3OPLA

Esbl r164h mutant shv-1 beta-lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDHWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase SHV-1
publication title Ligand-dependent disorder of the Omega loop observed in extended-spectrum SHV-type beta-lactamase.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3oplA00
4WEKA 3N8SA 4WMCD 4P87A 3N4IA 3V39A 3S22A 4BQMA 2ZLYA 3NC8A 3VFFA 3OPRA 4JF5A 4JXVA 2BLSA 4QHCA 1E4DA 2ZM8A 5CGWA 1K54C 1SKFA 4IEDA 2PU4A 5HFOA 1WYBA 2XEPA 1BTLA 1IELA 3O87A 4JPMA 4R3BA 2XFTA 5M1AA 3G2YA 4JXWA 4KG6A 4OKPA 3PAGA 4Y7PA 5A90A 2ZC3B 5F1GA 3W4PA 2G2UA 3NY4A 5EVIC 3PBQA 2GDNA 1W79A 1PW1A 2ZQCA 2EX8A 2RCXA 2QPNA 1K56A 1TVFA 4WZ5A 3UNWA 3IXGA 2P74A 4JXSA 2DCFA 3BEBA 4QB8A 4UA7A 4UA9A 4BD0A 4N92A 5G18A 4EV4A 1BLPA 4GDNA 3VP0A 1LL5A 5CRFA 2Y2QA 1ONGA 1M40A 1RGZA 3V3RA 4OH0A 4GN2A 3FZCA 4E6XA 5KSHA 3ZG9B 4YFMA 1PI5A 3WS1A 3N6IA 5FAPA 1MPLA 3IF5A 3AGEA 4KZBA 1LI9A 5AQAA 4E3MA 3SS5A 3P98A 5JYPA 2XGNA 3SOIA 5E2EA 2ZC4B 3UPPA 3IF6C 1MXOA 4BJPA 4RA7A 3SS3A 3FV7A 1QMEA 4OPQA 1YM1A 1ZG4A 1K57A 3CMZA 1GHMA 1L2SA 2Y2PA 2Y2LA 1PI4A 3Q7ZA 5HAPA 5JYOA 1ZC2A 4P0MA 5CGXA 1L0DA 3UE3A 2Y59A 1WE4A 5E2FA 1ESIA 1JTGA 1LHYA 2C5WB 1MKIA 1LI0A 2EX6A 3ITBA 4LENA 4X56A 3ZHHA 1XA7A 3V5MA 2OLVA 4KZ6A 3ITAA 1VQQA 2ZQDA 3E2LA 2WGIA 3VOYA 1YLWA 1CK3A 1NJ4A 2Y2IA 1K54A 4KG5A 2ZM0A 1CI9A 4FH4A 1ONHA 4JF4A 4WBGA 1KDSA 3ZDJA 4N1XA 4OOLA 1BZAA 4ZTKA 5CHMA 1YT4A 2EFUA 3UDFA 1MWSA 2ZQ9A 4E6WA 4DDSA 4OP8A 3UPNA 1J9MA 4MNRA 4KZ4A 2X71A 4DDYA 1KGEA 3OCLA 1IYSA 4UAAA 4HEFA 1K4FA 4XXRA 2HDSA 2P9VB 2QZ6A 4PM9A 1NYMA 2WADA 3OZHA 3GRJA 1W5DA 5F1FA 2X01A 5CHUA 4B4ZA 1K55C 3ISGA 3G31A 3IWQA 5DTTA 1PZOA 5GHXA 4KENB 4OLGA 4X69A 5AQBA 5FQKA 3MZFA 4D2OA 2UWXA 4E3OA 4BENA 4OVDA 1DJAA 4R1GA 2Y2NA 4OPRA 2XK1A 2ZD8A 3PBNA 4HBUA 4R4SA 4HBTA 4MLLA 4RX2A 1BLHA 1XGJA 4PM7A 4S2KA 5FQJA 4P6BA 5FA7A 3MKFA 3UDXA 3D4FA 1GA0A 5CEDA 3A3JA 1FR6A 3G2ZA 4K91A 3PBSA 1K6RA 3HLWA 3A3IA 4P85A 4OONA 3IF6A 3WS4A 5DF9A 4IVKA 2V2FF 2Y55A 5TGFA 4EUZA 4QJGA 3Q7VB 2C6WB 3G34A 4ZJ1A 1HVBA 2J9OA 5FQQA 3JYIA 4C6YA 3Q1FA 5DF8A 4OOYA 3LY3A 3HUOA 3IHAA 1XA1A 3S4XA 3HREA 2EX9A 4H8RA 2JE5A 4KZ5A 2VGJA 3UDIA 1DY6A 2G2WA 1EROA 5CHJA 3VFHA 4BL3A 1K56D 2WAFA 1ERMA 3QNCA 5A93A 3TOIA 1Q2PA 1YLJA 5FQ9A 2FFFB 1NYYA 4CJNA 3PBRA 2J7VA 4BD1A 3VSKA 1OMEA 5FI2A 3FKWA 1WYCA 3M6HA 5DF7A 2ZC6B 2R9WA 4GB7A 5GHYA 3SS4A 3DWZA 4BL2A 3HL9A 3W4QA 4DKIA 2HP6A 1Q2QA 4WYYA 2RL3A 3BFFA 4F94A 5EE8A 4ZBEA 1SHVA 4DE2A 3ZCZA 3M2KA 3RJUA 1XP4A 2WGVA 3IWIA 4YINA 2HP5A 1IYOA 1I2WA 3UN7A 4DE1A 2WKHA 3IXHA 3CJMA 3M2JA 1K55A 4Y0UA 3S1YA 4S2NC 1G68A 4S2PA 4LV1A 4R23A 5DTKA 4ID4A 3AGFA 4OQHA 3GV9A 5FQIA 2WGWB 3B3XA 2CC1A 3RXWA 1KGFA 4E3IA 5BOHA 4GD6A 2OV5A 2WGWA 4S2JA 2XD1A 1BSGA 4KG2A 2HPBA 4DF6A 1KE3A 3NDGA 5CTNA 1G6AA 4WZ4A 3ZG8B 1HTZA 4OQIA 4EQIA 1PWCA 3HLFA 4X68A 1MWRA 4L0LA 5EVLA 1PIOA 3DW0A 5CXWA 5GLBA 4PM5A 3A3DA 4X55A 4R0QA 1ES5A 2EXAA 1TEMA 3VP2A 3IXDA 3VOZA 3VP4A 4MBFA 1H8YA 5CEBA 3FYZA 3ZGAB 3GVBA 5FI6A 4GDBA 3HLDA 4LV0A 1NZOA 2WAEA 2WZXA 4R3JA 3V50A 5FASA 1ES2A 1XGIA 4UA6A 2Y2JA 4S2LA 4C75A 3OPPA 4NK3A 1YQSA 2Z2MB 3VP1A 4C3QA 2Y2HA 1ZKJA 3PBOA 5GLAA 4OLDA 3RXXA 3NI9A 2Y2KA 1CEFA 2ZC7A 3MBZA 1GHIA 2ZQ7A 3ZVTA 4K0XA 1GCEA 2X02A 2Z2LB 1KE0A 3A3FA 3BFCA 5FDHA 5HAIA 5EVIB 3P09A 3O3VA 3OC2A 3Q81A 3FKVA 1YLZA 1Z6FA 2A3UA 4JLFA 5EVIA 4N9LA 4OPYA 3LO7A 1JWPA 3MXSA 4PM6A 3IT9A 3OCNA 2JC7A 1IKIA 1MY8A 1JWZA 4RX3A 5U47A 3DTMA 2JCHA 4S2NA 1IYQA 3FWLA 4KQQA 2H0TA 4JBFA 3QNBA 4FD8A 1K38A 4E3JA 4DXCA 2V1ZA 1U60A 1BT5A 5AQ7A 1KVLA 4S2MA 5FAQA 5HARA 2J9PA 4JXGA 3N8RA 3UE1A 5D3OA 4WEJA 1K4EA 2ZMAA 1RCJA 4GZBA 2ZQAA 3ZG7B 1ES3A 2Y2GA 1DJBA 2DNSA 5EUAA 4Z9QA 4KZ3A 1XKZA 5GL9A 1ERQA 3IF6B 4LCLA 5CERA 4PMAA 3ZNTA 5J8XA 1NZUA 5HAQA 5CECA 5GLCA 1XPBA 5EPHA 2B5RA 2QMIA 2XQZA 2ZQ8A 2HDRA 4GD8A 4FH2A 4RVAA 4EWFA 4OOMA 4LV3A 1GHPA 4QY5A 3WS5A 2VGKA 3NIAA 2J8YA 1BUEA 4NETA 2EX2A 1PZPA 4KZ8A 2XR0A 3NCKA 1E25A 4Y0OA 4DXBA 1PYYA 4OP5A 4PM8A 1SCWA 3G4PA 5EECA 4BLMA 1SDNA 2E8IA 1I2SA 3HBRA 3C4PA 1S6RA 3ZNYA 1FCMA 4M3KA 4OQ0A 5CTMA 3VP3A 2ZC5B 1NRFA 2Y2MA 4PPRA 1O07A 3GQZA 1PWGA 4B4XA 1JWVA 3W8KA 5L2FA 1SDEA 2OSUA 3HLEA 3MZDA 1BULA 2IWDA 1K57C 5GLDA 4WELA 1N4OA 1KVMA 2HP9A 3GMWA 3QHYA 3IH9A 4E3NA 3BLMA 2JBFA 4KZ9A 1ES4A 3IXBA 4O7DA 4EBPA 3SH8A 1FSYA 5AQ9A 3PAEA 1YLPA 3HUNA 1JVJA 2IWBA 3O86A 5FQMA 4GOGA 4KQRA 3V3SA 3C7UA 3W4OA 3UO9A 1FOFA 4DE3A 1PWDA 3IH8A 1GA9A 4MEZA 3WS2A 3ZFZA 4GKUA 3MKEA 1C3BA 2H0YA 1KGGA 1E3UA 4WM9A 3ZVWA 2H10A 3EQVA 4OQGA 4XUZA 3PTEA 4HESA 5A91A 1NY0A 1CEGA 3G35A 5M19A 2FFYA 4X6TA 2HDQA 5HL1A 3BRMA 4KQOA 5EOEA 5TR7A 2Y4AA 2WKEA 3BYDA 3OPLA 3E2KA 3A3EA 4A5RA 4WMCA 1O7EA 4IVIA 4B88A 3IQAA 3BFGA 3UPOA 1K25A 4E3KA 5KMWA 4CPKA 1LLBA 1IKGA 5F82A 1RP5A 5CGSA 3VSLA 5HW3A 3NBLA 4XUXA 2Q9MA 1DJCA 3Q82A 4JF6A 3C5AA 2PBYA 3C4OA 4RYEA 5FSRA 4Q8IA 1KDWA 4MBKA 5EVID 1MWTA 4GNUA 1N9BA 2XLNA 2XFSA 1EWZA 3CZDA 2PU2A 1RGYA 3WWXA 3ZG5A 4N9KA 3PBTA 3HVFA 4QY6A 5KZHA 2ZM2A 3EQUA 1XXMA 3VMAA 5FAOA 3SH9A 3LCEA 3WRTA 5GHZA 4QU3A 5M18A 3CG5A 3HUMA 3N7WA 1MBLA 1FCOA 2WKIA 2Y91A 3UY6A 1IYPA 3G30A 2XD5A 2V20A 1LL9A 3BLSA 3TG9A 2Y2OA 3IHBA 1MWUA 1IEMA 4EBNA 1W8YA 5TFQA 5KSCA 1H5XA 1JTDA 2XH9A 3I7JA 1FR1A 3BFDA 1Y54A 1ZG6A 1YMSA 4LCMA 1AXBA 4ZDXA 3OPHA 4MBHA 4UHUA 2IWCA 3C7VA 4FCFA 4JKTA 4KZAA 3M6BA 2A49A 2XDMA 4Y0TA 5A92A 1CI8A 1W7FA 2I72A 3DWKA 1M6KA 1YLTA 1YMXA 1YLYA 2DRWA 3BM6A 4IBXA 4DE0A 3GTCA 4X53A 1W8QA 2XF3A 3N8LA 4S2IA 1L0FA 1ESUA 1L0EA 2BG1A 5FI7A 3HLBA 1EI5A 2Q9NA 5HX9A 3BFEA 3MZEA 4WZ5C 3WS0A 2H5SA 3HLGA 2P9VA 4K0WA 4ZJ3A 1K6SA 4R4RA 1QMFA 1L0GA 3MFDA 3GSGA 5E2GA 4FSFA 3IWOA 5DTSA 3HLCA 4E3LA 1FCNA 4QD4A 3WRZA 4S2OA 3AGDA 2WK0A 3LY4A 4U3TA 2EFXA 3O88A 3MXRA 3BECA 1HZOA 1H8ZA 1ALQA 1NXYA 1FQGA 3LEZA 4LV2A 4U0XA 2WYXA 4DRTA 1I5QA 5E2HA 1TDLA 4OPZA 2EXBA 1KE4A 5DVAA 5EOOA 4ZAMA 3SH7A 4ZJ2A 2WZZA 1BLSA 4IBRA 3G32A 5FATA 3UE0A 4EBLA 2R9XA 5F83A 1PW8A 1TDGA 5I94A 1E3UD 1FSWA 2OLUA 2ZJ9A 3Q7VA 2WUQA 3TSGA 1XX2A 3Q07A 3GR2A 5E43A 2HDUA 4N1HA 1HD8A 4KZ7A 4U0TA 1BLCA 1S0WA 3ZG0A 5IHVA 3NDEA 1VM1A
chains in the Genus database with same CATH superfamily
