3OPLA

Esbl r164h mutant shv-1 beta-lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDHWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-dependent disorder of the Omega loop observed in extended-spectrum SHV-type beta-lactamase.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
molecule keywords Beta-lactamase SHV-1
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3oplA00
2Y2KA 4MBKA 4JF5A 4R4RA 1ES3A 4KZ6A 4GZBA 2GDNA 2IWBA 2JE5A 1C3BA 2PU2A 1PW1A 5FSRA 3VOZA 4EUZA 3GMWA 3SH7A 3UDXA 4IVIA 3UN7A 3ZVWA 3OPHA 4S2PA 3P98A 1E3UD 3LCEA 1GHPA 3MKEA 4KENB 5FAPA 4KG6A 2JBFA 5FQQA 3FZCA 3SS3A 4OKPA 1YLZA 3D4FA 2Y2QA 1KE3A 5CTMA 3VFFA 1NZUA 4GNUA 4KG2A 4DDYA 2XH9A 3SH8A 4OQHA 3B3XA 4UA6A 1KDWA 4X56A 1BUEA 2WAEA 2Y2HA 4OQIA 3OC2A 2XLNA 4P87A 4EQIA 1ZC2A 4FCFA 1TDGA 3BFGA 3PAEA 3TOIA 5EOOA 4PM5A 3HLEA 3IXHA 4S2LA 1IKGA 3BYDA 5G18A 3HLBA 2ZC3B 3CZDA 4GDBA 4PM9A 4DE0A 5CEDA 3M6BA 5EVID 1PWGA 1O7EA 2WUQA 2G2WA 4DKIA 3VMAA 1CI9A 4MBFA 4D2OA 5HFOA 5FQ9A 3NC8A 2XK1A 3ZG7B 1L0GA 3GSGA 4Y0UA 3OCLA 4O7DA 1ESUA 1GHMA 5CTNA 1ALQA 3G31A 1PIOA 1CI8A 2Y2JA 3GVBA 3ZCZA 1JWZA 2HPBA 3N8RA 2ZQ8A 4WZ5A 1K57C 4R1GA 3UY6A 1L0EA 4C6YA 1YLTA 1YQSA 1L0FA 1CEFA 4MBHA 3BLSA 3C7UA 3ZG9B 1VM1A 2ZD8A 3PBQA 5M1AA 3AGFA 2IWDA 4ZJ2A 5JYPA 4OOLA 4ZAMA 4RYEA 2R9XA 3PBSA 4OVDA 1U60A 4WM9A 3CMZA 3JYIA 5E2HA 2H0YA 5FI6A 4B88A 5HL1A 4OPQA 3HLCA 3OPPA 4DE1A 3BFDA 2Y2LA 2Y2PA 2WADA 2ZM8A 2EXBA 3IF6A 4JXGA 2XFSA 4U0TA 4OLDA 1EWZA 3WS1A 2HP9A 3S1YA 3VP0A 2I72A 2WGWA 4FSFA 3C4PA 4GD8A 4MNRA 1K4FA 4S2IA 3GRJA 3LY4A 3MBZA 5EUAA 3WS5A 2Y2GA 1XA1A 2FFFB 2J7VA 3AGDA 1ZG6A 5DF9A 5U47A 4HBTA 2CC1A 4QY5A 3Q7VA 1I2WA 5KSHA 4EBPA 1JTDA 2ZQAA 3V3SA 2QZ6A 2V2FF 1DJCA 3HBRA 4FH2A 1W7FA 5GHZA 5BOHA 1H5XA 1K6SA 2ZLYA 4DXBA 1RCJA 4U3TA 4QD4A 1EI5A 4KZ7A 5AQ9A 3V39A 4UA9A 3OPRA 3WS0A 4LV3A 3ZVTA 2WYXA 3O87A 1J9MA 2ZC6B 4XXRA 2WK0A 3NDEA 2ZC7A 3UE1A 3G4PA 4EBLA 4BJPA 5EVIA 2WKIA 3HLDA 2Q9MA 4N9LA 