4E6XA

Clbp in complex boron-based inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
310
Chain Sequence
ERLSTLIHQRMQEAKVPALSVSVTIKGVRQRFVYGVADVASQKANTLDTVYELGSMSKAFTGLVVQILIQEGRLRQGDDIITYLPEMRLNYQGKPASLTVADFLYHTSGLPLRNENLLFAPGAKFSYASANYDVLGAVIENVTGKTFTEVIAERLTQPLGMSATVAVKIIVNKASGYKLGFGKPVLFARNHVPAAYIHSTLPDMEIWIDAWLHRKALPATLREAMSNSWRGNSDVPLAADNRILYASGWFIDQNQGPYISHGGQNPNFSSCIALRPDQQIGIVALANMNSNLILQLCADIDNYLRIGKYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ClbP peptidase
publication title The NRP peptidase ClbP as a target for the inhibition of genotoxicity, cell proliferation and tumorogenesis mediated by pks-harboring bacteria
rcsb
source organism Escherichia coli
total genus 89
structure length 310
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4e6xA00
4OP5A 3BM6A 4XUXA 5CHJA 5IHVA 1NYYA 3PAEA 3SS5A 3IWIA 3Q81A 2EX6A 2HPBA 4WZ5C 3M2JA 2H0TA 4K0WA 4HBTA 3ZNTA 5FQKA 1EROA 2HP5A 2Z2LB 2P9VA 3A3IA 3AGDA 3N6IA 1JWPA 4KZ9A 1K57A 3OPRA 3UDXA 2WGVA 1JTGA 3NDEA 1HTZA 4YFMA 1LLBA 3M6HA 5GL9A 5HAIA 1FOFA 4S2NA 1MWSA 1MWTA 4QU3A 4DE1A 1MBLA 4E6WA 3ITBA 2EX2A 2J9PA 3IHBA 3O86A 2H5SA 4C75A 1FCMA 5FQJA 4UA6A 1IYOA 4OQHA 2J7VA 2CC1A 5FDHA 3GTCA 3FV7A 5TR7A 1KDSA 3O3VA 1BLPA 3WRZA 3CMZA 2DNSA 1IYQA 3W4PA 5F1GA 3IT9A 1ERMA 1NZOA 4DKIA 3NIAA 3Q7VA 4WEJA 5FAOA 5GLDA 4ZJ2A 3RXXA 2HDQA 1Q2QA 4FD8A 5FQIA 5KZHA 3GRJA 3B3XA 5GLAA 4H8RA 4JLFA 5CGSA 2P74A 2ZQ9A 2ZC3B 2ZD8A 3IF6C 4Q8IA 4DRTA 4QB8A 3Q07A 1E25A 4RX3A 2B5RA 4OLDA 3TSGA 3VP4A 1K4EA 4PM5A 3OZHA 2A49A 3OPHA 1FQGA 1YMSA 1GA9A 1W8YA 4S2MA 4Y0OA 3VFHA 4OLGA 2H0YA 1YLPA 2EFXA 4LV2A 3ZG7B 1K6RA 5GHZA 3NY4A 2HP6A 4HBUA 3N8RA 4LV3A 1ONHA 4EBLA 2WGWB 4GOGA 3IH8A 4D2OA 2X02A 1NZUA 1ALQA 2V20A 3JYIA 3NCKA 4KQQA 4WZ5A 5CXWA 2Y91A 1TVFA 3SS4A 4GN2A 3UE0A 4GB7A 4WMCD 4Y0UA 1O07A 4LV1A 4X69A 3S4XA 3WS2A 1PZPA 2GDNA 5FQMA 3HLGA 5CEBA 3HUMA 2EX8A 3OPLA 4S2IA 2JBFA 5FASA 4HESA 3ZFZA 1M40A 3VSKA 1M6KA 3ZCZA 4OQIA 2X71A 3G35A 1MY8A 1SCWA 3E2LA 1PWDA 4E3NA 4DF6A 3HUNA 1NY0A 4O7DA 2XK1A 5EE8A 4S2PA 4E3JA 3HREA 1MXOA 3A3JA 4P0MA 4S2OA 1EWZA 1Q2PA 4X6TA 4B4XA 1J9MA 3EQVA 4E3KA 2XFTA 1JWVA 2IWCA 2RCXA 2XEPA 1E3UD 4FH4A 2G2UA 2HP9A 3LY4A 3OC2A 4ZBEA 2R9WA 2FFYA 4NETA 2Q9NA 3WS4A 1O7EA 3FYZA 3HL9A 1IYPA 4E3OA 1FCNA 1ERQA 3W4QA 1CEGA 4OOYA 4RVAA 1I5QA 4JPMA 3IQAA 1L2SA 2Y2IA 1ES3A 4GD8A 2WAEA 5J8XA 5M19A 1WE4A 3G2YA 5L2FA 4NK3A 4EUZA 4GD6A 1PI4A 1W5DA 1NJ4A 4XUZA 3MXSA 3VSLA 2ZC6B 3ZGAB 2Y4AA 3IHAA 3IXHA 4BD0A 3A3DA 2PU2A 1DY6A 5HW3A 1BUEA 4OPYA 1RP5A 1XX2A 5AQ9A 2RL3A 1RGZA 1IYSA 4N9KA 1LI0A 2XDMA 5E2EA 1ES2A 5F83A 1ZC2A 5HX9A 5EOEA 3UPPA 5CGWA 2XR0A 2ZQCA 3HLDA 5A90A 1H8ZA 2FFFB 3ZVWA 3BECA 3CJMA 1DJBA 1HD8A 1XXMA 1K56D 1MWUA 3PBSA 5U47A 3G32A 1BLCA 1GHMA 4BJPA 4R3BA 4JXWA 5FSRA 4QY5A 4U3TA 1E3UA 1MPLA 2H10A 2JC7A 5HAQA 2A3UA 3BYDA 1N4OA 1I2SA 1LHYA 4WZ4A 3FWLA 4IVKA 3BLMA 2BLSA 4X68A 2ZQAA 1HVBA 1IKGA 4DE3A 1SDNA 1AXBA 1MWRA 4JXSA 4OQGA 3G34A 3GMWA 3N4IA 3MZDA 5TGFA 2J9OA 1IELA 1BSGA 2OSUA 1LL9A 3WRTA 4MNRA 2VGKA 3GSGA 4OVDA 3UDFA 1GHIA 3NI9A 2ZC5B 3GV9A 5CGXA 3HLWA 3VP0A 3UE1A 2HDRA 3VP2A 5FQQA 1I2WA 3DWKA 1FSYA 4DXCA 4R4RA 4OP8A 2ZQDA 2C6WB 1RGYA 4ZTKA 4FCFA 4Y0TA 1VQQA 1N9BA 3LY3A 4RYEA 3AGEA 4LCMA 4KG6A 2IWBA 4BD1A 4GDBA 1BT5A 1BTLA 3PAGA 4KZ5A 2ZC7A 4YINA 4KQOA 4N1HA 2ZMAA 1TDLA 3DWZA 3FKWA 3CZDA 3NBLA 3HLBA 5CHMA 3WS1A 4PMAA 5JYOA 2WGWA 3BFGA 1IKIA 3V3SA 1FSWA 1LL5A 5EVID 2WUQA 3ZG8B 1PIOA 3W4OA 1PWGA 2EXBA 4OQ0A 2Q9MA 2Y2QA 3IXGA 3V3RA 1PW1A 3ZDJA 3WS0A 1TEMA 1ZKJA 4K0XA 3MFDA 4R4SA 1K54C 2ZM8A 3BFEA 5KSHA 1ES5A 2XD5A 4IVIA 3UPOA 1PYYA 3C5AA 3I7JA 2OLVA 5EUAA 3A3EA 3QHYA 3UO9A 2Y2HA 1YLWA 4KZ8A 2JCHA 5FI7A 1WYCA 3BEBA 4PM6A 1K55C 1XGJA 3OPPA 1Y54A 3SS3A 5DF9A 1K25A 3PBQA 2WAFA 4QHCA 3VOYA 2Y2MA 3AGFA 4QY6A 1YM1A 3SOIA 3DW0A 5DTSA 5GHXA 3G30A 3O88A 4OOLA 3OCNA 2WYXA 5M1AA 3ZG5A 1ESIA 1YLZA 5CHUA 2C5WB 1CI9A 1K57C 2QMIA 5FI6A 3MKFA 4MBFA 4S2JA 4R1GA 5A93A 3PBRA 4L0LA 1FCOA 5FAPA 5E43A 2VGJA 4KZ6A 4RX2A 3N7WA 4BL3A 2Y2PA 3IF6A 4JKTA 2ZJ9A 4N92A 5FI2A 5AQAA 2XD1A 3SH7A 3WS5A 3N8LA 5HARA 5F1FA 2PU4A 5EVIB 4JXVA 4DDSA 2V2FF 3FKVA 1KE4A 2XF3A 5BOHA 2ZLYA 3IF5A 5EECA 3IWOA 3ZG9B 2J8YA 1EI5A 1S0WA 4Z9QA 2R9XA 1W79A 2Y55A 2DRWA 4GDNA 4WMCA 3IWQA 3M6BA 3NDGA 2Y2OA 3MXRA 4KZ4A 4EWFA 5FQ9A 4WEKA 4MLLA 3HLFA 3Q7ZA 4KQRA 4KZ3A 3TG9A 2ZM2A 1K54A 1YQSA 2OV5A 3P98A 5DTKA 5GLCA 2WADA 2HDSA 3RXWA 3VP1A 4EBPA 1KGFA 1KDWA 3G2ZA 1QMFA 5KMWA 2V1ZA 1BLHA 4ZAMA 4E3MA 1KVLA 4JF5A 4N9LA 5DTTA 1C3BA 3C7UA 3A3FA 1W8QA 5E2FA 1YLYA 5DF7A 4E6XA 3UY6A 4CJNA 5HAPA 3V5MA 1KGGA 1Z6FA 1JVJA 4KZAA 4K91A 4BLMA 3HLEA 1K55A 1DJCA 2EX9A 2Y2LA 4Y7PA 3D4FA 3FZCA 3HUOA 5DVAA 2WZXA 2ZM0A 1NYMA 3NC8A 4LV0A 3EQUA 2WK0A 4PM7A 5CERA 4OH0A 4FSFA 4R0QA 4PPRA 1WYBA 1L0EA 4GZBA 3CG5A 2X01A 1TDGA 5AQBA 3BFCA 4S2LA 1CEFA 2Y2GA 5I94A 4MBKA 1BULA 4IBRA 1U60A 3UDIA 3BRMA 2G2WA 1SHVA 1ZG4A 1GHPA 4QD4A 1GCEA 2P9VB 1XGIA 1OMEA 3O87A 5AQ7A 1H8YA 3IXDA 4KG2A 4CPKA 5D3OA 3V50A 3LEZA 4S2KA 4HEFA 3MBZA 4R23A 1K6SA 1DJAA 3MKEA 5EVIC 2XLNA 5HFOA 4EQIA 2QPNA 2ZQ8A 4EBNA 4P87A 1QMEA 1BLSA 3GQZA 4X55A 3RJUA 1K38A 2EXAA 4FH2A 3QNCA 2WKIA 3ISGA 4X53A 5KSCA 3BFFA 3N8SA 5DF8A 1KGEA 1FR1A 4P85A 3SH8A 4DE2A 1K56A 4GNUA 4C3QA 2Y59A 5EVLA 4DDYA 1S6RA 4A5RA 4OOMA 1RCJA 4UA7A 1ES4A 3PBNA 3ZHHA 1ONGA 2Y2NA 1XA1A 3Q7VB 3IH9A 3GVBA 4E3IA 5CECA 1CI8A 1FR6A 2JE5A 2OLUA 4WELA 3C4PA 4UAAA 1L0FA 1VM1A 4UA9A 3VFFA 4KG5A 3V39A 2ZC4B 1KVMA 3HVFA 4F94A 3LO7A 1GA0A 4PM8A 4WM9A 3PBTA 4MEZA 5CTNA 3ZVTA 1CK3A 3G4PA 4EV4A 1G68A 2XFSA 4LENA 4MBHA 4B4ZA 3UPNA 1SDEA 4GKUA 1LI9A 5FAQA 1MKIA 4UHUA 2BG1A 1YT4A 1YLTA 4C6YA 5F82A 5GLBA 3S1YA 1E4DA 3UN7A 3ZNYA 1PI5A 2HDUA 5A91A 5E2HA 3SH9A 3HBRA 1YLJA 3MZEA 2PBYA 2ZQ7A 4X56A 5EPHA 5E2GA 3VOZA 4U0XA 5JYPA 2EFUA 5A92A 3UE3A 1KE0A 1ZG6A 2E8IA 4DE0A 3ITAA 1XKZA 1L0GA 3TOIA 4WBGA 4U0TA 3QNBA 2XQZA 4M3KA 4OONA 1JWZA 2Y2KA 1KE3A 5FA7A 1BZAA 4IEDA 1PWCA 4WYYA 3P09A 4S2NC 1G6AA 1NXYA 3BLSA 4JF4A 4ZJ1A 5EVIA 3LCEA 1PW8A 3HLCA 1YMXA 3PBOA 2QZ6A 4PM9A 4ID4A 4OPRA 4ZDXA 4ZJ3A 1H5XA 4QJGA 1NRFA 3W8KA 5EOOA 4LCLA 1L0DA 4IBXA 1XP4A 2IWDA 3M2KA 1XPBA 5G18A 4E3LA 4OKPA 4BQMA 1PZOA 3E2KA 4BENA 2WKHA 4JXGA 2Y2JA 4OPZA 4DXBA 3IXBA 4JF6A 3ZG0A 2XH9A 2WGIA 3C7VA 2I72A 3G31A 4B88A 3MZFA 3Q1FA 3BFDA 1IEMA 5FATA 1XA7A 4XXRA 3OCLA 3VMAA 1JTDA 1HZOA 3WWXA 4KZ7A 3DTMA 5TFQA 5M18A 1SKFA 3GR2A 1K4FA 4KZBA 4N1XA 4KENB 3IF6B 4R3JA 3S22A 1ESUA 2Z2MB 2DCFA 4OPQA 5CRFA 3UNWA 3VP3A 5HL1A 2XGNA 4BL2A 3C4OA 5CEDA 4RA7A 5GHYA 1W7FA 4P6BA 4JBFA 3Q82A 3PTEA 5CTMA 2WKEA 2WZZA 2UWXA
chains in the Genus database with same CATH superfamily
