4E6XA

Clbp in complex boron-based inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
310
Chain Sequence
ERLSTLIHQRMQEAKVPALSVSVTIKGVRQRFVYGVADVASQKANTLDTVYELGSMSKAFTGLVVQILIQEGRLRQGDDIITYLPEMRLNYQGKPASLTVADFLYHTSGLPLRNENLLFAPGAKFSYASANYDVLGAVIENVTGKTFTEVIAERLTQPLGMSATVAVKIIVNKASGYKLGFGKPVLFARNHVPAAYIHSTLPDMEIWIDAWLHRKALPATLREAMSNSWRGNSDVPLAADNRILYASGWFIDQNQGPYISHGGQNPNFSSCIALRPDQQIGIVALANMNSNLILQLCADIDNYLRIGKYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ClbP peptidase
publication title The NRP peptidase ClbP as a target for the inhibition of genotoxicity, cell proliferation and tumorogenesis mediated by pks-harboring bacteria
rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 89
structure length 310
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4e6xA00
4RYEA 4WM9A 4P87A 3BFGA 2OV5A 3ZGAB 4IEDA 3G2YA 2ZC3B 3LY4A 5EVIA 2PBYA 4JF5A 4JKTA 3HLEA 1K54A 4E3IA 5FQKA 1M40A 3W4OA 3GRJA 4JPMA 3OCLA 2Y2PA 4GOGA 1GCEA 5CGWA 4R23A 2WKEA 4OLGA 4DXBA 3BFEA 2ZC6B 1FR6A 2P9VB 3IXGA 3IH8A 3N6IA 4QB8A 5CHMA 4BLMA 4FD8A 1SCWA 3ZHHA 2XEPA 2JCHA 2XGNA 3BFDA 2OSUA 5CTNA 3D4FA 1KDWA 1S0WA 3GVBA 2Y2LA 1KE4A 3M6BA 1I2WA 4KQQA 3BRMA 2XK1A 3HLCA 2EX6A 2ZLYA 3N7WA 5DVAA 5KMWA 3GQZA 1E25A 4U3TA 4BD0A 1FCMA 3N8LA 3HLWA 4OONA 1FQGA 2ZQ7A 2XD1A 2RCXA 4S2MA 4BL3A 4C75A 4GD8A 1EI5A 3LEZA 3PBNA 5E43A 3VP1A 1MWSA 3PBTA 4OPQA 3LY3A 5FQ9A 4X56A 4Q8IA 1GA9A 2GDNA 1CI8A 5GHYA 4NK3A 4PMAA 3DWZA 1Q2PA 1XA7A 2A49A 3WRZA 3CJMA 1LLBA 4JLFA 4UAAA 2HP5A 5E2EA 1RP5A 3IXBA 1KVMA 2EX8A 2HP9A 3CZDA 4Y7PA 4E3NA 3S4XA 2J7VA 3I7JA 3JYIA 1JWPA 3G32A 3RXWA 5M19A 4S2KA 4M3KA 4E3OA 1CI9A 3HLFA 2ZM8A 2RL3A 1BLSA 2DRWA 4GDBA 4WYYA 2JC7A 2EFUA 2WKIA 3MXRA 4K0XA 3IF5A 5AQBA 3FKWA 4PM6A 1Z6FA 1JVJA 2H0TA 4LCLA 3LO7A 2J9PA 1VQQA 1XPBA 2QPNA 1IKGA 3V3SA 2WZZA 2WGWA 1XA1A 3GR2A 5J8XA 4H8RA 1ONGA 4BD1A 5TFQA 1Q2QA 2G2UA 3WWXA 2OLVA 1BSGA 2ZM2A 5EVID 5DF9A 4ZJ1A 2WYXA 3Q81A 5EOEA 3HREA 1ERQA 3ZDJA 3C7VA 4K0WA 4R1GA 4KZ3A 4OVDA 1ALQA 4KZBA 4WZ5A 2ZMAA 4PM9A 2VGKA 3BEBA 4OPZA 1EWZA 5FI7A 3NBLA 4UA6A 1ES3A 1YQSA 3OZHA 4GZBA 4S2JA 1BLCA 3BFFA 3MZEA 5FI2A 4S2NC 5DTKA 1O7EA 3B3XA 1PIOA 4U0XA 1LI9A 2DCFA 2HDUA 1YLWA 2WADA 2ZQ8A 3C4OA 1Y54A 4S2PA 4EV4A 2ZQ9A 1L0EA 1O07A 3OPPA 4CJNA 5F1FA 3PBRA 4UHUA 5EVLA 3VOZA 1WE4A 2G2WA 5FAPA 1L0DA 3DWKA 5GLAA 2ZC5B 4OQIA 5E2FA 3QHYA 4ZJ3A 4OKPA 4X68A 2ZM0A 1KE3A 4EQIA 5FASA 4X53A 1WYCA 1DY6A 2XQZA 3CG5A 3C7UA 1LHYA 1TDGA 3ZG9B 2C6WB 3EQVA 3BM6A 2BG1A 1K57C 3UE1A 3AGFA 3PTEA 5F1GA 4OQ0A 3ZNYA 1KGEA 3W4QA 3ZNTA 3WS2A 3VP3A 1IYPA 1L2SA 1WYBA 1KGFA 4MBFA 4FH2A 2X71A 2WAFA 3IWIA 4RX3A 3Q7VA 1YMXA 2EX9A 3IWQA 1ZC2A 3IF6C 2HDQA 4LCMA 3N8SA 4KG5A 2JE5A 2XF3A 1W8YA 2Y2HA 2Y59A 2XD5A 5FAOA 3ZVWA 2WGIA 5A90A 4KZ4A 2X01A 1IEMA 3SH7A 4OPYA 3IXHA 5DTSA 1FOFA 1IYOA 1YLPA 2XFTA 3OC2A 3SH8A 2Q9MA 5TGFA 3UDIA 1K4FA 2ZC4B 3WS0A 3IXDA 1CEGA 1NRFA 3HBRA 3DW0A 2Y2GA 3VP0A 1K55A 3Q7VB 1XKZA 4HBTA 3V50A 5EVIB 3NY4A 4GNUA 3SS5A 3WS1A 5JYOA 1BT5A 3Q7ZA 3ZG5A 1I2SA 2HDRA 4OOMA 2IWBA 1MKIA 1NZUA 4MLLA 1XXMA 3AGEA 1BULA 3O3VA 3BLSA 3BECA 4CPKA 3VSKA 3G2ZA 3UO9A 3UPOA 3IQAA 4E3LA 3MZDA 1PI5A 5CXWA 5AQ9A 3SH9A 1KDSA 4PPRA 1GHIA 1ERMA 3UE3A 2UWXA 5HL1A 1ZKJA 2Y2JA 2Y2MA 5HX9A 4DKIA 4HBUA 2V2FF 3Q07A 3ZG0A 1K56A 1DJBA 1YT4A 1H8YA 2Y2KA 1MXOA 4QD4A 2J9OA 1MWUA 1J9MA 2IWCA 3GTCA 1KE0A 3M2KA 2EXBA 3P09A 5CERA 1QMEA 2VGJA 4KQRA 1JWZA 4Y0UA 4OH0A 3W8KA 1NXYA 1OMEA 2JBFA 5TR7A 5E2HA 3VP4A 2ZJ9A 1HVBA 5GLDA 1N9BA 3ZG8B 1JTDA 1PWGA 2Z2MB 4YINA 4JXSA 5FQIA 3UY6A 3UE0A 4JF6A 4B4XA 3OCNA 2BLSA 2WGVA 1JTGA 3NDEA 2V1ZA 1ZG4A 5BOHA 3QNCA 2XLNA 1YMSA 3ITBA 3ZVTA 2WK0A 4S2NA 1S6RA 3FKVA 5FQQA 1HD8A 1K6RA 3BYDA 3A3DA 2R9WA 2HDSA 3NI9A 4WZ4A 3HL9A 4UA9A 1W5DA 4N1HA 4WBGA 5FDHA 5M1AA 5HW3A 4QJGA 1BUEA 3NDGA 4PM5A 5CHUA 3PAEA 2Y2QA 4KZAA 4ID4A 1L0FA 3ZFZA 3PBSA 4E3JA 4JXWA 1K4EA 4MBKA 5KZHA 1JWVA 1QMFA 5CEBA 4KG2A 3HUOA 2WGWB 3HUNA 4ZBEA 3N8RA 5CECA 1CK3A 5KSCA 4O7DA 4DDSA 3VSLA 4A5RA 1RGZA 1ESIA 3HLDA 5DF8A 5CHJA 5FA7A 1G68A 1ES2A 1MBLA 3A3IA 4N9LA 5HARA 5CRFA 4ZAMA 2QMIA 3OPRA 4E3KA 5HFOA 2HP6A 4N1XA 3HVFA 1BLPA 1FR1A 4DDYA 1M6KA 3AGDA 1U60A 4C3QA 4E6WA 1K6SA 4WEJA 4Y0TA 2I72A 1I5QA 1IYQA 3IF6A 4IBRA 4LV3A 4QY6A 4JF4A 3MXSA 2Z2LB 4P0MA 1XP4A 2V20A 2Y2NA 4LENA 4S2LA 1PZPA 3WS4A 3MKFA 1K56D 1SHVA 5CGXA 5EE8A 1K38A 1LL5A 5CEDA 1PW8A 2P74A 4K91A 1E3UA 2EX2A 4KQOA 4WZ5C 1RCJA 3G4PA 4XUXA 3MZFA 4P6BA 4R0QA 3W4PA 5CTMA 3GSGA 1LI0A 1PYYA 3Q82A 5GLBA 4N9KA 3ZCZA 4GN2A 3LCEA 1NZOA 1SDEA 4RX2A 3FZCA 2DNSA 2P9VA 5G18A 2XDMA 3G31A 5U47A 4S2OA 5HAPA 4RA7A 4B88A 3G35A 3HLBA 4S2IA 4UA7A 1MWRA 1NY0A 4WMCA 3VFHA 5FATA 4JXGA 1SDNA 5E2GA 1PWCA 4OLDA 2WZXA 5HAQA 5FQMA 1YLTA 4OP5A 4DRTA 3OPLA 1RGYA 1W8QA 3E2KA 1MPLA 1BZAA 5A92A 3MFDA 2CC1A 3ITAA 3GV9A 4LV2A 4X69A 3UPPA 1H8ZA 2H0YA 4WELA 2B5RA 5I94A 5F83A 2PU2A 1TEMA 1L0GA 4IBXA 3V3RA 3IHBA 1ES5A 2Y4AA 4PM8A 3V39A 3OPHA 3VOYA 4R4SA 4OP8A 3PAGA 4PM7A 4BENA 1VM1A 3S1YA 5EUAA 1BLHA 5EVIC 1DJAA 1PWDA 3O86A 3O88A 4QHCA 1K54C 3TG9A 1C3BA 1NJ4A 4OQGA 2H5SA 1YLZA 4IVIA 1E4DA 2R9XA 3M2JA 2A3UA 5JYPA 2H10A 5L2FA 1IKIA 1TVFA 3MBZA 5EPHA 2ZQCA 4EUZA 4MBHA 3UN7A 3ZG7B 3WRTA 1YLYA 1K25A 2WUQA 3BFCA 2ZQDA 1AXBA 1NYMA 5AQAA 4XXRA 2EXAA 3RJUA 3A3JA 5DTTA 2ZC7A 1N4OA 4R3JA 5IHVA 2WKHA 4KENB 4DXCA 1GA0A 1PW1A 4FH4A 3A3FA 1K55C 4XUZA 4YFMA 3VFFA 2E8IA 4JBFA 4GKUA 2QZ6A 3HUMA 4R4RA 1XX2A 1FCOA 1E3UD 1DJCA 5GHXA 3EQUA 4P85A 3G30A 3ISGA 5F82A 3VMAA 4EWFA 4OOLA 1SKFA 4Y0OA 2FFYA 5GHZA 1XGJA 4GD6A 4LV1A 4FSFA 4X55A 5FAQA 3FWLA 5M18A 4OPRA 1W7FA 3SOIA 3SS3A 1HTZA 4RVAA 3P98A 4KZ9A 4DE3A 5CGSA 1NYYA 4U0TA 5GLCA 3IH9A 1MY8A 5DF7A 5EOOA 5KSHA 4Z9QA 4ZTKA 1KGGA 4R3BA 3GMWA 4NETA 1LL9A 3SS4A 3VP2A 4WMCD 1PI4A 3NC8A 4DF6A 4MNRA 2ZD8A 2X02A 4JXVA 3S22A 3TOIA 4KZ8A 4HEFA 4QY5A 2OLUA 3TSGA 1GHMA 3UDXA 3PBOA 4L0LA 4X6TA 1K57A 3Q1FA 2Y55A 3M6HA 1MWTA 1GHPA 2XFSA 3IHAA 1BTLA 3MKEA 4KZ6A 5FQJA 2PU4A 4C6YA 2XH9A 5GL9A 2WAEA 3BLMA 3FYZA 3RXXA 3WS5A 4N92A 4EBLA 4DE1A 4OQHA 5FSRA 2Y2OA 4EBNA 3FV7A 4E6XA 1ZG6A 5A93A 1EROA 4QU3A 4ZJ2A 4BJPA 1FSYA 3UPNA 2HPBA 4DE2A 4EBPA 1YM1A 1TDLA 1ESUA 3DTMA 4GB7A 5FI6A 3QNBA 3UDFA 1FSWA 3CMZA 3IT9A 3UNWA 4IVKA 1W79A 4HESA 4GDNA 3HLGA 5AQ7A 1YLJA 4ZDXA 3IWOA 4MEZA 5D3OA 4BL2A 4DE0A 2J8YA 4FCFA 2Y2IA 4KZ7A 3C4PA 3NIAA 1HZOA 3V5MA 1FCNA 2Y91A 1G6AA 2ZQAA 3IF6B 3N4IA 2Q9NA 2EFXA 2C5WB 1KVLA 4F94A 4D2OA 3A3EA 1IELA 4KZ5A 1IYSA 5HAIA 4E3MA 1CEFA 5A91A 4LV0A 5EECA 2FFFB 1ES4A 3C5AA 4KG6A 3PBQA 1H5XA 1PZOA 3G34A 4OOYA 4WEKA 2XR0A 3NCKA 1ONHA 2IWDA 3E2LA 1XGIA 4BQMA 4B4ZA 3O87A
chains in the Genus database with same CATH superfamily
