEA 2ZC4B 2J9PA 1AXBA 3A3JA 1RP5A 1IYQA 2C5WB 3M2KA 4Q8IA 1PW8A 1PZOA 1DJAA 2WAFA 5HL1A 4HBTA 4PPRA 3ZDJA 4RYEA 4E3OA 1XGJA 1KE3A 2Y2GA 2ZC3B 3WWXA 3UY6A 3WRTA 2ZQAA 1KGGA 3GQZA 4KQRA 4GD6A 3FZCA 1MWRA 1JTGA 3ZHHA 3OPHA 5A93A 4UAAA 2FFFB 3ITBA 4QU3A 3IF6B 3M6BA 4RA7A 5GLDA 5CERA 4RX2A 3MXSA 3UPOA 3AGDA 1TVFA 5CGSA 3BFFA 3IH8A 2Y59A 3PTEA 1S6RA 3OPRA 5E2FA 3VP2A 4PM5A 4B4XA 4LV2A 1GA9A 1WE4A 1CEFA 1E3UA 4P6BA 1W8QA 4S2OA 5L2FA 1PWCA 1QMEA 3PBQA 2OLVA 3ZCZA 3V3RA 3IQAA 3N8LA 3MKEA 4RVAA 5GHZA 3BM6A 1PI4A 3E2KA 1KDWA 3N4IA 3FV7A 5E2HA 2V20A 4WBGA 3VOYA 4C6YA 3SH7A 1YLTA 1Z6FA 2WGWA 3S22A 3UDFA 3N7WA 1CEGA 5KMWA 1H5XA 4QY5A 3ZGAB 3ZG5A 1ESIA 1YT4A 4N1XA 2WYXA 3IXHA 5EOEA 4ZDXA 3JYIA 3IXDA 4ZJ3A 2WGWB 3O3VA 3OPLA 4BD1A 1K4EA 3UO9A 4OOLA 3IXGA 3A3DA 4R4SA 4FH2A 2J9OA 1C3BA 5EOOA 5A92A 1XX2A 4OLDA 5CHMA 3BLSA 3HUMA 3IHAA 5EPHA 4E3IA 3WRZA 3HUNA 3N6IA 3Q1FA 3Q81A 2JC7A 2ZM0A 3NBLA 1XKZA 3ZG7B 1O07A 4BL2A 5HFOA 2JE5A 4OP5A 2EX6A 2EFUA 4R23A 2Y2KA 4PMAA 3G35A 4WEJA 3OC2A 3Q7VA 4LV3A 4ZAMA 5CTNA 3O86A 1GA0A 5CHJA 3TG9A 4UHUA 4ID4A 4R1GA 4R3BA 2X71A 3EQUA 5HAQA 1K4FA 1XPBA 4KZ8A 3WS4A 1IEMA 5AQ9A 4GB7A 1PW1A 2Y2NA 1LHYA 5GLBA 3DWKA 2ZC7A 3G4PA 5AQAA 2A3UA 1FQGA 4FH4A 4KQQA 3W4PA 3RJUA 1CI8A 4WYYA 3GV9A 1CK3A 2ZQDA 4X53A 1GHPA 4GN2A 2ZMAA 1XP4A 1SHVA 1W79A 1W5DA 5E2EA 2WKEA 4U0XA 3NI9A 2I72A 4ZJ1A 4QB8A 4LV0A 5FI2A 5HAPA 4QHCA 1MY8A 5JYPA 3BECA 4K91A 2HPBA 3MZDA 1ZG6A 4X6TA 1YLPA 4DDSA 4OVDA 5EVIC 5AQ7A 3VSKA 4A5RA 1BSGA 2XLNA 4WM9A 5BOHA 1EWZA 4S2IA 3WS1A 1FCNA 4OLGA 4BQMA 4BL3A 1JTDA 2C6WB 1ZKJA 1ES4A 2HP5A 2HDRA 4EUZA 3G2ZA 2P74A 5I94A 2A49A 5D3OA 1YQSA 1K54C 3UPNA 4OQIA 4S2PA 3CG5A 2XK1A 4JBFA 5CRFA 5EE8A 2WKHA 1XA1A 4NETA 4DF6A 4KQOA 1K56D 2B5RA 5FQMA 1FOFA 2PBYA 4F94A 4BENA 4MNRA 2Z2MB 3NCKA 1ESUA 5FQQA 4MBKA 2QMIA 5CEDA 4KZ6A 3A3IA 3O87A 3C4OA 3FKWA 1K56A 3HLGA 3IF5A 1EI5A 2IWCA 3MZFA 1YLZA 2Y2JA 4FD8A 3RXXA 4FCFA 1PWGA 1IYPA 1BULA 1K38A 3GVBA 3C5AA 3ZFZA 5M1AA 1H8YA 3IF6A 4JF4A 3BYDA 5FAPA 5M18A 2H10A 3ZNTA 2R9WA 4DXBA 2Y2OA 2JCHA 3SS4A 1XXMA 5EVIA 1IYSA 3HLWA 3HLBA 3SH8A 1E3UD 2ZC5B 1K55C 4E3LA 1M6KA 2V2FF 4GD8A 4JXWA 1FSWA 3G31A 5EVIB 2OSUA 1NJ4A 3VMAA 3I7JA 3DW0A 3PBRA 1H8ZA 5DF7A 1IKIA 2DCFA 1ES3A 2E8IA 5U47A 5HX9A 3FYZA 3IWIA 1GHIA 2G2WA 3W8KA 3PBNA 3TSGA 3CJMA 1YMXA 4LV1A 1YM1A 2EX2A 3HLCA 5CGXA 3OPPA 1BLSA 3LEZA 1EROA 5JYOA 3BFCA 5F1GA 3IWQA 4S2NC 1L0DA 1PI5A 4ZTKA 2Y2PA 1E4DA 2WKIA 3PAGA 4ZBEA 1TDGA 2EX8A 5TR7A 3S4XA 4IEDA 5CTMA 4X55A 4CPKA 2Q9MA 4R4RA 5E43A 3BLMA 3CZDA 3VFHA 2OV5A 1SDEA 2QPNA 3HL9A 4HESA 4WEKA 4KG2A 3V3SA 5A90A 1K6RA 3VP1A 1LL9A 4JLFA 3OCLA 1L0GA 5KSCA 3NDEA 1MBLA 4UA7A 3VFFA 5DTTA 2Y2LA 1M40A 4OOYA 1O7EA 4HBUA 4KZBA 5HAIA 1I5QA 4DRTA 2XGNA 5HW3A 5FI6A 3HUOA 4B4ZA 4KG5A 3HVFA 1MWTA 1K55A 2WZXA 5CEBA 1YLJA 3HLFA 3VP3A 4X56A 4GOGA 1L2SA 1K6SA 4S2KA 3WS2A 3UDXA 1ZC2A 4H8RA 4K0WA 1U60A 4R0QA 1KGFA 2ZLYA 1IKGA 1G68A 4QJGA 4M3KA 2ZM2A 4WZ4A 2QZ6A 4NK3A 1IELA 1FCMA 2XH9A 4Y7PA 5G18A 3MBZA 2ZQ8A 3P98A 3TOIA 2R9XA 3UNWA 4S2NA 3Q82A 2ZJ9A 1ES2A 1NYYA 3BFEA 5TFQA 3UE1A 4EBNA 4FSFA 3A3FA 3ZG8B 4E3JA 2WGVA 2ZQ9A 3Q07A 1BUEA 2Y91A 1S0WA 1ERQA 4OQGA 1I2SA 2DRWA 4OONA 3G34A 4JF5A 2Y2QA 4MEZA 4DE0A 3NC8A 1OMEA 1SCWA 2WAEA 5FDHA 3GTCA 4X68A 1SDNA 5IHVA 4OPQA 5FSRA 1SKFA 4O7DA 3ISGA 4BJPA 1J9MA 3GRJA 4E3NA 1LL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8Y A;  1GCE A;  4GDB A;  4ZJ2 A;  3DWZ A;  3VSL A;  5M19 A;  5DTK A;  1L0F A;  3G30 A;  4Y0T A;  4OPR A;  4DKI A;  4EQI A;  1Q2P A;  2XR0 A;  3QHY A;  4JF6 A;  4KZ5 A;  4YFM A;  3IHB A;  5FQJ A;  2H0T A;  2WZZ A;  4N92 A;  2CC1 A;  3RXW A;  2HP9 A;  1BTL A;  1K25 A;  4WMC A;  3UN7 A;  1FR6 A;  1WYB A;  4KZ9 A;  1NZO A;  2XD5 A;  4S2J A;  3FWL A;  4Y0O A;  3O88 A;  4XUZ A;  4JXG A;  1BLP A;  3BRM A;  3AGE A;  1W7F A;  5TGF A;  1YLY A;  4IBR A;  1Y54 A;  4UA6 A;  1LI9 A;  2OLU A;  3GR2 A;  5EVI D;  2Y2M A;  2GDN A;  1ALQ A;  1YMS A;  1PWD A;  1PYY A;  4U3T A;  4S2M A;  3GMW A;  1HZO A;  2ZC6 B;  5J8X A;  3NY4 A;  5KSH A;  2WAD A;  4DDY A;  3EQV A;  5FI7 A;  5EEC A;  4EBL A;  2VGJ A;  2HDS A;  3NDG A;  2XEP A;  1TDL A;  2WK0 A;  4QD4 A;  3ITA A;  4WEL A;  5CEC A;  4XXR A;  1BLH A;  3UPP A;  1HTZ A;  4LCL A;  4MBH A;  1ES5 A;  1N4O A;  3ZVT A;  1TEM A;  3HLE A;  4N9K A;  1RCJ A;  3LY4 A;  1HVB A;  1K54 A;  3MFD A;  4E6W A;  4KZA A;  3ZNY A;  4OQ0 A;  2BLS A;  1YLW A;  3A3E A;  1GHM A;  1NRF A;  1BZA A;  4OOM A;  4C3Q