4WELA 5CERA 3VSLA 3UE3A 4KZ4A 4N92A 1LI9A 1PI5A 4KG5A 3IXGA 5CXWA 4LV1A 3IF6C 1NXYA 1MWSA 1E25A 2BG1A 1WYBA 5FI2A 3CJMA 4QU3A 5EECA 3HLFA 3QHYA 4E6WA 4LENA 4P0MA 4PM7A 1PW8A 3A3IA 1NYYA 4HBUA 1MWTA 1ES2A 1Z6FA 4UA7A 1MWRA 1L2SA 1IELA 3MXSA 4FD8A 2JCHA 1I2SA 1LHYA 3N6IA 1GA9A 3N4IA 3OCNA 5FQJA 1K54A 1JWPA 3O3VA 4WEJA 4S2NC 4R0QA 5CEBA 1BTLA 3NIAA 3NY4A 5EE8A 5EVIC 1GHIA 4E3JA 1BLHA 1H8ZA 4S2OA 5CECA 1O07A 5HAPA 3NCKA 3BFCA 1BULA 3VP2A 4E3NA 4DE2A 3ISGA 1MY8A 2ZQ7A 1MXOA 1W79A 3PTEA 4DDSA 4GN2A 1N4OA 2UWXA 4EV4A 4B4XA 4K91A 3BFFA 3NI9A 4U0XA 2OV5A 3LEZA 2G2UA 1FQGA 5HAQA 5HW3A 2XD5A 3C7VA 4IBXA 3HREA 3SS4A 3PBTA 2ZQDA 3ZG8B 2HP6A 3MZEA 4OP5A 1BSGA 3DWKA 4X6TA 4GDNA 2PBYA 3RJUA 3MZFA 2XQZA 1LL5A 4B4ZA 4BL2A 3ZDJA 3BFEA 1BZAA 1TDLA 3RXWA 1KE0A 1XKZA 1KGGA 5FQMA 5TGFA 4PPRA 5FASA 1IYQA 1HVBA 4K0XA 2EFUA 2HDSA 4Q8IA 4GB7A 4QHCA 4Z9QA 1K55C 4OPYA 5FQKA 1K54C 3ZNTA 1K56D 5DVAA 3IHBA 3ZG0A 3IQAA 1QMEA 3QNCA 3A3DA 1LLBA 3NDGA 3WWXA 1DJAA 1XA7A 4WBGA 4X69A 1TEMA 4OOYA 5FQIA 3G30A 1W5DA 2DNSA 4WYYA 3DTMA 4LCMA 4WMCA 2OSUA 5DTKA 4QJGA 3MFDA 1K55A 1K57A 2XGNA 1YLYA 3G32A 2X02A 4NK3A 5KSCA 5CGSA 3IWIA 4GOGA 3IHAA 1ESIA 2WGWB 5DTSA 4BQMA 1NJ4A 3WRZA 1MWUA 4KQRA 4OH0A 4S2NA 1M40A 1BLSA 5GLBA 3MZDA 4JF6A 5TR7A 4K0WA 3SH9A 1K56A 4BD1A 3WS4A 4IVKA 1ZKJA 2WGIA 2Y59A 3SS5A 4QY6A 4BD0A 2J9PA 4QB8A 3HUNA 1YMXA 1BLCA 1LI0A 3BECA 2WGVA 3BM6A 3UDIA 3IXDA 3E2LA 4JPMA 2RCXA 3SOIA 3UPNA 4OQGA 1K38A 2J8YA 5A93A 3A3EA 1PZPA 1XPBA 2P9VA 3QNBA 2IWCA 3G34A 5TFQA 3S4XA 5KZHA 3LY3A 3C4OA 4C75A 5CHMA 3Q7VB 3DW0A 2VGKA 4ZJ3A 4H8RA 1KE4A 4MEZA 3ITBA 3WS2A 3Q1FA 3IXBA 2A3UA 4NETA 2XR0A 1NRFA 3IWQA 3Q82A 3M2JA 4Y7PA 4ZJ1A 3HUMA 1GCEA 2X71A 4EWFA 1JWVA 1PWCA 2C6WB 4WZ4A 4M3KA 2HDQA 5CGXA 2WZXA 1VQQA 1ES4A 2BLSA 4RVAA 5A91A 4E3MA 3UPOA 1N9BA 2H0TA 4GD6A 4S2JA 5AQAA 3WRTA 4KQOA 2QMIA 2EX2A 1ZG4A 4BLMA 1CEGA 4E6XA 3W4PA 4S2KA 1W8QA 3N8LA 5FA7A 1ERMA 4LCLA 2WAFA 4XUZA 5GHXA 1BLPA 3DWZA 