3OPLA

Esbl r164h mutant shv-1 beta-lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDHWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Ligand-dependent disorder of the Omega loop observed in extended-spectrum SHV-type beta-lactamase.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3oplA00
3LY3A 5FQIA 4D2OA 3OC2A 1NRFA 5FDHA 4X55A 1LI9A 4OLDA 4M3KA 4OOMA 1RCJA 3WRTA 3QNBA 3MZEA 3PBRA 1XA1A 2EFUA 1YLTA 1GHIA 5CGWA 4JXWA 5CERA 4DRTA 4E6WA 2Y91A 5CTNA 1LHYA 2Y2JA 1FR6A 3N8SA 5DTKA 4RX2A 1LL9A 3BLSA 3Q07A 4PM6A 3FZCA 2IWCA 3M2JA 3AGFA 3BRMA 1W5DA 1L0GA 3TOIA 1ONHA 1TEMA 2OLVA 4R4RA 4ZAMA 3IXDA 3Q7ZA 3IHBA 4QD4A 3TG9A 5KMWA 4R3BA 3G2YA 4GZBA 4KQRA 1K4EA 2ZQ8A 3V3RA 3MXRA 3VMAA 3LEZA 4DKIA 3G31A 3Q82A 4FD8A 2EX6A 5DVAA 4U3TA 3N8RA 1BULA 3C4PA 5CHMA 3HUMA 4EBNA 1ES3A 3ZG5A 4JKTA 4PPRA 5F83A 1VQQA 4KZAA 4P87A 2Y2OA 5AQBA 1Y54A 2XD1A 3LO7A 1PWDA 4DE0A 2X01A 3W4OA 1FCNA 5KZHA 1BZAA 2VGKA 3BFDA 4JF5A 3G32A 5M1AA 1KE0A 3Q7VB 1JWVA 1ES2A 1XKZA 3BFGA 3G2ZA 3NDEA 3N8LA 5EOEA 1K55A 5A92A 2EXAA 3BFEA 1EWZA 1NZOA 5AQ9A 3BFCA 2EX8A 1QMFA 2XLNA 2V1ZA 1DJAA 1O07A 2B5RA 3SH7A 4KZ5A 2OLUA 5AQAA 4RA7A 2HP5A 4Q8IA 1GA0A 4ZBEA 4OQ0A 1K4FA 1EI5A 2HP9A 4X6TA 4DE3A 1HTZA 4Z9QA 3HLCA 1GCEA 4F94A 2V2FF 4YINA 4N1XA 5DF9A 5HL1A 4JPMA 4DDSA 5TGFA 2R9WA 4JBFA 1YT4A 3SS4A 4HBTA 4QY6A 3ZGAB 2HPBA 4KZBA 2Q9NA 1DJCA 4KZ9A 1JWPA 4JXGA 3OPHA 4U0TA 4IBRA 3GR2A 4QU3A 3IH8A 3W4QA 1L0FA 2A49A 1TDGA 1XA7A 1ES4A 5EPHA 1BLPA 2ZM2A 1BUEA 4OPQA 5HFOA 1KVMA 4ID4A 4OQHA 4GDBA 1E3UD 5EECA 1PW1A 4JF4A 4C6YA 2Y59A 4IVKA 4PM8A 4KZ6A 5CRFA 1ERMA 5L2FA 1KE4A 1LL5A 1XPBA 2PU2A 4DXBA 4R4SA 5FQ9A 2ZC3B 1XXMA 1IYOA 3G34A 1NZUA 2HDRA 5GLCA 3WS5A 1E3UA 1TVFA 3VSKA 5M18A 1ZC2A 3Q81A 3E2LA 3VOYA 5FQQA 4N92A 4WEJA 1LI0A 1ZG6A 2Y2NA 5GLBA 3N7WA 4BL2A 4P85A 1S6RA 4BD0A 4LCLA 3OZHA 3FKWA 1WE4A 1ZG4A 3P09A 3IXGA 1H8YA 1NYMA 5EUAA 4MLLA 3DWKA 4S2OA 2XD5A 3GTCA 1EROA 3BFFA 4RVAA 4OLGA 5JYOA 3D4FA 2ZMAA 3PAEA 4LV0A 1FR1A 2ZLYA 2Z2LB 4KZ7A 4WMCD 4IEDA 3IH9A 3HLWA 3EQUA 2WAFA 4C75A 1M6KA 3VP1A 4IVIA 4NK3A 5EVID 5GLAA 4GDNA 1GHMA 4LV1A 4WZ5A 1PI5A 4S2PA 4EBLA 2XF3A 1BLHA 2H5SA 1MBLA 2JE5A 3ZG8B 3E2KA 3MBZA 2X71A 4A5RA 4LCMA 5E2FA 3BM6A 5DF7A 2UWXA 2HDUA 4B4XA 1W7FA 2Y2HA 4KQOA 3C7UA 1ERQA 5CHUA 5CXWA 4MNRA 3G4PA 4B4ZA 4WBGA 4YFMA 3WS1A 2Y2KA 4E3LA 4O7DA 1L0DA 3A3IA 1IYQA 2RL3A 2BLSA 2EX9A 3UDXA 4JF6A 4P6BA 4RX3A 1I5QA 1ZKJA 4KZ8A 4OPYA 4Y0OA 5FATA 4JLFA 3WS0A 4EWFA 3FYZA 5FQJA 4N9KA 1BSGA 3UDFA 2WK0A 2ZM0A 2ZQCA 1MWRA 4KENB 1I2WA 3VFHA 3WRZA 3RXXA 1IEMA 3ZVTA 5FQKA 3VP3A 4RYEA 2A3UA 4QB8A 3M2KA 4BD1A 5M19A 1H5XA 5FQMA 5EOOA 3MKEA 2G2UA 1MKIA 4OOYA 1GA9A 1KDWA 4KG6A 1BLCA 1U60A 3W8KA 2HP6A 3GSGA 3JYIA 3GVBA 3PBTA 3Q1FA 4EV4A 2ZQAA 4GNUA 5D3OA 1IKGA 3MKFA 3VSLA 4S2LA 2ZQ7A 2IWDA 3TSGA 1JVJA 3ZDJA 2JCHA 4E3OA 1FSWA 1BT5A 4H8RA 1NY0A 1JTDA 1YLYA 3NIAA 3NC8A 2XH9A 2GDNA 4OQIA 4GOGA 4FSFA 4OOLA 3IHAA 4OVDA 3ZCZA 3QHYA 1BTLA 5F1GA 4XUXA 3ZHHA 5DTTA 1PWCA 1CEGA 3UE0A 3SOIA 2ZM8A 2XFTA 2Y2QA 5EVIB 3SS5A 3DTMA 2CC1A 3UDIA 2ZC6B 3NY4A 4Y7PA 1K38A 3OCLA 3IWQA 3HLDA 4EBPA 5FI2A 1W8YA 1K56D 3CMZA 5A91A 4N1HA 2XEPA 5HAIA 3IF6C 3SH8A 1KGFA 3EQVA 3UE1A 2IWBA 4L0LA 5U47A 5F82A 3ZFZA 5A93A 3V3SA 4PM9A 4NETA 4UHUA 1SHVA 5DF8A 3MXSA 5J8XA 1GHPA 4WEKA 2WKEA 3HL9A 1CI9A 1MXOA 2H0TA 4WZ4A 1H8ZA 4QHCA 4X53A 1Q2QA 2Y2IA 4S2JA 4CPKA 2Y4AA 1NYYA 2EXBA 2XR0A 5FAOA 4N9LA 2Y2PA 1K54C 4OH0A 2Q9MA 5TR7A 1FQGA 4UA7A 2OSUA 3LCEA 3N6IA 1WYBA 3NBLA 1K54A 4LV2A 4MBKA 3V50A 4S2NC 3HVFA 1E25A 3S22A 4WELA 2WGIA 5FAPA 1KDSA 4MBFA 3UE3A 2ZD8A 3NI9A 3PAGA 3VP0A 1JWZA 3MZFA 5HAQA 3HLGA 4HBUA 2WUQA 1YM1A 2J8YA 5A90A 1YQSA 5AQ7A 3G30A 4PM7A 2XK1A 3VP2A 3BECA 3GV9A 4B88A 1E4DA 2WYXA 3IXBA 2X02A 2R9XA 1DJBA 1HZOA 5CEBA 2PU4A 1NXYA 1G6AA 2RCXA 1KGEA 1MPLA 2EX2A 5CHJA 4K0WA 4ZTKA 1K6RA 4U0XA 1M40A 4R23A 3Q7VA 5EE8A 3HLFA 3FKVA 4GN2A 1FSYA 4X68A 4BENA 4E3MA 2JC7A 1HD8A 1RP5A 3BEBA 2WKIA 4WMCA 3ZVWA 1PZPA 1SKFA 2FFYA 3O88A 3RXWA 1CI8A 5EVIC 1PW8A 5EVIA 1IKIA 1ONGA 2OV5A 2ZC4B 5GL9A 2I72A 4ZJ3A 4OPZA 2ZC5B 4ZJ2A 3SS3A 3BYDA 3IF6B 1RGZA 1MWTA 3I7JA 4KZ3A 1XGJA 3UY6A 1HVBA 2QMIA 2Y2LA 3NDGA 3PTEA 4LENA 3V39A 2WKHA 1OMEA 4FH4A 3UPNA 1PWGA 3VOZA 1LLBA 1L0EA 1SDNA 5CECA 2J9PA 3ZNYA 3GMWA 4X69A 4Y0TA 3ZG0A 4UA6A 3IT9A 1Z6FA 2DRWA 3DW0A 4UA9A 4WYYA 3A3EA 4S2IA 2XGNA 1K57C 4CJNA 3MFDA 3UN7A 4ZJ1A 2XQZA 2BG1A 2WZZA 1K57A 3PBNA 3PBQA 2JBFA 3HREA 1W8QA 3A3DA 4IBXA 3C5AA 3CJMA 4ZDXA 1VM1A 3MZDA 5GLDA 4BQMA 1QMEA 2C5WB 5GHXA 3DWZA 4OKPA 1I2SA 3GRJA 5EVLA 3UPPA 3M6BA 3M6HA 2J7VA 1BLSA 2VGJA 3WS2A 2E8IA 3CZDA 1ALQA 4R1GA 4MBHA 3AGDA 3HBRA 5FI7A 5E2EA 1L2SA 3FWLA 4KG5A 3V5MA 3A3JA 1CK3A 4BLMA 4K0XA 4BL3A 5FASA 1N9BA 1SCWA 4KQQA 4MEZA 3IF5A 1YLJA 1K6SA 4FCFA 1PYYA 1FCOA 1ESIA 4S2KA 2P74A 3PBSA 5E2HA 5HAPA 3O87A 4XXRA 2XDMA 5KSHA 1NJ4A 3O3VA 4C3QA 1XP4A 4JXSA 2Y55A 1PZOA 1SDEA 1TDLA 4E3IA 2XFSA 4K91A 4X56A 4DDYA 3ZG7B 2ZC7A 2WGWB 1N4OA 1YLPA 3BLMA 1ESUA 3HLEA 4Y0UA 1J9MA 4GD6A 3W4PA 1JTGA 4R0QA 5E43A 1ES5A 3HUOA 3IXHA 2H0YA 3S4XA 1Q2PA 2Y2MA 3N4IA 5F1FA 1K56A 3OPLA 1K55C 2Z2MB 3IF6A 5GHYA 5KSCA 4OP8A 4E3NA 3IWOA 3ITBA 1IYPA 4JXVA 2HDQA 2DCFA 4OP5A 5E2GA 2P9VB 1MY8A 1YLWA 4GKUA 5CGSA 4GD8A 1PIOA 4OQGA 4OONA 4PMAA 5CTMA 5FAQA 1YMXA 5G18A 4DE1A 3WWXA 3A3FA 1XGIA 2QPNA 5GHZA 5FI6A 1O7EA 5IHVA 2DNSA 3IQAA 5HARA 4QY5A 3PBOA 3ZNTA 1FCMA 1KE3A 1IELA 1XX2A 1CEFA 1YMSA 4OPRA 4S2NA 4EQIA 5HW3A 3UNWA 3B3XA 3OPPA 4KG2A 3FV7A 3LY4A 2ZJ9A 5JYPA 1PI4A 2EFXA 2FFFB 5BOHA 2C6WB 3OCNA 1RGYA 5FSRA 4E3JA 4HESA 3G35A 3ITAA 1K25A 1MWSA 3QNCA 5I94A 1S0WA 2WAEA 1KVLA 4DE2A 3CG5A 2QZ6A 4PM5A 4BJPA 3IWIA 4UAAA 3SH9A 2ZQDA 5TFQA 4QJGA 2J9OA 2WADA 3NCKA 3RJUA 1WYCA 3S1YA 3C7VA 1W79A 4GB7A 4KZ4A 5CEDA 1FOFA 2H10A 5HX9A 3C4OA 3VFFA 4P0MA 1YLZA 4S2MA 2WGWA 1KGGA 3VP4A 2Y2GA 5CGXA 2G2WA 1AXBA 4HEFA 4DF6A 5DTSA 3HUNA 4E3KA 3HLBA 3WS4A 4EUZA 1IYSA 3GQZA 1MWUA 4XUZA 1DY6A 2V20A 1G68A 3P98A 2PBYA 2ZQ9A 4LV3A 4WM9A 3O86A 4R3JA 3OPRA 4WZ5C 4FH2A 2HDSA 2P9VA 2WGVA 3ISGA 5FA7A 4DXCA 3UO9A 4E6XA 3AGEA 3UPOA 1C3BA 2WZXA 3ZG9B
chains in the Genus database with same CATH superfamily