2OV5A 5EVIA 2PBYA 4LRYC 5F69A 4E3IA 4IUKA 2VJWA 2Y2PA 1GCEA 4R23A 4OLGA 4DXBA 1FR6A 5CHMA 5HD5A 1SCWA 2XGNA 1S0WA 1KE4A 3CPTB 4I5SA 1F98A 3N7WA 3CWFA 4S2MA 2JKTM 4F3LA 4GD8A 3LEZA 5LBRA 3VP1A 5DKKA 4OPQA 3LY3A 4UQIM 1GA9A 5GHYA 1CI8A 5L09A 3UMEA 1LLBA 4UAAA 1WA9A 2HP5A 4Q0IA 3SZTA 1KVMA 3TRCA 2QYBA 3S4XA 3CAXA 3LYXA 2J7VA 5AVEA 4S2KA 1YAXA 3LI8A 4GDBA 2JC7A 2WKIA 4K0XA 4LLOB 4PM6A 1JVJA 4MDZA 2QPNA 3KSFA 1CJFA 3U2AA 3GR2A 5J8XA 5TFQA 1Q2QA 3WWXA 4H6JA 2I9VA 3EGDC 4ZJ1A 2WYXA 3Q81A 3ZDJA 3C7VA 3VV4A 4OVDA 3NBLA 4GCZA 1NRJA 1BLCA 3MZEA 5FI2A 5MC7A 5DTKA 2EA9A 4U0XA 2HDUA 1H3QA 3QP2A 2KX6A 2ZQ8A 1TS7A 3LIAA 3PBRA 4UHUA 3MMHA 4UQIS 1L0DA 2JKTI 2PAVP 5E2FA 5FASA 2XQZA 3C7UA 2C6WB 3LR4A 1YPRA 3E0YA 3ZNYA 2HGVA 1L2SA 3DTKA 2PD8A 4MBFA 2X71A 4CLCE 3RH8B 3IBRA 5A90A 4OPYA 1FOFA 1P9RA 1YLPA 3SH8A 3KSHA 1K4FA 2W1TB 3WS0A 2Y2GA 2OWHA 3F1PB 2WKPA 1XKZA 2J80A 3SS5A 5JYOA 1I2SA 1XXMA 3F1NB 1BULA 1OJGA 3BECA 2K31A 3VSKA 4YWZA 3G2ZA 1OTBA 3UE3A 1ERMA 2Y2MA 2V2FF 1DJBA 1H8YA 1MXOA 4MCWA 1J9MA 3CUEA 2IWCA 3JVUA 4G3VA 3UB7A 5I5LA 5HDDA 1JWZA 1NXYA 4FOFA 3S7PA 5E2HA 3VP4A 1HVBA 1N9BA 5F6AA 2DMWA 2VV8A 4JXSA 4YINA 5FQIA 3UE0A 4JF6A 2BLSA 3NDEA 3D3OA 4JGPA 1ZG4A 3DAVA 2WK0A 4G3KA 4DN0A 4IUHA 1W5DA 4CLCC 4PM5A 1CQAA 4UEYA 3QP8A 3PBSA 4E3JA 4MBKA 1JWVA 1ACFA 1QMFA 3T1SA 3R4KA 4ZBEA 5CECA 5KSCA 1CK3A 3IBJA 5CHJA 4IHQA 3A3IA 4N9LA 4ZAMA 5J3WA 3C30A 4N1XA 1BLPA 4DDYA 4NXEA 5L10A 2I72A 4QY6A 1YSPA 1PRQA 2L0WA 2Z2LB 2L4RA 2V20A 2Y2NA 4LRZE 1PZPA 3LIDA 1SHVA 2EX2A 4BBTA 3W4PA 5CTMA 4ME4A 1JNUA 4LPZA 4N9KA 3VE3A 4GN2A 1ODVA 2P9VA 5G18A 5HAPA 4S2OA 2L1MA 4R3AA 4UA7A 1NY0A 3HCYA 2V8CA 5HAQA 1YLTA 4DRTA 3OPLA 3E2KA 1MPLA 1BZAA 3B42A 4BMWA 3MFDA 4K08A 4HJ6A 2B5RA 5F83A 2PU2A 2V8FA 1LSXA 4PM8A 3PAGA 1VB6A 1VM1A 1FILA 1NJ4A 4OQGA 1E4DA 4GS9B 4D60A 2H10A 1IKIA 2KDKA 2ZL1A 4GHIA 2D02A 4JGQA 4EUVA 1AXBA 5AQAA 3H82A 3R7WA 3A3JA 1MZUA 2V0WA 1N4OA 2CMNA 4KENB 1GA0A 4YFMA 2QWSA 2JKFA 2E8IA 4JBFA 4GKUA 3HUMA 4X1MA 4QPRA 4P85A 3K2NA 3G30A 5F82A 4OOLA 2FFYA 5GHZA 1XGJA 4LV1A 2UV0E 4FSFA 4X55A 3FWLA 1TS8A 2PR6A 1W7FA 5EVEA 4RVAA 4I39A 2OAQ1 4DE3A 4R3BA 3GMWA 4NETA 1LL9A 5EM0A 2GZAA 3NC8A 4MNRA 3TOIA 4JXVA 3ULFA 4KZ8A 4Y5FA 3MJQA 4QY5A 3Q1FA 2Y55A 3BQAA 3M6HA 1GHPA 2XFSA 4YOFA 2PU4A 4C6YA 1S1ZA 1Y4OA 2WAEA 5DJUA 2HJ9C 3RXXA 3WS5A 4DE1A 4OQHA 4EBNA 3MQOA 3A0SA 1FSYA 5HDSA 1TDLA 4GB7A 5FI6A 1FSWA 3UNWA 4IVKA 4GDNA 3BY9A 3IWOA 4MEZA 5IT5A 1SKOB 3D9YA 1Y28A 2J8YA 4FCFA 4AFIA 3C4PA 3NIAA 1HZOA 4CLCD 3N4IA 1X0OA 4D2OA 4E3MA 2YKFA 1F9IA 3QP1A 3PBQA 2J3TD 1PZOA 1ONHA 2IWDA 2B02A 2OOLA 1LL8A 3V67A 3ZGAB 3G2YA 3HLEA 1K54A 1A0KA 1M40A 5FQKA 4JPMA 3BY8A 4P6ZS 4GOGA 5CGWA 5CX7A 3IH8A 4QB8A 4FD8A 2XEPA 2JCHA 4NXBA 5CTNA 3GVBA 4KQQA 3HLCA 2EX6A 4GW9A 2ZLYA 5KMWA 3HLWA 4OONA 2ZQ7A 2XD1A 1MC0A 5KIZA 1EI5A 3PBNA 5E43A 1MWSA 4Q8IA 3T4TA 4NK3A 3DWZA 1F2KA 4YNRA 2XA7S 4JLFA 5E2EA 4E3NA 3CZDA 5M19A 3MSHA 4E3OA 4NXGA 1CI9A 3HLFA 2HF6A 2ZM8A 1N9NA 3T4SA 4WYYA 3LI9A 2EFUA 3IF5A 3MFXA 2R78A 2J9PA 1VQQA 2BTFP 4CLCB 1XPBA 3V3SA 2WGWA 4HOIA 4H8RA 4JGRA 2OLVA 5EM1A 1VETA 3NHQA 3HREA 1ERQA 4R38A 3ZQ5A 2VZWA 4WZ5A 4ZRRA 2Z6DA 4UA6A 4MN7A 4GZBA 4S2JA 3BFFA 1YSQA 1LI9A 1NWZA 4EV4A 3C4OA 2FH5A 1O07A 3OPPA 5GLAA 4OQIA 4PKYG 2K2NA 3QHYA 4NEED 4X68A 2ZM0A 1NLZA 1LHYA 3BM6A 2AVXA 2EWVA 3LR3A 2QHKA 1WYBA 1KGFA 3GDIA 4FH2A 3IWIA 3Q7VA 2EX9A 3IWQA 1ZC2A 2HDQA 3N8SA 4KG5A 2JE5A 2XF3A 1W8YA 2Y2HA 5HL6A 2Y59A 3ZVWA 4KZ4A 1IEMA 3SH7A 4HJ3A 4Q0HA 2Y8HA 2XFTA 3OC2A 2YKHA 5TGFA 3DW0A 4EXOA 2W3EA 3MQ0A 4WL9A 1SZVA 3NY4A 4B9OA 2HDRA 4OOMA 2IWBA 1XJ4A 4HP9A 1K0KA 3AGEA 3O3VA 3UMDA 2ZMVA 4CPKA 1PI5A 4HH2A 1KDSA 1J3WA 4PPRA 4G3WA 3Q07A 3ZG0A 1K56A 2P08A 4B93A 2Y2KA 4HNBA 5HPFA 1BYWA 2J9OA 2JN7A 2PR5A 1PFLA 3H7WA 2PYPA 3P09A 1QMEA 4KQRA 3W8KA 2JBFA 2QKPA 5TR7A 3ZG8B 1JTDA 4KUKA 2MJ6A 3UY6A 4B4XA 2WGVA 1JTGA 2Z6CA 3ITBA 4S2NA 1S6RA 5FQQA 1HD8A 3A3DA 2R9WA 3NI9A 5L8MA 3HL9A 4N1HA 4WBGA 5FDHA 5HWTA 1BUEA 5CHUA 3PAEA 1L0FA 4ETXA 4JXWA 1DRMA 3IS2A 5KZHA 1DP9A 5J7EA 3N8RA 4O7DA 2PBDP 4DDSA 3VSLA 4A5RA 1RGZA 1ESIA 3HLDA 5FA7A 2Y79A 4Q0JA 5TBMA 5HARA 2QMIA 3OPRA 5HFOA 3HVFA 4XT2B 1M6KA 1U60A 4Y0TA 3LICA 4WEJA 2V9AA 3IF6A 3CI6A 3MXSA 4P0MA 5FL3A 3QP5A 4LENA 4HI4A 3WS4A 5CEDA 1LL5A 4K91A 4WZ5C 1E3UA 2WKQA 1RCJA 3G4PA 3K3CA 4P6BA 3NULA 1PYYA 3Q82A 1L3LA 3UB6A 4RX2A 2VV7A 3FZCA 2DNSA 2XDMA 4RA7A 3VOLA 4B88A 2FZ0A 3HLBA 4S2IA 3CPTA 1TS6A 5FATA 1SDNA 1VHMA 4OLDA 4OP5A 3T4JA 3MF0A 1H8ZA 1L0GA 5HD3A 3T12B 4OP8A 1DP6A 4BENA 1MKMA 3S1YA 4KQDA 5EVIC 1DJAA 3O86A 3BW6A 1C3BA 3NOUC 4IVIA 3HJIA 5EPHA 4MMNA 2ZQCA 3WRTA 4R6LA 2B18A 2EXAA 5DTTA 1PW1A 4XUZA 4LGWA 3A3FA 3VFFA 2QZ6A 1FCOA 5GHXA 3E98A 3A0RA 2VV6A 3KX0X 3VMAA 4Y0OA 3NECA 5FAQA 3SOIA 1V9ZA 3P98A 2JKRI 5DF7A 5KSHA 4ZTKA 3SS4A 4WMCD 2ZD8A 4HEFA 2OLUA 1GHMA 3UDXA 4L0LA 3EGXC 1K57A 3MR0A 4FUWA 4KZ6A 5C5KA 2NUPC 2OAP1 4ARZB 2O99A 2Y2OA 3FV7A 3HJKA 4ZJ2A 3UPNA 2HPBA 4EBPA 1YM1A 3DTMA 3CITA 3CMZA 4HESA 5AQ7A 2Y2IA 4KZ7A 2XRNA 2Y91A 2Q9NA 4PKYA 2C5WB 3A3EA 1IELA 3EOIA 1CEFA 5A91A 2W1TA 4LV0A 1H5XA 3NCKA 3E2LA 3O87A 4RYEA 2Q0OA 4WM9A 3BFGA 4JKTA 3OBFA 3W4OA 3GRJA 3F1NA 2ZC6B 2PT7A 3IXGA 1G6OA 3N6IA 4MN6A 1W63Q 3D4FA 1KDWA 3M6BA 2INWA 3BRMA 1H0MA 1E25A 4U3TA 1FCMA 3N8LA 1FQGA 1PNEA 4C75A 3C38A 3C8CA 4JGOA 3ZYTA 5FQ9A 4ETZA 2VK3A 4X56A 4X1LA 4EETB 1RP5A 4Y7PA 2HP9A 1OTIA 3I7JA 3RXWA 1JWPA 3G32A 4I3IA 3D72A 4HP4A 1BLSA 2DRWA 4BBVA 3FKWA 1Z6FA 2H0TA 3LO7A 2A24B 1IKGA 1D7EA 1ONGA 3CUEC 3TW8A 2G2UA 1BSGA 1LSVA 5EVID 5EOEA 5HZHA 3RFBA 4R1GA 4L9FA 4KZ3A 1S66L 4I3JA 4KZBA 2ZMAA 4PM9A 3BEBA 4OPZA 5FI7A 2J3WA 1ES3A 1YQSA 3OZHA 3PR6A 3B3XA 2O9BA 2DCFA 3TE8A 2XSSA 4S2PA 1D1JA 2BASA 5F1FA 1WE4A 5FAPA 4RQ9A 2ZC5B 3F1OB 4ZJ3A 4OKPA 1KE3A 4X53A 1WYCA 1DY6A 4DJ2A 3MXQA 1TDGA 3IX3A 3EQVA 1K57C 1P0ZA 3PTEA 5F1GA 3SW1A 1S67L 4DMZA 4OQ0A 1KGEA 1S4RA 4HIAA 1T18A 3BWLA 3W4QA 3WS2A 5AVFA 3KYZA 4EQ1A 1N9LA 2WAFA 3T50A 4RX3A 1YMXA 3PHYA 4LCMA 5FAOA 2WGIA 2X01A 1STZA 5DTSA 1IYOA 4M4XA 2H28A 1CF0A 4GJ4A 3VP0A 1DP8A 4EERA 4R70A 2HJEA 1K55A 1Z09A 3Q7VB 4HBTA 3V50A 5EVIB 3WS1A 3ZG5A 4CQHA 1MKIA 1NZUA 4MLLA 3BLSA 2W3FA 3UPOA 3IQAA 3MZDA 3SH9A 3T4OA 3LIFA 1GHIA 2UWXA 4HBUA 5G4ZA 3NOTC 4QD4A 4F3LB 3LR0A 3GTCA 1KE0A 3M2KA 2EXBA 5CERA 4FTXA 2VGJA 2IA2A 4Y0UA 5DFYA 1OMEA 3T4QA 4BWIA 2ZJ9A 1S1YA 5GLDA 1PWGA 2Z2MB 5AJGA 3CLOA 5A8BA 1K6RA 4HQAA 4WZ4A 5HW3A 5M1AA 4QJGA 5FEGA 2Y2QA 1OTAA 3LGOA 2NUTC 3T1RA 4KZAA 4ID4A 3ZFZA 5CEBA 4KG2A 1T1BA 2VGLM 4Y13A 5DF8A 1EW0A 4H6JB 1G68A 1ES2A 1MBLA 3DTEA 5CRFA 1S4SA 2O9AA 1SKOA 2V1BA 4O01A 3AGDA 4C3QA 4LV3A 1I5QA 1IYQA 1N9OA 4JF4A 1XP4A 4S2LA 3MKFA 5CGXA 5EE8A 1K38A 1PW8A 4KQOA 1VEUA 4XUXA 5TBMB 3JVVA 4HY8A 3GSGA 3C2WA 4Y2FA 5GLBA 3ZCZA 1NZOA 2VKSA 1OT6A 3EWKA 4Z1WA 2KOIA 5U47A 3G35A 4WLAA 3VE4A 1UWPX 4EESA 3KYEA 1PWCA 5FQMA 3QP6A 2PDRA 5A92A 3ITAA 3UPPA 3GV9A 4LV2A 4X69A 4WELA 2PRFA 5HPIA 2VGLS 3V3RA 2E8JA 1ES5A 2Y4AA 4O8GA 3V39A 3VOYA 1HLUP 4PM7A 1KOUA 5EUAA 1PWDA 2W3HA 3O88A 1K54C 2H5SA 1YLZA 1ZHHB 3M2JA 2A3UA 1TVFA 4EUZA 3ZG7B 1YLYA 1K25A 3BFCA 4LFUA 2ZQDA 5HSQA 4XXRA 5IS1A 3KSGA 5IHVA 