4WMCD 3S22A 4BQMA 3NC8A 3BW6A 2ZM8A 5CGWA 1K54C 1IELA 3CLOA 4KG6A 1SZVA 3W4PA 5EVIC 1PW1A 4HH2A 2QKPA 2QPNA 4X1MA 2P74A 3OLOA 3GECA 4UA7A 3C8CA 2KOIA 4HHDA 4OH0A 4IJGA 3NECA 3LI8A 1MPLA 3IF5A 3AGEA 4KZBA 1LI9A 2XGNA 3SOIA 4DMZA 2NUTC 1YM1A 3CMZA 3R7WB 2Y2LA 1OTIA 1PI4A 3KSIA 3Q7ZA 1ZC2A 4P0MA 3R7WA 4LENA 1MKIA 5HDDA 4H6JA 1TD5A 4WF0A 4QWOA 3TRCA 1CI9A 4FH4A 4ARZB 3ZDJA 1A0KA 4Y5FA 3NJAA 2EFUA 3UPNA 2X71A 2PDRA 1IYSA 2LB9A 2JKGA 2WADA 3B47A 5F1FA 1K55C 4HNBA 4X69A 3MZFA 4D2OA 2PHYA 4HBUA 4HBTA 4RX2A 4S2KA 3D4FA 2J3WA 1T18A 3A3IA 4P85A 3JVUA 3BQAA 4IVKA 4QJGA 2L0WA 4ZJ1A 2PD8A 5IT5A 1HVBA 4OOYA 3LY3A 2EX9A 2VGJA 1S4RA 5CHJA 2G2WA 4BL3A 2PYRA 5IS1A 4JGOA 2WAFA 1ERMA 4DN0A 2W1TA 3M6HA 3MF0A 4HP9A 3SS4A 2K2NA 4Q0JA 5EFWA 3D72A 1SHVA 3KSGA 3RJUA 3IWIA 4WUJA 2M7VA 4B93A 3UN7A 1I2WA 3IXHA 3CJMA 1VB6A 4Y0UA 2M1CA 4S2PA 2IA2A 4R23A 1S67L 4OQHA 1NLYA 2XD1A 1BSGA 2HPBA 1KE3A 2L1MA 1G6AA 3ZG8B 3LIDA 4EQIA 1PWCA 4X68A 3A3DA 4R0QA 1ES5A 1TS0A 1TEMA 3VP2A 3IXDA 4GHIA 5F69A 3VP4A 3FYZA 2QYBA 3GVBA 1N9LA 4NXBA 5FI6A 2WAEA 2PRFA 2WZXA 4G3WA 4UA6A 4R3AA 4C75A 4MCWA 5GLAA 4OLDA 4EEUA 1CEFA 3MFXA 4IUKA 5J7EA 3BFCA 3A3FA 1JNUA 3P09A 4YWZA 1MZUA 1X0OA 3EGXC 4OPYA 4XT2B 1JWZA 3DTMA 4XT2A 1WA9A 2VZWA 4E3JA 1U60A 3QP2A 1UGUA 5FAQA 3T4OA 1K4EA 4I39A 2Y2GA 2MJ6A 5GL9A 3IF6B 4LCLA 5CERA 1NZUA 2B5RA 2V8FA 4FH2A 2XROA 3IBRA 5F68A 4EXOA 4P6ZS 3NCKA 4PM8A 4YOFA 4M3KA 3VP3A 1O07A 3LFVA 1PWGA 2OSUA 4WELA 3QHYA 4E3NA 1YPRA 1ES4A 3SH8A 3EWKA 1YLPA 5FQMA 5HZHA 3KYZA 3LR4A 3CAXA 3IH8A 1L3LA 4HOIA 2VLGA 2V0WA 4MDZA 5FL3A 4OQGA 3PTEA 4HESA 2JKTM 1CEGA 5TJJA 5M19A 3BRMA 3BYDA 3A3EA 3T4LA 4WMCA 4IVIA 3BFGA 1K25A 4E3KA 5KMWA 4CPKA 1IKGA 5F82A 3NBLA 2Q9MA 2ZOIA 3C5AA 5FSRA 4MBKA 4GNUA 1EWZA 3P7NA 4CQHA 5L09A 2INWA 4MN7A 3N7WA 3F1PB 4GJ4A 3H82B 3PYPA 3G30A 4LRXC 1G28A 2XD5A 3H82A 1LL9A 3IS2B 1Y4OA 1MWUA 2PD7A 3BWLA 1N9OA 5HDSA 3OPHA 4Y0TA 4FCFA 4KZAA 2IWCA 1YAXA 1S66L 4JKTA 5A92A 2JKFA 1XFQA 1YLTA 1W8QA 2XF3A 4HP4A 4S2IA 1L0FA 2HGVA 3KYEA 4HJ3A 4X25A 2Y79A 3MZEA 4WZ5C 3WS0A 2KLIA 2P9VA 3E98A 4ZJ3A 4R4RA 3HLCA 3WRZA 3LY4A 2EFXA 3MXRA 4CLCE 4LV2A 1FQGA 2WYXA 4WN5A 3S7NA 2EXBA 4ESPA 3SH7A 4ZJ2A 1BLSA 3P01A 4P6ZM 5F83A 1VHMA 3IX3A 1TDGA 2WUQA 4G3KA 1XX2A 5E43A 5C5KA 2VGLS 1BLCA 3ZG0A 5HX9A 5G4YA 3VFFA 3C30A 4JF5A 4JXVA 5L10A 2BLSA 1E4DA 2PU4A 5HFOA 3U2AA 1BTLA 5M1AA 3G2YA 4OKPA 3PAGA 4MMNA 2QJ5A 2ZC3B 2EX8A 2RCXA 3IXGA 4I38A 2DCFA 3BEBA 1PRQA 4BD0A 4UA9A 4I3IA 4Y2FA 1LL5A 2Y2QA 1FIKA 3V3RA 4YFMA 1PI5A 4MN5A 2GX5A 5AQAA 3SS5A 3P98A 1HLUP 2VV6A 4Z1WA 3IF6C 1NWZA 4BJPA 5A8BA 3SS3A 3FV7A 3E4PA 1ZG4A 5JYOA 1GHMA 1L2SA 2Y2PA 5HAPA 1S1ZA 3UE3A 3B33A 1JTGA 1LHYA 2EX6A 5HPIA 4X56A 3T4TA 1S4SA 3V5MA 2OLVA 3ITAA 1VQQA 2ZQDA 3E2LA 1YLWA 1NJ4A 1NLZA 4IUHA 4HJ4A 1BZAA 4GS9A 5CHMA 5TBMB 1VETB 3UDFA 1MWSA 4E6WA 3T50A 2I9VA 1J9MA 2UV0E 2EA9A 4KZ4A 3E0YA 3E4OA 3KSHA 1NYMA 3OZHA 1W5DA 5CHUA 3T4QA 3GDIA 4B4ZA 2J3TD 5HWWA 2Y2NA 2XK1A 2ZD8A 4R4SA 4MLLA 1TS8A 3RFBA 1BLHA 4CLCD 4GLQA 1GA0A 5CEDA 3FC7A 3UE6A 3A0VA 3G2ZA 4K91A 3QP8A 4R6LA 4NKPA 2Y55A 3Q7VB 3G34A 2J9OA 5FQQA 4C6YA 3Q1FA 1XA1A 3LI9A 3HREA 4H8RA 4KZ5A 2XA7S 1DY6A 1H3QA 1CF0A 1K56D 5A93A 5DJUA 1W63Q 1Q2PA 3TOIA 2FFFB 1NYYA 4M4XA 2J7VA 3LICA 3K3DA 1H8MA 1XJ3A 2R9WA 2ZC6B 3DWZA 4BL2A 2GZAA 3BFFA 5EE8A 4DE2A 1MKMA 3M2KA 3KSFA 2WGVA 4B9OA 3MXQA 2HP5A 1IYOA 1BYWA 1OPXA 3EEHA 3S1YA 2KDKA 4L9GA 3GV9A 2WGWB 3G6OA 1KGFA 4E3IA 1KOUA 2OV5A 2WGWA 1GSVA 4KG2A 3OOVA 3NDGA 4L0LA 5K5BA 1PIOA 3H7WA 5GLBA 4PM5A 2EXAA 3D9YA 1H8YA 2XRNA 4H6JB 4LV0A 2W3HA 5FASA 1AWIA 3RH8B 3OPPA 2Z2MB 1F9IA 1ZKJA 3NI9A 1TF1A 2Y2KA 2ZC7A 1GHIA 2ZQ7A 3ZVTA 2X02A 4AFIA 3UMDA 3FKVA 2A3UA 4LRYC 1JWPA 1MY8A 5U47A 4RX3A 3U4LP 4S2NA 4KQQA 3QNBA 4II7A 1K38A 4DXCA 1OT9A 1STZA 3A0RA 5AQ7A 1KVLA 4S2MA 3S7OA 3UE1A 1GSXA 1TS6A 3JVVA 4WEJA 3UB8A 5EVEA 3CHWP 4O8GA 5J8XA 5HAQA 2FH5A 3T12B 1XPBA 5EPHA 2QMIA 4BBVA 2HDRA 4EWFA 4OOMA 4LV3A 5G4ZA 3LUQA 1SKOA 4NETA 1PZPA 2XR0A 4Y0OA 4OP5A 4I3AA 2JN7A 4EEPA 4BLMA 3HBRA 2K31A 3C4PA 3ZNYA 2W1TB 1ZHHB 1NRFA 2Y2MA 4PPRA 2QJ7A 1JWVA 5L2FA 1BULA 2IWDA 4LPZA 5GLDA 2Q0OA 3IH9A 3HUNA 1JVJA 1OTAA 4GOGA 4KQRA 4O01A 3C7UA 3KYQA 2PBDP 4MEZA 3ZFZA 4BWIA 2H0YA 1KGGA 4LRZE 5A91A 3HCYA 2VX8A 4X6TA 3E4QA 5J4EA 4E04A 1D7EA 2Y4AA 4GW9A 2PAVP 4A5RA 3LYXA 3UB6A 4YNRA 5CGSA 5HW3A 4GHIB 4XUXA 1DRMA 4RYEA 3C4OA 1TS7A 2XFSA 3CZDA 3B42A 4QY6A 2OAQ1 3EQUA 3WRTA 5GHZA 4QU3A 3CG5A 5EV0A 1MBLA 4Y17A 5FEGA 3NOUC 3VE4A 4F3LA 2Y91A 3PHYA 1DP6A 3T4KA 4ETXA 3F1OA 3TG9A 3LIFA 2GNXA 3F1NB 2YKHA 3I7JA 3F1NA 1FR1A 1V9ZA 3BFDA 1Y54A 1ZG6A 4ZDXA 4UHUA 4MBHA 2DMWA 3C7VA 2XDMA 4NG2A 1M6KA 2DRWA 1YMXA 1YLYA 1N9NA 3N8LA 1L0EA 2BG1A 2O9BA 4NEED 3W2ZA 3HJKA 2HJ9C 2A2LA 1G6OA 3HLGA 1QMFA 3GSGA 4FSFA 5DTSA 4UQIS 1FCNA 3TW8A 2WK0A 3PXPA 4U3TA 1NXYA 3LEZA 5E2HA 1TDLA 2QWSA 1P9RA 3UE0A 2R9XA 3NOTC 1E3UD 1FSWA 3O5YA 3TSGA 3Q07A 4CLCB 4CLCA 4NXFA 4U0TA 2YKFA 1S0WA 3N8SA 3N4IA 3V39A 3S7QA 4LLOB 5F5YA 4QHCA 1IOUA 1SKFA 2B18A 1WYBA 2XEPA 4JPMA 4R3BA 2XFTA 4JXWA 2V1BA 5A90A 5F1GA 2G2UA 1ZTUA 3NY4A 2GDNA 2ZQCA 1K56A 1TVFA 3UNWA 4KQDA 4KUOA 3BY9A 5I5LA 1CJFA 4JXSA 4QB8A 1XJ6A 3LIEA 4N92A 5G18A 4EV4A 1BLPA 1ONGA 2W3DA 5HD3A 1RGZA 3MSHA 1D1JA 5EM1A 3N6IA 4E3MA 1P97A 3NHQA 1K0KA 1QMEA 1J3WA 1H0MA 1G5UA 1MC0A 2Z6CA 5CGXA 1L0DA 2Y59A 4HJ6A 5E2FA 1ESIA 3ITBA 1LI0A 4DJ2A 3VOYA 2Y2IA 1K54A 1OTDA 2ZM0A 2PYPA 4WBGA 1ONHA 4KG5A 1KDSA 4OOLA 4ZTKA 1YT4A 2ZQ9A 3FPWA 4MNRA 4DDYA 3OCLA 1K4FA 4XXRA 2ZL1B 2P9VB 2EWWA 2VV7A 2ZL1A 4FOFA 3ISGA 3IWQA 3IX8A 1PZOA 4KENB 4OLGA 5AQBA 5FQKA 2UWXA 4E3OA 4BENA 2VJWA 4OVDA 4MN6A 2FZ0A 1DJAA 4OPRA 1XGJA 4PM7A 5FQJA 1ODVA 5FA7A 3MKFA 3NULA 4Q0IA 4UQIM 1FR6A 3PBSA 1K6RA 3HLWA 3WS4A 5DF9A 5HDCA 5TGFA 3VV4A 1YSQA 1T19A 1LSWA 2W3GA 3LR0A 3UDIA 3VFHA 1EROA 3QNCA 2Z6DA 5FI2A 3FKWA 4EUVA 2P04A 5DF7A 3VE3A 2HP6A 1LSXA 4F94A 4D60A 5FEFA 4I5SA 2WKHA 2W1RA 3KX0X 3M2JA 1K55A 1GSWA 4LV1A 5L07A 5DTKA 4ID4A 3AGFA 3T1RA 3B3XA 2CC1A 5AVEA 4NXGA 4S2JA 1YKDA 4DF6A 5CTNA 3RTYA 1HTZA 2BASA 3HLFA 1MWRA 5EVLA 3K2NA 3LIBA 3MQ0A 3T1XA 2VKSA 2VK3A 3VOZA 4MBFA 2A24A 4GDBA 3HLDA 4LFUA 4R3JA 2D02A 1ES2A 4S2LA 3ZQ5A 3RXXA 4GS9B 1F5MA 3L9KA 4K0XA 1GCEA 5HAIA 2J3TC 3O3VA 3Q81A 1YLZA 1Z6FA 4JLFA 4N9LA 3LO7A 4CLCC 3MXSA 3IT9A 3OCNA 2JC7A 1IKIA 4Y15A 1VEUA 2Y8HA 1IYQA 4JBFA 2V1ZA 1IFQA 4BMWA 2J9PA 3N8RA 5D3OA 2ZMAA 3C2WA 4GZBA 2ZQAA 1DJBA 2DNSA 5EUAA 4KZ3A 3ZYTA 1XKZA 2CMNA 1ERQA 3ZNTA 5GLCA 1LT0A 2XQZA 4RVAA 4QY5A 3WS5A 2VGKA 2ACGA 2OOLA 1BUEA 1OJ5A 3CPTB 4DXBA 2WKQA 1SCWA 3CPTA 5EECA 4GCZA 2E8IA 1FCMA 3ICYA 2V0UA 4B4XA 2VGLM 3W8KA 1KVMA 1P0ZA 2HP9A 3BLMA 2W27A 2JBFA 3C38A 4KZ9A 3IX4A 3IXBA 4EBPA 3PAEA 2IWBA 2VA0A 3T1QB 4R38A 3V3SA 5DFXA 3UO9A 4DE3A 3UB5P 1Y28A 1C3BA 1E3UA 3EQVA 2FFYA 2HDQA 5HL1A 4KQOA 5TR7A 3D3OA 3OPLA 4B88A 1O7EA 3IQAA 4Y3IA 2HJEA 3H7WB 1LLBA 3EGDC 3MJQA 2WKPA 3UB7A 3DTKA 1DJCA 4JF6A 2O0YA 2PBYA 2B95A 1KDWA 4PAUA 5EVID 2W3EA 1MWTA 3MQQA 1N9BA 2XLNA 4EERA 5HWVA 1XFNA 2PU2A 3ZG5A 1FILA 2ZM2A 1XXMA 3VMAA 4L9EA 3SH9A 2GJ3A 5M18A 3PR6A 2VV8A 1UWPX 1FCOA 1CQAA 1P9WA 3QP4A 2WKIA 1IYPA 4ME4A 3LR3A 4HI4A 1YSPA 4WL9A 3IHBA 1IEMA 4Q0HA 1W8YA 3HJIA 5TFQA 5KSCA 1JTDA 2XH9A 4I3JA 1YMSA 4HH3A 3M6BA 1CI8A 1W7FA 2O99A 4ARZA 2JHEA 2WKRA 4DE0A 2P7JA 3GTCA 4X53A 1ESUA 5FI7A 3CUEA 3BFEA 2NUPC 4FTXA 2H5SA 2OAP1 4K0WA 5DKKA 1L0GA 5E2GA 1SKOB 3IWOA 4QD4A 4S2OA 3AGDA 3TJZC 1XJ4A 3O88A 4PHTA 3BECA 1HZOA 4JGPA 3LR5A 1I5QA 1KE4A 2VEAA 5EOOA 5DKLA 3G32A 