3VP4A 2P74A 5DF8A 3FV7A 3I7JA 3V3RA 3PBNA 5GL9A 4R3BA 4KQQA 3GR2A 3FKWA 2XFTA 5FATA 3UDFA 3ZNYA 4HESA 5GLAA 4JLFA 4RX3A 3W8KA 1K25A 2ZQCA 1K4EA 2EXAA 3BRMA 3PBRA 4P6BA 4L0LA 4FH4A 1ONGA 3AGEA 2PU4A 5EVLA 1FCMA 4R23A 4DRTA 2Y2NA 3P09A 3FWLA 2ZQ9A 2EFXA 3O88A 5IHVA 1IYPA 5EOEA 1HTZA 1YLWA 3G2YA 3G35A 3HLGA 2B5RA 3S22A 3UNWA 1KDSA 4JXWA 4RX2A 1RGZA 4CJNA 4KZ8A 1W8YA 2A49A 5CRFA 5DF7A 4JKTA 1SHVA 4RA7A 3EQUA 1NY0A 2OLUA 3BEBA 3IF6B 1LL9A 1YLPA 1FR6A 1IEMA 4KZ5A 1S0WA 4ZTKA 1FR1A 5FAOA 3BLMA 3C5AA 1TVFA 2HDUA 2Q9NA 1IKIA 1YLJA 5F82A 5E43A 3M2KA 1YT4A 1Y54A 4KZ3A 3VOYA 1KGEA 3A3JA 4BL3A 1SDEA 2FFYA 4GKUA 1DY6A 3HUOA 1E4DA 1PWDA 1IYSA 3E2KA 4KZBA 5EVIB 1WE4A 1DJBA 1NYMA 4S2MA 3VSKA 3MXRA 3LO7A 1Q2QA 1YMSA 2DRWA 4CPKA 3GQZA 3UPPA 1SCWA 5GHYA 4OLGA 1IYOA 4F94A 1KGFA 5J8XA 1G68A 1HD8A 1OMEA 4XUXA 2Z2LB 4E3LA 2EX8A 3OPLA 1AXBA 4OPRA 1PZOA 3Q07A 2Y2OA 4UHUA 4WZ5C 1MBLA 5FDHA 3V50A 2QPNA 4ID4A 4OPZA 4JXSA 2DCFA 1SDNA 1S6RA 4LV0A 5HARA 3UO9A 4HEFA 4OOMA 2RL3A 4WMCD 4DXCA 1RGYA 2HDRA 2WKHA 2ZM0A 1PYYA 1FCNA 4N1XA 5I94A 3RXXA 3A3FA 1SKFA 3FYZA 1GA0A 2Y2MA 4DF6A 4PM6A 4MLLA 3HL9A 2P9VB 4E3KA 2XDMA 1L0DA 4R3JA 4E3IA 2XEPA 2V1ZA 2VGJA 1MPLA 2ZJ9A 3IT9A 3M6HA 4KZ9A 1CK3A 5F83A 5KMWA 2JC7A 3FKVA 3IH9A 5DTTA 5F1GA 5A92A 4Y0TA 5GLDA 1QMFA 4R4SA 3ZHHA 3HLWA 1ONHA 2J9OA 1I5QA 3GTCA 5FAQA 5AQBA 1EROA 2ZC4B 4OONA 1JVJA 2ZC5B 5E2EA 3MKFA 4BENA 1WYCA 3ZFZA 2Y91A 1BT5A 4X53A 1H8YA 5D3OA 1NZOA 2H5SA 1XP4A 5E2GA 3ITAA 3O86A 1RP5A 2ZM2A 2Z2MB 4C3QA 3IH8A 3TSGA 5EPHA 1YM1A 4JBFA 5E2FA 1FSYA 4UAAA 1KVLA 2EX9A 2EX6A 2H10A 2WKEA 3GV9A 5F1FA 5CGWA 5M19A 4WEKA 4IBRA 3IF5A 3NBLA 1PI4A 1K6RA 2OLVA 2Y55A 5CHJA 3OZHA 3G2ZA 5A90A 4A5RA 3PBOA 4OQ0A 3Q81A 4JF4A 2R9WA 4N1HA 4P85A 4PMAA 2XD1A 4E3OA 1FCOA 3VP1A 3IWOA 5L2FA 1FSWA 2X01A 3ZG5A 4LV2A 2C5WB 3EQVA 1ERQA 1G6AA 4DE3A 2WZZA 3TG9A 5CHUA 4N9KA 3Q7ZA 5M18A 3VP3A 1KVMA 4IEDA 5FI7A 5HAIA 5GLCA 1JTGA 3VFHA 1XXMA 1Q2PA 4JXVA 5HX9A 5JYOA 4YFMA 3UE0A 2V20A 3N7WA 2E8IA 3V5MA 1MKIA 4PM8A 1XGJA 2XF3A 2Y2IA 1XGIA 3N8SA 4X55A 4ZBEA 3PAGA 5AQ7A 3CG5A 1E3UA 3HVFA 4YINA 3W4QA 1M6KA 4ZDXA 1HZOA 1ES5A 4X68A 4OP8A 3ZGAB 4KZAA 4Y0OA 2ZMAA 2Y4AA 3W4OA 4EBNA 1XX2A 2HP5A 1FOFA