4CLCA 4FH4A 1K55C 1T19A 4R4RA 1XX2A 1OPXA 1DJCA 3EQUA 2G7UA 2ZMFA 5DJTA 1SKFA 4OPRA 3SS3A 1XJ2A 1HTZA 4KZ9A 2M1CA 1NYYA 1MY8A 5EOOA 4Z9QA 3E4QA 3VP2A 4DF6A 3PYPA 3KO6A 3S22A 3TSGA 3TJZC 4I38A 4X6TA 1OT9A 1V9YA 1XJ3A 3LIBA 3BQ8A 2XH9A 3BLMA 1P97A 3BJNA 2PYRA 4N92A 4EBLA 2GX5A 3EEAA 4NG2A 5A93A 5EFWA 4BJPA 1XJ6A 1NLYA 3QNBA 3HLGA 3IX8A 4PHTA 4EU0A 3K3DA 1T1AA 4ZDXA 3UE6A 5D3OA 4BL2A 4NXFA 4PAUA 4DE0A 3FPVA 3V5MA 1D06A 2JKRM 2JHEA 1GSVA 5HAIA 1IYSA 2GNXA 5EECA 2FFFB 1ES4A 3C5AA 4OOYA 4Y3IA 4WEKA 3T1QB 4U0TA 4P87A 4IEDA 2ZC3B 3LY4A 4EEUA 4JF5A 4I3AA 4MN5A 3OCLA 2O9CA 2WKEA 3BFEA 2P9VB 4BLMA 3ZHHA 3BFDA 2OSUA 3S7OA 2Y2LA 1I2WA 2XK1A 3NOPC 2OWJA 5DVAA 3GQZA 3U4LP 4BD0A 2RCXA 1G5UA 4BL3A 4QWOA 3B33A 3OOVA 3PBTA 2GDNA 4PMAA 1OTEA 1Q2PA 1XA7A 2A49A 2V0UA 3WRZA 3CJMA 3P7NA 4HH3A 3IXBA 2EX8A 3JYIA 1G28A 4M3KA 3MQQA 4II7A 3KYQA 3FPWA 2RL3A 2ZL1B 3MS6A 4GHIB 3MXRA 3RTYA 3H82B 5AQBA 3R7WB 4LCLA 2W1RA 2ZOHA 1P9WA 3G6OA 2WZZA 3LIEA 1XA1A 2QJ5A 3UB8A 4BD1A 1TF1A 3A0VA 2ZM2A 5DF9A 4WUJA 4K0WA 1ALQA 2VGKA 1EWZA 4XT2A 4LRXC 2J3TC 5FEFA 1TD5A 1OJ5A 4S2NC 1XFNA 1O7EA 1PIOA 3W2ZA 1LSWA 1YLWA 2WADA 1Y54A 2ZQ9A 1L0EA 4CJNA 5EVLA 3VOZA 2G2WA 3DWKA 3E4PA 1IFQA 3DBAA 2B95A 4EQIA 3CG5A 3ZG9B 1TS0A 5K5BA 2BG1A 3UE1A 3AGFA 3QP4A 3O5YA 4L9GA 3ZNTA 3VP3A 1IYPA 3F1PA 5IU1A 3IF6C 5G4YA 2XD5A 4GLQA 3IXHA 3UB5P 2Q9MA 2HV1A 3UDIA 2ZC4B 3EEHA 3IXDA 1CEGA 2GJ3A 1NRFA 1T1CA 3HBRA 2VEAA 2K7SA 4GNUA 1BT5A 3Q7ZA 3L9KA 1FIKA 1LT0A 3UO9A 4E3LA 5L07A 5CXWA 5AQ9A 1H8MA 2LB9A 3L7HA 5HL1A 1ZKJA 2Y2JA 5HX9A 3T4KA 4DKIA 4HHDA 1YT4A 3GECA 3UB9A 2JKGA 1MWUA 3T1XA 2QJ7A 4OH0A 5DFXA 3LUQA 2D01A 3KSIA 3OCNA 2V1ZA 5BOHA 3QNCA 1XFQA 2XLNA 1YMSA 3IX4A 3ZVTA 5TJJA 1IOUA 3FKVA 3BYDA 2HDSA 4UA9A 3JPUA 2EWWA 2HZ5A 3NDGA 4WN5A 3E4OA 1K4EA 4ARZA 5HDCA 2KLIA 2W0NA 4P6ZM 3HUOA 2WGWB 3HUNA 2W3DA 3S7QA 1VETB 4BBUA 4E3KA 4O0PA 2HP6A 4DJ3A 4ESPA 3NJAA 5FDSA 1FR1A 4E04A 4E6WA 1OTDA 1K6SA 4IBRA 1UWNX 2W3GA 2ACGA 1K56D 3T4LA 2P74A 5F68A 4HJ4A 2XA7M 3MZFA 1GSWA 4R0QA 2M7VA 1LI0A 4NKPA 3LCEA 2P04A 1SDEA 3DTIA 3G31A 2A2LA 1ZTUA 1MWRA 4WMCA 2P7JA 3VFHA 3FG8A 4JXGA 5E2GA 2LB5A 2WZXA 1VEUB 2V1AA 5HWWA 1RGYA 1W8QA 4EW7A 4GS9A 2PHYA 3ICYA 1GSXA 2VLGA 2O0YA 2CC1A 2H0YA 5I94A 5F5YA 1TEMA 4IBXA 3IHBA 3OPHA 3PXPA 4R4SA 3P01A 1BLHA 3LFVA 4QHCA 2VX8A 3TG9A 3LEQA 5JYPA 2R9XA 5L2FA 1UGUA 3MBZA 3CHWP 4MBHA 3UN7A 2WUQA 3OLOA 2M7UA 1NYMA 3S7NA 4Y15A 3RJUA 2ZC7A 4R3JA 2WKHA 2A24A 4DXCA 4WF0A 4Y17A 1E3UD 1W63M 3ISGA 2WKRA 4EWFA 4GD6A 5M18A 3H7WB 3H9WA 5CGSA 5DKLA 5GLCA 3IH9A 4X25A 1KGGA 1PI4A 3B47A 1AWIA 2X02A 3LR5A 2ZBBA 5HWVA 3PBOA 2ZOIA 2XROA 4L9EA 1MWTA 3F1OA 3IHAA 1BTLA 3MKEA 5FQJA 2VA0A 5GL9A 3FYZA 3IS2B 5FSRA 4E6XA 1ZG6A 1EROA 4QU3A 4DE2A 1ESUA 4EEPA 3UDFA 3IT9A 1W79A 1YKDA 1YLJA 3FC7A 1FCNA 1F5MA 5J4EA 3IF6B 1G6AA 2ZQAA 2EFXA 1KVLA 4F94A 2W27A 4KZ5A 4IJGA 4KUOA 4KG6A 5EV0A 3G34A 2XR0A 1XGIA 4BQMA 4B4ZA 2PD7A
chains in the Genus database with same CATH topology
4RYEA 4WM9A 4P87A 3BFGA 2OV5A 3ZGAB 4IEDA 3G2YA 2ZC3B 3LY4A 5EVIA 2PBYA 4JF5A 4JKTA 3HLEA 1K54A 4E3IA 5FQKA 1M40A 3W4OA 3GRJA 4JPMA 3OCLA 2Y2PA 4GOGA 1GCEA 5CGWA 4R23A 2WKEA 4OLGA 4DXBA 3BFEA 2ZC6B 1FR6A 2P9VB 3IXGA 3IH8A 3N6IA 4QB8A 5CHMA 4BLMA 4FD8A 1SCWA 3ZHHA 2XEPA 2JCHA 2XGNA 3BFDA 2OSUA 5CTNA 3D4FA 1KDWA 1S0WA 3GVBA 2Y2LA 1KE4A 3M6BA 1I2WA 4KQQA 3BRMA 2XK1A 3HLCA 2EX6A 2ZLYA 3N7WA 5DVAA 5KMWA 3GQZA 1E25A 4U3TA 4BD0A 1FCMA 3N8LA 3HLWA 4OONA 1FQGA 2ZQ7A 2XD1A 2RCXA 4S2MA 4BL3A 4C75A 4GD8A 1EI5A 3LEZA 3PBNA 5E43A 3VP1A 1MWSA 3PBTA 4OPQA 3LY3A 5FQ9A 4X56A 4Q8IA 1GA9A 2GDNA 1CI8A 5GHYA 4NK3A 4PMAA 3DWZA 1Q2PA 1XA7A 2A49A 3WRZA 3CJMA 1LLBA 4JLFA 4UAAA 2HP5A 5E2EA 1RP5A 3IXBA 1KVMA 2EX8A 2HP9A 3CZDA 4Y7PA 4E3NA 3S4XA 2J7VA 3I7JA 3JYIA 1JWPA 3G32A 3RXWA 5M19A 4S2KA 4M3KA 4E3OA 1CI9A 3HLFA 2ZM8A 2RL3A 1BLSA 2DRWA 4GDBA 4WYYA 2JC7A 2EFUA 2WKIA 3MXRA 4K0XA 3IF5A 5AQBA 3FKWA 4PM6A 1Z6FA 1JVJA 2H0TA 4LCLA 3LO7A 2J9PA 1VQQA 1XPBA 2QPNA 1IKGA 3V3SA 2WZZA 2WGWA 1XA1A 3GR2A 5J8XA 4H8RA 1ONGA 4BD1A 5TFQA 1Q2QA 2G2UA 3WWXA 2OLVA 1BSGA 2ZM2A 5EVID 5DF9A 4ZJ1A 2WYXA 3Q81A 5EOEA 3HREA 1ERQA 3ZDJA 3C7VA 4K0WA 4R1GA 4KZ3A 4OVDA 1ALQA 4KZBA 4WZ5A 2ZMAA 4PM9A 2VGKA 3BEBA 4OPZA 1EWZA 5FI7A 3NBLA 4UA6A 1ES3A 1YQSA 3OZHA 4GZBA 4S2JA 1BLCA 3BFFA 3MZEA 5FI2A 4S2NC 5DTKA 1O7EA 3B3XA 1PIOA 4U0XA 1LI9A 2DCFA 2HDUA 1YLWA 2WADA 2ZQ8A 3C4OA 1Y54A 4S2PA 4EV4A 2ZQ9A 1L0EA 1O07A 3OPPA 4CJNA 5F1FA 3PBRA 4UHUA 5EVLA 3VOZA 1WE4A 2G2WA 5FAPA 1L0DA 3DWKA 5GLAA 2ZC5B 4OQIA 5E2FA 3QHYA 4ZJ3A 4OKPA 4X68A 2ZM0A 1KE3A 4EQIA 5FASA 4X53A 1WYCA 1DY6A 2XQZA 3CG5A 3C7UA 1LHYA 1TDGA 3ZG9B 2C6WB 3EQVA 3BM6A 2BG1A 1K57C 3UE1A 3AGFA 3PTEA 5F1GA 4OQ0A 3ZNYA 1KGEA 3W4QA 3ZNTA 3WS2A 3VP3A 1IYPA 1L2SA 1WYBA 1KGFA 4MBFA 4FH2A 2X71A 2WAFA 3IWIA 4RX3A 3Q7VA 1YMXA 2EX9A 3IWQA 1ZC2A 3IF6C 2HDQA 4LCMA 3N8SA 4KG5A 2JE5A 2XF3A 1W8YA 2Y2HA 2Y59A 2XD5A 5FAOA 3ZVWA 2WGIA 5A90A 4KZ4A 2X01A 1IEMA 3SH7A 4OPYA 3IXHA 5DTSA 1FOFA 1IYOA 1YLPA 2XFTA 3OC2A 3SH8A 2Q9MA 5TGFA 3UDIA 1K4FA 2ZC4B 3WS0A 3IXDA 1CEGA 1NRFA 3HBRA 3DW0A 2Y2GA 3VP0A 1K55A 3Q7VB 1XKZA 4HBTA 3V50A 5EVIB 3NY4A 4GNUA 3SS5A 3WS1A 5JYOA 1BT5A 3Q7ZA 3ZG5A 1I2SA 2HDRA 4OOMA 2IWBA 1MKIA 1NZUA 4MLLA 1XXMA 3AGEA 1BULA 3O3VA 3BLSA 3BECA 4CPKA 3VSKA 3G2ZA 3UO9A 3UPOA 3IQAA 4E3LA 3MZDA 1PI5A 5CXWA 5AQ9A 3SH9A 1KDSA 4PPRA 1GHIA 1ERMA 3UE3A 2UWXA 5HL1A 1ZKJA 2Y2JA 2Y2MA 5HX9A 4DKIA 4HBUA 2V2FF 3Q07A 3ZG0A 1K56A 1DJBA 1YT4A 1H8YA 2Y2KA 1MXOA 4QD4A 2J9OA 1MWUA 1J9MA 2IWCA 3GTCA 1KE0A 3M2KA 2EXBA 3P09A 5CERA 1QMEA 2VGJA 4KQRA 1JWZA 4Y0UA 4OH0A 3W8KA 1NXYA 1OMEA 2JBFA 5TR7A 5E2HA 3VP4A 2ZJ9A 1HVBA 5GLDA 1N9BA 3ZG8B 1JTDA 1PWGA 2Z2MB 4YINA 4JXSA 5FQIA 3UY6A 3UE0A 4JF6A 4B4XA 3OCNA 2BLSA 2WGVA 1JTGA 3NDEA 2V1ZA 1ZG4A 5BOHA 3QNCA 2XLNA 1YMSA 3ITBA 3ZVTA 2WK0A 4S2NA 1S6RA 3FKVA 5FQQA 1HD8A 1K6RA 3BYDA 3A3DA 2R9WA 2HDSA 3NI9A 4WZ4A 3HL9A 4UA9A 1W5DA 4N1HA 4WBGA 5FDHA 5M1AA 5HW3A 4QJGA 1BUEA 3NDGA 4PM5A 5CHUA 3PAEA 2Y2QA 4KZAA 4ID4A 1L0FA 3ZFZA 3PBSA 4E3JA 4JXWA 1K4EA 4MBKA 5KZHA 1JWVA 1QMFA 5CEBA 4KG2A 3HUOA 2WGWB 3HUNA 4ZBEA 3N8RA 5CECA 1CK3A 5KSCA 4O7DA 4DDSA 3VSLA 4A5RA 1RGZA 1ESIA 3HLDA 5DF8A 5CHJA 5FA7A 1G68A 1ES2A 1MBLA 3A3IA 4N9LA 5HARA 5CRFA 4ZAMA 2QMIA 3OPRA 4E3KA 5HFOA 2HP6A 4N1XA 3HVFA 1BLPA 1FR1A 4DDYA 1M6KA 3AGDA 1U60A 4C3QA 4E6WA 1K6SA 4WEJA 4Y0TA 2I72A 1I5QA 1IYQA 3IF6A 4IBRA 4LV3A 4QY6A 4JF4A 3MXSA 2Z2LB 4P0MA 1XP4A 2V20A 2Y2NA 4LENA 4S2LA 1PZPA 3WS4A 3MKFA 1K56D 1SHVA 5CGXA 5EE8A 1K38A 1LL5A 5CEDA 1PW8A 2P74A 4K91A 1E3UA 2EX2A 4KQOA 4WZ5C 1RCJA 3G4PA 4XUXA 3MZFA 4P6BA 4R0QA 3W4PA 5CTMA 3GSGA 1LI0A 1PYYA 3Q82A 5GLBA 4N9KA 3ZCZA 4GN2A 3LCEA 1NZOA 1SDEA 4RX2A 3FZCA 2DNSA 2P9VA 5G18A 2XDMA 3G31A 5U47A 4S2OA 5HAPA 4RA7A 4B88A 3G35A 3HLBA 4S2IA 4UA7A 1MWRA 1NY0A 4WMCA 3VFHA 5FATA 4JXGA 1SDNA 5E2GA 1PWCA 4OLDA 2WZXA 5HAQA 5FQMA 1YLTA 4OP5A 4DRTA 