4E6XA

Clbp in complex boron-based inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
310
Chain Sequence
ERLSTLIHQRMQEAKVPALSVSVTIKGVRQRFVYGVADVASQKANTLDTVYELGSMSKAFTGLVVQILIQEGRLRQGDDIITYLPEMRLNYQGKPASLTVADFLYHTSGLPLRNENLLFAPGAKFSYASANYDVLGAVIENVTGKTFTEVIAERLTQPLGMSATVAVKIIVNKASGYKLGFGKPVLFARNHVPAAYIHSTLPDMEIWIDAWLHRKALPATLREAMSNSWRGNSDVPLAADNRILYASGWFIDQNQGPYISHGGQNPNFSSCIALRPDQQIGIVALANMNSNLILQLCADIDNYLRIGKYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The NRP peptidase ClbP as a target for the inhibition of genotoxicity, cell proliferation and tumorogenesis mediated by pks-harboring bacteria
rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ClbP peptidase
total genus 89
structure length 310
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4e6xA00
3QNBA 4S2JA 1CEFA 2QMIA 4U3TA 5FSRA 4E3LA 1JTDA 3UDFA 1ES3A 1YLPA 2J9OA 2ZMAA 2ZC5B 4OP5A 1BUEA 5E2EA 2ZQ9A 2PU2A 5EECA 1LLBA 2H0YA 1KVLA 3AGDA 1BLHA 4MBHA 3VP2A 1Q2QA 4ZAMA 3V3SA 4C6YA 2Y2NA 3E2KA 1KGFA 4M3KA 4OOMA 3V50A 3C7VA 2Y2JA 5TFQA 1BT5A 3HL9A 1CEGA 2WZZA 4BJPA 5GLDA 4MLLA 4KZ8A 3WRTA 3FV7A 3HLBA 3SH9A 5JYPA 1YT4A 4OLDA 4PM5A 3Q07A 4WYYA 4KZ3A 1FOFA 1K55A 4P0MA 1HD8A 2EX9A 1U60A 4S2KA 5FAQA 1ES5A 4KZ6A 2XK1A 1PZPA 3E2LA 4MNRA 5FQIA 3DW0A 1M6KA 4HESA 2WKHA 1QMFA 2Z2LB 4R3JA 1ESIA 1TDGA 2Y2LA 4E3IA 1BZAA 1O07A 5KMWA 3C7UA 2WGIA 3WS2A 1IELA 5CTNA 1SDNA 4KZ9A 1H8ZA 3A3JA 3ZHHA 3O87A 4WELA 3ZVWA 5FAOA 3LCEA 1S6RA 4X69A 3NDEA 2Y2OA 5DTSA 4RYEA 4RX3A 4CJNA 4XUXA 3VMAA 1GCEA 5A91A 1NY0A 5AQAA 4PM8A 1PI4A 1K4FA 4KZBA 3G30A 1KDSA 1GHMA 1XGIA 2BG1A 2DRWA 1KVMA 1MWRA 4CPKA 1LHYA 3LEZA 4Z9QA 3VFHA 1PWDA 3ZNTA 1RCJA 3PAEA 5D3OA 5GLBA 4KZ5A 5A92A 2DNSA 2ZQDA 2E8IA 3SS4A 3UO9A 5GHXA 2J8YA 3N7WA 4PMAA 5CGXA 3IXGA 4D2OA 1NYMA 3HREA 3GR2A 3MKEA 3G31A 4MBFA 5A93A 1ZG6A 2J9PA 4IVKA 3NDGA 2RCXA 3HLDA 4R0QA 5EVLA 5KZHA 1MWUA 3HLFA 3OCNA 1IYSA 3ZNYA 4DE0A 4KG2A 1LI9A 1MY8A 4B4XA 5FAPA 4BD0A 1JWPA 3ZG5A 4KENB 3ZG8B 1MPLA 3O3VA 2JCHA 4YINA 3S22A 2Y2MA 3HUMA 3C5AA 2ZM8A 4NK3A 3IWQA 5TR7A 1MWSA 4X68A 1MKIA 1LI0A 2XR0A 5FATA 1K56A 3HBRA 4UAAA 4C75A 4O7DA 3UNWA 4E6XA 3QHYA 3N8SA 3ITBA 1HZOA 3UE0A 2R9XA 3UPOA 1NRFA 2H5SA 2WADA 3C4OA 3OPPA 3DWZA 3IT9A 2OLUA 1KGEA 4LENA 5F1FA 5KSCA 5KSHA 1DJBA 2ZC6B 3FWLA 5E2FA 4HBTA 4FCFA 4S2IA 1DJCA 2WKEA 3FKVA 2DCFA 3OPHA 1YMXA 2FFYA 1AXBA 3SOIA 1PZOA 1WYCA 2P74A 3TOIA 1CI8A 1ONHA 3Q81A 5FQMA 3GV9A 3Q1FA 3MZEA 3PBOA 4PM9A 5E43A 5I94A 3HVFA 4DDSA 4OP8A 2PU4A 3IWOA 5HX9A 1NZOA 3UPNA 5GHYA 2Y2IA 3NCKA 5M1AA 4DKIA 3BLMA 1BTLA 4K0WA 4MEZA 4WZ4A 2Y2GA 3HLEA 4S2PA 1GHPA 2EX8A 1JWZA 3IHBA 3AGFA 4QHCA 5HW3A 3BEBA 1KE0A 2WKIA 2XD1A 1MXOA 1W8QA 5CXWA 5DTTA 4BL3A 4QJGA 4IBXA 4JLFA 1ONGA 1EI5A 1YLTA 5DF8A 4OPYA 4E3KA 3MZDA 3W4OA 2I72A 3BECA 4DXBA 2JBFA 4ZJ1A 1LL5A 3O88A 3RJUA 1HVBA 4UA7A 2EXBA 3M2KA 5HAPA 3W4PA 3LY4A 2ZM0A 3TSGA 3IH9A 1OMEA 1MBLA 4OPQA 5CHJA 4KQQA 3CZDA 3BFGA 5FQJA 4PPRA 4JXSA 1LL9A 1L0FA 5FI2A 4EV4A 5FASA 5U47A 1IKIA 2WZXA 4WZ5C 4YFMA 3VOYA 5AQBA 1SCWA 3RXXA 3VSKA 1TDLA 2G2WA 2HDRA 3HLCA 3IQAA 4R4SA 5EPHA 5FI6A 5FQKA 3SS5A 4EBLA 3A3EA 4Y0OA 3IHAA 1Z6FA 4LV1A 1RGZA 1I5QA 4OQ0A 4P87A 1FCNA 2P9VA 3BFFA 4K91A 2P9VB 2ZC3B 2Y2QA 5CTMA 4DE3A 3HLWA 2XFSA 2H10A 3BFEA 1XGJA 2ZM2A 4EBNA 3IXDA 1K54C 3GSGA 1GA9A 1W5DA 1Y54A 4XXRA 4E3NA 3UPPA 1YLZA 3IXHA 3P98A 4JXWA 4S2LA 5CGSA 1I2WA 5CRFA 3ZVTA 4Y0UA 4HEFA 4NETA 3A3FA 4S2NA 1HTZA 2ZQ8A 3NC8A 4N92A 1L0GA 1EWZA 1XXMA 2EFXA 2IWBA 4EBPA 4L0LA 4OQHA 4X53A 3BFDA 1XPBA 1NJ4A 4OQIA 3WS1A 3W4QA 3C4PA 5JYOA 1E3UD 4N1HA 3B3XA 3LO7A 1SHVA 3OZHA 4ZDXA 3ZG0A 4DRTA 4QB8A 2BLSA 1BSGA 1ES4A 4E6WA 5J8XA 3IH8A 2R9WA 1XP4A 2VGKA 4GDNA 5GLAA 3IF6C 4JF4A 1BULA 1DJAA 1VQQA 1L2SA 1MWTA 5CECA 2WGWA 1FR6A 2Q9NA 2ZD8A 4HBUA 1KE3A 4OOYA 4DE2A 5L2FA 2QPNA 4OOLA 2HP6A 4GDBA 5IHVA 3VSLA 4BD1A 2UWXA 4GD8A 4DF6A 3MXRA 1JTGA 4BQMA 5M18A 3EQUA 3PBNA 1E4DA 2Q9MA 1FCOA 1QMEA 3OPRA 3Q7VA 2Y2PA 1PW1A 4RVAA 4UHUA 3WWXA 1K38A 1PI5A 5GLCA 1K25A 4S2MA 4DXCA 4EUZA 3IF6A 2C5WB 5HAQA 2WUQA 4GOGA 4LV0A 1KE4A 4WM9A 1EROA 4Q8IA 3GMWA 4RA7A 2EX6A 1G68A 2WAEA 5AQ9A 5EVIB 3DWKA 4JF6A 4OVDA 2HDUA 4JXVA 3MBZA 5EOEA 3WS4A 5AQ7A 3RXWA 1ERMA 1XA7A 3BM6A 1FSYA 2Y55A 4R23A 4BL2A 3NI9A 3O86A 5DF9A 1FSWA 2WK0A 3CMZA 1BLPA 4FSFA 1XX2A 5CEBA 3G34A 4ZBEA 1E3UA 4QD4A 4PM7A 4ZTKA 5CERA 3N8LA 4R3BA 4EQIA 4A5RA 5M19A 2CC1A 4KZAA 5GHZA 3G2YA 3MFDA 1CK3A 1I2SA 4OONA 3PBQA 5G18A 1FR1A 4P6BA 3HLGA 3ITAA 2PBYA 4P85A 4ZJ2A 1K56D 3CG5A 4LCLA 2WYXA 4GNUA 4LV2A 1G6AA 5E2GA 2OV5A 3VP4A 3PTEA 4QU3A 5CEDA 3OC2A 4MBKA 2XGNA 4GKUA 1O7EA 2ZQAA 2Y2KA 4N9KA 3NY4A 1SKFA 3OCLA 4WMCA 3UN7A 2GDNA 2C6WB 1XA1A 3GVBA 3Q7ZA 5EVID 3VFFA 2B5RA 4N1XA 3N4IA 3MKFA 1K55C 5CHMA 5FI7A 1N4OA 1SDEA 1ZG4A 3CJMA 3WRZA 4EWFA 3G35A 4DDYA 1PWCA 3DTMA 3VOZA 4IEDA 1C3BA 4JBFA 5E2HA 3OPLA 5FA7A 2Y59A 5HAIA 1YLWA 1WYBA 4H8RA 4KQRA 1YMSA 4OPRA 5DVAA 2Y91A 1PIOA 1YQSA 4KQOA 5FQQA 1JVJA 3A3DA 1RGYA 5HARA 1IEMA 3MZFA 2XH9A 3UE3A 2OLVA 1KGGA 1XKZA 3FZCA 2HPBA 3D4FA 3A3IA 2XF3A 3BLSA 4Y7PA 1PWGA 2ZLYA 3HUNA 3N8RA 4WZ5A 3W8KA 3FKWA 1RP5A 5GL9A 3UE1A 4E3MA 3IXBA 1S0WA 3PBTA 1K6SA 2QZ6A 3GQZA 1ESUA 3ZDJA 4B4ZA 3ZGAB 5CHUA 1L0EA 1W8YA 4OQGA 1ES2A 3V5MA 1PYYA 1W79A 1IYOA 1ZC2A 3AGEA 3ISGA 4UA6A 1Q2PA 5F1GA 2IWDA 4KG5A 1K57A 4GB7A 4GZBA 3VP3A 5HL1A 3MXSA 4K0XA 1K54A 2HDSA 2J7VA 3G4PA 3IF5A 2ZC4B 4WMCD 2WAFA 4OPZA 1ALQA 4B88A 3M2JA 3JYIA 3G32A 1N9BA 1K57C 1DY6A 3SS3A 3TG9A 2OSUA 5CGWA 2Y4AA 4U0XA 4JXGA 5BOHA 4LV3A 2A49A 1GA0A 1GHIA 2IWCA 2ZQCA 4LCMA 2XFTA 1BLCA 2X02A 2H0TA 3SH7A 1CI9A 2ZJ9A 2XQZA 1K4EA 5HFOA 1L0DA 4KG6A 4FH4A 2HP5A 5EE8A 3SH8A 1NYYA 4IBRA 4IVIA 1H8YA 2V2FF 3LY3A 4E3JA 3NBLA 3BYDA 4FD8A 3WS0A 3M6BA 3ZG7B 3M6HA 3QNCA 3G2ZA 4N9LA 5TGFA 4KZ4A 3PAGA 4OH0A 1WE4A 2V1ZA 4XUZA 1IYPA 5DTKA 3PBRA 3UDIA 4E3OA 3FYZA 1E25A 4X56A 2XDMA 3ZFZA 2WGWB 5EVIC 3Q82A 1ZKJA 5F82A 3WS5A 5FDHA 3GTCA 2JE5A 4OLGA 2HP9A 3I7JA 2Y2HA 3P09A 4FH2A 3S1YA 3S4XA 4BLMA 1VM1A 3VP1A 2RL3A 4ZJ3A 4Y0TA 5A90A 1NXYA 4DE1A 4F94A 3V39A 5DF7A 5EVIA 3PBSA 4ID4A 1YLJA 2FFFB 2XD5A 2ZC7A 2Z2MB 2HDQA 1FQGA 4X55A 2X71A 3VP0A 2VGJA 4OKPA 1TEMA 4U0TA 1FCMA 3BFCA 4UA9A 5EUAA 3IF6B 1PW8A 4GN2A 5EOOA 5FQ9A 1IYQA 2EFUA 1YM1A 4WEKA 2G2UA 3Q7VB 4GD6A 4QY5A 2V20A 3ZCZA 3ZG9B 1TVFA 1W7FA 1NZUA 2XEPA 1ERQA 1KDWA 4C3QA 4WEJA 1YLYA 2XLNA 3IWIA 3V3RA 3N6IA 4R1GA 2ZQ7A 4QY6A 2JC7A 3HUOA 3EQVA 2A3UA 4S2OA 4JF5A 4JPMA 4WBGA 1IKGA 4RX2A 5F83A 4PM6A 1BLSA 4S2NC 3BRMA 2X01A 3UDXA 2EXAA 4R4RA 1H5XA 4JKTA 1JWVA 2WGVA 4X6TA 1K6RA 3NIAA 4BENA 4KZ7A 1J9MA 2EX2A 1M40A 3GRJA 3UY6A
chains in the Genus database with same CATH superfamily