3FPVA 1PW8A 2XA7M 5I94A 2OLUA 1F98A 3TE8A 3GR2A 1V9YA 3KO6A 4PKYA 2HDUA 1HD8A 4BBUA 5IHVA 3IBJA 2ZMFA 2M7UA 1PFLA 2O9AA 4WEKA 4P87A 2ZLYA 2B02A 3OPRA 5MC7A 3DAVA 4IEDA 2ZOHA 3O87A 3LIAA 4QPRA 4HY8A 4Y7PA 3T4JA 1OJGA 3PBQA 1W79A 3CWFA 4WZ5A 5HWTA 2ZMVA 4RQ9A 2V8CA 3FG8A 4GDNA 3VP0A 5CRFA 1M40A 4GN2A 3FZCA 4E6XA 5KSHA 3ZG9B 3WS1A 5FAPA 2K7SA 3CI6A 5JYPA 5E2EA 2ZC4B 2E8JA 3UPPA 1MXOA 4RA7A 4F3LB 4OPQA 1K57A 4ETZA 4HIAA 3F1OB 3LEQA 4UEYA 1WE4A 2C5WB 3ZHHA 1XA7A 5HD5A 4KZ6A 1OTEA 3ULFA 2WGIA 3SZTA 1W63M 5CX7A 2J80A 1CK3A 1T1CA 4JF4A 2W3FA 4N1XA 3VOLA 3UB9A 1LL8A 4DDSA 5KIZA 4OP8A 3UMEA 1KGEA 4UAAA 4HEFA 2HDSA 2QZ6A 4PM9A 1F2KA 3GRJA 2X01A 3G31A 5GHXA 5DTTA 4KUKA 4PKYG 4R1GA 3PBNA 4P6BA 3UDXA 4BBTA 3A3JA 4OONA 3IF6A 4EUZA 2V2FF 3BJNA 2C6WB 4JGQA 3JYIA 5DF8A 1T1BA 3HUOA 3IHAA 3S4XA 2JE5A 3L7HA 4O0PA 2PR5A 5LBRA 3SW1A 1NRJA 1YLJA 5FQ9A 4CJNA 3PBRA 4BD1A 3VSKA 1OMEA 1WYCA 3DTIA 4GB7A 3T1SA 2W0NA 5GHYA 3HL9A 3W4QA 4DKIA 4EU0A 3JPUA 1Q2QA 4WYYA 2RL3A 4ZBEA 3ZCZA 1XP4A 2LB5A 4YINA 2EWVA 4WLAA 4DE1A 3QP6A 1T1AA 4IHQA 4S2NC 1G68A 4Y13A 4DJ3A 1OTBA 5AJGA 2L4RA 5FQIA 2KX6A 3RXWA 5BOHA 1OT6A 4GD6A 4X1LA 5J3WA 5FDSA 3CUEC 4WZ4A 4OQIA 4JGRA 2JKTI 3DW0A 5CXWA 3OBFA 4X55A 2HF6A 1Z09A 2PR6A 5CEBA 3CITA 3ZGAB 1NZOA 3V50A 1XGIA 2Y2JA 4NK3A 1YQSA 3VP1A 4C3QA 2Y2HA 3PBOA 3QP5A 3MBZA 2Z2LB 5FDHA 1KE0A 5EVIB 3OC2A 3F1PA 5EVIA 4K08A 2H28A 4PM6A 3T4SA 2JCHA 3IS2A 1EW0A 3FWLA 2H0TA 4FD8A 3LGOA 5L8MA 1BT5A 2D01A 5HARA 4JXGA 2OWJA 1RCJA 4EETB 3ZG7B 5DJTA 4L9FA 1ES3A 2JKRM 4Z9QA 3MMHA 4PMAA 5CECA 4GD8A 2ZQ8A 1UWNX 1GHPA 4R70A 3NIAA 2J8YA 2JKRI 3QP1A 2EX2A 4KZ8A 1E25A 1PYYA 3G4PA 1SDNA 1I2SA 1S6RA 4OQ0A 5CTMA 2ZC5B 3S7PA 3DTEA 3GQZA 1SDEA 3HLEA 5EM0A 3MZDA 1K57C 1N4OA 3GMWA 4EQ1A 2AVXA 4O7DA 1FSYA 5AQ9A 3O86A 2BTFP 2P08A 3W4OA 1FOFA 3H9WA 3MS6A 1PWDA 5AVFA 1GA9A 3WS2A 4GKUA 3MKEA 1D06A 4NXEA 4WM9A 3ZVWA 2H10A 4FUWA 4XUZA 3A0SA 1NY0A 3G35A 1DP8A 4ZRRA 4G3VA 5EOEA 2WKEA 3E2KA 5F6AA 3UPOA 1RP5A 3VSLA 5IU1A 3Q82A 3NOPC 2A24B 2QHKA 5DFYA 4Q8IA 2R78A 1S1YA 2XSSA 1RGYA 3WWXA 4N9KA 3BQ8A 3PBTA 3HVFA 5KZHA 3R4KA 5FAOA 3LCEA 1PNEA 5HSQA 3HUMA 3V67A 3BY8A 3UY6A 2V20A 3BLSA 5HL6A 1VEUB 2Y2OA 4EBNA 1ACFA 1H5XA 2HV1A 3EOIA 4LCMA 1AXBA 4EW7A 1LSVA 2A49A 3EEAA 2I72A 3DWKA 4IBXA 3BM6A 5TBMA 1VETA 3HLBA 3MQOA 1EI5A 2Q9NA 2HZ5A 2OWHA 3DBAA 1K6SA 3MFDA 4E3LA 4LGWA 2V9AA 4EESA 2V1AA 1ALQA 1H8ZA 4U0XA 4DRTA 4OPZA 4HQAA 5DVAA 4ZAMA 2WZZA 2PT7A 2ZBBA 4IBRA 5FATA 4EBLA 1XJ2A 2O9CA 2ZJ9A 3Q7VA 2G7UA 3MR0A 1DP9A 3K3CA 4N1HA 5HPFA 4KZ7A 3NDEA 1VM1A
chains in the Genus database with same CATH topology
4WEKA 3N8SA 4WMCD 4P87A 3N4IA 3V39A 3S22A 4BQMA 2ZLYA 3NC8A 3VFFA 3OPRA 4JF5A 4JXVA 2BLSA 4QHCA 1E4DA 2ZM8A 5CGWA 1K54C 1SKFA 4IEDA 2PU4A 5HFOA 1WYBA 2XEPA 1BTLA 1IELA 3O87A 4JPMA 4R3BA 2XFTA 5M1AA 3G2YA 4JXWA 4KG6A 4OKPA 3PAGA 4Y7PA 5A90A 2ZC3B 5F1GA 3W4PA 2G2UA 3NY4A 5EVIC 3PBQA 2GDNA 1W79A 1PW1A 2ZQCA 2EX8A 2RCXA 2QPNA 1K56A 1TVFA 4WZ5A 3UNWA 3IXGA 2P74A 4JXSA 2DCFA 3BEBA 4QB8A 4UA7A 4UA9A 4BD0A 4N92A 5G18A 4EV4A 1BLPA 4GDNA 3VP0A 1LL5A 5CRFA 2Y2QA 1ONGA 1M40A 1RGZA 3V3RA 4OH0A 4GN2A 3FZCA 4E6XA 5KSHA 3ZG9B 4YFMA 1PI5A 3WS1A 3N6IA 5FAPA 1MPLA 3IF5A 3AGEA 4KZBA 1LI9A 5AQAA 4E3MA 3SS5A 3P98A 5JYPA 2XGNA 3SOIA 5E2EA 2ZC4B 3UPPA 3IF6C 1MXOA 4BJPA 4RA7A 3SS3A 3FV7A 1QMEA 4OPQA 1YM1A 1ZG4A 1K57A 3CMZA 1GHMA 1L2SA 2Y2PA 2Y2LA 1PI4A 3Q7ZA 5HAPA 5JYOA 1ZC2A 4P0MA 5CGXA 1L0DA 3UE3A 2Y59A 1WE4A 5E2FA 1ESIA 1JTGA 1LHYA 2C5WB 1MKIA 1LI0A 2EX6A 3ITBA 4LENA 4X56A 3ZHHA 1XA7A 3V5MA 2OLVA 4KZ6A 3ITAA 1VQQA 2ZQDA 3E2LA 2WGIA 3VOYA 1YLWA 1CK3A 1NJ4A 2Y2IA 1K54A 4KG5A 2ZM0A 1CI9A 4FH4A 1ONHA 4JF4A 4WBGA 1KDSA 3ZDJA 4N1XA 4OOLA 1BZAA 4ZTKA 5CHMA 1YT4A 2EFUA 3UDFA 1MWSA 2ZQ9A 4E6WA 4DDSA 4OP8A 3UPNA 1J9MA 4MNRA 4KZ4A 2X71A 4DDYA 1KGEA 3OCLA 1IYSA 4UAAA 4HEFA 1K4FA 4XXRA 2HDSA 2P9VB 2QZ6A 4PM9A 1NYMA 2WADA 3OZHA 3GRJA 1W5DA 5F1FA 2X01A 5CHUA 4B4ZA 1K55C 3ISGA 3G31A 3IWQA 5DTTA 1PZOA 5GHXA 4KENB 4OLGA 4X69A 5AQBA 5FQKA 3MZFA 4D2OA 2UWXA 4E3OA 4BENA 4OVDA 1DJAA 4R1GA 2Y2NA 4OPRA 2XK1A 2ZD8A 3PBNA 4HBUA 4R4SA 4HBTA 4MLLA 4RX2A 1BLHA 1XGJA 4PM7A 4S2KA 5FQJA 4P6BA 5FA7A 3MKFA 3UDXA 3D4FA 1GA0A 5CEDA 3A3JA 1FR6A 3G2ZA 4K91A 3PBSA 1K6RA 3HLWA 3A3IA 4P85A 4OONA 3IF6A 3WS4A 5DF9A 4IVKA 2V2FF 2Y55A 5TGFA 4EUZA 4QJGA 3Q7VB 2C6WB 3G34A 4ZJ1A 1HVBA 2J9OA 5FQQA 3JYIA 4C6YA 3Q1FA 5DF8A 4OOYA 3LY3A 3HUOA 3IHAA 1XA1A 3S4XA 3HREA 2EX9A 4H8RA 2JE5A 4KZ5A 2VGJA 3UDIA 1DY6A 2G2WA 1EROA 5CHJA 3VFHA 4BL3A 1K56D 2WAFA 1ERMA 3QNCA 5A93A 3TOIA 1Q2PA 1YLJA 5FQ9A 2FFFB 1NYYA 4CJNA 3PBRA 2J7VA 4BD1A 3VSKA 1OMEA 5FI2A 3FKWA 1WYCA 3M6HA 5DF7A 2ZC6B 2R9WA 4GB7A 5GHYA 3SS4A 3DWZA 4BL2A 3HL9A 3W4QA 4DKIA 2HP6A 1Q2QA 4WYYA 2RL3A 3BFFA 4F94A 5EE8A 4ZBEA 1SHVA 4DE2A 3ZCZA 3M2KA 3RJUA 1XP4A 2WGVA 3IWIA 4YINA 2HP5A 1IYOA 1I2WA 3UN7A 4DE1A 2WKHA 3IXHA 3CJMA 3M2JA 1K55A 4Y0UA 3S1YA 4S2NC 1G68A 4S2PA 4LV1A 4R23A 5DTKA 4ID4A 3AGFA 4OQHA 3GV9A 5FQIA 2WGWB 3B3XA 2CC1A 3RXWA 1KGFA 4E3IA 5BOHA 4GD6A 2OV5A 2WGWA 4S2JA 2XD1A 1BSGA 4KG2A 2HPBA 4DF6A 1KE3A 3NDGA 5CTNA 1G6AA 4WZ4A 3ZG8B 1HTZA 4OQIA 4EQIA 1PWCA 3HLFA 4X68A 1MWRA 4L0LA 5EVLA 1PIOA 3DW0A 5CXWA 5GLBA 4PM5A 3A3DA 4X55A 4R0QA 1ES5A 2EXAA 1TEMA 3VP2A 3IXDA 3VOZA 3VP4A 4MBFA 1H8YA 5CEBA 3FYZA 3ZGAB 3GVBA 5FI6A 4GDBA 3HLDA 4LV0A 1NZOA 2WAEA 2WZXA 4R3JA 3V50A 5FASA 1ES2A 1XGIA 4UA6A 2Y2JA 4S2LA 4C75A 3OPPA 4NK3A 1YQSA 2Z2MB 3VP1A 4C3QA 2Y2HA 1ZKJA 3PBOA 5GLAA 4OLDA 3RXXA 3NI9A 2Y2KA 1CEFA 2ZC7A 3MBZA 1GHIA 2ZQ7A 3ZVTA 4K0XA 1GCEA 2X02A 2Z2LB 1KE0A 3A3FA 3BFCA 5FDHA 5HAIA 5EVIB 3P09A 3O3VA 3OC2A 3Q81A 3FKVA 1YLZA 1Z6FA 2A3UA 4JLFA 5EVIA 4N9LA 4OPYA 3LO7A 1JWPA 3MXSA 4PM6A 3IT9A 3OCNA 2JC7A 1IKIA 1MY8A 1JWZA 4RX3A 5U47A 3DTMA 2JCHA 4S2NA 1IYQA 3FWLA 4KQQA 2H0TA 4JBFA 3QNBA 4FD8A 1K38A 4E3JA 4DXCA 2V1ZA 1U60A 1BT5A 5AQ7A 1KVLA 4S2MA 5FAQA 5HARA 2J9PA 4JXGA 3N8RA 3UE1A 5D3OA 4WEJA 1K4EA 2ZMAA 1RCJA 4GZBA 2ZQAA 3ZG7B 1ES3A 2Y2GA 1DJBA 2DNSA 5EUAA 4Z9QA 4KZ3A 1XKZA 5GL9A 1ERQA 3IF6B 4LCLA 5CERA 4PMAA 3ZNTA 5J8XA 1NZUA 5HAQA 5CECA 5GLCA 1XPBA 5EPHA 2B5RA 2QMIA 2XQZA 2ZQ8A 2HDRA 4GD8A 4FH2A 4RVAA 4EWFA 4OOMA 4LV3A 1GHPA 4QY5A 3WS5A 2VGKA 3NIAA 2J8YA 1BUEA 4NETA 2EX2A 1PZPA 4KZ8A 2XR0A 3NCKA 1E25A 4Y0OA 4DXBA 1PYYA 4OP5A 4PM8A 1SCWA 3G4PA 5EECA 4BLMA 1SDNA 2E8IA 1I2SA 3HBRA 3C4PA 1S6RA 3ZNYA 1FCMA 4M3KA 4OQ0A 5CTMA 3VP3A 2ZC5B 1NRFA 2Y2MA 4PPRA 1O07A 3GQZA 1PWGA 4B4XA 1JWVA 3W8KA 5L2FA 1SDEA 2OSUA 3HLEA 3MZDA 1BULA 2IWDA 1K57C 5GLDA 4WELA 1N4OA 1KVMA 2HP9A 3GMWA 3QHYA 3IH9A 4E3NA 3BLMA 2JBFA 4KZ9A 1ES4A 3IXBA 4O7DA 4EBPA 3SH8A 1FSYA 5AQ9A 3PAEA 1YLPA 3HUNA 1JVJA 2IWBA 3O86A 5FQMA 4GOGA 4KQRA 3V3SA 3C7UA 3W4OA 3UO9A 1FOFA 4DE3A 1PWDA 3IH8A 1GA9A 4MEZA 3WS2A 3ZFZA 4GKUA 3MKEA 1C3BA 2H0YA 1KGGA 1E3UA 4WM9A 3ZVWA 2H10A 3EQVA 4OQGA 