3OPLA 1RGYA 1W8QA 3E2KA 1MPLA 1BZAA 5A92A 3MFDA 2CC1A 3ITAA 3GV9A 4LV2A 4X69A 3UPPA 1H8ZA 2H0YA 4WELA 2B5RA 5I94A 5F83A 2PU2A 1TEMA 1L0GA 4IBXA 3V3RA 3IHBA 1ES5A 2Y4AA 4PM8A 3V39A 3OPHA 3VOYA 4R4SA 4OP8A 3PAGA 4PM7A 4BENA 1VM1A 3S1YA 5EUAA 1BLHA 5EVIC 1DJAA 1PWDA 3O86A 3O88A 4QHCA 1K54C 3TG9A 1C3BA 1NJ4A 4OQGA 2H5SA 1YLZA 4IVIA 1E4DA 2R9XA 3M2JA 2A3UA 5JYPA 2H10A 5L2FA 1IKIA 1TVFA 3MBZA 5EPHA 2ZQCA 4EUZA 4MBHA 3UN7A 3ZG7B 3WRTA 1YLYA 1K25A 2WUQA 3BFCA 2ZQDA 1AXBA 1NYMA 5AQAA 4XXRA 2EXAA 3RJUA 3A3JA 5DTTA 2ZC7A 1N4OA 4R3JA 5IHVA 2WKHA 4KENB 4DXCA 1GA0A 1PW1A 4FH4A 3A3FA 1K55C 4XUZA 4YFMA 3VFFA 2E8IA 4JBFA 4GKUA 2QZ6A 3HUMA 4R4RA 1XX2A 1FCOA 1E3UD 1DJCA 5GHXA 3EQUA 4P85A 3G30A 3ISGA 5F82A 3VMAA 4EWFA 4OOLA 1SKFA 4Y0OA 2FFYA 5GHZA 1XGJA 4GD6A 4LV1A 4FSFA 4X55A 5FAQA 3FWLA 5M18A 4OPRA 1W7FA 3SOIA 3SS3A 1HTZA 4RVAA 3P98A 4KZ9A 4DE3A 5CGSA 1NYYA 4U0TA 5GLCA 3IH9A 1MY8A 5DF7A 5EOOA 5KSHA 4Z9QA 4ZTKA 1KGGA 4R3BA 3GMWA 4NETA 1LL9A 3SS4A 3VP2A 4WMCD 1PI4A 3NC8A 4DF6A 4MNRA 2ZD8A 2X02A 4JXVA 3S22A 3TOIA 4KZ8A 4HEFA 4QY5A 2OLUA 3TSGA 1GHMA 3UDXA 3PBOA 4L0LA 4X6TA 1K57A 3Q1FA 2Y55A 3M6HA 1MWTA 1GHPA 2XFSA 3IHAA 1BTLA 3MKEA 4KZ6A 5FQJA 2PU4A 4C6YA 2XH9A 5GL9A 2WAEA 3BLMA 3FYZA 3RXXA 3WS5A 4N92A 4EBLA 4DE1A 4OQHA 5FSRA 2Y2OA 4EBNA 3FV7A 4E6XA 1ZG6A 5A93A 1EROA 4QU3A 4ZJ2A 4BJPA 1FSYA 3UPNA 2HPBA 4DE2A 4EBPA 1YM1A 1TDLA 1ESUA 3DTMA 4GB7A 5FI6A 3QNBA 3UDFA 1FSWA 3CMZA 3IT9A 3UNWA 4IVKA 1W79A 4HESA 4GDNA 3HLGA 5AQ7A 1YLJA 4ZDXA 3IWOA 4MEZA 5D3OA 4BL2A 4DE0A 2J8YA 4FCFA 2Y2IA 4KZ7A 3C4PA 3NIAA 1HZOA 3V5MA 1FCNA 2Y91A 1G6AA 2ZQAA 3IF6B 3N4IA 2Q9NA 2EFXA 2C5WB 1KVLA 4F94A 4D2OA 3A3EA 1IELA 4KZ5A 1IYSA 5HAIA 4E3MA 1CEFA 5A91A 4LV0A 5EECA 2FFFB 1ES4A 3C5AA 4KG6A 3PBQA 1H5XA 1PZOA 3G34A 4OOYA 4WEKA 2XR0A 3NCKA 1ONHA 2IWDA 3E2LA 1XGIA 4BQMA 4B4ZA 3O87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RYE A;  4WM9 A;  4P87 A;  3BFG A;  2OV5 A;  3ZGA B;  4IED A;  3G2Y A;  2ZC3 B;  3LY4 A;  5EVI A;  2PBY A;  4JF5 A;  4JKT A;  3HLE A;  1K54 A;  4E3I A;  5FQK A;  1M40 A;  3W4O A;  3GRJ A;  4JPM A;  3OCL A;  2Y2P A;  4GOG A;  1GCE A;  5CGW A;  4R23 A;  2WKE A;  4OLG A;  4DXB A;  3BFE A;  2ZC6 B;  1FR6 A;  2P9V B;  3IXG A;  3IH8 A;  3N6I A;  4QB8 A;  5CHM A;  4BLM A;  4FD8 A;  1SCW A;  3ZHH A;  2XEP A;  2JCH A;  2XGN A;  3BFD A;  2OSU A;  5CTN A;  3D4F A;  1KDW A;  1S0W A;  3GVB A;  2Y2L A;  1KE4 A;  3M6B A;  1I2W A;  4KQQ A;  3BRM A;  2XK1 A;  3HLC A;  2EX6 A;  2ZLY A;  3N7W A;  5DVA A;  5KMW A;  3GQZ A;  1E25 A;  4U3T A;  4BD0 A;  1FCM A;  3N8L A;  3HLW A;  4OON A;  1FQG A;  2ZQ7 A;  2XD1 A;  2RCX A;  4S2M A;  4BL3 A;  4C75 A;  4GD8 A;  1EI5 A;  3LEZ A;  3PBN A;  5E43 A;  3VP1 A;  1MWS A;  3PBT A;  4OPQ A;  3LY3 A;  5FQ9 A;  4X56 A;  4Q8I A;  1GA9 A;  2GDN A;  1CI8 A;  5GHY A;  4NK3 A;  4PMA A;  3DWZ A;  1Q2P A;  1XA7 A;  2A49 A;  3WRZ A;  3CJM A;  1LLB A;  4JLF A;  4UAA A;  2HP5 A;  5E2E A;  1RP5 A;  3IXB A;  1KVM A;  2EX8 A;  2HP9 A;  3CZD A;  4Y7P A;  4E3N A;  3S4X A;  2J7V A;  3I7J A;  3JYI A;  1JWP A;  3G32 A;  3RXW A;  5M19 A;  4S2K A;  4M3K A;  4E3O A;  1CI9 A;  3HLF A;  2ZM8 A;  2RL3 A;  1BLS A;  2DRW A;  4GDB A;  4WYY A;  2JC7 A;  2EFU A;  2WKI A;  3MXR A;  4K0X A;  3IF5 A;  5AQB A;  3FKW A;  4PM6 A;  1Z6F A;  1JVJ A;  2H0T A;  4LCL A;  3LO7 A;  2J9P A;  1VQQ A;  1XPB A;  2QPN A;  1IKG A;  3V3S A;  2WZZ A;  2WGW A;  1XA1 A;  3GR2 A;  5J8X A;  4H8R A;  1ONG A;  4BD1 A;  5TFQ A;  1Q2Q A;  2G2U A;  3WWX A;  2OLV A;  1BSG A;  2ZM2 A;  5EVI D;  5DF9 A;  4ZJ1 A;  2WYX A;  3Q81 A;  5EOE A;  3HRE A;  1ERQ A;  3ZDJ A;  3C7V A;  4K0W A;  4R1G A;  4KZ3 A;  4OVD A;  1ALQ A;  4KZB A;  4WZ5 A;  2ZMA A;  4PM9 A;  2VGK A;  3BEB A;  4OPZ A;  1EWZ A;  5FI7 A;  3NBL A;  4UA6 A;  1ES3 A;  1YQS A;  3OZH A;  4GZB A;  4S2J A;  1BLC A;  3BFF A;  3MZE A;  5FI2 A;  4S2N C;  5DTK A;  1O7E A;  3B3X A;  1PIO A;  4U0X A;  1LI9 A;  2DCF A;  2HDU A;  1YLW A;  2WAD A;  2ZQ8 A;  3C4O A;  1Y54 A;  4S2P A;  4EV4 A;  2ZQ9 A;  1L0E A;  1O07 A;  3OPP A;  4CJN A;  5F1F A;  3PBR A;  4UHU A;  5EVL A;  3VOZ A;  1WE4 A;  2G2W A;  5FAP A;  1L0D A;  3DWK A;  5GLA A;  2ZC5 B;  4OQI A;  5E2F A;  3QHY A;  4ZJ3 A;  4OKP A;  4X68 A;  2ZM0 A;  1KE3 A;  4EQI A;  5FAS A;  4X53 A;  1WYC A;  1DY6 A;  2XQZ A;  3CG5 A;  3C7U A;  1LHY A;  1TDG A;  3ZG9 B;  2C6W B;  3EQV A;  3BM6 A;  2BG1 A;  1K57 C;  3UE1 A;  3AGF A;  3PTE A;  5F1G A;  4OQ0 A;  3ZNY A;  1KGE A;  3W4Q A;  3ZNT A;  3WS2 A;  3VP3 A;  1IYP A;  1L2S A;  1WYB A;  1KGF A;  4MBF A;  4FH2 A;  2X71 A;  2WAF A;  3IWI A;  4RX3 A;  3Q7V A;  1YMX A;  2EX9 A;  3IWQ A;  1ZC2 A;  3IF6 C;  2HDQ A;  4LCM A;  3N8S A;  4KG5 A;  2JE5 A;  2XF3 A;  1W8Y A;  2Y2H A;  2Y59 A;  2XD5 A;  5FAO A;  3ZVW A;  2WGI A;  5A90 A;  4KZ4 A;  2X01 A;  1IEM A;  3SH7 A;  4OPY A;  3IXH A;  5DTS A;  1FOF A;  1IYO A;  1YLP A;  2XFT A;  3OC2 A;  3SH8 A;  2Q9M A;  5TGF A;  3UDI A;  1K4F A;  2ZC4 B;  3WS0 A;  3IXD A;  1CEG A;  1NRF A;  3HBR A;  3DW0 A;  2Y2G A;  3VP0 A;  1K55 A;  3Q7V B;  1XKZ A;  4HBT A;  3V50 A;  5EVI B;  3NY4 A;  4GNU A;  3SS5 A;  3WS1 A;  5JYO A;  1BT5 A;  3Q7Z A;  3ZG5 A;  1I2S A;  2HDR A;  4OOM A;  2IWB A;  1MKI A;  1NZU A;  4MLL A;  1XXM A;  3AGE A;  1BUL A;  3O3V A;  3BLS A;  3BEC A;  4CPK A;  3VSK A;  3G2Z A;  3UO9 A;  3UPO A;  3IQA A;  4E3L A;  3MZD A;  1PI5 A;  5CXW A;  5AQ9 A;  3SH9 A;  1KDS A;  4PPR A;  1GHI A;  1ERM A;  3UE3 A;  2UWX A;  5HL1 A;  1ZKJ A;  2Y2J A;  2Y2M A;  5HX9 A;  4DKI A;  4HBU A;  2V2F F;  3Q07 A;  3ZG0 A;  1K56 A;  1DJB A;  1YT4 A;  1H8Y A;  2Y2K A;  1MXO A;  4QD4 A;  2J9O A;  1MWU A;  1J9M A;  2IWC A;  3GTC A;  1KE0 A;  3M2K A;  2EXB A;  3P09 A;  5CER A;  1QME A;  2VGJ A;  4KQR A;  1JWZ A;  4Y0U A;  4OH0 A;  3W8K A;  1NXY A;  1OME A;  2JBF A;  5TR7 A;  5E2H A;  3VP4 A;  2ZJ9 A;  1HVB A;  5GLD A;  1N9B A;  3ZG8 B;  1JTD A;  1PWG A;  2Z2M B;  4YIN A;  4JXS A;  5FQI A;  3UY6 A;  3UE0 A;  4JF6 A;  4B4X A;  3OCN A;  2BLS A;  2WGV A;  1JTG A;  3NDE A;  2V1Z A;  1ZG4 A;  5BOH A;  3QNC A;  2XLN A;  1YMS A;  3ITB A;  3ZVT A;  2WK0 A;  4S2N A;  1S6R A;  3FKV A;  5FQQ A;  1HD8 A;  1K6R A;  3BYD A;  3A3D A;  2R9W A;  2HDS A;  3NI9 A;  4WZ4 A;  3HL9 A;  4UA9 A;  1W5D A;  4N1H A;  4WBG A;  5FDH A;  5M1A A;  5HW3 A;  4QJG A;  1BUE A;  3NDG A;  4PM5 A;  5CHU A;  3PAE A;  2Y2Q A;  4KZA A;  4ID4 A;  1L0F A;  3ZFZ A;  3PBS A;  4E3J A;  4JXW A;  1K4E A;  4MBK A;  5KZH A;  1JWV A;  1QMF A;  5CEB A;  4KG2 A;  3HUO A;  2WGW B;  3HUN A;  4ZBE A;  3N8R A;  5CEC A;  1CK3 A;  5KSC A;  4O7D A;  4DDS A;  3VSL A;  4A5R A;  1RGZ A;  1ESI A;  3HLD A;  5DF8 A;  5CHJ A;  5FA7 A;  1G68 A;  1ES2 A;  1MBL A;  3A3I A;  4N9L A;  5HAR A;  5CRF A;  4ZAM A;  2QMI A;  3OPR A;  4E3K A;  5HFO A;  2HP6 A;  4N1X A;  3HVF A;  1BLP A;  1FR1 A;  4DDY