4S2JA 5FSRA 2PHYA 1ES3A 1YLPA 2ZMAA 5G4YA 3ULFA 2HZ5A 2H0YA 3AGDA 1BLHA 3LIAA 4II7A 4Q0IA 2Y2JA 1BT5A 1CJFA 3VV4A 1CEGA 2WZZA 4HP4A 4BJPA 3FV7A 3SH9A 5JYPA 1YT4A 1OJGA 4HJ4A 4IJGA 2EX9A 1T1BA 5FAQA 3MF0A 4KZ6A 5FQIA 2L1MA 4HESA 3LYXA 3WS2A 1IELA 4Y5FA 5CTNA 1BYWA 2M1CA 1H8ZA 4WELA 1S6RA 2Y2OA 2H28A 2PDRA 2ZOIA 3UMDA 5DFYA 3G30A 1Y4OA 1GHMA 4CLCA 2DRWA 2FH5A 1KVMA 3TW8A 1LHYA 3VFHA 3UE6A 3MXQA 3OLOA 3PAEA 1H8MA 3H82A 2ZQDA 2E8IA 2B18A 4PMAA 1XJ2A 4HI4A 3HJIA 4JGQA 4FOFA 4IVKA 3NDGA 1LT0A 5KZHA 5EVEA 4KG2A 1LI9A 4B4XA 4I39A 5FAPA 3QP5A 1CQAA 4KUKA 1J3WA 2Y2MA 3UB5P 3IWQA 3IX4A 2L4RA 1K56A 3HBRA 4UAAA 4E6XA 3N8SA 3SZTA 3C4OA 2GZAA 1FILA 1GSVA 2BASA 1UWNX 2DCFA 3S7NA 2W3GA 3Q1FA 5DFXA 3MZEA 5E43A 3IWOA 5GHYA 3FPWA 3BLMA 4MEZA 2HJEA 3HLEA 5IU1A 2EX8A 4PKYA 3BEBA 4BL3A 1MXOA 5DTTA 5K5BA 1ONGA 1YLTA 3MZDA 4DXBA 4NXEA 3T12B 4HJ3A 5DKKA 2PBDP 5TJJA 3W4PA 4I3AA 1OMEA 4OPQA 4KQQA 1L0FA 1TD5A 3VOYA 2K2NA 4E04A 3LIEA 5EPHA 3D9YA 4Y0OA 4ARZB 4OQ0A 4I3JA 4G3WA 5CTMA 4DE3A 5AJGA 3MS6A 2OAP1 3B47A 3P98A 5FL3A 3ZVTA 4NETA 3A3FA 2A24B 3EGDC 1ACFA 4EBPA 1L0GA 1YKDA 2QJ5A 3QP4A 4OQHA 2VK3A 1XPBA 5JYOA 3ZYTA 4ZDXA 4QB8A 1BSGA 1ES4A 3IH8A 3BWLA 3IF6C 1BULA 1MWTA 5CECA 4HBUA 1KE3A 4BD1A 3A0SA 3MXRA 1JTGA 4BQMA 3DTEA 3EQUA 5HWWA 2QHKA 4X25A 2Q9MA 1JNUA 3Q7VA 1PI5A 1K25A 2EWWA 4EUZA 4DXCA 3IF6A 4G3VA 2CMNA 1EROA 4JGOA 4RA7A 3BQ8A 1OT9A 4JGPA 1OTBA 2HDUA 3WS4A 3BM6A 1FSYA 2Y55A 4BL2A 3NI9A 1N9OA 5DF9A 1FSWA 2WK0A 3CMZA 2PYPA 1BLPA 3MR0A 3CWFA 4PM7A 4EW7A 3E4PA 4EQIA 2CC1A 3MFDA 3K2NA 4OONA 3LIFA 3E98A 3ITAA 3C30A 4LCLA 2MJ6A 5E2GA 2YKHA 3OC2A 2XGNA 3NY4A 4WMCA 3UN7A 3Q7ZA 1XFNA 4N1XA 3N4IA 3U4LP 4H6JB 3G35A 4DDYA 2AVXA 3T4KA 5E2HA 4KQRA 4OPRA 3MZFA 5FEGA 2OLVA 3RH8B 2HPBA 3N8RA 4WZ5A 5CX7A 5GL9A 1RP5A 2VV6A 3UE1A 1VEUB 1ESUA 3H9WA 1L0EA 1ES2A 1ZC2A 1IYOA 2VGLS 4KG5A 3V67A 3K3DA 4GB7A 3VP3A 5HL1A 3MXSA 4K0XA 1K54A 5HPFA 4WMCD 3M2JA 3JYIA 2OSUA 5BOHA 2IWCA 1VHMA 4RQ9A 1A0KA 3DBAA 4MCWA 3CPTB 2HP5A 5EE8A 4E3JA 2W0NA 2YKFA 5HDCA 3ZG7B 3QNCA 3C2WA 3G2ZA 2E8JA 4KZ4A 4OH0A 4X56A 2WGWB 1IOUA 2PAVP 5FDHA 3GTCA 2JE5A 4OLGA 3P09A 5LBRA 3V39A 3MFXA 2ZC7A 2NUPC 2X71A 3VP0A 5L8MA 1FCMA 4UA9A 5EUAA 4EEUA 4GN2A 1XJ6A 4MDZA 3E0YA 4GD6A 3CI6A 1TVFA 1W7FA 1ERQA 2XLNA 3MQQA 2A3UA 4JF5A 3JPUA 4PM6A 3F1PA 4ARZA 2EXAA 1JWVA 4X6TA 1K6RA 1ODVA 3NIAA 4BENA 2EX2A 4HH2A 3GRJA 3UY6A 3QNBA 1TF1A 3UDFA 4OP5A 3W2ZA 1BUEA 2PYRA 2PU2A 5EECA 2A24A 3ZQ5A 4OOMA 4M3KA 3V50A 2W3DA 5GLDA 4KZ8A 3WRTA 3HLBA 3NHQA 1DP9A 4OLDA 4PM5A 3Q07A 4KZ3A 1K55A 1U60A 1PZPA 3E2LA 3P7NA 3TRCA 1ESIA 4R6LA 3C7UA 4IUKA 2WGIA 2PD8A 5I5LA 1SDNA 3T50A 1CF0A 2LB9A 5DKLA 2V8FA 5C5KA 4X69A 4I5SA 5DTSA 3KYZA 4ETZA 3R4KA 3G6OA 2W1TB 4KZBA 1XGIA 4BMWA 5IS1A 2BG1A 4Z9QA 1RCJA 5A92A 2PR5A 3N7WA 5CGXA 4D2OA 1NYMA 5A93A 4MBFA 5HD3A 1ZG6A 2VGLM 2RCXA 4L9FA 4WL9A 3MQ0A 1MWUA 2HGVA 1MY8A 4KENB 3NOPC 3O3VA 5HL6A 1MC0A 1YAXA 3C5AA 5TR7A 1MWSA 1MKIA 2QYBA 4K08A 3ITBA 1HZOA 3UPOA 1NRFA 2WADA 3OPPA 2OLUA 1KGEA 1T1AA 5F1FA 5KSHA 1H0MA 4HQAA 2JKRI 4HBTA 1TS6A 4S2IA 1DJCA 2WKEA 1T19A 2FFYA 3MJQA 1PZOA 1WYCA 2P74A 2P08A 1CI8A 1ONHA 5FQMA 3GV9A 1S66L 4OP8A 1NLYA 5HX9A 4DN0A 3NCKA 4LGWA 3RFBA 2Y2GA 4S2PA 1GHPA 1JWZA 3IHBA 4GS9B 5HW3A 4XT2B 4JLFA 4LFUA 4E3KA 3W4OA 4ZJ1A 3O88A 4P6ZS 4WUJA 2EXBA 3M2KA 5HAPA 3NOUC 1MBLA 1NRJA 3CZDA 3BFGA 1EW0A 4JXSA 4EV4A 5U47A 1IKIA 1XJ3A 2O0YA 2XROA 3JVUA 4EBLA 3BY9A 1OTDA 4P87A 1FCNA 3BFFA 2K31A 4K91A 2P9VB 2VLGA 2H10A 1XGJA 4MN6A 1W5DA 4XXRA 4S2LA 1NWZA 4D60A 3NC8A 2VV7A 1EWZA 2IWBA 4HH3A 4L0LA 1S1ZA 4X53A 3BFDA 4OQIA 1NJ4A 5DJUA 3C4PA 1E3UD 3B3XA 3OOVA 1SHVA 1TS0A 5J8XA 3LEQA 4E6WA 4GDNA 1L2SA 3GDIA 3CHWP 3DTIA 4DE2A 5L2FA 2QJ7A 3P01A 4OOLA 4GDBA 2UWXA 5M18A 3PBNA 1FCOA 4BWIA 4Y13A 1YSQA 2BTFP 3CPTA 4S2MA 4LV0A 3HCYA 1DP8A 2EX6A 1G68A 5EVIB 3DWKA 3B33A 4LLOB 4I3IA 3EEHA 3MBZA 5AQ7A 3CLOA 4GS9A 3IS2A 1P97A 4R23A 1E3UA 4FTXA 4R3BA 3G2YA 1I2SA 4P6BA 4ZJ2A 2VJWA 1K56D 4GHIB 2JKTI 4R70A 4QU3A 2M7UA 5CEDA 2QKPA 4MBKA 4N9KA 1SKFA 2C6WB 1XA1A 3GVBA 2NUTC 3T4SA 2B5RA 3MSHA 4B93A 3MKFA 4L9GA 4O01A 5FI7A 5F68A 1VETA 1L3LA 4EWFA 3DTMA 2M7VA 4EXOA 1C3BA 3OPLA 3F1NA 5HAIA 5J4EA 3HJKA 3KYQA 2XSSA 3PHYA 4KQOA 1JVJA 1RGYA 1F98A 3T1RA 1KGGA 2XF3A 1MZUA 3W8KA 1GSWA 1F2KA 1S0WA 3DTKA 2R78A 3GQZA 3ZDJA 1G6OA 5F5YA 3BW6A 4IHQA 3IS2B 1Q2PA 2V1AA 2HDSA 3IF5A 2ZC4B 4OPZA 1ALQA 4B88A 3KO6A 1N9BA 3L9KA 4LV3A 2A49A 4GHIA 2XFTA 3OBFA 2X02A 2H0TA 4HOIA 1CI9A 2XQZA 4KG6A 3SH8A 2ACGA 4FD8A 4KUOA 5TGFA 3SOIA 2V1ZA 2O9CA 1IYPA 3FYZA 2XDMA 5EVIC 3Q82A 1ZKJA 5F82A 3NECA 3WS5A 2JN7A 2LB5A 2Y2HA 4ZJ3A 5A8BA 3CUEA 3QP6A 3LR3A 4ESPA 2K7SA 1UWPX 1TEMA 4U0TA 1P9WA 4P6ZM 3IF6B 5EOOA 3A0VA 3ZCZA 4ZRRA 4C3QA 3IWIA 2HF6A 2GX5A 3A0RA 4JPMA 4WBGA 4RX2A 3F1OB 4S2NC 4I38A 3UDXA 1H5XA 1WA9A 4ETXA 5MC7A 1UGUA 2ZMVA 1CEFA 4U3TA 2ZC5B 5E2EA 2ZQ9A 1LLBA 1KVLA 4MBHA 3U2AA 1Q2QA 4ZAMA 4C6YA 3E2KA 3H7WB 3C7VA 1F9IA 4MLLA 4KQDA 4WYYA 1FOFA 3DW0A 1M6KA 2WKHA 4R3JA 1TDGA 4E3IA 2Y2LA 3BY8A 1BZAA 1O07A 4Y17A 5KMWA 3PYPA 4KZ9A 3A3JA 4EU0A 2P04A 3O87A 3C8CA 4WF0A 2WKRA 3CITA 1S67L 4EERA 4CJNA 3VMAA 1GCEA 2D02A 5A91A 3UB8A 1OT6A 1K4FA 4BBTA 1SKOB 2JKTM 3LEZA 4LPZA 2V0UA 5GLBA 2DNSA 5HDSA 2OWJA 3SS4A 1OPXA 1X0OA 3HREA 3GR2A 3MKEA 3G31A 4B9OA 3KSIA 4HP9A 2G7UA 5EVLA 4R0QA 4M4XA 3OCNA 1IYSA 4DE0A 3LI8A 4BBVA 4YWZA 4BD0A 3ZG5A 5KIZA 2VEAA 4QWOA 3ZG8B 1OTIA 2ZM8A 4NK3A 4DMZA 4X68A 1LI0A 2HJ9C 5FATA 4O7DA 3UNWA 1SKOA 4EUVA 2H5SA 3ICYA 4FUWA 1S4RA 2ZBBA 4LENA 1DRMA 1OTAA 2KOIA 3CUEC 3FWLA 5E2FA 3EWKA 4GJ4A 1YMXA 4EQ1A 3LR0A 3TOIA 2WKQA 3TJZC 4DJ3A 3HVFA 4O0PA 3EEAA 2FZ0A 3FPVA 2Y2IA 5M1AA 5G4ZA 4O8GA 5EV0A 4YOFA 3KSFA 3JVVA 1ZTUA 3AGFA 4QHCA 4LRXC 1KE0A 2WKIA 1W8QA 4IBXA 1OTEA 4HY8A 4OPYA 4HIAA 3QP2A 3BECA 3B42A 1HVBA 2JKRM 4UA7A 3LGOA 2ZM0A 3TSGA 4PPRA 1P9RA 1LL9A 5FASA 4WZ5C 2WZXA 5AQBA 2ZMFA 3RXXA 3VSKA 1TDLA 2HDRA 5FQKA 5FI6A 3BQAA 3IHAA 1RGZA 3F1OA 2P9VA 3D3OA 2Y2QA 2L0WA 5IT5A 2W1RA 4EBNA 1K54C 1GA9A 5J3WA 3UPPA 1YLZA 3IXHA 4JXWA 1I2WA 5CRFA 3H7WA 4UQIM 4S2NA 1HTZA 3LR5A 4R3AA 4N92A 4BBUA 4L9EA 4N1HA 3OZHA 4NG2A 3EOIA 2BLSA 2R9WA 4QPRA 2VGKA 5GLAA 4JF4A 4XT2A 1S1YA 1VQQA 3F1PB 1NLZA 2W3HA 3UB6A 4GD8A 1E4DA 1T1CA 3OPRA 4EESA 3WWXA 2EA9A 1PFLA 5HAQA 2WUQA 4WM9A 1XFQA 3GMWA 4WN5A 4NXGA 2V9AA 4JXVA 2DMWA 2OAQ1 5HWTA 4EETB 1ERMA 1XA7A 3O86A 4FSFA 4ZBEA 3FG8A 4ZTKA 3N8LA 4A5RA 5M19A 1G28A 4KZAA 5EM1A 1CK3A 1FR1A 4YNRA 3CG5A 2J80A 3PTEA 3DAVA 1N9NA 3UB9A 3QP8A 2JHEA 4EEPA 2Z6CA 3LICA 2ZQAA 2GDNA 3VFFA 3F1NB 3S7QA 1K55C 4GLQA 3EGXC 1SDEA 1ZG4A 3CJMA 3WRZA 1TS8A 1YLWA 1WYBA 1TS7A 2W27A 5DVAA 2Y91A 1PIOA 1YQSA 3A3DA 4CLCD 3LIBA 3UE3A 3T1QB 3FZCA 3A3IA 3BLSA 2ZLYA 3HUNA 3NJAA 1LL8A 4E3MA 1Y28A 4B4ZA 2PRFA 5CHUA 2D01A 4OQGA 1PYYA 3ISGA 4UA6A 5F1GA 2Y8HA 4PAUA 1S4SA 4DJ2A 4Z1WA 4G3KA 1K57C 3SS3A 5CGWA 2Y4AA 4JXGA 3E4OA 3SH7A 5HFOA 3T1SA 4FH4A 1NYYA 4IBRA 2JKGA 4IVIA 3LY3A 3BYDA 3WS0A 3M6HA 2GNXA 4N9LA 2V8CA 3UDIA 2I9VA 3PAGA 1WE4A 3UPNA 5HPIA 5DTKA 3PBRA 1E25A 3ZFZA 5EFWA 3S4XA 3I7JA 3S1YA 4BLMA 1VM1A 3VP1A 4Y0TA 4F3LB 1NXYA 4DE1A 4F94A 4Y2FA 5EVIA 4ID4A 1YLJA 2HDQA 1H3QA 