3OPLA

Esbl r164h mutant shv-1 beta-lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDHWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-dependent disorder of the Omega loop observed in extended-spectrum SHV-type beta-lactamase.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
molecule keywords Beta-lactamase SHV-1
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3oplA00
5CXWA 5FASA 2WK0A 2DNSA 3NDGA 4OPRA 1MWUA 1K56D 5E2GA 3RXWA 5I94A 1K6SA 1KGFA 1LI0A 3ZDJA 1AXBA 2Y2QA 3BEBA 4IEDA 5FQKA 5FQ9A 3GSGA 4JXSA 1YT4A 3G32A 2WGWA 3UE1A 4CPKA 4JF6A 2J8YA 1KVLA 4X56A 5EVIC 5HW3A 3LY3A 5FI7A 5CHMA 3C4OA 2WZZA 3HUMA 2P74A 3TSGA 5BOHA 3IHBA 1OMEA 1KE0A 2WADA 3ZG0A 2XH9A 1W5DA 5EOEA 5GL9A 4N9LA 2Y2PA 5TFQA 4OP5A 4IVKA 1FSYA 3SS5A 1YLZA 2Q9NA 4OKPA 4XUXA 1FCOA 3W8KA 1E3UD 3O88A 2V20A 3IF6A 3IH9A 3Q7ZA 1MPLA 3GRJA 2IWCA 3OPHA 1PWCA 2E8IA 2DRWA 3G34A 1ES5A 3BYDA 4IBXA 4R3JA 4S2KA 4B88A 1NZOA 4OOMA 4ZJ2A 1YLPA 2ZMAA 1SDEA 3C5AA 1PI4A 2EXAA 3SH8A 4C6YA 3BFFA 3ITAA 1PWGA 1HVBA 4L0LA 4N9KA 2G2UA 4OQ0A 4FSFA 3IXBA 1JTDA 4S2OA 4OLDA 1K4FA 5GHXA 1GHMA 1PW1A 2A49A 2X71A 4KZ6A 4U0TA 3NCKA 4XUZA 4KZ8A 2XQZA 2XGNA 3HLWA 3PBQA 3MZEA 3IXDA 5GLDA 4Y0TA 3ZNTA 4EWFA 4BLMA 5IHVA 1ESUA 3G35A 2V1ZA 1XKZA 5GHZA 3Q81A 4ZBEA 2QPNA 5AQBA 3N6IA 5GLBA 1VQQA 2HPBA 2PU4A 5HX9A 4B4ZA 2IWBA 5HL1A 1H8ZA 1CEGA 3ZG7B 4KZ5A 1GCEA 3LO7A 1MWSA 4ZJ3A 3IQAA 3UE0A 2BLSA 1YLYA 5E2FA 1G68A 5CTNA 1JTGA 4DE2A 1EI5A 1ERMA 3BFGA 3SS4A 3NY4A 2WUQA 1M40A 2I72A 3UPNA 2H0YA 3V5MA 1NZUA 3UY6A 4BQMA 2VGJA 2ZQDA 3N4IA 3B3XA 4Y7PA 1K57A 4GKUA 3MKFA 4RVAA 3VP4A 1LL5A 2FFYA 5DF7A 1O7EA 5CEDA 2C5WB 4KZBA 3LCEA 4N92A 2G2WA 4O7DA 5F1GA 3SH9A 5KMWA 4P87A 5EECA 3WS4A 1MKIA 1KGEA 3IF6B 1FSWA 3E2KA 4X55A 3OCLA 1NYMA 5CGXA 1G6AA 2WAEA 3VP1A 5HARA 3AGDA 3AGEA 2ZM8A 2X01A 5CECA 4WEKA 1I2WA 4QY5A 1HTZA 1Q2QA 1SCWA 1J9MA 3BLSA 3ZNYA 2XK1A 4PM5A 5CHUA 1H5XA 2B5RA 1K4EA 2BG1A 5F82A 3A3EA 3WS1A 5DF8A 1FOFA 5HAPA 4JBFA 4HBTA 1LLBA 4S2PA 2ZLYA 2XFSA 3HVFA 3G2YA 2Y2NA 1H8YA 2HDSA 1XX2A 5M19A 1FCNA 3BLMA 4KQOA 4EBPA 2A3UA 3Q07A 3WS5A 4GD6A 2C6WB 4DDYA 2HDUA 2Z2LB 1BT5A 3BFDA 3HBRA 3IWIA 4WMCA 5EVIB 1FQGA 1VM1A 2EX2A 2ZC7A 2ZD8A 3V3RA 1JWVA 4KQQA 5EPHA 5EVIA 1ERQA 2XD5A 3SH7A 4GNUA 4LCMA 1IKGA 4JXGA 1XGIA 3G4PA 1ESIA 2XF3A 4RX3A 1BZAA 1KDSA 1ES2A 2WKIA 4S2LA 4WELA 4DKIA 4OQIA 1LI9A 3BECA 4KQRA 4E6XA 1L0FA 3VFHA 2EX8A 5AQ9A 1RGYA 3Q7VA 2EFUA 3VSLA 5HFOA 4GDBA 3WRZA 4OPZA 4JF5A 1IEMA 3QNBA 3LEZA 3C7UA 1L2SA 3FV7A 4PMAA 2JC7A 4OLGA 4KZAA 4HESA 4WEJA 3QHYA 3GMWA 1ZKJA 3NC8A 2ZC4B 4UA7A 2WKHA 4WMCD 3G30A 1KDWA 2GDNA 2J7VA 4FD8A 4F94A 1K55C 1LL9A 3HLDA 5DTKA 1NXYA 4DRTA 4EV4A 4LV1A 2Y2LA 4BD0A 5AQ7A 1RGZA 4U0XA 3Q1FA 4R23A 3UDXA 5EUAA 4JPMA 3HUOA 1K25A 3PBNA 2HP6A 4N1HA 4WYYA 1GHPA 3MKEA 3IXGA 5JYOA 3I7JA 4C3QA 2Y2HA 3ZCZA 4KG2A 1W8QA 3IWQA 3OC2A 1KE3A 5G18A 1YMXA 3P98A 1WE4A 5U47A 1ZG6A 5TR7A 4DXCA 2ZQCA 3GQZA 4BJPA 3OCNA 1PZOA 4EBLA 2OV5A 5L2FA 3EQUA 3PBSA 2RL3A 2XEPA 1CI8A 3S4XA 4PPRA 3UDIA 1TDLA 4DE0A 1QMEA 4BD1A 4E3JA 3CG5A 3WS0A 1MBLA 4KG6A 5EE8A 2UWXA 5DTTA 3O86A 3BFEA 3UNWA 2JBFA 3VMAA 5EOOA 1XGJA 3FKVA 1K57C 4KZ9A 2J9OA 5AQAA 4C75A 5CERA 4P85A 5A93A 2WGIA 5CEBA 3ZG8B 4LCLA 2XD1A 4JLFA 1E25A 1MXOA 1O07A 3PAEA 5E43A 5F1FA 3PAGA 3C7VA 3DWZA 3V39A 4GOGA 5FAPA 2ZC5B 3IXHA 1BLPA 3A3DA 3M6BA 4KZ7A 5CRFA 1C3BA 2WZXA 1HZOA 3DWKA 2WGVA 1N9BA 2FFFB 1E4DA 4K0XA 4K91A 3A3FA 3IWOA 4CJNA 2ZC3B 1NJ4A 1K54C 4OONA 4QY6A 2IWDA 4E6WA 3HREA 3N7WA 4E3KA 4QHCA 4KZ4A 3ZGAB 3TOIA 2EFXA 2CC1A 3WWXA 4RYEA 1PI5A 5DTSA 5FSRA 1W8YA 4PM7A 1Z6FA 1WYCA 3QNCA 3SOIA 1CEFA 1K56A 2X02A 2Y2IA 4OP8A 4R1GA 4IVIA 4S2NC 5CGSA 4OH0A 1E3UA 3M2JA 5M1AA 3UO9A 2WGWB 5A92A 4MBFA 2Y59A 5FATA 2ZQ8A 1EROA 3V3SA 5DVAA 1YM1A 5HAQA 1YLWA 1DY6A 1XA7A 1MWRA 1RP5A 1ALQA 3IHAA 1ONGA 4YINA 4P6BA 2JE5A 1SDNA 2EX9A 1FR1A 3N8RA 1I5QA 3FWLA 3WS2A 3MZDA 1NRFA 1ES4A 4KZ3A 3M6HA 4P0MA 4BL2A 5CTMA 4A5RA 3CMZA 5D3OA 1S0WA 1TDGA 3OPPA 3UPPA 1CI9A 3PTEA 3RXXA 3P09A 4GD8A 2OSUA 1JVJA 3NDEA 4X53A 3WRTA 3A3JA 4OVDA 1GHIA 3FZCA 4Y0OA 3MFDA 1IYOA 1L0GA 2Y4AA 3VOYA 2Q9MA 2P9VA 1SKFA 4MBKA 2PU2A 3HLEA 1XPBA 1DJBA 1MWTA 1I2SA 1K38A 2HDRA 4OPQA 1XP4A 4RX2A 1LHYA 2ZQ9A 4OOLA 2ZM2A 5FAQA 1FCMA 1ONHA 2VGKA 3BM6A 4GN2A 4Q8IA 3BRMA 4LV0A 2QMIA 4B4XA 2ZJ9A 2ZC6B 2Y2MA 4QB8A 3ZG9B 3IH8A 5E2EA 5CHJA 4E3MA 3N8SA 5F83A 5FQIA 3VP2A 1IELA 4EQIA 1NYYA 4DXBA 5EVLA 3GVBA 2Y91A 4ZJ1A 4JXVA 1BLCA 1W7FA 4UAAA 4LV2A 4R3BA 2Y2JA 2HP9A 1XXMA 4QU3A 3VFFA 1FR6A 3LY4A 4PM9A 1JWZA 2DCFA 1S6RA 2ZQ7A 4E3IA 3HLBA 4QD4A 1ZC2A 3AGFA 1U60A 3HUNA 4WBGA 2Y2KA 1L0EA 4JXWA 3UPOA 2XFTA 3JYIA 4N1XA 4NK3A 2EX6A 2WKEA 4FH2A 5FQMA 3TG9A 1PW8A 2H10A 3CZDA 1W79A 2Y55A 4GDNA 4H8RA 3UE3A 5KSHA 4X68A 5E2HA 4RA7A 3E2LA 1EWZA 5FDHA 3Q7VB 2QZ6A 5HAIA 4IBRA 2ZQAA 3FKWA 1Y54A 5J8XA 2Y2OA 2ZM0A 3IT9A 1KVMA 3ZHHA 2R9WA 4U3TA 4WZ5A 4WZ4A 5JYPA 1YQSA 2H0TA 4JKTA 3VSKA 4K0WA 3A3IA 3NI9A 3SS3A 4DE1A 3HL9A 4UA6A 3S22A 1IYSA 3NBLA 2J9PA 2PBYA 3IF5A 4S2MA 3OPRA 2OLVA 1QMFA 3UDFA 2Z2MB 4WM9A 3BFCA 5EVID 1SHVA 1TVFA 2XDMA 4DDSA 3ZFZA 1MY8A 2V2FF 4Z9QA 1KE4A 1KGGA 4MLLA 4XXRA 3G31A 3D4FA 1GA9A 4Y0UA 1K54A 1Q2PA 3G2ZA 2WYXA 5FI6A 2R9XA 1BULA 3Q82A 1IKIA 3PBTA 2HDQA 1N4OA 3DW0A 3S1YA 2HP5A 4OPYA 3VP0A 1BLSA 1L0DA 3O87A 4WZ5C 3MBZA 4BENA 2H5SA 1BLHA 4S2NA 3ZG5A 5GLAA 4R0QA 4MNRA 1YLJA 3NIAA 3MZFA 1CK3A 4MBHA 1JWPA 4MEZA 3C4PA 3GTCA 4PM6A 4X69A 3EQVA 4LV3A 5GHYA 4JF4A 3VOZA 4GB7A 1PZPA 4UA9A 3UN7A 4FH4A 5FA7A 1DJCA 1NY0A 3GR2A 1BSGA 2JCHA 1XA1A 2OLUA 5FQJA 4S2JA 5KZHA 1YMSA 4EBNA 1YLTA 4M3KA 4E3OA 3V50A 4E3NA 3FYZA 5TGFA 4DE3A 3W4QA 1BUEA 4OQGA 3DTMA 4D2OA 5A91A 1ZG4A 3MXSA 1IYQA 1ES3A 1GA0A 4KG5A 3CJMA 3ITBA 4YFMA 2WAFA 3MXRA 3PBOA 5FQQA 4KENB 4HBUA 4QJGA 3M2KA 5GLCA 1RCJA 4BL3A 4ZTKA 2XR0A 4R4RA 1WYBA 3VP3A 1BTLA 4PM8A 4FCFA 1PWDA 4NETA 4HEFA 1PYYA 2Y2GA 3RJUA 4UHUA 5M18A 2P9VB 4DF6A 3OZHA 3ISGA 2EXBA 5KSCA 3ZVTA 3O3VA 3GV9A 4ZDXA 3IF6C 4OQHA 4OOYA 5FAOA 3N8LA 1TEMA 1HD8A 2RCXA 3HLGA 3W4OA 1DJAA 5CGWA 5A90A 4GZBA 1K55A 4R4SA 1IYPA 4ZAMA 3PBRA 3ZVWA 3HLFA 3OPLA 3W4PA 4X6TA 1K6RA 2XLNA 4ID4A 4S2IA 4E3LA 4EUZA 4LENA 1M6KA 1PIOA 3HLCA 5FI2A 5DF9A
chains in the Genus database with same CATH superfamily