4D2OA 1NRFA 1H8MA 3QNBA 2EFUA 1YLTA 5CERA 2Y2JA 1OJGA 4RX2A 3Q07A 2IWCA 3VE4A 2QJ7A 1TEMA 3CUEC 4NKPA 3TG9A 4R3BA 2KDKA 4KQDA 4DKIA 2ACGA 2PAVP 4JGQA 2JKTM 3ZG5A 4I3JA 4JKTA 4PPRA 3VE3A 1Y54A 4BBUA 2XD1A 2IA2A 2WKQA 2JKRI 2X01A 1BZAA 2VGKA 5EM1A 5M1AA 1JWVA 2EXAA 1EWZA 3A0RA 1NZOA 5AQ9A 1NRJA 3JPUA 1YSQA 2EX8A 5IS1A 2V1ZA 1DJAA 3BY9A 2OLUA 4P6ZM 4OQ0A 4GS9B 1EI5A 3HLCA 1GCEA 2V2FF 2KOIA 5TGFA 2R9WA 4Y15A 2J3TD 1DJCA 4JXGA 4Y3IA 3EGXC 3OPHA 5F69A 4LFUA 1T1CA 3IH8A 3W4QA 1PRQA 5EPHA 1BLPA 5CRFA 5L2FA 2PU2A 2HDRA 1TVFA 3UB8A 2V0WA 3Q81A 3BWLA 2V1BA 4BL2A 4ETZA 3FKWA 3T50A 2HV1A 3IXGA 1NYMA 3LIBA 2XD5A 1OTAA 5JYOA 2ZMAA 1D1JA 1F9IA 1FR1A 2ZLYA 3PAEA 2W3FA 3IX4A 3SW1A 5A8BA 1MBLA 3E2KA 3MBZA 4A5RA 4B4XA 4KQOA 4ARZB 4B4ZA 4YFMA 4MN6A 3WS1A 1T1BA 2EX9A 3UDXA 4P6BA 4KZ8A 4HJ3A 4OPYA 4JLFA 3FYZA 3W2ZA 1Y4OA 1I2WA 3CAXA 3WRZA 3RXXA 3VP3A 2A3UA 2ZL1B 5FQMA 1MKIA 4PKYG 1GA9A 3EEHA 3DTIA 3W8KA 1LT0A 1AWIA 3Q1FA 4EV4A 2P08A 4GNUA 3MKFA 3SZTA 1OTDA 4II7A 3C2WA 1PFLA 1JTDA 1YLYA 4UQIM 2GDNA 4FSFA 4OVDA 3ZCZA 1BTLA 5F1GA 3ZHHA 4BBTA 4R6LA 3TJZC 4UEYA 1TF1A 2JKFA 2Y79A 3NY4A 2V8FA 3DBAA 1W8YA 3CMZA 4B93A 3IF6C 5HD3A 4ARZA 2IWBA 3KX0X 4FTXA 3T4LA 5F68A 1P9RA 4NETA 4HIAA 2NUPC 1V9YA 2WKEA 5F5YA 4QHCA 4CPKA 2Y2IA 4N9LA 3GDIA 1K54C 4OH0A 2Q9MA 3PXPA 1WYBA 3V50A 3MR0A 4S2NC 4KUKA 1KDSA 3MMHA 3PAGA 4HBUA 2J8YA 3VP2A 5C5KA 3BECA 2WYXA 2R9XA 4O01A 5CEBA 2O9BA 3CLOA 1KGEA 1MPLA 1M40A 2V0UA 5HZHA 3MXQA 3DAVA 1CI8A 3EGDC 3C38A 1ONGA 3LI8A 2OV5A 4ZJ2A 1MWTA 1W63M 3NDGA 3PTEA 3V39A 2WKHA 4PHTA 4ZRRA 5CECA 3E4QA 4LRZE 3MFDA 5DFYA 1N9OA 1W8QA 4HJ6A 4ZDXA 2C5WB 5GHXA 5EVLA 1I2SA 1VHMA 3M6BA 2W1TB 2I9VA 4BLMA 4K0XA 1T1AA 5LBRA 2PYRA 4AFIA 1YLJA 3T1SA 3D72A 1DRMA 3CITA 5HAPA 2GZAA 3O3VA 1SDEA 1TDLA 2XFSA 4K91A 4X56A 2YKFA 5HSQA 1YLPA 3BLMA 1JTGA 2Y2MA 4NXGA 1K56A 3UE6A 2Z2MB 5GHYA 5KSCA 1S1ZA 4OP8A 2VK3A 2NUTC 1MY8A 2V8CA 5KIZA 3WWXA 2GJ3A 3V67A 1O7EA 4B9OA 4EETB 4I39A 2DNSA 3PBOA 1YKDA 1KE3A 1IELA 4OPRA 1YMSA 1DP6A 5HW3A 2W1TA 4X25A 2FFFB 5BOHA 3OCNA 4E3JA 4GLQA 2PBDP 2A24A 5I94A 2WAEA 4DE2A 4R38A 4O8GA 4UAAA 3SH9A 5TFQA 2M7UA 2K31A 2YKHA 4YOFA 3RJUA 1WYCA 4KZ4A 1W79A 5CEDA 4HY8A 2H10A 5HX9A 4P0MA 3KYQA 1VEUA 3HUNA 2V20A 2PBYA 2ZQ9A 3O86A 1G28A 5AVFA 3TRCA 3UO9A 4E6XA 3AGEA 1C3BA 5EOEA 3UB5P 3ZG9B 1HLUP 4KUOA 3OLOA 2OWHA 3T4TA 5DKKA 3CPTB 3PBRA 4WLAA 4JXWA 4DRTA 5CTNA 1FR6A 5DTKA 3FZCA 1XJ6A 3AGFA 4IHQA 3BRMA 1W5DA 1L0GA 1ONHA 4R4RA 1T18A 3QP6A 4ZAMA 3CUEA 4GZBA 3V3RA 3MXRA 1TS7A 3VMAA 3N8RA 1BULA 3LYXA 3HUMA 3UMDA 3NOPC 4BBVA 1VQQA 4JGOA 3K3DA 1PWDA 4DE0A 1LL8A 3BQ8A 1Z09A 3BFDA 3G32A 1KE0A 2V1AA 1XKZA 3UB6A 1N9NA 5FEGA 2XLNA 2VLGA 2B5RA 3SH7A 4MN7A 5AQAA 4RA7A 2HP5A 1OTIA 4WN5A 3T1RA 4DE3A 4Z9QA 4F94A 1P0ZA 3CPTA 2O9AA 4JPMA 4DDSA 3GECA 1YT4A 3SS4A 4KZBA 1BYWA 1JWPA 4U0TA 3GR2A 4QU3A 2PD8A 2W3EA 1T19A 3E98A 1L0FA 3L7HA 4OPQA 4ID4A 1E3UD 4C6YA 4CLCC 4IVKA 3QP5A 4KZ6A 1ERMA 1XXMA 3G34A 1NZUA 1E3UA 2XA7S 3VSKA 5M18A 4N92A 1ZG6A 2Y2NA 5GLBA 3N7WA 1S6RA 4LCLA 1ZG4A 1F5MA 3LIAA 5EUAA 3DWKA 4S2OA 1EROA 4HOIA 4LV0A 3LIFA 3HLWA 4EEUA 3EQUA 2VGLM 4C75A 1M6KA 4IVIA 5GLAA 3LR3A 1GHMA 4WZ5A 4S2PA 2XF3A 4LCMA 4HHDA 1S67L 5DF7A 2Y2HA 5CXWA 2V9AA 1L0DA 5DJUA 3F1OA 5L8MA 2RL3A 2K2NA 5L07A 1I5QA 1ZKJA 4Y0OA 5FATA 1IOUA 1G6OA 3H7WB 4Q0HA 5HDCA 3S7QA 2W0NA 5FQKA 4NXBA 3VV4A 4BD1A 5EOOA 2G2UA 3LI9A 1X0OA 4EU0A 4OOYA 4EQ1A 1BLCA 3LR5A 1U60A 3PBTA 2ZQAA 3PHYA 1W63Q 1XJ2A 1IKGA 4G3KA 2IWDA 4HH2A 4FOFA 1JVJA 3ZDJA 1FSWA 2XSSA 1BT5A 4H8RA 2EWVA 4EEPA 2PYPA 4XUXA 3UE0A 2Y2QA 3DTMA 3UDIA 4Y7PA 3EEAA 3OCLA 3IWQA 5A91A 2XEPA 1YPRA 5HAIA 3SH8A 1DP9A 3UB7A 1V9ZA 4L0LA 5U47A 3NULA 5F82A 5A93A 3V3SA 3MQ0A 3T1XA 1P97A 1GHPA 3HL9A 1H8ZA 1NYYA 2H28A 2Y2PA 5TR7A 2R78A 3N6IA 3NBLA 1K54A 4WELA 3D3OA 2WGIA 5FAPA 4MBFA 1OT9A 1JWZA 5HAQA 1XFNA 5A90A 1YQSA 4D60A 1E4DA 2ZOHA 3IXBA 2X02A 1DJBA 3KSFA 1G6AA 1NWZA 5CHJA 1K6RA 4R23A 4GHIB 5EE8A 3HLFA 1CQAA 4BENA 4Q0JA 2JC7A 2WKIA 3ZVWA 1SKFA 3LGOA 5J7EA 5EV0A 4HJ4A 3D9YA 2I72A 2PT7A 1XFQA 4GS9A 3BYDA 5L10A 2Z6DA 3UY6A 4Y17A 1HVBA 2QMIA 2Y2LA 4LENA 1OMEA 1LLBA 2J9PA 5HDSA 4CQHA 3IBRA 3ZG0A 4UA6A 1TD5A 2ZMFA 3BY8A 3DW0A 4UA9A 3A3EA 4S2IA 1K57C 3S7NA 4ZJ1A 3P01A 2BG1A 2JBFA 3C5AA 3CJMA 3MZDA 4BQMA 2JKGA 3ULFA 3WS2A 2L4RA 1S1YA 4R1GA 3HBRA 3V5MA 5E2EA 4KG5A 1CK3A 2PD7A 4MEZA 1PYYA 1FCOA 4GHIA 5L09A 2P74A 3PBSA 5E2HA 2XDMA 5KSHA 1NJ4A 1XP4A 2Y55A 4E3IA 4DDYA 3ZG7B 1SZVA 2WGWB 2ZC7A 5G4YA 1ESUA 1LSWA 3HLEA 3C8CA 1J9MA 1K0KA 5E43A 3S4XA 2H0YA 5F1FA 3T4KA 4EXOA 2VV6A 5E2GA 4GKUA 4GD8A 4I38A 5CTMA 4X1LA 4DE1A 2QPNA 3ICYA 2ZL1A 4L9EA 3ZNTA 4QWOA 4EQIA 3UNWA 3OPPA 4KG2A 3FPWA 3IX8A 3LY4A 1PI4A 4IUHA 3IS2B 5DFXA 1S0WA 1S66L 3CG5A 2QZ6A 4PM5A 2Z6CA 2ZQDA 4QJGA 2J9OA 1ZTUA 4HH3A 3H82B 2INWA 1GSWA 2WGWA 3VP4A 5CGXA 3NECA 4EUZA 3GQZA 4XUZA 2ZOIA 1DY6A 1G68A 4LV3A 5AVEA 3OPRA 4H6JB 4I3AA 3UPOA 3VP1A 5FQIA 5FDHA 4M3KA 3WRTA 3IX3A 4IUKA 5CGWA 4LRXC 2WKPA 4NEED 3RFBA 1LL9A 3BLSA 4PM6A 3FG8A 3KO6A 2OLVA 2B02A 3IXDA 3Q7ZA 3IHBA 3LIDA 2W27A 4KQRA 2ZQ8A 3LEZA 5CX7A 5HL6A 3G31A 3Q82A 2EX6A 4CLCB 2FZ0A 2VV8A 3LR0A 1ES3A 4LRYC 4KZAA 1PNEA 2Y2OA 3H82A 5AQBA 3K2NA 5HWWA 4P6ZS 1G5UA 1FCNA 5KZHA 5IT5A 4JF5A 3Q7VB 3G2ZA 3NDEA 1TS8A 1K55A 2OAP1 3NOTC 3BFEA 2G7UA 1QMFA 2VA0A 4XT2B 1O07A 4KZ5A 1GA0A 4ZBEA 5HWTA 1K4FA 2HP9A 4X6TA 1OTBA 1HTZA 4YINA 2KX6A 5DF9A 4X1MA 2HPBA 4KZ9A 1GSXA 4IBRA 4EW7A 2A49A 1XA7A 1BUEA 4CLCD 4GDBA 1PW1A 4JF4A 2Y59A 4PM8A 1KE4A 4DXBA 4R4SA 2ZC3B 4CLCA 3FC7A 1ZC2A 2HGVA 5FQQA 4WEJA 1LI0A 4NG2A 3OZHA 1H8YA 4MLLA 1NLYA 2O9CA 3GTCA 3BFFA 4RVAA 3D4FA 5TJJA 4WMCD 2Z2LB 4IEDA 2M7VA 3IH9A 2WAFA 1OPXA 3C30A 2W3DA 5EVID 2OOLA 3IBJA 4GDNA 4LV1A 1PI5A 1BLHA 2H5SA 2QJ5A 3NOUC 5E2FA 2EA9A 4G3VA 4O0PA 2CMNA 3B42A 4WBGA 2MJ6A 2QYBA 2Y2KA 2EWWA 2P04A 2B95A 4O7DA 4E3LA 2BLSA 4JF6A 4RX3A 1KOUA 4EWFA 3WS0A 5FQJA 1VETB 4N9KA 3DTKA 1LSXA 1S4SA 3UDFA 2ZQCA 4KENB 4WF0A 2XROA 1IEMA 2W3HA 3E4OA 3M2KA 3MKEA 4UQIS 3KSGA 2VJWA 4KG6A 3GSGA 4GCZA 3GVBA 4YWZA 1YAXA 2ZQ7A 3QP2A 4E3OA 1D7EA 1NY0A 3NC8A 2XH9A 4OQIA 4GOGA 5DKLA 1XJ4A 4BMWA 5DTTA 1PWCA 1CEGA 3SOIA 5K5BA 2XFTA 3SS5A 2CC1A 2ZC6B 2GNXA 5FI2A 1OTEA 1UWPX 3EQVA 3UE1A 5FEFA 3ZFZA 4FUWA 4MCWA 4UHUA 1SHVA 3MXSA 5J8XA 1CI9A 1MXOA 2A2LA 2H0TA 3U4LP 4X53A 4S2JA 4F3LB 5FAOA 2XR0A 5HPIA 3U2AA 4UA7A 2OSUA 3LCEA 4LV2A 2LB9A 1FILA 3NI9A 1YM1A 2PRFA 2JKTI 3G30A 4PM7A 4WL9A 3GV9A 1HZOA 3TW8A 1L3LA 2VEAA 1NXYA 4PKYA 4GJ4A 1EW0A 2RCXA 4GN2A 1FSYA 4X68A 1HD8A 3G6OA 3O88A 4PAUA 5EVIC 3DTEA 1IKIA 2ZC4B 5GL9A 4ZJ3A 4OPZA 4Y13A 2XRNA 4ETXA 1TS0A 2UV0E 3IF6B 1RGZA 1XGJA 2LB5A 4LGWA 4FH4A 3UPNA 5I5LA 4JGRA 3VOZA 3RTYA 1SDNA 2Y8HA 3ZNYA 3GMWA 4QPRA 4LPZA 4X69A 4YNRA 4Y0TA 2PR6A 3IT9A 4F3LA 2DRWA 2XGNA 4CJNA 3T4SA 3L9KA 2XQZA 3KYEA 1K57A 3F1PB 3PBNA 3PBQA 3HREA 4IBXA 1F2KA 4HI4A 3EWKA 4OKPA 2GX5A 2J7VA 2VGJA 3CZDA 3CI6A 2O99A 3EOIA 4MBHA 3AGDA 1L2SA 3A3JA 5FASA 1N9BA 1NLZA 3IF5A 4FCFA 2BTFP 3MJQA 4S2KA 3O87A 2VX8A 4C3QA 4JXSA 1N4OA 4Q0IA 3W4PA 1CF0A 3UB9A 3HUOA 3N4IA 3OPLA 3IF6A 5TBMB 4E3NA 3ITBA 2HDQA 4OP5A 2P9VB 1YLWA 4HP9A 1H3QA 1PIOA 4OQGA 4PMAA 1YMXA 5G18A 4DJ3A 3H7WA 1XGIA 3E0YA 5IHVA 3HCYA 3F1PA 3IQAA 4QY5A 1XX2A 4S2NA 4MMNA 2ZBBA 3B3XA 3FV7A 2ZJ9A 1ODVA 2EFXA 2C6WB 1RGYA 2PHYA 5FSRA 3G35A 3QNCA 1MC0A 1KVLA 3S7OA 4BJPA 4HNBA 5HDDA 3MQQA 3NCKA 2JKRM 3BQAA 3CHWP 3MSHA 1D06A 3QP8A 1FIKA 3BW6A 3C4OA 3VFFA 1YLZA 1MZUA 1KGGA 2Y2GA 2G2WA 1AXBA 4DF6A 3HLBA 5HWVA 1IYSA 1MWUA 3P98A 5TBMA 4MN5A 4R3JA 4WZ5C 1F98A 