4XUZA 3PTEA 4HESA 5A91A 1NY0A 1CEGA 3G35A 5M19A 2FFYA 4X6TA 2HDQA 5HL1A 3BRMA 4KQOA 5EOEA 5TR7A 2Y4AA 2WKEA 3BYDA 3OPLA 3E2KA 3A3EA 4A5RA 4WMCA 1O7EA 4IVIA 4B88A 3IQAA 3BFGA 3UPOA 1K25A 4E3KA 5KMWA 4CPKA 1LLBA 1IKGA 5F82A 1RP5A 5CGSA 3VSLA 5HW3A 3NBLA 4XUXA 2Q9MA 1DJCA 3Q82A 4JF6A 3C5AA 2PBYA 3C4OA 4RYEA 5FSRA 4Q8IA 1KDWA 4MBKA 5EVID 1MWTA 4GNUA 1N9BA 2XLNA 2XFSA 1EWZA 3CZDA 2PU2A 1RGYA 3WWXA 3ZG5A 4N9KA 3PBTA 3HVFA 4QY6A 5KZHA 2ZM2A 3EQUA 1XXMA 3VMAA 5FAOA 3SH9A 3LCEA 3WRTA 5GHZA 4QU3A 5M18A 3CG5A 3HUMA 3N7WA 1MBLA 1FCOA 2WKIA 2Y91A 3UY6A 1IYPA 3G30A 2XD5A 2V20A 1LL9A 3BLSA 3TG9A 2Y2OA 3IHBA 1MWUA 1IEMA 4EBNA 1W8YA 5TFQA 5KSCA 1H5XA 1JTDA 2XH9A 3I7JA 1FR1A 3BFDA 1Y54A 1ZG6A 1YMSA 4LCMA 1AXBA 4ZDXA 3OPHA 4MBHA 4UHUA 2IWCA 3C7VA 4FCFA 4JKTA 4KZAA 3M6BA 2A49A 2XDMA 4Y0TA 5A92A 1CI8A 1W7FA 2I72A 3DWKA 1M6KA 1YLTA 1YMXA 1YLYA 2DRWA 3BM6A 4IBXA 4DE0A 3GTCA 4X53A 1W8QA 2XF3A 3N8LA 4S2IA 1L0FA 1ESUA 1L0EA 2BG1A 5FI7A 3HLBA 1EI5A 2Q9NA 5HX9A 3BFEA 3MZEA 4WZ5C 3WS0A 2H5SA 3HLGA 2P9VA 4K0WA 4ZJ3A 1K6SA 4R4RA 1QMFA 1L0GA 3MFDA 3GSGA 5E2GA 4FSFA 3IWOA 5DTSA 3HLCA 4E3LA 1FCNA 4QD4A 3WRZA 4S2OA 3AGDA 2WK0A 3LY4A 4U3TA 2EFXA 3O88A 3MXRA 3BECA 1HZOA 1H8ZA 1ALQA 1NXYA 1FQGA 3LEZA 4LV2A 4U0XA 2WYXA 4DRTA 1I5QA 5E2HA 1TDLA 4OPZA 2EXBA 1KE4A 5DVAA 5EOOA 4ZAMA 3SH7A 4ZJ2A 2WZZA 1BLSA 4IBRA 3G32A 5FATA 3UE0A 4EBLA 2R9XA 5F83A 1PW8A 1TDGA 5I94A 1E3UD 1FSWA 2OLUA 2ZJ9A 3Q7VA 2WUQA 3TSGA 1XX2A 3Q07A 3GR2A 5E43A 2HDUA 4N1HA 1HD8A 4KZ7A 4U0TA 1BLCA 1S0WA 3ZG0A 5IHVA 3NDEA 1VM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WEK A;  3N8S A;  4WMC D;  4P87 A;  3N4I A;  3V39 A;  3S22 A;  4BQM A;  2ZLY A;  3NC8 A;  3VFF A;  3OPR A;  4JF5 A;  4JXV A;  2BLS A;  4QHC A;  1E4D A;  2ZM8 A;  5CGW A;  1K54 C;  1SKF A;  4IED A;  2PU4 A;  5HFO A;  1WYB A;  2XEP A;  1BTL A;  1IEL A;  3O87 A;  4JPM A;  4R3B A;  2XFT A;  5M1A A;  3G2Y A;  4JXW A;  4KG6 A;  4OKP A;  3PAG A;  4Y7P A;  5A90 A;  2ZC3 B;  5F1G A;  3W4P A;  2G2U A;  3NY4 A;  5EVI C;  3PBQ A;  2GDN A;  1W79 A;  1PW1 A;  2ZQC A;  2EX8 A;  2RCX A;  2QPN A;  1K56 A;  1TVF A;  4WZ5 A;  3UNW A;  3IXG A;  2P74 A;  4JXS A;  2DCF A;  3BEB A;  4QB8 A;  4UA7 A;  4UA9 A;  4BD0 A;  4N92 A;  5G18 A;  4EV4 A;  1BLP A;  4GDN A;  3VP0 A;  1LL5 A;  5CRF A;  2Y2Q A;  1ONG A;  1M40 A;  1RGZ A;  3V3R A;  4OH0 A;  4GN2 A;  3FZC A;  4E6X A;  5KSH A;  3ZG9 B;  4YFM A;  1PI5 A;  3WS1 A;  3N6I A;  5FAP A;  1MPL A;  3IF5 A;  3AGE A;  4KZB A;  1LI9 A;  5AQA A;  4E3M A;  3SS5 A;  3P98 A;  5JYP A;  2XGN A;  3SOI A;  5E2E A;  2ZC4 B;  3UPP A;  3IF6 C;  1MXO A;  4BJP A;  4RA7 A;  3SS3 A;  3FV7 A;  1QME A;  4OPQ A;  1YM1 A;  1ZG4 A;  1K57 A;  3CMZ A;  1GHM A;  1L2S A;  2Y2P A;  2Y2L A;  1PI4 A;  3Q7Z A;  5HAP A;  5JYO A;  1ZC2 A;  4P0M A;  5CGX A;  1L0D A;  3UE3 A;  2Y59 A;  1WE4 A;  5E2F A;  1ESI A;  1JTG A;  1LHY A;  2C5W B;  1MKI A;  1LI0 A;  2EX6 A;  3ITB A;  4LEN A;  4X56 A;  3ZHH A;  1XA7 A;  3V5M A;  2OLV A;  4KZ6 A;  3ITA A;  1VQQ A;  2ZQD A;  3E2L A;  2WGI A;  3VOY A;  1YLW A;  1CK3 A;  1NJ4 A;  2Y2I A;  1K54 A;  4KG5 A;  2ZM0 A;  1CI9 A;  4FH4 A;  1ONH A;  4JF4 A;  4WBG A;  1KDS A;  3ZDJ A;  4N1X A;  4OOL A;  1BZA A;  4ZTK A;  5CHM A;  1YT4 A;  2EFU A;  3UDF A;  1MWS A;  2ZQ9 A;  4E6W A;  4DDS A;  4OP8 A;  3UPN A;  1J9M A;  4MNR A;  4KZ4 A;  2X71 A;  4DDY A;  1KGE A;  3OCL A;  1IYS A;  4UAA A;  4HEF A;  1K4F A;  4XXR A;  2HDS A;  2P9V B;  2QZ6 A;  4PM9 A;  1NYM A;  2WAD A;  3OZH A;  3GRJ A;  1W5D A;  5F1F A;  2X01 A;  5CHU A;  4B4Z A;  1K55 C;  3ISG A;  3G31 A;  3IWQ A;  5DTT A;  1PZO A;  5GHX A;  4KEN B;  4OLG A;  4X69 A;  5AQB A;  5FQK A;  3MZF A;  4D2O A;  2UWX A;  4E3O A;  4BEN A;  4OVD A;  1DJA A;  4R1G A;  2Y2N A;  4OPR A;  2XK1 A;  2ZD8 A;  3PBN A;  4HBU A;  4R4S A;  4HBT A;  4MLL A;  4RX2 A;  1BLH A;  1XGJ A;  4PM7 A;  4S2K A;  5FQJ A;  4P6B A;  5FA7 A;  3MKF A;  3UDX A;  3D4F A;  1GA0 A;  5CED A;  3A3J A;  1FR6 A;  3G2Z A;  4K91 A;  3PBS A;  1K6R A;  3HLW A;  3A3I A;  4P85 A;  4OON A;  3IF6 A;  3WS4 A;  5DF9 A;  4IVK A;  2V2F F;  2Y55 A;  5TGF A;  4EUZ A;  4QJG A;  3Q7V B;  2C6W B;  3G34 A;  4ZJ1 A;  1HVB A;  2J9O A;  5FQQ A;  3JYI A;  4C6Y A;  3Q1F A;  5DF8 A;  4OOY A;  3LY3 A;  3HUO A;  3IHA A;  1XA1 A;  3S4X A;  3HRE A;  2EX9 A;  4H8R A;  2JE5 A;  4KZ5 A;  2VGJ A;  3UDI A;  1DY6 A;  2G2W A;  1ERO A;  5CHJ A;  3VFH A;  4BL3 A;  1K56 D;  2WAF A;  1ERM A;  3QNC A;  5A93 A;  3TOI A;  1Q2P A;  1YLJ A;  5FQ9 A;  2FFF B;  1NYY A;  4CJN A;  3PBR A;  2J7V A;  4BD1 A;  3VSK A;  1OME A;  5FI2 A;  3FKW A;  1WYC A;  3M6H A;  5DF7 A;  2ZC6 B;  2R9W A;  4GB7 A;  5GHY A;  3SS4 A;  3DWZ A;  4BL2 A;  3HL9 A;  3W4Q A;  4DKI A;  2HP6 A;  1Q2Q A;  4WYY A;  2RL3 A;  3BFF A;  4F94 A;  5EE8 A;  4ZBE A;  1SHV A;  4DE2 A;  3ZCZ A;  3M2K A;  3RJU A;  1XP4 A;  2WGV A;  3IWI A;  4YIN A;  2HP5 A;  1IYO A;  1I2W A;  3UN7 A;  4DE1 A;  2WKH A;  3IXH A;  3CJM A;  3M2J A;  1K55 A;  4Y0U A;  3S1Y A;  4S2N C;  1G68 A;  4S2P A;  4LV1 A;  4R23 A;  5DTK A;  4ID4 A;  3AGF A;  4OQH A;  3GV9 A;  5FQI A;  2WGW B;  3B3X A;  2CC1 A;  3RXW A;  1KGF A;  4E3I A;  5BOH A;  4GD6 A;  2OV5 A;  2WGW A;  4S2J A;  2XD1 A;  1BSG A;  4KG2 A;  2HPB A;  4DF6 A;  1KE3 A;  3NDG A;  5CTN A;  1G6A A;  4WZ4 A;  3ZG8 B;  1HTZ A;  4OQI A;  4EQI A;  1PWC A;  3HLF A;  4X68 A;  1MWR A;  4L0L A;  5EVL A;  1PIO A;  3DW0 A;  5CXW A;  5GLB A;  4PM5 A;  3A3D A;  4X55 A;  4R0Q A;  1ES5 A;  2EXA A;  1TEM A;  3VP2 A;  3IXD A;  3VOZ A;  3VP4 A;  4MBF A;  1H8Y A;  5CEB A;  3FYZ A;  3ZGA B;  3GVB A;  5FI6 A;  4GDB A;  3HLD A;  4LV0 A;  1NZO A;  2WAE A;  2WZX A;  4R3J A;  3V50 A;  5FAS A;  1ES2 A;  1XGI A;  4UA6 A;  2Y2J A;  4S2L A;  4C75 A;  3OPP A;  4NK3 A;  1YQS A;  2Z2M B;  3VP1 A;  4C3Q A;  2Y2H A;  1ZKJ A;  3PBO A;  5GLA A;  4OLD A;  3RXX A;  3NI9 A;  2Y2K A;  1CEF A;  2ZC7 A;  3MBZ A;  1GHI A;  2ZQ7 A;  3ZVT A;  4K0X A;  1GCE A;  2X02 A;  2Z2L B;  1KE0 A;  3A3F A;  3BFC A;  5FDH A;  5HAI A;  5EVI B;  3P09 A;  3O3V A;  3OC2 A;  3Q81 A;  3FKV A;  1YLZ A;  1Z6F A;  2A3U A;  4JLF A;  5EVI A;  4N9L A;  4OPY A;  3LO7 A;  1JWP A;  3MXS A;  4PM6 A;  3IT9 A;  3OCN A;  2JC7 A;  1IKI A;  1MY8 A;  1JWZ A;  4RX3 A;  5U47 A;  3DTM A;  2JCH A;  4S2N A;  1IYQ A;  3FWL A;  4KQQ A;  2H0T A;  4JBF A;  3QNB A;  4FD8 A;  1K38 A;  4E3J A;  4DXC A;  2V1Z A;  1U60 A;  1BT5 A;  5AQ7 A;  1KVL A;  4S2M A;  5FAQ A;  5HAR A;  2J9P A;  4JXG A;  3N8R A;  3UE1 A;  5D3O A;  4WEJ A;  1K4E A;  2ZMA A;  1RCJ A;  4GZB A;  2ZQA A;  3ZG7 B;  1ES3 A;  2Y2G A;  1DJB A;  2DNS A;  5EUA A;  4Z9Q A;  4KZ3 A;  1XKZ A;  5GL9 A;  1ERQ A;  3IF6 B;  4LCL A;  5CER A;  4PMA A;  3ZNT A;  5J8X A;  1NZU A;  5HAQ A;  5CEC A;  5GLC A;  1XPB A;  5EPH A;  2B5R