5FASA 3EEHA 3NDGA 1MWUA 3RXWA 5I94A 1SZVA 5J7EA 1HLUP 4EU0A 4HHDA 4CPKA 2Y79A 4JF6A 4Y3IA 4AFIA 5HW3A 3LY3A 3NOPC 3C4OA 3TSGA 1OMEA 2WKRA 1KOUA 3ZG0A 1W5DA 5EM0A 2Y2PA 2J3TD 4OP5A 3SS5A 1YLZA 4OKPA 3IH9A 4GLQA 3Q7ZA 4WN5A 1PWCA 4Y15A 1TS6A 3G34A 1ES5A 4WLAA 1YLPA 2ZMAA 1PWGA 2D02A 4FSFA 4OLDA 1K4FA 5GHXA 2XQZA 5J4EA 1ESUA 3G35A 2GJ3A 1VB6A 1MC0A 1NLYA 1VQQA 2HPBA 2PU4A 5HX9A 3LO7A 4ZJ3A 1JTGA 4Q0HA 3SS4A 1M40A 3UY6A 4I3JA 3DTIA 4LPZA 1Y4OA 1EW0A 2FFYA 1O7EA 3K2NA 5KMWA 4P87A 4QWOA 1KGEA 3IF6B 3E2KA 4X55A 2PYPA 2IA2A 3VP1A 3AGDA 3AGEA 5CECA 1HTZA 3BLSA 3ZNYA 5HZHA 4JGRA 2XK1A 1VEUB 5CHUA 4PM5A 2D01A 2B5RA 3O5YA 5HAPA 1LSVA 3HVFA 4WL9A 3G2YA 2W1TA 1BT5A 5EVIB 1FQGA 1OTEA 1XJ3A 4HQAA 3KSIA 3VOLA 4LRXC 1IKGA 4RX3A 3LICA 4WELA 4I5SA 4OQIA 3PHYA 3BECA 3VE3A 2EX8A 5AQ9A 1RGYA 2EFUA 3WRZA 4JF5A 3QNBA 1NRJA 4OLGA 3KYEA 4WEJA 1ZKJA 3NC8A 4DRTA 1OTBA 1RGZA 1H3QA 4JPMA 3TJZC 4N1HA 4WYYA 1CF0A 4Y17A 4HNBA 1JNUA 5G18A 3W2ZA 1YMXA 4DXCA 5TR7A 2O9CA 4BJPA 1PZOA 3EQUA 3PBSA 2GNXA 3DAVA 4E3JA 3BY8A 3CG5A 3UB5P 2JN7A 2KOIA 5EE8A 4KZ9A 2J9OA 4P85A 4Z1WA 4DJ2A 1E25A 1MXOA 1LL8A 2ZC5B 4HJ4A 3DWKA 3CPTA 4K91A 3A3FA 3IWOA 5KIZA 4CLCD 4QY6A 3MJQA 3HREA 4R70A 3D9YA 1VETB 4KZ4A 3TOIA 5LBRA 4LRYC 3SOIA 3VV4A 4Q0JA 5HWTA 2X02A 4LFUA 4S2NC 4IVIA 1E3UA 3UO9A 4GS9A 5FATA 3V3SA 5HAQA 4KUOA 2B95A 2GZAA 3IHAA 1SDNA 3WS2A 5DKKA 4KZ3A 2HZ5A 4A5RA 1TDGA 3UPPA 1CI9A 3P09A 2HV1A 3A3JA 4OVDA 3LI8A 1GHIA 3FZCA 1OT6A 3LEQA 4MBKA 1XPBA 2HDRA 4OPQA 4NKPA 4RX2A 2ZQ9A 4GS9B 4Q8IA 4FUWA 4QB8A 3IH8A 4NXGA 2HF6A 4UQIS 4EERA 4BBTA 4DXBA 3H82A 4LV2A 1TS7A 1FR6A 1JWZA 3G6OA 1VEUA 1ODVA 1ZC2A 1U60A 4PKYG 1L0EA 1F5MA 4FOFA 4JXWA 3UPOA 3JYIA 3H7WB 2EX6A 3TG9A 3C30A 2Y55A 4H8RA 3EOIA 4X68A 4DN0A 3E2LA 4BBUA 4GHIA 3EGDC 2ZQAA 1Y54A 4HJ6A 2Y2OA 3IT9A 1F2KA 3VSKA 4PHTA 3A3IA 3HL9A 2PBDP 2Q0OA 3NBLA 2OLVA 2PDRA 1QMFA 1SHVA 1TVFA 4DDSA 3ZFZA 1MY8A 4Z9QA 1KE4A 2HJEA 4IHQA 4MLLA 4Y0UA 2R9XA 2M7UA 1IKIA 4MMNA 3PBTA 3S1YA 2HP5A 1L0DA 3O87A 1Y28A 2P7JA 2A24B 4R0QA 4MNRA 1YLJA 3MZFA 5GHYA 3BWLA 2W27A 3UN7A 4FH4A 2VV6A 2BASA 1YMSA 4M3KA 3V50A 4DE3A 1STZA 3LFVA 1GA0A 4KG5A 3CJMA 4JGPA 1ZTUA 4QPRA 3R4KA 3F1NB 1V9ZA 3VP3A 4NETA 2Y2GA 4DF6A 3QP2A 1D06A 4O01A 1HD8A 1XJ6A 4B93A 4XT2B 1K55A 5DKLA 3A0VA 3HLFA 1TS8A 4ID4A 4S2IA 3CITA 5DF9A 2L4RA 1XFNA 2DNSA 3IS2B 2LB9A 5E2GA 2EA9A 3T4QA 1YT4A 4X56A 1KVLA 5CHMA 5C5KA 1LSWA 3K3DA 1KE0A 2WADA 1VETA 4EESA 2Q9NA 5HDCA 3JPUA 3UB9A 1SKOA 1MPLA 1TF1A 3QP8A 2E8IA 4HP4A 2AVXA 4L9FA 4B88A 5IU1A 4ZJ2A 3NOTC 2DMWA 1SDEA 3C5AA 3SH8A 4MN5A 3BFFA 1HVBA 4N9KA 4OQ0A 3IXBA 1JTDA 2ZOIA 1S66L 2X71A 4KZ6A 4KZ8A 3HLWA 3MZEA 4Y0TA 1XKZA 3CUEA 2WKQA 4KQDA 2IWBA 1CEGA 3ZG7B 4KZ5A 1GCEA 1D7EA 4PAUA 3UE0A 4F3LB 2BLSA 1YLYA 3NULA 1ERMA 3BFGA 2WUQA 4NXEA 3UPNA 2H0YA 3V5MA 2H28A 4Y7PA 3MKFA 2BTFP 2QJ5A 4RVAA 3VP4A 5CEDA 2C5WB 4KZBA 3LCEA 4UQIM 2G2WA 3SH9A 5EECA 1MKIA 3ICYA 1OTDA 2K7SA 4H6JB 2ZM8A 2EWVA 3DBAA 4P6ZS 1I2WA 1Q2QA 5F82A 3MMHA 1FOFA 4JBFA 1YKDA 2Z6DA 1S1YA 1L3LA 4S2PA 2Y2NA 2HDSA 1FCNA 5EVEA 4DDYA 2B02A 3BFDA 5L07A 3LIAA 4WMCA 1VM1A 2EX2A 2ZC7A 1JWVA 5EVIA 1ERQA 1AWIA 4ETXA 1KDSA 4S2LA 2W0NA 4E6XA 4KQRA 4JGOA 3ZQ5A 3A0SA 4OPZA 1IEMA 3LEZA 2K2NA 3FV7A 4KZAA 4HESA 1DP9A 3GMWA 2ZC4B 4UA7A 2WKHA 4WMCD 2J7VA 4F94A 1K55C 1LL9A 5DTKA 2W3DA 4I3AA 4U0XA 3Q1FA 1K25A 1S67L 3MKEA 2W3EA 5JYOA 3I7JA 3IWQA 1KE3A 5U47A 1ZG6A 2ZQCA 2XEPA 3S4XA 3UDIA 4DE0A 1YSPA 4BD1A 3WS0A 1MBLA 5DTTA 3VMAA 3BFEA 4IUHA 3IS2A 3HCYA 4C75A 2XD1A 2VV7A 4JLFA 3PAEA 1S4RA 2ZOHA 4KZ7A 3M6BA 2WZXA 1XJ4A 3S7NA 4CJNA 2ZC3B 2V9AA 3CLOA 5TBMA 2IWDA 3U4LP 4E3KA 4QHCA 2EFXA 2CC1A 3WWXA 5DTSA 4HOIA 1CEFA 4F3LA 4OH0A 5A92A 2ZQ8A 5HD3A 4DJ3A 5DVAA 1YM1A 2FH5A 3OLOA 1RP5A 1N9LA 2JE5A 3T12B 2V8CA 1A0KA 2OOLA 3M6HA 4P0MA 5CTMA 3CMZA 4G3WA 3OPPA 3WRTA 1VHMA 4LRZE 4MCWA 1OT9A 1IYOA 2PYRA 2Q9MA 2P9VA 2PU2A 3HLEA 1DJBA 1MWTA 1I2SA 1XP4A 2JKFA 1LHYA 4OOLA 5FAQA 1FCMA 3KSHA 3BM6A 4HI4A 2QMIA 3ZG9B 5IT5A 3S7OA 3EWKA 2ACGA 3SZTA 1IELA 2YKHA 4EQIA 1G5UA 2Y91A 4RQ9A 3LIDA 5DFYA 4QU3A 1XXMA 3V67A 2PD8A 2DCFA 1S6RA 2ZQ7A 2M1CA 4QD4A 3HUNA 4WBGA 3R7WA 4GJ4A 4N1XA 2V1BA 4NK3A 5F5YA 2WKEA 2O9BA 2VJWA 2H10A 1BYWA 3CZDA 5DFXA 4EW7A 1W79A 1OJ5A 4RA7A 3PXPA 3T1RA 1EWZA 2XA7S 5FDHA 2ZM0A 2R9WA 4U3TA 4WZ5A 1YQSA 4DMZA 3ZYTA 3IX3A 3IF5A 2ZMFA 3FG8A 3CI6A 3UDFA 5EVID 3S7QA 1KGGA 3C2WA 3G31A 3D4FA 3BQ8A 1H0MA 3P01A 3T4KA 3KSGA 4R6LA 2ZL1B 3JVUA 4EETB 1P9RA 2H5SA 2INWA 5GLAA 3TRCA 3NIAA 4MBHA 3T50A 4MN6A 1G28A 1JWPA 3GTCA 3VOZA 4LV3A 2ZBBA 3C38A 4PKYA 1DJCA 1BSGA 1MKMA 1XA1A 5FQJA 4E3OA 5TGFA 1LT0A 3W4QA 3P7NA 3MXSA 2QKPA 3ITBA 1NWZA 3MXRA 3PBOA 4HBUA 4NXFA 5FEFA 3M2KA 5GLCA 1RCJA 4ZTKA 2XR0A 4R4RA 3BQAA 1BTLA 4FCFA 1DP6A 1PYYA 2ZL1A 1IOUA 3MQQA 3ISGA 5G4YA 3O3VA 4ZDXA 5TJJA 1TEMA 4IUKA 2V0WA 2RCXA 5CGWA 2R78A 5A90A 2LB5A 3PBRA 3ZVWA 3E98A 3W4PA 1K6RA 4ME4A 5AVEA 4P6ZM 5MC7A 4WUJA 5CXWA 5F6AA 4OPRA 5EFWA 1K56D 1K6SA 3ZDJA 1AXBA 2Y2QA 4IEDA 5FQ9A 3G32A 2WGWA 2A24A 4X1MA 3CHWP 5EVIC 5FI7A 2WZZA 2P74A 3IHBA 4H6JA 2XH9A 5EOEA 5GL9A 4EEPA 4N9LA 5TFQA 2JKTI 4IVKA 1FSYA 2CMNA 1FCOA 2PD7A 2O99A 2V20A 3IF6A 3OPHA 2DRWA 3BYDA 4R3JA 3QP4A 4S2KA 3HJIA 1NZOA 2P04A 4OOMA 3PR6A 4X25A 1GSWA 5FEGA 5HSQA 1GHMA 1PW1A 2A49A 4U0TA 5DJTA 4HJ3A 3IXDA 5GLDA 3T1SA 4BLMA 5IHVA 1W63Q 3Q81A 5AQBA 5GLBA 2NUPC 1Z09A 4B4ZA 5HL1A 3FC7A 1H8ZA 3LR5A 1MWSA 2L0WA 4DE2A 1EI5A 3NY4A 1NZUA 3UB7A 3D3OA 4G3VA 2OAP1 4GKUA 4N92A 4O7DA 3CPTB 5F1GA 3T4JA 3WS4A 4YNRA 1T1BA 2J3TC 3OCLA 3DTEA 4K08A 4R3AA 5CGXA 1G6AA 3FPWA 2WAEA 5HARA 4WEKA 1J9MA 1H5XA 1K4EA 2BG1A 3WS1A 5DF8A 4HBTA 1LLBA 5HDSA 1CJFA 2XFSA 2ZLYA 3KSFA 5L8MA 1H8YA 1J3WA 5DJUA 3BLMA 4EBPA 2A3UA 5TBMB 4GD6A 3RTYA 2C6WB 2Z2LB 3LR0A 3IWIA 2ZD8A 3V3RA 4KQQA 2XD5A 4LCMA 4JXGA 1XGIA 3G4PA 2XF3A 1BZAA 1ES2A 2WKIA 3VFHA 2Z6CA 5HFOA 1UWNX 4GCZA 2VEAA 1L2SA 4NXBA 4PMAA 2JC7A 5L09A 5J3WA 3G30A 2GDNA 4FD8A 4LV1A 3S7PA 4BD0A 5AQ7A 3TE8A 2PHYA 3UDXA 1V9YA 4JGQA 3IXGA 4C3QA 2Y2HA 3ZCZA 4KG2A 3OC2A 2V1AA 2JKRM 3MF0A 1WE4A 3UMEA 3RFBA 1OTAA 3E4QA 2XRNA 3OCNA 3LIFA 4EBLA 2OV5A 5L2FA 3B47A 2W3HA 4PPRA 2KDKA 2VGLS 4ARZA 3O86A 1ZHHB 5AQAA 4O0PA 3BJNA 3F1OA 5CEBA 3ZG8B 4LCLA 1XFQA 3MQ0A 3LUQA 3PAGA 3DWZA 3LYXA 4GOGA 4O8GA 2GX5A 3IXHA 3CAXA 5CRFA 2E8JA 1C3BA 1MZUA 2FFFB 1E4DA 3UB8A 4CLCC 4OONA 4GHIB 1OPXA 4E6WA 4ARZB 4RYEA 1PI5A 3LI9A 1W8YA 4PM7A 1WYCA 3QNCA 1K56A 4OP8A 3MSHA 4HIAA 5HL6A 3M2JA 5M1AA 4I38A 4MBFA 2Y59A 3ULFA 4G3KA 2YKFA 1XJ2A 2G7UA 1DY6A 1ALQA 1ONGA 3E4PA 4P6BA 3N8RA 1I5QA 3FWLA 3MZDA 1ES4A 1T1CA 4BL2A 2XA7M 1S0WA 5D3OA 3PTEA 3RXXA 3LIEA 1GSVA 4Y0OA 1L0GA 2W1TB 2Y4AA 1GSXA 1SKFA 2FZ0A 3LR3A 1ONHA 3BRMA 3OBFA 4B4XA 4HH2A 2ZJ9A 2ZC6B 2Y2MA 5CHJA 5FQIA 1H8MA 1NYYA 4ZJ1A 1W7FA 3KYZA 4UAAA 2Y2JA 1N9NA 1SKOB 4PM9A 4E3IA 3NECA 4I39A 3AGFA 1G6OA 2Y2KA 2XFTA 1PRQA 3C8CA 4FH2A 4ESPA 4CLCB 5E2HA 3MS6A 3Q7VB 2QZ6A 1S4SA 3FKWA 2VKSA 2QWSA 1KVMA 1WA9A 1CQAA 4WZ4A 5FL3A 4K0WA 1F98A 4DE1A 4UA6A 3S22A 2PBYA 2W1RA 1DP8A 5HD5A 3BFCA 2XDMA 2V2FF 1YSQA 4XXRA 2I9VA 1K54A 3G2ZA 5FI6A 3Q82A 3NJAA 4D60A 1UWPX 2PAVP 3VP0A 4X1LA 4WZ5C 3MBZA 1BLHA 3ZG5A 1P0ZA 4MEZA 3C4PA 4PM6A 3EQVA 1PZPA 1W63M 3B33A 1NY0A 3UMDA 2OLUA 1P97A 3FYZA 3DTMA 5A91A 2JKGA 1IYQA 1ES3A 2WAFA 5FQQA 3E4OA 4BL3A 2J80A 2QJ7A 3TW8A 3MQOA 3UE6A 1WYBA 1PWDA 2QHKA 3RJUA 4HY8A 5G4ZA 3A0RA 3OZHA 2EXBA 5KSCA 3GV9A 4CLCE 3UB6A 4OQHA 4OOYA 5FAOA 3N8LA 3W4OA 2VA0A 3HJKA 4GZBA 4ZAMA 3RH8B 