5J4EA 3EOIA 2M7VA 3VOLA 3CUEC 1YSPA 3BM6A 3SS5A 3JPUA 5DFYA 4K0WA 4G3KA 3A3IA 4KZ9A 1K57A 1G6OA 5GL9A 2XROA 4S2NA 1MWTA 4DE1A 1W63M 4C75A 1ZTUA 4BWIA 2VZWA 2YKHA 1TF1A 2J7VA 3LIDA 5FDHA 3FV7A 3O3VA 3WRZA 3A0SA 5F1GA 3PHYA 4WEJA 2HDQA 5HDSA 1Q2QA 2J80A 4QPRA 3GRJA 2FZ0A 3PR6A 2ZD8A 1CJFA 5HWTA 3VP4A 4HI4A 1OTEA 3OZHA 2A49A 2H0YA 3ZG7B 1S1ZA 3NY4A 2HP6A 3N8RA 3E0YA 4LV3A 4EBLA 3K2NA 4KQQA 4WZ5A 2GX5A 3MS6A 3JVUA 2PYPA 4X69A 2B18A 3WS2A 1PZPA 3HLGA 4LLOB 5G4ZA 3OPLA 2EX8A 5CEBA 4HH2A 3UE6A 3ZCZA 1TS0A 3G35A 1SCWA 1PWDA 1NY0A 5EE8A 4S2PA 1A0KA 4P0MA 1Q2PA 3F1NA 3TJZC 1E3UD 2PDRA 5DJUA 2Q9NA 1O7EA 5J3WA 2V9AA 3HL9A 4E3OA 3W4QA 1CEGA 1TS8A 5HD5A 1I5QA 3NJAA 4JPMA 3NOPC 1H8MA 1WE4A 5AVEA 4EUZA 1W5DA 3VSLA 3IHAA 4CLCC 4BD0A 2PU2A 1KOUA 1RP5A 2OWJA 1RGZA 1LI0A 2XDMA 1H8ZA 3ZVWA 3BECA 1HD8A 1K56D 1MWUA 4WL9A 4R3BA 1CQAA 3T50A 4QY5A 1E3UA 1MPLA 2A3UA 2GJ3A 1LHYA 4WZ4A 5G4YA 4ETXA 1SDNA 4EXOA 3GMWA 4DJ2A 5TGFA 5HPFA 3WRTA 1LL9A 2ZC5B 5FEFA 2PR6A 2JKRI 4X1MA 3HJKA 3DWKA 1FSYA 4IUHA 2HV1A 4I5SA 1VETA 2UV0E 2C6WB 3LY3A 3BJNA 4BD1A 3PAGA 4KZ5A 4YINA 1TDLA 3FKWA 3HLBA 5JYOA 1FSWA 2WUQA 1PIOA 3W4OA 3CUEA 4OQ0A 5HDDA 3KYQA 4R4SA 1NRJA 1IFQA 3I7JA 4PHTA 3H7WB 1YLWA 2JCHA 4PM6A 1K55C 3OPPA 3A0RA 4QHCA 2Y2MA 3AGFA 4PAUA 1GSXA 1YSQA 3ZG5A 3PXPA 1CI9A 4S2JA 4L0LA 5FAPA 2O9BA 5FI2A 2XD1A 3SH7A 4E04A 5TBMB 2PU4A 4HJ6A 5EVIB 1KE4A 5BOHA 3ZG9B 3EGXC 3KO6A 1S67L 2L1MA 1CF0A 2Y2OA 3T1QB 1P9WA 3SZTA 1OTDA 4MLLA 4UEYA 3FPWA 4KZ3A 3TG9A 2ZM2A 1K54A 1YQSA 1H0MA 2HDSA 3RXWA 1KGFA 1KVLA 3B33A 4JF5A 4N9LA 5C5KA 1LSVA 2JHEA 1JVJA 2VV7A 4BLMA 3D4FA 3HUOA 3BQAA 3NC8A 3S7PA 4LV0A 3EQUA 4OH0A 1OJ5A 1L0EA 4GZBA 3CG5A 3C2WA 2X01A 3MQOA 3BFCA 2W3HA 4S2LA 1BULA 4IBRA 2G2WA 1SHVA 1ZG4A 4IUKA 3V67A 2P9VB 1XGIA 1H8YA 4CPKA 3V50A 4R23A 3E98A 1EW0A 2QPNA 3KSIA 3RJUA 3QNCA 3ISGA 4CLCA 5DF8A 4C3QA 4A5RA 1RCJA 3NECA 4UA7A 5IT5A 3T4LA 1DRMA 2W27A 1VB6A 2OLUA 2JE5A 3C4PA 4GJ4A 3V39A 3S7QA 4F94A 1GA0A 3H7WA 3B42A 4LRZE 4B9OA 5FEGA 1MKIA 1PI5A 3U2AA 5E2HA 2EFUA 5A92A 1S66L 2E8IA 5EFWA 1PWCA 3P09A 4S2NC 1G6AA 1NXYA 4JF4A 5EVIA 4HOIA 4Q0JA 4PM9A 4ID4A 5A8BA 4ZDXA 4LCLA 1Y4OA 4HP9A 2MJ6A 2INWA 4JXGA 4DXBA 1XJ6A 3IXBA 3C7VA 3G31A 5FATA 1XA7A 5M18A 1K4FA 4KENB 3IF6B 2Z2MB 1X0OA 4EEUA 2XGNA 4BL2A 2FH5A 5CEDA 4EUVA 5CTMA 5L8MA 2WZZA 1S4SA 1PNEA 4XUXA 1T18A 3MR0A 2NUTC 3PAEA 3BY8A 2J3WA 2HPBA 4WZ5C 2H0TA 2HP5A 2Z2LB 2P9VA 3UDXA 2WGVA 2OAQ1 4LRXC 3M6HA 1BYWA 2G7UA 4K08A 3P01A 3QP8A 2H5SA 1FCMA 3CHWP 2QKPA 5FQJA 1IYOA 1T1CA 1Y28A 4BBTA 4B93A 3MJQA 2DNSA 3W4PA 1GSWA 1ERMA 3IT9A 5FAOA 4ZJ2A 3RXXA 5KZHA 4HQAA 5CGSA 2P74A 4HHDA 2KDKA 4X25A 1E25A 4OLDA 2XA7S 3TSGA 1K4EA 1VHMA 2O0YA 4PM5A 3E4PA 1YMSA 5L07A 1GA9A 1W8YA 1OTIA 4Y0OA 4OLGA 1K6RA 5GHZA 3BWLA 2HJEA 2KLIA 4Q0IA 2Z6CA 3B47A 1MKMA 4I38A 4D2OA 2HGVA 2V20A 3NCKA 2Y91A 1TVFA 4KUOA 2KX6A 3UE0A 4GB7A 4WMCD 4Y0UA 1O07A 3S4XA 5FQMA 1UWPX 5FASA 3IBJA 1OTBA 3VSKA 4IHQA 3R4KA 2JKTI 2PBDP 2X71A 3MQ0A 5L10A 4DF6A 3HUNA 4WF0A 4E3JA 3HREA 3A3JA 4S2OA 1EWZA 1J9MA 3EQVA 4E3KA 2IWCA 2RCXA 3LIEA 2G2UA 2HP9A 3LY4A 1YPRA 4ZBEA 2EA9A 1T1BA 3L7HA 3FYZA 3T4QA 3UMDA 4EESA 3T4OA 4O0PA 4NKPA 1L2SA 2Y2IA 4GD8A 2WAEA 3G2YA 3IXHA 4BBUA 4BBVA 3DTEA 5AQ9A 2RL3A 4XT2B 4R6LA 3VE3A 5E2EA 5F83A 1ZC2A 3UPPA 2ZQCA 3HLDA 5A90A 2FFFB 1DJBA 5U47A 4H6JA 3G32A 4JGOA 5FSRA 2JC7A 5EM0A 3BYDA 1N4OA 3FWLA 3BLMA 4DE3A 1IOUA 4JXSA 1MWRA 2VEAA 3MZDA 2OSUA 1BSGA 4MNRA 4OVDA 1GHIA 3GV9A 4L9GA 1I2WA 3D3OA 2V8FA 5F6AA 4R4RA 2ZQDA 2H28A 1RGYA 4ZTKA 4GS9B 4LCMA 2IWBA 4GDBA 1BT5A 3UB5P 2WKQA 2W3DA 2B02A 4KQOA 2ZMAA 3CZDA 1LSWA 3WS1A 2B95A 3BFGA 1PWGA 2Q9MA 4L9FA 2ZOIA 1TEMA 1ZKJA 4K0XA 1K54C 5KSHA 4ME4A 2W3FA 1LSXA 1L3LA 3QHYA 4HH3A 4Y5FA 1XGJA 3SS3A 2Z6DA 1XFNA 1YM1A 3SOIA 3H82B 3O88A 4OOLA 3OCNA 2WYXA 1ESIA 4ETZA 3QP4A 5A93A 3PBRA 1FCOA 5E43A 2VGJA 4KZ6A 3N7WA 2OWHA 2Y2PA 2VV6A 2ZJ9A 4N92A 3RFBA 5AQAA 3N8LA 4JXVA 2XF3A 1WA9A 3IF5A 3CAXA 3KYZA 5EECA 3IWOA 1EI5A 1G28A 5DKLA 4GW9A 5DKKA 2DRWA 2VV8A 4GDNA 3M6BA 3JVVA 3NULA 4XT2A 3CI6A 1GSVA 4NXEA 5FQ9A 3Q7ZA 3P98A 5DTKA 2WADA 3TE8A 4Y13A 2V1ZA 1BLHA 3D72A 5DF7A 4E6XA 4WN5A 3UY6A 4CJNA 3HLEA 2Y2LA 1DJCA 3FZCA 3ULFA 5DVAA 2ZM0A 1NYMA 4R0QA 4PPRA 3T1RA 1CEFA 4L9EA 3MFXA 3NOUC 2CMNA 1GCEA 5AQ7A 1OMEA 2ZBBA 4KG2A 4EEPA 3LEZA 4GS9A 5I5LA 5EVIC 1UGUA 3H9WA 2W1TB 4P87A 1N9NA 1K38A 2EXAA 4FH2A 2ZMFA 3QP5A 5KSCA 5HSQA 3N8SA 1KGEA 4P85A 3SH8A 4DE2A 3RTYA 1K56A 4GNUA 5EVLA 2Q0OA 1S6RA 4OOMA 4P6ZS 4MCWA 1ES4A 2Y2NA 1XA1A 3Q7VB 3TW8A 3GVBA 2KOIA 5CECA 1OT9A 3VFFA 1L0FA 1VM1A 3DAVA 1KVMA 2J3TC 4EERA 3LR5A 5CTNA 1OJGA 1CK3A 4LENA 4B4ZA 3UPNA 3LR3A 4GKUA 5FAQA 1LI9A 3QP1A 3K3CA 4UHUA 3H82A 5F82A 4RQ9A 1E4DA 3ZNYA 5HWVA 4LFUA 3MZEA 2ZQ7A 4X56A 5EPHA 3UE3A 1XKZA 4WBGA 4U0TA 1JWZA 3OOVA 2Y2KA 4IEDA 1F2KA 2P08A 1F98A 2IA2A 1PW8A 3HLCA 3T4TA 3MSHA 1STZA 4OPRA 3RH8B 4ZJ3A 4QJGA 3NHQA 2QJ5A 4IBXA 2IWDA 3M2KA 4OKPA 4BQMA 1PZOA 3ZG0A 3OLOA 4B88A 3CLOA 3A0VA 5TFQA 4N1XA 4KZBA 1N9LA 4R70A 3S22A 1ESUA 5F69A 4OPQA 3VP3A 3C4OA 1S4RA 2GNXA 1W7FA 4JBFA 2WKEA 4II7A 3IBRA 5CHJA 4ESPA 5IHVA 2VX8A 3Q81A 3W2ZA 1AWIA 3ZNTA 2OOLA 1EROA 1JWPA 1JTGA 3NDEA 1HTZA 1LLBA 1FOFA 1MWSA 3D9YA 5AVFA 1MBLA 2J9PA 4MMNA 4D60A 1T1AA 4Y2FA 3MMHA 2CC1A 3LUQA 3GTCA 1KDSA 2EWWA 3CMZA 1IYQA 5HPIA 1NZOA 5IU1A 3NIAA 3Q7VA 5GLDA 4FD8A 5FQIA 1MC0A 4H8RA 2ZQ9A 2D02A 3IF6C 4Q8IA 4DRTA 3Q07A 3E4QA 4O8GA 2K31A 4I3JA 2L0WA 4S2MA 4EQ1A 3VFHA 3DTKA 2EFXA 4LV2A 4DJ3A 4GHIB 3ZQ5A 4HBUA 1Z09A 1DP6A 1ONHA 2WGWB 4AFIA 4Q0HA 1ALQA 3ZYTA 5CXWA 2PD8A 1VEUB 4GN2A 3SS4A 2JKRM 4LV1A 2GDNA 4PKYG 4HESA 1M40A 3F1PB 4OQIA 5TBMA 3LYXA 4O7DA 3C30A 2PT7A 4X6TA 1V9ZA 4EU0A 1JWVA 1P0ZA 2V8CA 3OC2A 2FFYA 4NETA 1DP8A 3R7WB 2HF6A 1FCNA 3T1XA 1ERQA 2Y8HA 3FC7A 3IQAA 3LI8A 5J8XA 2A2LA 5M19A 5L2FA 4NK3A 4GD6A 4XUZA 1NJ4A 1NLZA 2ZC6B 3ZGAB 2Y4AA 1K0KA 5HW3A 3LR0A 4FTXA 3TRCA 5HX9A 5CGWA 2XA7M 4G3VA 1LL8A 5HL6A 3T1SA 3CJMA 5HWWA 4BJPA 4JXWA 2WKPA 2W1RA 4U3TA 2H10A 5HAQA 1I2SA 1SKOB 2BLSA 3T4SA 4X68A 2ZQAA 3LICA 5IS1A 1AXBA 4OQGA 2JN7A 3G34A 3N4IA 2D01A 3O5YA 3GSGA 3LI9A 4NXGA 4I3IA 5CGXA 3HLWA 3VP0A 1XJ3A 3UE1A 2HDRA 1ODVA 3VP2A 5FQQA 4DXCA 4OP8A 4Y0TA 2ACGA 1VQQA 2YKFA 3AGEA 2OAP1 4KG6A 2ZC7A 4GHIA 3DWZA 4R38A 4X1LA 5CHMA 1F5MA 3UB7A 4PMAA 4MN5A 2WGWA 1NLYA 3V3SA 1LL5A 2XRNA 2W0NA 4NEED 1VEUA 1PW1A 3ZDJA 3WS0A 3MFDA 1N9OA 3BFEA 2ZOHA 1ES5A 2XD5A 3LIFA 4IVIA 3F1PA 3C5AA 2OLVA 3A3EA 4O01A 3UO9A 3G6OA 4YNRA 4KZ8A 4MN6A 4M4XA 1D06A 1FIKA 1Y54A 1K25A 3PBQA 2WAFA 4QY6A 4NXBA 3DW0A 4NXFA 5GHXA 3GDIA 2ZMVA 2QWSA 3KSFA 3R7WA 2V1BA 2QMIA 5FI6A 3MKFA 1J3WA 3IF6A 1DP9A 2Y79A 3FG8A 3S7OA 4DDSA 3FKVA 4FUWA 1D7EA 3CWFA 4I3AA 2J8YA 4Z9QA 2Y55A 2BTFP 4WMCA 3IWQA 3NDGA 1ACFA 4ARZB 3MXRA 4EWFA 3HLFA 3CPTB 5GLCA 3LGOA 2I9VA 3VP1A 4EBPA 1KDWA 3G2ZA 3IS2B 1QMFA 4ZAMA 2V0UA 3T12B 3A3FA 1W8QA 5E2FA 1ZHHB 1F9IA 4KZAA 2LB9A 4K91A 4DN0A 2EX9A 4Y7PA 3KSGA 1XJ2A 2WK0A 5CERA 4FSFA 5F5YA 1WYBA 1TDGA 3NOTC 5AQBA 5I94A 2EWVA 4UQIS 3UDIA 1GHPA 4QD4A 3ICYA 5D3OA 4S2KA 3KYEA 3MBZA 4JGQA 1K6SA 1DJAA 3U4LP 2XLNA 4EQIA 3QP6A 2ZQ8A 4EBNA 1BLSA 5L09A 2A24B 1FR1A 5EVEA 4R3AA 