A;  4EBP A;  1ONH A;  4BLM A;  4L0L A;  2XDM A;  1MWS A;  4RX3 A;  5DF8 A;  3V50 A;  3WS0 A;  4GNU A;  3QNB A;  1FR1 A;  2J7V A;  3AGF A;  2XFS A;  2FFY A;  3LY3 A;  3VP4 A;  1BLC A;  2H0Y A;  4OH0 A;  2ZD8 A;  4XUX A;  5CHU A;  4E3K A;  3G2Y A;  5DTS A;  1NXY A;  2X02 A;  1MXO A;  2EXA A;  4P85 A;  4LEN A;  4EV4 A;  1G6A A;  2XQZ A;  2Y2H A;  5E2G A;  4DE3 A;  1VM1 A;  3LCE A;  4Z9Q A;  1MWU A;  2Q9N A;  5KZH A;  5AQB A;  1W8Y A;  3C4P A;  3WS5 A;  2H5S A;  1NZU A;  2EX9 A;  2RL3 A;  3Q7Z A;  3N8S A;  3ZG0 A;  5HAR A;  3IXB A;  4KZ4 A;  4PM8 A;  3S1Y A;  4DE1 A;  1E25 A;  3IH9 A;  5FQI A;  5FQK A;  1NYM A;  3UE0 A;  1DJC A;  2Y4A A;  1KE0 A;  4JXS A;  4IVK A;  4PM9 A;  1FSY A;  2EXB A;  2VGK A;  5GLC A;  5EVL A;  4PM6 A;  3BEB A;  3PBT A;  1MPL A;  5GL9 A;  1ONG A;  2ZM8 A;  3BFD A;  3G32 A;  1QMF A;  3W4Q A;  1CI9 A;  1N9B A;  1IYO A;  5CGW A;  3PBO A;  3SS5 A;  4C75 A;  1PZP A;  4Y0U A;  4BD0 A;  4S2L A;  4E6X A;  2IWD A;  4B88 A;  1WYC A;  3IT9 A;  1K57 C;  2DNS A;  1KVM A;  5DF9 A;  5F83 A;  4OQH A;  1ERM A;  4P0M A;  2Z2L B;  2WUQ A;  3LO7 A;  2HDU A;  2PU2 A;  4GZB A;  4MLL A;  4WZ5 C;  5A91 A;  2XF3 A;  5FAO A;  5GHY A;  3NIA A;  3Q7V B;  4OPZ A;  2BG1 A;  1RGY A;  2Y55 A;  5FAS A;  4E3M A;  2Y2I A;  1KVL A;  4KZ3 A;  2ZQC A;  1NY0 A;  4DE2 A;  4N1H A;  4UA9 A;  3QNC A;  2IWB A;  5FAQ A;  4OKP A;  1LLB A;  3MKF A;  1JVJ A;  3M6H A;  5CXW A;  3IWO A;  4GKU A;  3VOZ A;  1PIO A;  1XA7 A;  2ZQ7 A;  3HLD A;  3SH9 A;  4EWF A;  3D4F A;  4MBF A;  1VQQ A;  4WMC D;  4YIN A;  4KEN B;  2HDQ A;  1XGI A;  3B3X A;  4D2O A;  3C7V A;  4DXC A;  3E2L A;  2PU4 A;  3IF6 C;  3V5M A;  1LI0 A;  5GHX A;  4P87 A;  1JWP A;  3MXR A;  3OCN A;  2V1Z A;  4IVI A;  4K0X A;  4R3J A;  4JPM A;  4U0T A;  2XD1 A;  3UDI A;  5DVA A;  3V39 A;  2WGI A;  4N9L A;  4OPY A;  4KZ7 A;  1ZG4 A;  3UE3 A;  5EUA A;  5FAT A;  3N8R A;  2RCX A;  2UWX A;  1JWV A;  1HD8 A;  3CMZ A;  4CJN A;  1DY6 A;  2JBF A;  4OP8 A;  4JXV A;  3FKV A;  2G2U A;  3MZE A;  1K57 A;  4HEF A;  1KDS A;  1DJB A;  3W4O A;  5F82 A;  1BT5 A;  3C7U A;  4LCM A;  2P9V A;  2HP6 A;  4PM7 A;  4IBX A;  1JWZ A;  3ZVW A;  3P09 A;  2XFT A;  4KG6 A;  5F1F A;  3ZG9 B;  4QY6 A;  1MKI A;  5GLA A;  3SOI A;  4WZ5 A;  3GSG A;  1Q2Q A;  2EFX A;  3SS3 A;  2P9V B;  1L0E A;  5FA7 A;  1FCO A;  3VP0 A;  1I2W A;  3HBR A;  3HRE A;  3M2J A;  3PAE A;  1RGZ A;  3OZH A;  3PBS A;  4GDN A;  3BFG A;  1KE4 A;  3DTM A;  4X69 A;  5FQ9 A;  2X01 A;  4JKT A;  1KGE A;  2ZC4 B;  2J9P A;  1AXB A;  3A3J A;  1RP5 A;  1IYQ A;  2C5W B;  3M2K A;  4Q8I A;  1PW8 A;  1PZO A;  1DJA A;  2WAF A;  5HL1 A;  4HBT A;  4PPR A;  3ZDJ A;  4RYE A;  4E3O A;  1XGJ A;  1KE3 A;  2Y2G A;  2ZC3 B;  3WWX A;  3UY6 A;  3WRT A;  2ZQA A;  1KGG A;  3GQZ A;  4KQR A;  4GD6 A;  3FZC A;  1MWR A;  1JTG A;  3ZHH A;  3OPH A;  5A93 A;  4UAA A;  2FFF B;  3ITB A;  4QU3 A;  3IF6 B;  3M6B A;  4RA7 A;  5GLD A;  5CER A;  4RX2 A;  3MXS A;  3UPO A;  3AGD A;  1TVF A;  5CGS A;  3BFF A;  3IH8 A;  2Y59 A;  3PTE A;  1S6R A;  3OPR A;  5E2F A;  3VP2 A;  4PM5 A;  4B4X A;  4LV2 A;  1GA9 A;  1WE4 A;  1CEF A;  1E3U A;  4P6B A;  1W8Q A;  4S2O A;  5L2F A;  1PWC A;  1QME A;  3PBQ A;  2OLV A;  3ZCZ A;  3V3R A;  3IQA A;  3N8L A;  3MKE A;  4RVA A;  5GHZ A;  3BM6 A;  1PI4 A;  3E2K A;  1KDW A;  3N4I A;  3FV7 A;  5E2H A;  2V20 A;  4WBG A;  3VOY A;  4C6Y A;  3SH7 A;  1YLT A;  1Z6F A;  2WGW A;  3S22 A;  3UDF A;  3N7W A;  1CEG A;  5KMW A;  1H5X A;  4QY5 A;  3ZGA B;  3ZG5 A;  1ESI A;  1YT4 A;  4N1X A;  2WYX A;  3IXH A;  5EOE A;  4ZDX A;  3JYI A;  3IXD A;  4ZJ3 A;  2WGW B;  3O3V A;  3OPL A;  4BD1 A;  1K4E A;  3UO9 A;  4OOL A;  3IXG A;  3A3D A;  4R4S A;  4FH2 A;  2J9O A;  1C3B A;  5EOO A;  5A92 A;  1XX2 A;  4OLD A;  5CHM A;  3BLS A;  3HUM A;  3IHA A;  5EPH A;  4E3I A;  3WRZ A;  3HUN A;  3N6I A;  3Q1F A;  3Q81 A;  2JC7 A;  2ZM0 A;  3NBL A;  1XKZ A;  3ZG7 B;  1O07 A;  4BL2 A;  5HFO A;  2JE5 A;  4OP5 A;  2EX6 A;  2EFU A;  4R23 A;  2Y2K A;  4PMA A;  3G35 A;  4WEJ A;  3OC2 A;  3Q7V A;  4LV3 A;  4ZAM A;  5CTN A;  3O86 A;  1GA0 A;  5CHJ A;  3TG9 A;  4UHU A;  4ID4 A;  4R1G A;  4R3B A;  2X71 A;  3EQU A;  5HAQ A;  1K4F A;  1XPB A;  4KZ8 A;  3WS4 A;  1IEM A;  5AQ9 A;  4GB7 A;  1PW1 A;  2Y2N A;  1LHY A;  5GLB A;  3DWK A;  2ZC7 A;  3G4P A;  5AQA A;  2A3U A;  1FQG A;  4FH4 A;  4KQQ A;  3W4P A;  3RJU A;  1CI8 A;  4WYY A;  3GV9 A;  1CK3 A;  2ZQD A;  4X53 A;  1GHP A;  4GN2 A;  