A;  1M6K A;  3AGD A;  1U60 A;  4C3Q A;  4E6W A;  1K6S A;  4WEJ A;  4Y0T A;  2I72 A;  1I5Q A;  1IYQ A;  3IF6 A;  4IBR A;  4LV3 A;  4QY6 A;  4JF4 A;  3MXS A;  2Z2L B;  4P0M A;  1XP4 A;  2V20 A;  2Y2N A;  4LEN A;  4S2L A;  1PZP A;  3WS4 A;  3MKF A;  1K56 D;  1SHV A;  5CGX A;  5EE8 A;  1K38 A;  1LL5 A;  5CED A;  1PW8 A;  2P74 A;  4K91 A;  1E3U A;  2EX2 A;  4KQO A;  4WZ5 C;  1RCJ A;  3G4P A;  4XUX A;  3MZF A;  4P6B A;  4R0Q A;  3W4P A;  5CTM A;  3GSG A;  1LI0 A;  1PYY A;  3Q82 A;  5GLB A;  4N9K A;  3ZCZ A;  4GN2 A;  3LCE A;  1NZO A;  1SDE A;  4RX2 A;  3FZC A;  2DNS A;  2P9V A;  5G18 A;  2XDM A;  3G31 A;  5U47 A;  4S2O A;  5HAP A;  4RA7 A;  4B88 A;  3G35 A;  3HLB A;  4S2I A;  4UA7 A;  1MWR A;  1NY0 A;  4WMC A;  3VFH A;  5FAT A;  4JXG A;  1SDN A;  5E2G A;  1PWC A;  4OLD A;  2WZX A;  5HAQ A;  5FQM A;  1YLT A;  4OP5 A;  4DRT A;  3OPL A;  1RGY A;  1W8Q A;  3E2K A;  1MPL A;  1BZA A;  5A92 A;  3MFD A;  2CC1 A;  3ITA A;  3GV9 A;  4LV2 A;  4X69 A;  3UPP A;  1H8Z A;  2H0Y A;  4WEL A;  2B5R A;  5I94 A;  5F83 A;  2PU2 A;  1TEM A;  1L0G A;  4IBX A;  3V3R A;  3IHB A;  1ES5 A;  2Y4A A;  4PM8 A;  3V39 A;  3OPH A;  3VOY A;  4R4S A;  4OP8 A;  3PAG A;  4PM7 A;  4BEN A;  1VM1 A;  3S1Y A;  5EUA A;  1BLH A;  5EVI C;  1DJA A;  1PWD A;  3O86 A;  3O88 A;  4QHC A;  1K54 C;  3TG9 A;  1C3B A;  1NJ4 A;  4OQG A;  2H5S A;  1YLZ A;  4IVI A;  1E4D A;  2R9X A;  3M2J A;  2A3U A;  5JYP A;  2H10 A;  5L2F A;  1IKI A;  1TVF A;  3MBZ A;  5EPH A;  2ZQC A;  4EUZ A;  4MBH A;  3UN7 A;  3ZG7 B;  3WRT A;  1YLY A;  1K25 A;  2WUQ A;  3BFC A;  2ZQD A;  1AXB A;  1NYM A;  5AQA A;  4XXR A;  2EXA A;  3RJU A;  3A3J A;  5DTT A;  2ZC7 A;  1N4O A;  4R3J A;  5IHV A;  2WKH A;  4KEN B;  4DXC A;  1GA0 A;  1PW1 A;  4FH4 A;  3A3F A;  1K55 C;  4XUZ A;  4YFM A;  3VFF A;  2E8I A;  4JBF A;  4GKU A;  2QZ6 A;  3HUM A;  4R4R A;  1XX2 A;  1FCO A;  1E3U D;  1DJC A;  5GHX A;  3EQU A;  4P85 A;  3G30 A;  3ISG A;  5F82 A;  3VMA A;  4EWF A;  4OOL A;  1SKF A;  4Y0O A;  2FFY A;  5GHZ A;  1XGJ A;  4GD6 A;  4LV1 A;  4FSF A;  4X55 A;  5FAQ A;  3FWL A;  5M18 A;  4OPR A;  1W7F A;  3SOI A;  3SS3 A;  1HTZ A;  4RVA A;  3P98 A;  4KZ9 A;  4DE3 A;  5CGS A;  1NYY A;  4U0T A;  5GLC A;  3IH9 A;  1MY8 A;  5DF7 A;  5EOO A;  5KSH A;  4Z9Q A;  4ZTK A;  1KGG A;  4R3B A;  3GMW A;  4NET A;  1LL9 A;  3SS4 A;  3VP2 A;  4WMC D;  1PI4 A;  3NC8 A;  4DF6 A;  4MNR A;  2ZD8 A;  2X02 A;  4JXV A;  3S22 A;  3TOI A;  4KZ8 A;  4HEF A;  4QY5 A;  2OLU A;  3TSG A;  1GHM A;  3UDX A;  3PBO A;  4L0L A;  4X6T A;  1K57 A;  3Q1F A;  2Y55 A;  3M6H A;  1MWT A;  1GHP A;  2XFS A;  3IHA A;  1BTL A;  3MKE A;  4KZ6 A;  5FQJ A;  2PU4 A;  4C6Y A;  2XH9 A;  5GL9 A;  2WAE A;  3BLM A;  3FYZ A;  3RXX A;  3WS5 A;  4N92 A;  4EBL A;  4DE1 A;  4OQH A;  5FSR A;  2Y2O A;  4EBN A;  3FV7 A;  4E6X A;  1ZG6 A;  5A93 A;  1ERO A;  4QU3 A;  4ZJ2 A;  4BJP A;  1FSY A;  3UPN A;  2HPB A;  4DE2 A;  4EBP A;  1YM1 A;  1TDL A;  1ESU A;  3DTM A;  4GB7 A;  5FI6 A;  3QNB A;  3UDF A;  1FSW A;  3CMZ A;  3IT9 A;  3UNW A;  4IVK A;  1W79 A;  4HES A;  4GDN A;  3HLG A;  5AQ7 A;  1YLJ A;  4ZDX A;  3IWO A;  4MEZ A;  5D3O A;  4BL2 A;  4DE0 A;  2J8Y A;  4FCF A;  2Y2I A;  4KZ7 A;  3C4P A;  3NIA A;  1HZO A;  3V5M A;  1FCN A;  2Y91 A;  1G6A A;  2ZQA A;  3IF6 B;  3N4I A;  2Q9N A;  2EFX A;  2C5W B;  1KVL A;  4F94 A;  4D2O A;  3A3E A;  1IEL A;  4KZ5 A;  1IYS A;  5HAI A;  4E3M A;  1CEF A;  5A91 A;  4LV0 A;  5EEC A;  2FFF B;  1ES4 A;  3C5A A;  4KG6 A;  3PBQ A;  1H5X A;  1PZO A;  3G34 A;  4OOY A;  4WEK A;  2XR0 A;  3NCK A;  1ONH A;  2IWD A;  3E2L A;  1XGI A;  4BQM A;  4B4Z A;  3O87 A; 
#chains in the Genus database with same CATH topology
 2OV5 A;  5EVI A;  2PBY A;  4LRY C;  5F69 A;  4E3I A;  4IUK A;  2VJW A;  2Y2P A;  1GCE A;  4R23 A;  4OLG A;  4DXB A;  1FR6 A;  5CHM A;  5HD5 A;  1SCW A;  2XGN A;  1S0W A;  1KE4 A;  3CPT B;  4I5S A;  1F98 A;  3N7W A;  3CWF A;  4S2M A;  2JKT M;  4F3L A;  4GD8 A;  3LEZ A;  5LBR A;  3VP1 A;  5DKK A;  4OPQ A;  3LY3 A;  4UQI M;  1GA9 A;  5GHY A;  1CI8 A;  5L09 A;  3UME A;  1LLB A;  4UAA A;  1WA9 A;  2HP5 A;  4Q0I A;  3SZT A;  1KVM A;  3TRC A;  2QYB A;  3S4X A;  3CAX A;  3LYX A;  2J7V A;  5AVE A;  4S2K A;  1YAX A;  3LI8 A;  4GDB A;  2JC7 A;  2WKI A;  4K0X A;  4LLO B;  4PM6 A;  1JVJ A;  4MDZ A;  2QPN A;  3KSF A;  1CJF A;  3U2A A;  3GR2 A;  5J8X A;  5TFQ A;  1Q2Q A;  3WWX A;  4H6J A;  2I9V A;  3EGD C;  4ZJ1 A;  2WYX A;  3Q81 A;  3ZDJ A;  3C7V A;  3VV4 A;  4OVD A;  3NBL A;  4GCZ A;  1NRJ A;  1BLC A;  3MZE A;  5FI2 A;  5MC7 A;  5DTK A;  2EA9 A;  4U0X A;  2HDU A;  1H3Q A;  3QP2 A;  2KX6 A;  2ZQ8 A;  1TS7 A;  3LIA A;  3PBR A;  4UHU A;  3MMH A;  4UQI S;  1L0D A;  2JKT I;  2PAV P;  5E2F A;  5FAS A;  2XQZ A;  3C7U A;  2C6W B;  3LR4 A;  1YPR A;  3E0Y A;  3ZNY A;  2HGV A;  1L2S A;  3DTK A;  2PD8 A;  4MBF A;  2X71 A;  4CLC E;  3RH8 B;  3IBR A;  5A90 A;  4OPY A;  1FOF A;  1P9R A;  1YLP A;  3SH8 A;  3KSH A;  1K4F A;  2W1T B;  3WS0 A;  2Y2G A;  2OWH A;  3F1P B;  2WKP A;  1XKZ A;  2J80 A;  3SS5 A;  5JYO A;  1I2S A;  1XXM A;  3F1N B;  1BUL A;  1OJG A;  3BEC A;  2K31 A;  3VSK A;  4YWZ A;  3G2Z A;  1OTB A;  3UE3 A;  1ERM A;  2Y2M A;  2V2F F;  1DJB A;  1H8Y A;  1MXO A;  4MCW A;  1J9M A;  3CUE A;  2IWC A;  3JVU A;  4G3V A;  3UB7 A;  5I5L A;  5HDD A;  1JWZ A;  1NXY A;  4FOF A;  3S7P A;  5E2H A;  3VP4 A;  1HVB A;  1N9B A;  5F6A A;  2DMW A;  2VV8 A;  4JXS A;  4YIN A;  5FQI A;  3UE0 A;  4JF6 A;  2BLS A;  3NDE A;  3D3O A;  4JGP A;  1ZG4 A;  3DAV A;  2WK0 A;  4G3K A;  4DN0 A;  4IUH A;  1W5D A;  4CLC C;  4PM5 A;  1CQA A;  4UEY A;  3QP8 A;  3PBS A;  4E3J A;  4MBK A;  1JWV A;  1ACF A;  1QMF A;  3T1S A;  3R4K A;  4ZBE A;  5CEC A;  5KSC A;  1CK3 A;  3IBJ A;  5CHJ A;  4IHQ A;  3A3I A;  4N9L A;  4ZAM A;  5J3W A;  3C30 A;  4N1X A;  1BLP A;  4DDY A;  4NXE A;  5L10 A;  2I72 A;  4QY6 A;  1YSP A;  1PRQ A;  2L0W A;  2Z2L B;  2L4R A;  2V20 A;  2Y2N A;  4LRZ E;  1PZP A;  3LID A;  1SHV A;  2EX2 A;  4BBT A;  3W4P A;  5CTM A;  4ME4 A;  1JNU A;  4LPZ A;  4N9K A;  3VE3 A;  4GN2 A;  1ODV A;  2P9V A;  5G18 A;  5HAP A;  4S2O A;  2L1M A;  4R3A A;  4UA7 A;  1NY0 A;  3HCY A;  2V8C A;  5HAQ A;  1YLT A;  4DRT A;  3OPL A;  3E2K A;  1MPL A;  1BZA A;  3B42 A;  4BMW A;  3MFD A;  4K08 A;  4HJ6 A;  2B5R A;  5F83 A;  2PU2 A;  2V8F A;  1LSX A;  4PM8 A;  3PAG A;  1VB6 A;  1VM1 A;  1FIL A;  1NJ4 A;  4OQG A;  1E4D A;  4GS9 B;  4D60 A;  2H10 A;  1IKI A;  2KDK A;  2ZL1 A;  4GHI A;  2D02 A;  4JGQ A;  4EUV A;  1AXB A;  5AQA A;  3H82 A;  3R7W A;  3A3J A;  1MZU A;  2V0W A;  1N4O A;  2CMN A;  4KEN B;  1GA0 A;  4YFM A;  2QWS A;  2JKF A;  2E8I A;  4JBF A;  4GKU A;  3HUM A;  4X1M A;  4QPR A;  4P85 A;  3K2N A;  3G30 A;  5F82 A;  4OOL A;  2FFY A;  5GHZ A;  1XGJ A;  4LV1 A;  2UV0 E;  4FSF A;  4X55 A;  3FWL A;  1TS8 A;  2PR6 