1UWNX 4CLCE 3ZHHA 1ONGA 1P97A 2GZAA 3IH9A 1CI8A 2QYBA 2W3EA 2PAVP 1T19A 4UAAA 4LGWA 4KG5A 2ZC4B 3VV4A 1VETB 3UB8A 3HVFA 3UB6A 4DMZA 4WM9A 3PBTA 4PKYA 1TS7A 3G4PA 2XFSA 4MBHA 3EWKA 1SDEA 4C6YA 2BG1A 1YT4A 1YLTA 3UN7A 2HDUA 4YOFA 3HBRA 3IX4A 4Y15A 4U0XA 5KIZA 1KE0A 4DE0A 1L0GA 3P7NA 4M3KA 4OONA 4HIAA 1KE3A 5EV0A 3BLSA 2E8JA 3PYPA 1YMXA 2PR5A 2QZ6A 1NRFA 5EOOA 1L0DA 1XP4A 4ARZA 5K5BA 5G18A 1XPBA 4HP4A 3E2KA 4BENA 1XFQA 2Y2JA 4OPZA 2XH9A 3CPTA 3KX0X 2V1AA 2L4RA 4G3WA 3Q1FA 3BFDA 1IEMA 3OCLA 3VMAA 1JTDA 3IS2A 4KZ7A 3GR2A 3LIAA 2DCFA 5HL1A 2P04A 4P6ZM 5GHYA 2JKTM 3LFVA 3PTEA 4OP5A 5TJJA 1NYYA 3IWIA 2PD7A 2EX6A 1P9RA 3M2JA 2PHYA 4HBTA 2NUPC 3BY9A 5FQKA 3N6IA 4JGPA 3AGDA 4YWZA 3OPRA 2VK3A 4YFMA 3UB9A 5HAIA 4QU3A 4E6WA 3ITBA 2EX2A 1SZVA 3IHBA 3O86A 2A24A 4UA6A 1XJ4A 4OQHA 5TR7A 1BLPA 1JNUA 4DKIA 3K3DA 3B3XA 5GLAA 4JLFA 2ZC3B 2O9AA 2HJ9C 4QB8A 4RX3A 2B5RA 4CQHA 3OPHA 1FQGA 1YLPA 3S7NA 4CLCB 1S1YA 4GOGA 3IH8A 3LEQA 5F68A 4NG2A 2X02A 1NZUA 3JYIA 5CX7A 3BW6A 2R78A 3HUMA 3HCYA 4S2IA 2JBFA 3ZFZA 1M6KA 1MY8A 3E2LA 4E3NA 2XK1A 2VLGA 1MXOA 4B4XA 2VGLM 2XFTA 2XEPA 4FH4A 5MC7A 2R9WA 3WS4A 2LB5A 4MDZA 4WLAA 1IYPA 4LRYC 4WUJA 5HZHA 4OOYA 4RVAA 1G5UA 1ES3A 3IX8A 1PI4A 4HNBA 3MXSA 3A3DA 1DY6A 1BUEA 4OPYA 4Z1WA 4Y17A 2WKRA 1XX2A 2K7SA 4EW7A 2QJ7A 1IYSA 1HLUP 4N9KA 3MXQA 1V9YA 1ES2A 5EOEA 1NWZA 2XR0A 2PRFA 4CLCD 3F1OB 2VGLS 1XXMA 3PBSA 4I39A 1BLCA 1GHMA 1MZUA 4GLQA 2HZ5A 2W1TA 4GCZA 4IVKA 2JKGA 5FL3A 1HVBA 4EETB 1IKGA 2K2NA 2VJWA 4KQDA 2V0WA 2J9OA 1IELA 2VGKA 2M7UA 3UDFA 3NI9A 3CITA 2JKFA 1YKDA 4FCFA 5J7EA 3OBFA 1N9BA 3EEAA 4RYEA 4FOFA 1BTLA 5DFXA 4N1HA 3MQQA 5HD3A 3NBLA 3LR4A 1IKIA 5EVID 2ZL1B 3ZG8B 1PRQA 2EXBA 2PYRA 2Y2QA 3IXGA 3V3RA 2ZM8A 4QWOA 3C38A 3T4KA 3FPVA 3UPOA 1PYYA 4LPZA 5EUAA 2Y2HA 5FI7A 1W63Q 1WYCA 3BEBA 5DF9A 3VOYA 1OTAA 2J3TD 2QHKA 5DTSA 3G30A 5M1AA 1YLZA 5CHUA 2C5WB 4KUKA 1K57C 1PFLA 4MBFA 4R1GA 4RX2A 4BL3A 1YAXA 1TS6A 3KSHA 4JKTA 3BQ8A 3WS5A 2O9CA 5HARA 5F1FA 1FILA 2V2FF 2ZLYA 1TD5A 1S0WA 2R9XA 1W79A 4F3LB 5DJTA 4KZ4A 4WEKA 4KQRA 3F1OA 1H3QA 2OV5A 2VA0A 5KMWA 4E3MA 5FDSA 5DTTA 1C3BA 3C7UA 3E4OA 1YLYA 5HAPA 3V5MA 1KGGA 1Z6FA 1K55A 3DTIA 2WZXA 4PM7A 5LBRA 4BMWA 2AVXA 2Y2GA 4MBKA 3QP2A 1U60A 3BRMA 3EGDC 3MF0A 3O87A 4H6JB 3IXDA 4HEFA 3T4JA 5HFOA 3MKEA 2XSSA 3SW1A 1QMEA 4HY8A 3GQZA 4X55A 2WKIA 4X53A 3BFFA 3UMEA 2O99A 2ZL1A 2Y59A 4DDYA 3HJIA 3PBNA 4E3IA 4WELA 1FR6A 1OPXA 1OT6A 3VE4A 4UA9A 5AJGA 4Y3IA 2DMWA 4MN7A 3LO7A 4PM8A 4MEZA 3ZVTA 4EV4A 1G68A 4ZRRA 5HDCA 5EM1A 4JGRA 5GLBA 3S1YA 3EEHA 5A91A 2BASA 3SH9A 1YLJA 2PBYA 3VOZA 5E2GA 5JYPA 1ZG6A 2P7JA 3ITAA 3TOIA 1D1JA 3QNBA 2XQZA 5FA7A 1BZAA 4WYYA 4HJ3A 4ZJ1A 4HJ4A 4IJGA 3LCEA 3PBOA 1H5XA 3W8KA 4F3LA 4UQIM 2VKSA 3LIBA 3C8CA 4E3LA 2WKHA 3F1NB 4JF6A 2WGIA 2I72A 3MZFA 3WWXA 4XXRA 2M1CA 1HZOA 3DTMA 3GECA 3L9KA 1SKFA 4R3JA 5CRFA 3UNWA 3IX3A 3DBAA 4RA7A 1SKOA 4P6BA 3Q82A 2W3GA 1LT0A 2UWXA
chains in the Genus database with same CATH topology
4OP5A 3BM6A 4XUXA 5CHJA 5IHVA 1NYYA 3PAEA 3SS5A 3IWIA 3Q81A 2EX6A 2HPBA 4WZ5C 3M2JA 2H0TA 4K0WA 4HBTA 3ZNTA 5FQKA 1EROA 2HP5A 2Z2LB 2P9VA 3A3IA 3AGDA 3N6IA 1JWPA 4KZ9A 1K57A 3OPRA 3UDXA 2WGVA 1JTGA 3NDEA 1HTZA 4YFMA 1LLBA 3M6HA 5GL9A 5HAIA 1FOFA 4S2NA 1MWSA 1MWTA 4QU3A 4DE1A 1MBLA 4E6WA 3ITBA 2EX2A 2J9PA 3IHBA 3O86A 2H5SA 4C75A 1FCMA 5FQJA 4UA6A 1IYOA 4OQHA 2J7VA 2CC1A 5FDHA 3GTCA 3FV7A 5TR7A 1KDSA 3O3VA 1BLPA 3WRZA 3CMZA 2DNSA 1IYQA 3W4PA 5F1GA 3IT9A 1ERMA 1NZOA 4DKIA 3NIAA 3Q7VA 4WEJA 5FAOA 5GLDA 4ZJ2A 3RXXA 2HDQA 1Q2QA 4FD8A 5FQIA 5KZHA 3GRJA 3B3XA 5GLAA 4H8RA 4JLFA 5CGSA 2P74A 2ZQ9A 2ZC3B 2ZD8A 3IF6C 4Q8IA 4DRTA 4QB8A 3Q07A 1E25A 4RX3A 2B5RA 4OLDA 3TSGA 3VP4A 1K4EA 4PM5A 3OZHA 2A49A 3OPHA 1FQGA 1YMSA 1GA9A 1W8YA 4S2MA 4Y0OA 3VFHA 4OLGA 2H0YA 1YLPA 2EFXA 4LV2A 3ZG7B 1K6RA 5GHZA 3NY4A 2HP6A 4HBUA 3N8RA 4LV3A 1ONHA 4EBLA 2WGWB 4GOGA 3IH8A 4D2OA 2X02A 1NZUA 1ALQA 2V20A 3JYIA 3NCKA 4KQQA 4WZ5A 5CXWA 2Y91A 1TVFA 3SS4A 4GN2A 3UE0A 4GB7A 4WMCD 4Y0UA 1O07A 4LV1A 4X69A 3S4XA 3WS2A 1PZPA 2GDNA 5FQMA 3HLGA 5CEBA 3HUMA 2EX8A 3OPLA 4S2IA 2JBFA 5FASA 4HESA 3ZFZA 1M40A 3VSKA 1M6KA 3ZCZA 4OQIA 2X71A 3G35A 1MY8A 1SCWA 3E2LA 1PWDA 4E3NA 4DF6A 3HUNA 1NY0A 4O7DA 2XK1A 5EE8A 4S2PA 4E3JA 3HREA 1MXOA 3A3JA 4P0MA 4S2OA 1EWZA 1Q2PA 4X6TA 4B4XA 1J9MA 3EQVA 4E3KA 2XFTA 1JWVA 2IWCA 2RCXA 2XEPA 1E3UD 4FH4A 2G2UA 2HP9A 3LY4A 3OC2A 4ZBEA 2R9WA 2FFYA 4NETA 2Q9NA 3WS4A 1O7EA 3FYZA 3HL9A 1IYPA 4E3OA 1FCNA 1ERQA 3W4QA 1CEGA 4OOYA 4RVAA 1I5QA 4JPMA 3IQAA 1L2SA 2Y2IA 1ES3A 4GD8A 2WAEA 5J8XA 5M19A 1WE4A 3G2YA 5L2FA 4NK3A 4EUZA 4GD6A 1PI4A 1W5DA 1NJ4A 4XUZA 3MXSA 3VSLA 2ZC6B 3ZGAB 2Y4AA 3IHAA 3IXHA 4BD0A 3A3DA 2PU2A 1DY6A 5HW3A 1BUEA 4OPYA 1RP5A 1XX2A 5AQ9A 2RL3A 1RGZA 1IYSA 4N9KA 1LI0A 2XDMA 5E2EA 1ES2A 5F83A 1ZC2A 5HX9A 5EOEA 3UPPA 5CGWA 2XR0A 2ZQCA 3HLDA 5A90A 1H8ZA 2FFFB 3ZVWA 3BECA 3CJMA 1DJBA 1HD8A 1XXMA 1K56D 1MWUA 3PBSA 5U47A 3G32A 1BLCA 1GHMA 4BJPA 4R3BA 4JXWA 5FSRA 4QY5A 4U3TA 1E3UA 1MPLA 2H10A 2JC7A 5HAQA 2A3UA 3BYDA 1N4OA 1I2SA 1LHYA 4WZ4A 3FWLA 4IVKA 3BLMA 2BLSA 4X68A 2ZQAA 1HVBA 1IKGA 4DE3A 1SDNA 1AXBA 1MWRA 4JXSA 4OQGA 3G34A 3GMWA 3N4IA 3MZDA 5TGFA 2J9OA 1IELA 1BSGA 2OSUA 1LL9A 3WRTA 4MNRA 2VGKA 3GSGA 4OVDA 3UDFA 1GHIA 3NI9A 2ZC5B 3GV9A 5CGXA 3HLWA 3VP0A 3UE1A 2HDRA 3VP2A 5FQQA 1I2WA 3DWKA 1FSYA 4DXCA 4R4RA 4OP8A 2ZQDA 2C6WB 1RGYA 4ZTKA 4FCFA 4Y0TA 1VQQA 1N9BA 3LY3A 4RYEA 3AGEA 4LCMA 4KG6A 2IWBA 4BD1A 4GDBA 1BT5A 1BTLA 3PAGA 4KZ5A 2ZC7A 4YINA 4KQOA 4N1HA 2ZMAA 1TDLA 3DWZA 3FKWA 3CZDA 3NBLA 3HLBA 5CHMA 3WS1A 4PMAA 5JYOA 2WGWA 3BFGA 1IKIA 3V3SA 1FSWA 1LL5A 5EVID 2WUQA 3ZG8B 1PIOA 3W4OA 1PWGA 2EXBA 4OQ0A 2Q9MA 2Y2QA 3IXGA 3V3RA 1PW1A 3ZDJA 3WS0A 1TEMA 1ZKJA 4K0XA 3MFDA 4R4SA 1K54C 2ZM8A 3BFEA 5KSHA 1ES5A 2XD5A 4IVIA 3UPOA 1PYYA 3C5AA 3I7JA 2OLVA 5EUAA 3A3EA 3QHYA 3UO9A 2Y2HA 1YLWA 4KZ8A 2JCHA 5FI7A 1WYCA 3BEBA 4PM6A 1K55C 1XGJA 3OPPA 1Y54A 3SS3A 5DF9A 1K25A 3PBQA 2WAFA 4QHCA 3VOYA 2Y2MA 3AGFA 4QY6A 1YM1A 3SOIA 3DW0A 5DTSA 5GHXA 3G30A 3O88A 4OOLA 3OCNA 2WYXA 5M1AA 3ZG5A 1ESIA 1YLZA 5CHUA 2C5WB 1CI9A 1K57C 2QMIA 5FI6A 3MKFA 4MBFA 4S2JA 4R1GA 5A93A 3PBRA 4L0LA 1FCOA 5FAPA 5E43A 2VGJA 4KZ6A 4RX2A 3N7WA 4BL3A 2Y2PA 3IF6A 4JKTA 2ZJ9A 4N92A 5FI2A 5AQAA 2XD1A 3SH7A 3WS5A 3N8LA 5HARA 5F1FA 2PU4A 5EVIB 4JXVA 4DDSA 2V2FF 3FKVA 1KE4A 2XF3A 5BOHA 2ZLYA 3IF5A 5EECA 3IWOA 3ZG9B 2J8YA 1EI5A 1S0WA 4Z9QA 2R9XA 1W79A 2Y55A 2DRWA 4GDNA 4WMCA 3IWQA 3M6BA 3NDGA 2Y2OA 3MXRA 4KZ4A 4EWFA 5FQ9A 4WEKA 4MLLA 3HLFA 3Q7ZA 4KQRA 4KZ3A 3TG9A 2ZM2A 1K54A 1YQSA 2OV5A 3P98A 5DTKA 5GLCA 2WADA 2HDSA 3RXWA 3VP1A 4EBPA 1KGFA 1KDWA 3G2ZA 1QMFA 5KMWA 2V1ZA 1BLHA 4ZAMA 4E3MA 1KVLA 4JF5A 4N9LA 5DTTA 1C3BA 3C7UA 3A3FA 1W8QA 5E2FA 1YLYA 5DF7A 4E6XA 3UY6A 4CJNA 5HAPA 3V5MA 1KGGA 1Z6FA 1JVJA 4KZAA 4K91A 4BLMA 3HLEA 1K55A 1DJCA 2EX9A 2Y2LA 4Y7PA 3D4FA 3FZCA 3HUOA 5DVAA 2WZXA 2ZM0A 1NYMA 3NC8A 4LV0A 