2ZMA A;  1XP4 A;  1SHV A;  1W79 A;  1W5D A;  5E2E A;  2WKE A;  4U0X A;  3NI9 A;  2I72 A;  4ZJ1 A;  4QB8 A;  4LV0 A;  5FI2 A;  5HAP A;  4QHC A;  1MY8 A;  5JYP A;  3BEC A;  4K91 A;  2HPB A;  3MZD A;  1ZG6 A;  4X6T A;  1YLP A;  4DDS A;  4OVD A;  5EVI C;  5AQ7 A;  3VSK A;  4A5R A;  1BSG A;  2XLN A;  4WM9 A;  5BOH A;  1EWZ A;  4S2I A;  3WS1 A;  1FCN A;  4OLG A;  4BQM A;  4BL3 A;  1JTD A;  2C6W B;  1ZKJ A;  1ES4 A;  2HP5 A;  2HDR A;  4EUZ A;  3G2Z A;  2P74 A;  5I94 A;  2A49 A;  5D3O A;  1YQS A;  1K54 C;  3UPN A;  4OQI A;  4S2P A;  3CG5 A;  2XK1 A;  4JBF A;  5CRF A;  5EE8 A;  2WKH A;  1XA1 A;  4NET A;  4DF6 A;  4KQO A;  1K56 D;  2B5R A;  5FQM A;  1FOF A;  2PBY A;  4F94 A;  4BEN A;  4MNR A;  2Z2M B;  3NCK A;  1ESU A;  5FQQ A;  4MBK A;  2QMI A;  5CED A;  4KZ6 A;  3A3I A;  3O87 A;  3C4O A;  3FKW A;  1K56 A;  3HLG A;  3IF5 A;  1EI5 A;  2IWC A;  3MZF A;  1YLZ A;  2Y2J A;  4FD8 A;  3RXX A;  4FCF A;  1PWG A;  1IYP A;  1BUL A;  1K38 A;  3GVB A;  3C5A A;  3ZFZ A;  5M1A A;  1H8Y A;  3IF6 A;  4JF4 A;  3BYD A;  5FAP A;  5M18 A;  2H10 A;  3ZNT A;  2R9W A;  4DXB A;  2Y2O A;  2JCH A;  3SS4 A;  1XXM A;  5EVI A;  1IYS A;  3HLW A;  3HLB A;  3SH8 A;  1E3U D;  2ZC5 B;  1K55 C;  4E3L A;  1M6K A;  2V2F F;  4GD8 A;  4JXW A;  1FSW A;  3G31 A;  5EVI B;  2OSU A;  1NJ4 A;  3VMA A;  3I7J A;  3DW0 A;  3PBR A;  1H8Z A;  5DF7 A;  1IKI A;  2DCF A;  1ES3 A;  2E8I A;  5U47 A;  5HX9 A;  3FYZ A;  3IWI A;  1GHI A;  2G2W A;  3W8K A;  3PBN A;  3TSG A;  3CJM A;  1YMX A;  4LV1 A;  1YM1 A;  2EX2 A;  3HLC A;  5CGX A;  3OPP A;  1BLS A;  3LEZ A;  1ERO A;  5JYO A;  3BFC A;  5F1G A;  3IWQ A;  4S2N C;  1L0D A;  1PI5 A;  4ZTK A;  2Y2P A;  1E4D A;  2WKI A;  3PAG A;  4ZBE A;  1TDG A;  2EX8 A;  5TR7 A;  3S4X A;  4IED A;  5CTM A;  4X55 A;  4CPK A;  2Q9M A;  4R4R A;  5E43 A;  3BLM A;  3CZD A;  3VFH A;  2OV5 A;  1SDE A;  2QPN A;  3HL9 A;  4HES A;  4WEK A;  4KG2 A;  3V3S A;  5A90 A;  1K6R A;  3VP1 A;  1LL9 A;  4JLF A;  3OCL A;  1L0G A;  5KSC A;  3NDE A;  1MBL A;  4UA7 A;  3VFF A;  5DTT A;  2Y2L A;  1M40 A;  4OOY A;  1O7E A;  4HBU A;  4KZB A;  5HAI A;  1I5Q A;  4DRT A;  2XGN A;  5HW3 A;  5FI6 A;  3HUO A;  4B4Z A;  4KG5 A;  3HVF A;  1MWT A;  1K55 A;  2WZX A;  5CEB A;  1YLJ A;  3HLF A;  3VP3 A;  4X56 A;  4GOG A;  1L2S A;  1K6S A;  4S2K A;  3WS2 A;  3UDX A;  1ZC2 A;  4H8R A;  4K0W A;  1U60 A;  4R0Q A;  1KGF A;  2ZLY A;  1IKG A;  1G68 A;  4QJG A;  4M3K A;  2ZM2 A;  4WZ4 A;  2QZ6 A;  4NK3 A;  1IEL A;  1FCM A;  2XH9 A;  4Y7P A;  5G18 A;  3MBZ A;  2ZQ8 A;  3P98 A;  3TOI A;  2R9X A;  3UNW A;  4S2N A;  3Q82 A;  2ZJ9 A;  1ES2 A;  1NYY A;  3BFE A;  5TFQ A;  3UE1 A;  4EBN A;  4FSF A;  3A3F A;  3ZG8 B;  4E3J A;  2WGV A;  2ZQ9 A;  3Q07 A;  1BUE A;  2Y91 A;  1S0W A;  1ERQ A;  4OQG A;  1I2S A;  2DRW A;  4OON A;  3G34 A;  4JF5 A;  2Y2Q A;  4MEZ A;  4DE0 A;  3NC8 A;  1OME A;  1SCW A;  2WAE A;  5FDH A;  3GTC A;  4X68 A;  1SDN A;  5IHV A;  4OPQ A;  5FSR A;  1SKF A;  4O7D A;  3ISG A;  4BJP A;  1J9M A;  3GRJ A;  4E3N A;  1LL5 A; 
#chains in the Genus database with same CATH topology
 2ACG A;  1EW0 A;  1F5M A;  3VSL A;  5M19 A;  5DTK A;  1L0F A;  4OPR A;  3EOI A;  1OTA A;  4EQI A;  1Q2P A;  4KZ5 A;  4EU0 A;  2VV8 A;  4CLC E;  4JGQ A;  4WMC A;  1WYB A;  3FWL A;  4JXG A;  1BLP A;  3AGE A;  5TGF A;  1YLY A;  4UA6 A;  2W3F A;  5HPI A;  1F9I A;  3HJI A;  1DP6 A;  2KLI A;  2Y2M A;  2GDN A;  1YMS A;  2VV7 A;  3MF0 A;  4MN5 A;  2ZC6 B;  5J8X A;  4DDY A;  3EQV A;  4EBL A;  2HDS A;  1CQA A;  2K31 A;  3ITA A;  4WEL A;  2FH5 A;  3LI8 A;  1BLH A;  3UPP A;  1HTZ A;  1N4O A;  1TEM A;  3MFD A;  2W0N A;  3A3E A;  1ONH A;  2AVX A;  1MWS A;  4GLQ A;  2J7V A;  3LIF A;  2FFY A;  4PHT A;  1BLC A;  4XUX A;  4JGO A;  5DTS A;  3LR5 A;  1MXO A;  3BQA A;  2VK3 A;  1VM1 A;  1W8Y A;  3IXB A;  4DE1 A;  3PR6 A;  1E25 A;  5FQI A;  1NYM A;  2W1R A;  4IVK A;  4PM9 A;  3JVU A;  2L1M A;  4KUO A;  2HJ9 C;  5GL9 A;  1H3Q A;  3BFD A;  1QMF A;  1N9B A;  3T4Q A;  3PBO A;  2GX5 A;  3W2Z A;  1ERM A;  5C5K A;  2GNX A;  2Z2L B;  3T1Q B;  3F1O B;  2PD7 A;  1KVL A;  1G5U A;  4DE2 A;  5FAQ A;  1PRQ A;  1S67 L;  1PIO A;  2ZQ7 A;  3SH9 A;  3D4F A;  4R38 A;  4GHI A;  3MXR A;  5L09 A;  2V1Z A;  4O0P A;  4R3J A;  4U0T A;  2XD1 A;  4GHI B;  4N9L A;  3IX4 A;  3D9Y A;  3E4Q A;  1HD8 A;  1DY6 A;  4OP8 A;  4EXO A;  4JXV A;  4HEF A;  4BBV A;  2JKT M;  3SOI A;  1Q2Q A;  1FCO A;  3PAE A;  5J3W A;  4HIA A;  3CAX A;  