1STZA 1Z09A 2VGJA 3BFCA 3VE4A 1PW8A 2Z6DA 1IYQA 2EFUA 2G2UA 1VB6A 3T4TA 1ZHHB 4QY5A 2O9BA 1NZUA 4WEJA 3D72A 3N6IA 4R1GA 2ZQ7A 4QY6A 4UQIS 2JC7A 4S2OA 1IKGA 1KOUA 1BLSA 2X01A 3LI9A 4R4RA 2WGVA 1J9MA 3PR6A 5L07A 2QMIA 4E3LA 1JTDA 2J9OA 3RTYA 3GECA 3MQOA 3VP2A 3V3SA 2Y2NA 1KGFA 5TFQA 3HL9A 3IX8A 3KSHA 2B95A 3L7HA 4P0MA 1HD8A 4S2KA 1ES5A 2JKFA 1FIKA 2XK1A 4MNRA 4X1LA 2Z2LB 1QMFA 1HLUP 4NXFA 2Q0OA 5HSQA 3ZHHA 3ZVWA 2GJ3A 2J3TC 5FAOA 3LCEA 2KX6A 2KDKA 4R38A 3NDEA 2VX8A 4RYEA 1LSWA 4RX3A 4XUXA 2VKSA 4Y3IA 1NY0A 5AQAA 4PM8A 1PI4A 4GW9A 5AVEA 2VV8A 1KDSA 2VZWA 4H6JA 1MWRA 4CPKA 4CLCE 1PWDA 3ZNTA 5D3OA 4GCZA 2XA7M 4KZ5A 1G5UA 4CLCC 3QP1A 3UO9A 1VEUA 5GHXA 2J8YA 3IXGA 2J9PA 2ZOHA 3HLDA 5TBMB 3HLFA 3ZNYA 2J3TD 3S7OA 1JWPA 3KSGA 1MPLA 1LSVA 2JCHA 4YINA 3S22A 3HUMA 3H82B 2XR0A 3LUQA 1P0ZA 4C75A 1N9LA 3QHYA 4WLAA 3UE0A 2R9XA 1F5MA 3T4LA 4Q0HA 3DWZA 3T4QA 3IT9A 5KSCA 1DJBA 2ZC6B 4FCFA 3FKVA 3OPHA 1AXBA 2WKPA 3Q81A 3S7PA 2V1BA 3PBOA 4PM9A 5I94A 1SZVA 5AVFA 4DDSA 1D7EA 4IUHA 4MN5A 4X1MA 1YPRA 2PU4A 3VE3A 1NZOA 1XJ4A 1W63M 4DKIA 5FEFA 5HWVA 1BTLA 4K0WA 4WZ4A 3T4OA 2ZL1A 2A2LA 3LFVA 2QWSA 5CXWA 2XD1A 4CLCB 4JGRA 2EWVA 4QJGA 2B02A 1EI5A 5DF8A 2I72A 2JBFA 4HJ6A 4LRYC 1LL5A 3RJUA 1W63Q 3LY4A 3IH9A 5CHJA 5FQJA 5FI2A 4YFMA 1SCWA 2G2WA 3HLCA 3IQAA 4R4SA 5FDSA 3SS5A 3A3EA 2PR6A 1Z6FA 4LV1A 1AWIA 1I5QA 2VA0A 3K3CA 2ZC3B 3HLWA 2XFSA 2OOLA 3BFEA 2ZM2A 4CQHA 3IXDA 3GSGA 4E3NA 1Y54A 5CGSA 2V0WA 3BJNA 4Y0UA 4HEFA 2ZQ8A 1XXMA 2EFXA 1DP6A 5DJTA 2HV1A 5HZHA 1LSXA 3WS1A 3W4QA 3LO7A 5HDDA 3ZG0A 4F3LA 4DRTA 1XP4A 3UMEA 1D1JA 1DJAA 2WGWA 1FR6A 2Q9NA 2ZD8A 2ZL1B 4OOYA 3NULA 3IBRA 2QPNA 5IHVA 2HP6A 3VSLA 4DF6A 2Y79A 3IBJA 1QMEA 2INWA 1PW1A 2Y2PA 4RVAA 4UHUA 3KYEA 1K38A 5GLCA 2C5WB 3KX0X 3SW1A 4GOGA 2O9AA 1KE4A 4Q8IA 4MN7A 2J3WA 1YSPA 3LIDA 2WAEA 4NXBA 2PT7A 5AQ9A 4JF6A 2KLIA 4OVDA 1GSXA 5EOEA 3RXWA 1MKMA 3NOTC 1XX2A 5CEBA 3G34A 5F69A 4ME4A 4LRZE 4QD4A 5CERA 3O5YA 5GHZA 3PBQA 3T1XA 5G18A 5TBMA 5F6AA 3HLGA 3R7WA 1PNEA 2PBYA 4P85A 2WYXA 4GNUA 4LV2A 1G6AA 1V9YA 5L09A 2OV5A 3MMHA 3VP4A 1IFQA 4GKUA 1O7EA 2XA7S 2Y2KA 3OCLA 1OJ5A 5EVID 3LR4A 3IX3A 3UB7A 5CHMA 1N4OA 1VETB 2O99A 1PWCA 3VOZA 4IEDA 4JBFA 2W1TA 3T4JA 5FA7A 2Y59A 4H8RA 5L10A 4NEED 1YMSA 5FQQA 5HARA 1IEMA 2XRNA 2XH9A 1XKZA 3R7WB 2IA2A 3D4FA 2OWHA 4Y7PA 1PWGA 1K0KA 2UV0E 3C38A 3FKWA 3IXBA 3PBTA 1K6SA 2QZ6A 3ZGAB 1W8YA 3V5MA 5J7EA 3TE8A 4MMNA 1W79A 3AGEA 2W3FA 2IWDA 1K57A 3PXPA 4GZBA 2P7JA 2J7VA 4Q0JA 3G4PA 1T18A 2WAFA 3G32A 1DY6A 3TG9A 4AFIA 3E4QA 4U0XA 4UEYA 1GA0A 1GHIA 2ZQCA 4LCMA 3CAXA 1BLCA 2ZJ9A 1K4EA 1L0DA 1H8YA 2V2FF 2W3EA 3NBLA 3M6BA 4XUZA 4E3OA 4HNBA 4PHTA 3VOLA 2HP9A 4FH2A 3FC7A 2RL3A 5EM0A 5A90A 5DF7A 3PBSA 4HHDA 2FFFB 2XD5A 2Z2MB 1FQGA 4X55A 4OKPA 5FQ9A 4Y15A 1YM1A 4WEKA 3Q7VB 2V20A 3ZG9B 4PKYG 2PD7A 2XEPA 1KDWA 4NKPA 3V3RA 1YLYA 5HD5A 1V9ZA 3HUOA 3EQVA 5F83A 1D06A 3BRMA 4JKTA 4KZ7A 1PRQA 1M40A
chains in the Genus database with same CATH topology
3QNBA 4S2JA 1CEFA 2QMIA 4U3TA 5FSRA 4E3LA 1JTDA 3UDFA 1ES3A 1YLPA 2J9OA 2ZMAA 2ZC5B 4OP5A 1BUEA 5E2EA 2ZQ9A 2PU2A 5EECA 1LLBA 2H0YA 1KVLA 3AGDA 1BLHA 4MBHA 3VP2A 1Q2QA 4ZAMA 3V3SA 4C6YA 2Y2NA 3E2KA 1KGFA 4M3KA 4OOMA 3V50A 3C7VA 2Y2JA 5TFQA 1BT5A 3HL9A 1CEGA 2WZZA 4BJPA 5GLDA 4MLLA 4KZ8A 3WRTA 3FV7A 3HLBA 3SH9A 5JYPA 1YT4A 4OLDA 4PM5A 3Q07A 4WYYA 4KZ3A 1FOFA 1K55A 4P0MA 1HD8A 2EX9A 1U60A 4S2KA 5FAQA 1ES5A 4KZ6A 2XK1A 1PZPA 3E2LA 4MNRA 5FQIA 3DW0A 1M6KA 4HESA 2WKHA 1QMFA 2Z2LB 4R3JA 1ESIA 1TDGA 2Y2LA 4E3IA 1BZAA 1O07A 5KMWA 3C7UA 2WGIA 3WS2A 1IELA 5CTNA 1SDNA 4KZ9A 1H8ZA 3A3JA 3ZHHA 3O87A 4WELA 3ZVWA 5FAOA 3LCEA 1S6RA 4X69A 3NDEA 2Y2OA 5DTSA 4RYEA 4RX3A 4CJNA 4XUXA 3VMAA 1GCEA 5A91A 1NY0A 5AQAA 4PM8A 1PI4A 1K4FA 4KZBA 3G30A 1KDSA 1GHMA 1XGIA 2BG1A 2DRWA 1KVMA 1MWRA 4CPKA 1LHYA 3LEZA 4Z9QA 3VFHA 1PWDA 3ZNTA 1RCJA 3PAEA 5D3OA 5GLBA 4KZ5A 5A92A 2DNSA 2ZQDA 2E8IA 3SS4A 3UO9A 5GHXA 2J8YA 3N7WA 4PMAA 5CGXA 3IXGA 4D2OA 1NYMA 3HREA 3GR2A 3MKEA 3G31A 4MBFA 5A93A 1ZG6A 2J9PA 4IVKA 3NDGA 2RCXA 3HLDA 4R0QA 5EVLA 5KZHA 1MWUA 3HLFA 3OCNA 1IYSA 3ZNYA 4DE0A 4KG2A 1LI9A 1MY8A 4B4XA 5FAPA 4BD0A 1JWPA 3ZG5A 4KENB 3ZG8B 1MPLA 3O3VA 2JCHA 4YINA 3S22A 2Y2MA 3HUMA 3C5AA 2ZM8A 4NK3A 3IWQA 5TR7A 1MWSA 4X68A 1MKIA 1LI0A 2XR0A 5FATA 1K56A 3HBRA 4UAAA 4C75A 4O7DA 3UNWA 4E6XA 3QHYA 3N8SA 3ITBA 1HZOA 3UE0A 2R9XA 3UPOA 1NRFA 2H5SA 2WADA 3C4OA 3OPPA 3DWZA 3IT9A 2OLUA 1KGEA 4LENA 5F1FA 5KSCA 5KSHA 1DJBA 2ZC6B 3FWLA 5E2FA 4HBTA 4FCFA 4S2IA 1DJCA 2WKEA 3FKVA 2DCFA 3OPHA 1YMXA 2FFYA 1AXBA 3SOIA 1PZOA 1WYCA 2P74A 3TOIA 1CI8A 1ONHA 3Q81A 5FQMA 3GV9A 3Q1FA 3MZEA 3PBOA 4PM9A 5E43A 5I94A 3HVFA 4DDSA 4OP8A 2PU4A 3IWOA 5HX9A 1NZOA 3UPNA 5GHYA 2Y2IA 3NCKA 5M1AA 4DKIA 3BLMA 1BTLA 4K0WA 4MEZA 4WZ4A 2Y2GA 3HLEA 4S2PA 1GHPA 2EX8A 1JWZA 3IHBA 3AGFA 4QHCA 5HW3A 3BEBA 1KE0A 2WKIA 2XD1A 1MXOA 1W8QA 5CXWA 5DTTA 4BL3A 4QJGA 4IBXA 4JLFA 1ONGA 1EI5A 1YLTA 5DF8A 4OPYA 4E3KA 3MZDA 3W4OA 2I72A 3BECA 4DXBA 2JBFA 4ZJ1A 1LL5A 3O88A 3RJUA 1HVBA 4UA7A 2EXBA 3M2KA 5HAPA 3W4PA 3LY4A 2ZM0A 3TSGA 3IH9A 1OMEA 1MBLA 4OPQA 5CHJA 4KQQA 3CZDA 3BFGA 5FQJA 4PPRA 4JXSA 1LL9A 1L0FA 5FI2A 4EV4A 5FASA 5U47A 1IKIA 2WZXA 4WZ5C 4YFMA 3VOYA 5AQBA 1SCWA 3RXXA 3VSKA 1TDLA 2G2WA 2HDRA 3HLCA 3IQAA 4R4SA 5EPHA 5FI6A 5FQKA 3SS5A 4EBLA 3A3EA 4Y0OA 3IHAA 1Z6FA 4LV1A 1RGZA 1I5QA 4OQ0A 4P87A 1FCNA 2P9VA 3BFFA 4K91A 2P9VB 2ZC3B 2Y2QA 5CTMA 4DE3A 3HLWA 2XFSA 2H10A 3BFEA 1XGJA 2ZM2A 4EBNA 3IXDA 1K54C 3GSGA 1GA9A 1W5DA 1Y54A 4XXRA 4E3NA 3UPPA 1YLZA 3IXHA 3P98A 4JXWA 4S2LA 5CGSA 1I2WA 5CRFA 3ZVTA 4Y0UA 4HEFA 4NETA 3A3FA 4S2NA 1HTZA 2ZQ8A 3NC8A 4N92A 1L0GA 1EWZA 1XXMA 2EFXA 2IWBA 4EBPA 4L0LA 4OQHA 4X53A 3BFDA 1XPBA 1NJ4A 4OQIA 3WS1A 3W4QA 3C4PA 5JYOA 1E3UD 4N1HA 3B3XA 3LO7A 1SHVA 3OZHA 4ZDXA 3ZG0A 4DRTA 4QB8A 2BLSA 1BSGA 1ES4A 4E6WA 5J8XA 3IH8A 2R9WA 1XP4A 2VGKA 4GDNA 5GLAA 3IF6C 4JF4A 1BULA 1DJAA 1VQQA 1L2SA 1MWTA 5CECA 2WGWA 1FR6A 2Q9NA 2ZD8A 4HBUA 1KE3A 4OOYA 4DE2A 5L2FA 2QPNA 4OOLA 2HP6A 4GDBA 5IHVA 3VSLA 4BD1A 2UWXA 4GD8A 4DF6A 3MXRA 1JTGA 4BQMA 5M18A 3EQUA 3PBNA 1E4DA 2Q9MA 1FCOA 1QMEA 3OPRA 3Q7VA 2Y2PA 1PW1A 4RVAA 4UHUA 3WWXA 1K38A 1PI5A 5GLCA 1K25A 4S2MA 4DXCA 4EUZA 3IF6A 2C5WB 5HAQA 2WUQA 4GOGA 4LV0A 1KE4A 4WM9A 1EROA 4Q8IA 3GMWA 4RA7A 2EX6A 1G68A 2WAEA 5AQ9A 5EVIB 3DWKA 4JF6A 4OVDA 2HDUA 4JXVA 3MBZA 5EOEA 3WS4A 5AQ7A 3RXWA 1ERMA 1XA7A 3BM6A 1FSYA 2Y55A 4R23A 4BL2A 3NI9A 3O86A 5DF9A 1FSWA 2WK0A 3CMZA 1BLPA 4FSFA 1XX2A 5CEBA 3G34A 4ZBEA 1E3UA 4QD4A 4PM7A 4ZTKA 5CERA 3N8LA 4R3BA 4EQIA 4A5RA 5M19A 2CC1A 4KZAA 5GHZA 3G2YA 3MFDA 1CK3A 1I2SA 4OONA 3PBQA 5G18A 1FR1A 4P6BA 3HLGA 3ITAA 2PBYA 4P85A 4ZJ2A 1K56D 3CG5A 4LCLA 2WYXA 4GNUA 4LV2A 1G6AA 5E2GA 2OV5A 3VP4A 3PTEA 4QU3A 5CEDA 3OC2A 4MBKA 2XGNA 4GKUA 1O7EA 2ZQAA 2Y2KA 4N9KA 3NY4A 1SKFA 3OCLA 4WMCA 3UN7A 2GDNA 2C6WB 1XA1A 3GVBA 3Q7ZA 5EVID 3VFFA 2B5RA 4N1XA 3N4IA 3MKFA 1K55C 5CHMA 