3EQUA 2WK0A 4PM7A 5CERA 4OH0A 4FSFA 4R0QA 4PPRA 1WYBA 1L0EA 4GZBA 3CG5A 2X01A 1TDGA 5AQBA 3BFCA 4S2LA 1CEFA 2Y2GA 5I94A 4MBKA 1BULA 4IBRA 1U60A 3UDIA 3BRMA 2G2WA 1SHVA 1ZG4A 1GHPA 4QD4A 1GCEA 2P9VB 1XGIA 1OMEA 3O87A 5AQ7A 1H8YA 3IXDA 4KG2A 4CPKA 5D3OA 3V50A 3LEZA 4S2KA 4HEFA 3MBZA 4R23A 1K6SA 1DJAA 3MKEA 5EVIC 2XLNA 5HFOA 4EQIA 2QPNA 2ZQ8A 4EBNA 4P87A 1QMEA 1BLSA 3GQZA 4X55A 3RJUA 1K38A 2EXAA 4FH2A 3QNCA 2WKIA 3ISGA 4X53A 5KSCA 3BFFA 3N8SA 5DF8A 1KGEA 1FR1A 4P85A 3SH8A 4DE2A 1K56A 4GNUA 4C3QA 2Y59A 5EVLA 4DDYA 1S6RA 4A5RA 4OOMA 1RCJA 4UA7A 1ES4A 3PBNA 3ZHHA 1ONGA 2Y2NA 1XA1A 3Q7VB 3IH9A 3GVBA 4E3IA 5CECA 1CI8A 1FR6A 2JE5A 2OLUA 4WELA 3C4PA 4UAAA 1L0FA 1VM1A 4UA9A 3VFFA 4KG5A 3V39A 2ZC4B 1KVMA 3HVFA 4F94A 3LO7A 1GA0A 4PM8A 4WM9A 3PBTA 4MEZA 5CTNA 3ZVTA 1CK3A 3G4PA 4EV4A 1G68A 2XFSA 4LENA 4MBHA 4B4ZA 3UPNA 1SDEA 4GKUA 1LI9A 5FAQA 1MKIA 4UHUA 2BG1A 1YT4A 1YLTA 4C6YA 5F82A 5GLBA 3S1YA 1E4DA 3UN7A 3ZNYA 1PI5A 2HDUA 5A91A 5E2HA 3SH9A 3HBRA 1YLJA 3MZEA 2PBYA 2ZQ7A 4X56A 5EPHA 5E2GA 3VOZA 4U0XA 5JYPA 2EFUA 5A92A 3UE3A 1KE0A 1ZG6A 2E8IA 4DE0A 3ITAA 1XKZA 1L0GA 3TOIA 4WBGA 4U0TA 3QNBA 2XQZA 4M3KA 4OONA 1JWZA 2Y2KA 1KE3A 5FA7A 1BZAA 4IEDA 1PWCA 4WYYA 3P09A 4S2NC 1G6AA 1NXYA 3BLSA 4JF4A 4ZJ1A 5EVIA 3LCEA 1PW8A 3HLCA 1YMXA 3PBOA 2QZ6A 4PM9A 4ID4A 4OPRA 4ZDXA 4ZJ3A 1H5XA 4QJGA 1NRFA 3W8KA 5EOOA 4LCLA 1L0DA 4IBXA 1XP4A 2IWDA 3M2KA 1XPBA 5G18A 4E3LA 4OKPA 4BQMA 1PZOA 3E2KA 4BENA 2WKHA 4JXGA 2Y2JA 4OPZA 4DXBA 3IXBA 4JF6A 3ZG0A 2XH9A 2WGIA 3C7VA 2I72A 3G31A 4B88A 3MZFA 3Q1FA 3BFDA 1IEMA 5FATA 1XA7A 4XXRA 3OCLA 3VMAA 1JTDA 1HZOA 3WWXA 4KZ7A 3DTMA 5TFQA 5M18A 1SKFA 3GR2A 1K4FA 4KZBA 4N1XA 4KENB 3IF6B 4R3JA 3S22A 1ESUA 2Z2MB 2DCFA 4OPQA 5CRFA 3UNWA 3VP3A 5HL1A 2XGNA 4BL2A 3C4OA 5CEDA 4RA7A 5GHYA 1W7FA 4P6BA 4JBFA 3Q82A 3PTEA 5CTMA 2WKEA 2WZZA 2UWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OP5 A;  3BM6 A;  4XUX A;  5CHJ A;  5IHV A;  1NYY A;  3PAE A;  3SS5 A;  3IWI A;  3Q81 A;  2EX6 A;  2HPB A;  4WZ5 C;  3M2J A;  2H0T A;  4K0W A;  4HBT A;  3ZNT A;  5FQK A;  1ERO A;  2HP5 A;  2Z2L B;  2P9V A;  3A3I A;  3AGD A;  3N6I A;  1JWP A;  4KZ9 A;  1K57 A;  3OPR A;  3UDX A;  2WGV A;  1JTG A;  3NDE A;  1HTZ A;  4YFM A;  1LLB A;  3M6H A;  5GL9 A;  5HAI A;  1FOF A;  4S2N A;  1MWS A;  1MWT A;  4QU3 A;  4DE1 A;  1MBL A;  4E6W A;  3ITB A;  2EX2 A;  2J9P A;  3IHB A;  3O86 A;  2H5S A;  4C75 A;  1FCM A;  5FQJ A;  4UA6 A;  1IYO A;  4OQH A;  2J7V A;  2CC1 A;  5FDH A;  3GTC A;  3FV7 A;  5TR7 A;  1KDS A;  3O3V A;  1BLP A;  3WRZ A;  3CMZ A;  2DNS A;  1IYQ A;  3W4P A;  5F1G A;  3IT9 A;  1ERM A;  1NZO A;  4DKI A;  3NIA A;  3Q7V A;  4WEJ A;  5FAO A;  5GLD A;  4ZJ2 A;  3RXX A;  2HDQ A;  1Q2Q A;  4FD8 A;  5FQI A;  5KZH A;  3GRJ A;  3B3X A;  5GLA A;  4H8R A;  4JLF A;  5CGS A;  2P74 A;  2ZQ9 A;  2ZC3 B;  2ZD8 A;  3IF6 C;  4Q8I A;  4DRT A;  4QB8 A;  3Q07 A;  1E25 A;  4RX3 A;  2B5R A;  4OLD A;  3TSG A;  3VP4 A;  1K4E A;  4PM5 A;  3OZH A;  2A49 A;  3OPH A;  1FQG A;  1YMS A;  1GA9 A;  1W8Y A;  4S2M A;  4Y0O A;  3VFH A;  4OLG A;  2H0Y A;  1YLP A;  2EFX A;  4LV2 A;  3ZG7 B;  1K6R A;  5GHZ A;  3NY4 A;  2HP6 A;  4HBU A;  3N8R A;  4LV3 A;  1ONH A;  4EBL A;  2WGW B;  4GOG A;  3IH8 A;  4D2O A;  2X02 A;  1NZU A;  1ALQ A;  2V20 A;  3JYI A;  3NCK A;  4KQQ A;  4WZ5 A;  5CXW A;  2Y91 A;  1TVF A;  3SS4 A;  4GN2 A;  3UE0 A;  4GB7 A;  4WMC D;  4Y0U A;  1O07 A;  4LV1 A;  4X69 A;  3S4X A;  3WS2 A;  1PZP A;  2GDN A;  5FQM A;  3HLG A;  5CEB A;  3HUM A;  2EX8 A;  3OPL A;  4S2I A;  2JBF A;  5FAS A;  4HES A;  3ZFZ A;  1M40 A;  3VSK A;  1M6K A;  3ZCZ A;  4OQI A;  2X71 A;  3G35 A;  1MY8 A;  1SCW A;  3E2L A;  1PWD A;  4E3N A;  4DF6 A;  3HUN A;  1NY0 A;  4O7D A;  2XK1 A;  5EE8 A;  4S2P A;  4E3J A;  3HRE A;  1MXO A;  3A3J A;  4P0M A;  4S2O A;  1EWZ A;  1Q2P A;  4X6T A;  4B4X A;  1J9M A;  3EQV A;  4E3K A;  2XFT A;  1JWV A;  2IWC A;  2RCX A;  2XEP A;  1E3U D;  4FH4 A;  2G2U A;  2HP9 A;  3LY4 A;  3OC2 A;  4ZBE A;  2R9W A;  2FFY A;  4NET A;  2Q9N A;  3WS4 A;  1O7E A;  3FYZ A;  3HL9 A;  1IYP A;  4E3O A;  1FCN A;  1ERQ A;  3W4Q A;  1CEG A;  4OOY A;  4RVA A;  1I5Q A;  4JPM A;  3IQA A;  1L2S A;  2Y2I A;  1ES3 A;  4GD8 A;  2WAE A;  5J8X A;  5M19 A;  1WE4 A;  3G2Y A;  5L2F A;  4NK3 A;  4EUZ A;  4GD6 A;  1PI4 A;  1W5D A;  1NJ4 A;  4XUZ A;  3MXS A;  3VSL A;  2ZC6 B;  3ZGA B;  2Y4A A;  3IHA A;  3IXH A;  4BD0 A;  3A3D A;  2PU2 A;  1DY6 A;  5HW3 A;  1BUE A;  4OPY A;  1RP5 A;  1XX2 A;  5AQ9 A;  2RL3 A;  1RGZ A;  1IYS A;  4N9K A;  1LI0 A;  2XDM A;  5E2E A;  1ES2 A;  5F83 A;  1ZC2 A;  5HX9 A;  5EOE A;  3UPP A;  5CGW A;  2XR0 A;  2ZQC A;  3HLD A;  5A90 A;  1H8Z A;  2FFF B;  3ZVW A;  3BEC A;  3CJM A;  1DJB A;  1HD8 A;  1XXM A;  1K56 D;  1MWU A;  3PBS A;  5U47 A;  3G32 A;  1BLC A;  1GHM A;  4BJP A;  4R3B A;  4JXW A;  5FSR A;  4QY5 A;  4U3T A;  1E3U A;  1MPL A;  2H10 A;  2JC7 A;  5HAQ A;  2A3U A;  3BYD A;  1N4O A;  1I2S A;  1LHY A;  4WZ4 A;  3FWL A;  4IVK A;  3BLM A;  2BLS A;  4X68 A;  2ZQA A;  1HVB A;  1IKG A;  4DE3 A;  1SDN A;  1AXB A;  1MWR A;  4JXS A;  4OQG A;  3G34 A;  3GMW A;  3N4I A;  3MZD A;  5TGF A;  2J9O A;  1IEL A;  1BSG A;  2OSU A;  1LL9 A;  3WRT A;  4MNR A;  2VGK A;  3GSG A;  4OVD A;  3UDF A;  1GHI A;  3NI9 A;  2ZC5 B;  3GV9 A;  5CGX A;  3HLW A;  3VP0 A;  3UE1 A;  2HDR A;  3VP2 A;  5FQQ A;  1I2W A;  3DWK A;  1FSY A;  4DXC A;  4R4R A;  4OP8 A;  2ZQD A;  2C6W B;  1RGY A;  4ZTK A;  4FCF A;  4Y0T A;  1VQQ A;  1N9B A;  3LY3 A;  4RYE A;  3AGE A;  4LCM A;  4KG6 A;  2IWB A;  4BD1 A;  4GDB A;  1BT5 A;  1BTL A;  3PAG A;  4KZ5 A;  2ZC7 A;  4YIN A;  4KQO A;  4N1H A;  2ZMA A;  1TDL A;  3DWZ A;  3FKW A;  3CZD A;  3NBL A;  3HLB A;  5CHM A;  3WS1 A;  4PMA A;  5JYO A;  2WGW A;  3BFG A;  1IKI A;  3V3S A;  1FSW A;  1LL5 A;  5EVI D;  2WUQ A;  3ZG8 B;  1PIO A;  3W4O A;  1PWG A;  2EXB A;  4OQ0 A;  2Q9M A;  2Y2Q A;  3IXG A;  3V3R A;  1PW1 A;  3ZDJ A;  3WS0 A;  1TEM A;  1ZKJ A;  4K0X A;  3MFD A;  4R4S A;  1K54 C;  2ZM8 A;  3BFE A;  5KSH A;  1ES5 A;  2XD5 A;  4IVI A;  3UPO A;  1PYY A;  3C5A A;  3I7J A;  2OLV A;  5EUA A;  3A3E A;  3QHY A;  3UO9 A;  2Y2H A;  1YLW A;  4KZ8 A;  2JCH A;  5FI7 A;  1WYC A;  3BEB A;  4PM6 A;  1K55 C;  1XGJ A;  3OPP A;  1Y54 A;  3SS3 A;  5DF9 A;  1K25 A;  3PBQ A;  2WAF A;  4QHC A;  3VOY A;  2Y2M A;  3AGF A;  4QY6 A;  1YM1 A;  3SOI A;  3DW0 A;  5DTS A;  5GHX A;  3G30 A;  3O88 A;  4OOL A;  3OCN A;  2WYX A;  5M1A A;  3ZG5 A;  1ESI A;  1YLZ A;  5CHU A;  2C5W B;  1CI9 A;  1K57 C;  2QMI A;  5FI6 A;  3MKF A;  4MBF A;  4S2J A;  4R1G A;  5A93 A;  3PBR A;  4L0L A;  1FCO A;  5FAP A;  5E43 A;  2VGJ A;  4KZ6 A;  4RX2 A;  3N7W A;  4BL3 A;  2Y2P A;  3IF6 A;  4JKT A;  2ZJ9 A;  4N92 A;  5FI2 A;  5AQA A;  2XD1 A;  3SH7 A;  3WS5 A;  3N8L A;  5HAR A;  5F1F A;  2PU4 A;  5EVI B;  4JXV A;  4DDS A;  2V2F