3IBJA 2JKTM 4FTXA 4X6TA 2XLNA 4E3LA 2HGVA 4LENA 1M6KA 1PIOA 5FI2A 2WK0A 1LSXA 1KGFA 1LI0A 3BEBA 2VLGA 4NG2A 5FQKA 3GSGA 2A2LA 2EWWA 4JXSA 4Y2FA 2KLIA 3UE1A 2J8YA 2OWHA 3HUMA 4LGWA 5BOHA 3MR0A 2M7VA 3KO6A 3GECA 2O0YA 4XUXA 4WF0A 3W8KA 1E3UD 3O88A 3GRJA 2IWCA 4IBXA 1T18A 1PI4A 2EXAA 4C6YA 3ITAA 4L0LA 2G2UA 4Y13A 4S2OA 4XUZA 4EUVA 4YWZA 3NCKA 1N9OA 2XGNA 3PBQA 4Y5FA 3ZNTA 4EWFA 5AVFA 1IFQA 2V1ZA 5GHZA 4ZBEA 3F1PB 2QPNA 3JVVA 3N6IA 3IQAA 3IX8A 5E2FA 1G68A 5CTNA 4II7A 4BWIA 3L7HA 1D1JA 2I72A 3MXQA 4BQMA 5HDDA 2VGJA 2ZQDA 3N4IA 3B3XA 1K57A 1LL5A 2VZWA 5DF7A 2PT7A 1TD5A 4UEYA 1FSWA 1NYMA 3T1QB 3IX4A 3T4TA 2X01A 3R7WB 1T1AA 4QY5A 2WKPA 1SCWA 2O9AA 3GDIA 2PR6A 3A3EA 5HWWA 3EGXC 3SW1A 3QP1A 1XX2A 5M19A 3IBRA 3DTKA 4KQOA 3Q07A 3WS5A 2HDUA 3H9WA 3HBRA 1DRMA 5EPHA 3SH7A 4GNUA 1YAXA 1ESIA 4KUKA 4DKIA 1LI9A 1L0FA 3Q7VA 3VSLA 4GDBA 4MDZA 3T4SA 5K5BA 2MJ6A 2V0UA 3C7UA 2W3FA 3QHYA 1NLZA 2OAQ1 3QP5A 1KDWA 3HLDA 2JKRI 1NXYA 4EV4A 2Y2LA 3T4OA 4R23A 5EUAA 3HUOA 3PBNA 2HP6A 1GHPA 2B18A 3B42A 1W8QA 2Y8HA 3P98A 3GQZA 3LIBA 5IS1A 4XT2A 2RL3A 1CI8A 5I5LA 2XROA 1TDLA 1QMEA 4KG6A 2UWXA 3UNWA 2JBFA 5EOOA 1XGJA 3FKVA 1K57C 1ACFA 5CERA 5A93A 4HP9A 2WGIA 3F1NA 1OTIA 1O07A 5E43A 5F1FA 1K0KA 3C7VA 3V39A 5FAPA 1BLPA 1YPRA 3A3DA 1HZOA 3KX0X 2WGVA 1N9BA 5HWVA 4K0XA 1FIKA 1NJ4A 4GW9A 1K54C 5CX7A 5F69A 3N7WA 3ZGAB 2NUTC 5FSRA 1Z6FA 4CLCA 4EQ1A 2Y2IA 4R1GA 2OWJA 5CGSA 2WGWB 3BY9A 1EROA 3E0YA 1YLWA 1XA7A 1MWRA 4YINA 5L10A 2VV8A 2EX9A 3CUEC 1FR1A 1NRFA 3D72A 2J3WA 2PR5A 5FDSA 4GD8A 2OSUA 1JVJA 3NDEA 4X53A 4NEED 2PRFA 3KYQA 4L9GA 2VK3A 3MFDA 4M4XA 3F1OB 5HPIA 2ZMVA 3VOYA 3T4LA 5EV0A 1K38A 2W3GA 5F68A 2ZM2A 3H7WA 4BMWA 2VGKA 4GN2A 2KX6A 4LV0A 2QYBA 1PNEA 5E2EA 4E3MA 2VGLM 1TS0A 3N8SA 5F83A 4LLOB 3VP2A 1P9WA 5EVLA 3GVBA 4JXVA 1X0OA 3H82B 1BLCA 4R3BA 2HP9A 3VFFA 5A8BA 3LY4A 3HLBA 3T1XA 5AJGA 4YOFA 3NOUC 3CWFA 5FQMA 4R38A 2JHEA 1PW8A 3F1PA 4GDNA 5KSHA 3UE3A 5HPFA 2V8FA 1UGUA 1OJGA 5HAIA 4IBRA 2HJ9C 5EM1A 5J8XA 3U2AA 3ZHHA 5JYPA 2H0TA 4JKTA 3NI9A 3SS3A 3L9KA 2P08A 1IYSA 2J9PA 4S2MA 3OPRA 4E04A 2VX8A 3FPVA 2Z2MB 4WM9A 3PYPA 1GA9A 3EEAA 2XSSA 1Q2PA 4I3IA 2WYXA 3BW6A 1BULA 2HDQA 4MN7A 1N4OA 3DW0A 1PFLA 4OPYA 3LR4A 1BLSA 2L1MA 1T19A 2K31A 4BBVA 4BENA 4S2NA 3K3CA 3OOVA 1CK3A 4EXOA 4X69A 1F9IA 4JF4A 4GB7A 4UA9A 1S1ZA 5FA7A 3GR2A 2JCHA 4S2JA 5KZHA 4EBNA 1YLTA 4E3NA 1BUEA 4OQGA 4D2OA 1ZG4A 4YFMA 4Q0IA 4ZRRA 4KENB 4QJGA 4CQHA 4B9OA 3QP6A 4HH3A 4PM8A 3VE4A 4HEFA 4IJGA 4UHUA 5M18A 2P9VB 3ZVTA 3IF6C 3LGOA 3HLGA 1DJAA 2UV0E 4R4SA 1IYPA 1FILA 3NHQA 4L9EA 3OPLA 4ETZA 4EUZA 4EEUA 3HLCA 3MFXA
chains in the Genus database with same CATH topology
5CXWA 5FASA 2WK0A 2DNSA 3NDGA 4OPRA 1MWUA 1K56D 5E2GA 3RXWA 5I94A 1K6SA 1KGFA 1LI0A 3ZDJA 1AXBA 2Y2QA 3BEBA 4IEDA 5FQKA 5FQ9A 3GSGA 4JXSA 1YT4A 3G32A 2WGWA 3UE1A 4CPKA 4JF6A 2J8YA 1KVLA 4X56A 5EVIC 5HW3A 3LY3A 5FI7A 5CHMA 3C4OA 2WZZA 3HUMA 2P74A 3TSGA 5BOHA 3IHBA 1OMEA 1KE0A 2WADA 3ZG0A 2XH9A 1W5DA 5EOEA 5GL9A 4N9LA 2Y2PA 5TFQA 4OP5A 4IVKA 1FSYA 3SS5A 1YLZA 2Q9NA 4OKPA 4XUXA 1FCOA 3W8KA 1E3UD 3O88A 2V20A 3IF6A 3IH9A 3Q7ZA 1MPLA 3GRJA 2IWCA 3OPHA 1PWCA 2E8IA 2DRWA 3G34A 1ES5A 3BYDA 4IBXA 4R3JA 4S2KA 4B88A 1NZOA 4OOMA 4ZJ2A 1YLPA 2ZMAA 1SDEA 3C5AA 1PI4A 2EXAA 3SH8A 4C6YA 3BFFA 3ITAA 1PWGA 1HVBA 4L0LA 4N9KA 2G2UA 4OQ0A 4FSFA 3IXBA 1JTDA 4S2OA 4OLDA 1K4FA 5GHXA 1GHMA 1PW1A 2A49A 2X71A 4KZ6A 4U0TA 3NCKA 4XUZA 4KZ8A 2XQZA 2XGNA 3HLWA 3PBQA 3MZEA 3IXDA 5GLDA 4Y0TA 3ZNTA 4EWFA 4BLMA 5IHVA 1ESUA 3G35A 2V1ZA 1XKZA 5GHZA 3Q81A 4ZBEA 2QPNA 5AQBA 3N6IA 5GLBA 1VQQA 2HPBA 2PU4A 5HX9A 4B4ZA 2IWBA 5HL1A 1H8ZA 1CEGA 3ZG7B 4KZ5A 1GCEA 3LO7A 1MWSA 4ZJ3A 3IQAA 3UE0A 2BLSA 1YLYA 5E2FA 1G68A 5CTNA 1JTGA 4DE2A 1EI5A 1ERMA 3BFGA 3SS4A 3NY4A 2WUQA 1M40A 2I72A 3UPNA 2H0YA 3V5MA 1NZUA 3UY6A 4BQMA 2VGJA 2ZQDA 3N4IA 3B3XA 4Y7PA 1K57A 4GKUA 3MKFA 4RVAA 3VP4A 1LL5A 2FFYA 5DF7A 1O7EA 5CEDA 2C5WB 4KZBA 3LCEA 4N92A 2G2WA 4O7DA 5F1GA 3SH9A 5KMWA 4P87A 5EECA 3WS4A 1MKIA 1KGEA 3IF6B 1FSWA 3E2KA 4X55A 3OCLA 1NYMA 5CGXA 1G6AA 2WAEA 3VP1A 5HARA 3AGDA 3AGEA 2ZM8A 2X01A 5CECA 4WEKA 1I2WA 4QY5A 1HTZA 1Q2QA 1SCWA 1J9MA 3BLSA 3ZNYA 2XK1A 4PM5A 5CHUA 1H5XA 2B5RA 1K4EA 2BG1A 5F82A 3A3EA 3WS1A 5DF8A 1FOFA 5HAPA 4JBFA 4HBTA 1LLBA 4S2PA 2ZLYA 2XFSA 3HVFA 3G2YA 2Y2NA 1H8YA 2HDSA 1XX2A 5M19A 1FCNA 3BLMA 4KQOA 4EBPA 2A3UA 3Q07A 3WS5A 4GD6A 2C6WB 4DDYA 2HDUA 2Z2LB 1BT5A 3BFDA 3HBRA 3IWIA 4WMCA 5EVIB 1FQGA 1VM1A 2EX2A 2ZC7A 2ZD8A 3V3RA 1JWVA 4KQQA 5EPHA 5EVIA 1ERQA 2XD5A 3SH7A 4GNUA 4LCMA 1IKGA 4JXGA 1XGIA 3G4PA 1ESIA 2XF3A 4RX3A 1BZAA 1KDSA 1ES2A 2WKIA 4S2LA 4WELA 4DKIA 4OQIA 1LI9A 3BECA 4KQRA 4E6XA 1L0FA 3VFHA 2EX8A 5AQ9A 1RGYA 3Q7VA 2EFUA 3VSLA 5HFOA 4GDBA 3WRZA 4OPZA 4JF5A 1IEMA 3QNBA 3LEZA 3C7UA 1L2SA 3FV7A 4PMAA 2JC7A 4OLGA 4KZAA 4HESA 4WEJA 3QHYA 3GMWA 1ZKJA 3NC8A 2ZC4B 4UA7A 2WKHA 4WMCD 3G30A 1KDWA 2GDNA 2J7VA 4FD8A 4F94A 1K55C 1LL9A 3HLDA 5DTKA 1NXYA 4DRTA 4EV4A 4LV1A 2Y2LA 4BD0A 5AQ7A 1RGZA 4U0XA 3Q1FA 4R23A 3UDXA 5EUAA 4JPMA 3HUOA 1K25A 3PBNA 2HP6A 4N1HA 4WYYA 1GHPA 3MKEA 3IXGA 5JYOA 3I7JA 4C3QA 2Y2HA 3ZCZA 4KG2A 1W8QA 3IWQA 3OC2A 1KE3A 5G18A 1YMXA 3P98A 1WE4A 5U47A 1ZG6A 5TR7A 4DXCA 2ZQCA 3GQZA 4BJPA 3OCNA 1PZOA 4EBLA 2OV5A 5L2FA 3EQUA 3PBSA 2RL3A 2XEPA 1CI8A 3S4XA 4PPRA 3UDIA 1TDLA 4DE0A 1QMEA 4BD1A 4E3JA 3CG5A 3WS0A 1MBLA 4KG6A 5EE8A 2UWXA 5DTTA 3O86A 3BFEA 3UNWA 2JBFA 3VMAA 5EOOA 1XGJA 3FKVA 1K57C 4KZ9A 2J9OA 5AQAA 4C75A 5CERA 4P85A 5A93A 2WGIA 5CEBA 3ZG8B 4LCLA 2XD1A 4JLFA 1E25A 1MXOA 1O07A 3PAEA 5E43A 5F1FA 3PAGA 3C7VA 3DWZA 3V39A 4GOGA 5FAPA 2ZC5B 3IXHA 1BLPA 3A3DA 3M6BA 4KZ7A 5CRFA 1C3BA 2WZXA 1HZOA 3DWKA 2WGVA 1N9BA 2FFFB 1E4DA 4K0XA 4K91A 3A3FA 3IWOA 4CJNA 2ZC3B 1NJ4A 1K54C 4OONA 4QY6A 2IWDA 4E6WA 3HREA 3N7WA 4E3KA 4QHCA 4KZ4A 3ZGAB 3TOIA 2EFXA 2CC1A 3WWXA 4RYEA 1PI5A 5DTSA 5FSRA 1W8YA 4PM7A 1Z6FA 1WYCA 3QNCA 3SOIA 1CEFA 1K56A 2X02A 2Y2IA 4OP8A 4R1GA 4IVIA 4S2NC 5CGSA 4OH0A 1E3UA 3M2JA 5M1AA 3UO9A 2WGWB 5A92A 4MBFA 2Y59A 5FATA 2ZQ8A 1EROA 3V3SA 5DVAA 1YM1A 5HAQA 1YLWA 1DY6A 1XA7A 1MWRA 1RP5A 1ALQA 3IHAA 1ONGA 4YINA 4P6BA 2JE5A 1SDNA 2EX9A 1FR1A 3N8RA 1I5QA 3FWLA 3WS2A 3MZDA 1NRFA 1ES4A 4KZ3A 3M6HA 4P0MA 4BL2A 5CTMA 4A5RA 3CMZA 5D3OA 1S0WA 1TDGA 3OPPA 3UPPA 1CI9A 3PTEA 3RXXA 3P09A 4GD8A 2OSUA 1JVJA 3NDEA 4X53A 3WRTA 3A3JA 4OVDA 1GHIA 3FZCA 4Y0OA 3MFDA 1IYOA 1L0GA 2Y4AA 3VOYA 2Q9MA 2P9VA 1SKFA 4MBKA 2PU2A 3HLEA 1XPBA 1DJBA 1MWTA 1I2SA 1K38A 2HDRA 4OPQA 1XP4A 4RX2A 1LHYA 2ZQ9A 4OOLA 2ZM2A 5FAQA 1FCMA 1ONHA 2VGKA 3BM6A 4GN2A 4Q8IA 3BRMA 4LV0A 2QMIA 4B4XA 2ZJ9A 2ZC6B 2Y2MA 4QB8A 3ZG9B 3IH8A 5E2EA 5CHJA 4E3MA 3N8SA 5F83A 5FQIA 3VP2A 1IELA 4EQIA 1NYYA 4DXBA 5EVLA 3GVBA 2Y91A 4ZJ1A 4JXVA 1BLCA 1W7FA 4UAAA 4LV2A 4R3BA 2Y2JA 2HP9A 1XXMA 4QU3A 3VFFA 1FR6A 3LY4A 4PM9A 1JWZA 2DCFA 1S6RA 2ZQ7A 4E3IA 3HLBA 4QD4A 1ZC2A 