5FI7A 1N4OA 1SDEA 1ZG4A 3CJMA 3WRZA 4EWFA 3G35A 4DDYA 1PWCA 3DTMA 3VOZA 4IEDA 1C3BA 4JBFA 5E2HA 3OPLA 5FA7A 2Y59A 5HAIA 1YLWA 1WYBA 4H8RA 4KQRA 1YMSA 4OPRA 5DVAA 2Y91A 1PIOA 1YQSA 4KQOA 5FQQA 1JVJA 3A3DA 1RGYA 5HARA 1IEMA 3MZFA 2XH9A 3UE3A 2OLVA 1KGGA 1XKZA 3FZCA 2HPBA 3D4FA 3A3IA 2XF3A 3BLSA 4Y7PA 1PWGA 2ZLYA 3HUNA 3N8RA 4WZ5A 3W8KA 3FKWA 1RP5A 5GL9A 3UE1A 4E3MA 3IXBA 1S0WA 3PBTA 1K6SA 2QZ6A 3GQZA 1ESUA 3ZDJA 4B4ZA 3ZGAB 5CHUA 1L0EA 1W8YA 4OQGA 1ES2A 3V5MA 1PYYA 1W79A 1IYOA 1ZC2A 3AGEA 3ISGA 4UA6A 1Q2PA 5F1GA 2IWDA 4KG5A 1K57A 4GB7A 4GZBA 3VP3A 5HL1A 3MXSA 4K0XA 1K54A 2HDSA 2J7VA 3G4PA 3IF5A 2ZC4B 4WMCD 2WAFA 4OPZA 1ALQA 4B88A 3M2JA 3JYIA 3G32A 1N9BA 1K57C 1DY6A 3SS3A 3TG9A 2OSUA 5CGWA 2Y4AA 4U0XA 4JXGA 5BOHA 4LV3A 2A49A 1GA0A 1GHIA 2IWCA 2ZQCA 4LCMA 2XFTA 1BLCA 2X02A 2H0TA 3SH7A 1CI9A 2ZJ9A 2XQZA 1K4EA 5HFOA 1L0DA 4KG6A 4FH4A 2HP5A 5EE8A 3SH8A 1NYYA 4IBRA 4IVIA 1H8YA 2V2FF 3LY3A 4E3JA 3NBLA 3BYDA 4FD8A 3WS0A 3M6BA 3ZG7B 3M6HA 3QNCA 3G2ZA 4N9LA 5TGFA 4KZ4A 3PAGA 4OH0A 1WE4A 2V1ZA 4XUZA 1IYPA 5DTKA 3PBRA 3UDIA 4E3OA 3FYZA 1E25A 4X56A 2XDMA 3ZFZA 2WGWB 5EVIC 3Q82A 1ZKJA 5F82A 3WS5A 5FDHA 3GTCA 2JE5A 4OLGA 2HP9A 3I7JA 2Y2HA 3P09A 4FH2A 3S1YA 3S4XA 4BLMA 1VM1A 3VP1A 2RL3A 4ZJ3A 4Y0TA 5A90A 1NXYA 4DE1A 4F94A 3V39A 5DF7A 5EVIA 3PBSA 4ID4A 1YLJA 2FFFB 2XD5A 2ZC7A 2Z2MB 2HDQA 1FQGA 4X55A 2X71A 3VP0A 2VGJA 4OKPA 1TEMA 4U0TA 1FCMA 3BFCA 4UA9A 5EUAA 3IF6B 1PW8A 4GN2A 5EOOA 5FQ9A 1IYQA 2EFUA 1YM1A 4WEKA 2G2UA 3Q7VB 4GD6A 4QY5A 2V20A 3ZCZA 3ZG9B 1TVFA 1W7FA 1NZUA 2XEPA 1ERQA 1KDWA 4C3QA 4WEJA 1YLYA 2XLNA 3IWIA 3V3RA 3N6IA 4R1GA 2ZQ7A 4QY6A 2JC7A 3HUOA 3EQVA 2A3UA 4S2OA 4JF5A 4JPMA 4WBGA 1IKGA 4RX2A 5F83A 4PM6A 1BLSA 4S2NC 3BRMA 2X01A 3UDXA 2EXAA 4R4RA 1H5XA 4JKTA 1JWVA 2WGVA 4X6TA 1K6RA 3NIAA 4BENA 4KZ7A 1J9MA 2EX2A 1M40A 3GRJA 3UY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QNB A;  4S2J A;  1CEF A;  2QMI A;  4U3T A;  5FSR A;  4E3L A;  1JTD A;  3UDF A;  1ES3 A;  1YLP A;  2J9O A;  2ZMA A;  2ZC5 B;  4OP5 A;  1BUE A;  5E2E A;  2ZQ9 A;  2PU2 A;  5EEC A;  1LLB A;  2H0Y A;  1KVL A;  3AGD A;  1BLH A;  4MBH A;  3VP2 A;  1Q2Q A;  4ZAM A;  3V3S A;  4C6Y A;  2Y2N A;  3E2K A;  1KGF A;  4M3K A;  4OOM A;  3V50 A;  3C7V A;  2Y2J A;  5TFQ A;  1BT5 A;  3HL9 A;  1CEG A;  2WZZ A;  4BJP A;  5GLD A;  4MLL A;  4KZ8 A;  3WRT A;  3FV7 A;  3HLB A;  3SH9 A;  5JYP A;  1YT4 A;  4OLD A;  4PM5 A;  3Q07 A;  4WYY A;  4KZ3 A;  1FOF A;  1K55 A;  4P0M A;  1HD8 A;  2EX9 A;  1U60 A;  4S2K A;  5FAQ A;  1ES5 A;  4KZ6 A;  2XK1 A;  1PZP A;  3E2L A;  4MNR A;  5FQI A;  3DW0 A;  1M6K A;  4HES A;  2WKH A;  1QMF A;  2Z2L B;  4R3J A;  1ESI A;  1TDG A;  2Y2L A;  4E3I A;  1BZA A;  1O07 A;  5KMW A;  3C7U A;  2WGI A;  3WS2 A;  1IEL A;  5CTN A;  1SDN A;  4KZ9 A;  1H8Z A;  3A3J A;  3ZHH A;  3O87 A;  4WEL A;  3ZVW A;  5FAO A;  3LCE A;  1S6R A;  4X69 A;  3NDE A;  2Y2O A;  5DTS A;  4RYE A;  4RX3 A;  4CJN A;  4XUX A;  3VMA A;  1GCE A;  5A91 A;  1NY0 A;  5AQA A;  4PM8 A;  1PI4 A;  1K4F A;  4KZB A;  3G30 A;  1KDS A;  1GHM A;  1XGI A;  2BG1 A;  2DRW A;  1KVM A;  1MWR A;  4CPK A;  1LHY A;  3LEZ A;  4Z9Q A;  3VFH A;  1PWD A;  3ZNT A;  1RCJ A;  3PAE A;  5D3O A;  5GLB A;  4KZ5 A;  5A92 A;  2DNS A;  2ZQD A;  2E8I A;  3SS4 A;  3UO9 A;  5GHX A;  2J8Y A;  3N7W A;  4PMA A;  5CGX A;  3IXG A;  4D2O A;  1NYM A;  3HRE A;  3GR2 A;  3MKE A;  3G31 A;  4MBF A;  5A93 A;  1ZG6 A;  2J9P A;  4IVK A;  3NDG A;  2RCX A;  3HLD A;  4R0Q A;  5EVL A;  5KZH A;  1MWU A;  3HLF A;  3OCN A;  1IYS A;  3ZNY A;  4DE0 A;  4KG2 A;  1LI9 A;  1MY8 A;  4B4X A;  5FAP A;  4BD0 A;  1JWP A;  3ZG5 A;  4KEN B;  3ZG8 B;  1MPL A;  3O3V A;  2JCH A;  4YIN A;  3S22 A;  2Y2M A;  3HUM A;  3C5A A;  2ZM8 A;  4NK3 A;  3IWQ A;  5TR7 A;  1MWS A;  4X68 A;  1MKI A;  1LI0 A;  2XR0 A;  5FAT A;  1K56 A;  3HBR A;  4UAA A;  4C75 A;  4O7D A;  3UNW A;  4E6X A;  3QHY A;  3N8S A;  3ITB A;  1HZO A;  3UE0 A;  2R9X A;  3UPO A;  1NRF A;  2H5S A;  2WAD A;  3C4O A;  3OPP A;  3DWZ A;  3IT9 A;  2OLU A;  1KGE A;  4LEN A;  5F1F A;  5KSC A;  5KSH A;  1DJB A;  2ZC6 B;  3FWL A;  5E2F A;  4HBT A;  4FCF A;  4S2I A;  1DJC A;  2WKE A;  3FKV A;  2DCF A;  3OPH A;  1YMX A;  2FFY A;  1AXB A;  3SOI A;  1PZO A;  1WYC A;  2P74 A;  3TOI A;  1CI8 A;  1ONH A;  3Q81 A;  5FQM A;  3GV9 A;  3Q1F A;  3MZE A;  3PBO A;  4PM9 A;  5E43 A;  5I94 A;  3HVF A;  4DDS A;  4OP8 A;  2PU4 A;  3IWO A;  5HX9 A;  1NZO A;  3UPN A;  5GHY A;  2Y2I A;  3NCK A;  5M1A A;  4DKI A;  3BLM A;  1BTL A;  4K0W A;  4MEZ A;  4WZ4 A;  2Y2G A;  3HLE A;  4S2P A;  1GHP A;  2EX8 A;  1JWZ A;  3IHB A;  3AGF A;  4QHC A;  5HW3 A;  3BEB A;  1KE0 A;  2WKI A;  2XD1 A;  1MXO A;  1W8Q A;  5CXW A;  5DTT A;  4BL3 A;  4QJG A;  4IBX A;  4JLF A;  1ONG A;  1EI5 A;  1YLT A;  5DF8 A;  4OPY A;  4E3K A;  3MZD A;  3W4O A;  2I72 A;  3BEC A;  4DXB A;  2JBF A;  4ZJ1 A;  1LL5 A;  3O88 A;  3RJU A;  1HVB A;  4UA7 A;  2EXB A;  3M2K A;  5HAP A;  3W4P A;  3LY4 A;  2ZM0 A;  3TSG A;  3IH9 A;  1OME A;  1MBL A;  4OPQ A;  5CHJ A;  4KQQ A;  3CZD A;  3BFG A;  5FQJ A;  4PPR A;  4JXS A;  1LL9 A;  1L0F A;  5FI2 A;  4EV4 A;  5FAS A;  5U47 A;  1IKI A;  2WZX A;  4WZ5 C;  4YFM A;  3VOY A;  5AQB A;  1SCW A;  3RXX A;  3VSK A;  1TDL A;  2G2W A;  2HDR A;  3HLC A;  3IQA A;  4R4S A;  5EPH A;  5FI6 A;  5FQK A;  3SS5 A;  4EBL A;  3A3E A;  4Y0O A;  3IHA A;  1Z6F A;  4LV1 A;  1RGZ A;  1I5Q A;  4OQ0 A;  4P87 A;  1FCN A;  2P9V A;  3BFF A;  4K91 A;  2P9V B;  2ZC3 B;  2Y2Q A;  5CTM A;  4DE3 A;  3HLW A;  2XFS A;  2H10 A;  3BFE A;  1XGJ A;  2ZM2 A;  4EBN A;  3IXD A;  1K54 C;  3GSG A;  1GA9 A;  1W5D A;  1Y54 A;  4XXR A;  4E3N A;  3UPP A;  1YLZ A;  3IXH A;  3P98 A;  4JXW A;  4S2L A;  5CGS A;  1I2W A;  5CRF A;  3ZVT A;  4Y0U A;  4HEF A;  4NET A;  3A3F A;  4S2N A;  1HTZ A;  2ZQ8 A;  3NC8 A;  4N92 A;  1L0G A;  1EWZ A;  1XXM A;  2EFX A;  2IWB A;  4EBP A;  4L0L A;  4OQH A;  4X53 A;  3BFD A;  1XPB A;  1NJ4 A;  4OQI A;  3WS1 A;  3W4Q A;  3C4P A;  5JYO A;  1E3U D;  4N1H A;  3B3X A;  3LO7 A;  1SHV A;  3OZH A;  4ZDX A;  3ZG0 A;  4DRT A;  4QB8 A;  2BLS A;  1BSG A;  1ES4 A;  4E6W A;  5J8X A;  3IH8 A;  2R9W A;  1XP4 A;  2VGK A;  4GDN A;  5GLA A;  3IF6 C;  4JF4 A;  1BUL A;  1DJA A;  1VQQ A;  1L2S A;  1MWT A;  5CEC A;  2WGW A;  1FR6 A;  2Q9N A;  2ZD8 A;  4HBU A;  1KE3 A;  4OOY A;  4DE2 A;  5L2F A;  2QPN A;  4OOL A;  2HP6 A;  4GDB A;  5IHV A;  3VSL A;  4BD1 A;  2UWX A;  4GD8 A;  4DF6 A;  3MXR A;  1JTG A;  4BQM A;  5M18 A;  3EQU A;  3PBN A;  1E4D A;  2Q9M A;  1FCO A;  1QME A;  3OPR A;  3Q7V A;  2Y2P A;  1PW1 A;  4RVA A;  4UHU A;  3WWX A;  1K38 A;  1PI5 A;  5GLC A;  1K25 A;  4S2M A;  4DXC A;  4EUZ A;  3IF6 A;  2C5W B;  5HAQ A;  2WUQ A;  4GOG A;  4LV0 A;  1KE4 A;  4WM9 A;  1ERO A;  4Q8I A;  3GMW A;  4RA7 A;  2EX6 A;  1G68 A;  2WAE A;  5AQ9 A;  5EVI B;  3DWK A;  4JF6 A;  