3F1NB 2P9VA 4DXCA 3ISGA 2VKSA 3LY3A 3OC2A 4BWIA 4X55A 1LI9A 2VV7A 4OLDA 4OOMA 1RCJA 3MZEA 1XA1A 1GHIA 4E6WA 2Y91A 1J3WA 1LHYA 3N8SA 2KLIA 2PR5A 3M2JA 3TOIA 4Y2FA 3OBFA 3LIEA 2O0YA 4QD4A 5KMWA 3G2YA 1MKMA 1K4EA 3UMEA 4DN0A 4M4XA 1N9LA 4FD8A 5DVAA 4U3TA 3O5YA 3C4PA 5CHMA 3T4OA 4EBNA 5F83A 4P87A 5IU1A 3ZQ5A 3P7NA 2DMWA 2L1MA 3LO7A 3W4OA 1ES2A 3BFGA 3N8LA 5A92A 1A0KA 4RQ9A 3H9WA 4NXEA 3BFCA 3F1NA 3K3CA 1LSVA 2J80A 4Q8IA 3E4PA 3PYPA 4N1XA 5HL1A 4I5SA 4JBFA 4HBTA 4QY6A 3ZGAB 2Q9NA 2J3TC 1VB6A 4L9FA 1TDGA 1ES4A 5FDSA 2ZM2A 5HFOA 1KVMA 4OQHA 5EECA 3TE8A 4HP4A 3MFXA 1LL5A 1XPBA 2VGLS 5FQ9A 3WS5A 1IYOA 5GLCA 3E2LA 3VOYA 1DP8A 4Z1WA 4P85A 4BD0A 1WE4A 2W3GA 3P09A 3KSIA 4OLGA 4KZ7A 2JN7A 4R70A 2XA7M 5HD5A 4NK3A 2W1RA 1SKOB 1CJFA 1UWNX 4EBLA 4JGPA 2JE5A 3ZG8B 2Q0OA 2X71A 5F6AA 3BM6A 2UWXA 2HDUA 1W7FA 3C7UA 1ERQA 5CHUA 3T4QA 4MNRA 3G4PA 1S4RA 3A3IA 1IYQA 3MF0A 5EVEA 1GSVA 1XJ3A 3T4JA 3R7WB 1BSGA 1JNUA 2WK0A 2ZM0A 1MWRA 3VFHA 3ZVTA 3IS2A 4RYEA 4QB8A 4L9GA 5M19A 3JVVA 1H5XA 1IFQA 1KDWA 4WUJA 4DMZA 2HP6A 3JYIA 5D3OA 5G4ZA 3VSLA 4S2LA 3TSGA 3QP4A 2JCHA 2OWJA 2A24B 3NIAA 2HF6A 4OOLA 3IHAA 3QHYA 2B18A 3NJAA 4H6JA 3ZYTA 4K08A 1SKOA 2ZM8A 5EVIB 4EERA 1ZHHB 5EM0A 1K38A 3HLDA 4EBPA 4EUVA 1VEUB 1K56D 3RH8B 4N1HA 1KGFA 4LLOB 5MC7A 4PM9A 5AJGA 5DF8A 3HJKA 4WEKA 4WZ4A 4IJGA 3R7WA 1Q2QA 2Y4AA 2EXBA 3LICA 5DJTA 4ME4A 1FQGA 4MBKA 3HVFA 1E25A 3S22A 3QP1A 2QKPA 2HZ5A 5J3WA 2E8JA 2OAQ1 2ZD8A 3UE3A 3VP0A 3MZFA 3HLGA 2WUQA 3KYZA 5AQ7A 2XK1A 4B88A 2P7JA 1UGUA 4E04A 2PU4A 5HPFA 2EX2A 4K0WA 4ZTKA 4U0XA 3Q7VA 3FKVA 4E3MA 1RP5A 3BEBA 2J3WA 3JVUA 4WMCA 3KSHA 1PZPA 2FFYA 2D01A 3RXWA 4G3WA 2QHKA 1PW8A 3T12B 4DJ2A 2FH5A 5EVIA 4XT2A 1ACFA 2ZC5B 3SS3A 1STZA 3I7JA 4KZ3A 3R4KA 3LEQA 3NHQA 4ESPA 2ZMVA 1PWGA 1L0EA 4EESA 1Z6FA 4WYYA 3UN7A 3B47A 2WZZA 3A3DA 3OOVA 4GW9A 1VM1A 1OT6A 5GLDA 1QMEA 3LFVA 3DWZA 3UPPA 3GRJA 1WA9A 3M6HA 1BLSA 2E8IA 2HJEA 1ALQA 1TS6A 5FI7A 3FWLA 4BL3A 1SCWA 2AVXA 4KQQA 4CLCE 1K6SA 1H0MA 5FL3A 1ESIA 4XXRA 1YSPA 4HQAA 3BJNA 1PZOA 3A0SA 4NXFA 4Y0UA 4GD6A 4R0QA 1ES5A 3IXHA 1Q2PA 3MS6A 1K55C 3T1QB 2L0WA 3MQOA 2BASA 3IWOA 4JXVA 1IYPA 2DCFA 3S7PA 1Y28A 5CGSA 1VETA 1OJ5A 3VOLA 5FAQA 4OONA 3A3FA 1P9WA 4I3IA 5GHZA 5FI6A 2D02A 2VZWA 3F1OB 5HARA 1FCMA 1CEFA 4MDZA 5EFWA 2JHEA 5J4EA 4Y5FA 3A0VA 2M1CA 5JYPA 3LUQA 4HESA 3ITAA 1K25A 1MWSA 2WKRA 3FPVA 3IWIA 3HJIA 2WADA 3S1YA 3C7VA 2K7SA 4GB7A 1FOFA 3PR6A 4S2MA 2QWSA 4R3AA 2PDRA 3B33A 4HEFA 5DTSA 4E3KA 3WS4A 3LR4A 4WM9A 2HJ9C 4FH2A 2HDSA 2WGVA 5FA7A 2WZXA 3CWFA
chains in the Genus database with same CATH topology
3LY3A 5FQIA 4D2OA 3OC2A 1NRFA 5FDHA 4X55A 1LI9A 4OLDA 4M3KA 4OOMA 1RCJA 3WRTA 3QNBA 3MZEA 3PBRA 1XA1A 2EFUA 1YLTA 1GHIA 5CGWA 4JXWA 5CERA 4DRTA 4E6WA 2Y91A 5CTNA 1LHYA 2Y2JA 1FR6A 3N8SA 5DTKA 4RX2A 1LL9A 3BLSA 3Q07A 4PM6A 3FZCA 2IWCA 3M2JA 3AGFA 3BRMA 1W5DA 1L0GA 3TOIA 1ONHA 1TEMA 2OLVA 4R4RA 4ZAMA 3IXDA 3Q7ZA 3IHBA 4QD4A 3TG9A 5KMWA 4R3BA 3G2YA 4GZBA 4KQRA 1K4EA 2ZQ8A 3V3RA 3MXRA 3VMAA 3LEZA 4DKIA 3G31A 3Q82A 4FD8A 2EX6A 5DVAA 4U3TA 3N8RA 1BULA 3C4PA 5CHMA 3HUMA 4EBNA 1ES3A 3ZG5A 4JKTA 4PPRA 5F83A 1VQQA 4KZAA 4P87A 2Y2OA 5AQBA 1Y54A 2XD1A 3LO7A 1PWDA 4DE0A 2X01A 3W4OA 1FCNA 5KZHA 1BZAA 2VGKA 3BFDA 4JF5A 3G32A 5M1AA 1KE0A 3Q7VB 1JWVA 1ES2A 1XKZA 3BFGA 3G2ZA 3NDEA 3N8LA 5EOEA 1K55A 5A92A 2EXAA 3BFEA 1EWZA 1NZOA 5AQ9A 3BFCA 2EX8A 1QMFA 2XLNA 2V1ZA 1DJAA 1O07A 2B5RA 3SH7A 4KZ5A 2OLUA 5AQAA 4RA7A 2HP5A 4Q8IA 1GA0A 4ZBEA 4OQ0A 1K4FA 1EI5A 2HP9A 4X6TA 4DE3A 1HTZA 4Z9QA 3HLCA 1GCEA 4F94A 2V2FF 4YINA 4N1XA 5DF9A 5HL1A 4JPMA 4DDSA 5TGFA 2R9WA 4JBFA 1YT4A 3SS4A 4HBTA 4QY6A 3ZGAB 2HPBA 4KZBA 2Q9NA 1DJCA 4KZ9A 1JWPA 4JXGA 3OPHA 4U0TA 4IBRA 3GR2A 4QU3A 3IH8A 3W4QA 1L0FA 2A49A 1TDGA 1XA7A 1ES4A 5EPHA 1BLPA 2ZM2A 1BUEA 4OPQA 5HFOA 1KVMA 4ID4A 4OQHA 4GDBA 1E3UD 5EECA 1PW1A 4JF4A 4C6YA 2Y59A 4IVKA 4PM8A 4KZ6A 5CRFA 1ERMA 5L2FA 1KE4A 1LL5A 1XPBA 2PU2A 4DXBA 4R4SA 5FQ9A 2ZC3B 1XXMA 1IYOA 3G34A 1NZUA 2HDRA 5GLCA 3WS5A 1E3UA 1TVFA 3VSKA 5M18A 1ZC2A 3Q81A 3E2LA 3VOYA 5FQQA 4N92A 4WEJA 1LI0A 1ZG6A 2Y2NA 5GLBA 3N7WA 4BL2A 4P85A 1S6RA 4BD0A 4LCLA 3OZHA 3FKWA 1WE4A 1ZG4A 3P09A 3IXGA 1H8YA 1NYMA 5EUAA 4MLLA 3DWKA 4S2OA 2XD5A 3GTCA 1EROA 3BFFA 4RVAA 4OLGA 5JYOA 3D4FA 2ZMAA 3PAEA 4LV0A 1FR1A 2ZLYA 2Z2LB 4KZ7A 4WMCD 4IEDA 3IH9A 3HLWA 3EQUA 2WAFA 4C75A 1M6KA 3VP1A 4IVIA 4NK3A 5EVID 5GLAA 4GDNA 1GHMA 4LV1A 4WZ5A 1PI5A 4S2PA 4EBLA 2XF3A 1BLHA 2H5SA 1MBLA 2JE5A 3ZG8B 3E2KA 3MBZA 2X71A 4A5RA 4LCMA 5E2FA 3BM6A 5DF7A 2UWXA 2HDUA 4B4XA 1W7FA 2Y2HA 4KQOA 3C7UA 1ERQA 5CHUA 5CXWA 4MNRA 3G4PA 4B4ZA 4WBGA 4YFMA 3WS1A 2Y2KA 4E3LA 4O7DA 1L0DA 3A3IA 1IYQA 2RL3A 2BLSA 2EX9A 3UDXA 4JF6A 4P6BA 4RX3A 1I5QA 1ZKJA 4KZ8A 4OPYA 4Y0OA 5FATA 4JLFA 3WS0A 4EWFA 3FYZA 5FQJA 4N9KA 1BSGA 3UDFA 2WK0A 2ZM0A 2ZQCA 1MWRA 4KENB 1I2WA 3VFHA 3WRZA 3RXXA 1IEMA 3ZVTA 5FQKA 3VP3A 4RYEA 2A3UA 4QB8A 3M2KA 4BD1A 5M19A 1H5XA 5FQMA 5EOOA 3MKEA 2G2UA 1MKIA 4OOYA 1GA9A 1KDWA 4KG6A 1BLCA 1U60A 3W8KA 2HP6A 3GSGA 3JYIA 3GVBA 3PBTA 3Q1FA 4EV4A 2ZQAA 4GNUA 5D3OA 1IKGA 3MKFA 3VSLA 4S2LA 2ZQ7A 2IWDA 3TSGA 1JVJA 3ZDJA 2JCHA 4E3OA 1FSWA 1BT5A 4H8RA 1NY0A 1JTDA 1YLYA 3NIAA 3NC8A 2XH9A 2GDNA 4OQIA 4GOGA 4FSFA 4OOLA 3IHAA 4OVDA 3ZCZA 3QHYA 1BTLA 5F1GA 4XUXA 3ZHHA 5DTTA 1PWCA 1CEGA 3UE0A 3SOIA 2ZM8A 2XFTA 2Y2QA 5EVIB 3SS5A 3DTMA 2CC1A 3UDIA 2ZC6B 3NY4A 4Y7PA 1K38A 3OCLA 3IWQA 3HLDA 4EBPA 5FI2A 1W8YA 1K56D 3CMZA 5A91A 4N1HA 2XEPA 5HAIA 3IF6C 3SH8A 1KGFA 3EQVA 3UE1A 2IWBA 4L0LA 5U47A 5F82A 3ZFZA 5A93A 3V3SA 4PM9A 4NETA 4UHUA 1SHVA 5DF8A 3MXSA 5J8XA 1GHPA 4WEKA 2WKEA 3HL9A 1CI9A 1MXOA 2H0TA 4WZ4A 1H8ZA 4QHCA 4X53A 1Q2QA 2Y2IA 4S2JA 4CPKA 2Y4AA 1NYYA 2EXBA 2XR0A 5FAOA 4N9LA 2Y2PA 1K54C 4OH0A 2Q9MA 5TR7A 1FQGA 4UA7A 2OSUA 3LCEA 3N6IA 1WYBA 3NBLA 1K54A 4LV2A 4MBKA 3V50A 4S2NC 3HVFA 1E25A 3S22A 4WELA 2WGIA 5FAPA 1KDSA 4MBFA 3UE3A 2ZD8A 3NI9A 3PAGA 3VP0A 1JWZA 3MZFA 5HAQA 3HLGA 4HBUA 2WUQA 1YM1A 2J8YA 5A90A 1YQSA 5AQ7A 3G30A 4PM7A 2XK1A 3VP2A 3BECA 3GV9A 4B88A 1E4DA 2WYXA 3IXBA 2X02A 2R9XA 1DJBA 1HZOA 5CEBA 2PU4A 1NXYA 1G6AA 2RCXA 1KGEA 1MPLA 2EX2A 5CHJA 4K0WA 4ZTKA 1K6RA 4U0XA 1M40A 4R23A 3Q7VA 5EE8A 3HLFA 3FKVA 4GN2A 1FSYA 4X68A 4BENA 4E3MA 2JC7A 1HD8A 1RP5A 3BEBA 2WKIA 4WMCA 3ZVWA 1PZPA 1SKFA 2FFYA 3O88A 3RXWA 1CI8A 5EVIC 1PW8A 5EVIA 1IKIA 1ONGA 2OV5A 2ZC4B 5GL9A 2I72A 4ZJ3A 4OPZA 2ZC5B 4ZJ2A 3SS3A 3BYDA 3IF6B 1RGZA 1MWTA 3I7JA 4KZ3A 1XGJA 3UY6A 1HVBA 2QMIA 2Y2LA 3NDGA 3PTEA 4LENA 3V39A 2WKHA 1OMEA 4FH4A 3UPNA 1PWGA 3VOZA 1LLBA 1L0EA 1SDNA 5CECA 2J9PA 3ZNYA 3GMWA 4X69A 4Y0TA 3ZG0A 4UA6A 3IT9A 1Z6FA 2DRWA 3DW0A 4UA9A 4WYYA 3A3EA 4S2IA 2XGNA 1K57C 4CJNA 3MFDA 3UN7A 4ZJ1A 2XQZA 2BG1A 2WZZA 1K57A 3PBNA 3PBQA 2JBFA 3HREA 1W8QA 3A3DA 4IBXA 3C5AA 3CJMA 4ZDXA 1VM1A 3MZDA 5GLDA 4BQMA 1QMEA 2C5WB 5GHXA 3DWZA 4OKPA 1I2SA 3GRJA 