4G3K A;  2W1T B;  2X01 A;  4UEY A;  4JKT A;  2J9P A;  3HJK A;  1AXB A;  3IBJ A;  4Q8I A;  1DJA A;  4HBT A;  4RYE A;  4E3O A;  1XGJ A;  1KE3 A;  2Y2G A;  2ZC3 B;  1VB6 A;  2PYP A;  2ZQA A;  3H7W A;  3WRT A;  4GD6 A;  3B33 A;  3OPH A;  2FFF B;  1LSX A;  2VV6 A;  4RX2 A;  1AWI A;  3IH8 A;  3PTE A;  5E2F A;  4B4X A;  3ZQ5 A;  1WE4 A;  3NEC A;  3IQA A;  4L9E A;  4NG2 A;  5GHZ A;  1PI4 A;  5E2H A;  3LGO A;  3SH7 A;  1Z6F A;  1YKD A;  3N7W A;  1CEG A;  3ZG5 A;  5EOE A;  1OPX A;  4ZJ3 A;  3R7W A;  1K4E A;  2A24 A;  1C3B A;  5A92 A;  3IHA A;  4E3I A;  3N6I A;  3Q1F A;  5HSQ A;  2JC7 A;  4BL2 A;  3QP6 A;  5HWT A;  4R23 A;  3MFX A;  4M4X A;  5DFY A;  5CTN A;  4YNR A;  5CHJ A;  4R1G A;  5HAQ A;  1PW1 A;  5GLB A;  4KQQ A;  3FPV A;  2JKR M;  1GHP A;  1XP4 A;  3S7P A;  2M7U A;  1SHV A;  2Y79 A;  1F2K A;  4U0X A;  3NI9 A;  4QB8 A;  4X6T A;  1ZG6 A;  1OT6 A;  5BOH A;  1ZKJ A;  1ES4 A;  2PD8 A;  5D3O A;  2VGL M;  5EVE A;  4Y3I A;  3CG5 A;  2XK1 A;  4JBF A;  4NKP A;  4KQO A;  2B5R A;  2BTF P;  5FQM A;  3NCK A;  1A0K A;  1ESU A;  2QMI A;  3KYE A;  2DMW A;  2B95 A;  1K56 A;  3KSG A;  4FOF A;  3IF5 A;  2Y2J A;  2G7U A;  2R78 A;  3GVB A;  3C5A A;  3EEA A;  2K2N A;  3IF6 A;  4I3A A;  4DXB A;  2Y2O A;  3SS4 A;  1E3U D;  2ZC5 B;  1K55 C;  3MJQ A;  1VHM A;  1M6K A;  4DN0 A;  1FSW A;  2HF6 A;  1OTE A;  1ES3 A;  3DTE A;  2QWS A;  3IS2 A;  3CJM A;  4LV1 A;  4H6J A;  5F1G A;  1NLY A;  3IS2 B;  2J3T C;  2PHY A;  2ZBB A;  5CTM A;  4X55 A;  2Q9M A;  1SDE A;  4ESP A;  5IU1 A;  4WEK A;  3V3S A;  3VP1 A;  1LL9 A;  4EEU A;  3OCL A;  5KSC A;  3VFF A;  4BBT A;  4HBU A;  5HAI A;  3UME A;  1P9R A;  4KG5 A;  1K55 A;  3HLF A;  4EQ1 A;  3WS2 A;  4FUW A;  4K0W A;  1U60 A;  3E4P A;  3P7N A;  2ZM2 A;  2QZ6 A;  1OTD A;  2J80 A;  2ZQ8 A;  1NLZ A;  3TOI A;  2ZJ9 A;  1TD5 A;  3UE1 A;  4EBN A;  4E3J A;  1BUE A;  3U2A A;  1S0W A;  1I2S A;  2PT7 A;  3G34 A;  4HOI A;  4JF5 A;  4DE0 A;  3A0S A;  1OME A;  1SCW A;  3NHQ A;  3ISG A;  2JKT I;  1J9M A;  3GRJ A;  3CIT A;  1L3L A;  4ZJ2 A;  4Y0T A;  2XR0 A;  3LR4 A;  4JF6 A;  4YFM A;  4N92 A;  2ZOH A;  4EW7 A;  1BTL A;  3UN7 A;  2VZW A;  1FR6 A;  3CHW P;  1NZO A;  4Y0O A;  1N9O A;  1MZU A;  5EM1 A;  2H28 A;  4IBR A;  1LI9 A;  3NUL A;  4F3L B;  3K2N A;  1ALQ A;  1PYY A;  4S2M A;  3GMW A;  2Q0O A;  5FI7 A;  5EEC A;  3MQO A;  2VGJ A;  3MSH A;  5CEC A;  4XXR A;  1LT0 A;  3HLE A;  1T1A A;  1K54 A;  4Q0J A;  4E6W A;  4KZA A;  1SZV A;  4OQ0 A;  4NXB A;  2BLS A;  5TJJ A;  4OOM A;  4RX3 A;  3V50 A;  3AGF A;  2XFS A;  3LY3 A;  1DP9 A;  3G2Y A;  1NXY A;  5F6A A;  4I5S A;  2EXA A;  2P08 A;  2FZ0 A;  1G6A A;  2Y2H A;  4DE3 A;  5AJG A;  3C4P A;  2H5S A;  1S66 L;  2EX9 A;  3Q7Z A;  5HAR A;  4KZ4 A;  2O9A A;  5FQK A;  2Y4A A;  1ACF A;  1FSY A;  2EXB A;  5GLC A;  1LSV A;  3PBT A;  4PAU A;  2Z6D A;  3FPW A;  2JKR I;  3UB6 A;  5CGW A;  2QKP A;  4Y0U A;  5EV0 A;  4BD0 A;  3B42 A;  4WLA A;  1K57 C;  5F83 A;  4OQH A;  4P0M A;  2LB5 A;  2ZMV A;  4MLL A;  1XJ3 A;  5GHY A;  3Q7V B;  4OPZ A;  2Y55 A;  1RGY A;  5FAS A;  4E3M A;  1X0O A;  3B47 A;  4KZ3 A;  1OT9 A;  4UA9 A;  3QNC A;  1LLB A;  1JVJ A;  3IWO A;  4GKU A;  3QP4 A;  1XA7 A;  3MXQ A;  4G3V A;  4D2O A;  1XGI A;  3UB7 A;  1FIL A;  2PYR A;  4P87 A;  5HL6 A;  3OCN A;  4K0X A;  3UDI A;  2MJ6 A;  5EUA A;  2RCX A;  3MZE A;  1K57 A;  3W4O A;  5EFW A;  1BT5 A;  2GZA A;  3C7U A;  4LCM A;  4IBX A;  3ZG9 B;  4QY6 A;  3GSG A;  1YAX A;  2VLG A;  3JPU A;  3VP0 A;  1I2W A;  1RGZ A;  3PBS A;  1KE4 A;  3G6O A;  4EES A;  3LFV A;  5F5Y A;  3L7H A;  2ZC4 B;  4CLC B;  1PZO A;  1LSW A;  3OBF A;  2WAF A;  4GS9 B;  4G3W A;  2HGV A;  3FZC A;  1MWR A;  1JTG A;  4UAA A;  2V0W A;  3CUE C;  3UPO A;  3AGD A;  3BFF A;  4O8G A;  2Y59 A;  1S6R A;  4PM5 A;  3EGX C;  2W3D A;  4P6B A;  1QME A;  4X25 A;  3PHY A;  2O9C A;  3V3R A;  4RVA A;  1ODV A;  3T50 A;  3E2K A;  4HQA A;  4WBG A;  1IFQ A;  1YLT A;  5KMW A;  1H5X A;  3NOP C;  4QY5 A;  1YSP A;  4XT2 A;  1STZ A;  3OPL A;  2L0W A;  2GJ3 A;  5EOO A;  1LL8 A;  1NWZ A;  4OLD A;  4XT2 B;  3OLO A;  3BLS A;  3HUM A;  4MN7 A;  3D3O A;  3HUN A;  3F1N B;  3NBL A;  3ZG7 B;  1O07 A;  1FIK A;  2PR5 A;  2EFU A;  2Y2K A;  4PMA A;  2BAS A;  4LV3 A;  3CUE A;  3F1O A;  1GA0 A;  4MDZ A;  2X71 A;  3T1X A;  1K4F A;  4KZ8 A;  3WS4 A;  1LHY A;  2JKF A;  5AQA A;  4FH4 A;  3LIA A;  4I3J A;  4BWI A;  3PXP A;  1Z09 A;  4GN2 A;  2WKE A;  2I72 A;  4ZJ1 A;  4RQ9 A;  5HAP