chains in the Genus database with same CATH superfamily
4MBKA 4KZ6A 4GCZA 5L10A 3UB6A 2GDNA 1C3BA 3GMWA 3A0VA 3OPHA 4S2PA 1T1AA 5EFWA 5FAPA 3SS3A 4OKPA 2Y2QA 5CTMA 1Z09A 2J3WA 5CX7A 3SH8A 2DMWA 3LI8A 5HD3A 4MMNA 1KDWA 4X56A 1BUEA 3TOIA 4CLCD 3BFGA 3BQ8A 2VEAA 4LGWA 4DN0A 1IKGA 5G18A 2ZC3B 4DE0A 1PWGA 3R4KA 3VMAA 4IUKA 5FQ9A 3NC8A 3F1PB 5F5YA 4JGPA 5TBMA 3G31A 1JWZA 4EERA 2QHKA 1VETB 1L0FA 4MBHA 1LSWA 4AFIA 3AGFA 4ZJ2A 3FPWA 4WM9A 2W3EA 5E2HA 4B88A 5HL1A 4OPQA 3HLCA 4X25A 2VGLS 4ESPA 4JXGA 4OLDA 1UWPX 2I72A 4FSFA 4MNRA 1JNUA 5HDSA 4GS9A 3BQAA 4FOFA 1XA1A 2J7VA 1ZG6A 5U47A 2CC1A 1I2WA 5G4ZA 2W3DA 4BWIA 1JTDA 2LB9A 5EM1A 1DJCA 5BOHA 4WUJA 5AQ9A 1S4SA 1XJ4A 2ZC6B 2WK0A 1VEUB 4EBLA 4BJPA 2Q9MA 4Y3IA 5CERA 2O9CA 2W1RA 5EM0A 3IS2A 3LIFA 3QP6A 1MC0A 1E25A 3H7WB 4QU3A 3U2AA 3HLFA 4LENA 4PM7A 3A3IA 1NYYA 4HBUA 4UA7A 2W1TB 2ZL1A 3MXSA 2JCHA 1GA9A 2Y8HA 3OCNA 1JWPA 5DFXA 3NIAA 3NY4A 1OTIA 4PHTA 1BLHA 4L9FA 3VP2A 3ISGA 3MF0A 1N4OA 4B4XA 2KOIA 4GJ4A 4U0XA 2G2UA 3EGDC 3B47A 3MZEA 1BSGA 5TBMB 1LL5A 4EQ1A 4G3KA 2VZWA 2V1AA 3RXWA 3BW6A 1XKZA 3FC7A 5FQMA 5TGFA 3PR6A 3E4OA 3QP5A 4Q8IA 1N9NA 3ZNTA 1K55C 4OPYA 1K56D 5DVAA 3QNCA 3A3DA 5L8MA 5FQIA 2DNSA 1P9WA 5F68A 5DTKA 4QJGA 3MFDA 4Y5FA 4BQMA 2CMNA 4NXEA 1BLSA 5TR7A 4HOIA 4K0WA 3SH9A 1CJFA 4BD1A 4Q0IA 3EWKA 1ZKJA 2Y59A 1OTDA 3IXDA 3E2LA 2RCXA 2GZAA 3GDIA 2HF6A 4PAUA 2IWCA 3G34A 3IBJA 3T4QA 5TFQA 4EETB 5KZHA 3DW0A 4H8RA 3S7OA 4NETA 3W2ZA 2XR0A 3FPVA 2I9VA 2ZBBA 3IWQA 3MJQA 4ZJ1A 1OJ5A 2C6WB 4GHIB 4M3KA 2BTFP 1ES4A 3O5YA 3PXPA 5AQAA 3WRTA 1ZG4A 2PD7A 4E6XA 1ERMA 5EV0A 2WAFA 4XUZA 5GHXA 3DWZA 3FV7A 1NLZA 1XFNA 1N9LA 3PBNA 2XFTA 4UEYA 3UDFA 5HWWA 4HESA 3T4KA 1H8MA 2QKPA 1K4EA 2EXAA 3BRMA 4P6BA 