5EVLA 3UPPA 3M6BA 3M6HA 2J7VA 1BLSA 2VGJA 3WS2A 2E8IA 3CZDA 1ALQA 4R1GA 4MBHA 3AGDA 3HBRA 5FI7A 5E2EA 1L2SA 3FWLA 4KG5A 3V5MA 3A3JA 1CK3A 4BLMA 4K0XA 4BL3A 5FASA 1N9BA 1SCWA 4KQQA 4MEZA 3IF5A 1YLJA 1K6SA 4FCFA 1PYYA 1FCOA 1ESIA 4S2KA 2P74A 3PBSA 5E2HA 5HAPA 3O87A 4XXRA 2XDMA 5KSHA 1NJ4A 3O3VA 4C3QA 1XP4A 4JXSA 2Y55A 1PZOA 1SDEA 1TDLA 4E3IA 2XFSA 4K91A 4X56A 4DDYA 3ZG7B 2ZC7A 2WGWB 1N4OA 1YLPA 3BLMA 1ESUA 3HLEA 4Y0UA 1J9MA 4GD6A 3W4PA 1JTGA 4R0QA 5E43A 1ES5A 3HUOA 3IXHA 2H0YA 3S4XA 1Q2PA 2Y2MA 3N4IA 5F1FA 1K56A 3OPLA 1K55C 2Z2MB 3IF6A 5GHYA 5KSCA 4OP8A 4E3NA 3IWOA 3ITBA 1IYPA 4JXVA 2HDQA 2DCFA 4OP5A 5E2GA 2P9VB 1MY8A 1YLWA 4GKUA 5CGSA 4GD8A 1PIOA 4OQGA 4OONA 4PMAA 5CTMA 5FAQA 1YMXA 5G18A 4DE1A 3WWXA 3A3FA 1XGIA 2QPNA 5GHZA 5FI6A 1O7EA 5IHVA 2DNSA 3IQAA 5HARA 4QY5A 3PBOA 3ZNTA 1FCMA 1KE3A 1IELA 1XX2A 1CEFA 1YMSA 4OPRA 4S2NA 4EQIA 5HW3A 3UNWA 3B3XA 3OPPA 4KG2A 3FV7A 3LY4A 2ZJ9A 5JYPA 1PI4A 2EFXA 2FFFB 5BOHA 2C6WB 3OCNA 1RGYA 5FSRA 4E3JA 4HESA 3G35A 3ITAA 1K25A 1MWSA 3QNCA 5I94A 1S0WA 2WAEA 1KVLA 4DE2A 3CG5A 2QZ6A 4PM5A 4BJPA 3IWIA 4UAAA 3SH9A 2ZQDA 5TFQA 4QJGA 2J9OA 2WADA 3NCKA 3RJUA 1WYCA 3S1YA 3C7VA 1W79A 4GB7A 4KZ4A 5CEDA 1FOFA 2H10A 5HX9A 3C4OA 3VFFA 4P0MA 1YLZA 4S2MA 2WGWA 1KGGA 3VP4A 2Y2GA 5CGXA 2G2WA 1AXBA 4HEFA 4DF6A 5DTSA 3HUNA 4E3KA 3HLBA 3WS4A 4EUZA 1IYSA 3GQZA 1MWUA 4XUZA 1DY6A 2V20A 1G68A 3P98A 2PBYA 2ZQ9A 4LV3A 4WM9A 3O86A 4R3JA 3OPRA 4WZ5C 4FH2A 2HDSA 2P9VA 2WGVA 3ISGA 5FA7A 4DXCA 3UO9A 4E6XA 3AGEA 3UPOA 1C3BA 2WZXA 3ZG9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LY3 A;  5FQI A;  4D2O A;  3OC2 A;  1NRF A;  5FDH A;  4X55 A;  1LI9 A;  4OLD A;  4M3K A;  4OOM A;  1RCJ A;  3WRT A;  3QNB A;  3MZE A;  3PBR A;  1XA1 A;  2EFU A;  1YLT A;  1GHI A;  5CGW A;  4JXW A;  5CER A;  4DRT A;  4E6W A;  2Y91 A;  5CTN A;  1LHY A;  2Y2J A;  1FR6 A;  3N8S A;  5DTK A;  4RX2 A;  1LL9 A;  3BLS A;  3Q07 A;  4PM6 A;  3FZC A;  2IWC A;  3M2J A;  3AGF A;  3BRM A;  1W5D A;  1L0G A;  3TOI A;  1ONH A;  1TEM A;  2OLV A;  4R4R A;  4ZAM A;  3IXD A;  3Q7Z A;  3IHB A;  4QD4 A;  3TG9 A;  5KMW A;  4R3B A;  3G2Y A;  4GZB A;  4KQR A;  1K4E A;  2ZQ8 A;  3V3R A;  3MXR A;  3VMA A;  3LEZ A;  4DKI A;  3G31 A;  3Q82 A;  4FD8 A;  2EX6 A;  5DVA A;  4U3T A;  3N8R A;  1BUL A;  3C4P A;  5CHM A;  3HUM A;  4EBN A;  1ES3 A;  3ZG5 A;  4JKT A;  4PPR A;  5F83 A;  1VQQ A;  4KZA A;  4P87 A;  2Y2O A;  5AQB A;  1Y54 A;  2XD1 A;  3LO7 A;  1PWD A;  4DE0 A;  2X01 A;  3W4O A;  1FCN A;  5KZH A;  1BZA A;  2VGK A;  3BFD A;  4JF5 A;  3G32 A;  5M1A A;  1KE0 A;  3Q7V B;  1JWV A;  1ES2 A;  1XKZ A;  3BFG A;  3G2Z A;  3NDE A;  3N8L A;  5EOE A;  1K55 A;  5A92 A;  2EXA A;  3BFE A;  1EWZ A;  1NZO A;  5AQ9 A;  3BFC A;  2EX8 A;  1QMF A;  2XLN A;  2V1Z A;  1DJA A;  1O07 A;  2B5R A;  3SH7 A;  4KZ5 A;  2OLU A;  5AQA A;  4RA7 A;  2HP5 A;  4Q8I A;  1GA0 A;  4ZBE A;  4OQ0 A;  1K4F A;  1EI5 A;  2HP9 A;  4X6T A;  4DE3 A;  1HTZ A;  4Z9Q A;  3HLC A;  1GCE A;  4F94 A;  2V2F F;  4YIN A;  4N1X A;  5DF9 A;  5HL1 A;  4JPM A;  4DDS A;  5TGF A;  2R9W A;  4JBF A;  1YT4 A;  3SS4 A;  4HBT A;  4QY6 A;  3ZGA B;  2HPB A;  4KZB A;  2Q9N A;  1DJC A;  4KZ9 A;  1JWP A;  4JXG A;  3OPH A;  4U0T A;  4IBR A;  3GR2 A;  4QU3 A;  3IH8 A;  3W4Q A;  1L0F A;  2A49 A;  1TDG A;  1XA7 A;  1ES4 A;  5EPH A;  1BLP A;  2ZM2 A;  1BUE A;  4OPQ A;  5HFO A;  1KVM A;  4ID4 A;  4OQH A;  4GDB A;  1E3U D;  5EEC A;  1PW1 A;  4JF4 A;  4C6Y A;  2Y59 A;  4IVK A;  4PM8 A;  4KZ6 A;  5CRF A;  1ERM A;  5L2F A;  1KE4 A;  1LL5 A;  1XPB A;  2PU2 A;  4DXB A;  4R4S A;  5FQ9 A;  2ZC3 B;  1XXM A;  1IYO A;  3G34 A;  1NZU A;  2HDR A;  5GLC A;  3WS5 A;  1E3U A;  1TVF A;  3VSK A;  5M18 A;  1ZC2 A;  3Q81 A;  3E2L A;  3VOY A;  5FQQ A;  4N92 A;  4WEJ A;  1LI0 A;  1ZG6 A;  2Y2N A;  5GLB A;  3N7W A;  4BL2 A;  4P85 A;  1S6R A;  4BD0 A;  4LCL A;  3OZH A;  3FKW A;  1WE4 A;  1ZG4 A;  3P09 A;  3IXG A;  1H8Y A;  1NYM A;  5EUA A;  4MLL A;  3DWK A;  4S2O A;  2XD5 A;  3GTC A;  1ERO A;  3BFF A;  4RVA A;  4OLG A;  5JYO A;  3D4F A;  2ZMA A;  3PAE A;  4LV0 A;  1FR1 A;  2ZLY A;  2Z2L B;  4KZ7 A;  4WMC D;  4IED A;  3IH9 A;  3HLW A;  3EQU A;  2WAF A;  4C75 A;  1M6K A;  3VP1 A;  4IVI A;  4NK3 A;  5EVI D;  5GLA A;  4GDN A;  1GHM A;  4LV1 A;  4WZ5 A;  1PI5 A;  4S2P A;  4EBL A;  2XF3 A;  1BLH A;  2H5S A;  1MBL A;  2JE5 A;  3ZG8 B;  3E2K A;  3MBZ A;  2X71 A;  4A5R A;  4LCM A;  5E2F A;  3BM6 A;  5DF7 A;  2UWX A;  2HDU A;  4B4X A;  1W7F A;  2Y2H A;  4KQO A;  3C7U A;  1ERQ A;  5CHU A;  5CXW A;  4MNR A;  3G4P A;  4B4Z A;  4WBG A;  4YFM A;  3WS1 A;  2Y2K A;  4E3L A;  4O7D A;  1L0D A;  3A3I A;  1IYQ A;  2RL3 A;  2BLS A;  2EX9 A;  3UDX A;  4JF6 A;  4P6B A;  4RX3 A;  1I5Q A;  1ZKJ A;  4KZ8 A;  4OPY A;  4Y0O A;  5FAT A;  4JLF A;  3WS0 A;  4EWF A;  3FYZ A;  5FQJ A;  4N9K A;  1BSG A;  3UDF A;  2WK0 A;  2ZM0 A;  2ZQC A;  1MWR A;  4KEN B;  1I2W A;  3VFH A;  3WRZ A;  3RXX A;  1IEM A;  3ZVT A;  5FQK A;  3VP3 A;  4RYE A;  2A3U A;  4QB8 A;  3M2K A;  4BD1 A;  5M19 A;  1H5X A;  5FQM A;  5EOO A;  3MKE A;  2G2U A;  1MKI A;  4OOY A;  1GA9 A;  1KDW A;  4KG6 A;  1BLC A;  1U60 A;  3W8K A;  2HP6 A;  3GSG A;  3JYI A;  3GVB A;  3PBT A;  3Q1F A;  4EV4 A;  2ZQA A;  4GNU A;  5D3O A;  1IKG A;  3MKF A;  3VSL A;  4S2L A;  2ZQ7 A;  2IWD A;  3TSG A;  1JVJ A;  3ZDJ A;  2JCH A;  4E3O A;  1FSW A;  1BT5 A;  4H8R A;  1NY0 A;  1JTD A;  1YLY A;  3NIA A;  3NC8 A;  2XH9 A;  2GDN A;  4OQI A;  4GOG A;  4FSF A;  4OOL A;  3IHA A;  4OVD A;  3ZCZ A;  3QHY A;  1BTL A;  5F1G A;  4XUX A;  3ZHH A;  5DTT A;  1PWC A;  1CEG A;  3UE0 A;  3SOI A;  2ZM8 A;  2XFT A;  2Y2Q A;  5EVI B;  3SS5 A;  3DTM A;  2CC1 A;  3UDI A;  2ZC6 B;  3NY4 A;  4Y7P A;  1K38 A;  3OCL A;  3IWQ A;  3HLD A;  4EBP A;  5FI2 A;  1W8Y A;  1K56 D;  3CMZ A;  5A91 A;  4N1H A;  2XEP A;  5HAI A;  3IF6 C;  3SH8 A;  1KGF A;  3EQV A;  3UE1 A;  2IWB A;  4L0L A;  5U47 A;  5F82 A;  3ZFZ A;  5A93 A;  3V3S A;  4PM9 A;  4NET A;  4UHU A;  1SHV A;  5DF8 A;  3MXS A;  5J8X A;  1GHP A;  4WEK A;  2WKE A;  3HL9 A;  1CI9 A;  1MXO A;  2H0T A;  4WZ4 A;  1H8Z A;  4QHC A;  4X53 A;  1Q2Q A;  2Y2I A;  4S2J A;  4CPK A;  2Y4A A;  1NYY A;  2EXB A;  2XR0 A;  5FAO A;  4N9L A;  2Y2P A;  1K54 C;  4OH0 A;  2Q9M A;  5TR7 A;  1FQG A;  4UA7 A;  2OSU A;  3LCE A;  3N6I A;  1WYB A;  3NBL A;  1K54 A;  4LV2 A;  4MBK A;  3V50 A;  4S2N C;  3HVF A;  1E25 A;  3S22 A;  4WEL A;  2WGI A;  5FAP A;  1KDS A;  4MBF A;  3UE3 A;  2ZD8 A;  3NI9 A;  3PAG A;  3VP0 A;  1JWZ A;  3MZF A;  5HAQ A;  3HLG A;  4HBU A;  2WUQ A;  1YM1 A;  2J8Y A;  5A90 A;  1YQS A;  5AQ7 A;  3G30 A;  4PM7 A;  2XK1 A;  3VP2 A;  3BEC A;  3GV9 A;  4B88 A;  1E4D A;  2WYX A;  3IXB A;  2X02 A;  2R9X A;  1DJB A;  1HZO A;  5CEB A;  2PU4 A;  1NXY A;  1G6A A;  2RCX A;  1KGE A;  1MPL