A;  2QMI A;  2XQZ A;  2ZQ8 A;  2HDR A;  4GD8 A;  4FH2 A;  4RVA A;  4EWF A;  4OOM A;  4LV3 A;  1GHP A;  4QY5 A;  3WS5 A;  2VGK A;  3NIA A;  2J8Y A;  1BUE A;  4NET A;  2EX2 A;  1PZP A;  4KZ8 A;  2XR0 A;  3NCK A;  1E25 A;  4Y0O A;  4DXB A;  1PYY A;  4OP5 A;  4PM8 A;  1SCW A;  3G4P A;  5EEC A;  4BLM A;  1SDN A;  2E8I A;  1I2S A;  3HBR A;  3C4P A;  1S6R A;  3ZNY A;  1FCM A;  4M3K A;  4OQ0 A;  5CTM A;  3VP3 A;  2ZC5 B;  1NRF A;  2Y2M A;  4PPR A;  1O07 A;  3GQZ A;  1PWG A;  4B4X A;  1JWV A;  3W8K A;  5L2F A;  1SDE A;  2OSU A;  3HLE A;  3MZD A;  1BUL A;  2IWD A;  1K57 C;  5GLD A;  4WEL A;  1N4O A;  1KVM A;  2HP9 A;  3GMW A;  3QHY A;  3IH9 A;  4E3N A;  3BLM A;  2JBF A;  4KZ9 A;  1ES4 A;  3IXB A;  4O7D A;  4EBP A;  3SH8 A;  1FSY A;  5AQ9 A;  3PAE A;  1YLP A;  3HUN A;  1JVJ A;  2IWB A;  3O86 A;  5FQM A;  4GOG A;  4KQR A;  3V3S A;  3C7U A;  3W4O A;  3UO9 A;  1FOF A;  4DE3 A;  1PWD A;  3IH8 A;  1GA9 A;  4MEZ A;  3WS2 A;  3ZFZ A;  4GKU A;  3MKE A;  1C3B A;  2H0Y A;  1KGG A;  1E3U A;  4WM9 A;  3ZVW A;  2H10 A;  3EQV A;  4OQG A;  4XUZ A;  3PTE A;  4HES A;  5A91 A;  1NY0 A;  1CEG A;  3G35 A;  5M19 A;  2FFY A;  4X6T A;  2HDQ A;  5HL1 A;  3BRM A;  4KQO A;  5EOE A;  5TR7 A;  2Y4A A;  2WKE A;  3BYD A;  3OPL A;  3E2K A;  3A3E A;  4A5R A;  4WMC A;  1O7E A;  4IVI A;  4B88 A;  3IQA A;  3BFG A;  3UPO A;  1K25 A;  4E3K A;  5KMW A;  4CPK A;  1LLB A;  1IKG A;  5F82 A;  1RP5 A;  5CGS A;  3VSL A;  5HW3 A;  3NBL A;  4XUX A;  2Q9M A;  1DJC A;  3Q82 A;  4JF6 A;  3C5A A;  2PBY A;  3C4O A;  4RYE A;  5FSR A;  4Q8I A;  1KDW A;  4MBK A;  5EVI D;  1MWT A;  4GNU A;  1N9B A;  2XLN A;  2XFS A;  1EWZ A;  3CZD A;  2PU2 A;  1RGY A;  3WWX A;  3ZG5 A;  4N9K A;  3PBT A;  3HVF A;  4QY6 A;  5KZH A;  2ZM2 A;  3EQU A;  1XXM A;  3VMA A;  5FAO A;  3SH9 A;  3LCE A;  3WRT A;  5GHZ A;  4QU3 A;  5M18 A;  3CG5 A;  3HUM A;  3N7W A;  1MBL A;  1FCO A;  2WKI A;  2Y91 A;  3UY6 A;  1IYP A;  3G30 A;  2XD5 A;  2V20 A;  1LL9 A;  3BLS A;  3TG9 A;  2Y2O A;  3IHB A;  1MWU A;  1IEM A;  4EBN A;  1W8Y A;  5TFQ A;  5KSC A;  1H5X A;  1JTD A;  2XH9 A;  3I7J A;  1FR1 A;  3BFD A;  1Y54 A;  1ZG6 A;  1YMS A;  4LCM A;  1AXB A;  4ZDX A;  3OPH A;  4MBH A;  4UHU A;  2IWC A;  3C7V A;  4FCF A;  4JKT A;  4KZA A;  3M6B A;  2A49 A;  2XDM A;  4Y0T A;  5A92 A;  1CI8 A;  1W7F A;  2I72 A;  3DWK A;  1M6K A;  1YLT A;  1YMX A;  1YLY A;  2DRW A;  3BM6 A;  4IBX A;  4DE0 A;  3GTC A;  4X53 A;  1W8Q A;  2XF3 A;  3N8L A;  4S2I A;  1L0F A;  1ESU A;  1L0E A;  2BG1 A;  5FI7 A;  3HLB A;  1EI5 A;  2Q9N A;  5HX9 A;  3BFE A;  3MZE A;  4WZ5 C;  3WS0 A;  2H5S A;  3HLG A;  2P9V A;  4K0W A;  4ZJ3 A;  1K6S A;  4R4R A;  1QMF A;  1L0G A;  3MFD A;  3GSG A;  5E2G A;  4FSF A;  3IWO A;  5DTS A;  3HLC A;  4E3L A;  1FCN A;  4QD4 A;  3WRZ A;  4S2O A;  3AGD A;  2WK0 A;  3LY4 A;  4U3T A;  2EFX A;  3O88 A;  3MXR A;  3BEC A;  1HZO A;  1H8Z A;  1ALQ A;  1NXY A;  1FQG A;  3LEZ A;  4LV2 A;  4U0X A;  2WYX A;  4DRT A;  1I5Q A;  5E2H A;  1TDL A;  4OPZ A;  2EXB A;  1KE4 A;  5DVA A;  5EOO A;  4ZAM A;  3SH7 A;  4ZJ2 A;  2WZZ A;  1BLS A;  4IBR A;  3G32 A;  5FAT A;  3UE0 A;  4EBL A;  2R9X A;  5F83 A;  1PW8 A;  1TDG A;  5I94 A;  1E3U D;  1FSW A;  2OLU A;  2ZJ9 A;  3Q7V A;  2WUQ A;  3TSG A;  1XX2 A;  3Q07 A;  3GR2 A;  5E43 A;  2HDU A;  4N1H A;  1HD8 A;  4KZ7 A;  4U0T A;  1BLC A;  1S0W A;  3ZG0 A;  5IHV A;  3NDE A;  1VM1 A; 
#chains in the Genus database with same CATH topology
 4WMC D;  3S22 A;  4BQM A;  3NC8 A;  3BW6 A;  2ZM8 A;  5CGW A;  1K54 C;  1IEL A;  3CLO A;  4KG6 A;  1SZV A;  3W4P A;  5EVI C;  1PW1 A;  4HH2 A;  2QKP A;  2QPN A;  4X1M A;  2P74 A;  3OLO A;  3GEC A;  4UA7 A;  3C8C A;  2KOI A;  4HHD A;  4OH0 A;  4IJG A;  3NEC A;  3LI8 A;  1MPL A;  3IF5 A;  3AGE A;  4KZB A;  1LI9 A;  2XGN A;  3SOI A;  4DMZ A;  2NUT C;  1YM1 A;  3CMZ A;  3R7W B;  2Y2L A;  1OTI A;  1PI4 A;  3KSI A;  3Q7Z A;  1ZC2 A;  4P0M A;  3R7W A;  4LEN A;  1MKI A;  5HDD A;  4H6J A;  1TD5 A;  4WF0 A;  4QWO A;  3TRC A;  1CI9 A;  4FH4 A;  4ARZ B;  3ZDJ A;  1A0K A;  4Y5F A;  3NJA A;  2EFU A;  3UPN A;  2X71 A;  2PDR A;  1IYS A;  2LB9 A;  2JKG A;  2WAD A;  3B47 A;  5F1F A;  1K55 C;  4HNB A;  4X69 A;  3MZF A;  4D2O A;  2PHY A;  4HBU A;  4HBT A;  4RX2 A;  4S2K A;  3D4F A;  2J3W A;  1T18 A;  3A3I A;  4P85 A;  3JVU A;  3BQA A;  4IVK A;  4QJG A;  2L0W A;  4ZJ1 A;  2PD8 A;  5IT5 A;  1HVB A;  4OOY A;  3LY3 A;  2EX9 A;  2VGJ A;  1S4R A;  5CHJ A;  2G2W A;  4BL3 A;  2PYR A;  5IS1 A;  4JGO A;  2WAF A;  1ERM A;  4DN0 A;  2W1T A;  3M6H A;  3MF0 A;  4HP9 A;  3SS4 A;  2K2N A;  4Q0J A;  5EFW A;  3D72 A;  1SHV A;  3KSG A;  3RJU A;  3IWI A;  4WUJ A;  2M7V A;  4B93 A;  3UN7 A;  1I2W A;  3IXH A;  3CJM A;  1VB6 A;  4Y0U A;  2M1C A;  4S2P A;  2IA2 A;  4R23 A;  1S67 L;  4OQH A;  1NLY A;  2XD1 A;  1BSG A;  2HPB A;  1KE3 A;  2L1M A;  1G6A A;  3ZG8 B;  3LID A;  4EQI A;  1PWC A;  4X68 A;  3A3D A;  4R0Q A;  1ES5 A;  1TS0 A;  1TEM A;  3VP2 A;  3IXD A;  4GHI A;  5F69 A;  3VP4 A;  3FYZ A;  2QYB A;  3GVB A;  1N9L A;  4NXB A;  5FI6 A;  2WAE A;  2PRF A;  2WZX A;  4G3W A;  4UA6 A;  4R3A A;  4C75 A;  4MCW A;  5GLA A;  4OLD A;  4EEU A;  1CEF A;  3MFX A;  4IUK A;  5J7E A;  3BFC A;  3A3F A;  1JNU A;  3P09 A;  4YWZ A;  1MZU A;  1X0O A;  3EGX C;  4OPY A;  4XT2 B;  1JWZ A;  3DTM A;  4XT2 A;  1WA9 A;  2VZW A;  4E3J A;  1U60 A;  3QP2 A;  1UGU A;  5FAQ A;  3T4O A;  1K4E A;  4I39 A;  2Y2G A;  2MJ6 A;  5GL9 A;  3IF6 B;  4LCL A;  5CER A;  1NZU A;  2B5R A;  2V8F A;  4FH2 A;  2XRO A;  3IBR A;  5F68 A;  4EXO A;  4P6Z S;  3NCK A;  4PM8 A;  4YOF A;  4M3K A;  3VP3 A;  1O07 A;  3LFV A;  1PWG A;  2OSU A;  4WEL A;  3QHY A;  4E3N A;  1YPR A;  1ES4 A;  3SH8 A;  3EWK A;  1YLP A;  5FQM A;  5HZH A;  3KYZ A;  3LR4 A;  3CAX A;  3IH8 A;  1L3L A;  4HOI A;  2VLG A;  2V0W A;  4MDZ A;  5FL3 A;  4OQG A;  3PTE A;  4HES A;  2JKT M;  1CEG A;  5TJJ A;  5M19 A;  3BRM A;  3BYD A;  3A3E A;  3T4L A;  4WMC A;  4IVI A;  3BFG A;  1K25 A;  4E3K A;  5KMW A;  4CPK A;  1IKG A;  5F82 A;  3NBL A;  2Q9M A;  2ZOI A;  3C5A A;  5FSR A;  4MBK A;  4GNU A;  1EWZ A;  3P7N A;  4CQH A;  5L09 A;  2INW A;  4MN7 A;  3N7W A;  3F1P B;  4GJ4 A;  3H82 B;  3PYP A;  3G30 A;  4LRX C;  1G28 A;  2XD5 A;  3H82 A;  1LL9 A;  3IS2 B;  1Y4O A;  1MWU A;  2PD7 A;  3BWL A;  1N9O A;  5HDS A;  3OPH A;  4Y0T A;  4FCF A;  4KZA A;  2IWC A;  1YAX A;  1S66 L;  4JKT A;  5A92 A;  2JKF A;  1XFQ A;  1YLT A;  1W8Q A;  2XF3 A;  4HP4 A;  4S2I A;  1L0F A;  2HGV A;  3KYE A;  4HJ3 A;  4X25 A;  2Y79 A;  3MZE A;  4WZ5 C;  3WS0 A;  2KLI A;  2P9V A;  3E98 A;  4ZJ3 A;  4R4R A;  3HLC A;  3WRZ A;  3LY4 A;  2EFX A;  3MXR A;  4CLC E;  4LV2 A;  1FQG A;  2WYX A;  4WN5 A;  3S7N A;  2EXB A;  4ESP A;  3SH7 A;  4ZJ2 A;  1BLS A;  3P01 A;  4P6Z M;  5F83 A;  1VHM