4OH0A

Crystal structure of oxa-58 carbapenemase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
243
structure length
242
Chain Sequence
SIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFIANALIGLENHKATSTEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSGWGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase OXA-58
publication title Crystal Structure of Carbapenemase OXA-58 from Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 72
structure length 242
sequence length 243
ec nomenclature
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oh0A00
3UDIA 3G34A 3GVBA 2HPBA 3ZGAB 1SDEA 4D2OA 5EOOA 4KQRA 2Y2GA 5KZHA 1FCOA 1K56A 2XD5A 3ZNYA 1IYPA 1ES3A 1YM1A 3VP1A 3V5MA 1M6KA 3M6HA 2R9XA 2ZLYA 1ESIA 1L0EA 5GLCA 5FQQA 1NZOA 2OLVA 2V20A 4HESA 3IH8A 5HAPA 3FWLA 5A90A 5DVAA 4RX2A 3CZDA 1WE4A 3A3FA 3IF6B 4QY5A 1DY6A 4MEZA 4WZ5C 4JXGA 5FA7A 2JE5A 4ZDXA 3WS1A 4GB7A 5FATA 4Y0TA 1BLSA 2Y2HA 5CEDA 2ZQAA 2WGVA 1NYMA 5DTKA 4EBNA 3TG9A 2BLSA 4WZ4A 3HLBA 4RA7A 2Y59A 4CJNA 1O7EA 1HZOA 3B3XA 4Y0UA 1ES4A 4WYYA 4IVIA 5JYOA 2WAFA 3QHYA 4C6YA 1Z6FA 1LI9A 1PYYA 2Y2PA 4P6BA 3G35A 4OOLA 4FH4A 5DF8A 2J8YA 4N1HA 3V3RA 2P74A 4LV3A 4R1GA 4DDYA 3HLCA 3ZG0A 5DTTA 4QHCA 1GCEA 3UPOA 2H10A 2H5SA 3I7JA 3ZVWA 5DTSA 1XGJA 2ZC5B 4R3JA 4WBGA 1W5DA 4CPKA 1WYCA 5CHUA 4BENA 1I2SA 3MXRA 2J9PA 4HBTA 3PBOA 3S4XA 5AQ7A 3UN7A 3G32A 5GHXA 1JTGA 1RCJA 5J8XA 4OLDA 1NY0A 2RCXA 1I2WA 4X68A 1ZG4A 5FDHA 1KE0A 1M40A 3SS3A 4KZ7A 4S2NA 3M2JA 4KG2A 1XKZA 2VGJA 5HL1A 1BLCA 3N6IA 3W4QA 5AQ9A 5F1GA 5TFQA 1ZKJA 1CI8A 3NBLA 4X56A 2ZC6B 5EVIC 3S1YA 3UDXA 1XX2A 3GSGA 2WKIA 4OQGA 3BRMA 2V1ZA 4DKIA 1IELA 4DDSA 5GHYA 2XH9A 3P09A 3ZDJA 5CHJA 4IEDA 3HLDA 4E3OA 2Q9MA 1KE3A 1N9BA 3QNBA 4K91A 5FAOA 1MBLA 1FR1A 5CGSA 1CI9A 3OPLA 2Y2OA 4L0LA 4GZBA 1K4EA 4OPZA 3WRZA 1RGYA 3VP0A 5HARA 1EWZA 3G4PA 4KZBA 5EOEA 4BD1A 1O07A 3HLEA 4R4SA 4ZJ1A 2WZXA 1E3UA 3IXDA 4PPRA 4NK3A 4WMCA 5JYPA 1GHIA 3IXHA 1S6RA 3BFEA 1NZUA 3C4PA 2Z2LB 3UNWA 2RL3A 2EXAA 3SS4A 1YLWA 5HAIA 2OLUA 2WGWA 1BLPA 5GLBA 4IBXA 3WRTA 4BJPA 3VFFA 3ZG8B 5A93A 5HW3A 4OQ0A 3W4OA 2E8IA 1K54C 3GQZA 1J9MA 3IT9A 1BLHA 1K38A 2JBFA 3N8SA 3OCLA 4MBHA 5BOHA 1JVJA 2EX8A 4RVAA 4OPYA 5FAPA 3WWXA 3A3IA 4BL3A 3OC2A 3Q81A 3BFDA 3QNCA 1W79A 1YLPA 3LCEA 4JXSA 3MKEA 3Q7ZA 1E4DA 1ES2A 1MWRA 4QJGA 4DXBA 1YQSA 1K57A 3N8LA 3GR2A 4K0XA 2WKHA 5HX9A 1PWDA 2WAEA 3IF6C 2P9VA 1LL5A 3PBQA 4DF6A 5EE8A 1MXOA 1YLJA 1L0FA 2JC7A 5FQJA 2HDQA 1GA0A 3RXXA 1MY8A 1DJCA 2V2FF 3VOZA 4JPMA 5CTNA 3G30A 1RP5A 2WGWB 4E3KA 1OMEA 1K55A 3LY3A 3UY6A 1ESUA 1L2SA 2HDRA 1K4FA 4DE3A 2BG1A 4KZ3A 3BEBA 1CK3A 3PBRA 3GTCA 1PI4A 4OPQA 1GA9A 1IYQA 1BT5A 1KDWA 4MLLA 5GLDA 2X01A 1MKIA 3Q1FA 3AGEA 3Q07A 4JF4A 3UE3A 4JXVA 5HFOA 3ZNTA 3Q7VB 5KMWA 3ZVTA 5CGXA 3VMAA 1JWZA 1VQQA 2B5RA 4GD6A 1YLTA 3BM6A 5GLAA 4PM9A 3CMZA 2Z2MB 4GDNA 4X69A 4B88A 1G68A 1NXYA 1W8YA 1IEMA 3AGDA 3IH9A 1JWPA 4JXWA 4M3KA 1XGIA 1KGEA 4JKTA 3FYZA 4MBKA 1N4OA 3GMWA 4U0TA 2XEPA 4UA6A 2G2UA 3VOYA 2UWXA 2C5WB 4N9KA 2ZQ7A 1PWCA 3AGFA 2J7VA 4OOYA 3UE1A 1FOFA 3UPNA 5A92A 5F1FA 5FI2A 2DCFA 2WUQA 2XF3A 5AQBA 2H0TA 2VGKA 2OSUA 5GL9A 5U47A 1BTLA 4FSFA 3E2LA 5CECA 1YT4A 4Q8IA 4N9LA 4EQIA 5FASA 3MBZA 1NRFA 4PM8A 3N4IA 4UHUA 4DRTA 4P87A 2DNSA 4PM5A 2XR0A 1PW1A 2XQZA 2PBYA 1KE4A 4OPRA 3NY4A 4GOGA 2R9WA 3ZFZA 3C4OA 4BD0A 4BL2A 1XPBA 5E2GA 4DE1A 3V3SA 3GV9A 1YMXA 3VSLA 4DE2A 2WKEA 2ZC4B 3ITAA 2G2WA 4R23A 3NCKA 1ONGA 5AQAA 2WZZA 1ES5A 1K6SA 1ERQA 3LY4A 5DF9A 1BULA 4NETA 4S2NC 4F94A 3MKFA 1H8ZA 3HREA 4ZJ2A 3ZCZA 3FZCA 1GHPA 3OPPA 3IQAA 4Y0OA 2Y2KA 3O3VA 4E6XA 1S0WA 3UDFA 1ERMA 1YLZA 4S2LA 4Z9QA 2HDUA 5EVID 5G18A 3VP4A 5E2EA 1XA7A 2XDMA 1PWGA 3DWZA 2WADA 3NC8A 3NDGA 1TDGA 1KVMA 4RX3A 2Y2JA 4WELA 1KDSA 3HUMA 2ZM0A 4KZAA 4YINA 4OKPA 1AXBA 3HBRA 4HBUA 4EWFA 3IHAA 4KQOA 3SOIA 3EQVA 4KZ5A 1FCMA 3MZEA 3A3EA 4OOMA 1FSYA 4DXCA 3BECA 5FI7A 4FH2A 2EFXA 1TEMA 5D3OA 1W7FA 1RGZA 3NIAA 4UAAA 5CEBA 4R0QA 4PM7A 4UA7A 3VP2A 2IWDA 2FFFB 5IHVA 5FSRA 4XXRA 5EECA 2ZC3B 1YLYA 1I5QA 3BFFA 4X55A 4S2PA 4Y7PA 2CC1A 4X53A 3CG5A 4GNUA 4KG5A 3G2YA 4E6WA 5FQMA 3FV7A 3WS4A 4A5RA 4E3JA 3ISGA 3N8RA 3PTEA 4B4ZA 4E3LA 4JBFA 2XGNA 4MNRA 1CEGA 3E2KA 3P98A 1C3BA 3G2ZA 1LL9A 4LCLA 3W4PA 3PBTA 3IWOA 4GDBA 4KENB 1IYSA 2Y91A 4OQIA 1MWSA 1GHMA 3MZDA 2IWCA 3UPPA 4YFMA 4ZAMA 5E43A 3BYDA 1K57C 3PAEA 3GRJA 1SKFA 2EX2A 4B4XA 1ALQA 1WYBA 1FSWA 3O88A 3PBNA 4S2IA 5KSHA 4GD8A 5CRFA 3CJMA 3OPRA 2A49A 3G31A 3HLGA 4QY6A 3MFDA 4OH0A 3OCNA 4JF5A 2XD1A 1K55C 2ZQCA 2XFTA 4LV1A 4KZ6A 1K25A 2HDSA 3IXGA 2HP5A 1ONHA 1K56D 4LV0A 1EI5A 1BUEA 4H8RA 4LCMA 1DJAA 5I94A 1XP4A 4P0MA 2P9VB 4X6TA 3IXBA 2ZQ9A 4XUZA 4R4RA 1XXMA 3BFGA 4WZ5A 4LV2A 3UE0A 4UA9A 5CHMA 3V39A 2XK1A 4KZ9A 4FCFA 2Y2IA 3PAGA 4KZ8A 4P85A 3RXWA 3DWKA 3SH8A 2ZQ8A 1ZC2A 1SHVA 3ITBA 4OP5A 3HLFA 4JLFA 4OONA 3BLSA 2EFUA 5FQIA 3ZHHA 1VM1A 1G6AA 3HVFA 3OPHA 1H5XA 1BSGA 5E2HA 3TSGA 4EV4A 1MWUA 3C7UA 3OZHA 3LEZA 5TR7A 3IHBA 2ZQDA 2I72A 1H8YA 1LHYA 3HLWA 1MWTA 3Q82A 3BLMA 1NJ4A 5EVLA 2EXBA 5F83A 1HD8A 3NI9A 4QD4A 3VP3A 1YMSA 2C6WB 4N92A 4PMAA 3C7VA 3D4FA 3SH9A 2Q9NA 4R3BA 2QZ6A 3WS5A 1TVFA 3V50A 2HP9A 4QB8A 5M19A 2DRWA 4N1XA 1Q2PA 2WGIA 1PIOA 2FFYA 2PU4A 2EX6A 4O7DA 3UO9A 1NYYA 4KZ4A 2GDNA 2QPNA 4S2OA 1QMFA 1HTZA 1FR6A 1SDNA 2OV5A 4QU3A 3S22A 4EBPA 1FCNA 1L0DA 2XLNA 2ZMAA 5DF7A 3EQUA 3PBSA 2H0YA 4ID4A 4E3IA 5EPHA 1TDLA 4IBRA 3N7WA 2HP6A 4OLGA 2A3UA 1LLBA 3HL9A 3BFCA 4S2MA 2Y2LA 2ZJ9A 5L2FA 1K6RA 3ZG5A 5EVIA 1E25A 2Y2MA 2ZM8A 4IVKA 3W8KA 4ZBEA 1ZG6A 4C75A 1CEFA 5CXWA 4GN2A 3HUNA 3M6BA 3SS5A 3ZG7B 1JTDA 3A3JA 1BZAA 3IWQA 2WK0A 4PM6A 1IYOA 2X71A 3LO7A 3MXSA 2JCHA 5CTMA 2QMIA 5F82A 3IWIA 2ZC7A 4FD8A 3M2KA 2X02A 1PZOA 1Y54A 1IKGA 2J9OA 4EBLA 4E3NA 1Q2QA 1W8QA 4WEKA 4OVDA 3NDEA 4ZTKA 5EUAA 1U60A 5HAQA 2Y4AA 3TOIA 5FI6A 1PW8A 1PZPA 4GKUA 5FQKA 1E3UD 5EVIB 4C3QA 4E3MA 4WMCD 3VFHA 4OQHA 1MPLA 2Y55A 5GHZA 5A91A 1QMEA 5M1AA 1LI0A 4WEJA 3DW0A 1DJBA 4S2KA 1K54A 3ZG9B 1EROA 4KG6A 3FKWA 2ZD8A 4BQMA 2EX9A 4S2JA 4U0XA 2WYXA 2Y2QA 3DTMA 3MZFA 5E2FA 5TGFA 4EUZA 1KVLA 4ZJ3A 4K0WA 4XUXA 2IWBA 1SCWA 1KGGA 3JYIA 3C5AA 3O87A 5CGWA 3RJUA 3IF5A 3O86A 3HUOA 5KSCA 5CERA 3WS2A 3WS0A 3Q7VA 4RYEA 2Y2NA 4JF6A 4KQQA 4U3TA 1JWVA 2ZM2A 4HEFA 4OP8A 2PU2A 1FQGA 3IF6A 4LENA 4BLMA 4DE0A 2XFSA 1KGFA 1L0GA 5FAQA 3FKVA 5FQ9A 3SH7A 1XA1A 1IKIA 1HVBA 4MBFA 5M18A 1PI5A 3VSKA 3A3DA 4WM9A
chains in the Genus database with same CATH superfamily