A;  2EX2 A;  5CHJ A;  4K0W A;  4ZTK A;  1K6R A;  4U0X A;  1M40 A;  4R23 A;  3Q7V A;  5EE8 A;  3HLF A;  3FKV A;  4GN2 A;  1FSY A;  4X68 A;  4BEN A;  4E3M A;  2JC7 A;  1HD8 A;  1RP5 A;  3BEB A;  2WKI A;  4WMC A;  3ZVW A;  1PZP A;  1SKF A;  2FFY A;  3O88 A;  3RXW A;  1CI8 A;  5EVI C;  1PW8 A;  5EVI A;  1IKI A;  1ONG A;  2OV5 A;  2ZC4 B;  5GL9 A;  2I72 A;  4ZJ3 A;  4OPZ A;  2ZC5 B;  4ZJ2 A;  3SS3 A;  3BYD A;  3IF6 B;  1RGZ A;  1MWT A;  3I7J A;  4KZ3 A;  1XGJ A;  3UY6 A;  1HVB A;  2QMI A;  2Y2L A;  3NDG A;  3PTE A;  4LEN A;  3V39 A;  2WKH A;  1OME A;  4FH4 A;  3UPN A;  1PWG A;  3VOZ A;  1LLB A;  1L0E A;  1SDN A;  5CEC A;  2J9P A;  3ZNY A;  3GMW A;  4X69 A;  4Y0T A;  3ZG0 A;  4UA6 A;  3IT9 A;  1Z6F A;  2DRW A;  3DW0 A;  4UA9 A;  4WYY A;  3A3E A;  4S2I A;  2XGN A;  1K57 C;  4CJN A;  3MFD A;  3UN7 A;  4ZJ1 A;  2XQZ A;  2BG1 A;  2WZZ A;  1K57 A;  3PBN A;  3PBQ A;  2JBF A;  3HRE A;  1W8Q A;  3A3D A;  4IBX A;  3C5A A;  3CJM A;  4ZDX A;  1VM1 A;  3MZD A;  5GLD A;  4BQM A;  1QME A;  2C5W B;  5GHX A;  3DWZ A;  4OKP A;  1I2S A;  3GRJ A;  5EVL A;  3UPP A;  3M6B A;  3M6H A;  2J7V A;  1BLS A;  2VGJ A;  3WS2 A;  2E8I A;  3CZD A;  1ALQ A;  4R1G A;  4MBH A;  3AGD A;  3HBR A;  5FI7 A;  5E2E A;  1L2S A;  3FWL A;  4KG5 A;  3V5M A;  3A3J A;  1CK3 A;  4BLM A;  4K0X A;  4BL3 A;  5FAS A;  1N9B A;  1SCW A;  4KQQ A;  4MEZ A;  3IF5 A;  1YLJ A;  1K6S A;  4FCF A;  1PYY A;  1FCO A;  1ESI A;  4S2K A;  2P74 A;  3PBS A;  5E2H A;  5HAP A;  3O87 A;  4XXR A;  2XDM A;  5KSH A;  1NJ4 A;  3O3V A;  4C3Q A;  1XP4 A;  4JXS A;  2Y55 A;  1PZO A;  1SDE A;  1TDL A;  4E3I A;  2XFS A;  4K91 A;  4X56 A;  4DDY A;  3ZG7 B;  2ZC7 A;  2WGW B;  1N4O A;  1YLP A;  3BLM A;  1ESU A;  3HLE A;  4Y0U A;  1J9M A;  4GD6 A;  3W4P A;  1JTG A;  4R0Q A;  5E43 A;  1ES5 A;  3HUO A;  3IXH A;  2H0Y A;  3S4X A;  1Q2P A;  2Y2M A;  3N4I A;  5F1F A;  1K56 A;  3OPL A;  1K55 C;  2Z2M B;  3IF6 A;  5GHY A;  5KSC A;  4OP8 A;  4E3N A;  3IWO A;  3ITB A;  1IYP A;  4JXV A;  2HDQ A;  2DCF A;  4OP5 A;  5E2G A;  2P9V B;  1MY8 A;  1YLW A;  4GKU A;  5CGS A;  4GD8 A;  1PIO A;  4OQG A;  4OON A;  4PMA A;  5CTM A;  5FAQ A;  1YMX A;  5G18 A;  4DE1 A;  3WWX A;  3A3F A;  1XGI A;  2QPN A;  5GHZ A;  5FI6 A;  1O7E A;  5IHV A;  2DNS A;  3IQA A;  5HAR A;  4QY5 A;  3PBO A;  3ZNT A;  1FCM A;  1KE3 A;  1IEL A;  1XX2 A;  1CEF A;  1YMS A;  4OPR A;  4S2N A;  4EQI A;  5HW3 A;  3UNW A;  3B3X A;  3OPP A;  4KG2 A;  3FV7 A;  3LY4 A;  2ZJ9 A;  5JYP A;  1PI4 A;  2EFX A;  2FFF B;  5BOH A;  2C6W B;  3OCN A;  1RGY A;  5FSR A;  4E3J A;  4HES A;  3G35 A;  3ITA A;  1K25 A;  1MWS A;  3QNC A;  5I94 A;  1S0W A;  2WAE A;  1KVL A;  4DE2 A;  3CG5 A;  2QZ6 A;  4PM5 A;  4BJP A;  3IWI A;  4UAA A;  3SH9 A;  2ZQD A;  5TFQ A;  4QJG A;  2J9O A;  2WAD A;  3NCK A;  3RJU A;  1WYC A;  3S1Y A;  3C7V A;  1W79 A;  4GB7 A;  4KZ4 A;  5CED A;  1FOF A;  2H10 A;  5HX9 A;  3C4O A;  3VFF A;  4P0M A;  1YLZ A;  4S2M A;  2WGW A;  1KGG A;  3VP4 A;  2Y2G A;  5CGX A;  2G2W A;  1AXB A;  4HEF A;  4DF6 A;  5DTS A;  3HUN A;  4E3K A;  3HLB A;  3WS4 A;  4EUZ A;  1IYS A;  3GQZ A;  1MWU A;  4XUZ A;  1DY6 A;  2V20 A;  1G68 A;  3P98 A;  2PBY A;  2ZQ9 A;  4LV3 A;  4WM9 A;  3O86 A;  4R3J A;  3OPR A;  4WZ5 C;  4FH2 A;  2HDS A;  2P9V A;  2WGV A;  3ISG A;  5FA7 A;  4DXC A;  3UO9 A;  4E6X A;  3AGE A;  3UPO A;  1C3B A;  2WZX A;  3ZG9 B; 
#chains in the Genus database with same CATH topology
 4D2O A;  1NRF A;  1H8M A;  3QNB A;  2EFU A;  1YLT A;  5CER A;  2Y2J A;  1OJG A;  4RX2 A;  3Q07 A;  2IWC A;  3VE4 A;  2QJ7 A;  1TEM A;  3CUE C;  4NKP A;  3TG9 A;  4R3B A;  2KDK A;  4KQD A;  4DKI A;  2ACG A;  2PAV P;  4JGQ A;  2JKT M;  3ZG5 A;  4I3J A;  4JKT A;  4PPR A;  3VE3 A;  1Y54 A;  4BBU A;  2XD1 A;  2IA2 A;  2WKQ A;  2JKR I;  2X01 A;  1BZA A;  2VGK A;  5EM1 A;  5M1A A;  1JWV A;  2EXA A;  1EWZ A;  3A0R A;  1NZO A;  5AQ9 A;  1NRJ A;  3JPU A;  1YSQ A;  2EX8 A;  5IS1 A;  2V1Z A;  1DJA A;  3BY9 A;  2OLU A;  4P6Z M;  4OQ0 A;  4GS9 B;  1EI5 A;  3HLC A;  1GCE A;  2V2F F;  2KOI A;  5TGF A;  2R9W A;  4Y15 A;  2J3T D;  1DJC A;  4JXG A;  4Y3I A;  3EGX C;  3OPH A;  5F69 A;  4LFU A;  1T1C A;  3IH8 A;  3W4Q A;  1PRQ A;  5EPH A;  1BLP A;  5CRF A;  5L2F A;  2PU2 A;  2HDR A;  1TVF A;  3UB8 A;  2V0W A;  3Q81 A;  3BWL A;  2V1B A;  4BL2 A;  4ETZ A;  3FKW A;  3T50 A;  2HV1 A;  3IXG A;  1NYM A;  3LIB A;  2XD5 A;  1OTA A;  5JYO A;  2ZMA A;  1D1J A;  1F9I A;  1FR1 A;  2ZLY A;  3PAE A;  2W3F A;  3IX4 A;  3SW1 A;  5A8B A;  1MBL A;  3E2K A;  3MBZ A;  4A5R A;  4B4X A;  4KQO A;  4ARZ B;  4B4Z A;  4YFM A;  4MN6 A;  3WS1 A;  1T1B A;  2EX9 A;  3UDX A;  4P6B A;  4KZ8 A;  4HJ3 A;  4OPY A;  4JLF A;  3FYZ A;  3W2Z A;  1Y4O A;  1I2W A;  3CAX A;  3WRZ A;  3RXX A;  3VP3 A;  2A3U A;  2ZL1 B;  5FQM A;  1MKI A;  4PKY G;  1GA9 A;  3EEH A;  3DTI A;  3W8K A;  1LT0 A;  1AWI A;  3Q1F A;  4EV4 A;  2P08 A;  4GNU A;  3MKF A;  3SZT A;  1OTD A;  4II7 A;  3C2W A;  1PFL A;  1JTD A;  1YLY A;  4UQI M;  2GDN A;  4FSF A;  4OVD A;  3ZCZ A;  1BTL A;  5F1G A;  3ZHH A;  4BBT A;  4R6L A;  3TJZ C;  4UEY A;  1TF1 A;  2JKF A;  2Y79 A;  3NY4 A;  2V8F A;  3DBA A;  1W8Y A;  3CMZ A;  4B93 A;  3IF6 C;  5HD3 A;  4ARZ A;  2IWB A;  3KX0 X;  4FTX A;  3T4L A;  5F68 A;  1P9R A;  4NET A;  4HIA A;  2NUP C;  1V9Y A;  2WKE A;  5F5Y A;  4QHC A;  4CPK A;  2Y2I A;  4N9L A;  3GDI A;  1K54 C;  4OH0 A;  2Q9M A;  3PXP A;  1WYB A;  3V50 A;  3MR0 A;  4S2N C;  4KUK A;  1KDS A;  3MMH A;  3PAG A;  4HBU A;  2J8Y A;  3VP2 A;  5C5K A;  3BEC A;  2WYX A;  2R9X A;  4O01 A;  5CEB A;  2O9B A;  3CLO A;  1KGE A;  1MPL A;  1M40 A;  2V0U A;  5HZH A;  3MXQ A;  3DAV A;  1CI8 A;  3EGD C;  3C38 A;  1ONG A;  3LI8 A;  2OV5 A;  4ZJ2 A;  1MWT A;  1W63 M;  3NDG A;  3PTE A;  3V39 A;  2WKH A;  4PHT A;  4ZRR A;  5CEC A;  3E4Q A;  4LRZ E;  3MFD A;  5DFY A;  1N9O A;  1W8Q A;  4HJ6 A;  4ZDX A;  2C5W B;  5GHX A;  5EVL A;  1I2S A;  1VHM A;  3M6B A;  2W1T B;  2I9V A;  4BLM A;  4K0X A;  1T1A A;  5LBR A;  2PYR A;  4AFI A;  1YLJ A;  3T1S A;  3D72 A;  1DRM A;  3CIT A;  5HAP A;  2GZA A;  3O3V A;  1SDE A;  1TDL A;  2XFS A;  4K91 A;  4X56 A;  2YKF A;  5HSQ A;  1YLP A;  3BLM A;  1JTG A;  2Y2M A;  4NXG A;  1K56 A;  3UE6 A;  2Z2M B;  5GHY A;  5KSC A;  1S1Z A;  4OP8 A;  2VK3 A;  2NUT C;  1MY8 A;  2V8C A;  5KIZ A;  3WWX A;  2GJ3 A;  3V67 A;  1O7E A;  4B9O A;  4EET B;  4I39 A;  2DNS A;  3PBO A;  1YKD A;  1KE3 A;  1IEL A;  4OPR A;  1YMS A;  1DP6 A;  5HW3 A;  2W1T A;  4X25 A;  2FFF B;  5BOH A;  3OCN A;  4E3J A;  4GLQ A;  2PBD P;  2A24 A;  5I94 A;  2WAE A;  4DE2 A;  4R38 A;  4O8G A;  4UAA A;  3SH9 A;  5TFQ A;  2M7U A;  2K31 A;  2YKH A;  4YOF A;  3RJU A;  1WYC A;  4KZ4 A;  1W79 A;  5CED A;  4HY8 A;  2H10 A;  5HX9 A;  4P0M A;  3KYQ A;  1VEU A;  3HUN A;  