3AGFA 1U60A 3HUNA 4WBGA 2Y2KA 1L0EA 4JXWA 3UPOA 2XFTA 3JYIA 4N1XA 4NK3A 2EX6A 2WKEA 4FH2A 5FQMA 3TG9A 1PW8A 2H10A 3CZDA 1W79A 2Y55A 4GDNA 4H8RA 3UE3A 5KSHA 4X68A 5E2HA 4RA7A 3E2LA 1EWZA 5FDHA 3Q7VB 2QZ6A 5HAIA 4IBRA 2ZQAA 3FKWA 1Y54A 5J8XA 2Y2OA 2ZM0A 3IT9A 1KVMA 3ZHHA 2R9WA 4U3TA 4WZ5A 4WZ4A 5JYPA 1YQSA 2H0TA 4JKTA 3VSKA 4K0WA 3A3IA 3NI9A 3SS3A 4DE1A 3HL9A 4UA6A 3S22A 1IYSA 3NBLA 2J9PA 2PBYA 3IF5A 4S2MA 3OPRA 2OLVA 1QMFA 3UDFA 2Z2MB 4WM9A 3BFCA 5EVID 1SHVA 1TVFA 2XDMA 4DDSA 3ZFZA 1MY8A 2V2FF 4Z9QA 1KE4A 1KGGA 4MLLA 4XXRA 3G31A 3D4FA 1GA9A 4Y0UA 1K54A 1Q2PA 3G2ZA 2WYXA 5FI6A 2R9XA 1BULA 3Q82A 1IKIA 3PBTA 2HDQA 1N4OA 3DW0A 3S1YA 2HP5A 4OPYA 3VP0A 1BLSA 1L0DA 3O87A 4WZ5C 3MBZA 4BENA 2H5SA 1BLHA 4S2NA 3ZG5A 5GLAA 4R0QA 4MNRA 1YLJA 3NIAA 3MZFA 1CK3A 4MBHA 1JWPA 4MEZA 3C4PA 3GTCA 4PM6A 4X69A 3EQVA 4LV3A 5GHYA 4JF4A 3VOZA 4GB7A 1PZPA 4UA9A 3UN7A 4FH4A 5FA7A 1DJCA 1NY0A 3GR2A 1BSGA 2JCHA 1XA1A 2OLUA 5FQJA 4S2JA 5KZHA 1YMSA 4EBNA 1YLTA 4M3KA 4E3OA 3V50A 4E3NA 3FYZA 5TGFA 4DE3A 3W4QA 1BUEA 4OQGA 3DTMA 4D2OA 5A91A 1ZG4A 3MXSA 1IYQA 1ES3A 1GA0A 4KG5A 3CJMA 3ITBA 4YFMA 2WAFA 3MXRA 3PBOA 5FQQA 4KENB 4HBUA 4QJGA 3M2KA 5GLCA 1RCJA 4BL3A 4ZTKA 2XR0A 4R4RA 1WYBA 3VP3A 1BTLA 4PM8A 4FCFA 1PWDA 4NETA 4HEFA 1PYYA 2Y2GA 3RJUA 4UHUA 5M18A 2P9VB 4DF6A 3OZHA 3ISGA 2EXBA 5KSCA 3ZVTA 3O3VA 3GV9A 4ZDXA 3IF6C 4OQHA 4OOYA 5FAOA 3N8LA 1TEMA 1HD8A 2RCXA 3HLGA 3W4OA 1DJAA 5CGWA 5A90A 4GZBA 1K55A 4R4SA 1IYPA 4ZAMA 3PBRA 3ZVWA 3HLFA 3OPLA 3W4PA 4X6TA 1K6RA 2XLNA 4ID4A 4S2IA 4E3LA 4EUZA 4LENA 1M6KA 1PIOA 3HLCA 5FI2A 5DF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CXW A;  5FAS A;  2WK0 A;  2DNS A;  3NDG A;  4OPR A;  1MWU A;  1K56 D;  5E2G A;  3RXW A;  5I94 A;  1K6S A;  1KGF A;  1LI0 A;  3ZDJ A;  1AXB A;  2Y2Q A;  3BEB A;  4IED A;  5FQK A;  5FQ9 A;  3GSG A;  4JXS A;  1YT4 A;  3G32 A;  2WGW A;  3UE1 A;  4CPK A;  4JF6 A;  2J8Y A;  1KVL A;  4X56 A;  5EVI C;  5HW3 A;  3LY3 A;  5FI7 A;  5CHM A;  3C4O A;  2WZZ A;  3HUM A;  2P74 A;  3TSG A;  5BOH A;  3IHB A;  1OME A;  1KE0 A;  2WAD A;  3ZG0 A;  2XH9 A;  1W5D A;  5EOE A;  5GL9 A;  4N9L A;  2Y2P A;  5TFQ A;  4OP5 A;  4IVK A;  1FSY A;  3SS5 A;  1YLZ A;  2Q9N A;  4OKP A;  4XUX A;  1FCO A;  3W8K A;  1E3U D;  3O88 A;  2V20 A;  3IF6 A;  3IH9 A;  3Q7Z A;  1MPL A;  3GRJ A;  2IWC A;  3OPH A;  1PWC A;  2E8I A;  2DRW A;  3G34 A;  1ES5 A;  3BYD A;  4IBX A;  4R3J A;  4S2K A;  4B88 A;  1NZO A;  4OOM A;  4ZJ2 A;  1YLP A;  2ZMA A;  1SDE A;  3C5A A;  1PI4 A;  2EXA A;  3SH8 A;  4C6Y A;  3BFF A;  3ITA A;  1PWG A;  1HVB A;  4L0L A;  4N9K A;  2G2U A;  4OQ0 A;  4FSF A;  3IXB A;  1JTD A;  4S2O A;  4OLD A;  1K4F A;  5GHX A;  1GHM A;  1PW1 A;  2A49 A;  2X71 A;  4KZ6 A;  4U0T A;  3NCK A;  4XUZ A;  4KZ8 A;  2XQZ A;  2XGN A;  3HLW A;  3PBQ A;  3MZE A;  3IXD A;  5GLD A;  4Y0T A;  3ZNT A;  4EWF A;  4BLM A;  5IHV A;  1ESU A;  3G35 A;  2V1Z A;  1XKZ A;  5GHZ A;  3Q81 A;  4ZBE A;  2QPN A;  5AQB A;  3N6I A;  5GLB A;  1VQQ A;  2HPB A;  2PU4 A;  5HX9 A;  4B4Z A;  2IWB A;  5HL1 A;  1H8Z A;  1CEG A;  3ZG7 B;  4KZ5 A;  1GCE A;  3LO7 A;  1MWS A;  4ZJ3 A;  3IQA A;  3UE0 A;  2BLS A;  1YLY A;  5E2F A;  1G68 A;  5CTN A;  1JTG A;  4DE2 A;  1EI5 A;  1ERM A;  3BFG A;  3SS4 A;  3NY4 A;  2WUQ A;  1M40 A;  2I72 A;  3UPN A;  2H0Y A;  3V5M A;  1NZU A;  3UY6 A;  4BQM A;  2VGJ A;  2ZQD A;  3N4I A;  3B3X A;  4Y7P A;  1K57 A;  4GKU A;  3MKF A;  4RVA A;  3VP4 A;  1LL5 A;  2FFY A;  5DF7 A;  1O7E A;  5CED A;  2C5W B;  4KZB A;  3LCE A;  4N92 A;  2G2W A;  4O7D A;  5F1G A;  3SH9 A;  5KMW A;  4P87 A;  5EEC A;  3WS4 A;  1MKI A;  1KGE A;  3IF6 B;  1FSW A;  3E2K A;  4X55 A;  3OCL A;  1NYM A;  5CGX A;  1G6A A;  2WAE A;  3VP1 A;  5HAR A;  3AGD A;  3AGE A;  2ZM8 A;  2X01 A;  5CEC A;  4WEK A;  1I2W A;  4QY5 A;  1HTZ A;  1Q2Q A;  1SCW A;  1J9M A;  3BLS A;  3ZNY A;  2XK1 A;  4PM5 A;  5CHU A;  1H5X A;  2B5R A;  1K4E A;  2BG1 A;  5F82 A;  3A3E A;  3WS1 A;  5DF8 A;  1FOF A;  5HAP A;  4JBF A;  4HBT A;  1LLB A;  4S2P A;  2ZLY A;  2XFS A;  3HVF A;  3G2Y A;  2Y2N A;  1H8Y A;  2HDS A;  1XX2 A;  5M19 A;  1FCN A;  3BLM A;  4KQO A;  4EBP A;  2A3U A;  3Q07 A;  3WS5 A;  4GD6 A;  2C6W B;  4DDY A;  2HDU A;  2Z2L B;  1BT5 A;  3BFD A;  3HBR A;  3IWI A;  4WMC A;  5EVI B;  1FQG A;  1VM1 A;  2EX2 A;  2ZC7 A;  2ZD8 A;  3V3R A;  1JWV A;  4KQQ A;  5EPH A;  5EVI A;  1ERQ A;  2XD5 A;  3SH7 A;  4GNU A;  4LCM A;  1IKG A;  4JXG A;  1XGI A;  3G4P A;  1ESI A;  2XF3 A;  4RX3 A;  1BZA A;  1KDS A;  1ES2 A;  2WKI A;  4S2L A;  4WEL A;  4DKI A;  4OQI A;  1LI9 A;  3BEC A;  4KQR A;  4E6X A;  1L0F A;  3VFH A;  2EX8 A;  5AQ9 A;  1RGY A;  3Q7V A;  2EFU A;  3VSL A;  5HFO A;  4GDB A;  3WRZ A;  4OPZ A;  4JF5 A;  1IEM A;  3QNB A;  3LEZ A;  3C7U A;  1L2S A;  3FV7 A;  4PMA A;  2JC7 A;  4OLG A;  4KZA A;  4HES A;  4WEJ A;  3QHY A;  3GMW A;  1ZKJ A;  3NC8 A;  2ZC4 B;  4UA7 A;  2WKH A;  4WMC D;  3G30 A;  1KDW A;  2GDN A;  2J7V A;  4FD8 A;  4F94 A;  1K55 C;  1LL9 A;  3HLD A;  5DTK A;  1NXY A;  4DRT A;  4EV4 A;  4LV1 A;  2Y2L A;  4BD0 A;  5AQ7 A;  1RGZ A;  4U0X A;  3Q1F A;  4R23 A;  3UDX A;  5EUA A;  4JPM A;  3HUO A;  1K25 A;  3PBN A;  2HP6 A;  4N1H A;  4WYY A;  1GHP A;  3MKE A;  3IXG A;  5JYO A;  3I7J A;  4C3Q A;  2Y2H A;  3ZCZ A;  4KG2 A;  1W8Q A;  3IWQ A;  3OC2 A;  1KE3 A;  5G18 A;  1YMX A;  3P98 A;  1WE4 A;  5U47 A;  1ZG6 A;  5TR7 A;  4DXC A;  2ZQC A;  3GQZ A;  4BJP A;  3OCN A;  1PZO A;  4EBL A;  2OV5 A;  5L2F A;  3EQU A;  3PBS A;  2RL3 A;  2XEP A;  1CI8 A;  3S4X A;  4PPR A;  3UDI A;  1TDL A;  4DE0 A;  1QME A;  4BD1 A;  4E3J A;  3CG5 A;  3WS0 A;  1MBL A;  4KG6 A;  5EE8 A;  2UWX A;  5DTT A;  3O86 A;  3BFE A;  3UNW A;  2JBF A;  3VMA A;  5EOO A;  1XGJ A;  3FKV A;  1K57 C;  4KZ9 A;  2J9O A;  5AQA A;  4C75 A;  5CER A;  4P85 A;  5A93 A;  2WGI A;  5CEB A;  3ZG8 B;  4LCL A;  2XD1 A;  4JLF A;  1E25 A;  1MXO A;  1O07 A;  3PAE A;  5E43 A;  5F1F A;  3PAG A;  3C7V A;  3DWZ A;  3V39 A;  4GOG A;  5FAP A;  2ZC5 B;  3IXH A;  1BLP A;  3A3D A;  3M6B A;  4KZ7 A;  5CRF A;  1C3B A;  2WZX A;  1HZO A;  3DWK A;  2WGV A;  1N9B A;  2FFF B;  1E4D A;  4K0X A;  4K91 A;  3A3F A;  3IWO A;  4CJN A;  2ZC3 B;  1NJ4 A;  1K54 C;  4OON A;  4QY6 A;  2IWD A;  4E6W A;  3HRE A;  3N7W A;  4E3K A;  4QHC A;  4KZ4 A;  3ZGA B;  3TOI A;  2EFX A;  2CC1 A;  3WWX A;  4RYE A;  1PI5 A;  5DTS A;  5FSR A;  1W8Y A;  4PM7 A;  1Z6F A;  1WYC A;  3QNC A;  3SOI A;  1CEF A;  1K56 A;  2X02 A;  2Y2I A;  4OP8 A;  4R1G A;  4IVI A;  4S2N C;  5CGS A;  4OH0 A;  1E3U A;  3M2J A;  5M1A A;  3UO9 A;  2WGW B;  5A92 A;  4MBF A;  2Y59 A;  5FAT A;  2ZQ8 A;  1ERO A;  3V3S A;  5DVA A;  1YM1 A;  5HAQ A;  1YLW A;  1DY6 A;  1XA7 A;  1MWR A;  1RP5 A;  1ALQ A;  3IHA A;  1ONG A;  4YIN A;  4P6B A;  2JE5 A;  1SDN A;  2EX9 A;  1FR1 A;  3N8R