A;  1W7F A;  5EVE A;  4RVA A;  4I39 A;  2OAQ 1;  4DE3 A;  4R3B A;  3GMW A;  4NET A;  1LL9 A;  5EM0 A;  2GZA A;  3NC8 A;  4MNR A;  3TOI A;  4JXV A;  3ULF A;  4KZ8 A;  4Y5F A;  3MJQ A;  4QY5 A;  3Q1F A;  2Y55 A;  3BQA A;  3M6H A;  1GHP A;  2XFS A;  4YOF A;  2PU4 A;  4C6Y A;  1S1Z A;  1Y4O A;  2WAE A;  5DJU A;  2HJ9 C;  3RXX A;  3WS5 A;  4DE1 A;  4OQH A;  4EBN A;  3MQO A;  3A0S A;  1FSY A;  5HDS A;  1TDL A;  4GB7 A;  5FI6 A;  1FSW A;  3UNW A;  4IVK A;  4GDN A;  3BY9 A;  3IWO A;  4MEZ A;  5IT5 A;  1SKO B;  3D9Y A;  1Y28 A;  2J8Y A;  4FCF A;  4AFI A;  3C4P A;  3NIA A;  1HZO A;  4CLC D;  3N4I A;  1X0O A;  4D2O A;  4E3M A;  2YKF A;  1F9I A;  3QP1 A;  3PBQ A;  2J3T D;  1PZO A;  1ONH A;  2IWD A;  2B02 A;  2OOL A;  1LL8 A;  3V67 A;  3ZGA B;  3G2Y A;  3HLE A;  1K54 A;  1A0K A;  1M40 A;  5FQK A;  4JPM A;  3BY8 A;  4P6Z S;  4GOG A;  5CGW A;  5CX7 A;  3IH8 A;  4QB8 A;  4FD8 A;  2XEP A;  2JCH A;  4NXB A;  5CTN A;  3GVB A;  4KQQ A;  3HLC A;  2EX6 A;  4GW9 A;  2ZLY A;  5KMW A;  3HLW A;  4OON A;  2ZQ7 A;  2XD1 A;  1MC0 A;  5KIZ A;  1EI5 A;  3PBN A;  5E43 A;  1MWS A;  4Q8I A;  3T4T A;  4NK3 A;  3DWZ A;  1F2K A;  4YNR A;  2XA7 S;  4JLF A;  5E2E A;  4E3N A;  3CZD A;  5M19 A;  3MSH A;  4E3O A;  4NXG A;  1CI9 A;  3HLF A;  2HF6 A;  2ZM8 A;  1N9N A;  3T4S A;  4WYY A;  3LI9 A;  2EFU A;  3IF5 A;  3MFX A;  2R78 A;  2J9P A;  1VQQ A;  2BTF P;  4CLC B;  1XPB A;  3V3S A;  2WGW A;  4HOI A;  4H8R A;  4JGR A;  2OLV A;  5EM1 A;  1VET A;  3NHQ A;  3HRE A;  1ERQ A;  4R38 A;  3ZQ5 A;  2VZW A;  4WZ5 A;  4ZRR A;  2Z6D A;  4UA6 A;  4MN7 A;  4GZB A;  4S2J A;  3BFF A;  1YSQ A;  1LI9 A;  1NWZ A;  4EV4 A;  3C4O A;  2FH5 A;  1O07 A;  3OPP A;  5GLA A;  4OQI A;  4PKY G;  2K2N A;  3QHY A;  4NEE D;  4X68 A;  2ZM0 A;  1NLZ A;  1LHY A;  3BM6 A;  2AVX A;  2EWV A;  3LR3 A;  2QHK A;  1WYB A;  1KGF A;  3GDI A;  4FH2 A;  3IWI A;  3Q7V A;  2EX9 A;  3IWQ A;  1ZC2 A;  2HDQ A;  3N8S A;  4KG5 A;  2JE5 A;  2XF3 A;  1W8Y A;  2Y2H A;  5HL6 A;  2Y59 A;  3ZVW A;  4KZ4 A;  1IEM A;  3SH7 A;  4HJ3 A;  4Q0H A;  2Y8H A;  2XFT A;  3OC2 A;  2YKH A;  5TGF A;  3DW0 A;  4EXO A;  2W3E A;  3MQ0 A;  4WL9 A;  1SZV A;  3NY4 A;  4B9O A;  2HDR A;  4OOM A;  2IWB A;  1XJ4 A;  4HP9 A;  1K0K A;  3AGE A;  3O3V A;  3UMD A;  2ZMV A;  4CPK A;  1PI5 A;  4HH2 A;  1KDS A;  1J3W A;  4PPR A;  4G3W A;  3Q07 A;  3ZG0 A;  1K56 A;  2P08 A;  4B93 A;  2Y2K A;  4HNB A;  5HPF A;  1BYW A;  2J9O A;  2JN7 A;  2PR5 A;  1PFL A;  3H7W A;  2PYP A;  3P09 A;  1QME A;  4KQR A;  3W8K A;  2JBF A;  2QKP A;  5TR7 A;  3ZG8 B;  1JTD A;  4KUK A;  2MJ6 A;  3UY6 A;  4B4X A;  2WGV A;  1JTG A;  2Z6C A;  3ITB A;  4S2N A;  1S6R A;  5FQQ A;  1HD8 A;  3A3D A;  2R9W A;  3NI9 A;  5L8M A;  3HL9 A;  4N1H A;  4WBG A;  5FDH A;  5HWT A;  1BUE A;  5CHU A;  3PAE A;  1L0F A;  4ETX A;  4JXW A;  1DRM A;  3IS2 A;  5KZH A;  1DP9 A;  5J7E A;  3N8R A;  4O7D A;  2PBD P;  4DDS A;  3VSL A;  4A5R A;  1RGZ A;  1ESI A;  3HLD A;  5FA7 A;  2Y79 A;  4Q0J A;  5TBM A;  5HAR A;  2QMI A;  3OPR A;  5HFO A;  3HVF A;  4XT2 B;  1M6K A;  1U60 A;  4Y0T A;  3LIC A;  4WEJ A;  2V9A A;  3IF6 A;  3CI6 A;  3MXS A;  4P0M A;  5FL3 A;  3QP5 A;  4LEN A;  4HI4 A;  3WS4 A;  5CED A;  1LL5 A;  4K91 A;  4WZ5 C;  1E3U A;  2WKQ A;  1RCJ A;  3G4P A;  3K3C A;  4P6B A;  3NUL A;  1PYY A;  3Q82 A;  1L3L A;  3UB6 A;  4RX2 A;  2VV7 A;  3FZC A;  2DNS A;  2XDM A;  4RA7 A;  3VOL A;  4B88 A;  2FZ0 A;  3HLB A;  4S2I A;  3CPT A;  1TS6 A;  5FAT A;  1SDN A;  1VHM A;  4OLD A;  4OP5 A;  3T4J A;  3MF0 A;  1H8Z A;  1L0G A;  5HD3 A;  3T12 B;  4OP8 A;  1DP6 A;  4BEN A;  1MKM A;  3S1Y A;  4KQD A;  5EVI C;  1DJA A;  3O86 A;  3BW6 A;  1C3B A;  3NOU C;  4IVI A;  3HJI A;  5EPH A;  4MMN A;  2ZQC A;  3WRT A;  4R6L A;  2B18 A;  2EXA A;  5DTT A;  1PW1 A;  4XUZ A;  4LGW A;  3A3F A;  3VFF A;  2QZ6 A;  1FCO A;  5GHX A;  3E98 A;  3A0R A;  2VV6 A;  3KX0 X;  3VMA A;  4Y0O A;  3NEC A;  5FAQ A;  3SOI A;  1V9Z A;  3P98 A;  2JKR I;  5DF7 A;  5KSH A;  4ZTK A;  3SS4 A;  4WMC D;  2ZD8 A;  4HEF A;  2OLU A;  1GHM A;  3UDX A;  4L0L A;  3EGX C;  1K57 A;  3MR0 A;  4FUW A;  4KZ6 A;  5C5K A;  2NUP C;  2OAP 1;  4ARZ B;  2O99 A;  2Y2O A;  3FV7 A;  3HJK A;  4ZJ2 A;  3UPN A;  2HPB A;  4EBP A;  1YM1 A;  3DTM A;  3CIT A;  3CMZ A;  4HES A;  5AQ7 A;  2Y2I A;  4KZ7 A;  2XRN A;  2Y91 A;  2Q9N A;  4PKY A;  2C5W B;  3A3E A;  1IEL A;  3EOI A;  1CEF A;  5A91 A;  2W1T A;  4LV0 A;  1H5X A;  3NCK A;  3E2L A;  3O87 A;  4RYE A;  2Q0O A;  4WM9 A;  3BFG A;  4JKT A;  3OBF A;  3W4O A;  3GRJ A;  3F1N A;  2ZC6 B;  2PT7 A;  3IXG A;  1G6O A;  3N6I A;  4MN6 A;  1W63 Q;  3D4F A;  1KDW A;  3M6B A;  2INW A;  3BRM A;  1H0M A;  1E25 A;  4U3T A;  1FCM A;  3N8L A;  1FQG A;  1PNE A;  4C75 A;  3C38 A;  3C8C A;  4JGO A;  3ZYT A;  5FQ9 A;  4ETZ A;  2VK3 A;  4X56 A;  4X1L A;  4EET B;  1RP5 A;  4Y7P A;  2HP9 A;  1OTI A;  3I7J A;  3RXW A;  1JWP A;  3G32 A;  4I3I A;  3D72 A;  4HP4 A;  1BLS A;  2DRW A;  4BBV A;  3FKW A;  1Z6F A;  2H0T A;  3LO7 A;  2A24 B;  1IKG A;  1D7E A;  1ONG A;  3CUE C;  3TW8 A;  2G2U A;  1BSG A;  1LSV A;  5EVI D;  5EOE A;  5HZH A;  3RFB A;  4R1G A;  4L9F A;  4KZ3 A;  1S66 L;  4I3J A;  4KZB A;  2ZMA A;  4PM9 A;  3BEB A;  4OPZ A;  5FI7 A;  2J3W A;  1ES3 A;  1YQS A;  3OZH A;  3PR6 A;  3B3X A;  2O9B A;  2DCF A;  3TE8 A;  2XSS A;  4S2P A;  1D1J A;  2BAS A;  5F1F A;  1WE4 A;  5FAP A;  4RQ9 A;  2ZC5 B;  3F1O B;  4ZJ3 A;  4OKP A;  1KE3 A;  4X53 A;  1WYC A;  1DY6 A;  4DJ2 A;  3MXQ A;  1TDG A;  3IX3 A;  3EQV A;  1K57 C;  1P0Z A;  3PTE A;  5F1G A;  3SW1 A;  1S67 L;  4DMZ A;  4OQ0 A;  1KGE A;  1S4R A;  4HIA A;  1T18 A;  3BWL A;  3W4Q A;  3WS2 A;  5AVF A;  3KYZ A;  4EQ1 A;  1N9L A;  2WAF A;  3T50 A;  4RX3 A;  1YMX A;  3PHY A;  4LCM A;  5FAO A;  2WGI A;  2X01 A;  1STZ A;  5DTS A;  1IYO A;  4M4X A;  2H28 A;  1CF0 A;  4GJ4 A;  3VP0 A;  1DP8 A;  4EER A;  4R70 A;  2HJE A;  1K55 A;  1Z09 A;  3Q7V B;  4HBT A;  3V50 A;  5EVI B;  3WS1 A;  3ZG5 A;  4CQH A;  1MKI A;  1NZU A;  4MLL A;  3BLS A;  2W3F A;  3UPO A;  3IQA A;  3MZD A;  3SH9 A;  3T4O A;  3LIF A;  1GHI A;  2UWX A;  4HBU A;  5G4Z A;  3NOT C;  4QD4 A;  4F3L B;  3LR0 A;  3GTC A;  1KE0 A;  3M2K A;  2EXB A;  5CER A;  4FTX A;  2VGJ A;  2IA2 A;  4Y0U A;  5DFY A;  1OME A;  3T4Q A;  4BWI A;  2ZJ9 A;  1S1Y A;  5GLD A;  1PWG A;  2Z2M B;  5AJG A;  3CLO A;  5A8B A;  1K6R A;  4HQA A;  4WZ4 A;  5HW3 A;  5M1A A;  4QJG A;  5FEG A;  2Y2Q A;  1OTA A;  3LGO A;  2NUT C;  3T1R A;  4KZA A;  4ID4 A;  3ZFZ A;  5CEB A;  4KG2 A;  1T1B A;  2VGL M;  4Y13 A;  5DF8 A;  1EW0 A;  4H6J B;  1G68 A;  1ES2 A;  1MBL A;  3DTE A;  5CRF A;  1S4S A;  2O9A A;  1SKO A;  2V1B A;  4O01 A;  3AGD A;  4C3Q A;  4LV3 A;  1I5Q A;  1IYQ A;  1N9O A;  4JF4 A;  1XP4 A;  4S2L A;  3MKF A;  5CGX A;  5EE8 A;  1K38 A;  1PW8 A;  4KQO A;  1VEU A;  4XUX A;  5TBM B;  3JVV A;  