A;  3IX3 A;  1TDG A;  2WUQ A;  4G3K A;  1XX2 A;  5E43 A;  5C5K A;  2VGL S;  1BLC A;  3ZG0 A;  5HX9 A;  5G4Y A;  3VFF A;  3C30 A;  4JF5 A;  4JXV A;  5L10 A;  2BLS A;  1E4D A;  2PU4 A;  5HFO A;  3U2A A;  1BTL A;  5M1A A;  3G2Y A;  4OKP A;  3PAG A;  4MMN A;  2QJ5 A;  2ZC3 B;  2EX8 A;  2RCX A;  3IXG A;  4I38 A;  2DCF A;  3BEB A;  1PRQ A;  4BD0 A;  4UA9 A;  4I3I A;  4Y2F A;  1LL5 A;  2Y2Q A;  1FIK A;  3V3R A;  4YFM A;  1PI5 A;  4MN5 A;  2GX5 A;  5AQA A;  3SS5 A;  3P98 A;  1HLU P;  2VV6 A;  4Z1W A;  3IF6 C;  1NWZ A;  4BJP A;  5A8B A;  3SS3 A;  3FV7 A;  3E4P A;  1ZG4 A;  5JYO A;  1GHM A;  1L2S A;  2Y2P A;  5HAP A;  1S1Z A;  3UE3 A;  3B33 A;  1JTG A;  1LHY A;  2EX6 A;  5HPI A;  4X56 A;  3T4T A;  1S4S A;  3V5M A;  2OLV A;  3ITA A;  1VQQ A;  2ZQD A;  3E2L A;  1YLW A;  1NJ4 A;  1NLZ A;  4IUH A;  4HJ4 A;  1BZA A;  4GS9 A;  5CHM A;  5TBM B;  1VET B;  3UDF A;  1MWS A;  4E6W A;  3T50 A;  2I9V A;  1J9M A;  2UV0 E;  2EA9 A;  4KZ4 A;  3E0Y A;  3E4O A;  3KSH A;  1NYM A;  3OZH A;  1W5D A;  5CHU A;  3T4Q A;  3GDI A;  4B4Z A;  2J3T D;  5HWW A;  2Y2N A;  2XK1 A;  2ZD8 A;  4R4S A;  4MLL A;  1TS8 A;  3RFB A;  1BLH A;  4CLC D;  4GLQ A;  1GA0 A;  5CED A;  3FC7 A;  3UE6 A;  3A0V A;  3G2Z A;  4K91 A;  3QP8 A;  4R6L A;  4NKP A;  2Y55 A;  3Q7V B;  3G34 A;  2J9O A;  5FQQ A;  4C6Y A;  3Q1F A;  1XA1 A;  3LI9 A;  3HRE A;  4H8R A;  4KZ5 A;  2XA7 S;  1DY6 A;  1H3Q A;  1CF0 A;  1K56 D;  5A93 A;  5DJU A;  1W63 Q;  1Q2P A;  3TOI A;  2FFF B;  1NYY A;  4M4X A;  2J7V A;  3LIC A;  3K3D A;  1H8M A;  1XJ3 A;  2R9W A;  2ZC6 B;  3DWZ A;  4BL2 A;  2GZA A;  3BFF A;  5EE8 A;  4DE2 A;  1MKM A;  3M2K A;  3KSF A;  2WGV A;  4B9O A;  3MXQ A;  2HP5 A;  1IYO A;  1BYW A;  1OPX A;  3EEH A;  3S1Y A;  2KDK A;  4L9G A;  3GV9 A;  2WGW B;  3G6O A;  1KGF A;  4E3I A;  1KOU A;  2OV5 A;  2WGW A;  1GSV A;  4KG2 A;  3OOV A;  3NDG A;  4L0L A;  5K5B A;  1PIO A;  3H7W A;  5GLB A;  4PM5 A;  2EXA A;  3D9Y A;  1H8Y A;  2XRN A;  4H6J B;  4LV0 A;  2W3H A;  5FAS A;  1AWI A;  3RH8 B;  3OPP A;  2Z2M B;  1F9I A;  1ZKJ A;  3NI9 A;  1TF1 A;  2Y2K A;  2ZC7 A;  1GHI A;  2ZQ7 A;  3ZVT A;  2X02 A;  4AFI A;  3UMD A;  3FKV A;  2A3U A;  4LRY C;  1JWP A;  1MY8 A;  5U47 A;  4RX3 A;  3U4L P;  4S2N A;  4KQQ A;  3QNB A;  4II7 A;  1K38 A;  4DXC A;  1OT9 A;  1STZ A;  3A0R A;  5AQ7 A;  1KVL A;  4S2M A;  3S7O A;  3UE1 A;  1GSX A;  1TS6 A;  3JVV A;  4WEJ A;  3UB8 A;  5EVE A;  3CHW P;  4O8G A;  5J8X A;  5HAQ A;  2FH5 A;  3T12 B;  1XPB A;  5EPH A;  2QMI A;  4BBV A;  2HDR A;  4EWF A;  4OOM A;  4LV3 A;  5G4Z A;  3LUQ A;  1SKO A;  4NET A;  1PZP A;  2XR0 A;  4Y0O A;  4OP5 A;  4I3A A;  2JN7 A;  4EEP A;  4BLM A;  3HBR A;  2K31 A;  3C4P A;  3ZNY A;  2W1T B;  1ZHH B;  1NRF A;  2Y2M A;  4PPR A;  2QJ7 A;  1JWV A;  5L2F A;  1BUL A;  2IWD A;  4LPZ A;  5GLD A;  2Q0O A;  3IH9 A;  3HUN A;  1JVJ A;  1OTA A;  4GOG A;  4KQR A;  4O01 A;  3C7U A;  3KYQ A;  2PBD P;  4MEZ A;  3ZFZ A;  4BWI A;  2H0Y A;  1KGG A;  4LRZ E;  5A91 A;  3HCY A;  2VX8 A;  4X6T A;  3E4Q A;  5J4E A;  4E04 A;  1D7E A;  2Y4A A;  4GW9 A;  2PAV P;  4A5R A;  3LYX A;  3UB6 A;  4YNR A;  5CGS A;  5HW3 A;  4GHI B;  4XUX A;  1DRM A;  4RYE A;  3C4O A;  1TS7 A;  2XFS A;  3CZD A;  3B42 A;  4QY6 A;  2OAQ 1;  3EQU A;  3WRT A;  5GHZ A;  4QU3 A;  3CG5 A;  5EV0 A;  1MBL A;  4Y17 A;  5FEG A;  3NOU C;  3VE4 A;  4F3L A;  2Y91 A;  3PHY A;  1DP6 A;  3T4K A;  4ETX A;  3F1O A;  3TG9 A;  3LIF A;  2GNX A;  3F1N B;  2YKH A;  3I7J A;  3F1N A;  1FR1 A;  1V9Z A;  3BFD A;  1Y54 A;  1ZG6 A;  4ZDX A;  4UHU A;  4MBH A;  2DMW A;  3C7V A;  2XDM A;  4NG2 A;  1M6K A;  2DRW A;  1YMX A;  1YLY A;  1N9N A;  3N8L A;  1L0E A;  2BG1 A;  2O9B A;  4NEE D;  3W2Z A;  3HJK A;  2HJ9 C;  2A2L A;  1G6O A;  3HLG A;  1QMF A;  3GSG A;  4FSF A;  5DTS A;  4UQI S;  1FCN A;  3TW8 A;  2WK0 A;  3PXP A;  4U3T A;  1NXY A;  3LEZ A;  5E2H A;  1TDL A;  2QWS A;  1P9R A;  3UE0 A;  2R9X A;  3NOT C;  1E3U D;  1FSW A;  3O5Y A;  3TSG A;  3Q07 A;  4CLC B;  4CLC A;  4NXF A;  4U0T A;  2YKF A;  1S0W A;  3N8S A;  3N4I A;  3V39 A;  3S7Q A;  4LLO B;  5F5Y A;  4QHC A;  1IOU A;  1SKF A;  2B18 A;  1WYB A;  2XEP A;  4JPM A;  4R3B A;  2XFT A;  4JXW A;  2V1B A;  5A90 A;  5F1G A;  2G2U A;  1ZTU A;  3NY4 A;  2GDN A;  2ZQC A;  1K56 A;  1TVF A;  3UNW A;  4KQD A;  4KUO A;  3BY9 A;  5I5L A;  1CJF A;  4JXS A;  4QB8 A;  1XJ6 A;  3LIE A;  4N92 A;  5G18 A;  4EV4 A;  1BLP A;  1ONG A;  2W3D A;  5HD3 A;  1RGZ A;  3MSH A;  1D1J A;  5EM1 A;  3N6I A;  4E3M A;  1P97 A;  3NHQ A;  1K0K A;  1QME A;  1J3W A;  1H0M A;  1G5U A;  1MC0 A;  2Z6C A;  5CGX A;  1L0D A;  2Y59 A;  4HJ6 A;  5E2F A;  1ESI A;  3ITB A;  1LI0 A;  4DJ2 A;  3VOY A;  2Y2I A;  1K54 A;  1OTD A;  2ZM0 A;  2PYP A;  4WBG A;  1ONH A;  4KG5 A;  1KDS A;  4OOL A;  4ZTK A;  1YT4 A;  2ZQ9 A;  3FPW A;  4MNR A;  4DDY A;  3OCL A;  1K4F A;  4XXR A;  2ZL1 B;  2P9V B;  2EWW A;  2VV7 A;  2ZL1 A;  4FOF A;  3ISG A;  3IWQ A;  3IX8 A;  1PZO A;  4KEN B;  4OLG A;  5AQB A;  5FQK A;  2UWX A;  4E3O A;  4BEN A;  2VJW A;  4OVD A;  4MN6 A;  2FZ0 A;  1DJA A;  4OPR A;  1XGJ A;  4PM7 A;  5FQJ A;  1ODV A;  5FA7 A;  3MKF A;  3NUL A;  4Q0I A;  4UQI M;  1FR6 A;  3PBS A;  1K6R A;  3HLW A;  3WS4 A;  5DF9 A;  5HDC A;  5TGF A;  3VV4 A;  1YSQ A;  1T19 A;  1LSW A;  2W3G A;  3LR0 A;  3UDI A;  3VFH A;  1ERO A;  3QNC A;  2Z6D A;  5FI2 A;  3FKW A;  4EUV A;  2P04 A;  5DF7 A;  3VE3 A;  2HP6 A;  1LSX A;  4F94 A;  4D60 A;  5FEF A;  4I5S A;  2WKH A;  2W1R A;  3KX0 X;  3M2J A;  1K55 A;  1GSW A;  4LV1 A;  5L07 A;  5DTK A;  4ID4 A;  3AGF A;  3T1R A;  3B3X A;  2CC1 A;  5AVE A;  4NXG A;  4S2J A;  1YKD A;  4DF6 A;  5CTN A;  3RTY A;  1HTZ A;  2BAS A;  3HLF A;  1MWR A;  5EVL A;  3K2N A;  3LIB A;  3MQ0 A;  3T1X A;  2VKS A;  2VK3 A;  3VOZ A;  4MBF A;  2A24 A;  4GDB A;  3HLD A;  4LFU A;  4R3J A;  2D02 A;  1ES2 A;  4S2L A;  3ZQ5 A;  3RXX A;  4GS9 B;  1F5M A;  3L9K A;  4K0X A;  1GCE A;  5HAI A;  2J3T C;  3O3V A;  3Q81 A;  1YLZ A;  1Z6F A;  4JLF A;  4N9L A;  3LO7 A;  4CLC C;  3MXS A;  3IT9 A;  3OCN A;  2JC7 A;  1IKI A;  4Y15 A;  1VEU A;  2Y8H A;  1IYQ A;  4JBF A;  2V1Z A;  1IFQ A;  4BMW A;  2J9P A;  3N8R A;  5D3O A;  2ZMA A;  3C2W A;  4GZB A;  2ZQA A;  1DJB A;  2DNS A;  5EUA A;  4KZ3 A;  3ZYT A;  1XKZ A;  2CMN A;  1ERQ A;  3ZNT A;  5GLC A;  1LT0 A;  2XQZ A;  4RVA A;  4QY5 A;  3WS5 A;  2VGK A;  2ACG A;  2OOL A;  1BUE A;  1OJ5 A;  3CPT B;  4DXB A;  2WKQ A;  1SCW A;  3CPT A;  5EEC A;  4GCZ A;  2E8I A;  1FCM A;  3ICY A;  2V0U A;  4B4X A;  2VGL M;  3W8K A;  1KVM A;  1P0Z A;  2HP9 A;  3BLM A;  2W27 A;  2JBF A;  3C38 A;  4KZ9 A;  3IX4 A;  3IXB A;  4EBP A;  3PAE A;  2IWB A;  2VA0 A;  3T1Q B;  4R38 A;  3V3S A;  5DFX A;  3UO9 A;  4DE3 A;  3UB5 P;  1Y28 A;  1C3B A;  1E3U A;  3EQV A;  2FFY A;  2HDQ A;  5HL1 