A;  1I5Q A;  3FWL A;  3WS2 A;  3MZD A;  1NRF A;  1ES4 A;  4KZ3 A;  3M6H A;  4P0M A;  4BL2 A;  5CTM A;  4A5R A;  3CMZ A;  5D3O A;  1S0W A;  1TDG A;  3OPP A;  3UPP A;  1CI9 A;  3PTE A;  3RXX A;  3P09 A;  4GD8 A;  2OSU A;  1JVJ A;  3NDE A;  4X53 A;  3WRT A;  3A3J A;  4OVD A;  1GHI A;  3FZC A;  4Y0O A;  3MFD A;  1IYO A;  1L0G A;  2Y4A A;  3VOY A;  2Q9M A;  2P9V A;  1SKF A;  4MBK A;  2PU2 A;  3HLE A;  1XPB A;  1DJB A;  1MWT A;  1I2S A;  1K38 A;  2HDR A;  4OPQ A;  1XP4 A;  4RX2 A;  1LHY A;  2ZQ9 A;  4OOL A;  2ZM2 A;  5FAQ A;  1FCM A;  1ONH A;  2VGK A;  3BM6 A;  4GN2 A;  4Q8I A;  3BRM A;  4LV0 A;  2QMI A;  4B4X A;  2ZJ9 A;  2ZC6 B;  2Y2M A;  4QB8 A;  3ZG9 B;  3IH8 A;  5E2E A;  5CHJ A;  4E3M A;  3N8S A;  5F83 A;  5FQI A;  3VP2 A;  1IEL A;  4EQI A;  1NYY A;  4DXB A;  5EVL A;  3GVB A;  2Y91 A;  4ZJ1 A;  4JXV A;  1BLC A;  1W7F A;  4UAA A;  4LV2 A;  4R3B A;  2Y2J A;  2HP9 A;  1XXM A;  4QU3 A;  3VFF A;  1FR6 A;  3LY4 A;  4PM9 A;  1JWZ A;  2DCF A;  1S6R A;  2ZQ7 A;  4E3I A;  3HLB A;  4QD4 A;  1ZC2 A;  3AGF A;  1U60 A;  3HUN A;  4WBG A;  2Y2K A;  1L0E A;  4JXW A;  3UPO A;  2XFT A;  3JYI A;  4N1X A;  4NK3 A;  2EX6 A;  2WKE A;  4FH2 A;  5FQM A;  3TG9 A;  1PW8 A;  2H10 A;  3CZD A;  1W79 A;  2Y55 A;  4GDN A;  4H8R A;  3UE3 A;  5KSH A;  4X68 A;  5E2H A;  4RA7 A;  3E2L A;  1EWZ A;  5FDH A;  3Q7V B;  2QZ6 A;  5HAI A;  4IBR A;  2ZQA A;  3FKW A;  1Y54 A;  5J8X A;  2Y2O A;  2ZM0 A;  3IT9 A;  1KVM A;  3ZHH A;  2R9W A;  4U3T A;  4WZ5 A;  4WZ4 A;  5JYP A;  1YQS A;  2H0T A;  4JKT A;  3VSK A;  4K0W A;  3A3I A;  3NI9 A;  3SS3 A;  4DE1 A;  3HL9 A;  4UA6 A;  3S22 A;  1IYS A;  3NBL A;  2J9P A;  2PBY A;  3IF5 A;  4S2M A;  3OPR A;  2OLV A;  1QMF A;  3UDF A;  2Z2M B;  4WM9 A;  3BFC A;  5EVI D;  1SHV A;  1TVF A;  2XDM A;  4DDS A;  3ZFZ A;  1MY8 A;  2V2F F;  4Z9Q A;  1KE4 A;  1KGG A;  4MLL A;  4XXR A;  3G31 A;  3D4F A;  1GA9 A;  4Y0U A;  1K54 A;  1Q2P A;  3G2Z A;  2WYX A;  5FI6 A;  2R9X A;  1BUL A;  3Q82 A;  1IKI A;  3PBT A;  2HDQ A;  1N4O A;  3DW0 A;  3S1Y A;  2HP5 A;  4OPY A;  3VP0 A;  1BLS A;  1L0D A;  3O87 A;  4WZ5 C;  3MBZ A;  4BEN A;  2H5S A;  1BLH A;  4S2N A;  3ZG5 A;  5GLA A;  4R0Q A;  4MNR A;  1YLJ A;  3NIA A;  3MZF A;  1CK3 A;  4MBH A;  1JWP A;  4MEZ A;  3C4P A;  3GTC A;  4PM6 A;  4X69 A;  3EQV A;  4LV3 A;  5GHY A;  4JF4 A;  3VOZ A;  4GB7 A;  1PZP A;  4UA9 A;  3UN7 A;  4FH4 A;  5FA7 A;  1DJC A;  1NY0 A;  3GR2 A;  1BSG A;  2JCH A;  1XA1 A;  2OLU A;  5FQJ A;  4S2J A;  5KZH A;  1YMS A;  4EBN A;  1YLT A;  4M3K A;  4E3O A;  3V50 A;  4E3N A;  3FYZ A;  5TGF A;  4DE3 A;  3W4Q A;  1BUE A;  4OQG A;  3DTM A;  4D2O A;  5A91 A;  1ZG4 A;  3MXS A;  1IYQ A;  1ES3 A;  1GA0 A;  4KG5 A;  3CJM A;  3ITB A;  4YFM A;  2WAF A;  3MXR A;  3PBO A;  5FQQ A;  4KEN B;  4HBU A;  4QJG A;  3M2K A;  5GLC A;  1RCJ A;  4BL3 A;  4ZTK A;  2XR0 A;  4R4R A;  1WYB A;  3VP3 A;  1BTL A;  4PM8 A;  4FCF A;  1PWD A;  4NET A;  4HEF A;  1PYY A;  2Y2G A;  3RJU A;  4UHU A;  5M18 A;  2P9V B;  4DF6 A;  3OZH A;  3ISG A;  2EXB A;  5KSC A;  3ZVT A;  3O3V A;  3GV9 A;  4ZDX A;  3IF6 C;  4OQH A;  4OOY A;  5FAO A;  3N8L A;  1TEM A;  1HD8 A;  2RCX A;  3HLG A;  3W4O A;  1DJA A;  5CGW A;  5A90 A;  4GZB A;  1K55 A;  4R4S A;  1IYP A;  4ZAM A;  3PBR A;  3ZVW A;  3HLF A;  3OPL A;  3W4P A;  4X6T A;  1K6R A;  2XLN A;  4ID4 A;  4S2I A;  4E3L A;  4EUZ A;  4LEN A;  1M6K A;  1PIO A;  3HLC A;  5FI2 A;  5DF9 A; 
#chains in the Genus database with same CATH topology
 5FAS A;  3EEH A;  3NDG A;  1MWU A;  3RXW A;  5I94 A;  1SZV A;  5J7E A;  1HLU P;  4EU0 A;  4HHD A;  4CPK A;  2Y79 A;  4JF6 A;  4Y3I A;  4AFI A;  5HW3 A;  3LY3 A;  3NOP C;  3C4O A;  3TSG A;  1OME A;  2WKR A;  1KOU A;  3ZG0 A;  1W5D A;  5EM0 A;  2Y2P A;  2J3T D;  4OP5 A;  3SS5 A;  1YLZ A;  4OKP A;  3IH9 A;  4GLQ A;  3Q7Z A;  4WN5 A;  1PWC A;  4Y15 A;  1TS6 A;  3G34 A;  1ES5 A;  4WLA A;  1YLP A;  2ZMA A;  1PWG A;  2D02 A;  4FSF A;  4OLD A;  1K4F A;  5GHX A;  2XQZ A;  5J4E A;  1ESU A;  3G35 A;  2GJ3 A;  1VB6 A;  1MC0 A;  1NLY A;  1VQQ A;  2HPB A;  2PU4 A;  5HX9 A;  3LO7 A;  4ZJ3 A;  1JTG A;  4Q0H A;  3SS4 A;  1M40 A;  3UY6 A;  4I3J A;  3DTI A;  4LPZ A;  1Y4O A;  1EW0 A;  2FFY A;  1O7E A;  3K2N A;  5KMW A;  4P87 A;  4QWO A;  1KGE A;  3IF6 B;  3E2K A;  4X55 A;  2PYP A;  2IA2 A;  3VP1 A;  3AGD A;  3AGE A;  5CEC A;  1HTZ A;  3BLS A;  3ZNY A;  5HZH A;  4JGR A;  2XK1 A;  1VEU B;  5CHU A;  4PM5 A;  2D01 A;  2B5R A;  3O5Y A;  5HAP A;  1LSV A;  3HVF A;  4WL9 A;  3G2Y A;  2W1T A;  1BT5 A;  5EVI B;  1FQG A;  1OTE A;  1XJ3 A;  4HQA A;  3KSI A;  3VOL A;  4LRX C;  1IKG A;  4RX3 A;  3LIC A;  4WEL A;  4I5S A;  4OQI A;  3PHY A;  3BEC A;  3VE3 A;  2EX8 A;  5AQ9 A;  1RGY A;  2EFU A;  3WRZ A;  4JF5 A;  3QNB A;  1NRJ A;  4OLG A;  3KYE A;  4WEJ A;  1ZKJ A;  3NC8 A;  4DRT A;  1OTB A;  1RGZ A;  1H3Q A;  4JPM A;  3TJZ C;  4N1H A;  4WYY A;  1CF0 A;  4Y17 A;  4HNB A;  1JNU A;  5G18 A;  3W2Z A;  1YMX A;  4DXC A;  5TR7 A;  2O9C A;  4BJP A;  1PZO A;  3EQU A;  3PBS A;  2GNX A;  3DAV A;  4E3J A;  3BY8 A;  3CG5 A;  3UB5 P;  2JN7 A;  2KOI A;  5EE8 A;  4KZ9 A;  2J9O A;  4P85 A;  4Z1W A;  4DJ2 A;  1E25 A;  1MXO A;  1LL8 A;  2ZC5 B;  4HJ4 A;  3DWK A;  3CPT A;  4K91 A;  3A3F A;  3IWO A;  5KIZ A;  4CLC D;  4QY6 A;  3MJQ A;  3HRE A;  4R70 A;  3D9Y A;  1VET B;  4KZ4 A;  3TOI A;  5LBR A;  4LRY C;  3SOI A;  3VV4 A;  4Q0J A;  5HWT A;  2X02 A;  4LFU A;  4S2N C;  4IVI A;  1E3U A;  3UO9 A;  4GS9 A;  5FAT A;  3V3S A;  5HAQ A;  4KUO A;  2B95 A;  2GZA A;  3IHA A;  1SDN A;  3WS2 A;  5DKK A;  4KZ3 A;  2HZ5 A;  4A5R A;  1TDG A;  3UPP A;  1CI9 A;  3P09 A;  2HV1 A;  3A3J A;  4OVD A;  3LI8 A;  1GHI A;  3FZC A;  1OT6 A;  3LEQ A;  4MBK A;  1XPB A;  2HDR A;  4OPQ A;  4NKP A;  4RX2 A;  2ZQ9 A;  4GS9 B;  4Q8I A;  4FUW A;  4QB8 A;  3IH8 A;  4NXG A;  2HF6 A;  4UQI S;  4EER A;  4BBT A;  4DXB A;  3H82 A;  4LV2 A;  1TS7 A;  1FR6 A;  1JWZ A;  3G6O A;  1VEU A;  1ODV A;  1ZC2 A;  1U60 A;  4PKY G;  1L0E A;  1F5M A;  4FOF A;  4JXW A;  3UPO A;  3JYI A;  3H7W B;  2EX6 A;  3TG9 A;  3C30 A;  2Y55 A;  4H8R A;  3EOI A;  4X68 A;  4DN0 A;  3E2L A;  4BBU A;  4GHI A;  3EGD C;  2ZQA A;  1Y54 A;  4HJ6 A;  2Y2O A;  3IT9 A;  1F2K A;  3VSK A;  4PHT A;  3A3I A;  3HL9 A;  2PBD P;  2Q0O A;  3NBL A;  2OLV A;  2PDR A;  1QMF A;  1SHV A;  1TVF A;  4DDS A;  3ZFZ A;  1MY8 A;  4Z9Q A;  1KE4 A;  2HJE A;  4IHQ A;  4MLL A;  4Y0U A;  2R9X A;  2M7U A;  1IKI A;  4MMN A;  3PBT A;  3S1Y A;  2HP5 A;  1L0D A;  3O87 A;  1Y28 A;  2P7J A;  2A24 B;  4R0Q A;  4MNR A;  1YLJ A;  3MZF A;  5GHY A;  3BWL A;  2W27 A;  3UN7 A;  4FH4 A;  2VV6 A;  2BAS A;  1YMS A;  4M3K A;  3V50 A;  4DE3 A;  1STZ A;  3LFV A;  1GA0 A;  4KG5 A;  3CJM A;  4JGP A;  1ZTU A;  4QPR A;  3R4K A;  3F1N B;  1V9Z A;  3VP3 A;  4NET A;  