3UDIA 3G34A 3LIAA 2ZL1A 1SDEA 2Y2GA 3MQOA 1K56A 4X1LA 4HOIA 2PDRA 4NXBA 3V5MA 1M6KA 2R9XA 1L0EA 5GLCA 5FQQA 3FWLA 5A90A 5HDDA 3K3DA 1WE4A 5HDCA 1VETB 1OPXA 5FATA 1LSXA 1NYMA 4E04A 3HLBA 2M7UA 2PRFA 1ES4A 2WAFA 1Z6FA 1DP9A 1LI9A 4P6BA 2W3GA 4QHCA 4Y5FA 3LEQA 1XGJA 4R3JA 5DTSA 1SZVA 2Z6CA 4NG2A 3PBOA 2K2NA 2B18A 2XRNA 4OLDA 1NY0A 4X68A 1KE0A 3SS3A 5G4ZA 4S2NA 5F1GA 3C38A 4X56A 5EVIC 1XFQA 1D1JA 3ZDJA 4IEDA 1PFLA 1MBLA 1CI9A 1TS6A 4L0LA 2BASA 1K4EA 4OPZA 5HARA 4YOFA 1FILA 1E3UA 3IXDA 3E98A 3IXHA 1S6RA 1NRJA 4R6LA 4UEYA 2Z2LB 5HAIA 2OLUA 1IFQA 5EM1A 3GQZA 2JBFA 3N8SA 5BOHA 3KX0X 1JVJA 5FAPA 4BL3A 1N9NA 1W79A 4BMWA 4LFUA 3MKEA 1PRQA 5J3WA 3LIFA 4K0XA 1PWDA 2J3TD 4P6ZM 2P9VA 1LL5A 1MZUA 4IUHA 3VOZA 1BYWA 1JNUA 3T4JA 1F98A 4KZ3A 1CK3A 3GTCA 1GA9A 1IYQA 1BT5A 1KDWA 4MLLA 4JF4A 4BBTA 4JXVA 5HFOA 3Q7VB 5KMWA 2W3FA 3ZVTA 5CGXA 3F1NB 5GLAA 3CMZA 4B88A 4DN0A 4IJGA 5EV0A 3LI9A 4JXWA 4M3KA 2LB5A 1YSQA 1PWCA 4OOYA 2J7VA 1V9YA 2LB9A 2DCFA 3T1QB 2WUQA 2H0TA 3E2LA 3UB7A 5CECA 4EQIA 4PM8A 2V9AA 3LUQA 3N4IA 3NHQA 4P87A 1Z09A 4PM5A 1PW1A 2PBYA 4IUKA 1G28A 3NY4A 3ZFZA 3C4OA 1XPBA 5E2GA 3V3SA 1YMXA 4DE2A 1N9LA 2WKEA 3C2WA 3ITAA 2L0WA 4R23A 5IS1A 4GJ4A 1K6SA 1ERQA 4F3LB 3HREA 4Y0OA 4E6XA 1XA7A 3NC8A 1KVMA 4RX3A 2Y2JA 4WELA 4KZAA 1F5MA 5AVEA 1TF1A 4PAUA 4ETXA 3F1OB 3IHAA 1OTAA 3SOIA 1T1BA 3MZEA 4OOMA 4DXCA 4FH2A 5D3OA 3H7WB 1W7FA 3KYQA 3VP2A 3LR0A 2FFFB 4S2PA 4X53A 3EEHA 4E6WA 4A5RA 3N8RA 3PTEA 3HJKA 1F2KA 3MSHA 4X25A 1W63Q 1LL9A 3D3OA 4GDBA 1MWSA 3E4PA 2EX2A 1ALQA 3LR3A 2ZBBA 4S2IA 2VX8A 3IBRA 2ZQCA 2HDSA 2HP5A 3IS2A 1ONHA 5HPIA 1EI5A 1BUEA 4LCMA 2QWSA 1XP4A 4X6TA 1XXMA 3BFGA 4LV2A 5CHMA 4KZ9A 3PAGA 3RXWA 3ITBA 4OP5A 1WA9A 4WF0A 3ZHHA 2EFUA 5FQIA 4G3VA 3C7UA 5EFWA 3IHBA 1LHYA 3Q82A 5F83A 1MWTA 3O5YA 3BLMA 5L10A 3DTEA 3LFVA 2HP9A 2M1CA 5M19A 2EX6A 2VV6A 3R4KA 2JKFA 4S2OA 1QMFA 2JKRI 1HTZA 1SDNA 2OV5A 3S22A 2WKPA 1FCNA 4X1MA 1FIKA 4I38A 4ID4A 4E3IA 1T1AA 2VLGA 3OOVA 2PR5A 5L2FA 3W8KA 4C75A 4GN2A 3HUNA 3M6BA 3MJQA 2L4RA 4PM6A 2WK0A 1IYOA 3K3CA 3LO7A 3MXSA 5AVFA 2JCHA 2QMIA 2UV0E 2ZC7A 5DJTA 3MQQA 3TRCA 1T1CA 2J9OA 4OVDA 4ZTKA 2W3DA 4I3AA 2Y4AA 1KOUA 1PW8A 3ZQ5A 1PZPA 5TBMA 5EVIB 4C3QA 3NOPC 3CUEC 1MPLA 3ZG9B 4S2JA 1VHMA 2WYXA 2Y2QA 5HWTA 4GLQA 1ZHHB 2VGLS 1KGGA 3O87A 3IF5A 4PKYG 2V8FA 4KQDA 2A2LA 4ARZB 3Q7VA 4KQQA 4EU0A 2PU2A 1FQGA 5I5LA 4LENA 2W1RA 1KGFA 5FQ9A 3SH7A 1HVBA 5M18A 1PI5A 3VSKA 3ZGAB 4ESPA 3ZNYA 1ES3A 4EEUA 4EESA 4G3WA 5J4EA 1ESIA 5L07A 3S7OA 5HAPA 3FG8A 1S4RA 1DY6A 4JXGA 5FA7A 2JE5A 4GB7A 4Y0TA 1SKOB 5CEDA 5DTKA 2QJ5A 1F9IA 4PKYA 2XA7S 1O7EA 1HZOA 3MS6A 1TD5A 4WYYA 4IVIA 5JYOA 3SW1A 3QHYA 4EEPA 1PYYA 2Y2PA 3G35A 4FH4A 3KO6A 4LV3A 4R1GA 4DDYA 3QP4A 5DTTA 2W27A 2W1TB 3I7JA 4ETZA 1WYCA 5L8MA 4MCWA 3MXRA 3LR4A 4IHQA 1ZG4A 3F1OA 3M2JA 1XKZA 3TW8A 3W4QA 1ODVA 4HH2A 4I3JA 2GX5A 2ZC6B 2KX6A 3H7WA 3S1YA 1XX2A 2WKIA 3E4OA 2V1ZA 2B95A 4DKIA 5CHJA 2Q9MA 5CGSA 4YWZA 3QP2A 1IOUA 4GZBA 4WUJA 1O07A 3D9YA 3EGXC 4R4SA 1DRMA 4WMCA 5JYPA 1GHIA 4LGWA 1VEUB 3U4LP 3C4PA 2RL3A 1BLPA 4BJPA 3P01A 3VFFA 3IX3A 5A93A 3W4OA 1K54C 2QYBA 3T1SA 1DP8A 3KSIA 3IT9A 2HJ9C 2J80A 2PAVP 3Q81A 3BFDA 3QNCA 4JXSA 1YLPA 1MWRA 1K57A 4L9GA 5HX9A 2WAEA 1X0OA 3IF6C 3PBQA 2VV7A 5EE8A 2JC7A 5HWVA 2HDQA 1GA0A 3NJAA 1MY8A 4JGQA 3G30A 1RP5A 2WGWB 1XJ3A 3NECA 1K55A 3MXQA 2HDRA 4DE3A 2W3EA 3BEBA 1PI4A 1UWPX 2X01A 3VMAA 1JWZA 2B5RA 4R3AA 1YLTA 1CF0A 1G68A 1NXYA 3AGDA 1P9WA 1XGIA 4MBKA 2ZMFA 2AVXA 5MC7A 2G2UA 3T4KA 2UWXA 5FEFA 2C5WB 4N9KA 2JN7A 1FOFA 2OSUA 5GL9A 1GSXA 1S4SA 1YT4A 2MJ6A 5FASA 3KSHA 3MBZA 4DRTA 2XR0A 3S7PA 4GOGA 4BD0A 4BL2A 4DE1A 2NUTC 3VSLA 3C8CA 4Y15A 1TS0A 1ONGA 5AQAA 2K31A 2WZZA 1BULA 4S2NC 3MKFA 4ZJ2A 2JKRM 3FZCA 3IQAA 3H9WA 4Y2FA 4HNBA 1S0WA 5FDSA 1YLZA 4S2LA 3CHWP 2HDUA 3EOIA 5EVID 3VP4A 1PWGA 3DWZA 2WADA 4XT2B 2ZM0A 4OKPA 1AXBA 3CAXA 4HBUA 4EWFA 4ME4A 1STZA 1FCMA 1GSWA 3BECA 4MN7A 4UAAA 5CEBA 4R0QA 2IWDA 2A24A 1YLYA 1I5QA 3BFFA 4X55A 4WLAA 4CLCE 2CC1A 3CG5A 4KG5A 3G2YA 5FQMA 3FV7A 4HP4A 4E3JA 4JBFA 2XGNA 3E2KA 3S7NA 4KENB 3IWOA 2Y91A 4OQIA 2D02A 4UQIS 4YFMA 4ZAMA 5E43A 2PYPA 4B4XA 1SKFA 3QP1A 2O9BA 1WYBA 3O88A 3PBNA 5CRFA 1S1ZA 3G31A 4D60A 4QY6A 3MFDA 3MMHA 1K0KA 4OH0A 1ACFA 3CI6A 4KZ6A 1K25A 3IXGA 5IT5A 4R4RA 4WZ5A 4G3KA 4JGPA 4Q0IA 3V39A 2XK1A 4HJ4A 4P85A 3UB5P 3BLSA 3L7HA 5E2HA 4Q0JA 5EVLA 1HD8A 4N92A 3SH9A 4R3BA 2QZ6A 3D72A 3WS5A 3IBJA 2OOLA 1OT6A 1D7EA 1Q2PA 2WGIA 4O7DA 5F69A 2GDNA 1AWIA 3MR0A 4HQAA 5J7EA 4QU3A 1L0DA 5DF7A 3EQUA 3BQAA 2H0YA 5EPHA 2A3UA 1LLBA 3HL9A 4JGOA 3BFCA 2ZJ9A 3KSGA 2ACGA 3KYEA 4ZBEA 1VEUA 1TS8A 2EWVA 3SS5A 3A3JA 2JKTI 5CTMA 3T12B 2Y79A 1PZOA 4EBLA 3TE8A 1XJ2A 3PHYA 4K08A 1D06A 2L1MA 1H3QA 2W3HA 4E3MA 4OQHA 5GHZA 1QMEA 5M1AA 1LI0A 3T4SA 4EERA 4EUZA 3CLOA 4ZJ3A 4XUXA 2IWBA 3RJUA 2ZMVA 5CERA 5L09A 2B02A 4B9OA 4RYEA 4U3TA 4HIAA 4HEFA 1OTBA 4GHIB 1VETA 4BLMA 1L0GA 5FAQA 2VA0A 3FKVA 1XA1A 3GVBA 3JPUA 4D2OA 3RH8B 5KZHA 1FCOA 2R78A 3VP1A 3M6HA 2HZ5A 2QJ7A 2V0WA 1NZOA 4H6JB 4HESA 3IH8A 5DVAA 3T4TA 3A3FA 4GS9B 3IF6B 4QY5A 4MEZA 3S7QA 3EEAA 3CPTB 4AFIA 5FL3A 3NOUC 4ZDXA 4R70A 3WS1A 1YAXA 1V9ZA 2Y2HA 2ZQAA 3QP6A 4EBNA 3TG9A 2BLSA 2BTFP 4WZ4A 2ZL1B 4RA7A 3T1RA 3W2ZA 3LYXA 4Y0UA 5HDSA 2ZOIA 4FUWA 4WL9A 4OOLA 3HLCA 3UPOA 1GCEA 2H10A 2ZC5B 4LRYC 1YKDA 4WBGA 1W5DA 2PD8A 4CPKA 4NKPA 4BENA 1I2SA 4HBTA 2KLIA 3S4XA 3HCYA 3UN7A 3G32A 2JHEA 3IX4A 5GHXA 5DKLA 5FDHA 1I2WA 4DMZA 4KZ7A 4GW9A 2VGJA 5HL1A 1BLCA 3N6IA 1W63M 1ZKJA 3NBLA 3GSGA 4OQGA 3PXPA 2XH9A 3HLDA 3T4OA 1N9BA 3QNBA 4K91A 3JVUA 3OPLA 3WRZA 2OWJA 4O01A 3A0SA 4KZBA 4LRXC 3HLEA 3PR6A 3MF0A 4Y3IA 2FH5A 3UNWA 3SS4A 4LPZA 3U2AA 3WRTA 3ZG8B 3CUEA 3UMEA 1BLHA 3OCLA 2V1BA 2EX8A 1OT9A 3RFBA 3F1NA 4RVAA 3H82B 5IU1A 5HPFA 2IA2A 4HJ6A 3RXXA 1DJCA 2V2FF 2PYRA 4E3KA 3UY6A 1L2SA 1K4FA 2BG1A 4OPQA 5DKKA 3PBRA 1MKIA 3Q1FA 3UE3A 2Z6DA 4JGRA 3ZNTA 1H8MA 3B47A 3LIBA 4II7A 3BM6A 4PM9A 3FYZA 4U0TA 2XEPA 3VOYA 1OTIA 3AGFA 5TJJA 4F3LA 3P7NA 5F1FA 2V0UA 2XF3A 3VE3A 4FSFA 4Q8IA 3KYZA 3SZTA 2XROA 2V8CA 4I39A 3E4QA 4OPRA 1HLUP 3GV9A 2EWWA 4MDZA 2WKRA 2VGLM 2VV8A 2G2WA 1J3WA 3T1XA 4HJ3A 3NCKA 1G6OA 2O0YA 4MN5A 3LY4A 5DF9A 3T50A 1H8ZA 3ZCZA 4Y13A 2Y2KA 4EETB 2PR6A 3UDFA 1ERMA 5G18A 5E2EA 2XDMA 2O9AA 3ULFA 1TDGA 2KDKA 4CLCC 1KDSA 5KIZA 3HUMA 1G5UA 2JKTM 4CLCD 1OTDA 4KZ5A 4B93A 4KUKA 1FSYA 1TEMA 1RGZA 3NIAA 2P7JA 3LI8A 3LR5A 1XJ6A 5CX7A 4PM7A 3OLOA 2ZC3B 5HZHA 5HL6A 5DFYA 2XA7M 2I9VA 1YSPA 4B4ZA 4EW7A 1GSVA 4MNRA 1C3BA 3G2ZA 3DTKA 4LCLA 3W4PA 1IYSA 3MZDA 3UPPA 3BYDA 1K57C 3PAEA 3GRJA 3G6OA 1FSWA 4GD8A 3BY8A 3OPRA 3CPTA 2NUPC 2XD1A 1K55C 2XFTA 4LV1A 2O99A 4LV0A 1K56D 3IX8A 1DJAA 2KOIA 4P0MA 1XJ4A 3IXBA 2ZQ9A 4XUZA 4UA9A 4FCFA 2Y2IA 4R38A 2VEAA 3HLFA 1LL8A 4JLFA 1T19A 1G6AA 2VKSA 1H5XA 1BSGA 2HJEA 3OZHA 1OJ5A 3BJNA 2ZQDA 2I72A 1H8YA 3HLWA 1NJ4A 2EXBA 1YMSA 3IS2B 4PMAA 2W0NA 3C7VA 2Q9NA 1S66L 1TVFA 3UB8A 3LGOA 4P6ZS 4QB8A 2DRWA 1P0ZA 1PIOA 2FFYA 2Y8HA 3GDIA 2PU4A 4L9FA 3UO9A 1NYYA 3FPVA 4FOFA 2OWHA 1FR6A 4EBPA 2XLNA 2ZMAA 3PBSA 1TDLA 4IBRA 3N7WA 3BY9A 4S2MA 5EVIA 1E25A 2Y2MA 2ZM8A 1ZG6A 1CEFA 5CXWA 4HI4A 2HGVA 3ZG7B 1JTDA 1BZAA 2X71A 3A0VA 4QPRA 3NOTC 1TS7A 4FD8A 4NEED 3T4LA 2X02A 1S67L 1Y54A 4ARZA 1IKGA 1P97A 2JKGA 1Q2QA 2EA9A 5AJGA 3RTYA 1PNEA 4RQ9A 1A0KA 1MKMA 3V67A 5FQKA 1E3UD 3H82A 