4OVD A;  2HDU A;  4JXV A;  3MBZ A;  5EOE A;  3WS4 A;  5AQ7 A;  3RXW A;  1ERM A;  1XA7 A;  3BM6 A;  1FSY A;  2Y55 A;  4R23 A;  4BL2 A;  3NI9 A;  3O86 A;  5DF9 A;  1FSW A;  2WK0 A;  3CMZ A;  1BLP A;  4FSF A;  1XX2 A;  5CEB A;  3G34 A;  4ZBE A;  1E3U A;  4QD4 A;  4PM7 A;  4ZTK A;  5CER A;  3N8L A;  4R3B A;  4EQI A;  4A5R A;  5M19 A;  2CC1 A;  4KZA A;  5GHZ A;  3G2Y A;  3MFD A;  1CK3 A;  1I2S A;  4OON A;  3PBQ A;  5G18 A;  1FR1 A;  4P6B A;  3HLG A;  3ITA A;  2PBY A;  4P85 A;  4ZJ2 A;  1K56 D;  3CG5 A;  4LCL A;  2WYX A;  4GNU A;  4LV2 A;  1G6A A;  5E2G A;  2OV5 A;  3VP4 A;  3PTE A;  4QU3 A;  5CED A;  3OC2 A;  4MBK A;  2XGN A;  4GKU A;  1O7E A;  2ZQA A;  2Y2K A;  4N9K A;  3NY4 A;  1SKF A;  3OCL A;  4WMC A;  3UN7 A;  2GDN A;  2C6W B;  1XA1 A;  3GVB A;  3Q7Z A;  5EVI D;  3VFF A;  2B5R A;  4N1X A;  3N4I A;  3MKF A;  1K55 C;  5CHM A;  5FI7 A;  1N4O A;  1SDE A;  1ZG4 A;  3CJM A;  3WRZ A;  4EWF A;  3G35 A;  4DDY A;  1PWC A;  3DTM A;  3VOZ A;  4IED A;  1C3B A;  4JBF A;  5E2H A;  3OPL A;  5FA7 A;  2Y59 A;  5HAI A;  1YLW A;  1WYB A;  4H8R A;  4KQR A;  1YMS A;  4OPR A;  5DVA A;  2Y91 A;  1PIO A;  1YQS A;  4KQO A;  5FQQ A;  1JVJ A;  3A3D A;  1RGY A;  5HAR A;  1IEM A;  3MZF A;  2XH9 A;  3UE3 A;  2OLV A;  1KGG A;  1XKZ A;  3FZC A;  2HPB A;  3D4F A;  3A3I A;  2XF3 A;  3BLS A;  4Y7P A;  1PWG A;  2ZLY A;  3HUN A;  3N8R A;  4WZ5 A;  3W8K A;  3FKW A;  1RP5 A;  5GL9 A;  3UE1 A;  4E3M A;  3IXB A;  1S0W A;  3PBT A;  1K6S A;  2QZ6 A;  3GQZ A;  1ESU A;  3ZDJ A;  4B4Z A;  3ZGA B;  5CHU A;  1L0E A;  1W8Y A;  4OQG A;  1ES2 A;  3V5M A;  1PYY A;  1W79 A;  1IYO A;  1ZC2 A;  3AGE A;  3ISG A;  4UA6 A;  1Q2P A;  5F1G A;  2IWD A;  4KG5 A;  1K57 A;  4GB7 A;  4GZB A;  3VP3 A;  5HL1 A;  3MXS A;  4K0X A;  1K54 A;  2HDS A;  2J7V A;  3G4P A;  3IF5 A;  2ZC4 B;  4WMC D;  2WAF A;  4OPZ A;  1ALQ A;  4B88 A;  3M2J A;  3JYI A;  3G32 A;  1N9B A;  1K57 C;  1DY6 A;  3SS3 A;  3TG9 A;  2OSU A;  5CGW A;  2Y4A A;  4U0X A;  4JXG A;  5BOH A;  4LV3 A;  2A49 A;  1GA0 A;  1GHI A;  2IWC A;  2ZQC A;  4LCM A;  2XFT A;  1BLC A;  2X02 A;  2H0T A;  3SH7 A;  1CI9 A;  2ZJ9 A;  2XQZ A;  1K4E A;  5HFO A;  1L0D A;  4KG6 A;  4FH4 A;  2HP5 A;  5EE8 A;  3SH8 A;  1NYY A;  4IBR A;  4IVI A;  1H8Y A;  2V2F F;  3LY3 A;  4E3J A;  3NBL A;  3BYD A;  4FD8 A;  3WS0 A;  3M6B A;  3ZG7 B;  3M6H A;  3QNC A;  3G2Z A;  4N9L A;  5TGF A;  4KZ4 A;  3PAG A;  4OH0 A;  1WE4 A;  2V1Z A;  4XUZ A;  1IYP A;  5DTK A;  3PBR A;  3UDI A;  4E3O A;  3FYZ A;  1E25 A;  4X56 A;  2XDM A;  3ZFZ A;  2WGW B;  5EVI C;  3Q82 A;  1ZKJ A;  5F82 A;  3WS5 A;  5FDH A;  3GTC A;  2JE5 A;  4OLG A;  2HP9 A;  3I7J A;  2Y2H A;  3P09 A;  4FH2 A;  3S1Y A;  3S4X A;  4BLM A;  1VM1 A;  3VP1 A;  2RL3 A;  4ZJ3 A;  4Y0T A;  5A90 A;  1NXY A;  4DE1 A;  4F94 A;  3V39 A;  5DF7 A;  5EVI A;  3PBS A;  4ID4 A;  1YLJ A;  2FFF B;  2XD5 A;  2ZC7 A;  2Z2M B;  2HDQ A;  1FQG A;  4X55 A;  2X71 A;  3VP0 A;  2VGJ A;  4OKP A;  1TEM A;  4U0T A;  1FCM A;  3BFC A;  4UA9 A;  5EUA A;  3IF6 B;  1PW8 A;  4GN2 A;  5EOO A;  5FQ9 A;  1IYQ A;  2EFU A;  1YM1 A;  4WEK A;  2G2U A;  3Q7V B;  4GD6 A;  4QY5 A;  2V20 A;  3ZCZ A;  3ZG9 B;  1TVF A;  1W7F A;  1NZU A;  2XEP A;  1ERQ A;  1KDW A;  4C3Q A;  4WEJ A;  1YLY A;  2XLN A;  3IWI A;  3V3R A;  3N6I A;  4R1G A;  2ZQ7 A;  4QY6 A;  2JC7 A;  3HUO A;  3EQV A;  2A3U A;  4S2O A;  4JF5 A;  4JPM A;  4WBG A;  1IKG A;  4RX2 A;  5F83 A;  4PM6 A;  1BLS A;  4S2N C;  3BRM A;  2X01 A;  3UDX A;  2EXA A;  4R4R A;  1H5X A;  4JKT A;  1JWV A;  2WGV A;  4X6T A;  1K6R A;  3NIA A;  4BEN A;  4KZ7 A;  1J9M A;  2EX2 A;  1M40 A;  3GRJ A;  3UY6 A; 
#chains in the Genus database with same CATH topology
 4S2J A;  5FSR A;  2PHY A;  1ES3 A;  1YLP A;  2ZMA A;  5G4Y A;  3ULF A;  2HZ5 A;  2H0Y A;  3AGD A;  1BLH A;  3LIA A;  4II7 A;  4Q0I A;  2Y2J A;  1BT5 A;  1CJF A;  3VV4 A;  1CEG A;  2WZZ A;  4HP4 A;  4BJP A;  3FV7 A;  3SH9 A;  5JYP A;  1YT4 A;  1OJG A;  4HJ4 A;  4IJG A;  2EX9 A;  1T1B A;  5FAQ A;  3MF0 A;  4KZ6 A;  5FQI A;  2L1M A;  4HES A;  3LYX A;  3WS2 A;  1IEL A;  4Y5F A;  5CTN A;  1BYW A;  2M1C A;  1H8Z A;  4WEL A;  1S6R A;  2Y2O A;  2H28 A;  2PDR A;  2ZOI A;  3UMD A;  5DFY A;  3G30 A;  1Y4O A;  1GHM A;  4CLC A;  2DRW A;  2FH5 A;  1KVM A;  3TW8 A;  1LHY A;  3VFH A;  3UE6 A;  3MXQ A;  3OLO A;  3PAE A;  1H8M A;  3H82 A;  2ZQD A;  2E8I A;  2B18 A;  4PMA A;  1XJ2 A;  4HI4 A;  3HJI A;  4JGQ A;  4FOF A;  4IVK A;  3NDG A;  1LT0 A;  5KZH A;  5EVE A;  4KG2 A;  1LI9 A;  4B4X A;  4I39 A;  5FAP A;  3QP5 A;  1CQA A;  4KUK A;  1J3W A;  2Y2M A;  3UB5 P;  3IWQ A;  3IX4 A;  2L4R A;  1K56 A;  3HBR A;  4UAA A;  4E6X A;  3N8S A;  3SZT A;  3C4O A;  2GZA A;  1FIL A;  1GSV A;  2BAS A;  1UWN X;  2DCF A;  3S7N A;  2W3G A;  3Q1F A;  5DFX A;  3MZE A;  5E43 A;  3IWO A;  5GHY A;  3FPW A;  3BLM A;  4MEZ A;  2HJE A;  3HLE A;  5IU1 A;  2EX8 A;  4PKY A;  3BEB A;  4BL3 A;  1MXO A;  5DTT A;  5K5B A;  1ONG A;  1YLT A;  3MZD A;  4DXB A;  4NXE A;  3T12 B;  4HJ3 A;  5DKK A;  2PBD P;  5TJJ A;  3W4P A;  4I3A A;  1OME A;  4OPQ A;  4KQQ A;  1L0F A;  1TD5 A;  3VOY A;  2K2N A;  4E04 A;  3LIE A;  5EPH A;  3D9Y A;  4Y0O A;  4ARZ B;  4OQ0 A;  4I3J A;  4G3W A;  5CTM A;  4DE3 A;  5AJG A;  3MS6 A;  2OAP 1;  3B47 A;  3P98 A;  5FL3 A;  3ZVT A;  4NET A;  3A3F A;  2A24 B;  3EGD C;  1ACF A;  4EBP A;  1L0G A;  1YKD A;  2QJ5 A;  3QP4 A;  4OQH A;  2VK3 A;  1XPB A;  5JYO A;  3ZYT A;  4ZDX A;  4QB8 A;  1BSG A;  1ES4 A;  3IH8 A;  3BWL A;  3IF6 C;  1BUL A;  1MWT A;  5CEC A;  4HBU A;  1KE3 A;  4BD1 A;  3A0S A;  3MXR A;  1JTG A;  4BQM A;  3DTE A;  3EQU A;  5HWW A;  2QHK A;  4X25 A;  2Q9M A;  1JNU A;  3Q7V A;  1PI5 A;  1K25 A;  2EWW A;  4EUZ A;  4DXC A;  3IF6 A;  4G3V A;  2CMN A;  1ERO A;  4JGO A;  4RA7 A;  3BQ8 A;  1OT9 A;  4JGP A;  1OTB A;  2HDU A;  3WS4 A;  3BM6 A;  1FSY A;  2Y55 A;  4BL2 A;  3NI9 A;  1N9O A;  5DF9 A;  1FSW A;  2WK0 A;  3CMZ A;  2PYP A;  1BLP A;  3MR0 A;  3CWF A;  4PM7 A;  4EW7 A;  3E4P A;  4EQI A;  2CC1 A;  3MFD A;  3K2N A;  4OON A;  3LIF A;  3E98 A;  3ITA A;  3C30 A;  4LCL A;  2MJ6 A;  5E2G A;  2YKH A;  3OC2 A;  2XGN A;  3NY4 A;  4WMC A;  3UN7 A;  3Q7Z A;  1XFN A;  4N1X A;  3N4I A;  3U4L P;  4H6J B;  3G35 A;  4DDY A;  2AVX A;  3T4K A;  5E2H A;  4KQR A;  4OPR A;  3MZF A;  5FEG A;  2OLV A;  3RH8 B;  2HPB A;  3N8R A;  4WZ5 A;  5CX7 A;  5GL9 A;  1RP5 A;  2VV6 A;  3UE1 A;  1VEU B;  1ESU A;  3H9W A;  1L0E A;  1ES2 A;  1ZC2 A;  1IYO A;  2VGL S;  4KG5 A;  3V67 A;  3K3D A;  4GB7 A;  3VP3 A;  5HL1 A;  3MXS A;  4K0X A;  1K54 A;  5HPF A;  4WMC D;  3M2J A;  3JYI A;  2OSU A;  5BOH A;  2IWC A;  1VHM A;  4RQ9 A;  1A0K A;  3DBA A;  4MCW A;  3CPT B;  2HP5 A;  5EE8 A;  4E3J A;  2W0N A;  2YKF A;  5HDC A;  3ZG7 B;  3QNC A;  3C2W A;  3G2Z A;  2E8J A;  4KZ4 A;  4OH0 A;  4X56 A;  2WGW B;  1IOU A;  2PAV P;  