2Y2G A;  4DF6 A;  3QP2 A;  1D06 A;  4O01 A;  1HD8 A;  1XJ6 A;  4B93 A;  4XT2 B;  1K55 A;  5DKL A;  3A0V A;  3HLF A;  1TS8 A;  4ID4 A;  4S2I A;  3CIT A;  5DF9 A;  2L4R A;  1XFN A;  2DNS A;  3IS2 B;  2LB9 A;  5E2G A;  2EA9 A;  3T4Q A;  1YT4 A;  4X56 A;  1KVL A;  5CHM A;  5C5K A;  1LSW A;  3K3D A;  1KE0 A;  2WAD A;  1VET A;  4EES A;  2Q9N A;  5HDC A;  3JPU A;  3UB9 A;  1SKO A;  1MPL A;  1TF1 A;  3QP8 A;  2E8I A;  4HP4 A;  2AVX A;  4L9F A;  4B88 A;  5IU1 A;  4ZJ2 A;  3NOT C;  2DMW A;  1SDE A;  3C5A A;  3SH8 A;  4MN5 A;  3BFF A;  1HVB A;  4N9K A;  4OQ0 A;  3IXB A;  1JTD A;  2ZOI A;  1S66 L;  2X71 A;  4KZ6 A;  4KZ8 A;  3HLW A;  3MZE A;  4Y0T A;  1XKZ A;  3CUE A;  2WKQ A;  4KQD A;  2IWB A;  1CEG A;  3ZG7 B;  4KZ5 A;  1GCE A;  1D7E A;  4PAU A;  3UE0 A;  4F3L B;  2BLS A;  1YLY A;  3NUL A;  1ERM A;  3BFG A;  2WUQ A;  4NXE A;  3UPN A;  2H0Y A;  3V5M A;  2H28 A;  4Y7P A;  3MKF A;  2BTF P;  2QJ5 A;  4RVA A;  3VP4 A;  5CED A;  2C5W B;  4KZB A;  3LCE A;  4UQI M;  2G2W A;  3SH9 A;  5EEC A;  1MKI A;  3ICY A;  1OTD A;  2K7S A;  4H6J B;  2ZM8 A;  2EWV A;  3DBA A;  4P6Z S;  1I2W A;  1Q2Q A;  5F82 A;  3MMH A;  1FOF A;  4JBF A;  1YKD A;  2Z6D A;  1S1Y A;  1L3L A;  4S2P A;  2Y2N A;  2HDS A;  1FCN A;  5EVE A;  4DDY A;  2B02 A;  3BFD A;  5L07 A;  3LIA A;  4WMC A;  1VM1 A;  2EX2 A;  2ZC7 A;  1JWV A;  5EVI A;  1ERQ A;  1AWI A;  4ETX A;  1KDS A;  4S2L A;  2W0N A;  4E6X A;  4KQR A;  4JGO A;  3ZQ5 A;  3A0S A;  4OPZ A;  1IEM A;  3LEZ A;  2K2N A;  3FV7 A;  4KZA A;  4HES A;  1DP9 A;  3GMW A;  2ZC4 B;  4UA7 A;  2WKH A;  4WMC D;  2J7V A;  4F94 A;  1K55 C;  1LL9 A;  5DTK A;  2W3D A;  4I3A A;  4U0X A;  3Q1F A;  1K25 A;  1S67 L;  3MKE A;  2W3E A;  5JYO A;  3I7J A;  3IWQ A;  1KE3 A;  5U47 A;  1ZG6 A;  2ZQC A;  2XEP A;  3S4X A;  3UDI A;  4DE0 A;  1YSP A;  4BD1 A;  3WS0 A;  1MBL A;  5DTT A;  3VMA A;  3BFE A;  4IUH A;  3IS2 A;  3HCY A;  4C75 A;  2XD1 A;  2VV7 A;  4JLF A;  3PAE A;  1S4R A;  2ZOH A;  4KZ7 A;  3M6B A;  2WZX A;  1XJ4 A;  3S7N A;  4CJN A;  2ZC3 B;  2V9A A;  3CLO A;  5TBM A;  2IWD A;  3U4L P;  4E3K A;  4QHC A;  2EFX A;  2CC1 A;  3WWX A;  5DTS A;  4HOI A;  1CEF A;  4F3L A;  4OH0 A;  5A92 A;  2ZQ8 A;  5HD3 A;  4DJ3 A;  5DVA A;  1YM1 A;  2FH5 A;  3OLO A;  1RP5 A;  1N9L A;  2JE5 A;  3T12 B;  2V8C A;  1A0K A;  2OOL A;  3M6H A;  4P0M A;  5CTM A;  3CMZ A;  4G3W A;  3OPP A;  3WRT A;  1VHM A;  4LRZ E;  4MCW A;  1OT9 A;  1IYO A;  2PYR A;  2Q9M A;  2P9V A;  2PU2 A;  3HLE A;  1DJB A;  1MWT A;  1I2S A;  1XP4 A;  2JKF A;  1LHY A;  4OOL A;  5FAQ A;  1FCM A;  3KSH A;  3BM6 A;  4HI4 A;  2QMI A;  3ZG9 B;  5IT5 A;  3S7O A;  3EWK A;  2ACG A;  3SZT A;  1IEL A;  2YKH A;  4EQI A;  1G5U A;  2Y91 A;  4RQ9 A;  3LID A;  5DFY A;  4QU3 A;  1XXM A;  3V67 A;  2PD8 A;  2DCF A;  1S6R A;  2ZQ7 A;  2M1C A;  4QD4 A;  3HUN A;  4WBG A;  3R7W A;  4GJ4 A;  4N1X A;  2V1B A;  4NK3 A;  5F5Y A;  2WKE A;  2O9B A;  2VJW A;  2H10 A;  1BYW A;  3CZD A;  5DFX A;  4EW7 A;  1W79 A;  1OJ5 A;  4RA7 A;  3PXP A;  3T1R A;  1EWZ A;  2XA7 S;  5FDH A;  2ZM0 A;  2R9W A;  4U3T A;  4WZ5 A;  1YQS A;  4DMZ A;  3ZYT A;  3IX3 A;  3IF5 A;  2ZMF A;  3FG8 A;  3CI6 A;  3UDF A;  5EVI D;  3S7Q A;  1KGG A;  3C2W A;  3G31 A;  3D4F A;  3BQ8 A;  1H0M A;  3P01 A;  3T4K A;  3KSG A;  4R6L A;  2ZL1 B;  3JVU A;  4EET B;  1P9R A;  2H5S A;  2INW A;  5GLA A;  3TRC A;  3NIA A;  4MBH A;  3T50 A;  4MN6 A;  1G28 A;  1JWP A;  3GTC A;  3VOZ A;  4LV3 A;  2ZBB A;  3C38 A;  4PKY A;  1DJC A;  1BSG A;  1MKM A;  1XA1 A;  5FQJ A;  4E3O A;  5TGF A;  1LT0 A;  3W4Q A;  3P7N A;  3MXS A;  2QKP A;  3ITB A;  1NWZ A;  3MXR A;  3PBO A;  4HBU A;  4NXF A;  5FEF A;  3M2K A;  5GLC A;  1RCJ A;  4ZTK A;  2XR0 A;  4R4R A;  3BQA A;  1BTL A;  4FCF A;  1DP6 A;  1PYY A;  2ZL1 A;  1IOU A;  3MQQ A;  3ISG A;  5G4Y A;  3O3V A;  4ZDX A;  5TJJ A;  1TEM A;  4IUK A;  2V0W A;  2RCX A;  5CGW A;  2R78 A;  5A90 A;  2LB5 A;  3PBR A;  3ZVW A;  3E98 A;  3W4P A;  1K6R A;  4ME4 A;  5AVE A;  4P6Z M;  5MC7 A;  4WUJ A;  5CXW A;  5F6A A;  4OPR A;  5EFW A;  1K56 D;  1K6S A;  3ZDJ A;  1AXB A;  2Y2Q A;  4IED A;  5FQ9 A;  3G32 A;  2WGW A;  2A24 A;  4X1M A;  3CHW P;  5EVI C;  5FI7 A;  2WZZ A;  2P74 A;  3IHB A;  4H6J A;  2XH9 A;  5EOE A;  5GL9 A;  4EEP A;  4N9L A;  5TFQ A;  2JKT I;  4IVK A;  1FSY A;  2CMN A;  1FCO A;  2PD7 A;  2O99 A;  2V20 A;  3IF6 A;  3OPH A;  2DRW A;  3BYD A;  4R3J A;  3QP4 A;  4S2K A;  3HJI A;  1NZO A;  2P04 A;  4OOM A;  3PR6 A;  4X25 A;  1GSW A;  5FEG A;  5HSQ A;  1GHM A;  1PW1 A;  2A49 A;  4U0T A;  5DJT A;  4HJ3 A;  3IXD A;  5GLD A;  3T1S A;  4BLM A;  5IHV A;  1W63 Q;  3Q81 A;  5AQB A;  5GLB A;  2NUP C;  1Z09 A;  4B4Z A;  5HL1 A;  3FC7 A;  1H8Z A;  3LR5 A;  1MWS A;  2L0W A;  4DE2 A;  1EI5 A;  3NY4 A;  1NZU A;  3UB7 A;  3D3O A;  4G3V A;  2OAP 1;  4GKU A;  4N92 A;  4O7D A;  3CPT B;  5F1G A;  3T4J A;  3WS4 A;  4YNR A;  1T1B A;  2J3T C;  3OCL A;  3DTE A;  4K08 A;  4R3A A;  5CGX A;  1G6A A;  3FPW A;  2WAE A;  5HAR A;  4WEK A;  1J9M A;  1H5X A;  1K4E A;  2BG1 A;  3WS1 A;  5DF8 A;  4HBT A;  1LLB A;  5HDS A;  1CJF A;  2XFS A;  2ZLY A;  3KSF A;  5L8M A;  1H8Y A;  1J3W A;  5DJU A;  3BLM A;  4EBP A;  2A3U A;  5TBM B;  4GD6 A;  3RTY A;  2C6W B;  2Z2L B;  3LR0 A;  3IWI A;  2ZD8 A;  3V3R A;  4KQQ A;  2XD5 A;  4LCM A;  4JXG A;  1XGI A;  3G4P A;  2XF3 A;  1BZA A;  1ES2 A;  2WKI A;  3VFH A;  2Z6C A;  5HFO A;  1UWN X;  4GCZ A;  2VEA A;  1L2S A;  4NXB A;  4PMA A;  2JC7 A;  5L09 A;  5J3W A;  3G30 A;  2GDN A;  4FD8 A;  4LV1 A;  3S7P A;  4BD0 A;  5AQ7 A;  3TE8 A;  2PHY A;  3UDX A;  1V9Y A;  4JGQ A;  3IXG A;  4C3Q A;  2Y2H A;  3ZCZ A;  4KG2 A;  3OC2 A;  2V1A A;  2JKR M;  3MF0 A;  1WE4 A;  3UME A;  3RFB A;  1OTA A;  3E4Q A;  2XRN A;  3OCN A;  3LIF A;  4EBL A;  2OV5 A;  5L2F A;  3B47 A;  2W3H A;  4PPR A;  2KDK A;  2VGL S;  4ARZ A;  3O86 A;  1ZHH B;  5AQA A;  4O0P A;  3BJN A;  3F1O A;  5CEB A;  3ZG8 B;  4LCL A;  1XFQ A;  3MQ0 A;  3LUQ A;  3PAG A;  3DWZ A;  3LYX A;  4GOG A;  4O8G A;  2GX5 A;  3IXH A;  3CAX A;  5CRF A;  2E8J A;  1C3B A;  1MZU A;  2FFF B;  1E4D A;  3UB8 A;  4CLC C;  4OON A;  4GHI B;  1OPX A;  4E6W A;  4ARZ B;  4RYE A;  1PI5 A;  3LI9 A;  1W8Y A;  4PM7 A;  1WYC A;  3QNC A;  1K56 A;  4OP8 A;  3MSH A;  4HIA A;  5HL6 A;  3M2J A;  5M1A A;  4I38 A;  4MBF A;  2Y59 A;  3ULF A;  4G3K A;  2YKF A;  1XJ2 A;  2G7U A;  1DY6 A;  1ALQ A;  1ONG A;  3E4P A;  4P6B A;  3N8R A;  1I5Q A;  3FWL A;  3MZD A;  1ES4 A;  1T1C A;  4BL2 A;  2XA7 M;  1S0W A;  5D3O A;  3PTE A;  3RXX A;  3LIE A;  1GSV A;  4Y0O A;  1L0G A;  2W1T B;  2Y4A A;  1GSX A;  1SKF A;  2FZ0 A;  3LR3 A;  1ONH A;  3BRM A;  3OBF A;  4B4X A;  4HH2 A;  2ZJ9 A;  2ZC6 B;  2Y2M A;  5CHJ A;  5FQI A;  1H8M A;  1NYY A;  4ZJ1 A;  1W7F A;  3KYZ A;  4UAA A;  2Y2J A;  1N9N A;  1SKO B;  