2Y55A 2E8JA 2CMNA 4FTXA 5A91A 3DW0A 4S2KA 4KG6A 3FKWA 3FC7A 4BQMA 4U0XA 5E2FA 4YNRA 4PHTA 4NXFA 1OTEA 1S1YA 3HUOA 2Y2NA 3QP8A 2J3TC 2ZM2A 4NXGA 4DE0A 4O8GA 1SKOA 3ZYTA 5TBMB 3CITA 2HPBA 4DJ2A 5EOOA 4KQRA 5FEGA 2XD5A 3MFXA 1IYPA 1YM1A 2ZLYA 2O9CA 2W1TA 2OLVA 2V20A 4EQ1A 3OBFA 4RX2A 3CZDA 1H0MA 4HHDA 4Q0HA 4WZ5C 3GECA 2Q0OA 1LSWA 5HD5A 1NLYA 1BLSA 1Y4OA 2WGVA 3BW6A 5F6AA 1UGUA 2Y59A 4CJNA 3F1PB 3B3XA 3A0RA 1NWZA 4C6YA 5DF8A 2J8YA 4N1HA 3V3RA 2P74A 3ZG0A 2H5SA 3ZVWA 2QHKA 5CHUA 2J9PA 5AQ7A 5EM0A 2XSSA 2V1AA 5J8XA 1JTGA 1RCJA 2RCXA 2P08A 2FZ0A 1M40A 4KG2A 2K7SA 5AQ9A 5TFQA 4UQIM 1CI8A 3C30A 3UDXA 4HP9A 3BRMA 5F5YA 1IELA 4DDSA 4Z1WA 5GHYA 3P09A 2GZAA 4E3OA 4LRZE 1KE3A 2ZOHA 5FAOA 3E0YA 5EVEA 1FR1A 2Y2OA 2D01A 1RGYA 3VP0A 1EWZA 3G4PA 3UB6A 1XFNA 5EOEA 4BD1A 4ZJ1A 2WZXA 4PPRA 4NK3A 3BFEA 1NZUA 3B42A 2EXAA 1YLWA 2WGWA 5GLBA 4IBXA 1VB6A 5HW3A 4OQ0A 2E8IA 4CLCB 2YKHA 1Y28A 1J9MA 1L3LA 1K38A 4MBHA 1OJGA 3MQ0A 4OPYA 3WWXA 3A3IA 3CWFA 3OC2A 3LCEA 3Q7ZA 2VZWA 1E4DA 1ES2A 4QJGA 4DXBA 1UWNX 1YQSA 3N8LA 3GR2A 2WKHA 4DF6A 1MXOA 3R7WB 1YLJA 1L0FA 5FQJA 3DBAA 4JPMA 5CTNA 1OMEA 3LY3A 1ESUA 4ZRRA 4BBVA 5GLDA 3Q07A 3AGEA 2J3WA 3BWLA 1VQQA 4GD6A 2Z2MB 4GDNA 4X69A 3UB9A 1W8YA 1IEMA 3IH9A 1JWPA 1KGEA 4JKTA 1N4OA 3GMWA 4UA6A 2ZQ7A 3UE1A 3UPNA 1LSVA 5A92A 5FI2A 3DAVA 3PYPA 5AQBA 3HJIA 2VGKA 4LLOB 5U47A 1BTLA 4N9LA 5HSQA 1CQAA 1NRFA 4I5SA 4UHUA 2DNSA 2XQZA 1KE4A 4XT2A 2HV1A 2R9WA 3VOLA 4BBUA 2ZC4B 5DJUA 2PT7A 3EWKA 1ES5A 5G4YA 4NETA 4F94A 4QWOA 1GHPA 3OPPA 2QKPA 2H28A 3O3VA 4O0PA 4Z9QA 4EXOA 4HY8A 3NDGA 3KSFA 1NLZA 4YINA 4L9EA 5LBRA 3HBRA 2VJWA 4KQOA 2OAP1 3EQVA 2GJ3A 3A3EA 4NXEA 3LIDA 2PD7A 2GNXA 5FI7A 2EFXA 5K5BA 4GCZA 1ZTUA 1DP6A 4UA7A 4CQHA 5IHVA 5FSRA 3L9KA 4XXRA 2VK3A 5EECA 3BQ8A 2HF6A 2P04A 4DJ3A 4Y7PA 3B33A 4GNUA 3FPWA 3WS4A 3ISGA 3LIEA 4E3LA 3LICA 1CEGA 3P98A 3TJZC 3NULA 3PBTA 4MMNA 1GHMA 2PBDP 4EUVA 2IWCA 2OAQ1 5KSHA 3CJMA 2A49A 3HLGA 2A24B 4KUOA 3OCNA 4JF5A 4M4XA 1N9OA 4H8RA 3F1PA 1YPRA 4WN5A 5I94A 2P9VB 1P9RA 3UE0A 3EGDC 4KZ8A 3DWKA 3SH8A 2ZQ8A 1ZC2A 1SHVA 3VE4A 4OONA 1VM1A 3HVFA 3OPHA 2DMWA 3TSGA 4EV4A 1MWUA 3LEZA 5TR7A 3JVVA 3NI9A 4QD4A 5F68A 3VP3A 1MC0A 2C6WB 3D4FA 3V50A 3VV4A 3K2NA 4N1XA 5A8BA 2INWA 5DFXA 4KZ4A 2QPNA 2G7UA 4BWIA 4MN6A 2HP6A 4OLGA 2Y2LA 1K6RA 3ZG5A 4IVKA 2PHYA 3QP5A 2M7VA 1CJFA 3IWQA 1LT0A 5F82A 3ICYA 3IWIA 3M2KA 4I3IA 4CLCA 4Y17A 2WKQA 1T18A 4E3NA 1W8QA 4WEKA 2YKFA 3NDEA 4GHIA 5EUAA 1U60A 5HAQA 3TOIA 5FI6A 4GKUA 4WMCD 3VFHA 1EW0A 3R7WA 4WEJA 1DJBA 1K54A 1EROA 5HD3A 2ZD8A 5HWWA 2EX9A 3DTMA 3MZFA 5TGFA 1KVLA 4K0WA 1SCWA 3JYIA 5CGWA 3C5AA 3O86A 3UE6A 5C5KA 3DTIA 3T4QA 5KSCA 3WS2A 3WS0A 4H6JA 4JF6A 4GS9A 1JWVA 4OP8A 3IF6A 2XFSA 3UMDA 4HH3A 1IKIA 4MBFA 3A3DA 4WM9A
chains in the Genus database with same CATH topology
3UDIA 3G34A 3GVBA 2HPBA 3ZGAB 1SDEA 4D2OA 5EOOA 4KQRA 2Y2GA 5KZHA 1FCOA 1K56A 2XD5A 3ZNYA 1IYPA 1ES3A 1YM1A 3VP1A 3V5MA 1M6KA 3M6HA 2R9XA 2ZLYA 1ESIA 1L0EA 5GLCA 5FQQA 1NZOA 2OLVA 2V20A 4HESA 3IH8A 5HAPA 3FWLA 5A90A 5DVAA 4RX2A 3CZDA 1WE4A 3A3FA 3IF6B 4QY5A 1DY6A 4MEZA 4WZ5C 4JXGA 5FA7A 2JE5A 4ZDXA 3WS1A 4GB7A 5FATA 4Y0TA 1BLSA 2Y2HA 5CEDA 2ZQAA 2WGVA 1NYMA 5DTKA 4EBNA 3TG9A 2BLSA 4WZ4A 3HLBA 4RA7A 2Y59A 4CJNA 1O7EA 1HZOA 3B3XA 4Y0UA 1ES4A 4WYYA 4IVIA 5JYOA 2WAFA 3QHYA 4C6YA 1Z6FA 1LI9A 1PYYA 2Y2PA 4P6BA 3G35A 4OOLA 4FH4A 5DF8A 2J8YA 4N1HA 3V3RA 2P74A 4LV3A 4R1GA 4DDYA 3HLCA 3ZG0A 5DTTA 4QHCA 1GCEA 3UPOA 2H10A 2H5SA 3I7JA 3ZVWA 5DTSA 1XGJA 2ZC5B 4R3JA 4WBGA 1W5DA 4CPKA 1WYCA 5CHUA 4BENA 1I2SA 3MXRA 2J9PA 4HBTA 3PBOA 3S4XA 5AQ7A 3UN7A 3G32A 5GHXA 1JTGA 1RCJA 5J8XA 4OLDA 1NY0A 2RCXA 1I2WA 4X68A 1ZG4A 5FDHA 1KE0A 1M40A 3SS3A 4KZ7A 4S2NA 3M2JA 4KG2A 1XKZA 2VGJA 5HL1A 1BLCA 3N6IA 3W4QA 5AQ9A 5F1GA 5TFQA 1ZKJA 1CI8A 3NBLA 4X56A 2ZC6B 5EVIC 3S1YA 3UDXA 1XX2A 3GSGA 2WKIA 4OQGA 3BRMA 2V1ZA 4DKIA 1IELA 4DDSA 5GHYA 2XH9A 3P09A 3ZDJA 5CHJA 4IEDA 3HLDA 4E3OA 2Q9MA 1KE3A 1N9BA 3QNBA 4K91A 5FAOA 1MBLA 1FR1A 5CGSA 1CI9A 3OPLA 2Y2OA 4L0LA 4GZBA 1K4EA 4OPZA 3WRZA 1RGYA 3VP0A 5HARA 1EWZA 3G4PA 4KZBA 5EOEA 4BD1A 1O07A 3HLEA 4R4SA 4ZJ1A 2WZXA 1E3UA 3IXDA 4PPRA 4NK3A 4WMCA 5JYPA 1GHIA 3IXHA 1S6RA 3BFEA 1NZUA 3C4PA 2Z2LB 3UNWA 2RL3A 2EXAA 3SS4A 1YLWA 5HAIA 2OLUA 2WGWA 1BLPA 5GLBA 4IBXA 3WRTA 4BJPA 3VFFA 3ZG8B 5A93A 5HW3A 4OQ0A 3W4OA 2E8IA 1K54C 3GQZA 1J9MA 3IT9A 1BLHA 1K38A 2JBFA 3N8SA 3OCLA 4MBHA 5BOHA 1JVJA 2EX8A 4RVAA 4OPYA 5FAPA 3WWXA 3A3IA 4BL3A 3OC2A 3Q81A 3BFDA 3QNCA 1W79A 1YLPA 3LCEA 4JXSA 3MKEA 3Q7ZA 1E4DA 1ES2A 1MWRA 4QJGA 4DXBA 1YQSA 1K57A 3N8LA 3GR2A 4K0XA 2WKHA 5HX9A 1PWDA 2WAEA 3IF6C 2P9VA 1LL5A 3PBQA 4DF6A 5EE8A 1MXOA 1YLJA 1L0FA 2JC7A 5FQJA 2HDQA 1GA0A 3RXXA 1MY8A 1DJCA 2V2FF 3VOZA 4JPMA 5CTNA 3G30A 1RP5A 2WGWB 4E3KA 1OMEA 1K55A 3LY3A 3UY6A 1ESUA 1L2SA 2HDRA 1K4FA 4DE3A 2BG1A 4KZ3A 3BEBA 1CK3A 3PBRA 3GTCA 1PI4A 4OPQA 1GA9A 1IYQA 1BT5A 1KDWA 4MLLA 5GLDA 2X01A 1MKIA 3Q1FA 3AGEA 3Q07A 4JF4A 3UE3A 4JXVA 5HFOA 3ZNTA 3Q7VB 5KMWA 3ZVTA 5CGXA 3VMAA 1JWZA 1VQQA 2B5RA 4GD6A 1YLTA 3BM6A 5GLAA 4PM9A 3CMZA 2Z2MB 4GDNA 4X69A 4B88A 1G68A 1NXYA 1W8YA 1IEMA 3AGDA 3IH9A 1JWPA 4JXWA 4M3KA 1XGIA 1KGEA 4JKTA 3FYZA 4MBKA 1N4OA 3GMWA 4U0TA 2XEPA 4UA6A 2G2UA 3VOYA 2UWXA 2C5WB 4N9KA 2ZQ7A 1PWCA 3AGFA 2J7VA 4OOYA 3UE1A 1FOFA 3UPNA 5A92A 5F1FA 5FI2A 2DCFA 2WUQA 2XF3A 5AQBA 2H0TA 2VGKA 2OSUA 5GL9A 5U47A 1BTLA 4FSFA 3E2LA 5CECA 1YT4A 4Q8IA 4N9LA 4EQIA 5FASA 3MBZA 1NRFA 4PM8A 3N4IA 4UHUA 4DRTA 4P87A 2DNSA 4PM5A 2XR0A 1PW1A 2XQZA 2PBYA 1KE4A 4OPRA 3NY4A 4GOGA 2R9WA 3ZFZA 3C4OA 4BD0A 4BL2A 1XPBA 5E2GA 4DE1A 3V3SA 3GV9A 1YMXA 3VSLA 4DE2A 2WKEA 2ZC4B 3ITAA 2G2WA 4R23A 3NCKA 1ONGA 5AQAA 2WZZA 1ES5A 1K6SA 1ERQA 3LY4A 5DF9A 1BULA 4NETA 4S2NC 4F94A 3MKFA 1H8ZA 3HREA 4ZJ2A 3ZCZA 3FZCA 1GHPA 3OPPA 3IQAA 4Y0OA 2Y2KA 3O3VA 4E6XA 1S0WA 3UDFA 1ERMA 1YLZA 4S2LA 4Z9QA 2HDUA 5EVID 5G18A 3VP4A 5E2EA 1XA7A 2XDMA 1PWGA 3DWZA 2WADA 3NC8A 3NDGA 1TDGA 1KVMA 4RX3A 2Y2JA 4WELA 1KDSA 3HUMA 2ZM0A 4KZAA 4YINA 4OKPA 1AXBA 3HBRA 4HBUA 4EWFA 3IHAA 4KQOA 3SOIA 3EQVA 4KZ5A 1FCMA 3MZEA 3A3EA 4OOMA 1FSYA 4DXCA 3BECA 5FI7A 4FH2A 2EFXA 1TEMA 5D3OA 1W7FA 1RGZA 3NIAA 4UAAA 5CEBA 4R0QA 4PM7A 4UA7A 3VP2A 2IWDA 2FFFB 5IHVA 5FSRA 4XXRA 5EECA 2ZC3B 1YLYA 1I5QA 3BFFA 4X55A 4S2PA 4Y7PA 2CC1A 4X53A 3CG5A 4GNUA 4KG5A 3G2YA 4E6WA 5FQMA 3FV7A 3WS4A 4A5RA 4E3JA 3ISGA 3N8RA 3PTEA 4B4ZA 4E3LA 4JBFA 2XGNA 4MNRA 1CEGA 3E2KA 3P98A 1C3BA 3G2ZA 1LL9A 4LCLA 3W4PA 3PBTA 3IWOA 4GDBA 4KENB 1IYSA 2Y91A 4OQIA 1MWSA 1GHMA 3MZDA 2IWCA 3UPPA 4YFMA 4ZAMA 5E43A 3BYDA 1K57C 3PAEA 3GRJA 1SKFA 2EX2A 4B4XA 1ALQA 1WYBA 1FSWA 3O88A 3PBNA 4S2IA 5KSHA 4GD8A 5CRFA 3CJMA 3OPRA 2A49A 3G31A 3HLGA 4QY6A 3MFDA 4OH0A 3OCNA 4JF5A 2XD1A 1K55C 2ZQCA 2XFTA 4LV1A 4KZ6A 1K25A 2HDSA 3IXGA 2HP5A 1ONHA 1K56D 4LV0A 1EI5A 1BUEA 4H8RA 4LCMA 1DJAA 5I94A 1XP4A 4P0MA 2P9VB 4X6TA 3IXBA 2ZQ9A 