4HY8 A;  3GSG A;  3C2W A;  4Y2F A;  5GLB A;  3ZCZ A;  1NZO A;  2VKS A;  1OT6 A;  3EWK A;  4Z1W A;  2KOI A;  5U47 A;  3G35 A;  4WLA A;  3VE4 A;  1UWP X;  4EES A;  3KYE A;  1PWC A;  5FQM A;  3QP6 A;  2PDR A;  5A92 A;  3ITA A;  3UPP A;  3GV9 A;  4LV2 A;  4X69 A;  4WEL A;  2PRF A;  5HPI A;  2VGL S;  3V3R A;  2E8J A;  1ES5 A;  2Y4A A;  4O8G A;  3V39 A;  3VOY A;  1HLU P;  4PM7 A;  1KOU A;  5EUA A;  1PWD A;  2W3H A;  3O88 A;  1K54 C;  2H5S A;  1YLZ A;  1ZHH B;  3M2J A;  2A3U A;  1TVF A;  4EUZ A;  3ZG7 B;  1YLY A;  1K25 A;  3BFC A;  4LFU A;  2ZQD A;  5HSQ A;  4XXR A;  5IS1 A;  3KSG A;  5IHV A;  4CLC A;  4FH4 A;  1K55 C;  1T19 A;  4R4R A;  1XX2 A;  1OPX A;  1DJC A;  3EQU A;  2G7U A;  2ZMF A;  5DJT A;  1SKF A;  4OPR A;  3SS3 A;  1XJ2 A;  1HTZ A;  4KZ9 A;  2M1C A;  1NYY A;  1MY8 A;  5EOO A;  4Z9Q A;  3E4Q A;  3VP2 A;  4DF6 A;  3PYP A;  3KO6 A;  3S22 A;  3TSG A;  3TJZ C;  4I38 A;  4X6T A;  1OT9 A;  1V9Y A;  1XJ3 A;  3LIB A;  3BQ8 A;  2XH9 A;  3BLM A;  1P97 A;  3BJN A;  2PYR A;  4N92 A;  4EBL A;  2GX5 A;  3EEA A;  4NG2 A;  5A93 A;  5EFW A;  4BJP A;  1XJ6 A;  1NLY A;  3QNB A;  3HLG A;  3IX8 A;  4PHT A;  4EU0 A;  3K3D A;  1T1A A;  4ZDX A;  3UE6 A;  5D3O A;  4BL2 A;  4NXF A;  4PAU A;  4DE0 A;  3FPV A;  3V5M A;  1D06 A;  2JKR M;  2JHE A;  1GSV A;  5HAI A;  1IYS A;  2GNX A;  5EEC A;  2FFF B;  1ES4 A;  3C5A A;  4OOY A;  4Y3I A;  4WEK A;  3T1Q B;  4U0T A;  4P87 A;  4IED A;  2ZC3 B;  3LY4 A;  4EEU A;  4JF5 A;  4I3A A;  4MN5 A;  3OCL A;  2O9C A;  2WKE A;  3BFE A;  2P9V B;  4BLM A;  3ZHH A;  3BFD A;  2OSU A;  3S7O A;  2Y2L A;  1I2W A;  2XK1 A;  3NOP C;  2OWJ A;  5DVA A;  3GQZ A;  3U4L P;  4BD0 A;  2RCX A;  1G5U A;  4BL3 A;  4QWO A;  3B33 A;  3OOV A;  3PBT A;  2GDN A;  4PMA A;  1OTE A;  1Q2P A;  1XA7 A;  2A49 A;  2V0U A;  3WRZ A;  3CJM A;  3P7N A;  4HH3 A;  3IXB A;  2EX8 A;  3JYI A;  1G28 A;  4M3K A;  3MQQ A;  4II7 A;  3KYQ A;  3FPW A;  2RL3 A;  2ZL1 B;  3MS6 A;  4GHI B;  3MXR A;  3RTY A;  3H82 B;  5AQB A;  3R7W B;  4LCL A;  2W1R A;  2ZOH A;  1P9W A;  3G6O A;  2WZZ A;  3LIE A;  1XA1 A;  2QJ5 A;  3UB8 A;  4BD1 A;  1TF1 A;  3A0V A;  2ZM2 A;  5DF9 A;  4WUJ A;  4K0W A;  1ALQ A;  2VGK A;  1EWZ A;  4XT2 A;  4LRX C;  2J3T C;  5FEF A;  1TD5 A;  1OJ5 A;  4S2N C;  1XFN A;  1O7E A;  1PIO A;  3W2Z A;  1LSW A;  1YLW A;  2WAD A;  1Y54 A;  2ZQ9 A;  1L0E A;  4CJN A;  5EVL A;  3VOZ A;  2G2W A;  3DWK A;  3E4P A;  1IFQ A;  3DBA A;  2B95 A;  4EQI A;  3CG5 A;  3ZG9 B;  1TS0 A;  5K5B A;  2BG1 A;  3UE1 A;  3AGF A;  3QP4 A;  3O5Y A;  4L9G A;  3ZNT A;  3VP3 A;  1IYP A;  3F1P A;  5IU1 A;  3IF6 C;  5G4Y A;  2XD5 A;  4GLQ A;  3IXH A;  3UB5 P;  2Q9M A;  2HV1 A;  3UDI A;  2ZC4 B;  3EEH A;  3IXD A;  1CEG A;  2GJ3 A;  1NRF A;  1T1C A;  3HBR A;  2VEA A;  2K7S A;  4GNU A;  1BT5 A;  3Q7Z A;  3L9K A;  1FIK A;  1LT0 A;  3UO9 A;  4E3L A;  5L07 A;  5CXW A;  5AQ9 A;  1H8M A;  2LB9 A;  3L7H A;  5HL1 A;  1ZKJ A;  2Y2J A;  5HX9 A;  3T4K A;  4DKI A;  4HHD A;  1YT4 A;  3GEC A;  3UB9 A;  2JKG A;  1MWU A;  3T1X A;  2QJ7 A;  4OH0 A;  5DFX A;  3LUQ A;  2D01 A;  3KSI A;  3OCN A;  2V1Z A;  5BOH A;  3QNC A;  1XFQ A;  2XLN A;  1YMS A;  3IX4 A;  3ZVT A;  5TJJ A;  1IOU A;  3FKV A;  3BYD A;  2HDS A;  4UA9 A;  3JPU A;  2EWW A;  2HZ5 A;  3NDG A;  4WN5 A;  3E4O A;  1K4E A;  4ARZ A;  5HDC A;  2KLI A;  2W0N A;  4P6Z M;  3HUO A;  2WGW B;  3HUN A;  2W3D A;  3S7Q A;  1VET B;  4BBU A;  4E3K A;  4O0P A;  2HP6 A;  4DJ3 A;  4ESP A;  3NJA A;  5FDS A;  1FR1 A;  4E04 A;  4E6W A;  1OTD A;  1K6S A;  4IBR A;  1UWN X;  2W3G A;  2ACG A;  1K56 D;  3T4L A;  2P74 A;  5F68 A;  4HJ4 A;  2XA7 M;  3MZF A;  1GSW A;  4R0Q A;  2M7V A;  1LI0 A;  4NKP A;  3LCE A;  2P04 A;  1SDE A;  3DTI A;  3G31 A;  2A2L A;  1ZTU A;  1MWR A;  4WMC A;  2P7J A;  3VFH A;  3FG8 A;  4JXG A;  5E2G A;  2LB5 A;  2WZX A;  1VEU B;  2V1A A;  5HWW A;  1RGY A;  1W8Q A;  4EW7 A;  4GS9 A;  2PHY A;  3ICY A;  1GSX A;  2VLG A;  2O0Y A;  2CC1 A;  2H0Y A;  5I94 A;  5F5Y A;  1TEM A;  4IBX A;  3IHB A;  3OPH A;  3PXP A;  4R4S A;  3P01 A;  1BLH A;  3LFV A;  4QHC A;  2VX8 A;  3TG9 A;  3LEQ A;  5JYP A;  2R9X A;  5L2F A;  1UGU A;  3MBZ A;  3CHW P;  4MBH A;  3UN7 A;  2WUQ A;  3OLO A;  2M7U A;  1NYM A;  3S7N A;  4Y15 A;  3RJU A;  2ZC7 A;  4R3J A;  2WKH A;  2A24 A;  4DXC A;  4WF0 A;  4Y17 A;  1E3U D;  1W63 M;  3ISG A;  2WKR A;  4EWF A;  4GD6 A;  5M18 A;  3H7W B;  3H9W A;  5CGS A;  5DKL A;  5GLC A;  3IH9 A;  4X25 A;  1KGG A;  1PI4 A;  3B47 A;  1AWI A;  2X02 A;  3LR5 A;  2ZBB A;  5HWV A;  3PBO A;  2ZOI A;  2XRO A;  4L9E A;  1MWT A;  3F1O A;  3IHA A;  1BTL A;  3MKE A;  5FQJ A;  2VA0 A;  5GL9 A;  3FYZ A;  3IS2 B;  5FSR A;  4E6X A;  1ZG6 A;  1ERO A;  4QU3 A;  4DE2 A;  1ESU A;  4EEP A;  3UDF A;  3IT9 A;  1W79 A;  1YKD A;  1YLJ A;  3FC7 A;  1FCN A;  1F5M A;  5J4E A;  3IF6 B;  1G6A A;  2ZQA A;  2EFX A;  1KVL A;  4F94 A;  2W27 A;  4KZ5 A;  4IJG A;  4KUO A;  4KG6 A;  5EV0 A;  3G34 A;  2XR0 A;  1XGI A;  4BQM A;  4B4Z A;  2PD7 A; 
#chains in the Genus database with same CATH homology
 4RYE A;  4WM9 A;  4P87 A;  3BFG A;  2OV5 A;  3ZGA B;  4IED A;  3G2Y A;  2ZC3 B;  3LY4 A;  5EVI A;  2PBY A;  4JF5 A;  4JKT A;  3HLE A;  1K54 A;  4E3I A;  5FQK A;  1M40 A;  3W4O A;  3GRJ A;  4JPM A;  3OCL A;  2Y2P A;  4GOG A;  1GCE A;  5CGW A;  4R23 A;  2WKE A;  4OLG A;  4DXB A;  3BFE A;  2ZC6 B;  1FR6 A;  2P9V B;  3IXG A;  3IH8 A;  3N6I A;  4QB8 A;  5CHM A;  4BLM A;  4FD8 A;  1SCW A;  3ZHH A;  2XEP A;  2JCH A;  2XGN A;  3BFD A;  2OSU A;  5CTN A;  3D4F A;  1KDW A;  1S0W A;  3GVB A;  2Y2L A;  1KE4 A;  3M6B A;  1I2W A;  4KQQ A;  3BRM A;  2XK1 A;  3HLC A;  2EX6 A;  2ZLY A;  3N7W A;  5DVA A;  5KMW A;  3GQZ A;  1E25 A;  4U3T A;  4BD0 A;  1FCM A;  3N8L A;  3HLW A;  4OON A;  1FQG A;  2ZQ7 A;  2XD1 A;  2RCX A;  4S2M A;  4BL3 A;  4C75 A;  4GD8 A;  1EI5 A;  3LEZ A;  3PBN A;  5E43 A;  3VP1 A;  1MWS A;  3PBT A;  4OPQ A;  3LY3 A;  5FQ9 A;  4X56 A;  4Q8I A;  1GA9 A;  2GDN A;  1CI8 A;  5GHY A;  4NK3 A;  4PMA A;  3DWZ A;  1Q2P A;  1XA7 A;  2A49 A;  3WRZ A;  3CJM A;  1LLB A;  4JLF A;  4UAA A;  2HP5 A;  5E2E A;  1RP5 A;  3IXB A;  1KVM A;  2EX8 A;  2HP9 A;  3CZD A;  4Y7P A;  4E3N A;  3S4X A;  2J7V A;  3I7J A;  3JYI A;  1JWP A;  3G32 A;  3RXW A;  5M19 A;  4S2K A;  4M3K A;  4E3O A;  1CI9 A;  3HLF A;  2ZM8 A;  2RL3 A;  1BLS A;  2DRW A;  4GDB A;  4WYY A;  2JC7 A;  2EFU A;  2WKI A;  3MXR A;  4K0X A;  3IF5 A;  5AQB A;  3FKW A;  4PM6 A;  1Z6F A;  1JVJ A;  2H0T A;  4LCL A;  3LO7 A;  2J9P A;  1VQQ A;  1XPB A;  2QPN A;  1IKG A;  3V3S A;  2WZZ A;  2WGW A;  1XA1 A;  3GR2 A;  5J8X A;  4H8R A;  1ONG A;  4BD1 A;  5TFQ A;  1Q2Q A;  2G2U A;  3WWX A;  2OLV A;  1BSG A;  2ZM2 A;  5EVI D;  5DF9 A;  4ZJ1 A;  2WYX A;  3Q81 A;  5EOE A;  3HRE A;  1ERQ A;  3ZDJ A;  3C7V A;  4K0W A;  4R1G A;  4KZ3 A;  4OVD A;  1ALQ A;  4KZB A;  4WZ5 