4L0LA 2B02A 1WA9A 1ONGA 5DJUA 1KOUA 1H0MA 3BJNA 2PU4A 5FDSA 2YKFA 2Y2NA 4DRTA 4GLQA 4HY8A 1HTZA 1YLWA 3IX3A 3EGXC 3G35A 4LFUA 2B5RA 4RX2A 4MCWA 2A49A 1SHVA 3BY8A 3UB8A 1LT0A 5K5BA 3BEBA 5IT5A 1S0WA 1FR1A 1TVFA 3DTIA 1IKIA 2NUPC 4HP9A 1YT4A 4KZ3A 1KGEA 4BL3A 4GKUA 4R6LA 2YKHA 1MZUA 4KZBA 5L09A 3ZYTA 3S7PA 4S2MA 3MR0A 3QP8A 1Q2QA 3LR3A 3UPPA 2B18A 4OLGA 4F94A 1SKOB 1OMEA 5J3WA 3Q07A 1GSVA 2W1TA 4UHUA 5FDHA 1VEUA 4WF0A 1SDNA 1YSPA 1Y28A 2HDRA 1LSVA 3CPTA 3CI6A 4N1XA 3IS2B 4I3IA 1GA0A 4E3KA 2QJ5A 2XDMA 2ZJ9A 3M6HA 1CK3A 2XA7M 2JC7A 5F1GA 4Y0TA 5GLDA 3ZHHA 1ONHA 2EA9A 3T4LA 4ETXA 1FILA 1S4RA 3ZFZA 1BT5A 3KX0X 4HJ3A 5HWVA 5E2GA 4LPZA 2Z2MB 4C3QA 3IH8A 3TSGA 5EPHA 4JBFA 2P7JA 3E0YA 3LI9A 4Q0HA 1KVLA 2WKPA 2WKEA 5CGWA 5M19A 4IBRA 1PI4A 2Y55A 2OOLA 4A5RA 2JKRI 3VE4A 3ZG5A 1ERQA 2HZ5A 4R70A 4N9KA 1Q2PA 4YFMA 3UE0A 2V20A 3N7WA 4PM8A 1FIKA 1X0OA 1F9IA 3MQOA 3PAGA 1E3UA 3W4QA 1G5UA 1M6KA 4ZDXA 4KZAA 2ZMAA 3E4PA 3W4OA 3K3CA 2ZOIA 1FOFA 2OWJA 4R4RA 2JHEA 2J80A 5AVEA 2IWBA 3S7NA 2PU2A 1PW1A 4EUZA 3SH7A 3GECA 1IFQA 4IJGA 1GHPA 2ZMFA 4KENB 5FQQA 2JBFA 3MXQA 1KE3A 3VFFA 1NZUA 4KG2A 5F69A 4CLCC 4DDYA 2XH9A 4UA6A 4PKYA 2GJ3A 3G6OA 4OQIA 3PAEA 5DJTA 4PM5A 3IXHA 3BYDA 3HLBA 3R7WB 4GDBA 4K08A 3CPTB 1CI9A 5HFOA 3GSGA 4Y0UA 3OCLA 4O7DA 1GHMA 1YAXA 2V9AA 1D1JA 1PIOA 1CI8A 3N8RA 2HPBA 4WZ5A 2HGVA 4GW9A 2A24A 3KSIA 4NXBA 1VM1A 4RYEA 2R9XA 4OVDA 3JYIA 2OAQ1 2JN7A 3OPPA 4NKPA 3BFDA 4DE1A 2VK3A 2EXBA 5HSQA 1T1CA 2WGWA 4S2IA 3GRJA 3QP4A 1STZA 4I3AA 3Q7VA 1MKMA 1LL8A 3F1OB 2QZ6A 3HBRA 4FH2A 5GHZA 1OT9A 4U3TA 1EI5A 3MMHA 4KZ7A 4UA9A 3OPRA 4LV3A 4BBTA 3O87A 4ARZB 3UE1A 3NHQA 4I3JA 1OPXA 3HLDA 4WELA 4KZ4A 1PI5A 3IXGA 1XJ6A 3KSGA 1NXYA 2IA2A 4E6WA 1MWTA 1Z6FA 1MWRA 2PBDP 1L2SA 1IELA 4FD8A 3N4IA 5FQJA 4Q0JA 3IBRA 4B93A 3NECA 5CEBA 1BTLA 1P9RA 1UWNX 5CECA 2EWVA 4YOFA 4E3NA 4DE2A 1MY8A 1W79A 4EV4A 4K91A 1NLYA 2ACGA 3BFFA 3CAXA 3NI9A 3CLOA 3JPUA 3LEZA 3C7VA 4IBXA 1OTAA 3PBTA 3F1NA 3ZG8B 