4XUZA 4R4RA 1XXMA 3BFGA 4WZ5A 4LV2A 3UE0A 4UA9A 5CHMA 3V39A 2XK1A 4KZ9A 4FCFA 2Y2IA 3PAGA 4KZ8A 4P85A 3RXWA 3DWKA 3SH8A 2ZQ8A 1ZC2A 1SHVA 3ITBA 4OP5A 3HLFA 4JLFA 4OONA 3BLSA 2EFUA 5FQIA 3ZHHA 1VM1A 1G6AA 3HVFA 3OPHA 1H5XA 1BSGA 5E2HA 3TSGA 4EV4A 1MWUA 3C7UA 3OZHA 3LEZA 5TR7A 3IHBA 2ZQDA 2I72A 1H8YA 1LHYA 3HLWA 1MWTA 3Q82A 3BLMA 1NJ4A 5EVLA 2EXBA 5F83A 1HD8A 3NI9A 4QD4A 3VP3A 1YMSA 2C6WB 4N92A 4PMAA 3C7VA 3D4FA 3SH9A 2Q9NA 4R3BA 2QZ6A 3WS5A 1TVFA 3V50A 2HP9A 4QB8A 5M19A 2DRWA 4N1XA 1Q2PA 2WGIA 1PIOA 2FFYA 2PU4A 2EX6A 4O7DA 3UO9A 1NYYA 4KZ4A 2GDNA 2QPNA 4S2OA 1QMFA 1HTZA 1FR6A 1SDNA 2OV5A 4QU3A 3S22A 4EBPA 1FCNA 1L0DA 2XLNA 2ZMAA 5DF7A 3EQUA 3PBSA 2H0YA 4ID4A 4E3IA 5EPHA 1TDLA 4IBRA 3N7WA 2HP6A 4OLGA 2A3UA 1LLBA 3HL9A 3BFCA 4S2MA 2Y2LA 2ZJ9A 5L2FA 1K6RA 3ZG5A 5EVIA 1E25A 2Y2MA 2ZM8A 4IVKA 3W8KA 4ZBEA 1ZG6A 4C75A 1CEFA 5CXWA 4GN2A 3HUNA 3M6BA 3SS5A 3ZG7B 1JTDA 3A3JA 1BZAA 3IWQA 2WK0A 4PM6A 1IYOA 2X71A 3LO7A 3MXSA 2JCHA 5CTMA 2QMIA 5F82A 3IWIA 2ZC7A 4FD8A 3M2KA 2X02A 1PZOA 1Y54A 1IKGA 2J9OA 4EBLA 4E3NA 1Q2QA 1W8QA 4WEKA 4OVDA 3NDEA 4ZTKA 5EUAA 1U60A 5HAQA 2Y4AA 3TOIA 5FI6A 1PW8A 1PZPA 4GKUA 5FQKA 1E3UD 5EVIB 4C3QA 4E3MA 4WMCD 3VFHA 4OQHA 1MPLA 2Y55A 5GHZA 5A91A 1QMEA 5M1AA 1LI0A 4WEJA 3DW0A 1DJBA 4S2KA 1K54A 3ZG9B 1EROA 4KG6A 3FKWA 2ZD8A 4BQMA 2EX9A 4S2JA 4U0XA 2WYXA 2Y2QA 3DTMA 3MZFA 5E2FA 5TGFA 4EUZA 1KVLA 4ZJ3A 4K0WA 4XUXA 2IWBA 1SCWA 1KGGA 3JYIA 3C5AA 3O87A 5CGWA 3RJUA 3IF5A 3O86A 3HUOA 5KSCA 5CERA 3WS2A 3WS0A 3Q7VA 4RYEA 2Y2NA 4JF6A 4KQQA 4U3TA 1JWVA 2ZM2A 4HEFA 4OP8A 2PU2A 1FQGA 3IF6A 4LENA 4BLMA 4DE0A 2XFSA 1KGFA 1L0GA 5FAQA 3FKVA 5FQ9A 3SH7A 1XA1A 1IKIA 1HVBA 4MBFA 5M18A 1PI5A 3VSKA 3A3DA 4WM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UDI A;  3G34 A;  3GVB A;  2HPB A;  3ZGA B;  1SDE A;  4D2O A;  5EOO A;  4KQR A;  2Y2G A;  5KZH A;  1FCO A;  1K56 A;  2XD5 A;  3ZNY A;  1IYP A;  1ES3 A;  1YM1 A;  3VP1 A;  3V5M A;  1M6K A;  3M6H A;  2R9X A;  2ZLY A;  1ESI A;  1L0E A;  5GLC A;  5FQQ A;  1NZO A;  2OLV A;  2V20 A;  4HES A;  3IH8 A;  5HAP A;  3FWL A;  5A90 A;  5DVA A;  4RX2 A;  3CZD A;  1WE4 A;  3A3F A;  3IF6 B;  4QY5 A;  1DY6 A;  4MEZ A;  4WZ5 C;  4JXG A;  5FA7 A;  2JE5 A;  4ZDX A;  3WS1 A;  4GB7 A;  5FAT A;  4Y0T A;  1BLS A;  2Y2H A;  5CED A;  2ZQA A;  2WGV A;  1NYM A;  5DTK A;  4EBN A;  3TG9 A;  2BLS A;  4WZ4 A;  3HLB A;  4RA7 A;  2Y59 A;  4CJN A;  1O7E A;  1HZO A;  3B3X A;  4Y0U A;  1ES4 A;  4WYY A;  4IVI A;  5JYO A;  2WAF A;  3QHY A;  4C6Y A;  1Z6F A;  1LI9 A;  1PYY A;  2Y2P A;  4P6B A;  3G35 A;  4OOL A;  4FH4 A;  5DF8 A;  2J8Y A;  4N1H A;  3V3R A;  2P74 A;  4LV3 A;  4R1G A;  4DDY A;  3HLC A;  3ZG0 A;  5DTT A;  4QHC A;  1GCE A;  3UPO A;  2H10 A;  2H5S A;  3I7J A;  3ZVW A;  5DTS A;  1XGJ A;  2ZC5 B;  4R3J A;  4WBG A;  1W5D A;  4CPK A;  1WYC A;  5CHU A;  4BEN A;  1I2S A;  3MXR A;  2J9P A;  4HBT A;  3PBO A;  3S4X A;  5AQ7 A;  3UN7 A;  3G32 A;  5GHX A;  1JTG A;  1RCJ A;  5J8X A;  4OLD A;  1NY0 A;  2RCX A;  1I2W A;  4X68 A;  1ZG4 A;  5FDH A;  1KE0 A;  1M40 A;  3SS3 A;  4KZ7 A;  4S2N A;  3M2J A;  4KG2 A;  1XKZ A;  2VGJ A;  5HL1 A;  1BLC A;  3N6I A;  3W4Q A;  5AQ9 A;  5F1G A;  5TFQ A;  1ZKJ A;  1CI8 A;  3NBL A;  4X56 A;  2ZC6 B;  5EVI C;  3S1Y A;  3UDX A;  1XX2 A;  3GSG A;  2WKI A;  4OQG A;  3BRM A;  2V1Z A;  4DKI A;  1IEL A;  4DDS A;  5GHY A;  2XH9 A;  3P09 A;  3ZDJ A;  5CHJ A;  4IED A;  3HLD A;  4E3O A;  2Q9M A;  1KE3 A;  1N9B A;  3QNB A;  4K91 A;  5FAO A;  1MBL A;  1FR1 A;  5CGS A;  1CI9 A;  3OPL A;  2Y2O A;  4L0L A;  4GZB A;  1K4E A;  4OPZ A;  3WRZ A;  1RGY A;  3VP0 A;  5HAR A;  1EWZ A;  3G4P A;  4KZB A;  5EOE A;  4BD1 A;  1O07 A;  3HLE A;  4R4S A;  4ZJ1 A;  2WZX A;  1E3U A;  3IXD A;  4PPR A;  4NK3 A;  4WMC A;  5JYP A;  1GHI A;  3IXH A;  1S6R A;  3BFE A;  1NZU A;  3C4P A;  2Z2L B;  3UNW A;  2RL3 A;  2EXA A;  3SS4 A;  1YLW A;  5HAI A;  2OLU A;  2WGW A;  1BLP A;  5GLB A;  4IBX A;  3WRT A;  4BJP A;  3VFF A;  3ZG8 B;  5A93 A;  5HW3 A;  4OQ0 A;  3W4O A;  2E8I A;  1K54 C;  3GQZ A;  1J9M A;  3IT9 A;  1BLH A;  1K38 A;  2JBF A;  3N8S A;  3OCL A;  4MBH A;  5BOH A;  1JVJ A;  2EX8 A;  4RVA A;  4OPY A;  5FAP A;  3WWX A;  3A3I A;  4BL3 A;  3OC2 A;  3Q81 A;  3BFD A;  3QNC A;  1W79 A;  1YLP A;  3LCE A;  4JXS A;  3MKE A;  3Q7Z A;  1E4D A;  1ES2 A;  1MWR A;  4QJG A;  4DXB A;  1YQS A;  1K57 A;  3N8L A;  3GR2 A;  4K0X A;  2WKH A;  5HX9 A;  1PWD A;  2WAE A;  3IF6 C;  2P9V A;  1LL5 A;  3PBQ A;  4DF6 A;  5EE8 A;  1MXO A;  1YLJ A;  1L0F A;  2JC7 A;  5FQJ A;  2HDQ A;  1GA0 A;  3RXX A;  1MY8 A;  1DJC A;  2V2F F;  3VOZ A;  4JPM A;  5CTN A;  3G30 A;  1RP5 A;  2WGW B;  4E3K A;  1OME A;  1K55 A;  3LY3 A;  3UY6 A;  1ESU A;  1L2S A;  2HDR A;  1K4F A;  4DE3 A;  2BG1 A;  4KZ3 A;  3BEB A;  1CK3 A;  3PBR A;  3GTC A;  1PI4 A;  4OPQ A;  1GA9 A;  1IYQ A;  1BT5 A;  1KDW A;  4MLL A;  5GLD A;  2X01 A;  1MKI A;  3Q1F A;  3AGE A;  3Q07 A;  4JF4 A;  3UE3 A;  4JXV A;  5HFO A;  3ZNT A;  3Q7V B;  5KMW A;  3ZVT A;  5CGX A;  3VMA A;  1JWZ A;  1VQQ A;  2B5R A;  4GD6 A;  1YLT A;  3BM6 A;  5GLA A;  4PM9 A;  3CMZ A;  2Z2M B;  4GDN A;  4X69 A;  4B88 A;  1G68 A;  1NXY A;  1W8Y A;  1IEM A;  3AGD A;  3IH9 A;  1JWP A;  4JXW A;  4M3K A;  1XGI A;  1KGE A;  4JKT A;  3FYZ A;  4MBK A;  1N4O A;  3GMW A;  4U0T A;  2XEP A;  4UA6 A;  2G2U A;  3VOY A;  2UWX A;  2C5W B;  4N9K A;  2ZQ7 A;  1PWC A;  3AGF A;  2J7V A;  4OOY A;  3UE1 A;  1FOF A;  3UPN A;  5A92 A;  5F1F A;  5FI2 A;  2DCF A;  2WUQ A;  2XF3 A;  5AQB A;  2H0T A;  2VGK A;  2OSU A;  5GL9 A;  5U47 A;  1BTL A;  4FSF A;  3E2L A;  5CEC A;  1YT4 A;  4Q8I A;  4N9L A;  4EQI A;  5FAS A;  3MBZ A;  1NRF A;  4PM8 A;  3N4I A;  4UHU A;  4DRT A;  4P87 A;  2DNS A;  4PM5 A;  2XR0 A;  1PW1 A;  2XQZ A;  2PBY A;  1KE4 A;  4OPR A;  3NY4 A;  4GOG A;  2R9W A;  3ZFZ A;  3C4O A;  4BD0 A;  4BL2 A;  1XPB A;  5E2G A;  4DE1 A;  3V3S A;  3GV9 A;  1YMX A;  3VSL A;  4DE2 A;  2WKE A;  2ZC4 B;  3ITA A;  2G2W A;  4R23 A;  3NCK A;  1ONG A;  5AQA A;  2WZZ A;  1ES5 A;  1K6S A;  1ERQ A;  3LY4 A;  5DF9 A;  1BUL A;  4NET A;  4S2N C;  4F94 A;  3MKF A;  1H8Z A;  3HRE A;  4ZJ2 A;  3ZCZ A;  3FZC A;  1GHP A;  3OPP A;  3IQA A;  4Y0O A;  2Y2K A;  3O3V A;  4E6X A;  1S0W A;  3UDF A;  1ERM A;  1YLZ A;  4S2L A;  4Z9Q A;  2HDU A;  5EVI D;  5G18 A;  3VP4 A;  5E2E A;  1XA7 A;  2XDM A;  1PWG A;  3DWZ A;  2WAD A;  3NC8 A;  3NDG A;  1TDG A;  1KVM A;  4RX3 A;  2Y2J A;  4WEL A;  1KDS A;  3HUM A;  2ZM0 A;  4KZA A;  4YIN A;  4OKP A;  1AXB A;  3HBR A;  4HBU A;  4EWF A;  3IHA A;  4KQO A;  3SOI A;  3EQV A;  4KZ5 A;  1FCM A;  3MZE A;  3A3E A;  4OOM A;  1FSY A;  4DXC A;  3BEC A;  5FI7 A;  4FH2 A;  2EFX A;  1TEM A;  5D3O A;  1W7F A;  1RGZ A;  3NIA A;  4UAA A;  5CEB A;  4R0Q A;  4PM7 A;  4UA7 A;  3VP2 A;  2IWD A;  2FFF B;  5IHV A;  5FSR A;  4XXR