5FDH A;  3GTC A;  2JE5 A;  4OLG A;  3P09 A;  5LBR A;  3V39 A;  3MFX A;  2ZC7 A;  2NUP C;  2X71 A;  3VP0 A;  5L8M A;  1FCM A;  4UA9 A;  5EUA A;  4EEU A;  4GN2 A;  1XJ6 A;  4MDZ A;  3E0Y A;  4GD6 A;  3CI6 A;  1TVF A;  1W7F A;  1ERQ A;  2XLN A;  3MQQ A;  2A3U A;  4JF5 A;  3JPU A;  4PM6 A;  3F1P A;  4ARZ A;  2EXA A;  1JWV A;  4X6T A;  1K6R A;  1ODV A;  3NIA A;  4BEN A;  2EX2 A;  4HH2 A;  3GRJ A;  3UY6 A;  3QNB A;  1TF1 A;  3UDF A;  4OP5 A;  3W2Z A;  1BUE A;  2PYR A;  2PU2 A;  5EEC A;  2A24 A;  3ZQ5 A;  4OOM A;  4M3K A;  3V50 A;  2W3D A;  5GLD A;  4KZ8 A;  3WRT A;  3HLB A;  3NHQ A;  1DP9 A;  4OLD A;  4PM5 A;  3Q07 A;  4KZ3 A;  1K55 A;  1U60 A;  1PZP A;  3E2L A;  3P7N A;  3TRC A;  1ESI A;  4R6L A;  3C7U A;  4IUK A;  2WGI A;  2PD8 A;  5I5L A;  1SDN A;  3T50 A;  1CF0 A;  2LB9 A;  5DKL A;  2V8F A;  5C5K A;  4X69 A;  4I5S A;  5DTS A;  3KYZ A;  4ETZ A;  3R4K A;  3G6O A;  2W1T B;  4KZB A;  1XGI A;  4BMW A;  5IS1 A;  2BG1 A;  4Z9Q A;  1RCJ A;  5A92 A;  2PR5 A;  3N7W A;  5CGX A;  4D2O A;  1NYM A;  5A93 A;  4MBF A;  5HD3 A;  1ZG6 A;  2VGL M;  2RCX A;  4L9F A;  4WL9 A;  3MQ0 A;  1MWU A;  2HGV A;  1MY8 A;  4KEN B;  3NOP C;  3O3V A;  5HL6 A;  1MC0 A;  1YAX A;  3C5A A;  5TR7 A;  1MWS A;  1MKI A;  2QYB A;  4K08 A;  3ITB A;  1HZO A;  3UPO A;  1NRF A;  2WAD A;  3OPP A;  2OLU A;  1KGE A;  1T1A A;  5F1F A;  5KSH A;  1H0M A;  4HQA A;  2JKR I;  4HBT A;  1TS6 A;  4S2I A;  1DJC A;  2WKE A;  1T19 A;  2FFY A;  3MJQ A;  1PZO A;  1WYC A;  2P74 A;  2P08 A;  1CI8 A;  1ONH A;  5FQM A;  3GV9 A;  1S66 L;  4OP8 A;  1NLY A;  5HX9 A;  4DN0 A;  3NCK A;  4LGW A;  3RFB A;  2Y2G A;  4S2P A;  1GHP A;  1JWZ A;  3IHB A;  4GS9 B;  5HW3 A;  4XT2 B;  4JLF A;  4LFU A;  4E3K A;  3W4O A;  4ZJ1 A;  3O88 A;  4P6Z S;  4WUJ A;  2EXB A;  3M2K A;  5HAP A;  3NOU C;  1MBL A;  1NRJ A;  3CZD A;  3BFG A;  1EW0 A;  4JXS A;  4EV4 A;  5U47 A;  1IKI A;  1XJ3 A;  2O0Y A;  2XRO A;  3JVU A;  4EBL A;  3BY9 A;  1OTD A;  4P87 A;  1FCN A;  3BFF A;  2K31 A;  4K91 A;  2P9V B;  2VLG A;  2H10 A;  1XGJ A;  4MN6 A;  1W5D A;  4XXR A;  4S2L A;  1NWZ A;  4D60 A;  3NC8 A;  2VV7 A;  1EWZ A;  2IWB A;  4HH3 A;  4L0L A;  1S1Z A;  4X53 A;  3BFD A;  4OQI A;  1NJ4 A;  5DJU A;  3C4P A;  1E3U D;  3B3X A;  3OOV A;  1SHV A;  1TS0 A;  5J8X A;  3LEQ A;  4E6W A;  4GDN A;  1L2S A;  3GDI A;  3CHW P;  3DTI A;  4DE2 A;  5L2F A;  2QJ7 A;  3P01 A;  4OOL A;  4GDB A;  2UWX A;  5M18 A;  3PBN A;  1FCO A;  4BWI A;  4Y13 A;  1YSQ A;  2BTF P;  3CPT A;  4S2M A;  4LV0 A;  3HCY A;  1DP8 A;  2EX6 A;  1G68 A;  5EVI B;  3DWK A;  3B33 A;  4LLO B;  4I3I A;  3EEH A;  3MBZ A;  5AQ7 A;  3CLO A;  4GS9 A;  3IS2 A;  1P97 A;  4R23 A;  1E3U A;  4FTX A;  4R3B A;  3G2Y A;  1I2S A;  4P6B A;  4ZJ2 A;  2VJW A;  1K56 D;  4GHI B;  2JKT I;  4R70 A;  4QU3 A;  2M7U A;  5CED A;  2QKP A;  4MBK A;  4N9K A;  1SKF A;  2C6W B;  1XA1 A;  3GVB A;  2NUT C;  3T4S A;  2B5R A;  3MSH A;  4B93 A;  3MKF A;  4L9G A;  4O01 A;  5FI7 A;  5F68 A;  1VET A;  1L3L A;  4EWF A;  3DTM A;  2M7V A;  4EXO A;  1C3B A;  3OPL A;  3F1N A;  5HAI A;  5J4E A;  3HJK A;  3KYQ A;  2XSS A;  3PHY A;  4KQO A;  1JVJ A;  1RGY A;  1F98 A;  3T1R A;  1KGG A;  2XF3 A;  1MZU A;  3W8K A;  1GSW A;  1F2K A;  1S0W A;  3DTK A;  2R78 A;  3GQZ A;  3ZDJ A;  1G6O A;  5F5Y A;  3BW6 A;  4IHQ A;  3IS2 B;  1Q2P A;  2V1A A;  2HDS A;  3IF5 A;  2ZC4 B;  4OPZ A;  1ALQ A;  4B88 A;  3KO6 A;  1N9B A;  3L9K A;  4LV3 A;  2A49 A;  4GHI A;  2XFT A;  3OBF A;  2X02 A;  2H0T A;  4HOI A;  1CI9 A;  2XQZ A;  4KG6 A;  3SH8 A;  2ACG A;  4FD8 A;  4KUO A;  5TGF A;  3SOI A;  2V1Z A;  2O9C A;  1IYP A;  3FYZ A;  2XDM A;  5EVI C;  3Q82 A;  1ZKJ A;  5F82 A;  3NEC A;  3WS5 A;  2JN7 A;  2LB5 A;  2Y2H A;  4ZJ3 A;  5A8B A;  3CUE A;  3QP6 A;  3LR3 A;  4ESP A;  2K7S A;  1UWP X;  1TEM A;  4U0T A;  1P9W A;  4P6Z M;  3IF6 B;  5EOO A;  3A0V A;  3ZCZ A;  4ZRR A;  4C3Q A;  3IWI A;  2HF6 A;  2GX5 A;  3A0R A;  4JPM A;  4WBG A;  4RX2 A;  3F1O B;  4S2N C;  4I38 A;  3UDX A;  1H5X A;  1WA9 A;  4ETX A;  5MC7 A;  1UGU A;  2ZMV A;  1CEF A;  4U3T A;  2ZC5 B;  5E2E A;  2ZQ9 A;  1LLB A;  1KVL A;  4MBH A;  3U2A A;  1Q2Q A;  4ZAM A;  4C6Y A;  3E2K A;  3H7W B;  3C7V A;  1F9I A;  4MLL A;  4KQD A;  4WYY A;  1FOF A;  3DW0 A;  1M6K A;  2WKH A;  4R3J A;  1TDG A;  4E3I A;  2Y2L A;  3BY8 A;  1BZA A;  1O07 A;  4Y17 A;  5KMW A;  3PYP A;  4KZ9 A;  3A3J A;  4EU0 A;  2P04 A;  3O87 A;  3C8C A;  4WF0 A;  2WKR A;  3CIT A;  1S67 L;  4EER A;  4CJN A;  3VMA A;  1GCE A;  2D02 A;  5A91 A;  3UB8 A;  1OT6 A;  1K4F A;  4BBT A;  1SKO B;  2JKT M;  3LEZ A;  4LPZ A;  2V0U A;  5GLB A;  2DNS A;  5HDS A;  2OWJ A;  3SS4 A;  1OPX A;  1X0O A;  3HRE A;  3GR2 A;  3MKE A;  3G31 A;  4B9O A;  3KSI A;  4HP9 A;  2G7U A;  5EVL A;  4R0Q A;  4M4X A;  3OCN A;  1IYS A;  4DE0 A;  3LI8 A;  4BBV A;  4YWZ A;  4BD0 A;  3ZG5 A;  5KIZ A;  2VEA A;  4QWO A;  3ZG8 B;  1OTI A;  2ZM8 A;  4NK3 A;  4DMZ A;  4X68 A;  1LI0 A;  2HJ9 C;  5FAT A;  4O7D A;  3UNW A;  1SKO A;  4EUV A;  2H5S A;  3ICY A;  4FUW A;  1S4R A;  2ZBB A;  4LEN A;  1DRM A;  1OTA A;  2KOI A;  3CUE C;  3FWL A;  5E2F A;  3EWK A;  4GJ4 A;  1YMX A;  4EQ1 A;  3LR0 A;  3TOI A;  2WKQ A;  3TJZ C;  4DJ3 A;  3HVF A;  4O0P A;  3EEA A;  2FZ0 A;  3FPV A;  2Y2I A;  5M1A A;  5G4Z A;  4O8G A;  5EV0 A;  4YOF A;  3KSF A;  3JVV A;  1ZTU A;  3AGF A;  4QHC A;  4LRX C;  1KE0 A;  2WKI A;  1W8Q A;  4IBX A;  1OTE A;  4HY8 A;  4OPY A;  4HIA A;  3QP2 A;  3BEC A;  3B42 A;  1HVB A;  2JKR M;  4UA7 A;  3LGO A;  2ZM0 A;  3TSG A;  4PPR A;  1P9R A;  1LL9 A;  5FAS A;  4WZ5 C;  2WZX A;  5AQB A;  2ZMF A;  3RXX A;  3VSK A;  1TDL A;  2HDR A;  5FQK A;  5FI6 A;  3BQA A;  3IHA A;  1RGZ A;  3F1O A;  2P9V A;  3D3O A;  2Y2Q A;  2L0W A;  5IT5 A;  2W1R A;  4EBN A;  1K54 C;  1GA9 A;  5J3W A;  3UPP A;  1YLZ A;  3IXH A;  4JXW A;  1I2W A;  5CRF A;  3H7W A;  4UQI M;  4S2N A;  1HTZ A;  3LR5 A;  4R3A A;  4N92 A;  4BBU A;  4L9E A;  4N1H A;  3OZH A;  4NG2 A;  3EOI A;  2BLS A;  2R9W A;  4QPR A;  2VGK A;  5GLA A;  4JF4 A;  4XT2 A;  1S1Y A;  1VQQ A;  3F1P B;  1NLZ A;  2W3H A;  3UB6 A;  4GD8 A;  1E4D A;  1T1C A;  3OPR A;  4EES A;  3WWX A;  2EA9 A;  1PFL A;  5HAQ A;  2WUQ A;  4WM9 A;  1XFQ A;  3GMW A;  4WN5 A;  4NXG A;  2V9A A;  4JXV A;  2DMW A;  2OAQ 1;  5HWT A;  4EET B;  1ERM A;  1XA7 A;  3O86 A;  4FSF A;  4ZBE A;  3FG8 A;  4ZTK A;  3N8L A;  4A5R A;  5M19 A;  1G28 A;  4KZA A;  5EM1 A;  1CK3 A;  1FR1 A;  4YNR A;  3CG5 A;  2J80 A;  3PTE A;  3DAV A;  1N9N A;  3UB9 A;  3QP8 A;  2JHE A;  4EEP A;  2Z6C A;  3LIC A;  2ZQA A;  2GDN A;  3VFF A;  3F1N B;  3S7Q A;  1K55 C;  4GLQ A;  3EGX C;  1SDE A;  1ZG4 A;  3CJM A;  3WRZ A;  1TS8 A;  1YLW A;  1WYB A;  1TS7 A;  2W27 A;  5DVA A;  2Y91 A;  1PIO A;  1YQS A;  3A3D A;  4CLC D;  3LIB A;  3UE3 A;  3T1Q B;  3FZC A;  3A3I A;  3BLS A;  2ZLY A;  3HUN A;  3NJA A;  