3FG8A 4X6TA 4E04A 4B4ZA 4BL2A 4CLCB 1TDLA 4DJ3A 1ZHHB 1KE0A 1KGGA 2VV6A 2KX6A 1OTBA 3SZTA 4K0XA 1HVBA 1ACFA 4GB7A 2HJEA 2INWA 4QPRA 3IHBA 3IQAA 1PNEA 2P04A 3NDGA 1DJAA 1XA7A 4WBGA 4OOYA 4WYYA 4D60A 4MDZA 1K55A 3NOTC 4GOGA 3IHAA 5DTSA 1NJ4A 1M40A 5GLBA 1EW0A 2WGIA 3SS5A 4BD0A 5HWTA 2J9PA 4QB8A 1YMXA 1BLCA 3BECA 2BASA 3CUEA 4FTXA 2V1BA 4JPMA 3SOIA 3UPNA 4OQGA 1Y4OA 3A3EA 3JVUA 5CHMA 1P0ZA 2VGKA 5HD5A 5F6AA 2H28A 4MEZA 4PKYG 3IXBA 2A3UA 3RFBA 1GCEA 2QYBA 3PHYA 1ZTUA 2HDQA 3LIDA 3C2WA 4GD6A 2QMIA 2EX2A 4BLMA 3C8CA 3TJZC 5AVFA 3ULFA 2JKRM 1YSQA 3VP4A 1HLUP 4O8GA 3I7JA 3V3RA 4R3BA 3FKWA 5GLAA 4JLFA 4RX3A 1K25A 2ZQCA 2PT7A 3RTYA 2KLIA 5EVLA 4ETZA 3P09A 5IHVA 2ZQ9A 3O88A 1IYPA 5EOEA 4KUKA 3G2YA 3HLGA 1OT6A 2V0WA 5HPIA 5IU1A 4JKTA 1UGUA 3A0SA 2OLUA 1FR6A 3BLMA 3C5AA 4X1LA 3LEQA 3HJKA 4M4XA 5F82A 2Q0OA 2W3GA 3UB5P 3VOYA 3A3JA 1DY6A 3HUOA 3T1RA 1IYSA 3E2KA 3PYPA 5DKKA 3LYXA 3U4LP 3KO6A 2XRNA 1YMSA 1J3WA 4LLOB 3T1SA 1IYOA 2GNXA 4XUXA 1VHMA 3MFXA 3HJIA 4E3LA 2Y2OA 1MBLA 4HEFA 5HDDA 2WKHA 2HV1A 1S1YA 3FYZA 4MLLA 3T50A 1VB6A 2A24B 4XT2B 4E3IA 4O01A 2VGJA 2QWSA 4KZ9A 3HLWA 3GTCA 5FAQA 2Z6DA 4OONA 1NRJA 4BENA 1WYCA 3H82A 1H8YA 1N9OA 4GHIA 3MQQA 4HIAA 1YM1A 1FSYA 4UAAA 2PYRA 3GV9A 1W63Q 2VJWA 5CHJA 3F1NB 2FZ0A 4JF4A 2R9WA 4PMAA 1FCOA 5L2FA 1FSWA 1T19A 3EQVA 1G6AA 4X1MA 2WZZA 4MN5A 5CHUA 1KVMA 5J7EA 4HJ4A 4IEDA 2XSSA 4JXVA 5HX9A 5JYOA 1H3QA 3V5MA 1XGJA 4X55A 1XGIA 2LB5A 3CG5A 3H7WA 2O99A 1ES5A 4OP8A 3ZGAB 4Y0OA 2Y4AA 2HP5A 3UE6A 1YPRA 4LRYC 2Y2KA 4JF5A 1ES3A 4I39A 5FSRA 3TRCA 4CQHA 3UDXA 4IVIA 3UN7A 2JKFA 1BYWA 3FZCA 1G28A 3D4FA 4EXOA 5DFYA 2WAEA 3OC2A 5EOOA 3HLEA 4S2LA 5CEDA 2G2WA 4DKIA 2XROA 2D02A 4EW7A 3VV4A 1ESUA 5CTNA 1ALQA 4QWOA 3NJAA 3GVBA 4ARZA 3DTKA 1YLTA 3QP2A 3D72A 2JKTM 3BLSA 3C7UA 4NXGA 3ZG9B 4OOLA 4ZAMA 2PR6A 3PBSA 1DRMA 1GSXA 2Y2LA 2WADA 2ZM8A 3IF6A 3H82B 1EWZA 3WS1A 4GD8A 1K4FA 2W27A 3WS5A 2Y2GA 5AJGA 5DF9A 3AGDA 3L7HA 4Y13A 2ZQAA 3V3SA 1PRQA 