F;  3FKV A;  1KE4 A;  2XF3 A;  5BOH A;  2ZLY A;  3IF5 A;  5EEC A;  3IWO A;  3ZG9 B;  2J8Y A;  1EI5 A;  1S0W A;  4Z9Q A;  2R9X A;  1W79 A;  2Y55 A;  2DRW A;  4GDN A;  4WMC A;  3IWQ A;  3M6B A;  3NDG A;  2Y2O A;  3MXR A;  4KZ4 A;  4EWF A;  5FQ9 A;  4WEK A;  4MLL A;  3HLF A;  3Q7Z A;  4KQR A;  4KZ3 A;  3TG9 A;  2ZM2 A;  1K54 A;  1YQS A;  2OV5 A;  3P98 A;  5DTK A;  5GLC A;  2WAD A;  2HDS A;  3RXW A;  3VP1 A;  4EBP A;  1KGF A;  1KDW A;  3G2Z A;  1QMF A;  5KMW A;  2V1Z A;  1BLH A;  4ZAM A;  4E3M A;  1KVL A;  4JF5 A;  4N9L A;  5DTT A;  1C3B A;  3C7U A;  3A3F A;  1W8Q A;  5E2F A;  1YLY A;  5DF7 A;  4E6X A;  3UY6 A;  4CJN A;  5HAP A;  3V5M A;  1KGG A;  1Z6F A;  1JVJ A;  4KZA A;  4K91 A;  4BLM A;  3HLE A;  1K55 A;  1DJC A;  2EX9 A;  2Y2L A;  4Y7P A;  3D4F A;  3FZC A;  3HUO A;  5DVA A;  2WZX A;  2ZM0 A;  1NYM A;  3NC8 A;  4LV0 A;  3EQU A;  2WK0 A;  4PM7 A;  5CER A;  4OH0 A;  4FSF A;  4R0Q A;  4PPR A;  1WYB A;  1L0E A;  4GZB A;  3CG5 A;  2X01 A;  1TDG A;  5AQB A;  3BFC A;  4S2L A;  1CEF A;  2Y2G A;  5I94 A;  4MBK A;  1BUL A;  4IBR A;  1U60 A;  3UDI A;  3BRM A;  2G2W A;  1SHV A;  1ZG4 A;  1GHP A;  4QD4 A;  1GCE A;  2P9V B;  1XGI A;  1OME A;  3O87 A;  5AQ7 A;  1H8Y A;  3IXD A;  4KG2 A;  4CPK A;  5D3O A;  3V50 A;  3LEZ A;  4S2K A;  4HEF A;  3MBZ A;  4R23 A;  1K6S A;  1DJA A;  3MKE A;  5EVI C;  2XLN A;  5HFO A;  4EQI A;  2QPN A;  2ZQ8 A;  4EBN A;  4P87 A;  1QME A;  1BLS A;  3GQZ A;  4X55 A;  3RJU A;  1K38 A;  2EXA A;  4FH2 A;  3QNC A;  2WKI A;  3ISG A;  4X53 A;  5KSC A;  3BFF A;  3N8S A;  5DF8 A;  1KGE A;  1FR1 A;  4P85 A;  3SH8 A;  4DE2 A;  1K56 A;  4GNU A;  4C3Q A;  2Y59 A;  5EVL A;  4DDY A;  1S6R A;  4A5R A;  4OOM A;  1RCJ A;  4UA7 A;  1ES4 A;  3PBN A;  3ZHH A;  1ONG A;  2Y2N A;  1XA1 A;  3Q7V B;  3IH9 A;  3GVB A;  4E3I A;  5CEC A;  1CI8 A;  1FR6 A;  2JE5 A;  2OLU A;  4WEL A;  3C4P A;  4UAA A;  1L0F A;  1VM1 A;  4UA9 A;  3VFF A;  4KG5 A;  3V39 A;  2ZC4 B;  1KVM A;  3HVF A;  4F94 A;  3LO7 A;  1GA0 A;  4PM8 A;  4WM9 A;  3PBT A;  4MEZ A;  5CTN A;  3ZVT A;  1CK3 A;  3G4P A;  4EV4 A;  1G68 A;  2XFS A;  4LEN A;  4MBH A;  4B4Z A;  3UPN A;  1SDE A;  4GKU A;  1LI9 A;  5FAQ A;  1MKI A;  4UHU A;  2BG1 A;  1YT4 A;  1YLT A;  4C6Y A;  5F82 A;  5GLB A;  3S1Y A;  1E4D A;  3UN7 A;  3ZNY A;  1PI5 A;  2HDU A;  5A91 A;  5E2H A;  3SH9 A;  3HBR A;  1YLJ A;  3MZE A;  2PBY A;  2ZQ7 A;  4X56 A;  5EPH A;  5E2G A;  3VOZ A;  4U0X A;  5JYP A;  2EFU A;  5A92 A;  3UE3 A;  1KE0 A;  1ZG6 A;  2E8I A;  4DE0 A;  3ITA A;  1XKZ A;  1L0G A;  3TOI A;  4WBG A;  4U0T A;  3QNB A;  2XQZ A;  4M3K A;  4OON A;  1JWZ A;  2Y2K A;  1KE3 A;  5FA7 A;  1BZA A;  4IED A;  1PWC A;  4WYY A;  3P09 A;  4S2N C;  1G6A A;  1NXY A;  3BLS A;  4JF4 A;  4ZJ1 A;  5EVI A;  3LCE A;  1PW8 A;  3HLC A;  1YMX A;  3PBO A;  2QZ6 A;  4PM9 A;  4ID4 A;  4OPR A;  4ZDX A;  4ZJ3 A;  1H5X A;  4QJG A;  1NRF A;  3W8K A;  5EOO A;  4LCL A;  1L0D A;  4IBX A;  1XP4 A;  2IWD A;  3M2K A;  1XPB A;  5G18 A;  4E3L A;  4OKP A;  4BQM A;  1PZO A;  3E2K A;  4BEN A;  2WKH A;  4JXG A;  2Y2J A;  4OPZ A;  4DXB A;  3IXB A;  4JF6 A;  3ZG0 A;  2XH9 A;  2WGI A;  3C7V A;  2I72 A;  3G31 A;  4B88 A;  3MZF A;  3Q1F A;  3BFD A;  1IEM A;  5FAT A;  1XA7 A;  4XXR A;  3OCL A;  3VMA A;  1JTD A;  1HZO A;  3WWX A;  4KZ7 A;  3DTM A;  5TFQ A;  5M18 A;  1SKF A;  3GR2 A;  1K4F A;  4KZB A;  4N1X A;  4KEN B;  3IF6 B;  4R3J A;  3S22 A;  1ESU A;  2Z2M B;  2DCF A;  4OPQ A;  5CRF A;  3UNW A;  3VP3 A;  5HL1 A;  2XGN A;  4BL2 A;  3C4O A;  5CED A;  4RA7 A;  5GHY A;  1W7F A;  4P6B A;  4JBF A;  3Q82 A;  3PTE A;  5CTM A;  2WKE A;  2WZZ A;  2UWX A; 
#chains in the Genus database with same CATH topology
 5J4E A;  3EOI A;  2M7V A;  3VOL A;  3CUE C;  1YSP A;  3BM6 A;  3SS5 A;  3JPU A;  5DFY A;  4K0W A;  4G3K A;  3A3I A;  4KZ9 A;  1K57 A;  1G6O A;  5GL9 A;  2XRO A;  4S2N A;  1MWT A;  4DE1 A;  1W63 M;  4C75 A;  1ZTU A;  4BWI A;  2VZW A;  2YKH A;  1TF1 A;  2J7V A;  3LID A;  5FDH A;  3FV7 A;  3O3V A;  3WRZ A;  3A0S A;  5F1G A;  3PHY A;  4WEJ A;  2HDQ A;  5HDS A;  1Q2Q A;  2J80 A;  4QPR A;  3GRJ A;  2FZ0 A;  3PR6 A;  2ZD8 A;  1CJF A;  5HWT A;  3VP4 A;  4HI4 A;  1OTE A;  3OZH A;  2A49 A;  2H0Y A;  3ZG7 B;  1S1Z A;  3NY4 A;  2HP6 A;  3N8R A;  3E0Y A;  4LV3 A;  4EBL A;  3K2N A;  4KQQ A;  4WZ5 A;  2GX5 A;  3MS6 A;  3JVU A;  2PYP A;  4X69 A;  2B18 A;  3WS2 A;  1PZP A;  3HLG A;  4LLO B;  5G4Z A;  3OPL A;  2EX8 A;  5CEB A;  4HH2 A;  3UE6 A;  3ZCZ A;  1TS0 A;  3G35 A;  1SCW A;  1PWD A;  1NY0 A;  5EE8 A;  4S2P A;  1A0K A;  4P0M A;  1Q2P A;  3F1N A;  3TJZ C;  1E3U D;  2PDR A;  5DJU A;  2Q9N A;  1O7E A;  5J3W A;  2V9A A;  3HL9 A;  4E3O A;  3W4Q A;  1CEG A;  1TS8 A;  5HD5 A;  1I5Q A;  3NJA A;  4JPM A;  3NOP C;  1H8M A;  1WE4 A;  5AVE A;  4EUZ A;  1W5D A;  3VSL A;  3IHA A;  4CLC C;  4BD0 A;  2PU2 A;  1KOU A;  1RP5 A;  2OWJ A;  1RGZ A;  1LI0 A;  2XDM A;  1H8Z A;  3ZVW A;  3BEC A;  1HD8 A;  1K56 D;  1MWU A;  4WL9 A;  4R3B A;  1CQA A;  3T50 A;  4QY5 A;  1E3U A;  1MPL A;  2A3U A;  2GJ3 A;  1LHY A;  4WZ4 A;  5G4Y A;  4ETX A;  1SDN A;  4EXO A;  3GMW A;  4DJ2 A;  5TGF A;  5HPF A;  3WRT A;  1LL9 A;  2ZC5 B;  5FEF A;  2PR6 A;  2JKR I;  4X1M A;  3HJK A;  3DWK A;  1FSY A;  4IUH A;  2HV1 A;  4I5S A;  1VET A;  2UV0 E;  2C6W B;  3LY3 A;  3BJN A;  4BD1 A;  3PAG A;  4KZ5 A;  4YIN A;  1TDL A;  3FKW A;  3HLB A;  5JYO A;  1FSW A;  2WUQ A;  1PIO A;  3W4O A;  3CUE A;  4OQ0 A;  5HDD A;  3KYQ A;  4R4S A;  1NRJ A;  1IFQ A;  3I7J A;  4PHT A;  3H7W B;  1YLW A;  2JCH A;  4PM6 A;  1K55 C;  3OPP A;  3A0R A;  4QHC A;  2Y2M A;  3AGF A;  4PAU A;  1GSX A;  1YSQ A;  3ZG5 A;  3PXP A;  1CI9 A;  4S2J A;  4L0L A;  5FAP A;  2O9B A;  5FI2 A;  2XD1 A;  3SH7 A;  4E04 A;  5TBM B;  2PU4 A;  4HJ6 A;  5EVI B;  1KE4 A;  5BOH A;  3ZG9 B;  3EGX C;  3KO6 A;  1S67 L;  2L1M A;  1CF0 A;  2Y2O A;  3T1Q B;  1P9W A;  3SZT A;  1OTD A;  4MLL A;  4UEY A;  3FPW A;  4KZ3 A;  3TG9 A;  2ZM2 A;  1K54 A;  1YQS A;  1H0M A;  2HDS A;  3RXW A;  1KGF A;  1KVL A;  3B33 A;  4JF5 A;  4N9L A;  5C5K A;  1LSV A;  2JHE A;  1JVJ A;  2VV7 A;  4BLM A;  3D4F A;  3HUO A;  3BQA A;  3NC8 A;  3S7P A;  4LV0 A;  3EQU A;  4OH0 A;  1OJ5 A;  1L0E A;  4GZB A;  3CG5 A;  3C2W A;  2X01 A;  3MQO A;  3BFC A;  2W3H A;  4S2L A;  1BUL A;  4IBR A;  2G2W A;  1SHV A;  1ZG4 A;  4IUK A;  3V67 A;  2P9V B;  1XGI A;  1H8Y A;  4CPK A;  3V50 A;  4R23 A;  3E98 A;  1EW0 A;  2QPN A;  3KSI A;  3RJU A;  3QNC A;  3ISG A;  4CLC A;  5DF8 A;  4C3Q A;  4A5R A;  1RCJ A;  3NEC A;  4UA7 A;  5IT5 A;  3T4L A;  1DRM A;  2W27 A;  1VB6 A;  2OLU A;  2JE5 A;  3C4P A;  4GJ4 A;  3V39 A;  3S7Q A;  4F94 A;  1GA0 A;  3H7W A;  3B42 A;  4LRZ E;  4B9O A;  5FEG A;  1MKI A;  1PI5 A;  3U2A A;  5E2H A;  2EFU A;  5A92 A;  1S66 L;  2E8I A;  5EFW A;  1PWC A;  3P09 A;  4S2N C;  1G6A A;  1NXY A;  4JF4 A;  