A;  5EEC A;  2ZC3 B;  1YLY A;  1I5Q A;  3BFF A;  4X55 A;  4S2P A;  4Y7P A;  2CC1 A;  4X53 A;  3CG5 A;  4GNU A;  4KG5 A;  3G2Y A;  4E6W A;  5FQM A;  3FV7 A;  3WS4 A;  4A5R A;  4E3J A;  3ISG A;  3N8R A;  3PTE A;  4B4Z A;  4E3L A;  4JBF A;  2XGN A;  4MNR A;  1CEG A;  3E2K A;  3P98 A;  1C3B A;  3G2Z A;  1LL9 A;  4LCL A;  3W4P A;  3PBT A;  3IWO A;  4GDB A;  4KEN B;  1IYS A;  2Y91 A;  4OQI A;  1MWS A;  1GHM A;  3MZD A;  2IWC A;  3UPP A;  4YFM A;  4ZAM A;  5E43 A;  3BYD A;  1K57 C;  3PAE A;  3GRJ A;  1SKF A;  2EX2 A;  4B4X A;  1ALQ A;  1WYB A;  1FSW A;  3O88 A;  3PBN A;  4S2I A;  5KSH A;  4GD8 A;  5CRF A;  3CJM A;  3OPR A;  2A49 A;  3G31 A;  3HLG A;  4QY6 A;  3MFD A;  4OH0 A;  3OCN A;  4JF5 A;  2XD1 A;  1K55 C;  2ZQC A;  2XFT A;  4LV1 A;  4KZ6 A;  1K25 A;  2HDS A;  3IXG A;  2HP5 A;  1ONH A;  1K56 D;  4LV0 A;  1EI5 A;  1BUE A;  4H8R A;  4LCM A;  1DJA A;  5I94 A;  1XP4 A;  4P0M A;  2P9V B;  4X6T A;  3IXB A;  2ZQ9 A;  4XUZ A;  4R4R A;  1XXM A;  3BFG A;  4WZ5 A;  4LV2 A;  3UE0 A;  4UA9 A;  5CHM A;  3V39 A;  2XK1 A;  4KZ9 A;  4FCF A;  2Y2I A;  3PAG A;  4KZ8 A;  4P85 A;  3RXW A;  3DWK A;  3SH8 A;  2ZQ8 A;  1ZC2 A;  1SHV A;  3ITB A;  4OP5 A;  3HLF A;  4JLF A;  4OON A;  3BLS A;  2EFU A;  5FQI A;  3ZHH A;  1VM1 A;  1G6A A;  3HVF A;  3OPH A;  1H5X A;  1BSG A;  5E2H A;  3TSG A;  4EV4 A;  1MWU A;  3C7U A;  3OZH A;  3LEZ A;  5TR7 A;  3IHB A;  2ZQD A;  2I72 A;  1H8Y A;  1LHY A;  3HLW A;  1MWT A;  3Q82 A;  3BLM A;  1NJ4 A;  5EVL A;  2EXB A;  5F83 A;  1HD8 A;  3NI9 A;  4QD4 A;  3VP3 A;  1YMS A;  2C6W B;  4N92 A;  4PMA A;  3C7V A;  3D4F A;  3SH9 A;  2Q9N A;  4R3B A;  2QZ6 A;  3WS5 A;  1TVF A;  3V50 A;  2HP9 A;  4QB8 A;  5M19 A;  2DRW A;  4N1X A;  1Q2P A;  2WGI A;  1PIO A;  2FFY A;  2PU4 A;  2EX6 A;  4O7D A;  3UO9 A;  1NYY A;  4KZ4 A;  2GDN A;  2QPN A;  4S2O A;  1QMF A;  1HTZ A;  1FR6 A;  1SDN A;  2OV5 A;  4QU3 A;  3S22 A;  4EBP A;  1FCN A;  1L0D A;  2XLN A;  2ZMA A;  5DF7 A;  3EQU A;  3PBS A;  2H0Y A;  4ID4 A;  4E3I A;  5EPH A;  1TDL A;  4IBR A;  3N7W A;  2HP6 A;  4OLG A;  2A3U A;  1LLB A;  3HL9 A;  3BFC A;  4S2M A;  2Y2L A;  2ZJ9 A;  5L2F A;  1K6R A;  3ZG5 A;  5EVI A;  1E25 A;  2Y2M A;  2ZM8 A;  4IVK A;  3W8K A;  4ZBE A;  1ZG6 A;  4C75 A;  1CEF A;  5CXW A;  4GN2 A;  3HUN A;  3M6B A;  3SS5 A;  3ZG7 B;  1JTD A;  3A3J A;  1BZA A;  3IWQ A;  2WK0 A;  4PM6 A;  1IYO A;  2X71 A;  3LO7 A;  3MXS A;  2JCH A;  5CTM A;  2QMI A;  5F82 A;  3IWI A;  2ZC7 A;  4FD8 A;  3M2K A;  2X02 A;  1PZO A;  1Y54 A;  1IKG A;  2J9O A;  4EBL A;  4E3N A;  1Q2Q A;  1W8Q A;  4WEK A;  4OVD A;  3NDE A;  4ZTK A;  5EUA A;  1U60 A;  5HAQ A;  2Y4A A;  3TOI A;  5FI6 A;  1PW8 A;  1PZP A;  4GKU A;  5FQK A;  1E3U D;  5EVI B;  4C3Q A;  4E3M A;  4WMC D;  3VFH A;  4OQH A;  1MPL A;  2Y55 A;  5GHZ A;  5A91 A;  1QME A;  5M1A A;  1LI0 A;  4WEJ A;  3DW0 A;  1DJB A;  4S2K A;  1K54 A;  3ZG9 B;  1ERO A;  4KG6 A;  3FKW A;  2ZD8 A;  4BQM A;  2EX9 A;  4S2J A;  4U0X A;  2WYX A;  2Y2Q A;  3DTM A;  3MZF A;  5E2F A;  5TGF A;  4EUZ A;  1KVL A;  4ZJ3 A;  4K0W A;  4XUX A;  2IWB A;  1SCW A;  1KGG A;  3JYI A;  3C5A A;  3O87 A;  5CGW A;  3RJU A;  3IF5 A;  3O86 A;  3HUO A;  5KSC A;  5CER A;  3WS2 A;  3WS0 A;  3Q7V A;  4RYE A;  2Y2N A;  4JF6 A;  4KQQ A;  4U3T A;  1JWV A;  2ZM2 A;  4HEF A;  4OP8 A;  2PU2 A;  1FQG A;  3IF6 A;  4LEN A;  4BLM A;  4DE0 A;  2XFS A;  1KGF A;  1L0G A;  5FAQ A;  3FKV A;  5FQ9 A;  3SH7 A;  1XA1 A;  1IKI A;  1HVB A;  4MBF A;  5M18 A;  1PI5 A;  3VSK A;  3A3D A;  4WM9 A; 
#chains in the Genus database with same CATH topology
 3UDI A;  3G34 A;  3LIA A;  2ZL1 A;  1SDE A;  2Y2G A;  3MQO A;  1K56 A;  4X1L A;  4HOI A;  2PDR A;  4NXB A;  3V5M A;  1M6K A;  2R9X A;  1L0E A;  5GLC A;  5FQQ A;  3FWL A;  5A90 A;  5HDD A;  3K3D A;  1WE4 A;  5HDC A;  1VET B;  1OPX A;  5FAT A;  1LSX A;  1NYM A;  4E04 A;  3HLB A;  2M7U A;  2PRF A;  1ES4 A;  2WAF A;  1Z6F A;  1DP9 A;  1LI9 A;  4P6B A;  2W3G A;  4QHC A;  4Y5F A;  3LEQ A;  1XGJ A;  4R3J A;  5DTS A;  1SZV A;  2Z6C A;  4NG2 A;  3PBO A;  2K2N A;  2B18 A;  2XRN A;  4OLD A;  1NY0 A;  4X68 A;  1KE0 A;  3SS3 A;  5G4Z A;  4S2N A;  5F1G A;  3C38 A;  4X56 A;  5EVI C;  1XFQ A;  1D1J A;  3ZDJ A;  4IED A;  1PFL A;  1MBL A;  1CI9 A;  1TS6 A;  4L0L A;  2BAS A;  1K4E A;  4OPZ A;  5HAR A;  4YOF A;  1FIL A;  1E3U A;  3IXD A;  3E98 A;  3IXH A;  1S6R A;  1NRJ A;  4R6L A;  4UEY A;  2Z2L B;  5HAI A;  2OLU A;  1IFQ A;  5EM1 A;  3GQZ A;  2JBF A;  3N8S A;  5BOH A;  3KX0 X;  1JVJ A;  5FAP A;  4BL3 A;  1N9N A;  1W79 A;  4BMW A;  4LFU A;  3MKE A;  1PRQ A;  5J3W A;  3LIF A;  4K0X A;  1PWD A;  2J3T D;  4P6Z M;  2P9V A;  1LL5 A;  1MZU A;  4IUH A;  3VOZ A;  1BYW A;  1JNU A;  3T4J A;  1F98 A;  4KZ3 A;  1CK3 A;  3GTC A;  1GA9 A;  1IYQ A;  1BT5 A;  1KDW A;  4MLL A;  4JF4 A;  4BBT A;  4JXV A;  5HFO A;  3Q7V B;  5KMW A;  2W3F A;  3ZVT A;  5CGX A;  3F1N B;  5GLA A;  3CMZ A;  4B88 A;  4DN0 A;  4IJG A;  5EV0 A;  3LI9 A;  4JXW A;  4M3K A;  2LB5 A;  1YSQ A;  1PWC A;  4OOY A;  2J7V A;  1V9Y A;  2LB9 A;  2DCF A;  3T1Q B;  2WUQ A;  2H0T A;  3E2L A;  3UB7 A;  5CEC A;  4EQI A;  4PM8 A;  2V9A A;  3LUQ A;  3N4I A;  3NHQ A;  4P87 A;  1Z09 A;  4PM5 A;  1PW1 A;  2PBY A;  4IUK A;  1G28 A;  3NY4 A;  3ZFZ A;  3C4O A;  1XPB A;  5E2G A;  3V3S A;  1YMX A;  4DE2 A;  1N9L A;  2WKE A;  3C2W A;  3ITA A;  2L0W A;  4R23 A;  5IS1 A;  4GJ4 A;  1K6S A;  1ERQ A;  4F3L B;  3HRE A;  4Y0O A;  4E6X A;  1XA7 A;  3NC8 A;  1KVM A;  4RX3 A;  2Y2J A;  4WEL A;  4KZA A;  1F5M A;  5AVE A;  1TF1 A;  4PAU A;  4ETX A;  3F1O B;  3IHA A;  1OTA A;  3SOI A;  1T1B A;  3MZE A;  4OOM A;  4DXC A;  4FH2 A;  5D3O A;  3H7W B;  1W7F A;  3KYQ A;  3VP2 A;  3LR0 A;  2FFF B;  4S2P A;  4X53 A;  3EEH A;  4E6W A;  4A5R A;  3N8R A;  3PTE A;  3HJK A;  1F2K A;  3MSH A;  4X25 A;  1W63 Q;  1LL9 A;  3D3O A;  4GDB A;  1MWS A;  3E4P A;  2EX2 A;  1ALQ A;  3LR3 A;  2ZBB A;  4S2I A;  2VX8 A;  3IBR A;  2ZQC A;  2HDS A;  2HP5 A;  3IS2 A;  1ONH A;  5HPI A;  1EI5 A;  1BUE A;  4LCM A;  2QWS A;  1XP4 A;  4X6T A;  1XXM A;  3BFG A;  4LV2 A;  5CHM A;  4KZ9 A;  3PAG A;  3RXW A;  3ITB A;  4OP5 A;  1WA9 A;  4WF0 A;  3ZHH A;  2EFU A;  5FQI A;  4G3V A;  3C7U A;  5EFW A;  3IHB A;  1LHY A;  3Q82 A;  5F83 A;  1MWT A;  3O5Y A;  3BLM A;  5L10 A;  3DTE A;  3LFV A;  2HP9 A;  2M1C A;  5M19 A;  2EX6 A;  2VV6 A;  3R4K A;  2JKF A;  4S2O A;  1QMF A;  2JKR I;  1HTZ A;  1SDN A;  2OV5 A;  3S22 A;  2WKP A;  1FCN A;  4X1M A;  1FIK A;  4I38 A;  4ID4 A;  4E3I A;  1T1A A;  2VLG A;  3OOV A;  2PR5 A;  5L2F A;  3W8K A;  4C75 A;  4GN2 A;  3HUN A;  3M6B A;  3MJQ A;  2L4R A;  4PM6 A;  2WK0 A;  1IYO A;  3K3C A;  3LO7 A;  3MXS A;  5AVF A;  2JCH A;  2QMI A;  2UV0 E;  2ZC7 A;  5DJT A;  3MQQ A;  3TRC A;  1T1C A;  2J9O A;  4OVD A;  4ZTK A;  2W3D A;  4I3A A;  2Y4A