A;  3BEC A;  4K91 A;  2HPB A;  1OTB A;  4S2I A;  3WS1 A;  1FCN A;  4OLG A;  1JTD A;  5F68 A;  4BMW A;  2C6W B;  3F1P B;  2HDR A;  3G2Z A;  2A49 A;  1YQS A;  1SKO B;  3E4O A;  2WKH A;  2W1T A;  2XA7 S;  1K56 D;  3CI6 A;  1FOF A;  4F94 A;  1OTI A;  3T1R A;  5CED A;  3H82 A;  4KZ6 A;  3O87 A;  3FKW A;  3HLG A;  3TW8 A;  3H82 B;  4FD8 A;  3RXX A;  4FCF A;  1TS8 A;  4JF4 A;  3BYD A;  2H10 A;  1S4R A;  5L07 A;  1WA9 A;  3HLW A;  4NXE A;  4JXW A;  3G31 A;  3BW6 A;  3VMA A;  1H8Z A;  3DBA A;  2ZOI A;  5HX9 A;  4WF0 A;  3FYZ A;  2VX8 A;  1P0Z A;  3S7O A;  3PBN A;  1YM1 A;  3LEZ A;  1ERO A;  3BFC A;  2Y2P A;  2WKI A;  1TDG A;  4HH3 A;  3CZD A;  3VFH A;  4HES A;  2XRN A;  5LBR A;  5AVF A;  2Y2L A;  1M40 A;  1PFL A;  4DRT A;  4B4Z A;  3HVF A;  1MWT A;  4Q0I A;  2ZL1 A;  4R3A A;  4X56 A;  4GOG A;  1VET A;  1K6S A;  4S2K A;  2V8F A;  4R0Q A;  2ZL1 B;  1G68 A;  4WZ4 A;  1VET B;  2XH9 A;  5G18 A;  3C38 A;  4B93 A;  4I38 A;  3MBZ A;  1GSX A;  3Q82 A;  3A3F A;  3RFB A;  4OQG A;  3QP2 A;  4GW9 A;  3K3D A;  4MEZ A;  3NC8 A;  4O01 A;  3GTC A;  2NUT C;  5FSR A;  4O7D A;  4BJP A;  2YKF A;  3LIB A;  1GCE A;  3O5Y A;  3P01 A;  3UB8 A;  3G30 A;  4R70 A;  1TS7 A;  3LR3 A;  5FQJ A;  2H0T A;  2WKP A;  2I9V A;  2WZZ A;  3RTY A;  3RXW A;  3V67 A;  3GEC A;  4DMZ A;  3ZYT A;  4KZ9 A;  2XD5 A;  4DJ3 A;  4S2J A;  3O88 A;  4XUZ A;  2V1A A;  1W7F A;  1Y54 A;  3MS6 A;  2OLU A;  3T12 B;  1BYW A;  5EVI D;  5J7E A;  1PWD A;  4U3T A;  1H8M A;  1HZO A;  3NY4 A;  3NDG A;  3HCY A;  1TDL A;  2WK0 A;  4QD4 A;  1J3W A;  3E0Y A;  1ES5 A;  1XFN A;  1RCJ A;  1Y4O A;  3LY4 A;  4DJ2 A;  1NRF A;  4MN6 A;  4BLM A;  3WS0 A;  1GSW A;  3LIC A;  2PDR A;  4GNU A;  1FR1 A;  2K7S A;  1S1Y A;  2H0Y A;  4HJ4 A;  2ZD8 A;  4OH0 A;  1P9W A;  5CHU A;  4R6L A;  5AVE A;  4P85 A;  1T1B A;  1T19 A;  1XJ6 A;  4MCW A;  1MWU A;  2Q9N A;  4EER A;  5AQB A;  2RL3 A;  3N8S A;  3LEQ A;  5G4Y A;  1UWP X;  2ZMF A;  4Y13 A;  3UE0 A;  3KO6 A;  1KE0 A;  4JXS A;  2VGK A;  3BEB A;  3ICY A;  3G32 A;  3W4Q A;  1IYO A;  1PZP A;  1H0M A;  3KYZ A;  2IWD A;  1OJG A;  3DTI A;  3T4K A;  2IA2 A;  1KVM A;  4X1M A;  4MMN A;  3LO7 A;  1T18 A;  2PU2 A;  4WZ5 C;  3LYX A;  4IJG A;  1NY0 A;  4N1H A;  4OKP A;  3MKF A;  3PYP A;  4UQI S;  3HLD A;  4EWF A;  4DXC A;  4WMC D;  2PU4 A;  2KX6 A;  2EWW A;  1LI0 A;  3A0R A;  1JWP A;  3DAV A;  3V39 A;  4KZ7 A;  1ZG4 A;  5A8B A;  5FAT A;  3N8R A;  2M1C A;  2JHE A;  4F3L A;  1JWV A;  3CMZ A;  2G2U A;  3T4T A;  1KDS A;  1DJB A;  2P9V A;  2HP6 A;  4PM7 A;  1JWZ A;  5HDS A;  1MKI A;  4NXG A;  5GLA A;  4WZ5 A;  2P9V B;  3HBR A;  3HRE A;  3M2J A;  5EM0 A;  3TRC A;  3ULF A;  3OZH A;  4X69 A;  5HD3 A;  3SW1 A;  1KGE A;  3A3J A;  1RP5 A;  1IYQ A;  2C5W B;  3M2K A;  3MR0 A;  2YKH A;  1PW8 A;  3ZDJ A;  4BBU A;  3KX0 X;  3UY6 A;  1XJ2 A;  3GQZ A;  5A93 A;  5HPF A;  3ITB A;  4QU3 A;  4ETX A;  5GLD A;  5CER A;  3MXS A;  5CGS A;  3CPT B;  5IT5 A;  3LI9 A;  4FTX A;  3VP2 A;  2PAV P;  3IBR A;  5L2F A;  1CEF A;  1E3U A;  4S2O A;  2V8C A;  4AFI A;  3BM6 A;  1KDW A;  3N4I A;  3FV7 A;  3S22 A;  4WN5 A;  4IUH A;  1ESI A;  2Z6C A;  3IXH A;  3O3V A;  4BD1 A;  4Y5F A;  3IXG A;  1N9N A;  4K08 A;  4FH2 A;  1XX2 A;  4IHQ A;  5EPH A;  2VA0 A;  1UWN X;  2D02 A;  1Y28 A;  2UV0 E;  3OOV A;  5HFO A;  2JE5 A;  1S1Z A;  3Q7V A;  4E04 A;  4ZAM A;  5G4Z A;  3TG9 A;  2PBD P;  4ID4 A;  4R3B A;  1XPB A;  4GB7 A;  3DWK A;  4CLC C;  4EEP A;  1FQG A;  3W4P A;  4WYY A;  5L8M A;  2V0U A;  2ZQD A;  3CWF A;  4X53 A;  3C30 A;  4D60 A;  2ZMA A;  1W79 A;  1UGU A;  5FI2 A;  1YLP A;  4DDS A;  5AQ7 A;  3VSK A;  1BSG A;  2XLN A;  4WM9 A;  1D06 A;  1EWZ A;  4BQM A;  1D7E A;  1VEU B;  4BL3 A;  2HP5 A;  4EUZ A;  5I94 A;  1CJF A;  3S7Q A;  2KOI A;  4EET B;  2XA7 M;  4S2P A;  2EA9 A;  3GDI A;  5CRF A;  5EE8 A;  1XA1 A;  4NET A;  3QP1 A;  4BEN A;  4MNR A;  2Z2M B;  4CLC A;  1NRJ A;  2M7V A;  3NOU C;  4GS9 A;  3L9K A;  2Y8H A;  3T1S A;  3MZF A;  4YWZ A;  1W63 M;  3LID A;  2B02 A;  1MC0 A;  1BUL A;  3SZT A;  3ZFZ A;  2PRF A;  1H8Y A;  5FAP A;  2R9W A;  1XXM A;  1XFQ A;  4ZRR A;  2V2F F;  3KSH A;  1IOU A;  2OOL A;  2HJE A;  3DW0 A;  1S4S A;  3PBR A;  5TBM A;  2DCF A;  2E8I A;  3QP8 A;  1GHI A;  4L9F A;  4LRZ E;  3W8K A;  5TBM B;  1DRM A;  5CGX A;  5HWW A;  1KOU A;  1PI5 A;  3PAG A;  4ZBE A;  4IED A;  5E43 A;  2OAP 1;  3F1N A;  4HNB A;  2QPN A;  3HL9 A;  5HWV A;  4ETZ A;  3NDE A;  1MBL A;  1G6O