5EVI A;  4HOI A;  4Q0J A;  4PM9 A;  4ID4 A;  5A8B A;  4ZDX A;  4LCL A;  1Y4O A;  4HP9 A;  2MJ6 A;  2INW A;  4JXG A;  4DXB A;  1XJ6 A;  3IXB A;  3C7V A;  3G31 A;  5FAT A;  1XA7 A;  5M18 A;  1K4F A;  4KEN B;  3IF6 B;  2Z2M B;  1X0O A;  4EEU A;  2XGN A;  4BL2 A;  2FH5 A;  5CED A;  4EUV A;  5CTM A;  5L8M A;  2WZZ A;  1S4S A;  1PNE A;  4XUX A;  1T18 A;  3MR0 A;  2NUT C;  3PAE A;  3BY8 A;  2J3W A;  2HPB A;  4WZ5 C;  2H0T A;  2HP5 A;  2Z2L B;  2P9V A;  3UDX A;  2WGV A;  2OAQ 1;  4LRX C;  3M6H A;  1BYW A;  2G7U A;  4K08 A;  3P01 A;  3QP8 A;  2H5S A;  1FCM A;  3CHW P;  2QKP A;  5FQJ A;  1IYO A;  1T1C A;  1Y28 A;  4BBT A;  4B93 A;  3MJQ A;  2DNS A;  3W4P A;  1GSW A;  1ERM A;  3IT9 A;  5FAO A;  4ZJ2 A;  3RXX A;  5KZH A;  4HQA A;  5CGS A;  2P74 A;  4HHD A;  2KDK A;  4X25 A;  1E25 A;  4OLD A;  2XA7 S;  3TSG A;  1K4E A;  1VHM A;  2O0Y A;  4PM5 A;  3E4P A;  1YMS A;  5L07 A;  1GA9 A;  1W8Y A;  1OTI A;  4Y0O A;  4OLG A;  1K6R A;  5GHZ A;  3BWL A;  2HJE A;  2KLI A;  4Q0I A;  2Z6C A;  3B47 A;  1MKM A;  4I38 A;  4D2O A;  2HGV A;  2V20 A;  3NCK A;  2Y91 A;  1TVF A;  4KUO A;  2KX6 A;  3UE0 A;  4GB7 A;  4WMC D;  4Y0U A;  1O07 A;  3S4X A;  5FQM A;  1UWP X;  5FAS A;  3IBJ A;  1OTB A;  3VSK A;  4IHQ A;  3R4K A;  2JKT I;  2PBD P;  2X71 A;  3MQ0 A;  5L10 A;  4DF6 A;  3HUN A;  4WF0 A;  4E3J A;  3HRE A;  3A3J A;  4S2O A;  1EWZ A;  1J9M A;  3EQV A;  4E3K A;  2IWC A;  2RCX A;  3LIE A;  2G2U A;  2HP9 A;  3LY4 A;  1YPR A;  4ZBE A;  2EA9 A;  1T1B A;  3L7H A;  3FYZ A;  3T4Q A;  3UMD A;  4EES A;  3T4O A;  4O0P A;  4NKP A;  1L2S A;  2Y2I A;  4GD8 A;  2WAE A;  3G2Y A;  3IXH A;  4BBU A;  4BBV A;  3DTE A;  5AQ9 A;  2RL3 A;  4XT2 B;  4R6L A;  3VE3 A;  5E2E A;  5F83 A;  1ZC2 A;  3UPP A;  2ZQC A;  3HLD A;  5A90 A;  2FFF B;  1DJB A;  5U47 A;  4H6J A;  3G32 A;  4JGO A;  5FSR A;  2JC7 A;  5EM0 A;  3BYD A;  1N4O A;  3FWL A;  3BLM A;  4DE3 A;  1IOU A;  4JXS A;  1MWR A;  2VEA A;  3MZD A;  2OSU A;  1BSG A;  4MNR A;  4OVD A;  1GHI A;  3GV9 A;  4L9G A;  1I2W A;  3D3O A;  2V8F A;  5F6A A;  4R4R A;  2ZQD A;  2H28 A;  1RGY A;  4ZTK A;  4GS9 B;  4LCM A;  2IWB A;  4GDB A;  1BT5 A;  3UB5 P;  2WKQ A;  2W3D A;  2B02 A;  4KQO A;  2ZMA A;  3CZD A;  1LSW A;  3WS1 A;  2B95 A;  3BFG A;  1PWG A;  2Q9M A;  4L9F A;  2ZOI A;  1TEM A;  1ZKJ A;  4K0X A;  1K54 C;  5KSH A;  4ME4 A;  2W3F A;  1LSX A;  1L3L A;  3QHY A;  4HH3 A;  4Y5F A;  1XGJ A;  3SS3 A;  2Z6D A;  1XFN A;  1YM1 A;  3SOI A;  3H82 B;  3O88 A;  4OOL A;  3OCN A;  2WYX A;  1ESI A;  4ETZ A;  3QP4 A;  5A93 A;  3PBR A;  1FCO A;  5E43 A;  2VGJ A;  4KZ6 A;  3N7W A;  2OWH A;  2Y2P A;  2VV6 A;  2ZJ9 A;  4N92 A;  3RFB A;  5AQA A;  3N8L A;  4JXV A;  2XF3 A;  1WA9 A;  3IF5 A;  3CAX A;  3KYZ A;  5EEC A;  3IWO A;  1EI5 A;  1G28 A;  5DKL A;  4GW9 A;  5DKK A;  2DRW A;  2VV8 A;  4GDN A;  3M6B A;  3JVV A;  3NUL A;  4XT2 A;  3CI6 A;  1GSV A;  4NXE A;  5FQ9 A;  3Q7Z A;  3P98 A;  5DTK A;  2WAD A;  3TE8 A;  4Y13 A;  2V1Z A;  1BLH A;  3D72 A;  5DF7 A;  4E6X A;  4WN5 A;  3UY6 A;  4CJN A;  3HLE A;  2Y2L A;  1DJC A;  3FZC A;  3ULF A;  5DVA A;  2ZM0 A;  1NYM A;  4R0Q A;  4PPR A;  3T1R A;  1CEF A;  4L9E A;  3MFX A;  3NOU C;  2CMN A;  1GCE A;  5AQ7 A;  1OME A;  2ZBB A;  4KG2 A;  4EEP A;  3LEZ A;  4GS9 A;  5I5L A;  5EVI C;  1UGU A;  3H9W A;  2W1T B;  4P87 A;  1N9N A;  1K38 A;  2EXA A;  4FH2 A;  2ZMF A;  3QP5 A;  5KSC A;  5HSQ A;  3N8S A;  1KGE A;  4P85 A;  3SH8 A;  4DE2 A;  3RTY A;  1K56 A;  4GNU A;  5EVL A;  2Q0O A;  1S6R A;  4OOM A;  4P6Z S;  4MCW A;  1ES4 A;  2Y2N A;  1XA1 A;  3Q7V B;  3TW8 A;  3GVB A;  2KOI A;  5CEC A;  1OT9 A;  3VFF A;  1L0F A;  1VM1 A;  3DAV A;  1KVM A;  2J3T C;  4EER A;  3LR5 A;  5CTN A;  1OJG A;  1CK3 A;  4LEN A;  4B4Z A;  3UPN A;  3LR3 A;  4GKU A;  5FAQ A;  1LI9 A;  3QP1 A;  3K3C A;  4UHU A;  3H82 A;  5F82 A;  4RQ9 A;  1E4D A;  3ZNY A;  5HWV A;  4LFU A;  3MZE A;  2ZQ7 A;  4X56 A;  5EPH A;  3UE3 A;  1XKZ A;  4WBG A;  4U0T A;  1JWZ A;  3OOV A;  2Y2K A;  4IED A;  1F2K A;  2P08 A;  1F98 A;  2IA2 A;  1PW8 A;  3HLC A;  3T4T A;  3MSH A;  1STZ A;  4OPR A;  3RH8 B;  4ZJ3 A;  4QJG A;  3NHQ A;  2QJ5 A;  4IBX A;  2IWD A;  3M2K A;  4OKP A;  4BQM A;  1PZO A;  3ZG0 A;  3OLO A;  4B88 A;  3CLO A;  3A0V A;  5TFQ A;  4N1X A;  4KZB A;  1N9L A;  4R70 A;  3S22 A;  1ESU A;  5F69 A;  4OPQ A;  3VP3 A;  3C4O A;  1S4R A;  2GNX A;  1W7F A;  4JBF A;  2WKE A;  4II7 A;  3IBR A;  5CHJ A;  4ESP A;  5IHV A;  2VX8 A;  3Q81 A;  3W2Z A;  1AWI A;  3ZNT A;  2OOL A;  1ERO A;  1JWP A;  1JTG A;  3NDE A;  1HTZ A;  1LLB A;  1FOF A;  1MWS A;  3D9Y A;  5AVF A;  1MBL A;  2J9P A;  4MMN A;  4D60 A;  1T1A A;  4Y2F A;  3MMH A;  2CC1 A;  3LUQ A;  3GTC A;  1KDS A;  2EWW A;  3CMZ A;  1IYQ A;  5HPI A;  1NZO A;  5IU1 A;  3NIA A;  3Q7V A;  5GLD A;  4FD8 A;  5FQI A;  1MC0 A;  4H8R A;  2ZQ9 A;  2D02 A;  3IF6 C;  4Q8I A;  4DRT A;  3Q07 A;  3E4Q A;  4O8G A;  2K31 A;  4I3J A;  2L0W A;  4S2M A;  4EQ1 A;  3VFH A;  3DTK A;  2EFX A;  4LV2 A;  4DJ3 A;  4GHI B;  3ZQ5 A;  4HBU A;  1Z09 A;  1DP6 A;  1ONH A;  2WGW B;  4AFI A;  4Q0H A;  1ALQ A;  3ZYT A;  5CXW A;  2PD8 A;  1VEU B;  4GN2 A;  3SS4 A;  2JKR M;  4LV1 A;  2GDN A;  4PKY G;  4HES A;  1M40 A;  3F1P B;  4OQI A;  5TBM A;  3LYX A;  4O7D A;  3C30 A;  2PT7 A;  4X6T A;  1V9Z A;  4EU0 A;  1JWV A;  1P0Z A;  2V8C A;  3OC2 A;  2FFY A;  4NET A;  1DP8 A;  3R7W B;  2HF6 A;  1FCN A;  3T1X A;  1ERQ A;  2Y8H A;  3FC7 A;  3IQA A;  3LI8 A;  5J8X A;  2A2L A;  5M19 A;  5L2F A;  4NK3 A;  4GD6 A;  4XUZ A;  1NJ4 A;  1NLZ A;  2ZC6 B;  3ZGA B;  2Y4A A;  1K0K A;  5HW3 A;  3LR0 A;  4FTX A;  3TRC A;  5HX9 A;  5CGW A;  2XA7 M;  4G3V A;  1LL8 A;  5HL6 A;  3T1S A;  3CJM A;  5HWW A;  4BJP A;  4JXW A;  2WKP A;  2W1R A;  4U3T A;  2H10 A;  5HAQ A;  1I2S A;  1SKO B;  2BLS A;  3T4S A;  4X68 A;  2ZQA A;  3LIC A;  5IS1 A;  1AXB A;  4OQG A;  2JN7 A;  3G34 A;  3N4I A;  2D01 A;  3O5Y A;  3GSG A;  3LI9 A;  4NXG A;  4I3I A;  5CGX A;  3HLW A;  3VP0 A;  1XJ3 A;  3UE1 A;  2HDR A;  1ODV A;  3VP2 A;  5FQQ A;  4DXC A;  4OP8 A;  4Y0T A;  2ACG A;  1VQQ A;  2YKF A;  3AGE A;  2OAP 1;  4KG6 A;  2ZC7 A;  4GHI A;  3DWZ A;  4R38 A;  4X1L A;  5CHM A;  1F5M A;  3UB7 A;  4PMA A;  4MN5 A;  2WGW A;  1NLY A;  3V3S A;  1LL5 A;  2XRN A;  2W0N A;  4NEE D;  1VEU A;  1PW1 A;  3ZDJ A;  3WS0 A;  3MFD A;  1N9O A;  3BFE A;  2ZOH A;  1ES5 A;  2XD5 A;  3LIF A;  4IVI A;  3F1P A;  3C5A A;  2OLV A;  3A3E A;  4O01 A;  3UO9 A;  3G6O A;  4YNR A;  4KZ8 A;  4MN6 A;  4M4X A;  1D06 A;  1FIK A;  1Y54 A;  1K25 A;  3PBQ A;  2WAF A;  4QY6 A;  4NXB A;  3DW0 A;  4NXF A;  5GHX A;  3GDI A;  2ZMV A;  2QWS A;  3KSF A;  3R7W A;  2V1B A;  2QMI A;  5FI6 A;  3MKF A;  1J3W A;  3IF6 A;  1DP9 A;  2Y79 A;  3FG8 A;  3S7O A;  4DDS A;  3FKV A;  4FUW A;  1D7E A;  3CWF A;  4I3A A;  2J8Y A;  4Z9Q A;  2Y55 A;  2BTF P;  4WMC A;  