2V20 A;  2PBY A;  2ZQ9 A;  3O86 A;  1G28 A;  5AVF A;  3TRC A;  3UO9 A;  4E6X A;  3AGE A;  1C3B A;  5EOE A;  3UB5 P;  3ZG9 B;  1HLU P;  4KUO A;  3OLO A;  2OWH A;  3T4T A;  5DKK A;  3CPT B;  3PBR A;  4WLA A;  4JXW A;  4DRT A;  5CTN A;  1FR6 A;  5DTK A;  3FZC A;  1XJ6 A;  3AGF A;  4IHQ A;  3BRM A;  1W5D A;  1L0G A;  1ONH A;  4R4R A;  1T18 A;  3QP6 A;  4ZAM A;  3CUE A;  4GZB A;  3V3R A;  3MXR A;  1TS7 A;  3VMA A;  3N8R A;  1BUL A;  3LYX A;  3HUM A;  3UMD A;  3NOP C;  4BBV A;  1VQQ A;  4JGO A;  3K3D A;  1PWD A;  4DE0 A;  1LL8 A;  3BQ8 A;  1Z09 A;  3BFD A;  3G32 A;  1KE0 A;  2V1A A;  1XKZ A;  3UB6 A;  1N9N A;  5FEG A;  2XLN A;  2VLG A;  2B5R A;  3SH7 A;  4MN7 A;  5AQA A;  4RA7 A;  2HP5 A;  1OTI A;  4WN5 A;  3T1R A;  4DE3 A;  4Z9Q A;  4F94 A;  1P0Z A;  3CPT A;  2O9A A;  4JPM A;  4DDS A;  3GEC A;  1YT4 A;  3SS4 A;  4KZB A;  1BYW A;  1JWP A;  4U0T A;  3GR2 A;  4QU3 A;  2PD8 A;  2W3E A;  1T19 A;  3E98 A;  1L0F A;  3L7H A;  4OPQ A;  4ID4 A;  1E3U D;  4C6Y A;  4CLC C;  4IVK A;  3QP5 A;  4KZ6 A;  1ERM A;  1XXM A;  3G34 A;  1NZU A;  1E3U A;  2XA7 S;  3VSK A;  5M18 A;  4N92 A;  1ZG6 A;  2Y2N A;  5GLB A;  3N7W A;  1S6R A;  4LCL A;  1ZG4 A;  1F5M A;  3LIA A;  5EUA A;  3DWK A;  4S2O A;  1ERO A;  4HOI A;  4LV0 A;  3LIF A;  3HLW A;  4EEU A;  3EQU A;  2VGL M;  4C75 A;  1M6K A;  4IVI A;  5GLA A;  3LR3 A;  1GHM A;  4WZ5 A;  4S2P A;  2XF3 A;  4LCM A;  4HHD A;  1S67 L;  5DF7 A;  2Y2H A;  5CXW A;  2V9A A;  1L0D A;  5DJU A;  3F1O A;  5L8M A;  2RL3 A;  2K2N A;  5L07 A;  1I5Q A;  1ZKJ A;  4Y0O A;  5FAT A;  1IOU A;  1G6O A;  3H7W B;  4Q0H A;  5HDC A;  3S7Q A;  2W0N A;  5FQK A;  4NXB A;  3VV4 A;  4BD1 A;  5EOO A;  2G2U A;  3LI9 A;  1X0O A;  4EU0 A;  4OOY A;  4EQ1 A;  1BLC A;  3LR5 A;  1U60 A;  3PBT A;  2ZQA A;  3PHY A;  1W63 Q;  1XJ2 A;  1IKG A;  4G3K A;  2IWD A;  4HH2 A;  4FOF A;  1JVJ A;  3ZDJ A;  1FSW A;  2XSS A;  1BT5 A;  4H8R A;  2EWV A;  4EEP A;  2PYP A;  4XUX A;  3UE0 A;  2Y2Q A;  3DTM A;  3UDI A;  4Y7P A;  3EEA A;  3OCL A;  3IWQ A;  5A91 A;  2XEP A;  1YPR A;  5HAI A;  3SH8 A;  1DP9 A;  3UB7 A;  1V9Z A;  4L0L A;  5U47 A;  3NUL A;  5F82 A;  5A93 A;  3V3S A;  3MQ0 A;  3T1X A;  1P97 A;  1GHP A;  3HL9 A;  1H8Z A;  1NYY A;  2H28 A;  2Y2P A;  5TR7 A;  2R78 A;  3N6I A;  3NBL A;  1K54 A;  4WEL A;  3D3O A;  2WGI A;  5FAP A;  4MBF A;  1OT9 A;  1JWZ A;  5HAQ A;  1XFN A;  5A90 A;  1YQS A;  4D60 A;  1E4D A;  2ZOH A;  3IXB A;  2X02 A;  1DJB A;  3KSF A;  1G6A A;  1NWZ A;  5CHJ A;  1K6R A;  4R23 A;  4GHI B;  5EE8 A;  3HLF A;  1CQA A;  4BEN A;  4Q0J A;  2JC7 A;  2WKI A;  3ZVW A;  1SKF A;  3LGO A;  5J7E A;  5EV0 A;  4HJ4 A;  3D9Y A;  2I72 A;  2PT7 A;  1XFQ A;  4GS9 A;  3BYD A;  5L10 A;  2Z6D A;  3UY6 A;  4Y17 A;  1HVB A;  2QMI A;  2Y2L A;  4LEN A;  1OME A;  1LLB A;  2J9P A;  5HDS A;  4CQH A;  3IBR A;  3ZG0 A;  4UA6 A;  1TD5 A;  2ZMF A;  3BY8 A;  3DW0 A;  4UA9 A;  3A3E A;  4S2I A;  1K57 C;  3S7N A;  4ZJ1 A;  3P01 A;  2BG1 A;  2JBF A;  3C5A A;  3CJM A;  3MZD A;  4BQM A;  2JKG A;  3ULF A;  3WS2 A;  2L4R A;  1S1Y A;  4R1G A;  3HBR A;  3V5M A;  5E2E A;  4KG5 A;  1CK3 A;  2PD7 A;  4MEZ A;  1PYY A;  1FCO A;  4GHI A;  5L09 A;  2P74 A;  3PBS A;  5E2H A;  2XDM A;  5KSH A;  1NJ4 A;  1XP4 A;  2Y55 A;  4E3I A;  4DDY A;  3ZG7 B;  1SZV A;  2WGW B;  2ZC7 A;  5G4Y A;  1ESU A;  1LSW A;  3HLE A;  3C8C A;  1J9M A;  1K0K A;  5E43 A;  3S4X A;  2H0Y A;  5F1F A;  3T4K A;  4EXO A;  2VV6 A;  5E2G A;  4GKU A;  4GD8 A;  4I38 A;  5CTM A;  4X1L A;  4DE1 A;  2QPN A;  3ICY A;  2ZL1 A;  4L9E A;  3ZNT A;  4QWO A;  4EQI A;  3UNW A;  3OPP A;  4KG2 A;  3FPW A;  3IX8 A;  3LY4 A;  1PI4 A;  4IUH A;  3IS2 B;  5DFX A;  1S0W A;  1S66 L;  3CG5 A;  2QZ6 A;  4PM5 A;  2Z6C A;  2ZQD A;  4QJG A;  2J9O A;  1ZTU A;  4HH3 A;  3H82 B;  2INW A;  1GSW A;  2WGW A;  3VP4 A;  5CGX A;  3NEC A;  4EUZ A;  3GQZ A;  4XUZ A;  2ZOI A;  1DY6 A;  1G68 A;  4LV3 A;  5AVE A;  3OPR A;  4H6J B;  4I3A A;  3UPO A;  3VP1 A;  5FQI A;  5FDH A;  4M3K A;  3WRT A;  3IX3 A;  4IUK A;  5CGW A;  4LRX C;  2WKP A;  4NEE D;  3RFB A;  1LL9 A;  3BLS A;  4PM6 A;  3FG8 A;  3KO6 A;  2OLV A;  2B02 A;  3IXD A;  3Q7Z A;  3IHB A;  3LID A;  2W27 A;  4KQR A;  2ZQ8 A;  3LEZ A;  5CX7 A;  5HL6 A;  3G31 A;  3Q82 A;  2EX6 A;  4CLC B;  2FZ0 A;  2VV8 A;  3LR0 A;  1ES3 A;  4LRY C;  4KZA A;  1PNE A;  2Y2O A;  3H82 A;  5AQB A;  3K2N A;  5HWW A;  4P6Z S;  1G5U A;  1FCN A;  5KZH A;  5IT5 A;  4JF5 A;  3Q7V B;  3G2Z A;  3NDE A;  1TS8 A;  1K55 A;  2OAP 1;  3NOT C;  3BFE A;  2G7U A;  1QMF A;  2VA0 A;  4XT2 B;  1O07 A;  4KZ5 A;  1GA0 A;  4ZBE A;  5HWT A;  1K4F A;  2HP9 A;  4X6T A;  1OTB A;  1HTZ A;  4YIN A;  2KX6 A;  5DF9 A;  4X1M A;  2HPB A;  4KZ9 A;  1GSX A;  4IBR A;  4EW7 A;  2A49 A;  1XA7 A;  1BUE A;  4CLC D;  4GDB A;  1PW1 A;  4JF4 A;  2Y59 A;  4PM8 A;  1KE4 A;  4DXB A;  4R4S A;  2ZC3 B;  4CLC A;  3FC7 A;  1ZC2 A;  2HGV A;  5FQQ A;  4WEJ A;  1LI0 A;  4NG2 A;  3OZH A;  1H8Y A;  4MLL A;  1NLY A;  2O9C A;  3GTC A;  3BFF A;  4RVA A;  3D4F A;  5TJJ A;  4WMC D;  2Z2L B;  4IED A;  2M7V A;  3IH9 A;  2WAF A;  1OPX A;  3C30 A;  2W3D A;  5EVI D;  2OOL A;  3IBJ A;  4GDN A;  4LV1 A;  1PI5 A;  1BLH A;  2H5S A;  2QJ5 A;  3NOU C;  5E2F A;  2EA9 A;  4G3V A;  4O0P A;  2CMN A;  3B42 A;  4WBG A;  2MJ6 A;  2QYB A;  2Y2K A;  2EWW A;  2P04 A;  2B95 A;  4O7D A;  4E3L A;  2BLS A;  4JF6 A;  4RX3 A;  1KOU A;  4EWF A;  3WS0 A;  5FQJ A;  1VET B;  4N9K A;  3DTK A;  1LSX A;  1S4S A;  3UDF A;  2ZQC A;  4KEN B;  4WF0 A;  2XRO A;  1IEM A;  2W3H A;  3E4O A;  3M2K A;  3MKE A;  4UQI S;  3KSG A;  2VJW A;  4KG6 A;  3GSG A;  4GCZ A;  3GVB A;  4YWZ A;  1YAX A;  2ZQ7 A;  3QP2 A;  4E3O A;  1D7E A;  1NY0 A;  3NC8 A;  2XH9 A;  4OQI A;  4GOG A;  5DKL A;  1XJ4 A;  4BMW A;  5DTT A;  1PWC A;  1CEG A;  3SOI A;  5K5B A;  2XFT A;  3SS5 A;  2CC1 A;  2ZC6 B;  2GNX A;  5FI2 A;  1OTE A;  1UWP X;  3EQV A;  3UE1 A;  5FEF A;  3ZFZ A;  4FUW A;  4MCW A;  4UHU A;  1SHV A;  3MXS A;  5J8X A;  1CI9 A;  1MXO A;  2A2L A;  2H0T A;  3U4L P;  4X53 A;  4S2J A;  4F3L B;  5FAO A;  2XR0 A;  5HPI A;  3U2A A;  4UA7 A;  2OSU A;  3LCE A;  4LV2 A;  2LB9 A;  1FIL A;  3NI9 A;  1YM1 A;  2PRF A;  2JKT I;  3G30 A;  4PM7 A;  4WL9 A;  3GV9 A;  1HZO A;  3TW8 A;  1L3L A;  2VEA A;  1NXY A;  4PKY A;  4GJ4 A;  1EW0 A;  2RCX A;  4GN2 A;  1FSY A;  4X68 A;  1HD8 A;  3G6O A;  3O88 A;  4PAU A;  5EVI C;  3DTE A;  1IKI A;  2ZC4 B;  5GL9 A;  4ZJ3 A;  4OPZ A;  4Y13 A;  2XRN A;  4ETX A;  1TS0 A;  2UV0 E;  3IF6 B;  1RGZ A;  1XGJ A;  2LB5 A;  4LGW A;  4FH4 A;  3UPN A;  5I5L A;  4JGR A;  3VOZ A;  3RTY A;  1SDN A;  2Y8H A;  3ZNY A;  3GMW A;  4QPR A;  4LPZ A;  4X69 A;  4YNR A;  4Y0T A;  2PR6 A;  3IT9 A;  4F3L A;  2DRW A;  2XGN A;  4CJN A;  3T4S A;  3L9K A;  2XQZ A;  3KYE A;  1K57 A;  3F1P