A;  1O7E A;  4KZB A;  5HW3 A;  5FI6 A;  3HUO A;  2WZX A;  5CEB A;  2JKG A;  1D1J A;  1YLJ A;  3VP3 A;  1OJ5 A;  1L2S A;  2V1B A;  3UDX A;  1KGF A;  5L10 A;  4NEE D;  2O0Y A;  1FCM A;  4Y7P A;  4P6Z M;  1F98 A;  2R9X A;  3LIE A;  2E8J A;  3DTK A;  1NYY A;  4FSF A;  1P97 A;  3ZG8 B;  2WGV A;  3K3C A;  1ERQ A;  4HP9 A;  4OON A;  2Y2Q A;  3F1P A;  2WAE A;  5FDH A;  1SDN A;  1SKO A;  4NXF A;  4E3N A;  2J8Y A;  4GDB A;  3DWZ A;  3A0V A;  3U4L P;  2WKQ A;  1ZTU A;  4DKI A;  3QHY A;  3IHB A;  2CC1 A;  2HP9 A;  5DKK A;  1K25 A;  4HHD A;  4WL9 A;  5IS1 A;  3BQ8 A;  2PR6 A;  5FEG A;  3FG8 A;  3BRM A;  2VEA A;  4PKY A;  3GR2 A;  1XJ4 A;  3EGD C;  3VOL A;  5KSH A;  3BY8 A;  2WAD A;  2XEP A;  2A2L A;  3E98 A;  4LCL A;  3NOT C;  4KQD A;  4MBH A;  3ZVT A;  4N9K A;  1HVB A;  3ZNY A;  2VKS A;  4Q0H A;  4WUJ A;  1YLW A;  1GHM A;  1BZA A;  4C3Q A;  4EBP A;  4L0L A;  2XDM A;  5DF8 A;  3QNB A;  2QHK A;  3H7W B;  3VP4 A;  4E3K A;  2X02 A;  4LEN A;  4EV4 A;  2XQZ A;  3NJA A;  5E2G A;  4Z9Q A;  3LCE A;  5KZH A;  4B9O A;  3WS5 A;  1NZU A;  3ZG0 A;  4PM8 A;  3S1Y A;  4LRY C;  1JNU A;  3MQ0 A;  3IH9 A;  1DJC A;  3BWL A;  1MKM A;  1G28 A;  4YOF A;  5EVL A;  4PM6 A;  1MPL A;  1ONG A;  2ZM8 A;  1CI9 A;  3SS5 A;  4C75 A;  4S2L A;  3R7W B;  4HJ3 A;  4LLO B;  4E6X A;  4B88 A;  3T4J A;  2J3T D;  1WYC A;  3IT9 A;  2A24 B;  4II7 A;  2DNS A;  5DF9 A;  2WUQ A;  4P6Z S;  4KUK A;  2HDU A;  4GZB A;  5A91 A;  2XF3 A;  2P04 A;  5FAO A;  3NIA A;  4X1L A;  2BG1 A;  2Y2I A;  3LR0 A;  2ZQC A;  2WKR A;  2LB9 A;  4UQI M;  2IWB A;  3M6H A;  5CXW A;  3UB9 A;  3VOZ A;  4MBF A;  1VQQ A;  4YIN A;  4KEN B;  2HDQ A;  3B3X A;  4Y15 A;  3C7V A;  5HZH A;  3E2L A;  1ZHH B;  3IF6 C;  3V5M A;  5GHX A;  1T1C A;  4IVI A;  1YPR A;  4JPM A;  4PKY G;  5DVA A;  2WGI A;  4OPY A;  3T4S A;  3UE3 A;  2UWX A;  2QYB A;  4CJN A;  2JBF A;  4HJ6 A;  3FKV A;  2HV1 A;  4HP4 A;  5F82 A;  5J4E A;  3ZVW A;  1TS6 A;  2XFT A;  3P09 A;  4KG6 A;  5F1F A;  1W63 Q;  3TE8 A;  2EFX A;  3SS3 A;  2XSS A;  5DFX A;  5FA7 A;  1L0E A;  2W3E A;  4GDN A;  2OWH A;  3BFG A;  3DTM A;  5FQ9 A;  3UMD A;  4HH2 A;  3BJN A;  2NUP C;  5HL1 A;  4PPR A;  1TS0 A;  2EWV A;  3WWX A;  3T4L A;  5HD5 A;  1KGG A;  4KQR A;  4QWO A;  3ZHH A;  3EEH A;  3IF6 B;  3M6B A;  4RA7 A;  3LUQ A;  1TVF A;  3OPR A;  4LV2 A;  3MMH A;  1GA9 A;  1W8Q A;  2QJ5 A;  1PWC A;  2W3H A;  4HY8 A;  2VJW A;  3PBQ A;  2OLV A;  3ZCZ A;  4L9G A;  3N8L A;  3MKE A;  2V20 A;  3VOY A;  4C6Y A;  1GSV A;  5HDC A;  1V9Y A;  2WGW A;  3UDF A;  1YSQ A;  3ZGA B;  1YT4 A;  4N1X A;  4ARZ A;  2WYX A;  3MQQ A;  4H6J B;  4ZDX A;  3JYI A;  3IXD A;  2WGW B;  1DP8 A;  5DKL A;  3UO9 A;  4OOL A;  4CQH A;  4R4S A;  3A3D A;  4ARZ B;  2J9O A;  4LPZ A;  5CHM A;  1CF0 A;  3WRZ A;  4LRX C;  3Q81 A;  2ZM0 A;  1XKZ A;  2W27 A;  4Z1W A;  4OP5 A;  2EX6 A;  3IX3 A;  4WEJ A;  3G35 A;  5FL3 A;  3OC2 A;  5F69 A;  3VE4 A;  3O86 A;  3D72 A;  4UHU A;  3EQU A;  4QPR A;  1IEM A;  5AQ9 A;  3S7N A;  2Y2N A;  2ZC7 A;  3G4P A;  2A3U A;  2W3G A;  3RJU A;  1CI8 A;  3GV9 A;  1CK3 A;  2B18 A;  3EWK A;  5HDD A;  1N9L A;  1W5D A;  5E2E A;  3R4K A;  4LV0 A;  4QHC A;  1MY8 A;  3FC7 A;  5JYP A;  3MZD A;  4HI4 A;  2D01 A;  4OVD A;  5EVI C;  4A5R A;  5FEF A;  4I3I A;  2O9B A;  2P74 A;  2L4R A;  3UPN A;  1K54 C;  2P7J A;  2OWJ A;  1PNE A;  4OQI A;  3RH8 B;  4CLC D;  3C2W A;  2VGL S;  4Y17 A;  4DF6 A;  2JN7 A;  1V9Z A;  4IUK A;  2PBY A;  5FQQ A;  4MBK A;  1K0K A;  3A3I A;  3C4O A;  1EI5 A;  2IWC A;  5DJT A;  2XRO A;  1YLZ A;  1PWG A;  1IYP A;  1K38 A;  5M1A A;  3BY9 A;  2KDK A;  5M18 A;  3ZNT A;  3VV4 A;  3CPT A;  2JCH A;  5EVI A;  1IYS A;  3IX8 A;  3HLB A;  4GJ4 A;  3SH8 A;  5DJU A;  4JGP A;  4E3L A;  4GD8 A;  2QJ7 A;  4LGW A;  5EVI B;  2OSU A;  1NJ4 A;  4EUV A;  3I7J A;  5DF7 A;  2INW A;  4JGR A;  1IKI A;  5U47 A;  3H9W A;  3IWI A;  2G2W A;  2V9A A;  3TSG A;  1YMX A;  5FDS A;  2EX2 A;  3HLC A;  3OPP A;  1BLS A;  1HLU P;  4LFU A;  5JYO A;  4ME4 A;  3IWQ A;  4S2N C;  1L0D A;  4ZTK A;  1E4D A;  5TR7 A;  2EX8 A;  3JVV A;  2CMN A;  3S4X A;  5MC7 A;  2O99 A;  4CPK A;  3CLO A;  4R4R A;  1TF1 A;  2HZ5 A;  3BLM A;  2OV5 A;  5KIZ A;  5A90 A;  4KG2 A;  1K6R A;  4JLF A;  2OAQ 1;  1L0G A;  3TJZ C;  3UB5 P;  4UA7 A;  5DTT A;  4OOY A;  1I5Q A;  2XGN A;  3T4O A;  3UE6 A;  3KYQ A;  4I39 A;  1ZC2 A;  4H8R A;  5CX7 A;  2ZLY A;  1IKG A;  4GCZ A;  4Y2F A;  4QJG A;  4M3K A;  3C8C A;  5I5L A;  4NK3 A;  1IEL A;  3P98 A;  3KSF A;  3UNW A;  3VE3 A;  4S2N A;  1ES2 A;  3BFE A;  5TFQ A;  3QP5 A;  2ZQ9 A;  3Q07 A;  2Y91 A;  2DRW A;  1VEU A;  2J3W A;  5K5B A;  3KSI A;  4X68 A;  5IHV A;  4OPQ A;  1SKF A;  1LL5 A; 