3IWQ A;  3NDG A;  1ACF A;  4ARZ B;  3MXR A;  4EWF A;  3HLF A;  3CPT B;  5GLC A;  3LGO A;  2I9V A;  3VP1 A;  4EBP A;  1KDW A;  3G2Z A;  3IS2 B;  1QMF A;  4ZAM A;  2V0U A;  3T12 B;  3A3F A;  1W8Q A;  5E2F A;  1ZHH B;  1F9I A;  4KZA A;  2LB9 A;  4K91 A;  4DN0 A;  2EX9 A;  4Y7P A;  3KSG A;  1XJ2 A;  2WK0 A;  5CER A;  4FSF A;  5F5Y A;  1WYB A;  1TDG A;  3NOT C;  5AQB A;  5I94 A;  2EWV A;  4UQI S;  3UDI A;  1GHP A;  4QD4 A;  3ICY A;  5D3O A;  4S2K A;  3KYE A;  3MBZ A;  4JGQ A;  1K6S A;  1DJA A;  3U4L P;  2XLN A;  4EQI A;  3QP6 A;  2ZQ8 A;  4EBN A;  1BLS A;  5L09 A;  2A24 B;  1FR1 A;  5EVE A;  4R3A A;  1UWN X;  4CLC E;  3ZHH A;  1ONG A;  1P97 A;  2GZA A;  3IH9 A;  1CI8 A;  2QYB A;  2W3E A;  2PAV P;  1T19 A;  4UAA A;  4LGW A;  4KG5 A;  2ZC4 B;  3VV4 A;  1VET B;  3UB8 A;  3HVF A;  3UB6 A;  4DMZ A;  4WM9 A;  3PBT A;  4PKY A;  1TS7 A;  3G4P A;  2XFS A;  4MBH A;  3EWK A;  1SDE A;  4C6Y A;  2BG1 A;  1YT4 A;  1YLT A;  3UN7 A;  2HDU A;  4YOF A;  3HBR A;  3IX4 A;  4Y15 A;  4U0X A;  5KIZ A;  1KE0 A;  4DE0 A;  1L0G A;  3P7N A;  4M3K A;  4OON A;  4HIA A;  1KE3 A;  5EV0 A;  3BLS A;  2E8J A;  3PYP A;  1YMX A;  2PR5 A;  2QZ6 A;  1NRF A;  5EOO A;  1L0D A;  1XP4 A;  4ARZ A;  5K5B A;  5G18 A;  1XPB A;  4HP4 A;  3E2K A;  4BEN A;  1XFQ A;  2Y2J A;  4OPZ A;  2XH9 A;  3CPT A;  3KX0 X;  2V1A A;  2L4R A;  4G3W A;  3Q1F A;  3BFD A;  1IEM A;  3OCL A;  3VMA A;  1JTD A;  3IS2 A;  4KZ7 A;  3GR2 A;  3LIA A;  2DCF A;  5HL1 A;  2P04 A;  4P6Z M;  5GHY A;  2JKT M;  3LFV A;  3PTE A;  4OP5 A;  5TJJ A;  1NYY A;  3IWI A;  2PD7 A;  2EX6 A;  1P9R A;  3M2J A;  2PHY A;  4HBT A;  2NUP C;  3BY9 A;  5FQK A;  3N6I A;  4JGP A;  3AGD A;  4YWZ A;  3OPR A;  2VK3 A;  4YFM A;  3UB9 A;  5HAI A;  4QU3 A;  4E6W A;  3ITB A;  2EX2 A;  1SZV A;  3IHB A;  3O86 A;  2A24 A;  4UA6 A;  1XJ4 A;  4OQH A;  5TR7 A;  1BLP A;  1JNU A;  4DKI A;  3K3D A;  3B3X A;  5GLA A;  4JLF A;  2ZC3 B;  2O9A A;  2HJ9 C;  4QB8 A;  4RX3 A;  2B5R A;  4CQH A;  3OPH A;  1FQG A;  1YLP A;  3S7N A;  4CLC B;  1S1Y A;  4GOG A;  3IH8 A;  3LEQ A;  5F68 A;  4NG2 A;  2X02 A;  1NZU A;  3JYI A;  5CX7 A;  3BW6 A;  2R78 A;  3HUM A;  3HCY A;  4S2I A;  2JBF A;  3ZFZ A;  1M6K A;  1MY8 A;  3E2L A;  4E3N A;  2XK1 A;  2VLG A;  1MXO A;  4B4X A;  2VGL M;  2XFT A;  2XEP A;  4FH4 A;  5MC7 A;  2R9W A;  3WS4 A;  2LB5 A;  4MDZ A;  4WLA A;  1IYP A;  4LRY C;  4WUJ A;  5HZH A;  4OOY A;  4RVA A;  1G5U A;  1ES3 A;  3IX8 A;  1PI4 A;  4HNB A;  3MXS A;  3A3D A;  1DY6 A;  1BUE A;  4OPY A;  4Z1W A;  4Y17 A;  2WKR A;  1XX2 A;  2K7S A;  4EW7 A;  2QJ7 A;  1IYS A;  1HLU P;  4N9K A;  3MXQ A;  1V9Y A;  1ES2 A;  5EOE A;  1NWZ A;  2XR0 A;  2PRF A;  4CLC D;  3F1O B;  2VGL S;  1XXM A;  3PBS A;  4I39 A;  1BLC A;  1GHM A;  1MZU A;  4GLQ A;  2HZ5 A;  2W1T A;  4GCZ A;  4IVK A;  2JKG A;  5FL3 A;  1HVB A;  4EET B;  1IKG A;  2K2N A;  2VJW A;  4KQD A;  2V0W A;  2J9O A;  1IEL A;  2VGK A;  2M7U A;  3UDF A;  3NI9 A;  3CIT A;  2JKF A;  1YKD A;  4FCF A;  5J7E A;  3OBF A;  1N9B A;  3EEA A;  4RYE A;  4FOF A;  1BTL A;  5DFX A;  4N1H A;  3MQQ A;  5HD3 A;  3NBL A;  3LR4 A;  1IKI A;  5EVI D;  2ZL1 B;  3ZG8 B;  1PRQ A;  2EXB A;  2PYR A;  2Y2Q A;  3IXG A;  3V3R A;  2ZM8 A;  4QWO A;  3C38 A;  3T4K A;  3FPV A;  3UPO A;  1PYY A;  4LPZ A;  5EUA A;  2Y2H A;  5FI7 A;  1W63 Q;  1WYC A;  3BEB A;  5DF9 A;  3VOY A;  1OTA A;  2J3T D;  2QHK A;  5DTS A;  3G30 A;  5M1A A;  1YLZ A;  5CHU A;  2C5W B;  4KUK A;  1K57 C;  1PFL A;  4MBF A;  4R1G A;  4RX2 A;  4BL3 A;  1YAX A;  1TS6 A;  3KSH A;  4JKT A;  3BQ8 A;  3WS5 A;  2O9C A;  5HAR A;  5F1F A;  1FIL A;  2V2F F;  2ZLY A;  1TD5 A;  1S0W A;  2R9X A;  1W79 A;  4F3L B;  5DJT A;  4KZ4 A;  4WEK A;  4KQR A;  3F1O A;  1H3Q A;  2OV5 A;  2VA0 A;  5KMW A;  4E3M A;  5FDS A;  5DTT A;  1C3B A;  3C7U A;  3E4O A;  1YLY A;  5HAP A;  3V5M A;  1KGG A;  1Z6F A;  1K55 A;  3DTI A;  2WZX A;  4PM7 A;  5LBR A;  4BMW A;  2AVX A;  2Y2G A;  4MBK A;  3QP2 A;  1U60 A;  3BRM A;  3EGD C;  3MF0 A;  3O87 A;  4H6J B;  3IXD A;  4HEF A;  3T4J A;  5HFO A;  3MKE A;  2XSS A;  3SW1 A;  1QME A;  4HY8 A;  3GQZ A;  4X55 A;  2WKI A;  4X53 A;  3BFF A;  3UME A;  2O99 A;  2ZL1 A;  2Y59 A;  4DDY A;  3HJI A;  3PBN A;  4E3I A;  4WEL A;  1FR6 A;  1OPX A;  1OT6 A;  3VE4 A;  4UA9 A;  5AJG A;  4Y3I A;  2DMW A;  4MN7 A;  3LO7 A;  4PM8 A;  4MEZ A;  3ZVT A;  4EV4 A;  1G68 A;  4ZRR A;  5HDC A;  5EM1 A;  4JGR A;  5GLB A;  3S1Y A;  3EEH A;  5A91 A;  2BAS A;  3SH9 A;  1YLJ A;  2PBY A;  3VOZ A;  5E2G A;  5JYP A;  1ZG6 A;  2P7J A;  3ITA A;  3TOI A;  1D1J A;  3QNB A;  2XQZ A;  5FA7 A;  1BZA A;  4WYY A;  4HJ3 A;  4ZJ1 A;  4HJ4 A;  4IJG A;  3LCE A;  3PBO A;  1H5X A;  3W8K A;  4F3L A;  4UQI M;  2VKS A;  3LIB A;  3C8C A;  4E3L A;  2WKH A;  3F1N B;  4JF6 A;  2WGI A;  2I72 A;  3MZF A;  3WWX A;  4XXR A;  2M1C A;  1HZO A;  3DTM A;  3GEC A;  3L9K A;  1SKF A;  4R3J A;  5CRF A;  3UNW A;  3IX3 A;  3DBA A;  4RA7 A;  1SKO A;  4P6B A;  3Q82 A;  2W3G A;  1LT0 A;  2UWX A; 
#chains in the Genus database with same CATH homology
 4OP5 A;  3BM6 A;  4XUX A;  5CHJ A;  5IHV A;  1NYY A;  3PAE A;  3SS5 A;  3IWI A;  3Q81 A;  2EX6 A;  2HPB A;  4WZ5 C;  3M2J A;  2H0T A;  4K0W A;  4HBT A;  3ZNT A;  5FQK A;  1ERO A;  2HP5 A;  2Z2L B;  2P9V A;  3A3I A;  3AGD A;  3N6I A;  1JWP A;  4KZ9 A;  1K57 A;  3OPR A;  3UDX A;  2WGV A;  1JTG A;  3NDE A;  1HTZ A;  4YFM A;  1LLB A;  3M6H A;  5GL9 A;  5HAI A;  1FOF A;  4S2N A;  1MWS A;  1MWT A;  4QU3 A;  4DE1 A;  1MBL A;  4E6W A;  3ITB A;  2EX2 A;  2J9P A;  3IHB A;  3O86 A;  2H5S A;  4C75 A;  1FCM A;  5FQJ A;  4UA6 A;  1IYO A;  4OQH A;  2J7V A;  2CC1 A;  5FDH A;  3GTC A;  3FV7 A;  5TR7 A;  1KDS A;  3O3V A;  1BLP A;  3WRZ A;  3CMZ A;  2DNS A;  1IYQ A;  3W4P A;  5F1G A;  3IT9 A;  1ERM A;  1NZO A;  4DKI A;  3NIA A;  3Q7V A;  4WEJ A;  5FAO A;  5GLD A;  4ZJ2 A;  3RXX A;  2HDQ A;  1Q2Q A;  4FD8 A;  5FQI A;  5KZH A;  3GRJ A;  3B3X A;  5GLA A;  4H8R A;  4JLF A;  5CGS A;  2P74 A;  2ZQ9 A;  2ZC3 B;  2ZD8 A;  3IF6 C;  4Q8I A;  4DRT A;  4QB8 A;  3Q07 A;  1E25 A;  4RX3 A;  2B5R A;  4OLD A;  3TSG A;  3VP4 A;  1K4E A;  4PM5 A;  3OZH A;  2A49 A;  3OPH A;  1FQG A;  1YMS A;  1GA9 A;  1W8Y A;  4S2M A;  4Y0O A;  3VFH A;  4OLG A;  2H0Y A;  1YLP A;  2EFX A;  4LV2 A;  3ZG7 B;  1K6R A;  5GHZ A;  3NY4 A;  2HP6 A;  4HBU A;  3N8R A;  4LV3 A;  1ONH A;  4EBL A;  2WGW B;  4GOG A;  3IH8 A;  4D2O A;  2X02 A;  1NZU A;  1ALQ A;  2V20 A;  3JYI A;  3NCK A;  4KQQ A;  4WZ5 A;  5CXW A;  2Y91 A;  1TVF A;  3SS4 A;  4GN2 A;  3UE0 A;  4GB7 A;  4WMC D;  4Y0U A;  1O07 A;  4LV1 A;  4X69 A;  3S4X A;  3WS2 A;  1PZP A;  2GDN A;  5FQM A;  3HLG A;  5CEB A;  3HUM A;  2EX8 A;  3OPL A;  4S2I A;  2JBF A;  5FAS A;  4HES A;  3ZFZ A;  1M40 A;  3VSK A;  1M6K A;  3ZCZ A;  4OQI A;  2X71 A;  3G35 A;  1MY8 A;  1SCW A;  3E2L A;  1PWD A;  4E3N A;  4DF6 