4PM9 A;  4E3I A;  3NEC A;  4I39 A;  3AGF A;  1G6O A;  2Y2K A;  2XFT A;  1PRQ A;  3C8C A;  4FH2 A;  4ESP A;  4CLC B;  5E2H A;  3MS6 A;  3Q7V B;  2QZ6 A;  1S4S A;  3FKW A;  2VKS A;  2QWS A;  1KVM A;  1WA9 A;  1CQA A;  4WZ4 A;  5FL3 A;  4K0W A;  1F98 A;  4DE1 A;  4UA6 A;  3S22 A;  2PBY A;  2W1R A;  1DP8 A;  5HD5 A;  3BFC A;  2XDM A;  2V2F F;  1YSQ A;  4XXR A;  2I9V A;  1K54 A;  3G2Z A;  5FI6 A;  3Q82 A;  3NJA A;  4D60 A;  1UWP X;  2PAV P;  3VP0 A;  4X1L A;  4WZ5 C;  3MBZ A;  1BLH A;  3ZG5 A;  1P0Z A;  4MEZ A;  3C4P A;  4PM6 A;  3EQV A;  1PZP A;  1W63 M;  3B33 A;  1NY0 A;  3UMD A;  2OLU A;  1P97 A;  3FYZ A;  3DTM A;  5A91 A;  2JKG A;  1IYQ A;  1ES3 A;  2WAF A;  5FQQ A;  3E4O A;  4BL3 A;  2J80 A;  2QJ7 A;  3TW8 A;  3MQO A;  3UE6 A;  1WYB A;  1PWD A;  2QHK A;  3RJU A;  4HY8 A;  5G4Z A;  3A0R A;  3OZH A;  2EXB A;  5KSC A;  3GV9 A;  4CLC E;  3UB6 A;  4OQH A;  4OOY A;  5FAO A;  3N8L A;  3W4O A;  2VA0 A;  3HJK A;  4GZB A;  4ZAM A;  3RH8 B;  3IBJ A;  2JKT M;  4FTX A;  4X6T A;  2XLN A;  4E3L A;  2HGV A;  4LEN A;  1M6K A;  1PIO A;  5FI2 A;  2WK0 A;  1LSX A;  1KGF A;  1LI0 A;  3BEB A;  2VLG A;  4NG2 A;  5FQK A;  3GSG A;  2A2L A;  2EWW A;  4JXS A;  4Y2F A;  2KLI A;  3UE1 A;  2J8Y A;  2OWH A;  3HUM A;  4LGW A;  5BOH A;  3MR0 A;  2M7V A;  3KO6 A;  3GEC A;  2O0Y A;  4XUX A;  4WF0 A;  3W8K A;  1E3U D;  3O88 A;  3GRJ A;  2IWC A;  4IBX A;  1T18 A;  1PI4 A;  2EXA A;  4C6Y A;  3ITA A;  4L0L A;  2G2U A;  4Y13 A;  4S2O A;  4XUZ A;  4EUV A;  4YWZ A;  3NCK A;  1N9O A;  2XGN A;  3PBQ A;  4Y5F A;  3ZNT A;  4EWF A;  5AVF A;  1IFQ A;  2V1Z A;  5GHZ A;  4ZBE A;  3F1P B;  2QPN A;  3JVV A;  3N6I A;  3IQA A;  3IX8 A;  5E2F A;  1G68 A;  5CTN A;  4II7 A;  4BWI A;  3L7H A;  1D1J A;  2I72 A;  3MXQ A;  4BQM A;  5HDD A;  2VGJ A;  2ZQD A;  3N4I A;  3B3X A;  1K57 A;  1LL5 A;  2VZW A;  5DF7 A;  2PT7 A;  1TD5 A;  4UEY A;  1FSW A;  1NYM A;  3T1Q B;  3IX4 A;  3T4T A;  2X01 A;  3R7W B;  1T1A A;  4QY5 A;  2WKP A;  1SCW A;  2O9A A;  3GDI A;  2PR6 A;  3A3E A;  5HWW A;  3EGX C;  3SW1 A;  3QP1 A;  1XX2 A;  5M19 A;  3IBR A;  3DTK A;  4KQO A;  3Q07 A;  3WS5 A;  2HDU A;  3H9W A;  3HBR A;  1DRM A;  5EPH A;  3SH7 A;  4GNU A;  1YAX A;  1ESI A;  4KUK A;  4DKI A;  1LI9 A;  1L0F A;  3Q7V A;  3VSL A;  4GDB A;  4MDZ A;  3T4S A;  5K5B A;  2MJ6 A;  2V0U A;  3C7U A;  2W3F A;  3QHY A;  1NLZ A;  2OAQ 1;  3QP5 A;  1KDW A;  3HLD A;  2JKR I;  1NXY A;  4EV4 A;  2Y2L A;  3T4O A;  4R23 A;  5EUA A;  3HUO A;  3PBN A;  2HP6 A;  1GHP A;  2B18 A;  3B42 A;  1W8Q A;  2Y8H A;  3P98 A;  3GQZ A;  3LIB A;  5IS1 A;  4XT2 A;  2RL3 A;  1CI8 A;  5I5L A;  2XRO A;  1TDL A;  1QME A;  4KG6 A;  2UWX A;  3UNW A;  2JBF A;  5EOO A;  1XGJ A;  3FKV A;  1K57 C;  1ACF A;  5CER A;  5A93 A;  4HP9 A;  2WGI A;  3F1N A;  1OTI A;  1O07 A;  5E43 A;  5F1F A;  1K0K A;  3C7V A;  3V39 A;  5FAP A;  1BLP A;  1YPR A;  3A3D A;  1HZO A;  3KX0 X;  2WGV A;  1N9B A;  5HWV A;  4K0X A;  1FIK A;  1NJ4 A;  4GW9 A;  1K54 C;  5CX7 A;  5F69 A;  3N7W A;  3ZGA B;  2NUT C;  5FSR A;  1Z6F A;  4CLC A;  4EQ1 A;  2Y2I A;  4R1G A;  2OWJ A;  5CGS A;  2WGW B;  3BY9 A;  1ERO A;  3E0Y A;  1YLW A;  1XA7 A;  1MWR A;  4YIN A;  5L10 A;  2VV8 A;  2EX9 A;  3CUE C;  1FR1 A;  1NRF A;  3D72 A;  2J3W A;  2PR5 A;  5FDS A;  4GD8 A;  2OSU A;  1JVJ A;  3NDE A;  4X53 A;  4NEE D;  2PRF A;  3KYQ A;  4L9G A;  2VK3 A;  3MFD A;  4M4X A;  3F1O B;  5HPI A;  2ZMV A;  3VOY A;  3T4L A;  5EV0 A;  1K38 A;  2W3G A;  5F68 A;  2ZM2 A;  3H7W A;  4BMW A;  2VGK A;  4GN2 A;  2KX6 A;  4LV0 A;  2QYB A;  1PNE A;  5E2E A;  4E3M A;  2VGL M;  1TS0 A;  3N8S A;  5F83 A;  4LLO B;  3VP2 A;  1P9W A;  5EVL A;  3GVB A;  4JXV A;  1X0O A;  3H82 B;  1BLC A;  4R3B A;  2HP9 A;  3VFF A;  5A8B A;  3LY4 A;  3HLB A;  3T1X A;  5AJG A;  4YOF A;  3NOU C;  3CWF A;  5FQM A;  4R38 A;  2JHE A;  1PW8 A;  3F1P A;  4GDN A;  5KSH A;  3UE3 A;  5HPF A;  2V8F A;  1UGU A;  1OJG A;  5HAI A;  4IBR A;  2HJ9 C;  5EM1 A;  5J8X A;  3U2A A;  3ZHH A;  5JYP A;  2H0T A;  4JKT A;  3NI9 A;  3SS3 A;  3L9K A;  2P08 A;  1IYS A;  2J9P A;  4S2M A;  3OPR A;  4E04 A;  2VX8 A;  3FPV A;  2Z2M B;  4WM9 A;  3PYP A;  1GA9 A;  3EEA A;  2XSS A;  1Q2P A;  4I3I A;  2WYX A;  3BW6 A;  1BUL A;  2HDQ A;  4MN7 A;  1N4O A;  3DW0 A;  1PFL A;  4OPY A;  3LR4 A;  1BLS A;  2L1M A;  1T19 A;  2K31 A;  4BBV A;  4BEN A;  4S2N A;  3K3C A;  3OOV A;  1CK3 A;  4EXO A;  4X69 A;  1F9I A;  4JF4 A;  4GB7 A;  4UA9 A;  1S1Z A;  5FA7 A;  3GR2 A;  2JCH A;  4S2J A;  5KZH A;  4EBN A;  1YLT A;  4E3N A;  1BUE A;  4OQG A;  4D2O A;  1ZG4 A;  4YFM A;  4Q0I A;  4ZRR A;  4KEN B;  4QJG A;  4CQH A;  4B9O A;  3QP6 A;  4HH3 A;  4PM8 A;  3VE4 A;  4HEF A;  4IJG A;  4UHU A;  5M18 A;  2P9V B;  3ZVT A;  3IF6 C;  3LGO A;  3HLG A;  1DJA A;  2UV0 E;  4R4S A;  1IYP A;  1FIL A;  3NHQ A;  4L9E A;  3OPL A;  4ETZ A;  4EUZ A;  4EEU A;  3HLC A;  3MFX A; 
#chains in the Genus database with same CATH homology
 5CXW A;  5FAS A;  2WK0 A;  2DNS A;  3NDG A;  4OPR A;  1MWU A;  1K56 D;  5E2G A;  3RXW A;  5I94 A;  1K6S A;  1KGF A;  1LI0 A;  3ZDJ A;  1AXB A;  2Y2Q A;  3BEB A;  4IED A;  5FQK A;  5FQ9 A;  3GSG A;  4JXS A;  1YT4 A;  3G32 A;  2WGW A;  3UE1 A;  4CPK A;  4JF6 A;  2J8Y A;  1KVL A;  4X56 A;  5EVI C;  5HW3 A;  3LY3 A;  5FI7 A;  5CHM A;  3C4O A;  2WZZ A;  3HUM A;  2P74 A;  3TSG A;  5BOH A;  3IHB A;  1OME A;  1KE0 A;  2WAD A;  3ZG0 A;  2XH9 A;  1W5D A;  5EOE A;  5GL9 A;  4N9L A;  2Y2P A;  5TFQ A;  4OP5 A;  4IVK A;  1FSY A;  3SS5 A;  1YLZ A;  2Q9N A;  4OKP A;  4XUX A;  1FCO A;  3W8K A;  1E3U D;  3O88 A;  2V20 A;  3IF6 A;  3IH9 A;  3Q7Z A;  1MPL A;  3GRJ A;  2IWC A;  3OPH A;  1PWC A;  2E8I A;  2DRW A;  3G34 A;  1ES5 A;  3BYD A;  4IBX A;  4R3J A;  4S2K A;  4B88 A;  1NZO A;  4OOM A;  4ZJ2 A;  1YLP A;  2ZMA A;  1SDE A;  3C5A A;  1PI4 A;  2EXA A;  3SH8 A;  4C6Y A;  3BFF A;  3ITA A;  1PWG A;  1HVB A;  4L0L A;  4N9K A;  2G2U A;  4OQ0 A;  4FSF A;  3IXB A;  1JTD A;  4S2O A;  4OLD A;  1K4F A;  5GHX A;  1GHM A;  1PW1 A;  2A49 A;  2X71 A;  4KZ6 A;  4U0T A;  3NCK A;  4XUZ A;  4KZ8 A;  2XQZ A;  2XGN A;  3HLW A;  3PBQ A;  3MZE A;  3IXD A;  5GLD A;  4Y0T A;  3ZNT A;  4EWF A;  4BLM A;  5IHV A;  1ESU A;  3G35 A;  2V1Z A;  1XKZ A;  5GHZ A;  3Q81 A;  4ZBE A;  2QPN A;  5AQB A;  3N6I A;  5GLB A;  1VQQ A;  2HPB A;  2PU4 A;  5HX9 A;  4B4Z A;  2IWB A;  5HL1 A;  1H8Z A;  1CEG A;  3ZG7 B;  4KZ5 A;  1GCE A;  3LO7 A;  1MWS A;  4ZJ3 A;  3IQA A;  3UE0 A;  2BLS A;  1YLY A;  5E2F A;  1G68 A;  5CTN A;  1JTG A;  4DE2 A;  1EI5 A;  1ERM A;  3BFG A;  3SS4 A;  3NY4 A;  2WUQ A;  1M40 A;  2I72 A;  3UPN A;  2H0Y A;  3V5M A;  1NZU A;  3UY6 A;  4BQM A;  2VGJ A;  2ZQD A;  3N4I A;  3B3X A;  4Y7P A;  1K57 A;  4GKU A;  3MKF A;  4RVA A;  3VP4 A;  1LL5 A;  2FFY A;  5DF7 A;  1O7E A;  5CED