B;  3PBN A;  3PBQ A;  3HRE A;  4IBX A;  1F2K A;  4HI4 A;  3EWK A;  4OKP A;  2GX5 A;  2J7V A;  2VGJ A;  3CZD A;  3CI6 A;  2O99 A;  3EOI A;  4MBH A;  3AGD A;  1L2S A;  3A3J A;  5FAS A;  1N9B A;  1NLZ A;  3IF5 A;  4FCF A;  2BTF P;  3MJQ A;  4S2K A;  3O87 A;  2VX8 A;  4C3Q A;  4JXS A;  1N4O A;  4Q0I A;  3W4P A;  1CF0 A;  3UB9 A;  3HUO A;  3N4I A;  3OPL A;  3IF6 A;  5TBM B;  4E3N A;  3ITB A;  2HDQ A;  4OP5 A;  2P9V B;  1YLW A;  4HP9 A;  1H3Q A;  1PIO A;  4OQG A;  4PMA A;  1YMX A;  5G18 A;  4DJ3 A;  3H7W A;  1XGI A;  3E0Y A;  5IHV A;  3HCY A;  3F1P A;  3IQA A;  4QY5 A;  1XX2 A;  4S2N A;  4MMN A;  2ZBB A;  3B3X A;  3FV7 A;  2ZJ9 A;  1ODV A;  2EFX A;  2C6W B;  1RGY A;  2PHY A;  5FSR A;  3G35 A;  3QNC A;  1MC0 A;  1KVL A;  3S7O A;  4BJP A;  4HNB A;  5HDD A;  3MQQ A;  3NCK A;  2JKR M;  3BQA A;  3CHW P;  3MSH A;  1D06 A;  3QP8 A;  1FIK A;  3BW6 A;  3C4O A;  3VFF A;  1YLZ A;  1MZU A;  1KGG A;  2Y2G A;  2G2W A;  1AXB A;  4DF6 A;  3HLB A;  5HWV A;  1IYS A;  1MWU A;  3P98 A;  5TBM A;  4MN5 A;  4R3J A;  4WZ5 C;  1F98 A;  3F1N B;  2P9V A;  4DXC A;  3ISG A;  2VKS A;  3LY3 A;  3OC2 A;  4BWI A;  4X55 A;  1LI9 A;  2VV7 A;  4OLD A;  4OOM A;  1RCJ A;  3MZE A;  1XA1 A;  1GHI A;  4E6W A;  2Y91 A;  1J3W A;  1LHY A;  3N8S A;  2KLI A;  2PR5 A;  3M2J A;  3TOI A;  4Y2F A;  3OBF A;  3LIE A;  2O0Y A;  4QD4 A;  5KMW A;  3G2Y A;  1MKM A;  1K4E A;  3UME A;  4DN0 A;  4M4X A;  1N9L A;  4FD8 A;  5DVA A;  4U3T A;  3O5Y A;  3C4P A;  5CHM A;  3T4O A;  4EBN A;  5F83 A;  4P87 A;  5IU1 A;  3ZQ5 A;  3P7N A;  2DMW A;  2L1M A;  3LO7 A;  3W4O A;  1ES2 A;  3BFG A;  3N8L A;  5A92 A;  1A0K A;  4RQ9 A;  3H9W A;  4NXE A;  3BFC A;  3F1N A;  3K3C A;  1LSV A;  2J80 A;  4Q8I A;  3E4P A;  3PYP A;  4N1X A;  5HL1 A;  4I5S A;  4JBF A;  4HBT A;  4QY6 A;  3ZGA B;  2Q9N A;  2J3T C;  1VB6 A;  4L9F A;  1TDG A;  1ES4 A;  5FDS A;  2ZM2 A;  5HFO A;  1KVM A;  4OQH A;  5EEC A;  3TE8 A;  4HP4 A;  3MFX A;  1LL5 A;  1XPB A;  2VGL S;  5FQ9 A;  3WS5 A;  1IYO A;  5GLC A;  3E2L A;  3VOY A;  1DP8 A;  4Z1W A;  4P85 A;  4BD0 A;  1WE4 A;  2W3G A;  3P09 A;  3KSI A;  4OLG A;  4KZ7 A;  2JN7 A;  4R70 A;  2XA7 M;  5HD5 A;  4NK3 A;  2W1R A;  1SKO B;  1CJF A;  1UWN X;  4EBL A;  4JGP A;  2JE5 A;  3ZG8 B;  2Q0O A;  2X71 A;  5F6A A;  3BM6 A;  2UWX A;  2HDU A;  1W7F A;  3C7U A;  1ERQ A;  5CHU A;  3T4Q A;  4MNR A;  3G4P A;  1S4R A;  3A3I A;  1IYQ A;  3MF0 A;  5EVE A;  1GSV A;  1XJ3 A;  3T4J A;  3R7W B;  1BSG A;  1JNU A;  2WK0 A;  2ZM0 A;  1MWR A;  3VFH A;  3ZVT A;  3IS2 A;  4RYE A;  4QB8 A;  4L9G A;  5M19 A;  3JVV A;  1H5X A;  1IFQ A;  1KDW A;  4WUJ A;  4DMZ A;  2HP6 A;  3JYI A;  5D3O A;  5G4Z A;  3VSL A;  4S2L A;  3TSG A;  3QP4 A;  2JCH A;  2OWJ A;  2A24 B;  3NIA A;  2HF6 A;  4OOL A;  3IHA A;  3QHY A;  2B18 A;  3NJA A;  4H6J A;  3ZYT A;  4K08 A;  1SKO A;  2ZM8 A;  5EVI B;  4EER A;  1ZHH B;  5EM0 A;  1K38 A;  3HLD A;  4EBP A;  4EUV A;  1VEU B;  1K56 D;  3RH8 B;  4N1H A;  1KGF A;  4LLO B;  5MC7 A;  4PM9 A;  5AJG A;  5DF8 A;  3HJK A;  4WEK A;  4WZ4 A;  4IJG A;  3R7W A;  1Q2Q A;  2Y4A A;  2EXB A;  3LIC A;  5DJT A;  4ME4 A;  1FQG A;  4MBK A;  3HVF A;  1E25 A;  3S22 A;  3QP1 A;  2QKP A;  2HZ5 A;  5J3W A;  2E8J A;  2OAQ 1;  2ZD8 A;  3UE3 A;  3VP0 A;  3MZF A;  3HLG A;  2WUQ A;  3KYZ A;  5AQ7 A;  2XK1 A;  4B88 A;  2P7J A;  1UGU A;  4E04 A;  2PU4 A;  5HPF A;  2EX2 A;  4K0W A;  4ZTK A;  4U0X A;  3Q7V A;  3FKV A;  4E3M A;  1RP5 A;  3BEB A;  2J3W A;  3JVU A;  4WMC A;  3KSH A;  1PZP A;  2FFY A;  2D01 A;  3RXW A;  4G3W A;  2QHK A;  1PW8 A;  3T12 B;  4DJ2 A;  2FH5 A;  5EVI A;  4XT2 A;  1ACF A;  2ZC5 B;  3SS3 A;  1STZ A;  3I7J A;  4KZ3 A;  3R4K A;  3LEQ A;  3NHQ A;  4ESP A;  2ZMV A;  1PWG A;  1L0E A;  4EES A;  1Z6F A;  4WYY A;  3UN7 A;  3B47 A;  2WZZ A;  3A3D A;  3OOV A;  4GW9 A;  1VM1 A;  1OT6 A;  5GLD A;  1QME A;  3LFV A;  3DWZ A;  3UPP A;  3GRJ A;  1WA9 A;  3M6H A;  1BLS A;  2E8I A;  2HJE A;  1ALQ A;  1TS6 A;  5FI7 A;  3FWL A;  4BL3 A;  1SCW A;  2AVX A;  4KQQ A;  4CLC E;  1K6S A;  1H0M A;  5FL3 A;  1ESI A;  4XXR A;  1YSP A;  4HQA A;  3BJN A;  1PZO A;  3A0S A;  4NXF A;  4Y0U A;  4GD6 A;  4R0Q A;  1ES5 A;  3IXH A;  1Q2P A;  3MS6 A;  1K55 C;  3T1Q B;  2L0W A;  3MQO A;  2BAS A;  3IWO A;  4JXV A;  1IYP A;  2DCF A;  3S7P A;  1Y28 A;  5CGS A;  1VET A;  1OJ5 A;  3VOL A;  5FAQ A;  4OON A;  3A3F A;  1P9W A;  4I3I A;  5GHZ A;  5FI6 A;  2D02 A;  2VZW A;  3F1O B;  5HAR A;  1FCM A;  1CEF A;  4MDZ A;  5EFW A;  2JHE A;  5J4E A;  4Y5F A;  3A0V A;  2M1C A;  5JYP A;  3LUQ A;  4HES A;  3ITA A;  1K25 A;  1MWS A;  2WKR A;  3FPV A;  3IWI A;  3HJI A;  2WAD A;  3S1Y A;  3C7V A;  2K7S A;  4GB7 A;  1FOF A;  3PR6 A;  4S2M A;  2QWS A;  4R3A A;  2PDR A;  3B33 A;  4HEF A;  5DTS A;  4E3K A;  3WS4 A;  3LR4 A;  4WM9 A;  2HJ9 C;  4FH2 A;  2HDS A;  2WGV A;  5FA7 A;  2WZX A;  3CWF A; 
#chains in the Genus database with same CATH homology
 3LY3 A;  5FQI A;  4D2O A;  3OC2 A;  1NRF A;  5FDH A;  4X55 A;  1LI9 A;  4OLD A;  4M3K A;  4OOM A;  1RCJ A;  3WRT A;  3QNB A;  3MZE A;  3PBR A;  1XA1 A;  2EFU A;  1YLT A;  1GHI A;  5CGW A;  4JXW A;  5CER A;  4DRT A;  4E6W A;  2Y91 A;  5CTN A;  1LHY A;  2Y2J A;  1FR6 A;  3N8S A;  5DTK A;  4RX2 A;  1LL9 A;  3BLS A;  3Q07 A;  4PM6 A;  3FZC A;  2IWC A;  3M2J A;  3AGF A;  3BRM A;  1W5D A;  1L0G A;  3TOI A;  1ONH A;  1TEM A;  2OLV A;  4R4R A;  4ZAM A;  3IXD A;  3Q7Z A;  3IHB A;  4QD4 A;  3TG9 A;  5KMW A;  4R3B A;  3G2Y A;  4GZB A;  4KQR A;  1K4E A;  2ZQ8 A;  3V3R A;  3MXR A;  3VMA A;  3LEZ A;  4DKI A;  3G31 A;  3Q82 A;  4FD8 A;  2EX6 A;  5DVA A;  4U3T A;  3N8R A;  1BUL A;  3C4P A;  5CHM A;  3HUM A;  4EBN A;  1ES3 A;  3ZG5 A;  4JKT A;  4PPR A;  5F83 A;  1VQQ A;  4KZA A;  4P87 A;  2Y2O A;  5AQB A;  1Y54 A;  2XD1 A;  3LO7 A;  1PWD A;  4DE0 A;  2X01 A;  3W4O A;  1FCN A;  5KZH A;  1BZA A;  2VGK A;  3BFD A;  4JF5 A;  3G32 A;  5M1A A;  1KE0 A;  3Q7V B;  1JWV A;  1ES2 A;  1XKZ A;  3BFG A;  3G2Z A;  3NDE A;  3N8L A;  5EOE A;  1K55 A;  5A92 A;  2EXA A;  3BFE A;  1EWZ A;  1NZO A;  5AQ9 A;  3BFC A;  2EX8 A;  1QMF A;  2XLN A;  2V1Z A;  1DJA A;  1O07 A;  2B5R A;  3SH7 A;  4KZ5 A;  2OLU A;  5AQA A;  4RA7 A;  2HP5 A;  4Q8I A;  1GA0 A;  4ZBE A;  4OQ0 A;  1K4F A;  1EI5 A;  2HP9 A;  4X6T A;  4DE3 A;  1HTZ A;  4Z9Q A;  3HLC A;  1GCE A;  4F94 A;  2V2F F;  4YIN A;  4N1X A;  5DF9 A;  5HL1 A;  4JPM A;  4DDS A;  5TGF A;  2R9W A;  4JBF A;  1YT4 A;  3SS4 A;  4HBT A;  4QY6 A;  3ZGA B;  2HPB A;  4KZB A;  2Q9N A;  1DJC A;  4KZ9 A;  1JWP A;  4JXG A;  3OPH A;  4U0T A;  4IBR A;  3GR2 A;  4QU3 A;  3IH8 A;  3W4Q A;  1L0F A;  2A49 A;  1TDG A;  1XA7 A;  1ES4 A;  5EPH A;  1BLP A;  2ZM2 A;  1BUE A;  4OPQ A;  5HFO A;  1KVM A;  4ID4 A;  4OQH A;  4GDB A;  1E3U D;  5EEC A;  1PW1 A;  4JF4 A;  