2ZLYA 4DXBA 1RCJA 1DP9A 3DBAA 4QD4A 3WS0A 1XJ2A 2WYXA 4P6ZM 2A2LA 4F3LA 3NDEA 2AVXA 2WKIA 4N9LA 2GX5A 4LRXC 3UE3A 4N92A 4KG5A 2ZMVA 5CXWA 4LV1A 1F98A 5FI2A 3EEHA 1SKOA 3T1XA 4P0MA 1PW8A 2Y79A 1K54A 4Y15A 2VX8A 3O3VA 3D3OA 4WEJA 4S2NC 5EE8A 3KYQA 4E3JA 1H8ZA 5HAPA 4S2OA 4Y2FA 1BULA 1S1ZA 2L0WA 3PTEA 1OTEA 2UWXA 3LR4A 2OV5A 5HAQA 1FQGA 3UMDA 1K0KA 2ZQDA 3T1QB 4OP5A 1TS7A 4GDNA 3S7QA 2PBYA 4BBVA 3BFEA 4KQDA 3EOIA 5I5LA 1IYQA 2HDSA 4QHCA 4Z9QA 3LR0A 5FQKA 1K54C 1QMEA 3P01A 1LLBA 3WWXA 4X69A 1F5MA 2V8CA 3G30A 4LCMA 2OSUA 4MN6A 1K57A 4NK3A 5CGSA 3WRZA 4EUVA 4JF6A 4L9GA 1K56A 2WKQA 3WS4A 4IVKA 4WN5A 4QY6A 5FEGA 1LI0A 2WGVA 3UDIA 3C30A 2J8YA 1PZPA 1XPBA 3QNBA 3S4XA 4C75A 3Q7VB 2VV8A 2W3HA 3ITBA 3Q82A 3M2JA 4Y7PA 2X71A 4HP4A 4EWFA 1PWCA 4WZ4A 4HNBA 5CGXA 2WZXA 1VQQA 5A91A 4RVAA 1V9ZA 2H0TA 3HCYA 4S2JA 4KQOA 5MC7A 2VV7A 1W8QA 5HPFA 4LCLA 5FL3A 1BLPA 3LIEA 2P74A 1TS8A 3C38A 3T4OA 1CQAA 5FATA 3ZNYA 5FEFA 3W8KA 1SZVA 3F1PA 3PBRA 2VGLM 2PD8A 4G3VA 1TS6A 2PDRA 1FCMA 2HJ9C 2EFXA 3D9YA 3UNWA 1RGZA 5HDCA 3B42A 4CJNA 3H9WA 1NY0A 3MSHA 1YLPA 2OAP1 4BBUA 2MJ6A 5TJJA 5FAOA 2HDUA 2Q9NA 5E43A 3M2KA 1Y54A 3VOLA 4CLCA 3DTEA 1E4DA 4HH2A 1WE4A 2L4RA 2DRWA 3GQZA 5GHYA 1KGFA 5J8XA 1HD8A 4NXFA 4H6JA 2EX8A 3OPLA 4YNRA 1DP6A 4ID4A 2DCFA 4DJ2A 5HARA 3UO9A 2KDKA 4OOMA 2RL3A 4DXCA 1RGYA 2ZM0A 1PYYA 1FCNA 5I94A 3RXXA 1SKFA 3UMEA 2Y2MA 3OOVA 1D06A 3HL9A 4R3JA 3KYZA 3IT9A 2M1CA 5KMWA 3QP1A 4R4SA 2J9OA 3E4QA 1EROA 2ZC4B 5E2EA 1JVJA 2ZC5B 4WL9A 3MKFA 4EESA 1XP4A 5L07A 3ITAA 3O86A 1RP5A 2ZM2A 3KSFA 2EX9A 2H10A 2K2NA 5F1FA 4WEKA 3IF5A 3NBLA 1K6RA 2O0YA 2OLVA 3OZHA 3G2ZA 3RH8B 2JKTI 4OQ0A 3Q81A 4KUOA 4N1HA 2XD1A 4HJ6A 2X01A 4LV2A 2C5WB 3TG9A 3Q7ZA 1T1BA 2PHYA 5GLCA 1JTGA 3VFHA 3LICA 2E8IA 4XT2A 5AQ7A 3HVFA 4YINA 2PR5A 4UQIM 4X68A 3EEAA 4EBNA 1XX2A 5LBRA 4NG2A 2VLGA 4GZBA 2JE5A 3VOZA 2OWHA 1PFLA 3ZVWA 4MN7A 5G4YA 3P98A 1E3UD 5C5KA 3LCEA 3MKEA 3IX8A 4KG6A 1YLZA 1G6OA 4R3AA 4GNUA 4OQHA 