A;  1KOU A;  1PW8 A;  3ZQ5 A;  1PZP A;  5TBM A;  5EVI B;  4C3Q A;  3NOP C;  3CUE C;  1MPL A;  3ZG9 B;  4S2J A;  1VHM A;  2WYX A;  2Y2Q A;  5HWT A;  4GLQ A;  1ZHH B;  2VGL S;  1KGG A;  3O87 A;  3IF5 A;  4PKY G;  2V8F A;  4KQD A;  2A2L A;  4ARZ B;  3Q7V A;  4KQQ A;  4EU0 A;  2PU2 A;  1FQG A;  5I5L A;  4LEN A;  2W1R A;  1KGF A;  5FQ9 A;  3SH7 A;  1HVB A;  5M18 A;  1PI5 A;  3VSK A;  3ZGA B;  4ESP A;  3ZNY A;  1ES3 A;  4EEU A;  4EES A;  4G3W A;  5J4E A;  1ESI A;  5L07 A;  3S7O A;  5HAP A;  3FG8 A;  1S4R A;  1DY6 A;  4JXG A;  5FA7 A;  2JE5 A;  4GB7 A;  4Y0T A;  1SKO B;  5CED A;  5DTK A;  2QJ5 A;  1F9I A;  4PKY A;  2XA7 S;  1O7E A;  1HZO A;  3MS6 A;  1TD5 A;  4WYY A;  4IVI A;  5JYO A;  3SW1 A;  3QHY A;  4EEP A;  1PYY A;  2Y2P A;  3G35 A;  4FH4 A;  3KO6 A;  4LV3 A;  4R1G A;  4DDY A;  3QP4 A;  5DTT A;  2W27 A;  2W1T B;  3I7J A;  4ETZ A;  1WYC A;  5L8M A;  4MCW A;  3MXR A;  3LR4 A;  4IHQ A;  1ZG4 A;  3F1O A;  3M2J A;  1XKZ A;  3TW8 A;  3W4Q A;  1ODV A;  4HH2 A;  4I3J A;  2GX5 A;  2ZC6 B;  2KX6 A;  3H7W A;  3S1Y A;  1XX2 A;  2WKI A;  3E4O A;  2V1Z A;  2B95 A;  4DKI A;  5CHJ A;  2Q9M A;  5CGS A;  4YWZ A;  3QP2 A;  1IOU A;  4GZB A;  4WUJ A;  1O07 A;  3D9Y A;  3EGX C;  4R4S A;  1DRM A;  4WMC A;  5JYP A;  1GHI A;  4LGW A;  1VEU B;  3U4L P;  3C4P A;  2RL3 A;  1BLP A;  4BJP A;  3P01 A;  3VFF A;  3IX3 A;  5A93 A;  3W4O A;  1K54 C;  2QYB A;  3T1S A;  1DP8 A;  3KSI A;  3IT9 A;  2HJ9 C;  2J80 A;  2PAV P;  3Q81 A;  3BFD A;  3QNC A;  4JXS A;  1YLP A;  1MWR A;  1K57 A;  4L9G A;  5HX9 A;  2WAE A;  1X0O A;  3IF6 C;  3PBQ A;  2VV7 A;  5EE8 A;  2JC7 A;  5HWV A;  2HDQ A;  1GA0 A;  3NJA A;  1MY8 A;  4JGQ A;  3G30 A;  1RP5 A;  2WGW B;  1XJ3 A;  3NEC A;  1K55 A;  3MXQ A;  2HDR A;  4DE3 A;  2W3E A;  3BEB A;  1PI4 A;  1UWP X;  2X01 A;  3VMA A;  1JWZ A;  2B5R A;  4R3A A;  1YLT A;  1CF0 A;  1G68 A;  1NXY A;  3AGD A;  1P9W A;  1XGI A;  4MBK A;  2ZMF A;  2AVX A;  5MC7 A;  2G2U A;  3T4K A;  2UWX A;  5FEF A;  2C5W B;  4N9K A;  2JN7 A;  1FOF A;  2OSU A;  5GL9 A;  1GSX A;  1S4S A;  1YT4 A;  2MJ6 A;  5FAS A;  3KSH A;  3MBZ A;  4DRT A;  2XR0 A;  3S7P A;  4GOG A;  4BD0 A;  4BL2 A;  4DE1 A;  2NUT C;  3VSL A;  3C8C A;  4Y15 A;  1TS0 A;  1ONG A;  5AQA A;  2K31 A;  2WZZ A;  1BUL A;  4S2N C;  3MKF A;  4ZJ2 A;  2JKR M;  3FZC A;  3IQA A;  3H9W A;  4Y2F A;  4HNB A;  1S0W A;  5FDS A;  1YLZ A;  4S2L A;  3CHW P;  2HDU A;  3EOI A;  5EVI D;  3VP4 A;  1PWG A;  3DWZ A;  2WAD A;  4XT2 B;  2ZM0 A;  4OKP A;  1AXB A;  3CAX A;  4HBU A;  4EWF A;  4ME4 A;  1STZ A;  1FCM A;  1GSW A;  3BEC A;  4MN7 A;  4UAA A;  5CEB A;  4R0Q A;  2IWD A;  2A24 A;  1YLY A;  1I5Q A;  3BFF A;  4X55 A;  4WLA A;  4CLC E;  2CC1 A;  3CG5 A;  4KG5 A;  3G2Y A;  5FQM A;  3FV7 A;  4HP4 A;  4E3J A;  4JBF A;  2XGN A;  3E2K A;  3S7N A;  4KEN B;  3IWO A;  2Y91 A;  4OQI A;  2D02 A;  4UQI S;  4YFM A;  4ZAM A;  5E43 A;  2PYP A;  4B4X A;  1SKF A;  3QP1 A;  2O9B A;  1WYB A;  3O88 A;  3PBN A;  5CRF A;  1S1Z A;  3G31 A;  4D60 A;  4QY6 A;  3MFD A;  3MMH A;  1K0K A;  4OH0 A;  1ACF A;  3CI6 A;  4KZ6 A;  1K25 A;  3IXG A;  5IT5 A;  4R4R A;  4WZ5 A;  4G3K A;  4JGP A;  4Q0I A;  3V39 A;  2XK1 A;  4HJ4 A;  4P85 A;  3UB5 P;  3BLS A;  3L7H A;  5E2H A;  4Q0J A;  5EVL A;  1HD8 A;  4N92 A;  3SH9 A;  4R3B A;  2QZ6 A;  3D72 A;  3WS5 A;  3IBJ A;  2OOL A;  1OT6 A;  1D7E A;  1Q2P A;  2WGI A;  4O7D A;  5F69 A;  2GDN A;  1AWI A;  3MR0 A;  4HQA A;  5J7E A;  4QU3 A;  1L0D A;  5DF7 A;  3EQU A;  3BQA A;  2H0Y A;  5EPH A;  2A3U A;  1LLB A;  3HL9 A;  4JGO A;  3BFC A;  2ZJ9 A;  3KSG A;  2ACG A;  3KYE A;  4ZBE A;  1VEU A;  1TS8 A;  2EWV A;  3SS5 A;  3A3J A;  2JKT I;  5CTM A;  3T12 B;  2Y79 A;  1PZO A;  4EBL A;  3TE8 A;  1XJ2 A;  3PHY A;  4K08 A;  1D06 A;  2L1M A;  1H3Q A;  2W3H A;  4E3M A;  4OQH A;  5GHZ A;  1QME A;  5M1A A;  1LI0 A;  3T4S A;  4EER A;  4EUZ A;  3CLO A;  4ZJ3 A;  4XUX A;  2IWB A;  3RJU A;  2ZMV A;  5CER A;  5L09 A;  2B02 A;  4B9O A;  4RYE A;  4U3T A;  4HIA A;  4HEF A;  1OTB A;  4GHI B;  1VET A;  4BLM A;  1L0G A;  5FAQ A;  2VA0 A;  3FKV A;  1XA1 A;  3GVB A;  3JPU A;  4D2O A;  3RH8 B;  5KZH A;  1FCO A;  2R78 A;  3VP1 A;  3M6H A;  2HZ5 A;  2QJ7 A;  2V0W A;  1NZO A;  4H6J B;  4HES A;  3IH8 A;  5DVA A;  3T4T A;  3A3F A;  4GS9 B;  3IF6 B;  4QY5 A;  4MEZ A;  3S7Q A;  3EEA A;  3CPT B;  4AFI A;  5FL3 A;  3NOU C;  4ZDX A;  4R70 A;  3WS1 A;  1YAX A;  1V9Z A;  2Y2H A;  2ZQA A;  3QP6 A;  4EBN A;  3TG9 A;  2BLS A;  2BTF P;  4WZ4 A;  2ZL1 B;  4RA7 A;  3T1R A;  3W2Z A;  3LYX A;  4Y0U A;  5HDS A;  2ZOI A;  4FUW A;  4WL9 A;  4OOL A;  3HLC A;  3UPO A;  1GCE A;  2H10 A;  2ZC5 B;  4LRY C;  1YKD A;  4WBG A;  1W5D A;  2PD8 A;  4CPK A;  4NKP A;  4BEN A;  1I2S A;  4HBT A;  2KLI A;  3S4X A;  3HCY A;  3UN7 A;  3G32 A;  2JHE A;  3IX4 A;  5GHX A;  5DKL A;  5FDH A;  1I2W A;  4DMZ A;  4KZ7 A;  4GW9 A;  2VGJ A;  5HL1 A;  1BLC A;  3N6I A;  1W63 M;  1ZKJ A;  3NBL A;  3GSG A;  4OQG A;  3PXP A;  2XH9 A;  3HLD A;  3T4O A;  1N9B A;  3QNB A;  4K91 A;  3JVU A;  3OPL A;  3WRZ A;  2OWJ A;  4O01 A;  3A0S A;  4KZB A;  4LRX C;  3HLE A;  3PR6 A;  3MF0 A;  4Y3I A;  2FH5 A;  3UNW A;  3SS4 A;  4LPZ A;  3U2A A;  3WRT A;  3ZG8 B;  3CUE A;  3UME A;  1BLH A;  3OCL A;  2V1B A;  2EX8 A;  1OT9 A;  3RFB A;  3F1N A;  4RVA A;  3H82 B;  5IU1 A;  5HPF A;  2IA2 A;  4HJ6 A;  3RXX A;  1DJC A;  2V2F F;  2PYR A;  4E3K A;  3UY6 A;  1L2S A;  1K4F A;  2BG1 A;  4OPQ A;  5DKK A;  3PBR A;  1MKI A;  3Q1F A;  3UE3 A;  2Z6D A;  4JGR A;  3ZNT A;  1H8M A;  3B47 A;  3LIB A;  4II7 A;  3BM6 A;  4PM9 A;  3FYZ A;  4U0T A;  2XEP A;  3VOY A;  1OTI A;  3AGF A;  5TJJ A;  4F3L A;  3P7N A;  5F1F A;  2V0U A;  2XF3 A;  3VE3 A;  4FSF A;  4Q8I A;  3KYZ A;  3SZT A;  2XRO A;  2V8C A;  4I39 A;  3E4Q A;  4OPR A;  1HLU P;  3GV9 A;  2EWW A;  4MDZ A;  2WKR A;  2VGL M;  2VV8 A;  2G2W A;  1J3W A;  3T1X A;  4HJ3 A;  3NCK A;  1G6O A;  2O0Y A;  4MN5 A;  3LY4 A;  5DF9 A;  3T50 A;  1H8Z A;  3ZCZ A;  4Y13 A;  2Y2K A;  4EET B;  2PR6 A;  3UDF A;  1ERM A;  5G18 A;  5E2E A;  2XDM A;  2O9A A;  3ULF A;  1TDG A;  2KDK A;  4CLC C;  1KDS A;  5KIZ A;  3HUM A;  1G5U A;  2JKT M;  4CLC D;  1OTD A;  4KZ5 A;  4B93 A;  4KUK A;  1FSY A;  1TEM A;  1RGZ A;  3NIA A;  2P7J A;  3LI8 A;  3LR5 A;  1XJ6 A;  5CX7 A;  4PM7 A;  3OLO A;  2ZC3 B;  5HZH A;  5HL6 A;  5DFY A;  2XA7 M;  2I9V A;  1YSP A;  4B4Z A;  4EW7 A;  1GSV A;  4MNR A;  1C3B A;  3G2Z A;  3DTK A;  4LCL A;  3W4P A;  1IYS A;  3MZD A;  3UPP A;  3BYD A;  1K57 C;  3PAE A;  3GRJ A;  3G6O A;  1FSW A;  4GD8 A;  3BY8 A;  3OPR A;  3CPT A;  2NUP C;  2XD1 A;  1K55 C;  2XFT A;  4LV1 A;  2O99 A;  4LV0 A;  1K56 D;  3IX8 A;  1DJA A;  2KOI A;  4P0M A;  1XJ4 A;  3IXB A;  2ZQ9 A;  4XUZ A;  4UA9 A;  4FCF A;  2Y2I A;  4R38 A;  2VEA A;  3HLF A;  1LL8 A;  4JLF A;  1T19 A;  1G6A A;  