1LL8 A;  4E3M A;  1Y28 A;  4B4Z A;  2PRF A;  5CHU A;  2D01 A;  4OQG A;  1PYY A;  3ISG A;  4UA6 A;  5F1G A;  2Y8H A;  4PAU A;  1S4S A;  4DJ2 A;  4Z1W A;  4G3K A;  1K57 C;  3SS3 A;  5CGW A;  2Y4A A;  4JXG A;  3E4O A;  3SH7 A;  5HFO A;  3T1S A;  4FH4 A;  1NYY A;  4IBR A;  2JKG A;  4IVI A;  3LY3 A;  3BYD A;  3WS0 A;  3M6H A;  2GNX A;  4N9L A;  2V8C A;  3UDI A;  2I9V A;  3PAG A;  1WE4 A;  3UPN A;  5HPI A;  5DTK A;  3PBR A;  1E25 A;  3ZFZ A;  5EFW A;  3S4X A;  3I7J A;  3S1Y A;  4BLM A;  1VM1 A;  3VP1 A;  4Y0T A;  4F3L B;  1NXY A;  4DE1 A;  4F94 A;  4Y2F A;  5EVI A;  4ID4 A;  1YLJ A;  2HDQ A;  1H3Q A;  1STZ A;  1Z09 A;  2VGJ A;  3BFC A;  3VE4 A;  1PW8 A;  2Z6D A;  1IYQ A;  2EFU A;  2G2U A;  1VB6 A;  3T4T A;  1ZHH B;  4QY5 A;  2O9B A;  1NZU A;  4WEJ A;  3D72 A;  3N6I A;  4R1G A;  2ZQ7 A;  4QY6 A;  4UQI S;  2JC7 A;  4S2O A;  1IKG A;  1KOU A;  1BLS A;  2X01 A;  3LI9 A;  4R4R A;  2WGV A;  1J9M A;  3PR6 A;  5L07 A;  2QMI A;  4E3L A;  1JTD A;  2J9O A;  3RTY A;  3GEC A;  3MQO A;  3VP2 A;  3V3S A;  2Y2N A;  1KGF A;  5TFQ A;  3HL9 A;  3IX8 A;  3KSH A;  2B95 A;  3L7H A;  4P0M A;  1HD8 A;  4S2K A;  1ES5 A;  2JKF A;  1FIK A;  2XK1 A;  4MNR A;  4X1L A;  2Z2L B;  1QMF A;  1HLU P;  4NXF A;  2Q0O A;  5HSQ A;  3ZHH A;  3ZVW A;  2GJ3 A;  2J3T C;  5FAO A;  3LCE A;  2KX6 A;  2KDK A;  4R38 A;  3NDE A;  2VX8 A;  4RYE A;  1LSW A;  4RX3 A;  4XUX A;  2VKS A;  4Y3I A;  1NY0 A;  5AQA A;  4PM8 A;  1PI4 A;  4GW9 A;  5AVE A;  2VV8 A;  1KDS A;  2VZW A;  4H6J A;  1MWR A;  4CPK A;  4CLC E;  1PWD A;  3ZNT A;  5D3O A;  4GCZ A;  2XA7 M;  4KZ5 A;  1G5U A;  4CLC C;  3QP1 A;  3UO9 A;  1VEU A;  5GHX A;  2J8Y A;  3IXG A;  2J9P A;  2ZOH A;  3HLD A;  5TBM B;  3HLF A;  3ZNY A;  2J3T D;  3S7O A;  1JWP A;  3KSG A;  1MPL A;  1LSV A;  2JCH A;  4YIN A;  3S22 A;  3HUM A;  3H82 B;  2XR0 A;  3LUQ A;  1P0Z A;  4C75 A;  1N9L A;  3QHY A;  4WLA A;  3UE0 A;  2R9X A;  1F5M A;  3T4L A;  4Q0H A;  3DWZ A;  3T4Q A;  3IT9 A;  5KSC A;  1DJB A;  2ZC6 B;  4FCF A;  3FKV A;  3OPH A;  1AXB A;  2WKP A;  3Q81 A;  3S7P A;  2V1B A;  3PBO A;  4PM9 A;  5I94 A;  1SZV A;  5AVF A;  4DDS A;  1D7E A;  4IUH A;  4MN5 A;  4X1M A;  1YPR A;  2PU4 A;  3VE3 A;  1NZO A;  1XJ4 A;  1W63 M;  4DKI A;  5FEF A;  5HWV A;  1BTL A;  4K0W A;  4WZ4 A;  3T4O A;  2ZL1 A;  2A2L A;  3LFV A;  2QWS A;  5CXW A;  2XD1 A;  4CLC B;  4JGR A;  2EWV A;  4QJG A;  2B02 A;  1EI5 A;  5DF8 A;  2I72 A;  2JBF A;  4HJ6 A;  4LRY C;  1LL5 A;  3RJU A;  1W63 Q;  3LY4 A;  3IH9 A;  5CHJ A;  5FQJ A;  5FI2 A;  4YFM A;  1SCW A;  2G2W A;  3HLC A;  3IQA A;  4R4S A;  5FDS A;  3SS5 A;  3A3E A;  2PR6 A;  1Z6F A;  4LV1 A;  1AWI A;  1I5Q A;  2VA0 A;  3K3C A;  2ZC3 B;  3HLW A;  2XFS A;  2OOL A;  3BFE A;  2ZM2 A;  4CQH A;  3IXD A;  3GSG A;  4E3N A;  1Y54 A;  5CGS A;  2V0W A;  3BJN A;  4Y0U A;  4HEF A;  2ZQ8 A;  1XXM A;  2EFX A;  1DP6 A;  5DJT A;  2HV1 A;  5HZH A;  1LSX A;  3WS1 A;  3W4Q A;  3LO7 A;  5HDD A;  3ZG0 A;  4F3L A;  4DRT A;  1XP4 A;  3UME A;  1D1J A;  1DJA A;  2WGW A;  1FR6 A;  2Q9N A;  2ZD8 A;  2ZL1 B;  4OOY A;  3NUL A;  3IBR A;  2QPN A;  5IHV A;  2HP6 A;  3VSL A;  4DF6 A;  2Y79 A;  3IBJ A;  1QME A;  2INW A;  1PW1 A;  2Y2P A;  4RVA A;  4UHU A;  3KYE A;  1K38 A;  5GLC A;  2C5W B;  3KX0 X;  3SW1 A;  4GOG A;  2O9A A;  1KE4 A;  4Q8I A;  4MN7 A;  2J3W A;  1YSP A;  3LID A;  2WAE A;  4NXB A;  2PT7 A;  5AQ9 A;  4JF6 A;  2KLI A;  4OVD A;  1GSX A;  5EOE A;  3RXW A;  1MKM A;  3NOT C;  1XX2 A;  5CEB A;  3G34 A;  5F69 A;  4ME4 A;  4LRZ E;  4QD4 A;  5CER A;  3O5Y A;  5GHZ A;  3PBQ A;  3T1X A;  5G18 A;  5TBM A;  5F6A A;  3HLG A;  3R7W A;  1PNE A;  2PBY A;  4P85 A;  2WYX A;  4GNU A;  4LV2 A;  1G6A A;  1V9Y A;  5L09 A;  2OV5 A;  3MMH A;  3VP4 A;  1IFQ A;  4GKU A;  1O7E A;  2XA7 S;  2Y2K A;  3OCL A;  1OJ5 A;  5EVI D;  3LR4 A;  3IX3 A;  3UB7 A;  5CHM A;  1N4O A;  1VET B;  2O99 A;  1PWC A;  3VOZ A;  4IED A;  4JBF A;  2W1T A;  3T4J A;  5FA7 A;  2Y59 A;  4H8R A;  5L10 A;  4NEE D;  1YMS A;  5FQQ A;  5HAR A;  1IEM A;  2XRN A;  2XH9 A;  1XKZ A;  3R7W B;  2IA2 A;  3D4F A;  2OWH A;  4Y7P A;  1PWG A;  1K0K A;  2UV0 E;  3C38 A;  3FKW A;  3IXB A;  3PBT A;  1K6S A;  2QZ6 A;  3ZGA B;  1W8Y A;  3V5M A;  5J7E A;  3TE8 A;  4MMN A;  1W79 A;  3AGE A;  2W3F A;  2IWD A;  1K57 A;  3PXP A;  4GZB A;  2P7J A;  2J7V A;  4Q0J A;  3G4P A;  1T18 A;  2WAF A;  3G32 A;  1DY6 A;  3TG9 A;  4AFI A;  3E4Q A;  4U0X A;  4UEY A;  1GA0 A;  1GHI A;  2ZQC A;  4LCM A;  3CAX A;  1BLC A;  2ZJ9 A;  1K4E A;  1L0D A;  1H8Y A;  2V2F F;  2W3E A;  3NBL A;  3M6B A;  4XUZ A;  4E3O A;  4HNB A;  4PHT A;  3VOL A;  2HP9 A;  4FH2 A;  3FC7 A;  2RL3 A;  5EM0 A;  5A90 A;  5DF7 A;  3PBS A;  4HHD A;  2FFF B;  2XD5 A;  2Z2M B;  1FQG A;  4X55 A;  4OKP A;  5FQ9 A;  4Y15 A;  1YM1 A;  4WEK A;  3Q7V B;  2V20 A;  3ZG9 B;  4PKY G;  2PD7 A;  2XEP A;  1KDW A;  4NKP A;  3V3R A;  1YLY A;  5HD5 A;  1V9Z A;  3HUO A;  3EQV A;  5F83 A;  1D06 A;  3BRM A;  4JKT A;  4KZ7 A;  1PRQ A;  1M40 A; 
#chains in the Genus database with same CATH homology
 3QNB A;  4S2J A;  1CEF A;  2QMI A;  4U3T A;  5FSR A;  4E3L A;  1JTD A;  3UDF A;  1ES3 A;  1YLP A;  2J9O A;  2ZMA A;  2ZC5 B;  4OP5 A;  1BUE A;  5E2E A;  2ZQ9 A;  2PU2 A;  5EEC A;  1LLB A;  2H0Y A;  1KVL A;  3AGD A;  1BLH A;  4MBH A;  3VP2 A;  1Q2Q A;  4ZAM A;  3V3S A;  4C6Y A;  2Y2N A;  3E2K A;  1KGF A;  4M3K A;  4OOM A;  3V50 A;  3C7V A;  2Y2J A;  5TFQ A;  1BT5 A;  3HL9 A;  1CEG A;  2WZZ A;  4BJP A;  5GLD A;  4MLL A;  4KZ8 A;  3WRT A;  3FV7 A;  3HLB A;  3SH9 A;  5JYP A;  1YT4 A;  4OLD A;  4PM5 A;  3Q07 A;  4WYY A;  4KZ3 A;  1FOF A;  1K55 A;  4P0M A;  1HD8 A;  2EX9 A;  1U60 A;  4S2K A;  5FAQ A;  1ES5 A;  4KZ6 A;  2XK1 A;  1PZP A;  3E2L A;  4MNR A;  5FQI A;  3DW0 A;  1M6K A;  4HES A;  2WKH A;  1QMF A;  2Z2L B;  4R3J A;  1ESI A;  1TDG A;  2Y2L A;  4E3I A;  1BZA A;  1O07 A;  5KMW A;  3C7U A;  2WGI A;  3WS2 A;  1IEL A;  5CTN A;  1SDN A;  4KZ9 A;  1H8Z A;  3A3J A;  3ZHH A;  3O87 A;  4WEL A;  3ZVW A;  5FAO A;  3LCE A;  1S6R A;  4X69 A;  3NDE A;  2Y2O A;  5DTS A;  4RYE A;  4RX3 A;  4CJN A;  4XUX A;  3VMA A;  1GCE A;  5A91 A;  1NY0 A;  5AQA A;  4PM8 A;  1PI4 A;  1K4F A;  4KZB A;  3G30 A;  1KDS A;  1GHM A;  1XGI A;  2BG1 A;  2DRW A;  1KVM A;  1MWR A;  4CPK A;  1LHY A;  3LEZ A;  4Z9Q A;  3VFH A;  1PWD A;  3ZNT A;  1RCJ A;  3PAE A;  5D3O A;  5GLB A;  4KZ5 A;  5A92 A;  2DNS A;  2ZQD A;  2E8I A;  3SS4 A;  3UO9 A;  5GHX A;  2J8Y A;  3N7W A;  4PMA A;  5CGX A;  3IXG A;  4D2O A;  1NYM A;  3HRE A;  3GR2 A;  3MKE A;  3G31 A;  4MBF A;  5A93 A;  1ZG6 A;  2J9P A;  4IVK A;  3NDG A;  2RCX A;  3HLD A;  4R0Q A;  5EVL A;  5KZH A;  1MWU A;  3HLF A;  3OCN A;  1IYS A;  3ZNY A;  4DE0 A;  4KG2 A;  1LI9 A;  1MY8 A;  4B4X A;  5FAP A;  4BD0 A;  1JWP A;  3ZG5 A;  4KEN B;  3ZG8 B;  1MPL A;  3O3V A;  2JCH A;  4YIN A;  3S22 