#chains in the Genus database with same CATH homology
 2J8Y A;  1GCE A;  4GDB A;  4ZJ2 A;  3DWZ A;  3VSL A;  5M19 A;  5DTK A;  1L0F A;  3G30 A;  4Y0T A;  4OPR A;  4DKI A;  4EQI A;  1Q2P A;  2XR0 A;  3QHY A;  4JF6 A;  4KZ5 A;  4YFM A;  3IHB A;  5FQJ A;  2H0T A;  2WZZ A;  4N92 A;  2CC1 A;  3RXW A;  2HP9 A;  1BTL A;  1K25 A;  4WMC A;  3UN7 A;  1FR6 A;  1WYB A;  4KZ9 A;  1NZO A;  2XD5 A;  4S2J A;  3FWL A;  4Y0O A;  3O88 A;  4XUZ A;  4JXG A;  1BLP A;  3BRM A;  3AGE A;  1W7F A;  5TGF A;  1YLY A;  4IBR A;  1Y54 A;  4UA6 A;  1LI9 A;  2OLU A;  3GR2 A;  5EVI D;  2Y2M A;  2GDN A;  1ALQ A;  1YMS A;  1PWD A;  1PYY A;  4U3T A;  4S2M A;  3GMW A;  1HZO A;  2ZC6 B;  5J8X A;  3NY4 A;  5KSH A;  2WAD A;  4DDY A;  3EQV A;  5FI7 A;  5EEC A;  4EBL A;  2VGJ A;  2HDS A;  3NDG A;  2XEP A;  1TDL A;  2WK0 A;  4QD4 A;  3ITA A;  4WEL A;  5CEC A;  4XXR A;  1BLH A;  3UPP A;  1HTZ A;  4LCL A;  4MBH A;  1ES5 A;  1N4O A;  3ZVT A;  1TEM A;  3HLE A;  4N9K A;  1RCJ A;  3LY4 A;  1HVB A;  1K54 A;  3MFD A;  4E6W A;  4KZA A;  3ZNY A;  4OQ0 A;  2BLS A;  1YLW A;  3A3E A;  1GHM A;  1NRF A;  1BZA A;  4OOM A;  4C3Q A;  4EBP A;  1ONH A;  4BLM A;  4L0L A;  2XDM A;  1MWS A;  4RX3 A;  5DF8 A;  3V50 A;  3WS0 A;  4GNU A;  3QNB A;  1FR1 A;  2J7V A;  3AGF A;  2XFS A;  2FFY A;  3LY3 A;  3VP4 A;  1BLC A;  2H0Y A;  4OH0 A;  2ZD8 A;  4XUX A;  5CHU A;  4E3K A;  3G2Y A;  5DTS A;  1NXY A;  2X02 A;  1MXO A;  2EXA A;  4P85 A;  4LEN A;  4EV4 A;  1G6A A;  2XQZ A;  2Y2H A;  5E2G A;  4DE3 A;  1VM1 A;  3LCE A;  4Z9Q A;  1MWU A;  2Q9N A;  5KZH A;  5AQB A;  1W8Y A;  3C4P A;  3WS5 A;  2H5S A;  1NZU A;  2EX9 A;  2RL3 A;  3Q7Z A;  3N8S A;  3ZG0 A;  5HAR A;  3IXB A;  4KZ4 A;  4PM8 A;  3S1Y A;  4DE1 A;  1E25 A;  3IH9 A;  5FQI A;  5FQK A;  1NYM A;  3UE0 A;  1DJC A;  2Y4A A;  1KE0 A;  4JXS A;  4IVK A;  4PM9 A;  1FSY A;  2EXB A;  2VGK A;  5GLC A;  5EVL A;  4PM6 A;  3BEB A;  3PBT A;  1MPL A;  5GL9 A;  1ONG A;  2ZM8 A;  3BFD A;  3G32 A;  1QMF A;  3W4Q A;  1CI9 A;  1N9B A;  1IYO A;  5CGW A;  3PBO A;  3SS5 A;  4C75 A;  1PZP A;  4Y0U A;  4BD0 A;  4S2L A;  4E6X A;  2IWD A;  4B88 A;  1WYC A;  3IT9 A;  1K57 C;  2DNS A;  1KVM A;  5DF9 A;  5F83 A;  4OQH A;  1ERM A;  4P0M A;  2Z2L B;  2WUQ A;  3LO7 A;  2HDU A;  2PU2 A;  4GZB A;  4MLL A;  4WZ5 C;  5A91 A;  2XF3 A;  5FAO A;  5GHY A;  3NIA A;  3Q7V B;  4OPZ A;  2BG1 A;  1RGY A;  2Y55 A;  5FAS A;  4E3M A;  2Y2I A;  1KVL A;  4KZ3 A;  2ZQC A;  1NY0 A;  4DE2 A;  4N1H A;  4UA9 A;  3QNC A;  2IWB A;  5FAQ A;  4OKP A;  1LLB A;  3MKF A;  1JVJ A;  3M6H A;  5CXW A;  3IWO A;  4GKU A;  3VOZ A;  1PIO A;  1XA7 A;  2ZQ7 A;  3HLD A;  3SH9 A;  4EWF A;  3D4F A;  4MBF A;  1VQQ A;  4WMC D;  4YIN A;  4KEN B;  2HDQ A;  1XGI A;  3B3X A;  4D2O A;  3C7V A;  4DXC A;  3E2L A;  2PU4 A;  3IF6 C;  3V5M A;  1LI0 A;  5GHX A;  4P87 A;  1JWP A;  3MXR A;  3OCN A;  2V1Z A;  4IVI A;  4K0X A;  4R3J A;  4JPM A;  4U0T A;  2XD1 A;  3UDI A;  5DVA A;  3V39 A;  2WGI A;  4N9L A;  4OPY A;  4KZ7 A;  1ZG4 A;  3UE3 A;  5EUA A;  5FAT A;  3N8R A;  2RCX A;  2UWX A;  1JWV A;  1HD8 A;  3CMZ A;  4CJN A;  1DY6 A;  2JBF A;  4OP8 A;  4JXV A;  3FKV A;  2G2U A;  3MZE A;  1K57 A;  4HEF A;  1KDS A;  1DJB A;  3W4O A;  5F82 A;  1BT5 A;  3C7U A;  4LCM A;  2P9V A;  2HP6 A;  4PM7 A;  4IBX A;  1JWZ A;  3ZVW A;  3P09 A;  2XFT A;  4KG6 A;  5F1F A;  3ZG9 B;  4QY6 A;  1MKI A;  5GLA A;  3SOI A;  4WZ5 A;  3GSG A;  1Q2Q A;  2EFX A;  3SS3 A;  2P9V B;  1L0E A;  5FA7 A;  1FCO A;  3VP0 A;  1I2W A;  3HBR A;  3HRE A;  3M2J A;  3PAE A;  1RGZ A;  3OZH A;  3PBS A;  4GDN A;  3BFG A;  1KE4 A;  3DTM A;  4X69 A;  5FQ9 A;  2X01 A;  4JKT A;  1KGE A;  2ZC4 B;  2J9P A;  1AXB A;  3A3J A;  1RP5 A;  1IYQ A;  2C5W B;  3M2K A;  4Q8I A;  1PW8 A;  1PZO A;  1DJA A;  2WAF A;  5HL1 A;  4HBT A;  4PPR A;  3ZDJ A;  4RYE A;  4E3O A;  1XGJ A;  1KE3 A;  2Y2G A;  2ZC3 B;  3WWX A;  3UY6 A;  3WRT A;  2ZQA A;  1KGG A;  3GQZ A;  4KQR A;  4GD6 A;  3FZC A;  1MWR A;  1JTG A;  3ZHH A;  3OPH A;  5A93 A;  4UAA A;  2FFF B;  3ITB A;  4QU3 A;  3IF6 B;  3M6B A;  4RA7 A;  5GLD A;  5CER A;  4RX2 A;  3MXS A;  3UPO A;  3AGD A;  1TVF A;  5CGS A;  3BFF A;  3IH8 A;  2Y59 A;  3PTE A;  1S6R A;  3OPR A;  5E2F A;  3VP2 A;  4PM5 A;  