A;  2ZMA A;  4PM9 A;  2VGK A;  3BEB A;  4OPZ A;  1EWZ A;  5FI7 A;  3NBL A;  4UA6 A;  1ES3 A;  1YQS A;  3OZH A;  4GZB A;  4S2J A;  1BLC A;  3BFF A;  3MZE A;  5FI2 A;  4S2N C;  5DTK A;  1O7E A;  3B3X A;  1PIO A;  4U0X A;  1LI9 A;  2DCF A;  2HDU A;  1YLW A;  2WAD A;  2ZQ8 A;  3C4O A;  1Y54 A;  4S2P A;  4EV4 A;  2ZQ9 A;  1L0E A;  1O07 A;  3OPP A;  4CJN A;  5F1F A;  3PBR A;  4UHU A;  5EVL A;  3VOZ A;  1WE4 A;  2G2W A;  5FAP A;  1L0D A;  3DWK A;  5GLA A;  2ZC5 B;  4OQI A;  5E2F A;  3QHY A;  4ZJ3 A;  4OKP A;  4X68 A;  2ZM0 A;  1KE3 A;  4EQI A;  5FAS A;  4X53 A;  1WYC A;  1DY6 A;  2XQZ A;  3CG5 A;  3C7U A;  1LHY A;  1TDG A;  3ZG9 B;  2C6W B;  3EQV A;  3BM6 A;  2BG1 A;  1K57 C;  3UE1 A;  3AGF A;  3PTE A;  5F1G A;  4OQ0 A;  3ZNY A;  1KGE A;  3W4Q A;  3ZNT A;  3WS2 A;  3VP3 A;  1IYP A;  1L2S A;  1WYB A;  1KGF A;  4MBF A;  4FH2 A;  2X71 A;  2WAF A;  3IWI A;  4RX3 A;  3Q7V A;  1YMX A;  2EX9 A;  3IWQ A;  1ZC2 A;  3IF6 C;  2HDQ A;  4LCM A;  3N8S A;  4KG5 A;  2JE5 A;  2XF3 A;  1W8Y A;  2Y2H A;  2Y59 A;  2XD5 A;  5FAO A;  3ZVW A;  2WGI A;  5A90 A;  4KZ4 A;  2X01 A;  1IEM A;  3SH7 A;  4OPY A;  3IXH A;  5DTS A;  1FOF A;  1IYO A;  1YLP A;  2XFT A;  3OC2 A;  3SH8 A;  2Q9M A;  5TGF A;  3UDI A;  1K4F A;  2ZC4 B;  3WS0 A;  3IXD A;  1CEG A;  1NRF A;  3HBR A;  3DW0 A;  2Y2G A;  3VP0 A;  1K55 A;  3Q7V B;  1XKZ A;  4HBT A;  3V50 A;  5EVI B;  3NY4 A;  4GNU A;  3SS5 A;  3WS1 A;  5JYO A;  1BT5 A;  3Q7Z A;  3ZG5 A;  1I2S A;  2HDR A;  4OOM A;  2IWB A;  1MKI A;  1NZU A;  4MLL A;  1XXM A;  3AGE A;  1BUL A;  3O3V A;  3BLS A;  3BEC A;  4CPK A;  3VSK A;  3G2Z A;  3UO9 A;  3UPO A;  3IQA A;  4E3L A;  3MZD A;  1PI5 A;  5CXW A;  5AQ9 A;  3SH9 A;  1KDS A;  4PPR A;  1GHI A;  1ERM A;  3UE3 A;  2UWX A;  5HL1 A;  1ZKJ A;  2Y2J A;  2Y2M A;  5HX9 A;  4DKI A;  4HBU A;  2V2F F;  3Q07 A;  3ZG0 A;  1K56 A;  1DJB A;  1YT4 A;  1H8Y A;  2Y2K A;  1MXO A;  4QD4 A;  2J9O A;  1MWU A;  1J9M A;  2IWC A;  3GTC A;  1KE0 A;  3M2K A;  2EXB A;  3P09 A;  5CER A;  1QME A;  2VGJ A;  4KQR A;  1JWZ A;  4Y0U A;  4OH0 A;  3W8K A;  1NXY A;  1OME A;  2JBF A;  5TR7 A;  5E2H A;  3VP4 A;  2ZJ9 A;  1HVB A;  5GLD A;  1N9B A;  3ZG8 B;  1JTD A;  1PWG A;  2Z2M B;  4YIN A;  4JXS A;  5FQI A;  3UY6 A;  3UE0 A;  4JF6 A;  4B4X A;  3OCN A;  2BLS A;  2WGV A;  1JTG A;  3NDE A;  2V1Z A;  1ZG4 A;  5BOH A;  3QNC A;  2XLN A;  1YMS A;  3ITB A;  3ZVT A;  2WK0 A;  4S2N A;  1S6R A;  3FKV A;  5FQQ A;  1HD8 A;  1K6R A;  3BYD A;  3A3D A;  2R9W A;  2HDS A;  3NI9 A;  4WZ4 A;  3HL9 A;  4UA9 A;  1W5D A;  4N1H A;  4WBG A;  5FDH A;  5M1A A;  5HW3 A;  4QJG A;  1BUE A;  3NDG A;  4PM5 A;  5CHU A;  3PAE A;  2Y2Q A;  4KZA A;  4ID4 A;  1L0F A;  3ZFZ A;  3PBS A;  4E3J A;  4JXW A;  1K4E A;  4MBK A;  5KZH A;  1JWV A;  1QMF A;  5CEB A;  4KG2 A;  3HUO A;  2WGW B;  3HUN A;  4ZBE A;  3N8R A;  5CEC A;  1CK3 A;  5KSC A;  4O7D A;  4DDS A;  3VSL A;  4A5R A;  1RGZ A;  1ESI A;  3HLD A;  5DF8 A;  5CHJ A;  5FA7 A;  1G68 A;  1ES2 A;  1MBL A;  3A3I A;  4N9L A;  5HAR A;  5CRF A;  4ZAM A;  2QMI A;  3OPR A;  4E3K A;  5HFO A;  2HP6 A;  4N1X A;  3HVF A;  1BLP A;  1FR1 A;  4DDY A;  1M6K A;  3AGD A;  1U60 A;  4C3Q A;  4E6W A;  1K6S A;  4WEJ A;  4Y0T A;  2I72 A;  1I5Q A;  1IYQ A;  3IF6 A;  4IBR A;  4LV3 A;  4QY6 A;  4JF4 A;  3MXS A;  2Z2L B;  4P0M A;  1XP4 A;  2V20 A;  2Y2N A;  4LEN A;  4S2L A;  1PZP A;  3WS4 A;  3MKF A;  1K56 D;  1SHV A;  5CGX A;  5EE8 A;  1K38 A;  1LL5 A;  5CED A;  1PW8 A;  2P74 A;  4K91 A;  1E3U A;  2EX2 A;  4KQO A;  4WZ5 C;  1RCJ A;  3G4P A;  4XUX A;  3MZF A;  4P6B A;  4R0Q A;  3W4P A;  5CTM A;  3GSG A;  1LI0 A;  1PYY A;  3Q82 A;  5GLB A;  4N9K A;  3ZCZ A;  4GN2 A;  3LCE A;  1NZO A;  1SDE A;  4RX2 A;  3FZC A;  2DNS A;  2P9V A;  5G18 A;  2XDM A;  3G31 A;  5U47 A;  4S2O A;  5HAP A;  4RA7 A;  4B88 A;  3G35 A;  3HLB A;  4S2I A;  4UA7 A;  1MWR A;  1NY0 A;  4WMC A;  3VFH A;  5FAT A;  4JXG A;  1SDN A;  5E2G A;  1PWC A;  4OLD A;  2WZX A;  5HAQ A;  5FQM A;  1YLT A;  4OP5 A;  4DRT A;  3OPL A;  1RGY A;  1W8Q A;  3E2K A;  1MPL A;  1BZA A;  5A92 A;  3MFD A;  2CC1 A;  3ITA A;  3GV9 A;  4LV2 A;  4X69 A;  3UPP A;  1H8Z A;  2H0Y A;  4WEL A;  2B5R A;  5I94 A;  5F83 A;  2PU2 A;  1TEM A;  1L0G A;  4IBX A;  3V3R A;  3IHB A;  1ES5 A;  2Y4A A;  4PM8 A;  3V39 A;  3OPH A;  3VOY A;  4R4S A;  4OP8 A;  3PAG A;  4PM7 A;  4BEN A;  1VM1 A;  3S1Y A;  5EUA A;  1BLH A;  5EVI C;  1DJA A;  1PWD A;  3O86 A;  3O88 A;  4QHC A;  1K54 C;  3TG9 A;  1C3B A;  1NJ4 A;  4OQG A;  2H5S A;  1YLZ A;  4IVI A;  1E4D A;  2R9X A;  3M2J A;  2A3U A;  5JYP A;  2H10 A;  5L2F A;  1IKI A;  1TVF A;  3MBZ A;  5EPH A;  2ZQC A;  4EUZ A;  4MBH A;  3UN7 A;  3ZG7 B;  3WRT A;  1YLY A;  1K25 A;  2WUQ A;  3BFC A;  2ZQD A;  1AXB A;  1NYM A;  5AQA A;  4XXR A;  2EXA A;  3RJU A;  3A3J A;  5DTT A;  2ZC7 A;  1N4O A;  4R3J A;  5IHV A;  2WKH A;  4KEN B;  4DXC A;  1GA0 A;  1PW1 A;  4FH4 A;  3A3F A;  1K55 C;  4XUZ A;  4YFM A;  3VFF A;  2E8I A;  4JBF A;  4GKU A;  2QZ6 A;  3HUM A;  4R4R A;  1XX2 A;  1FCO A;  1E3U D;  1DJC A;  5GHX A;  3EQU A;  4P85 A;  3G30 A;  3ISG A;  5F82 A;  3VMA A;  4EWF A;  4OOL A;  1SKF A;  4Y0O A;  2FFY A;  5GHZ A;  1XGJ A;  4GD6 A;  4LV1 A;  4FSF A;  4X55 A;  5FAQ A;  3FWL A;  5M18 A;  4OPR A;  1W7F A;  3SOI A;  3SS3 A;  1HTZ A;  4RVA A;  3P98 A;  4KZ9 A;  4DE3 A;  5CGS A;  1NYY A;  4U0T A;  5GLC A;  3IH9 A;  1MY8 A;  5DF7 A;  5EOO A;  5KSH A;  4Z9Q A;  4ZTK A;  1KGG A;  4R3B A;  3GMW A;  4NET A;  1LL9 A;  3SS4 A;  3VP2 A;  4WMC D;  1PI4 A;  3NC8 A;  4DF6 A;  4MNR A;  2ZD8 A;  2X02 A;  4JXV A;  3S22 A;  3TOI A;  4KZ8 A;  4HEF A;  4QY5 A;  2OLU A;  3TSG A;  1GHM A;  3UDX A;  3PBO A;  4L0L A;  4X6T A;  1K57 A;  3Q1F A;  2Y55 A;  3M6H A;  1MWT A;  1GHP A;  2XFS A;  3IHA A;  1BTL A;  3MKE A;  4KZ6 A;  5FQJ A;  2PU4 A;  4C6Y A;  2XH9 A;  5GL9 A;  2WAE A;  3BLM A;  3FYZ A;  3RXX A;  3WS5 A;  4N92 A;  4EBL A;  4DE1 A;  4OQH A;  5FSR A;  2Y2O A;  4EBN A;  3FV7 A;  4E6X A;  1ZG6 A;  5A93 A;  1ERO A;  4QU3 A;  4ZJ2 A;  4BJP A;  1FSY A;  3UPN A;  2HPB A;  4DE2 A;  4EBP A;  1YM1 A;  1TDL A;  1ESU A;  3DTM A;  4GB7 A;  5FI6 A;  3QNB A;  3UDF A;  1FSW A;  3CMZ A;  3IT9 A;  3UNW A;  4IVK A;  1W79 A;  4HES A;  4GDN A;  3HLG A;  5AQ7 A;  1YLJ A;  4ZDX A;  3IWO A;  4MEZ A;  5D3O A;  4BL2 A;  4DE0 A;  2J8Y A;  4FCF A;  2Y2I A;  4KZ7 A;  3C4P A;  3NIA A;  1HZO A;  3V5M A;  1FCN A;  2Y91 A;  1G6A A;  2ZQA A;  3IF6 B;  3N4I A;  2Q9N A;  2EFX A;  2C5W B;  1KVL A;  4F94 A;  4D2O A;  3A3E A;  1IEL A;  4KZ5 A;  1IYS A;  5HAI A;  4E3M A;  1CEF A;  5A91 A;  4LV0 A;  5EEC A;  2FFF B;  1ES4 A;  3C5A A;  4KG6 A;  3PBQ A;  1H5X A;  1PZO A;  3G34 A;  4OOY A;  4WEK A;  2XR0 A;  3NCK A;  1ONH A;  2IWD A;  3E2L A;  1XGI A;  4BQM A;  4B4Z A;  3O87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...