A;  3HUN A;  1NY0 A;  4O7D A;  2XK1 A;  5EE8 A;  4S2P A;  4E3J A;  3HRE A;  1MXO A;  3A3J A;  4P0M A;  4S2O A;  1EWZ A;  1Q2P A;  4X6T A;  4B4X A;  1J9M A;  3EQV A;  4E3K A;  2XFT A;  1JWV A;  2IWC A;  2RCX A;  2XEP A;  1E3U D;  4FH4 A;  2G2U A;  2HP9 A;  3LY4 A;  3OC2 A;  4ZBE A;  2R9W A;  2FFY A;  4NET A;  2Q9N A;  3WS4 A;  1O7E A;  3FYZ A;  3HL9 A;  1IYP A;  4E3O A;  1FCN A;  1ERQ A;  3W4Q A;  1CEG A;  4OOY A;  4RVA A;  1I5Q A;  4JPM A;  3IQA A;  1L2S A;  2Y2I A;  1ES3 A;  4GD8 A;  2WAE A;  5J8X A;  5M19 A;  1WE4 A;  3G2Y A;  5L2F A;  4NK3 A;  4EUZ A;  4GD6 A;  1PI4 A;  1W5D A;  1NJ4 A;  4XUZ A;  3MXS A;  3VSL A;  2ZC6 B;  3ZGA B;  2Y4A A;  3IHA A;  3IXH A;  4BD0 A;  3A3D A;  2PU2 A;  1DY6 A;  5HW3 A;  1BUE A;  4OPY A;  1RP5 A;  1XX2 A;  5AQ9 A;  2RL3 A;  1RGZ A;  1IYS A;  4N9K A;  1LI0 A;  2XDM A;  5E2E A;  1ES2 A;  5F83 A;  1ZC2 A;  5HX9 A;  5EOE A;  3UPP A;  5CGW A;  2XR0 A;  2ZQC A;  3HLD A;  5A90 A;  1H8Z A;  2FFF B;  3ZVW A;  3BEC A;  3CJM A;  1DJB A;  1HD8 A;  1XXM A;  1K56 D;  1MWU A;  3PBS A;  5U47 A;  3G32 A;  1BLC A;  1GHM A;  4BJP A;  4R3B A;  4JXW A;  5FSR A;  4QY5 A;  4U3T A;  1E3U A;  1MPL A;  2H10 A;  2JC7 A;  5HAQ A;  2A3U A;  3BYD A;  1N4O A;  1I2S A;  1LHY A;  4WZ4 A;  3FWL A;  4IVK A;  3BLM A;  2BLS A;  4X68 A;  2ZQA A;  1HVB A;  1IKG A;  4DE3 A;  1SDN A;  1AXB A;  1MWR A;  4JXS A;  4OQG A;  3G34 A;  3GMW A;  3N4I A;  3MZD A;  5TGF A;  2J9O A;  1IEL A;  1BSG A;  2OSU A;  1LL9 A;  3WRT A;  4MNR A;  2VGK A;  3GSG A;  4OVD A;  3UDF A;  1GHI A;  3NI9 A;  2ZC5 B;  3GV9 A;  5CGX A;  3HLW A;  3VP0 A;  3UE1 A;  2HDR A;  3VP2 A;  5FQQ A;  1I2W A;  3DWK A;  1FSY A;  4DXC A;  4R4R A;  4OP8 A;  2ZQD A;  2C6W B;  1RGY A;  4ZTK A;  4FCF A;  4Y0T A;  1VQQ A;  1N9B A;  3LY3 A;  4RYE A;  3AGE A;  4LCM A;  4KG6 A;  2IWB A;  4BD1 A;  4GDB A;  1BT5 A;  1BTL A;  3PAG A;  4KZ5 A;  2ZC7 A;  4YIN A;  4KQO A;  4N1H A;  2ZMA A;  1TDL A;  3DWZ A;  3FKW A;  3CZD A;  3NBL A;  3HLB A;  5CHM A;  3WS1 A;  4PMA A;  5JYO A;  2WGW A;  3BFG A;  1IKI A;  3V3S A;  1FSW A;  1LL5 A;  5EVI D;  2WUQ A;  3ZG8 B;  1PIO A;  3W4O A;  1PWG A;  2EXB A;  4OQ0 A;  2Q9M A;  2Y2Q A;  3IXG A;  3V3R A;  1PW1 A;  3ZDJ A;  3WS0 A;  1TEM A;  1ZKJ A;  4K0X A;  3MFD A;  4R4S A;  1K54 C;  2ZM8 A;  3BFE A;  5KSH A;  1ES5 A;  2XD5 A;  4IVI A;  3UPO A;  1PYY A;  3C5A A;  3I7J A;  2OLV A;  5EUA A;  3A3E A;  3QHY A;  3UO9 A;  2Y2H A;  1YLW A;  4KZ8 A;  2JCH A;  5FI7 A;  1WYC A;  3BEB A;  4PM6 A;  1K55 C;  1XGJ A;  3OPP A;  1Y54 A;  3SS3 A;  5DF9 A;  1K25 A;  3PBQ A;  2WAF A;  4QHC A;  3VOY A;  2Y2M A;  3AGF A;  4QY6 A;  1YM1 A;  3SOI A;  3DW0 A;  5DTS A;  5GHX A;  3G30 A;  3O88 A;  4OOL A;  3OCN A;  2WYX A;  5M1A A;  3ZG5 A;  1ESI A;  1YLZ A;  5CHU A;  2C5W B;  1CI9 A;  1K57 C;  2QMI A;  5FI6 A;  3MKF A;  4MBF A;  4S2J A;  4R1G A;  5A93 A;  3PBR A;  4L0L A;  1FCO A;  5FAP A;  5E43 A;  2VGJ A;  4KZ6 A;  4RX2 A;  3N7W A;  4BL3 A;  2Y2P A;  3IF6 A;  4JKT A;  2ZJ9 A;  4N92 A;  5FI2 A;  5AQA A;  2XD1 A;  3SH7 A;  3WS5 A;  3N8L A;  5HAR A;  5F1F A;  2PU4 A;  5EVI B;  4JXV A;  4DDS A;  2V2F F;  3FKV A;  1KE4 A;  2XF3 A;  5BOH A;  2ZLY A;  3IF5 A;  5EEC A;  3IWO A;  3ZG9 B;  2J8Y A;  1EI5 A;  1S0W A;  4Z9Q A;  2R9X A;  1W79 A;  2Y55 A;  2DRW A;  4GDN A;  4WMC A;  3IWQ A;  3M6B A;  3NDG A;  2Y2O A;  3MXR A;  4KZ4 A;  4EWF A;  5FQ9 A;  4WEK A;  4MLL A;  3HLF A;  3Q7Z A;  4KQR A;  4KZ3 A;  3TG9 A;  2ZM2 A;  1K54 A;  1YQS A;  2OV5 A;  3P98 A;  5DTK A;  5GLC A;  2WAD A;  2HDS A;  3RXW A;  3VP1 A;  4EBP A;  1KGF A;  1KDW A;  3G2Z A;  1QMF A;  5KMW A;  2V1Z A;  1BLH A;  4ZAM A;  4E3M A;  1KVL A;  4JF5 A;  4N9L A;  5DTT A;  1C3B A;  3C7U A;  3A3F A;  1W8Q A;  5E2F A;  1YLY A;  5DF7 A;  4E6X A;  3UY6 A;  4CJN A;  5HAP A;  3V5M A;  1KGG A;  1Z6F A;  1JVJ A;  4KZA A;  4K91 A;  4BLM A;  3HLE A;  1K55 A;  1DJC A;  2EX9 A;  2Y2L A;  4Y7P A;  3D4F A;  3FZC A;  3HUO A;  5DVA A;  2WZX A;  2ZM0 A;  1NYM A;  3NC8 A;  4LV0 A;  3EQU A;  2WK0 A;  4PM7 A;  5CER A;  4OH0 A;  4FSF A;  4R0Q A;  4PPR A;  1WYB A;  1L0E A;  4GZB A;  3CG5 A;  2X01 A;  1TDG A;  5AQB A;  3BFC A;  4S2L A;  1CEF A;  2Y2G A;  5I94 A;  4MBK A;  1BUL A;  4IBR A;  1U60 A;  3UDI A;  3BRM A;  2G2W A;  1SHV A;  1ZG4 A;  1GHP A;  4QD4 A;  1GCE A;  2P9V B;  1XGI A;  1OME A;  3O87 A;  5AQ7 A;  1H8Y A;  3IXD A;  4KG2 A;  4CPK A;  5D3O A;  3V50 A;  3LEZ A;  4S2K A;  4HEF A;  3MBZ A;  4R23 A;  1K6S A;  1DJA A;  3MKE A;  5EVI C;  2XLN A;  5HFO A;  4EQI A;  2QPN A;  2ZQ8 A;  4EBN A;  4P87 A;  1QME A;  1BLS A;  3GQZ A;  4X55 A;  3RJU A;  1K38 A;  2EXA A;  4FH2 A;  3QNC A;  2WKI A;  3ISG A;  4X53 A;  5KSC A;  3BFF A;  3N8S A;  5DF8 A;  1KGE A;  1FR1 A;  4P85 A;  3SH8 A;  4DE2 A;  1K56 A;  4GNU A;  4C3Q A;  2Y59 A;  5EVL A;  4DDY A;  1S6R A;  4A5R A;  4OOM A;  1RCJ A;  4UA7 A;  1ES4 A;  3PBN A;  3ZHH A;  1ONG A;  2Y2N A;  1XA1 A;  3Q7V B;  3IH9 A;  3GVB A;  4E3I A;  5CEC A;  1CI8 A;  1FR6 A;  2JE5 A;  2OLU A;  4WEL A;  3C4P A;  4UAA A;  1L0F A;  1VM1 A;  4UA9 A;  3VFF A;  4KG5 A;  3V39 A;  2ZC4 B;  1KVM A;  3HVF A;  4F94 A;  3LO7 A;  1GA0 A;  4PM8 A;  4WM9 A;  3PBT A;  4MEZ A;  5CTN A;  3ZVT A;  1CK3 A;  3G4P A;  4EV4 A;  1G68 A;  2XFS A;  4LEN A;  4MBH A;  4B4Z A;  3UPN A;  1SDE A;  4GKU A;  1LI9 A;  5FAQ A;  1MKI A;  4UHU A;  2BG1 A;  1YT4 A;  1YLT A;  4C6Y A;  5F82 A;  5GLB A;  3S1Y A;  1E4D A;  3UN7 A;  3ZNY A;  1PI5 A;  2HDU A;  5A91 A;  5E2H A;  3SH9 A;  3HBR A;  1YLJ A;  3MZE A;  2PBY A;  2ZQ7 A;  4X56 A;  5EPH A;  5E2G A;  3VOZ A;  4U0X A;  5JYP A;  2EFU A;  5A92 A;  3UE3 A;  1KE0 A;  1ZG6 A;  2E8I A;  4DE0 A;  3ITA A;  1XKZ A;  1L0G A;  3TOI A;  4WBG A;  4U0T A;  3QNB A;  2XQZ A;  4M3K A;  4OON A;  1JWZ A;  2Y2K A;  1KE3 A;  5FA7 A;  1BZA A;  4IED A;  1PWC A;  4WYY A;  3P09 A;  4S2N C;  1G6A A;  1NXY A;  3BLS A;  4JF4 A;  4ZJ1 A;  5EVI A;  3LCE A;  1PW8 A;  3HLC A;  1YMX A;  3PBO A;  2QZ6 A;  4PM9 A;  4ID4 A;  4OPR A;  4ZDX A;  4ZJ3 A;  1H5X A;  4QJG A;  1NRF A;  3W8K A;  5EOO A;  4LCL A;  1L0D A;  4IBX A;  1XP4 A;  2IWD A;  3M2K A;  1XPB A;  5G18 A;  4E3L A;  4OKP A;  4BQM A;  1PZO A;  3E2K A;  4BEN A;  2WKH A;  4JXG A;  2Y2J A;  4OPZ A;  4DXB A;  3IXB A;  4JF6 A;  3ZG0 A;  2XH9 A;  2WGI A;  3C7V A;  2I72 A;  3G31 A;  4B88 A;  3MZF A;  3Q1F A;  3BFD A;  1IEM A;  5FAT A;  1XA7 A;  4XXR A;  3OCL A;  3VMA A;  1JTD A;  1HZO A;  3WWX A;  4KZ7 A;  3DTM A;  5TFQ A;  5M18 A;  1SKF A;  3GR2 A;  1K4F A;  4KZB A;  4N1X A;  4KEN B;  3IF6 B;  4R3J A;  3S22 A;  1ESU A;  2Z2M B;  2DCF A;  4OPQ A;  5CRF A;  3UNW A;  3VP3 A;  5HL1 A;  2XGN A;  4BL2 A;  3C4O A;  5CED A;  4RA7 A;  5GHY A;  1W7F A;  4P6B A;  4JBF A;  3Q82 A;  3PTE A;  5CTM A;  2WKE A;  2WZZ A;  2UWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...