A;  2Y2M A;  3HUM A;  3C5A A;  2ZM8 A;  4NK3 A;  3IWQ A;  5TR7 A;  1MWS A;  4X68 A;  1MKI A;  1LI0 A;  2XR0 A;  5FAT A;  1K56 A;  3HBR A;  4UAA A;  4C75 A;  4O7D A;  3UNW A;  4E6X A;  3QHY A;  3N8S A;  3ITB A;  1HZO A;  3UE0 A;  2R9X A;  3UPO A;  1NRF A;  2H5S A;  2WAD A;  3C4O A;  3OPP A;  3DWZ A;  3IT9 A;  2OLU A;  1KGE A;  4LEN A;  5F1F A;  5KSC A;  5KSH A;  1DJB A;  2ZC6 B;  3FWL A;  5E2F A;  4HBT A;  4FCF A;  4S2I A;  1DJC A;  2WKE A;  3FKV A;  2DCF A;  3OPH A;  1YMX A;  2FFY A;  1AXB A;  3SOI A;  1PZO A;  1WYC A;  2P74 A;  3TOI A;  1CI8 A;  1ONH A;  3Q81 A;  5FQM A;  3GV9 A;  3Q1F A;  3MZE A;  3PBO A;  4PM9 A;  5E43 A;  5I94 A;  3HVF A;  4DDS A;  4OP8 A;  2PU4 A;  3IWO A;  5HX9 A;  1NZO A;  3UPN A;  5GHY A;  2Y2I A;  3NCK A;  5M1A A;  4DKI A;  3BLM A;  1BTL A;  4K0W A;  4MEZ A;  4WZ4 A;  2Y2G A;  3HLE A;  4S2P A;  1GHP A;  2EX8 A;  1JWZ A;  3IHB A;  3AGF A;  4QHC A;  5HW3 A;  3BEB A;  1KE0 A;  2WKI A;  2XD1 A;  1MXO A;  1W8Q A;  5CXW A;  5DTT A;  4BL3 A;  4QJG A;  4IBX A;  4JLF A;  1ONG A;  1EI5 A;  1YLT A;  5DF8 A;  4OPY A;  4E3K A;  3MZD A;  3W4O A;  2I72 A;  3BEC A;  4DXB A;  2JBF A;  4ZJ1 A;  1LL5 A;  3O88 A;  3RJU A;  1HVB A;  4UA7 A;  2EXB A;  3M2K A;  5HAP A;  3W4P A;  3LY4 A;  2ZM0 A;  3TSG A;  3IH9 A;  1OME A;  1MBL A;  4OPQ A;  5CHJ A;  4KQQ A;  3CZD A;  3BFG A;  5FQJ A;  4PPR A;  4JXS A;  1LL9 A;  1L0F A;  5FI2 A;  4EV4 A;  5FAS A;  5U47 A;  1IKI A;  2WZX A;  4WZ5 C;  4YFM A;  3VOY A;  5AQB A;  1SCW A;  3RXX A;  3VSK A;  1TDL A;  2G2W A;  2HDR A;  3HLC A;  3IQA A;  4R4S A;  5EPH A;  5FI6 A;  5FQK A;  3SS5 A;  4EBL A;  3A3E A;  4Y0O A;  3IHA A;  1Z6F A;  4LV1 A;  1RGZ A;  1I5Q A;  4OQ0 A;  4P87 A;  1FCN A;  2P9V A;  3BFF A;  4K91 A;  2P9V B;  2ZC3 B;  2Y2Q A;  5CTM A;  4DE3 A;  3HLW A;  2XFS A;  2H10 A;  3BFE A;  1XGJ A;  2ZM2 A;  4EBN A;  3IXD A;  1K54 C;  3GSG A;  1GA9 A;  1W5D A;  1Y54 A;  4XXR A;  4E3N A;  3UPP A;  1YLZ A;  3IXH A;  3P98 A;  4JXW A;  4S2L A;  5CGS A;  1I2W A;  5CRF A;  3ZVT A;  4Y0U A;  4HEF A;  4NET A;  3A3F A;  4S2N A;  1HTZ A;  2ZQ8 A;  3NC8 A;  4N92 A;  1L0G A;  1EWZ A;  1XXM A;  2EFX A;  2IWB A;  4EBP A;  4L0L A;  4OQH A;  4X53 A;  3BFD A;  1XPB A;  1NJ4 A;  4OQI A;  3WS1 A;  3W4Q A;  3C4P A;  5JYO A;  1E3U D;  4N1H A;  3B3X A;  3LO7 A;  1SHV A;  3OZH A;  4ZDX A;  3ZG0 A;  4DRT A;  4QB8 A;  2BLS A;  1BSG A;  1ES4 A;  4E6W A;  5J8X A;  3IH8 A;  2R9W A;  1XP4 A;  2VGK A;  4GDN A;  5GLA A;  3IF6 C;  4JF4 A;  1BUL A;  1DJA A;  1VQQ A;  1L2S A;  1MWT A;  5CEC A;  2WGW A;  1FR6 A;  2Q9N A;  2ZD8 A;  4HBU A;  1KE3 A;  4OOY A;  4DE2 A;  5L2F A;  2QPN A;  4OOL A;  2HP6 A;  4GDB A;  5IHV A;  3VSL A;  4BD1 A;  2UWX A;  4GD8 A;  4DF6 A;  3MXR A;  1JTG A;  4BQM A;  5M18 A;  3EQU A;  3PBN A;  1E4D A;  2Q9M A;  1FCO A;  1QME A;  3OPR A;  3Q7V A;  2Y2P A;  1PW1 A;  4RVA A;  4UHU A;  3WWX A;  1K38 A;  1PI5 A;  5GLC A;  1K25 A;  4S2M A;  4DXC A;  4EUZ A;  3IF6 A;  2C5W B;  5HAQ A;  2WUQ A;  4GOG A;  4LV0 A;  1KE4 A;  4WM9 A;  1ERO A;  4Q8I A;  3GMW A;  4RA7 A;  2EX6 A;  1G68 A;  2WAE A;  5AQ9 A;  5EVI B;  3DWK A;  4JF6 A;  4OVD A;  2HDU A;  4JXV A;  3MBZ A;  5EOE A;  3WS4 A;  5AQ7 A;  3RXW A;  1ERM A;  1XA7 A;  3BM6 A;  1FSY A;  2Y55 A;  4R23 A;  4BL2 A;  3NI9 A;  3O86 A;  5DF9 A;  1FSW A;  2WK0 A;  3CMZ A;  1BLP A;  4FSF A;  1XX2 A;  5CEB A;  3G34 A;  4ZBE A;  1E3U A;  4QD4 A;  4PM7 A;  4ZTK A;  5CER A;  3N8L A;  4R3B A;  4EQI A;  4A5R A;  5M19 A;  2CC1 A;  4KZA A;  5GHZ A;  3G2Y A;  3MFD A;  1CK3 A;  1I2S A;  4OON A;  3PBQ A;  5G18 A;  1FR1 A;  4P6B A;  3HLG A;  3ITA A;  2PBY A;  4P85 A;  4ZJ2 A;  1K56 D;  3CG5 A;  4LCL A;  2WYX A;  4GNU A;  4LV2 A;  1G6A A;  5E2G A;  2OV5 A;  3VP4 A;  3PTE A;  4QU3 A;  5CED A;  3OC2 A;  4MBK A;  2XGN A;  4GKU A;  1O7E A;  2ZQA A;  2Y2K A;  4N9K A;  3NY4 A;  1SKF A;  3OCL A;  4WMC A;  3UN7 A;  2GDN A;  2C6W B;  1XA1 A;  3GVB A;  3Q7Z A;  5EVI D;  3VFF A;  2B5R A;  4N1X A;  3N4I A;  3MKF A;  1K55 C;  5CHM A;  5FI7 A;  1N4O A;  1SDE A;  1ZG4 A;  3CJM A;  3WRZ A;  4EWF A;  3G35 A;  4DDY A;  1PWC A;  3DTM A;  3VOZ A;  4IED A;  1C3B A;  4JBF A;  5E2H A;  3OPL A;  5FA7 A;  2Y59 A;  5HAI A;  1YLW A;  1WYB A;  4H8R A;  4KQR A;  1YMS A;  4OPR A;  5DVA A;  2Y91 A;  1PIO A;  1YQS A;  4KQO A;  5FQQ A;  1JVJ A;  3A3D A;  1RGY A;  5HAR A;  1IEM A;  3MZF A;  2XH9 A;  3UE3 A;  2OLV A;  1KGG A;  1XKZ A;  3FZC A;  2HPB A;  3D4F A;  3A3I A;  2XF3 A;  3BLS A;  4Y7P A;  1PWG A;  2ZLY A;  3HUN A;  3N8R A;  4WZ5 A;  3W8K A;  3FKW A;  1RP5 A;  5GL9 A;  3UE1 A;  4E3M A;  3IXB A;  1S0W A;  3PBT A;  1K6S A;  2QZ6 A;  3GQZ A;  1ESU A;  3ZDJ A;  4B4Z A;  3ZGA B;  5CHU A;  1L0E A;  1W8Y A;  4OQG A;  1ES2 A;  3V5M A;  1PYY A;  1W79 A;  1IYO A;  1ZC2 A;  3AGE A;  3ISG A;  4UA6 A;  1Q2P A;  5F1G A;  2IWD A;  4KG5 A;  1K57 A;  4GB7 A;  4GZB A;  3VP3 A;  5HL1 A;  3MXS A;  4K0X A;  1K54 A;  2HDS A;  2J7V A;  3G4P A;  3IF5 A;  2ZC4 B;  4WMC D;  2WAF A;  4OPZ A;  1ALQ A;  4B88 A;  3M2J A;  3JYI A;  3G32 A;  1N9B A;  1K57 C;  1DY6 A;  3SS3 A;  3TG9 A;  2OSU A;  5CGW A;  2Y4A A;  4U0X A;  4JXG A;  5BOH A;  4LV3 A;  2A49 A;  1GA0 A;  1GHI A;  2IWC A;  2ZQC A;  4LCM A;  2XFT A;  1BLC A;  2X02 A;  2H0T A;  3SH7 A;  1CI9 A;  2ZJ9 A;  2XQZ A;  1K4E A;  5HFO A;  1L0D A;  4KG6 A;  4FH4 A;  2HP5 A;  5EE8 A;  3SH8 A;  1NYY A;  4IBR A;  4IVI A;  1H8Y A;  2V2F F;  3LY3 A;  4E3J A;  3NBL A;  3BYD A;  4FD8 A;  3WS0 A;  3M6B A;  3ZG7 B;  3M6H A;  3QNC A;  3G2Z A;  4N9L A;  5TGF A;  4KZ4 A;  3PAG A;  4OH0 A;  1WE4 A;  2V1Z A;  4XUZ A;  1IYP A;  5DTK A;  3PBR A;  3UDI A;  4E3O A;  3FYZ A;  1E25 A;  4X56 A;  2XDM A;  3ZFZ A;  2WGW B;  5EVI C;  3Q82 A;  1ZKJ A;  5F82 A;  3WS5 A;  5FDH A;  3GTC A;  2JE5 A;  4OLG A;  2HP9 A;  3I7J A;  2Y2H A;  3P09 A;  4FH2 A;  3S1Y A;  3S4X A;  4BLM A;  1VM1 A;  3VP1 A;  2RL3 A;  4ZJ3 A;  4Y0T A;  5A90 A;  1NXY A;  4DE1 A;  4F94 A;  3V39 A;  5DF7 A;  5EVI A;  3PBS A;  4ID4 A;  1YLJ A;  2FFF B;  2XD5 A;  2ZC7 A;  2Z2M B;  2HDQ A;  1FQG A;  4X55 A;  2X71 A;  3VP0 A;  2VGJ A;  4OKP A;  1TEM A;  4U0T A;  1FCM A;  3BFC A;  4UA9 A;  5EUA A;  3IF6 B;  1PW8 A;  4GN2 A;  5EOO A;  5FQ9 A;  1IYQ A;  2EFU A;  1YM1 A;  4WEK A;  2G2U A;  3Q7V B;  4GD6 A;  4QY5 A;  2V20 A;  3ZCZ A;  3ZG9 B;  1TVF A;  1W7F A;  1NZU A;  2XEP A;  1ERQ A;  1KDW A;  4C3Q A;  4WEJ A;  1YLY A;  2XLN A;  3IWI A;  3V3R A;  3N6I A;  4R1G A;  2ZQ7 A;  4QY6 A;  2JC7 A;  3HUO A;  3EQV A;  2A3U A;  4S2O A;  4JF5 A;  4JPM A;  4WBG A;  1IKG A;  4RX2 A;  5F83 A;  4PM6 A;  1BLS A;  4S2N C;  3BRM A;  2X01 A;  3UDX A;  2EXA A;  4R4R A;  1H5X A;  4JKT A;  1JWV A;  2WGV A;  4X6T A;  1K6R A;  3NIA A;  4BEN A;  4KZ7 A;  1J9M A;  2EX2 A;  1M40 A;  3GRJ A;  3UY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...