A;  2C5W B;  4KZB A;  3LCE A;  4N92 A;  2G2W A;  4O7D A;  5F1G A;  3SH9 A;  5KMW A;  4P87 A;  5EEC A;  3WS4 A;  1MKI A;  1KGE A;  3IF6 B;  1FSW A;  3E2K A;  4X55 A;  3OCL A;  1NYM A;  5CGX A;  1G6A A;  2WAE A;  3VP1 A;  5HAR A;  3AGD A;  3AGE A;  2ZM8 A;  2X01 A;  5CEC A;  4WEK A;  1I2W A;  4QY5 A;  1HTZ A;  1Q2Q A;  1SCW A;  1J9M A;  3BLS A;  3ZNY A;  2XK1 A;  4PM5 A;  5CHU A;  1H5X A;  2B5R A;  1K4E A;  2BG1 A;  5F82 A;  3A3E A;  3WS1 A;  5DF8 A;  1FOF A;  5HAP A;  4JBF A;  4HBT A;  1LLB A;  4S2P A;  2ZLY A;  2XFS A;  3HVF A;  3G2Y A;  2Y2N A;  1H8Y A;  2HDS A;  1XX2 A;  5M19 A;  1FCN A;  3BLM A;  4KQO A;  4EBP A;  2A3U A;  3Q07 A;  3WS5 A;  4GD6 A;  2C6W B;  4DDY A;  2HDU A;  2Z2L B;  1BT5 A;  3BFD A;  3HBR A;  3IWI A;  4WMC A;  5EVI B;  1FQG A;  1VM1 A;  2EX2 A;  2ZC7 A;  2ZD8 A;  3V3R A;  1JWV A;  4KQQ A;  5EPH A;  5EVI A;  1ERQ A;  2XD5 A;  3SH7 A;  4GNU A;  4LCM A;  1IKG A;  4JXG A;  1XGI A;  3G4P A;  1ESI A;  2XF3 A;  4RX3 A;  1BZA A;  1KDS A;  1ES2 A;  2WKI A;  4S2L A;  4WEL A;  4DKI A;  4OQI A;  1LI9 A;  3BEC A;  4KQR A;  4E6X A;  1L0F A;  3VFH A;  2EX8 A;  5AQ9 A;  1RGY A;  3Q7V A;  2EFU A;  3VSL A;  5HFO A;  4GDB A;  3WRZ A;  4OPZ A;  4JF5 A;  1IEM A;  3QNB A;  3LEZ A;  3C7U A;  1L2S A;  3FV7 A;  4PMA A;  2JC7 A;  4OLG A;  4KZA A;  4HES A;  4WEJ A;  3QHY A;  3GMW A;  1ZKJ A;  3NC8 A;  2ZC4 B;  4UA7 A;  2WKH A;  4WMC D;  3G30 A;  1KDW A;  2GDN A;  2J7V A;  4FD8 A;  4F94 A;  1K55 C;  1LL9 A;  3HLD A;  5DTK A;  1NXY A;  4DRT A;  4EV4 A;  4LV1 A;  2Y2L A;  4BD0 A;  5AQ7 A;  1RGZ A;  4U0X A;  3Q1F A;  4R23 A;  3UDX A;  5EUA A;  4JPM A;  3HUO A;  1K25 A;  3PBN A;  2HP6 A;  4N1H A;  4WYY A;  1GHP A;  3MKE A;  3IXG A;  5JYO A;  3I7J A;  4C3Q A;  2Y2H A;  3ZCZ A;  4KG2 A;  1W8Q A;  3IWQ A;  3OC2 A;  1KE3 A;  5G18 A;  1YMX A;  3P98 A;  1WE4 A;  5U47 A;  1ZG6 A;  5TR7 A;  4DXC A;  2ZQC A;  3GQZ A;  4BJP A;  3OCN A;  1PZO A;  4EBL A;  2OV5 A;  5L2F A;  3EQU A;  3PBS A;  2RL3 A;  2XEP A;  1CI8 A;  3S4X A;  4PPR A;  3UDI A;  1TDL A;  4DE0 A;  1QME A;  4BD1 A;  4E3J A;  3CG5 A;  3WS0 A;  1MBL A;  4KG6 A;  5EE8 A;  2UWX A;  5DTT A;  3O86 A;  3BFE A;  3UNW A;  2JBF A;  3VMA A;  5EOO A;  1XGJ A;  3FKV A;  1K57 C;  4KZ9 A;  2J9O A;  5AQA A;  4C75 A;  5CER A;  4P85 A;  5A93 A;  2WGI A;  5CEB A;  3ZG8 B;  4LCL A;  2XD1 A;  4JLF A;  1E25 A;  1MXO A;  1O07 A;  3PAE A;  5E43 A;  5F1F A;  3PAG A;  3C7V A;  3DWZ A;  3V39 A;  4GOG A;  5FAP A;  2ZC5 B;  3IXH A;  1BLP A;  3A3D A;  3M6B A;  4KZ7 A;  5CRF A;  1C3B A;  2WZX A;  1HZO A;  3DWK A;  2WGV A;  1N9B A;  2FFF B;  1E4D A;  4K0X A;  4K91 A;  3A3F A;  3IWO A;  4CJN A;  2ZC3 B;  1NJ4 A;  1K54 C;  4OON A;  4QY6 A;  2IWD A;  4E6W A;  3HRE A;  3N7W A;  4E3K A;  4QHC A;  4KZ4 A;  3ZGA B;  3TOI A;  2EFX A;  2CC1 A;  3WWX A;  4RYE A;  1PI5 A;  5DTS A;  5FSR A;  1W8Y A;  4PM7 A;  1Z6F A;  1WYC A;  3QNC A;  3SOI A;  1CEF A;  1K56 A;  2X02 A;  2Y2I A;  4OP8 A;  4R1G A;  4IVI A;  4S2N C;  5CGS A;  4OH0 A;  1E3U A;  3M2J A;  5M1A A;  3UO9 A;  2WGW B;  5A92 A;  4MBF A;  2Y59 A;  5FAT A;  2ZQ8 A;  1ERO A;  3V3S A;  5DVA A;  1YM1 A;  5HAQ A;  1YLW A;  1DY6 A;  1XA7 A;  1MWR A;  1RP5 A;  1ALQ A;  3IHA A;  1ONG A;  4YIN A;  4P6B A;  2JE5 A;  1SDN A;  2EX9 A;  1FR1 A;  3N8R A;  1I5Q A;  3FWL A;  3WS2 A;  3MZD A;  1NRF A;  1ES4 A;  4KZ3 A;  3M6H A;  4P0M A;  4BL2 A;  5CTM A;  4A5R A;  3CMZ A;  5D3O A;  1S0W A;  1TDG A;  3OPP A;  3UPP A;  1CI9 A;  3PTE A;  3RXX A;  3P09 A;  4GD8 A;  2OSU A;  1JVJ A;  3NDE A;  4X53 A;  3WRT A;  3A3J A;  4OVD A;  1GHI A;  3FZC A;  4Y0O A;  3MFD A;  1IYO A;  1L0G A;  2Y4A A;  3VOY A;  2Q9M A;  2P9V A;  1SKF A;  4MBK A;  2PU2 A;  3HLE A;  1XPB A;  1DJB A;  1MWT A;  1I2S A;  1K38 A;  2HDR A;  4OPQ A;  1XP4 A;  4RX2 A;  1LHY A;  2ZQ9 A;  4OOL A;  2ZM2 A;  5FAQ A;  1FCM A;  1ONH A;  2VGK A;  3BM6 A;  4GN2 A;  4Q8I A;  3BRM A;  4LV0 A;  2QMI A;  4B4X A;  2ZJ9 A;  2ZC6 B;  2Y2M A;  4QB8 A;  3ZG9 B;  3IH8 A;  5E2E A;  5CHJ A;  4E3M A;  3N8S A;  5F83 A;  5FQI A;  3VP2 A;  1IEL A;  4EQI A;  1NYY A;  4DXB A;  5EVL A;  3GVB A;  2Y91 A;  4ZJ1 A;  4JXV A;  1BLC A;  1W7F A;  4UAA A;  4LV2 A;  4R3B A;  2Y2J A;  2HP9 A;  1XXM A;  4QU3 A;  3VFF A;  1FR6 A;  3LY4 A;  4PM9 A;  1JWZ A;  2DCF A;  1S6R A;  2ZQ7 A;  4E3I A;  3HLB A;  4QD4 A;  1ZC2 A;  3AGF A;  1U60 A;  3HUN A;  4WBG A;  2Y2K A;  1L0E A;  4JXW A;  3UPO A;  2XFT A;  3JYI A;  4N1X A;  4NK3 A;  2EX6 A;  2WKE A;  4FH2 A;  5FQM A;  3TG9 A;  1PW8 A;  2H10 A;  3CZD A;  1W79 A;  2Y55 A;  4GDN A;  4H8R A;  3UE3 A;  5KSH A;  4X68 A;  5E2H A;  4RA7 A;  3E2L A;  1EWZ A;  5FDH A;  3Q7V B;  2QZ6 A;  5HAI A;  4IBR A;  2ZQA A;  3FKW A;  1Y54 A;  5J8X A;  2Y2O A;  2ZM0 A;  3IT9 A;  1KVM A;  3ZHH A;  2R9W A;  4U3T A;  4WZ5 A;  4WZ4 A;  5JYP A;  1YQS A;  2H0T A;  4JKT A;  3VSK A;  4K0W A;  3A3I A;  3NI9 A;  3SS3 A;  4DE1 A;  3HL9 A;  4UA6 A;  3S22 A;  1IYS A;  3NBL A;  2J9P A;  2PBY A;  3IF5 A;  4S2M A;  3OPR A;  2OLV A;  1QMF A;  3UDF A;  2Z2M B;  4WM9 A;  3BFC A;  5EVI D;  1SHV A;  1TVF A;  2XDM A;  4DDS A;  3ZFZ A;  1MY8 A;  2V2F F;  4Z9Q A;  1KE4 A;  1KGG A;  4MLL A;  4XXR A;  3G31 A;  3D4F A;  1GA9 A;  4Y0U A;  1K54 A;  1Q2P A;  3G2Z A;  2WYX A;  5FI6 A;  2R9X A;  1BUL A;  3Q82 A;  1IKI A;  3PBT A;  2HDQ A;  1N4O A;  3DW0 A;  3S1Y A;  2HP5 A;  4OPY A;  3VP0 A;  1BLS A;  1L0D A;  3O87 A;  4WZ5 C;  3MBZ A;  4BEN A;  2H5S A;  1BLH A;  4S2N A;  3ZG5 A;  5GLA A;  4R0Q A;  4MNR A;  1YLJ A;  3NIA A;  3MZF A;  1CK3 A;  4MBH A;  1JWP A;  4MEZ A;  3C4P A;  3GTC A;  4PM6 A;  4X69 A;  3EQV A;  4LV3 A;  5GHY A;  4JF4 A;  3VOZ A;  4GB7 A;  1PZP A;  4UA9 A;  3UN7 A;  4FH4 A;  5FA7 A;  1DJC A;  1NY0 A;  3GR2 A;  1BSG A;  2JCH A;  1XA1 A;  2OLU A;  5FQJ A;  4S2J A;  5KZH A;  1YMS A;  4EBN A;  1YLT A;  4M3K A;  4E3O A;  3V50 A;  4E3N A;  3FYZ A;  5TGF A;  4DE3 A;  3W4Q A;  1BUE A;  4OQG A;  3DTM A;  4D2O A;  5A91 A;  1ZG4 A;  3MXS A;  1IYQ A;  1ES3 A;  1GA0 A;  4KG5 A;  3CJM A;  3ITB A;  4YFM A;  2WAF A;  3MXR A;  3PBO A;  5FQQ A;  4KEN B;  4HBU A;  4QJG A;  3M2K A;  5GLC A;  1RCJ A;  4BL3 A;  4ZTK A;  2XR0 A;  4R4R A;  1WYB A;  3VP3 A;  1BTL A;  4PM8 A;  4FCF A;  1PWD A;  4NET A;  4HEF A;  1PYY A;  2Y2G A;  3RJU A;  4UHU A;  5M18 A;  2P9V B;  4DF6 A;  3OZH A;  3ISG A;  2EXB A;  5KSC A;  3ZVT A;  3O3V A;  3GV9 A;  4ZDX A;  3IF6 C;  4OQH A;  4OOY A;  5FAO A;  3N8L A;  1TEM A;  1HD8 A;  2RCX A;  3HLG A;  3W4O A;  1DJA A;  5CGW A;  5A90 A;  4GZB A;  1K55 A;  4R4S A;  1IYP A;  4ZAM A;  3PBR A;  3ZVW A;  3HLF A;  3OPL A;  3W4P A;  4X6T A;  1K6R A;  2XLN A;  4ID4 A;  4S2I A;  4E3L A;  4EUZ A;  4LEN A;  1M6K A;  1PIO A;  3HLC A;  5FI2 A;  5DF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...