A;  4KQO A;  5TR7 A;  3D3O A;  3OPL A;  4B88 A;  1O7E A;  3IQA A;  4Y3I A;  2HJE A;  3H7W B;  1LLB A;  3EGD C;  3MJQ A;  2WKP A;  3UB7 A;  3DTK A;  1DJC A;  4JF6 A;  2O0Y A;  2PBY A;  2B95 A;  1KDW A;  4PAU A;  5EVI D;  2W3E A;  1MWT A;  3MQQ A;  1N9B A;  2XLN A;  4EER A;  5HWV A;  1XFN A;  2PU2 A;  3ZG5 A;  1FIL A;  2ZM2 A;  1XXM A;  3VMA A;  4L9E A;  3SH9 A;  2GJ3 A;  5M18 A;  3PR6 A;  2VV8 A;  1UWP X;  1FCO A;  1CQA A;  1P9W A;  3QP4 A;  2WKI A;  1IYP A;  4ME4 A;  3LR3 A;  4HI4 A;  1YSP A;  4WL9 A;  3IHB A;  1IEM A;  4Q0H A;  1W8Y A;  3HJI A;  5TFQ A;  5KSC A;  1JTD A;  2XH9 A;  4I3J A;  1YMS A;  4HH3 A;  3M6B A;  1CI8 A;  1W7F A;  2O99 A;  4ARZ A;  2JHE A;  2WKR A;  4DE0 A;  2P7J A;  3GTC A;  4X53 A;  1ESU A;  5FI7 A;  3CUE A;  3BFE A;  2NUP C;  4FTX A;  2H5S A;  2OAP 1;  4K0W A;  5DKK A;  1L0G A;  5E2G A;  1SKO B;  3IWO A;  4QD4 A;  4S2O A;  3AGD A;  3TJZ C;  1XJ4 A;  3O88 A;  4PHT A;  3BEC A;  1HZO A;  4JGP A;  3LR5 A;  1I5Q A;  1KE4 A;  2VEA A;  5EOO A;  5DKL A;  3G32 A;  3FPV A;  1PW8 A;  2XA7 M;  5I94 A;  2OLU A;  1F98 A;  3TE8 A;  3GR2 A;  1V9Y A;  3KO6 A;  4PKY A;  2HDU A;  1HD8 A;  4BBU A;  5IHV A;  3IBJ A;  2ZMF A;  2M7U A;  1PFL A;  2O9A A;  4WEK A;  4P87 A;  2ZLY A;  2B02 A;  3OPR A;  5MC7 A;  3DAV A;  4IED A;  2ZOH A;  3O87 A;  3LIA A;  4QPR A;  4HY8 A;  4Y7P A;  3T4J A;  1OJG A;  3PBQ A;  1W79 A;  3CWF A;  4WZ5 A;  5HWT A;  2ZMV A;  4RQ9 A;  2V8C A;  3FG8 A;  4GDN A;  3VP0 A;  5CRF A;  1M40 A;  4GN2 A;  3FZC A;  4E6X A;  5KSH A;  3ZG9 B;  3WS1 A;  5FAP A;  2K7S A;  3CI6 A;  5JYP A;  5E2E A;  2ZC4 B;  2E8J A;  3UPP A;  1MXO A;  4RA7 A;  4F3L B;  4OPQ A;  1K57 A;  4ETZ A;  4HIA A;  3F1O B;  3LEQ A;  4UEY A;  1WE4 A;  2C5W B;  3ZHH A;  1XA7 A;  5HD5 A;  4KZ6 A;  1OTE A;  3ULF A;  2WGI A;  3SZT A;  1W63 M;  5CX7 A;  2J80 A;  1CK3 A;  1T1C A;  4JF4 A;  2W3F A;  4N1X A;  3VOL A;  3UB9 A;  1LL8 A;  4DDS A;  5KIZ A;  4OP8 A;  3UME A;  1KGE A;  4UAA A;  4HEF A;  2HDS A;  2QZ6 A;  4PM9 A;  1F2K A;  3GRJ A;  2X01 A;  3G31 A;  5GHX A;  5DTT A;  4KUK A;  4PKY G;  4R1G A;  3PBN A;  4P6B A;  3UDX A;  4BBT A;  3A3J A;  4OON A;  3IF6 A;  4EUZ A;  2V2F F;  3BJN A;  2C6W B;  4JGQ A;  3JYI A;  5DF8 A;  1T1B A;  3HUO A;  3IHA A;  3S4X A;  2JE5 A;  3L7H A;  4O0P A;  2PR5 A;  5LBR A;  3SW1 A;  1NRJ A;  1YLJ A;  5FQ9 A;  4CJN A;  3PBR A;  4BD1 A;  3VSK A;  1OME A;  1WYC A;  3DTI A;  4GB7 A;  3T1S A;  2W0N A;  5GHY A;  3HL9 A;  3W4Q A;  4DKI A;  4EU0 A;  3JPU A;  1Q2Q A;  4WYY A;  2RL3 A;  4ZBE A;  3ZCZ A;  1XP4 A;  2LB5 A;  4YIN A;  2EWV A;  4WLA A;  4DE1 A;  3QP6 A;  1T1A A;  4IHQ A;  4S2N C;  1G68 A;  4Y13 A;  4DJ3 A;  1OTB A;  5AJG A;  2L4R A;  5FQI A;  2KX6 A;  3RXW A;  5BOH A;  1OT6 A;  4GD6 A;  4X1L A;  5J3W A;  5FDS A;  3CUE C;  4WZ4 A;  4OQI A;  4JGR A;  2JKT I;  3DW0 A;  5CXW A;  3OBF A;  4X55 A;  2HF6 A;  1Z09 A;  2PR6 A;  5CEB A;  3CIT A;  3ZGA B;  1NZO A;  3V50 A;  1XGI A;  2Y2J A;  4NK3 A;  1YQS A;  3VP1 A;  4C3Q A;  2Y2H A;  3PBO A;  3QP5 A;  3MBZ A;  2Z2L B;  5FDH A;  1KE0 A;  5EVI B;  3OC2 A;  3F1P A;  5EVI A;  4K08 A;  2H28 A;  4PM6 A;  3T4S A;  2JCH A;  3IS2 A;  1EW0 A;  3FWL A;  2H0T A;  4FD8 A;  3LGO A;  5L8M A;  1BT5 A;  2D01 A;  5HAR A;  4JXG A;  2OWJ A;  1RCJ A;  4EET B;  3ZG7 B;  5DJT A;  4L9F A;  1ES3 A;  2JKR M;  4Z9Q A;  3MMH A;  4PMA A;  5CEC A;  4GD8 A;  2ZQ8 A;  1UWN X;  1GHP A;  4R70 A;  3NIA A;  2J8Y A;  2JKR I;  3QP1 A;  2EX2 A;  4KZ8 A;  1E25 A;  1PYY A;  3G4P A;  1SDN A;  1I2S A;  1S6R A;  4OQ0 A;  5CTM A;  2ZC5 B;  3S7P A;  3DTE A;  3GQZ A;  1SDE A;  3HLE A;  5EM0 A;  3MZD A;  1K57 C;  1N4O A;  3GMW A;  4EQ1 A;  2AVX A;  4O7D A;  1FSY A;  5AQ9 A;  3O86 A;  2BTF P;  2P08 A;  3W4O A;  1FOF A;  3H9W A;  3MS6 A;  1PWD A;  5AVF A;  1GA9 A;  3WS2 A;  4GKU A;  3MKE A;  1D06 A;  4NXE A;  4WM9 A;  3ZVW A;  2H10 A;  4FUW A;  4XUZ A;  3A0S A;  1NY0 A;  3G35 A;  1DP8 A;  4ZRR A;  4G3V A;  5EOE A;  2WKE A;  3E2K A;  5F6A A;  3UPO A;  1RP5 A;  3VSL A;  5IU1 A;  3Q82 A;  3NOP C;  2A24 B;  2QHK A;  5DFY A;  4Q8I A;  2R78 A;  1S1Y A;  2XSS A;  1RGY A;  3WWX A;  4N9K A;  3BQ8 A;  3PBT A;  3HVF A;  5KZH A;  3R4K A;  5FAO A;  3LCE A;  1PNE A;  5HSQ A;  3HUM A;  3V67 A;  3BY8 A;  3UY6 A;  2V20 A;  3BLS A;  5HL6 A;  1VEU B;  2Y2O A;  4EBN A;  1ACF A;  1H5X A;  2HV1 A;  3EOI A;  4LCM A;  1AXB A;  4EW7 A;  1LSV A;  2A49 A;  3EEA A;  2I72 A;  3DWK A;  4IBX A;  3BM6 A;  5TBM A;  1VET A;  3HLB A;  3MQO A;  1EI5 A;  2Q9N A;  2HZ5 A;  2OWH A;  3DBA A;  1K6S A;  3MFD A;  4E3L A;  4LGW A;  2V9A A;  4EES A;  2V1A A;  1ALQ A;  1H8Z A;  4U0X A;  4DRT A;  4OPZ A;  4HQA A;  5DVA A;  4ZAM A;  2WZZ A;  2PT7 A;  2ZBB A;  4IBR A;  5FAT A;  4EBL A;  1XJ2 A;  2O9C A;  2ZJ9 A;  3Q7V A;  2G7U A;  3MR0 A;  1DP9 A;  3K3C A;  4N1H A;  5HPF A;  4KZ7 A;  3NDE A;  1VM1 A; 
#chains in the Genus database with same CATH homology
 4WEK A;  3N8S A;  4WMC D;  4P87 A;  3N4I A;  3V39 A;  3S22 A;  4BQM A;  2ZLY A;  3NC8 A;  3VFF A;  3OPR A;  4JF5 A;  4JXV A;  2BLS A;  4QHC A;  1E4D A;  2ZM8 A;  5CGW A;  1K54 C;  1SKF A;  4IED A;  2PU4 A;  5HFO A;  1WYB A;  2XEP A;  1BTL A;  1IEL A;  3O87 A;  4JPM A;  4R3B A;  2XFT A;  5M1A A;  3G2Y A;  4JXW A;  4KG6 A;  4OKP A;  3PAG A;  4Y7P A;  5A90 A;  2ZC3 B;  5F1G A;  3W4P A;  2G2U A;  3NY4 A;  5EVI C;  3PBQ A;  2GDN A;  1W79 A;  1PW1 A;  2ZQC A;  2EX8 A;  2RCX A;  2QPN A;  1K56 A;  1TVF A;  4WZ5 A;  3UNW A;  3IXG A;  2P74 A;  4JXS A;  2DCF A;  3BEB A;  4QB8 A;  4UA7 A;  4UA9 A;  4BD0 A;  4N92 A;  5G18 A;  4EV4 A;  1BLP A;  4GDN A;  3VP0 A;  1LL5 A;  5CRF A;  2Y2Q A;  1ONG A;  1M40 A;  1RGZ A;  3V3R A;  4OH0 A;  4GN2 A;  3FZC A;  4E6X A;  5KSH A;  3ZG9 B;  4YFM A;  1PI5 A;  3WS1 A;  3N6I A;  5FAP A;  1MPL A;  3IF5 A;  3AGE A;  4KZB A;  1LI9 A;  5AQA A;  4E3M A;  3SS5 A;  3P98 A;  5JYP A;  2XGN A;  3SOI A;  5E2E A;  2ZC4 B;  3UPP A;  3IF6 C;  1MXO A;  4BJP A;  4RA7 A;  3SS3 A;  3FV7 A;  1QME A;  4OPQ A;  1YM1 A;  1ZG4 A;  1K57 A;  3CMZ A;  1GHM A;  1L2S A;  2Y2P A;  2Y2L A;  1PI4 A;  3Q7Z A;  5HAP A;  5JYO A;  1ZC2 A;  4P0M A;  5CGX A;  1L0D A;  3UE3 A;  2Y59 A;  1WE4 A;  5E2F A;  1ESI A;  1JTG A;  1LHY A;  2C5W B;  1MKI A;  1LI0 A;  2EX6 A;  3ITB A;  4LEN A;  4X56 A;  3ZHH A;  1XA7 A;  3V5M A;  2OLV A;  4KZ6 A;  3ITA A;  1VQQ A;  2ZQD A;  3E2L A;  2WGI A;  3VOY A;  1YLW A;  1CK3 A;  1NJ4 A;  2Y2I A;  1K54 A;  4KG5 A;  2ZM0 A;  1CI9 A;  4FH4 A;  1ONH A;  4JF4 A;  4WBG A;  1KDS A;  3ZDJ A;  4N1X A;  4OOL A;  1BZA A;  4ZTK A;  5CHM A;  1YT4 A;  2EFU A;  3UDF A;  1MWS A;  2ZQ9 A;  4E6W A;  4DDS A;  4OP8 A;  3UPN A;  1J9M A;  4MNR A;  4KZ4 A;  2X71 A;  4DDY A;  1KGE A;  3OCL A;  1IYS A;  4UAA A;  4HEF A;  1K4F A;  4XXR A;  2HDS A;  2P9V