4C6Y A;  2Y59 A;  4IVK A;  4PM8 A;  4KZ6 A;  5CRF A;  1ERM A;  5L2F A;  1KE4 A;  1LL5 A;  1XPB A;  2PU2 A;  4DXB A;  4R4S A;  5FQ9 A;  2ZC3 B;  1XXM A;  1IYO A;  3G34 A;  1NZU A;  2HDR A;  5GLC A;  3WS5 A;  1E3U A;  1TVF A;  3VSK A;  5M18 A;  1ZC2 A;  3Q81 A;  3E2L A;  3VOY A;  5FQQ A;  4N92 A;  4WEJ A;  1LI0 A;  1ZG6 A;  2Y2N A;  5GLB A;  3N7W A;  4BL2 A;  4P85 A;  1S6R A;  4BD0 A;  4LCL A;  3OZH A;  3FKW A;  1WE4 A;  1ZG4 A;  3P09 A;  3IXG A;  1H8Y A;  1NYM A;  5EUA A;  4MLL A;  3DWK A;  4S2O A;  2XD5 A;  3GTC A;  1ERO A;  3BFF A;  4RVA A;  4OLG A;  5JYO A;  3D4F A;  2ZMA A;  3PAE A;  4LV0 A;  1FR1 A;  2ZLY A;  2Z2L B;  4KZ7 A;  4WMC D;  4IED A;  3IH9 A;  3HLW A;  3EQU A;  2WAF A;  4C75 A;  1M6K A;  3VP1 A;  4IVI A;  4NK3 A;  5EVI D;  5GLA A;  4GDN A;  1GHM A;  4LV1 A;  4WZ5 A;  1PI5 A;  4S2P A;  4EBL A;  2XF3 A;  1BLH A;  2H5S A;  1MBL A;  2JE5 A;  3ZG8 B;  3E2K A;  3MBZ A;  2X71 A;  4A5R A;  4LCM A;  5E2F A;  3BM6 A;  5DF7 A;  2UWX A;  2HDU A;  4B4X A;  1W7F A;  2Y2H A;  4KQO A;  3C7U A;  1ERQ A;  5CHU A;  5CXW A;  4MNR A;  3G4P A;  4B4Z A;  4WBG A;  4YFM A;  3WS1 A;  2Y2K A;  4E3L A;  4O7D A;  1L0D A;  3A3I A;  1IYQ A;  2RL3 A;  2BLS A;  2EX9 A;  3UDX A;  4JF6 A;  4P6B A;  4RX3 A;  1I5Q A;  1ZKJ A;  4KZ8 A;  4OPY A;  4Y0O A;  5FAT A;  4JLF A;  3WS0 A;  4EWF A;  3FYZ A;  5FQJ A;  4N9K A;  1BSG A;  3UDF A;  2WK0 A;  2ZM0 A;  2ZQC A;  1MWR A;  4KEN B;  1I2W A;  3VFH A;  3WRZ A;  3RXX A;  1IEM A;  3ZVT A;  5FQK A;  3VP3 A;  4RYE A;  2A3U A;  4QB8 A;  3M2K A;  4BD1 A;  5M19 A;  1H5X A;  5FQM A;  5EOO A;  3MKE A;  2G2U A;  1MKI A;  4OOY A;  1GA9 A;  1KDW A;  4KG6 A;  1BLC A;  1U60 A;  3W8K A;  2HP6 A;  3GSG A;  3JYI A;  3GVB A;  3PBT A;  3Q1F A;  4EV4 A;  2ZQA A;  4GNU A;  5D3O A;  1IKG A;  3MKF A;  3VSL A;  4S2L A;  2ZQ7 A;  2IWD A;  3TSG A;  1JVJ A;  3ZDJ A;  2JCH A;  4E3O A;  1FSW A;  1BT5 A;  4H8R A;  1NY0 A;  1JTD A;  1YLY A;  3NIA A;  3NC8 A;  2XH9 A;  2GDN A;  4OQI A;  4GOG A;  4FSF A;  4OOL A;  3IHA A;  4OVD A;  3ZCZ A;  3QHY A;  1BTL A;  5F1G A;  4XUX A;  3ZHH A;  5DTT A;  1PWC A;  1CEG A;  3UE0 A;  3SOI A;  2ZM8 A;  2XFT A;  2Y2Q A;  5EVI B;  3SS5 A;  3DTM A;  2CC1 A;  3UDI A;  2ZC6 B;  3NY4 A;  4Y7P A;  1K38 A;  3OCL A;  3IWQ A;  3HLD A;  4EBP A;  5FI2 A;  1W8Y A;  1K56 D;  3CMZ A;  5A91 A;  4N1H A;  2XEP A;  5HAI A;  3IF6 C;  3SH8 A;  1KGF A;  3EQV A;  3UE1 A;  2IWB A;  4L0L A;  5U47 A;  5F82 A;  3ZFZ A;  5A93 A;  3V3S A;  4PM9 A;  4NET A;  4UHU A;  1SHV A;  5DF8 A;  3MXS A;  5J8X A;  1GHP A;  4WEK A;  2WKE A;  3HL9 A;  1CI9 A;  1MXO A;  2H0T A;  4WZ4 A;  1H8Z A;  4QHC A;  4X53 A;  1Q2Q A;  2Y2I A;  4S2J A;  4CPK A;  2Y4A A;  1NYY A;  2EXB A;  2XR0 A;  5FAO A;  4N9L A;  2Y2P A;  1K54 C;  4OH0 A;  2Q9M A;  5TR7 A;  1FQG A;  4UA7 A;  2OSU A;  3LCE A;  3N6I A;  1WYB A;  3NBL A;  1K54 A;  4LV2 A;  4MBK A;  3V50 A;  4S2N C;  3HVF A;  1E25 A;  3S22 A;  4WEL A;  2WGI A;  5FAP A;  1KDS A;  4MBF A;  3UE3 A;  2ZD8 A;  3NI9 A;  3PAG A;  3VP0 A;  1JWZ A;  3MZF A;  5HAQ A;  3HLG A;  4HBU A;  2WUQ A;  1YM1 A;  2J8Y A;  5A90 A;  1YQS A;  5AQ7 A;  3G30 A;  4PM7 A;  2XK1 A;  3VP2 A;  3BEC A;  3GV9 A;  4B88 A;  1E4D A;  2WYX A;  3IXB A;  2X02 A;  2R9X A;  1DJB A;  1HZO A;  5CEB A;  2PU4 A;  1NXY A;  1G6A A;  2RCX A;  1KGE A;  1MPL A;  2EX2 A;  5CHJ A;  4K0W A;  4ZTK A;  1K6R A;  4U0X A;  1M40 A;  4R23 A;  3Q7V A;  5EE8 A;  3HLF A;  3FKV A;  4GN2 A;  1FSY A;  4X68 A;  4BEN A;  4E3M A;  2JC7 A;  1HD8 A;  1RP5 A;  3BEB A;  2WKI A;  4WMC A;  3ZVW A;  1PZP A;  1SKF A;  2FFY A;  3O88 A;  3RXW A;  1CI8 A;  5EVI C;  1PW8 A;  5EVI A;  1IKI A;  1ONG A;  2OV5 A;  2ZC4 B;  5GL9 A;  2I72 A;  4ZJ3 A;  4OPZ A;  2ZC5 B;  4ZJ2 A;  3SS3 A;  3BYD A;  3IF6 B;  1RGZ A;  1MWT A;  3I7J A;  4KZ3 A;  1XGJ A;  3UY6 A;  1HVB A;  2QMI A;  2Y2L A;  3NDG A;  3PTE A;  4LEN A;  3V39 A;  2WKH A;  1OME A;  4FH4 A;  3UPN A;  1PWG A;  3VOZ A;  1LLB A;  1L0E A;  1SDN A;  5CEC A;  2J9P A;  3ZNY A;  3GMW A;  4X69 A;  4Y0T A;  3ZG0 A;  4UA6 A;  3IT9 A;  1Z6F A;  2DRW A;  3DW0 A;  4UA9 A;  4WYY A;  3A3E A;  4S2I A;  2XGN A;  1K57 C;  4CJN A;  3MFD A;  3UN7 A;  4ZJ1 A;  2XQZ A;  2BG1 A;  2WZZ A;  1K57 A;  3PBN A;  3PBQ A;  2JBF A;  3HRE A;  1W8Q A;  3A3D A;  4IBX A;  3C5A A;  3CJM A;  4ZDX A;  1VM1 A;  3MZD A;  5GLD A;  4BQM A;  1QME A;  2C5W B;  5GHX A;  3DWZ A;  4OKP A;  1I2S A;  3GRJ A;  5EVL A;  3UPP A;  3M6B A;  3M6H A;  2J7V A;  1BLS A;  2VGJ A;  3WS2 A;  2E8I A;  3CZD A;  1ALQ A;  4R1G A;  4MBH A;  3AGD A;  3HBR A;  5FI7 A;  5E2E A;  1L2S A;  3FWL A;  4KG5 A;  3V5M A;  3A3J A;  1CK3 A;  4BLM A;  4K0X A;  4BL3 A;  5FAS A;  1N9B A;  1SCW A;  4KQQ A;  4MEZ A;  3IF5 A;  1YLJ A;  1K6S A;  4FCF A;  1PYY A;  1FCO A;  1ESI A;  4S2K A;  2P74 A;  3PBS A;  5E2H A;  5HAP A;  3O87 A;  4XXR A;  2XDM A;  5KSH A;  1NJ4 A;  3O3V A;  4C3Q A;  1XP4 A;  4JXS A;  2Y55 A;  1PZO A;  1SDE A;  1TDL A;  4E3I A;  2XFS A;  4K91 A;  4X56 A;  4DDY A;  3ZG7 B;  2ZC7 A;  2WGW B;  1N4O A;  1YLP A;  3BLM A;  1ESU A;  3HLE A;  4Y0U A;  1J9M A;  4GD6 A;  3W4P A;  1JTG A;  4R0Q A;  5E43 A;  1ES5 A;  3HUO A;  3IXH A;  2H0Y A;  3S4X A;  1Q2P A;  2Y2M A;  3N4I A;  5F1F A;  1K56 A;  3OPL A;  1K55 C;  2Z2M B;  3IF6 A;  5GHY A;  5KSC A;  4OP8 A;  4E3N A;  3IWO A;  3ITB A;  1IYP A;  4JXV A;  2HDQ A;  2DCF A;  4OP5 A;  5E2G A;  2P9V B;  1MY8 A;  1YLW A;  4GKU A;  5CGS A;  4GD8 A;  1PIO A;  4OQG A;  4OON A;  4PMA A;  5CTM A;  5FAQ A;  1YMX A;  5G18 A;  4DE1 A;  3WWX A;  3A3F A;  1XGI A;  2QPN A;  5GHZ A;  5FI6 A;  1O7E A;  5IHV A;  2DNS A;  3IQA A;  5HAR A;  4QY5 A;  3PBO A;  3ZNT A;  1FCM A;  1KE3 A;  1IEL A;  1XX2 A;  1CEF A;  1YMS A;  4OPR A;  4S2N A;  4EQI A;  5HW3 A;  3UNW A;  3B3X A;  3OPP A;  4KG2 A;  3FV7 A;  3LY4 A;  2ZJ9 A;  5JYP A;  1PI4 A;  2EFX A;  2FFF B;  5BOH A;  2C6W B;  3OCN A;  1RGY A;  5FSR A;  4E3J A;  4HES A;  3G35 A;  3ITA A;  1K25 A;  1MWS A;  3QNC A;  5I94 A;  1S0W A;  2WAE A;  1KVL A;  4DE2 A;  3CG5 A;  2QZ6 A;  4PM5 A;  4BJP A;  3IWI A;  4UAA A;  3SH9 A;  2ZQD A;  5TFQ A;  4QJG A;  2J9O A;  2WAD A;  3NCK A;  3RJU A;  1WYC A;  3S1Y A;  3C7V A;  1W79 A;  4GB7 A;  4KZ4 A;  5CED A;  1FOF A;  2H10 A;  5HX9 A;  3C4O A;  3VFF A;  4P0M A;  1YLZ A;  4S2M A;  2WGW A;  1KGG A;  3VP4 A;  2Y2G A;  5CGX A;  2G2W A;  1AXB A;  4HEF A;  4DF6 A;  5DTS A;  3HUN A;  4E3K A;  3HLB A;  3WS4 A;  4EUZ A;  1IYS A;  3GQZ A;  1MWU A;  4XUZ A;  1DY6 A;  2V20 A;  1G68 A;  3P98 A;  2PBY A;  2ZQ9 A;  4LV3 A;  4WM9 A;  3O86 A;  4R3J A;  3OPR A;  4WZ5 C;  4FH2 A;  2HDS A;  2P9V A;  2WGV A;  3ISG A;  5FA7 A;  4DXC A;  3UO9 A;  4E6X A;  3AGE A;  3UPO A;  1C3B A;  2WZX A;  3ZG9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...