2VKS A;  1H5X A;  1BSG A;  2HJE A;  3OZH A;  1OJ5 A;  3BJN A;  2ZQD A;  2I72 A;  1H8Y A;  3HLW A;  1NJ4 A;  2EXB A;  1YMS A;  3IS2 B;  4PMA A;  2W0N A;  3C7V A;  2Q9N A;  1S66 L;  1TVF A;  3UB8 A;  3LGO A;  4P6Z S;  4QB8 A;  2DRW A;  1P0Z A;  1PIO A;  2FFY A;  2Y8H A;  3GDI A;  2PU4 A;  4L9F A;  3UO9 A;  1NYY A;  3FPV A;  4FOF A;  2OWH A;  1FR6 A;  4EBP A;  2XLN A;  2ZMA A;  3PBS A;  1TDL A;  4IBR A;  3N7W A;  3BY9 A;  4S2M A;  5EVI A;  1E25 A;  2Y2M A;  2ZM8 A;  1ZG6 A;  1CEF A;  5CXW A;  4HI4 A;  2HGV A;  3ZG7 B;  1JTD A;  1BZA A;  2X71 A;  3A0V A;  4QPR A;  3NOT C;  1TS7 A;  4FD8 A;  4NEE D;  3T4L A;  2X02 A;  1S67 L;  1Y54 A;  4ARZ A;  1IKG A;  1P97 A;  2JKG A;  1Q2Q A;  2EA9 A;  5AJG A;  3RTY A;  1PNE A;  4RQ9 A;  1A0K A;  1MKM A;  3V67 A;  5FQK A;  1E3U D;  3H82 A;  2Y55 A;  2E8J A;  2CMN A;  4FTX A;  5A91 A;  3DW0 A;  4S2K A;  4KG6 A;  3FKW A;  3FC7 A;  4BQM A;  4U0X A;  5E2F A;  4YNR A;  4PHT A;  4NXF A;  1OTE A;  1S1Y A;  3HUO A;  2Y2N A;  3QP8 A;  2J3T C;  2ZM2 A;  4NXG A;  4DE0 A;  4O8G A;  1SKO A;  3ZYT A;  5TBM B;  3CIT A;  2HPB A;  4DJ2 A;  5EOO A;  4KQR A;  5FEG A;  2XD5 A;  3MFX A;  1IYP A;  1YM1 A;  2ZLY A;  2O9C A;  2W1T A;  2OLV A;  2V20 A;  4EQ1 A;  3OBF A;  4RX2 A;  3CZD A;  1H0M A;  4HHD A;  4Q0H A;  4WZ5 C;  3GEC A;  2Q0O A;  1LSW A;  5HD5 A;  1NLY A;  1BLS A;  1Y4O A;  2WGV A;  3BW6 A;  5F6A A;  1UGU A;  2Y59 A;  4CJN A;  3F1P B;  3B3X A;  3A0R A;  1NWZ A;  4C6Y A;  5DF8 A;  2J8Y A;  4N1H A;  3V3R A;  2P74 A;  3ZG0 A;  2H5S A;  3ZVW A;  2QHK A;  5CHU A;  2J9P A;  5AQ7 A;  5EM0 A;  2XSS A;  2V1A A;  5J8X A;  1JTG A;  1RCJ A;  2RCX A;  2P08 A;  2FZ0 A;  1M40 A;  4KG2 A;  2K7S A;  5AQ9 A;  5TFQ A;  4UQI M;  1CI8 A;  3C30 A;  3UDX A;  4HP9 A;  3BRM A;  5F5Y A;  1IEL A;  4DDS A;  4Z1W A;  5GHY A;  3P09 A;  2GZA A;  4E3O A;  4LRZ E;  1KE3 A;  2ZOH A;  5FAO A;  3E0Y A;  5EVE A;  1FR1 A;  2Y2O A;  2D01 A;  1RGY A;  3VP0 A;  1EWZ A;  3G4P A;  3UB6 A;  1XFN A;  5EOE A;  4BD1 A;  4ZJ1 A;  2WZX A;  4PPR A;  4NK3 A;  3BFE A;  1NZU A;  3B42 A;  2EXA A;  1YLW A;  2WGW A;  5GLB A;  4IBX A;  1VB6 A;  5HW3 A;  4OQ0 A;  2E8I A;  4CLC B;  2YKH A;  1Y28 A;  1J9M A;  1L3L A;  1K38 A;  4MBH A;  1OJG A;  3MQ0 A;  4OPY A;  3WWX A;  3A3I A;  3CWF A;  3OC2 A;  3LCE A;  3Q7Z A;  2VZW A;  1E4D A;  1ES2 A;  4QJG A;  4DXB A;  1UWN X;  1YQS A;  3N8L A;  3GR2 A;  2WKH A;  4DF6 A;  1MXO A;  3R7W B;  1YLJ A;  1L0F A;  5FQJ A;  3DBA A;  4JPM A;  5CTN A;  1OME A;  3LY3 A;  1ESU A;  4ZRR A;  4BBV A;  5GLD A;  3Q07 A;  3AGE A;  2J3W A;  3BWL A;  1VQQ A;  4GD6 A;  2Z2M B;  4GDN A;  4X69 A;  3UB9 A;  1W8Y A;  1IEM A;  3IH9 A;  1JWP A;  1KGE A;  4JKT A;  1N4O A;  3GMW A;  4UA6 A;  2ZQ7 A;  3UE1 A;  3UPN A;  1LSV A;  5A92 A;  5FI2 A;  3DAV A;  3PYP A;  5AQB A;  3HJI A;  2VGK A;  4LLO B;  5U47 A;  1BTL A;  4N9L A;  5HSQ A;  1CQA A;  1NRF A;  4I5S A;  4UHU A;  2DNS A;  2XQZ A;  1KE4 A;  4XT2 A;  2HV1 A;  2R9W A;  3VOL A;  4BBU A;  2ZC4 B;  5DJU A;  2PT7 A;  3EWK A;  1ES5 A;  5G4Y A;  4NET A;  4F94 A;  4QWO A;  1GHP A;  3OPP A;  2QKP A;  2H28 A;  3O3V A;  4O0P A;  4Z9Q A;  4EXO A;  4HY8 A;  3NDG A;  3KSF A;  1NLZ A;  4YIN A;  4L9E A;  5LBR A;  3HBR A;  2VJW A;  4KQO A;  2OAP 1;  3EQV A;  2GJ3 A;  3A3E A;  4NXE A;  3LID A;  2PD7 A;  2GNX A;  5FI7 A;  2EFX A;  5K5B A;  4GCZ A;  1ZTU A;  1DP6 A;  4UA7 A;  4CQH A;  5IHV A;  5FSR A;  3L9K A;  4XXR A;  2VK3 A;  5EEC A;  3BQ8 A;  2HF6 A;  2P04 A;  4DJ3 A;  4Y7P A;  3B33 A;  4GNU A;  3FPW A;  3WS4 A;  3ISG A;  3LIE A;  4E3L A;  3LIC A;  1CEG A;  3P98 A;  3TJZ C;  3NUL A;  3PBT A;  4MMN A;  1GHM A;  2PBD P;  4EUV A;  2IWC A;  2OAQ 1;  5KSH A;  3CJM A;  2A49 A;  3HLG A;  2A24 B;  4KUO A;  3OCN A;  4JF5 A;  4M4X A;  1N9O A;  4H8R A;  3F1P A;  1YPR A;  4WN5 A;  5I94 A;  2P9V B;  1P9R A;  3UE0 A;  3EGD C;  4KZ8 A;  3DWK A;  3SH8 A;  2ZQ8 A;  1ZC2 A;  1SHV A;  3VE4 A;  4OON A;  1VM1 A;  3HVF A;  3OPH A;  2DMW A;  3TSG A;  4EV4 A;  1MWU A;  3LEZ A;  5TR7 A;  3JVV A;  3NI9 A;  4QD4 A;  5F68 A;  3VP3 A;  1MC0 A;  2C6W B;  3D4F A;  3V50 A;  3VV4 A;  3K2N A;  4N1X A;  5A8B A;  2INW A;  5DFX A;  4KZ4 A;  2QPN A;  2G7U A;  4BWI A;  4MN6 A;  2HP6 A;  4OLG A;  2Y2L A;  1K6R A;  3ZG5 A;  4IVK A;  2PHY A;  3QP5 A;  2M7V A;  1CJF A;  3IWQ A;  1LT0 A;  5F82 A;  3ICY A;  3IWI A;  3M2K A;  4I3I A;  4CLC A;  4Y17 A;  2WKQ A;  1T18 A;  4E3N A;  1W8Q A;  4WEK A;  2YKF A;  3NDE A;  4GHI A;  5EUA A;  1U60 A;  5HAQ A;  3TOI A;  5FI6 A;  4GKU A;  4WMC D;  3VFH A;  1EW0 A;  3R7W A;  4WEJ A;  1DJB A;  1K54 A;  1ERO A;  5HD3 A;  2ZD8 A;  5HWW A;  2EX9 A;  3DTM A;  3MZF A;  5TGF A;  1KVL A;  4K0W A;  1SCW A;  3JYI A;  5CGW A;  3C5A A;  3O86 A;  3UE6 A;  5C5K A;  3DTI A;  3T4Q A;  5KSC A;  3WS2 A;  3WS0 A;  4H6J A;  4JF6 A;  4GS9 A;  1JWV A;  4OP8 A;  3IF6 A;  2XFS A;  3UMD A;  4HH3 A;  1IKI A;  4MBF A;  3A3D A;  4WM9 A; 
#chains in the Genus database with same CATH homology
 3UDI A;  3G34 A;  3GVB A;  2HPB A;  3ZGA B;  1SDE A;  4D2O A;  5EOO A;  4KQR A;  2Y2G A;  5KZH A;  1FCO A;  1K56 A;  2XD5 A;  3ZNY A;  1IYP A;  1ES3 A;  1YM1 A;  3VP1 A;  3V5M A;  1M6K A;  3M6H A;  2R9X A;  2ZLY A;  1ESI A;  1L0E A;  5GLC A;  5FQQ A;  1NZO A;  2OLV A;  2V20 A;  4HES A;  3IH8 A;  5HAP A;  3FWL A;  5A90 A;  5DVA A;  4RX2 A;  3CZD A;  1WE4 A;  3A3F A;  3IF6 B;  4QY5 A;  1DY6 A;  4MEZ A;  4WZ5 C;  4JXG A;  5FA7 A;  2JE5 A;  4ZDX A;  3WS1 A;  4GB7 A;  5FAT A;  4Y0T A;  1BLS A;  2Y2H A;  5CED A;  2ZQA A;  2WGV A;  1NYM A;  5DTK A;  4EBN A;  3TG9 A;  2BLS A;  4WZ4 A;  3HLB A;  4RA7 A;  2Y59 A;  4CJN A;  1O7E A;  1HZO A;  3B3X A;  4Y0U A;  1ES4 A;  4WYY A;  4IVI A;  5JYO A;  2WAF A;  3QHY A;  4C6Y A;  1Z6F A;  1LI9 A;  1PYY A;  2Y2P A;  4P6B A;  3G35 A;  4OOL A;  4FH4 A;  5DF8 A;  2J8Y A;  4N1H A;  3V3R A;  2P74 A;  4LV3 A;  4R1G A;  4DDY A;  3HLC A;  3ZG0 A;  5DTT A;  4QHC A;  1GCE A;  3UPO A;  2H10 A;  2H5S A;  3I7J A;  3ZVW A;  5DTS A;  1XGJ A;  2ZC5 B;  4R3J A;  4WBG A;  1W5D A;  4CPK A;  1WYC A;  5CHU A;  4BEN A;  1I2S A;  3MXR A;  2J9P A;  4HBT A;  3PBO A;  3S4X A;  5AQ7 A;  3UN7 A;  3G32 A;  5GHX A;  1JTG A;  1RCJ A;  5J8X A;  4OLD A;  1NY0 A;  2RCX A;  1I2W A;  4X68 A;  1ZG4 A;  5FDH A;  1KE0 A;  1M40 A;  3SS3 A;  4KZ7 A;  4S2N A;  3M2J A;  4KG2 A;  1XKZ A;  2VGJ A;  5HL1 A;  1BLC A;  3N6I A;  3W4Q A;  5AQ9 A;  5F1G A;  5TFQ A;  1ZKJ A;  1CI8 A;  3NBL A;  4X56 A;  2ZC6 B;  5EVI C;  3S1Y A;  3UDX A;  1XX2 A;  3GSG A;  2WKI A;  4OQG A;  3BRM A;  2V1Z A;  4DKI A;  1IEL A;  4DDS A;  5GHY A;  2XH9 A;  3P09 A;  3ZDJ A;  5CHJ A;  4IED A;  3HLD A;  4E3O A;  2Q9M A;  1KE3 A;  1N9B A;  3QNB A;  4K91 A;  5FAO A;  1MBL A;  1FR1 A;  5CGS A;  1CI9 A;  3OPL A;  2Y2O A;  4L0L A;  4GZB A;  1K4E A;  4OPZ A;  