B;  2QZ6 A;  4PM9 A;  1NYM A;  2WAD A;  3OZH A;  3GRJ A;  1W5D A;  5F1F A;  2X01 A;  5CHU A;  4B4Z A;  1K55 C;  3ISG A;  3G31 A;  3IWQ A;  5DTT A;  1PZO A;  5GHX A;  4KEN B;  4OLG A;  4X69 A;  5AQB A;  5FQK A;  3MZF A;  4D2O A;  2UWX A;  4E3O A;  4BEN A;  4OVD A;  1DJA A;  4R1G A;  2Y2N A;  4OPR A;  2XK1 A;  2ZD8 A;  3PBN A;  4HBU A;  4R4S A;  4HBT A;  4MLL A;  4RX2 A;  1BLH A;  1XGJ A;  4PM7 A;  4S2K A;  5FQJ A;  4P6B A;  5FA7 A;  3MKF A;  3UDX A;  3D4F A;  1GA0 A;  5CED A;  3A3J A;  1FR6 A;  3G2Z A;  4K91 A;  3PBS A;  1K6R A;  3HLW A;  3A3I A;  4P85 A;  4OON A;  3IF6 A;  3WS4 A;  5DF9 A;  4IVK A;  2V2F F;  2Y55 A;  5TGF A;  4EUZ A;  4QJG A;  3Q7V B;  2C6W B;  3G34 A;  4ZJ1 A;  1HVB A;  2J9O A;  5FQQ A;  3JYI A;  4C6Y A;  3Q1F A;  5DF8 A;  4OOY A;  3LY3 A;  3HUO A;  3IHA A;  1XA1 A;  3S4X A;  3HRE A;  2EX9 A;  4H8R A;  2JE5 A;  4KZ5 A;  2VGJ A;  3UDI A;  1DY6 A;  2G2W A;  1ERO A;  5CHJ A;  3VFH A;  4BL3 A;  1K56 D;  2WAF A;  1ERM A;  3QNC A;  5A93 A;  3TOI A;  1Q2P A;  1YLJ A;  5FQ9 A;  2FFF B;  1NYY A;  4CJN A;  3PBR A;  2J7V A;  4BD1 A;  3VSK A;  1OME A;  5FI2 A;  3FKW A;  1WYC A;  3M6H A;  5DF7 A;  2ZC6 B;  2R9W A;  4GB7 A;  5GHY A;  3SS4 A;  3DWZ A;  4BL2 A;  3HL9 A;  3W4Q A;  4DKI A;  2HP6 A;  1Q2Q A;  4WYY A;  2RL3 A;  3BFF A;  4F94 A;  5EE8 A;  4ZBE A;  1SHV A;  4DE2 A;  3ZCZ A;  3M2K A;  3RJU A;  1XP4 A;  2WGV A;  3IWI A;  4YIN A;  2HP5 A;  1IYO A;  1I2W A;  3UN7 A;  4DE1 A;  2WKH A;  3IXH A;  3CJM A;  3M2J A;  1K55 A;  4Y0U A;  3S1Y A;  4S2N C;  1G68 A;  4S2P A;  4LV1 A;  4R23 A;  5DTK A;  4ID4 A;  3AGF A;  4OQH A;  3GV9 A;  5FQI A;  2WGW B;  3B3X A;  2CC1 A;  3RXW A;  1KGF A;  4E3I A;  5BOH A;  4GD6 A;  2OV5 A;  2WGW A;  4S2J A;  2XD1 A;  1BSG A;  4KG2 A;  2HPB A;  4DF6 A;  1KE3 A;  3NDG A;  5CTN A;  1G6A A;  4WZ4 A;  3ZG8 B;  1HTZ A;  4OQI A;  4EQI A;  1PWC A;  3HLF A;  4X68 A;  1MWR A;  4L0L A;  5EVL A;  1PIO A;  3DW0 A;  5CXW A;  5GLB A;  4PM5 A;  3A3D A;  4X55 A;  4R0Q A;  1ES5 A;  2EXA A;  1TEM A;  3VP2 A;  3IXD A;  3VOZ A;  3VP4 A;  4MBF A;  1H8Y A;  5CEB A;  3FYZ A;  3ZGA B;  3GVB A;  5FI6 A;  4GDB A;  3HLD A;  4LV0 A;  1NZO A;  2WAE A;  2WZX A;  4R3J A;  3V50 A;  5FAS A;  1ES2 A;  1XGI A;  4UA6 A;  2Y2J A;  4S2L A;  4C75 A;  3OPP A;  4NK3 A;  1YQS A;  2Z2M B;  3VP1 A;  4C3Q A;  2Y2H A;  1ZKJ A;  3PBO A;  5GLA A;  4OLD A;  3RXX A;  3NI9 A;  2Y2K A;  1CEF A;  2ZC7 A;  3MBZ A;  1GHI A;  2ZQ7 A;  3ZVT A;  4K0X A;  1GCE A;  2X02 A;  2Z2L B;  1KE0 A;  3A3F A;  3BFC A;  5FDH A;  5HAI A;  5EVI B;  3P09 A;  3O3V A;  3OC2 A;  3Q81 A;  3FKV A;  1YLZ A;  1Z6F A;  2A3U A;  4JLF A;  5EVI A;  4N9L A;  4OPY A;  3LO7 A;  1JWP A;  3MXS A;  4PM6 A;  3IT9 A;  3OCN A;  2JC7 A;  1IKI A;  1MY8 A;  1JWZ A;  4RX3 A;  5U47 A;  3DTM A;  2JCH A;  4S2N A;  1IYQ A;  3FWL A;  4KQQ A;  2H0T A;  4JBF A;  3QNB A;  4FD8 A;  1K38 A;  4E3J A;  4DXC A;  2V1Z A;  1U60 A;  1BT5 A;  5AQ7 A;  1KVL A;  4S2M A;  5FAQ A;  5HAR A;  2J9P A;  4JXG A;  3N8R A;  3UE1 A;  5D3O A;  4WEJ A;  1K4E A;  2ZMA A;  1RCJ A;  4GZB A;  2ZQA A;  3ZG7 B;  1ES3 A;  2Y2G A;  1DJB A;  2DNS A;  5EUA A;  4Z9Q A;  4KZ3 A;  1XKZ A;  5GL9 A;  1ERQ A;  3IF6 B;  4LCL A;  5CER A;  4PMA A;  3ZNT A;  5J8X A;  1NZU A;  5HAQ A;  5CEC A;  5GLC A;  1XPB A;  5EPH A;  2B5R A;  2QMI A;  2XQZ A;  2ZQ8 A;  2HDR A;  4GD8 A;  4FH2 A;  4RVA A;  4EWF A;  4OOM A;  4LV3 A;  1GHP A;  4QY5 A;  3WS5 A;  2VGK A;  3NIA A;  2J8Y A;  1BUE A;  4NET A;  2EX2 A;  1PZP A;  4KZ8 A;  2XR0 A;  3NCK A;  1E25 A;  4Y0O A;  4DXB A;  1PYY A;  4OP5 A;  4PM8 A;  1SCW A;  3G4P A;  5EEC A;  4BLM A;  1SDN A;  2E8I A;  1I2S A;  3HBR A;  3C4P A;  1S6R A;  3ZNY A;  1FCM A;  4M3K A;  4OQ0 A;  5CTM A;  3VP3 A;  2ZC5 B;  1NRF A;  2Y2M A;  4PPR A;  1O07 A;  3GQZ A;  1PWG A;  4B4X A;  1JWV A;  3W8K A;  5L2F A;  1SDE A;  2OSU A;  3HLE A;  3MZD A;  1BUL A;  2IWD A;  1K57 C;  5GLD A;  4WEL A;  1N4O A;  1KVM A;  2HP9 A;  3GMW A;  3QHY A;  3IH9 A;  4E3N A;  3BLM A;  2JBF A;  4KZ9 A;  1ES4 A;  3IXB A;  4O7D A;  4EBP A;  3SH8 A;  1FSY A;  5AQ9 A;  3PAE A;  1YLP A;  3HUN A;  1JVJ A;  2IWB A;  3O86 A;  5FQM A;  4GOG A;  4KQR A;  3V3S A;  3C7U A;  3W4O A;  3UO9 A;  1FOF A;  4DE3 A;  1PWD A;  3IH8 A;  1GA9 A;  4MEZ A;  3WS2 A;  3ZFZ A;  4GKU A;  3MKE A;  1C3B A;  2H0Y A;  1KGG A;  1E3U A;  4WM9 A;  3ZVW A;  2H10 A;  3EQV A;  4OQG A;  4XUZ A;  3PTE A;  4HES A;  5A91 A;  1NY0 A;  1CEG A;  3G35 A;  5M19 A;  2FFY A;  4X6T A;  2HDQ A;  5HL1 A;  3BRM A;  4KQO A;  5EOE A;  5TR7 A;  2Y4A A;  2WKE A;  3BYD A;  3OPL A;  3E2K A;  3A3E A;  4A5R A;  4WMC A;  1O7E A;  4IVI A;  4B88 A;  3IQA A;  3BFG A;  3UPO A;  1K25 A;  4E3K A;  5KMW A;  4CPK A;  1LLB A;  1IKG A;  5F82 A;  1RP5 A;  5CGS A;  3VSL A;  5HW3 A;  3NBL A;  4XUX A;  2Q9M A;  1DJC A;  3Q82 A;  4JF6 A;  3C5A A;  2PBY A;  3C4O A;  4RYE A;  5FSR A;  4Q8I A;  1KDW A;  4MBK A;  5EVI D;  1MWT A;  4GNU A;  1N9B A;  2XLN A;  2XFS A;  1EWZ A;  3CZD A;  2PU2 A;  1RGY A;  3WWX A;  3ZG5 A;  4N9K A;  3PBT A;  3HVF A;  4QY6 A;  5KZH A;  2ZM2 A;  3EQU A;  1XXM A;  3VMA A;  5FAO A;  3SH9 A;  3LCE A;  3WRT A;  5GHZ A;  4QU3 A;  5M18 A;  3CG5 A;  3HUM A;  3N7W A;  1MBL A;  1FCO A;  2WKI A;  2Y91 A;  3UY6 A;  1IYP A;  3G30 A;  2XD5 A;  2V20 A;  1LL9 A;  3BLS A;  3TG9 A;  2Y2O A;  3IHB A;  1MWU A;  1IEM A;  4EBN A;  1W8Y A;  5TFQ A;  5KSC A;  1H5X A;  1JTD A;  2XH9 A;  3I7J A;  1FR1 A;  3BFD A;  1Y54 A;  1ZG6 A;  1YMS A;  4LCM A;  1AXB A;  4ZDX A;  3OPH A;  4MBH A;  4UHU A;  2IWC A;  3C7V A;  4FCF A;  4JKT A;  4KZA A;  3M6B A;  2A49 A;  2XDM A;  4Y0T A;  5A92 A;  1CI8 A;  1W7F A;  2I72 A;  3DWK A;  1M6K A;  1YLT A;  1YMX A;  1YLY A;  2DRW A;  3BM6 A;  4IBX A;  4DE0 A;  3GTC A;  4X53 A;  1W8Q A;  2XF3 A;  3N8L A;  4S2I A;  1L0F A;  1ESU A;  1L0E A;  2BG1 A;  5FI7 A;  3HLB A;  1EI5 A;  2Q9N A;  5HX9 A;  3BFE A;  3MZE A;  4WZ5 C;  3WS0 A;  2H5S A;  3HLG A;  2P9V A;  4K0W A;  4ZJ3 A;  1K6S A;  4R4R A;  1QMF A;  1L0G A;  3MFD A;  3GSG A;  5E2G A;  4FSF A;  3IWO A;  5DTS A;  3HLC A;  4E3L A;  1FCN A;  4QD4 A;  3WRZ A;  4S2O A;  3AGD A;  2WK0 A;  3LY4 A;  4U3T A;  2EFX A;  3O88 A;  3MXR A;  3BEC A;  1HZO A;  1H8Z A;  1ALQ A;  1NXY A;  1FQG A;  3LEZ A;  4LV2 A;  4U0X A;  2WYX A;  4DRT A;  1I5Q A;  5E2H A;  1TDL A;  4OPZ A;  2EXB A;  1KE4 A;  5DVA A;  5EOO A;  4ZAM A;  3SH7 A;  4ZJ2 A;  2WZZ A;  1BLS A;  4IBR A;  3G32 A;  5FAT A;  3UE0 A;  4EBL A;  2R9X A;  5F83 A;  1PW8 A;  1TDG A;  5I94 A;  1E3U D;  1FSW A;  2OLU A;  2ZJ9 A;  3Q7V A;  2WUQ A;  3TSG A;  1XX2 A;  3Q07 A;  3GR2 A;  5E43 A;  2HDU A;  4N1H A;  1HD8 A;  4KZ7 A;  4U0T A;  1BLC A;  1S0W A;  3ZG0 A;  5IHV A;  3NDE A;  1VM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...