4B4X A;  4LV2 A;  1GA9 A;  1WE4 A;  1CEF A;  1E3U A;  4P6B A;  1W8Q A;  4S2O A;  5L2F A;  1PWC A;  1QME A;  3PBQ A;  2OLV A;  3ZCZ A;  3V3R A;  3IQA A;  3N8L A;  3MKE A;  4RVA A;  5GHZ A;  3BM6 A;  1PI4 A;  3E2K A;  1KDW A;  3N4I A;  3FV7 A;  5E2H A;  2V20 A;  4WBG A;  3VOY A;  4C6Y A;  3SH7 A;  1YLT A;  1Z6F A;  2WGW A;  3S22 A;  3UDF A;  3N7W A;  1CEG A;  5KMW A;  1H5X A;  4QY5 A;  3ZGA B;  3ZG5 A;  1ESI A;  1YT4 A;  4N1X A;  2WYX A;  3IXH A;  5EOE A;  4ZDX A;  3JYI A;  3IXD A;  4ZJ3 A;  2WGW B;  3O3V A;  3OPL A;  4BD1 A;  1K4E A;  3UO9 A;  4OOL A;  3IXG A;  3A3D A;  4R4S A;  4FH2 A;  2J9O A;  1C3B A;  5EOO A;  5A92 A;  1XX2 A;  4OLD A;  5CHM A;  3BLS A;  3HUM A;  3IHA A;  5EPH A;  4E3I A;  3WRZ A;  3HUN A;  3N6I A;  3Q1F A;  3Q81 A;  2JC7 A;  2ZM0 A;  3NBL A;  1XKZ A;  3ZG7 B;  1O07 A;  4BL2 A;  5HFO A;  2JE5 A;  4OP5 A;  2EX6 A;  2EFU A;  4R23 A;  2Y2K A;  4PMA A;  3G35 A;  4WEJ A;  3OC2 A;  3Q7V A;  4LV3 A;  4ZAM A;  5CTN A;  3O86 A;  1GA0 A;  5CHJ A;  3TG9 A;  4UHU A;  4ID4 A;  4R1G A;  4R3B A;  2X71 A;  3EQU A;  5HAQ A;  1K4F A;  1XPB A;  4KZ8 A;  3WS4 A;  1IEM A;  5AQ9 A;  4GB7 A;  1PW1 A;  2Y2N A;  1LHY A;  5GLB A;  3DWK A;  2ZC7 A;  3G4P A;  5AQA A;  2A3U A;  1FQG A;  4FH4 A;  4KQQ A;  3W4P A;  3RJU A;  1CI8 A;  4WYY A;  3GV9 A;  1CK3 A;  2ZQD A;  4X53 A;  1GHP A;  4GN2 A;  2ZMA A;  1XP4 A;  1SHV A;  1W79 A;  1W5D A;  5E2E A;  2WKE A;  4U0X A;  3NI9 A;  2I72 A;  4ZJ1 A;  4QB8 A;  4LV0 A;  5FI2 A;  5HAP A;  4QHC A;  1MY8 A;  5JYP A;  3BEC A;  4K91 A;  2HPB A;  3MZD A;  1ZG6 A;  4X6T A;  1YLP A;  4DDS A;  4OVD A;  5EVI C;  5AQ7 A;  3VSK A;  4A5R A;  1BSG A;  2XLN A;  4WM9 A;  5BOH A;  1EWZ A;  4S2I A;  3WS1 A;  1FCN A;  4OLG A;  4BQM A;  4BL3 A;  1JTD A;  2C6W B;  1ZKJ A;  1ES4 A;  2HP5 A;  2HDR A;  4EUZ A;  3G2Z A;  2P74 A;  5I94 A;  2A49 A;  5D3O A;  1YQS A;  1K54 C;  3UPN A;  4OQI A;  4S2P A;  3CG5 A;  2XK1 A;  4JBF A;  5CRF A;  5EE8 A;  2WKH A;  1XA1 A;  4NET A;  4DF6 A;  4KQO A;  1K56 D;  2B5R A;  5FQM A;  1FOF A;  2PBY A;  4F94 A;  4BEN A;  4MNR A;  2Z2M B;  3NCK A;  1ESU A;  5FQQ A;  4MBK A;  2QMI A;  5CED A;  4KZ6 A;  3A3I A;  3O87 A;  3C4O A;  3FKW A;  1K56 A;  3HLG A;  3IF5 A;  1EI5 A;  2IWC A;  3MZF A;  1YLZ A;  2Y2J A;  4FD8 A;  3RXX A;  4FCF A;  1PWG A;  1IYP A;  1BUL A;  1K38 A;  3GVB A;  3C5A A;  3ZFZ A;  5M1A A;  1H8Y A;  3IF6 A;  4JF4 A;  3BYD A;  5FAP A;  5M18 A;  2H10 A;  3ZNT A;  2R9W A;  4DXB A;  2Y2O A;  2JCH A;  3SS4 A;  1XXM A;  5EVI A;  1IYS A;  3HLW A;  3HLB A;  3SH8 A;  1E3U D;  2ZC5 B;  1K55 C;  4E3L A;  1M6K A;  2V2F F;  4GD8 A;  4JXW A;  1FSW A;  3G31 A;  5EVI B;  2OSU A;  1NJ4 A;  3VMA A;  3I7J A;  3DW0 A;  3PBR A;  1H8Z A;  5DF7 A;  1IKI A;  2DCF A;  1ES3 A;  2E8I A;  5U47 A;  5HX9 A;  3FYZ A;  3IWI A;  1GHI A;  2G2W A;  3W8K A;  3PBN A;  3TSG A;  3CJM A;  1YMX A;  4LV1 A;  1YM1 A;  2EX2 A;  3HLC A;  5CGX A;  3OPP A;  1BLS A;  3LEZ A;  1ERO A;  5JYO A;  3BFC A;  5F1G A;  3IWQ A;  4S2N C;  1L0D A;  1PI5 A;  4ZTK A;  2Y2P A;  1E4D A;  2WKI A;  3PAG A;  4ZBE A;  1TDG A;  2EX8 A;  5TR7 A;  3S4X A;  4IED A;  5CTM A;  4X55 A;  4CPK A;  2Q9M A;  4R4R A;  5E43 A;  3BLM A;  3CZD A;  3VFH A;  2OV5 A;  1SDE A;  2QPN A;  3HL9 A;  4HES A;  4WEK A;  4KG2 A;  3V3S A;  5A90 A;  1K6R A;  3VP1 A;  1LL9 A;  4JLF A;  3OCL A;  1L0G A;  5KSC A;  3NDE A;  1MBL A;  4UA7 A;  3VFF A;  5DTT A;  2Y2L A;  1M40 A;  4OOY A;  1O7E A;  4HBU A;  4KZB A;  5HAI A;  1I5Q A;  4DRT A;  2XGN A;  5HW3 A;  5FI6 A;  3HUO A;  4B4Z A;  4KG5 A;  3HVF A;  1MWT A;  1K55 A;  2WZX A;  5CEB A;  1YLJ A;  3HLF A;  3VP3 A;  4X56 A;  4GOG A;  1L2S A;  1K6S A;  4S2K A;  3WS2 A;  3UDX A;  1ZC2 A;  4H8R A;  4K0W A;  1U60 A;  4R0Q A;  1KGF A;  2ZLY A;  1IKG A;  1G68 A;  4QJG A;  4M3K A;  2ZM2 A;  4WZ4 A;  2QZ6 A;  4NK3 A;  1IEL A;  1FCM A;  2XH9 A;  4Y7P A;  5G18 A;  3MBZ A;  2ZQ8 A;  3P98 A;  3TOI A;  2R9X A;  3UNW A;  4S2N A;  3Q82 A;  2ZJ9 A;  1ES2 A;  1NYY A;  3BFE A;  5TFQ A;  3UE1 A;  4EBN A;  4FSF A;  3A3F A;  3ZG8 B;  4E3J A;  2WGV A;  2ZQ9 A;  3Q07 A;  1BUE A;  2Y91 A;  1S0W A;  1ERQ A;  4OQG A;  1I2S A;  2DRW A;  4OON A;  3G34 A;  4JF5 A;  2Y2Q A;  4MEZ A;  4DE0 A;  3NC8 A;  1OME A;  1SCW A;  2WAE A;  5FDH A;  3GTC A;  4X68 A;  1SDN A;  5IHV A;  4OPQ A;  5FSR A;  1SKF A;  4O7D A;  3ISG A;  4BJP A;  1J9M A;  3GRJ A;  4E3N A;  1LL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...