3WRZ A;  1RGY A;  3VP0 A;  5HAR A;  1EWZ A;  3G4P A;  4KZB A;  5EOE A;  4BD1 A;  1O07 A;  3HLE A;  4R4S A;  4ZJ1 A;  2WZX A;  1E3U A;  3IXD A;  4PPR A;  4NK3 A;  4WMC A;  5JYP A;  1GHI A;  3IXH A;  1S6R A;  3BFE A;  1NZU A;  3C4P A;  2Z2L B;  3UNW A;  2RL3 A;  2EXA A;  3SS4 A;  1YLW A;  5HAI A;  2OLU A;  2WGW A;  1BLP A;  5GLB A;  4IBX A;  3WRT A;  4BJP A;  3VFF A;  3ZG8 B;  5A93 A;  5HW3 A;  4OQ0 A;  3W4O A;  2E8I A;  1K54 C;  3GQZ A;  1J9M A;  3IT9 A;  1BLH A;  1K38 A;  2JBF A;  3N8S A;  3OCL A;  4MBH A;  5BOH A;  1JVJ A;  2EX8 A;  4RVA A;  4OPY A;  5FAP A;  3WWX A;  3A3I A;  4BL3 A;  3OC2 A;  3Q81 A;  3BFD A;  3QNC A;  1W79 A;  1YLP A;  3LCE A;  4JXS A;  3MKE A;  3Q7Z A;  1E4D A;  1ES2 A;  1MWR A;  4QJG A;  4DXB A;  1YQS A;  1K57 A;  3N8L A;  3GR2 A;  4K0X A;  2WKH A;  5HX9 A;  1PWD A;  2WAE A;  3IF6 C;  2P9V A;  1LL5 A;  3PBQ A;  4DF6 A;  5EE8 A;  1MXO A;  1YLJ A;  1L0F A;  2JC7 A;  5FQJ A;  2HDQ A;  1GA0 A;  3RXX A;  1MY8 A;  1DJC A;  2V2F F;  3VOZ A;  4JPM A;  5CTN A;  3G30 A;  1RP5 A;  2WGW B;  4E3K A;  1OME A;  1K55 A;  3LY3 A;  3UY6 A;  1ESU A;  1L2S A;  2HDR A;  1K4F A;  4DE3 A;  2BG1 A;  4KZ3 A;  3BEB A;  1CK3 A;  3PBR A;  3GTC A;  1PI4 A;  4OPQ A;  1GA9 A;  1IYQ A;  1BT5 A;  1KDW A;  4MLL A;  5GLD A;  2X01 A;  1MKI A;  3Q1F A;  3AGE A;  3Q07 A;  4JF4 A;  3UE3 A;  4JXV A;  5HFO A;  3ZNT A;  3Q7V B;  5KMW A;  3ZVT A;  5CGX A;  3VMA A;  1JWZ A;  1VQQ A;  2B5R A;  4GD6 A;  1YLT A;  3BM6 A;  5GLA A;  4PM9 A;  3CMZ A;  2Z2M B;  4GDN A;  4X69 A;  4B88 A;  1G68 A;  1NXY A;  1W8Y A;  1IEM A;  3AGD A;  3IH9 A;  1JWP A;  4JXW A;  4M3K A;  1XGI A;  1KGE A;  4JKT A;  3FYZ A;  4MBK A;  1N4O A;  3GMW A;  4U0T A;  2XEP A;  4UA6 A;  2G2U A;  3VOY A;  2UWX A;  2C5W B;  4N9K A;  2ZQ7 A;  1PWC A;  3AGF A;  2J7V A;  4OOY A;  3UE1 A;  1FOF A;  3UPN A;  5A92 A;  5F1F A;  5FI2 A;  2DCF A;  2WUQ A;  2XF3 A;  5AQB A;  2H0T A;  2VGK A;  2OSU A;  5GL9 A;  5U47 A;  1BTL A;  4FSF A;  3E2L A;  5CEC A;  1YT4 A;  4Q8I A;  4N9L A;  4EQI A;  5FAS A;  3MBZ A;  1NRF A;  4PM8 A;  3N4I A;  4UHU A;  4DRT A;  4P87 A;  2DNS A;  4PM5 A;  2XR0 A;  1PW1 A;  2XQZ A;  2PBY A;  1KE4 A;  4OPR A;  3NY4 A;  4GOG A;  2R9W A;  3ZFZ A;  3C4O A;  4BD0 A;  4BL2 A;  1XPB A;  5E2G A;  4DE1 A;  3V3S A;  3GV9 A;  1YMX A;  3VSL A;  4DE2 A;  2WKE A;  2ZC4 B;  3ITA A;  2G2W A;  4R23 A;  3NCK A;  1ONG A;  5AQA A;  2WZZ A;  1ES5 A;  1K6S A;  1ERQ A;  3LY4 A;  5DF9 A;  1BUL A;  4NET A;  4S2N C;  4F94 A;  3MKF A;  1H8Z A;  3HRE A;  4ZJ2 A;  3ZCZ A;  3FZC A;  1GHP A;  3OPP A;  3IQA A;  4Y0O A;  2Y2K A;  3O3V A;  4E6X A;  1S0W A;  3UDF A;  1ERM A;  1YLZ A;  4S2L A;  4Z9Q A;  2HDU A;  5EVI D;  5G18 A;  3VP4 A;  5E2E A;  1XA7 A;  2XDM A;  1PWG A;  3DWZ A;  2WAD A;  3NC8 A;  3NDG A;  1TDG A;  1KVM A;  4RX3 A;  2Y2J A;  4WEL A;  1KDS A;  3HUM A;  2ZM0 A;  4KZA A;  4YIN A;  4OKP A;  1AXB A;  3HBR A;  4HBU A;  4EWF A;  3IHA A;  4KQO A;  3SOI A;  3EQV A;  4KZ5 A;  1FCM A;  3MZE A;  3A3E A;  4OOM A;  1FSY A;  4DXC A;  3BEC A;  5FI7 A;  4FH2 A;  2EFX A;  1TEM A;  5D3O A;  1W7F A;  1RGZ A;  3NIA A;  4UAA A;  5CEB A;  4R0Q A;  4PM7 A;  4UA7 A;  3VP2 A;  2IWD A;  2FFF B;  5IHV A;  5FSR A;  4XXR A;  5EEC A;  2ZC3 B;  1YLY A;  1I5Q A;  3BFF A;  4X55 A;  4S2P A;  4Y7P A;  2CC1 A;  4X53 A;  3CG5 A;  4GNU A;  4KG5 A;  3G2Y A;  4E6W A;  5FQM A;  3FV7 A;  3WS4 A;  4A5R A;  4E3J A;  3ISG A;  3N8R A;  3PTE A;  4B4Z A;  4E3L A;  4JBF A;  2XGN A;  4MNR A;  1CEG A;  3E2K A;  3P98 A;  1C3B A;  3G2Z A;  1LL9 A;  4LCL A;  3W4P A;  3PBT A;  3IWO A;  4GDB A;  4KEN B;  1IYS A;  2Y91 A;  4OQI A;  1MWS A;  1GHM A;  3MZD A;  2IWC A;  3UPP A;  4YFM A;  4ZAM A;  5E43 A;  3BYD A;  1K57 C;  3PAE A;  3GRJ A;  1SKF A;  2EX2 A;  4B4X A;  1ALQ A;  1WYB A;  1FSW A;  3O88 A;  3PBN A;  4S2I A;  5KSH A;  4GD8 A;  5CRF A;  3CJM A;  3OPR A;  2A49 A;  3G31 A;  3HLG A;  4QY6 A;  3MFD A;  4OH0 A;  3OCN A;  4JF5 A;  2XD1 A;  1K55 C;  2ZQC A;  2XFT A;  4LV1 A;  4KZ6 A;  1K25 A;  2HDS A;  3IXG A;  2HP5 A;  1ONH A;  1K56 D;  4LV0 A;  1EI5 A;  1BUE A;  4H8R A;  4LCM A;  1DJA A;  5I94 A;  1XP4 A;  4P0M A;  2P9V B;  4X6T A;  3IXB A;  2ZQ9 A;  4XUZ A;  4R4R A;  1XXM A;  3BFG A;  4WZ5 A;  4LV2 A;  3UE0 A;  4UA9 A;  5CHM A;  3V39 A;  2XK1 A;  4KZ9 A;  4FCF A;  2Y2I A;  3PAG A;  4KZ8 A;  4P85 A;  3RXW A;  3DWK A;  3SH8 A;  2ZQ8 A;  1ZC2 A;  1SHV A;  3ITB A;  4OP5 A;  3HLF A;  4JLF A;  4OON A;  3BLS A;  2EFU A;  5FQI A;  3ZHH A;  1VM1 A;  1G6A A;  3HVF A;  3OPH A;  1H5X A;  1BSG A;  5E2H A;  3TSG A;  4EV4 A;  1MWU A;  3C7U A;  3OZH A;  3LEZ A;  5TR7 A;  3IHB A;  2ZQD A;  2I72 A;  1H8Y A;  1LHY A;  3HLW A;  1MWT A;  3Q82 A;  3BLM A;  1NJ4 A;  5EVL A;  2EXB A;  5F83 A;  1HD8 A;  3NI9 A;  4QD4 A;  3VP3 A;  1YMS A;  2C6W B;  4N92 A;  4PMA A;  3C7V A;  3D4F A;  3SH9 A;  2Q9N A;  4R3B A;  2QZ6 A;  3WS5 A;  1TVF A;  3V50 A;  2HP9 A;  4QB8 A;  5M19 A;  2DRW A;  4N1X A;  1Q2P A;  2WGI A;  1PIO A;  2FFY A;  2PU4 A;  2EX6 A;  4O7D A;  3UO9 A;  1NYY A;  4KZ4 A;  2GDN A;  2QPN A;  4S2O A;  1QMF A;  1HTZ A;  1FR6 A;  1SDN A;  2OV5 A;  4QU3 A;  3S22 A;  4EBP A;  1FCN A;  1L0D A;  2XLN A;  2ZMA A;  5DF7 A;  3EQU A;  3PBS A;  2H0Y A;  4ID4 A;  4E3I A;  5EPH A;  1TDL A;  4IBR A;  3N7W A;  2HP6 A;  4OLG A;  2A3U A;  1LLB A;  3HL9 A;  3BFC A;  4S2M A;  2Y2L A;  2ZJ9 A;  5L2F A;  1K6R A;  3ZG5 A;  5EVI A;  1E25 A;  2Y2M A;  2ZM8 A;  4IVK A;  3W8K A;  4ZBE A;  1ZG6 A;  4C75 A;  1CEF A;  5CXW A;  4GN2 A;  3HUN A;  3M6B A;  3SS5 A;  3ZG7 B;  1JTD A;  3A3J A;  1BZA A;  3IWQ A;  2WK0 A;  4PM6 A;  1IYO A;  2X71 A;  3LO7 A;  3MXS A;  2JCH A;  5CTM A;  2QMI A;  5F82 A;  3IWI A;  2ZC7 A;  4FD8 A;  3M2K A;  2X02 A;  1PZO A;  1Y54 A;  1IKG A;  2J9O A;  4EBL A;  4E3N A;  1Q2Q A;  1W8Q A;  4WEK A;  4OVD A;  3NDE A;  4ZTK A;  5EUA A;  1U60 A;  5HAQ A;  2Y4A A;  3TOI A;  5FI6 A;  1PW8 A;  1PZP A;  4GKU A;  5FQK A;  1E3U D;  5EVI B;  4C3Q A;  4E3M A;  4WMC D;  3VFH A;  4OQH A;  1MPL A;  2Y55 A;  5GHZ A;  5A91 A;  1QME A;  5M1A A;  1LI0 A;  4WEJ A;  3DW0 A;  1DJB A;  4S2K A;  1K54 A;  3ZG9 B;  1ERO A;  4KG6 A;  3FKW A;  2ZD8 A;  4BQM A;  2EX9 A;  4S2J A;  4U0X A;  2WYX A;  2Y2Q A;  3DTM A;  3MZF A;  5E2F A;  5TGF A;  4EUZ A;  1KVL A;  4ZJ3 A;  4K0W A;  4XUX A;  2IWB A;  1SCW A;  1KGG A;  3JYI A;  3C5A A;  3O87 A;  5CGW A;  3RJU A;  3IF5 A;  3O86 A;  3HUO A;  5KSC A;  5CER A;  3WS2 A;  3WS0 A;  3Q7V A;  4RYE A;  2Y2N A;  4JF6 A;  4KQQ A;  4U3T A;  1JWV A;  2ZM2 A;  4HEF A;  4OP8 A;  2PU2 A;  1FQG A;  3IF6 A;  4LEN A;  4BLM A;  4DE0 A;  2XFS A;  1KGF A;  1L0G A;  5FAQ A;  3FKV A;  5FQ9 A;  3SH7 A;  1XA1 A;  1IKI A;  1HVB A;  4MBF A;  5M18 A;  1PI5 A;  3VSK A;  3A3D A;  4WM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...