3B3XA 3E98A 3K3DA 1S67L 2Y2HA 3CHWP 2XLNA 4P87A 4H6JB 4EQIA 1ZC2A 4FCFA 1TDGA 2PYPA 2V0UA 3IX4A 3ICYA 4L9EA 3CZDA 4PM9A 3M6BA 5EVID 1O7EA 2W0NA 2WUQA 4ZRRA 1ODVA 4MBFA 3UB7A 4D2OA 2XK1A 3ZG7B 2FH5A 1L0GA 2Y2JA 4EEPA 2W3FA 3ZCZA 1TS0A 2ZQ8A 2B95A 1K57C 1YKDA 4R1GA 3UY6A 1L0EA 4C6YA 3MS6A 1YQSA 4NEED 1CEFA 4JGRA 2ZD8A 3PBQA 5M1AA 5JYPA 2IWDA 3OLOA 1U60A 3CMZA 2H0YA 4HHDA 5FI6A 1L3LA 2Y2PA 2XFSA 4U0TA 2HP9A 3S1YA 3LFVA 3VP0A 3C4PA 3LY4A 3MBZA 5EUAA 3LR5A 4HI4A 2FFFB 2PRFA 4HBTA 4QY5A 3R7WA 5KSHA 4EBPA 5J4EA 1TF1A 3LGOA 2V2FF 3MQ0A 1W7FA 1H5XA 1K6SA 2K7SA 3TW8A 1AWIA 3T4TA 3V39A 3ZVTA 1J9MA 3CITA 4XXRA 2ZC7A 3G4PA 5EVIA 3VSLA 1LI9A 5HZHA 3JVVA 1V9YA 3IF6C 3A0RA 1MWSA 2BG1A 1WYBA 5EECA 3CJMA 3QHYA 5DKLA 1ES2A 3CUEC 5EVEA 1I2SA 1LHYA 3N6IA 3SW1A 1IOUA 4IUHA 4R0QA 3B33A 3LIBA 5EVIC 4EU0A 1GHIA 1XJ3A 1O07A 3NCKA 3BFCA 2ZQ7A 1MXOA 3K2NA 4DDSA 3ZQ5A 4GN2A 5HW3A 2XD5A 3HREA 3SS4A 1NWZA 4HH3A 2HP6A 3DWKA 2M7VA 3RJUA 3MZFA 2XQZA 3ZDJA 1XFQA 1BZAA 3KYEA 4I5SA 4PPRA 5FASA 3T4JA 2EFUA 1P97A 4JGOA 1F2KA 1DP8A 1A0KA 3ZG0A 2VA0A 1TEMA 1VETA 1W5DA 3DTMA 4P6ZS 4WMCA 4BMWA 2WKRA 2G7UA 2XGNA 3V67A 1YLYA 3G32A 2X02A 5KSCA 3IWIA 1ESIA 2WGWB 4IHQA 1MWUA 4KQRA 4OH0A 4S2NA 2L1MA 3MZDA 3KSHA 1W63M 4UQIS 3HUNA 3BM6A 3NOUC 1K38A 5A93A 2P9VA 3LY3A 3C4OA 4ZJ3A 4FUWA 1KE4A 2UV0E 3WS2A 4ME4A 3Q1FA 3T12B 4HQAA 1NRFA 3HUMA 1JWVA 2BLSA 4E3MA 3UPOA 1N9BA 5IS1A 3BY9A 1CEGA 3W4PA 3BWLA 2JKGA 4S2KA 3N8LA 5FA7A 2E8JA 3P7NA 5DF8A 3T4SA 2ZOHA 5GL9A 4KQQA 3GR2A 2O9BA 4DMZA 4FH4A 2XA7S 3AGEA 4R23A 3FWLA 2VKSA 5KIZA 5A8BA 1D7EA 3TE8A 4YWZA 1OJGA 3S22A 1KDSA 4JXWA 3LIAA 4KZ8A 1W8YA 5CRFA 5DF7A 3NOPC 2O9AA 4RA7A 3EQUA 4Z1WA 3IF6B 1LL9A 1IEMA 3F1OA 4KZ5A 4ZTKA 1YLJA 4GS9B 4G3WA 1SDEA 2FFYA 2J3TC 4WLAA 4F3LB 1PWDA 5EVIB 1TD5A 1DJBA 1NYMA 3VSKA 1T18A 3MXRA 3LO7A 1LSXA 4CPKA 1SCWA 1G68A 1S66L 4B9OA 2Z2LB 4LRZE 3UB9A 4OPRA 1AXBA 1PZOA 4WZ5C 3V50A 2QPNA 4OPZA 4JXSA 4RQ9A 1S6RA 4LV0A 4O0PA 4WMCD 3CWFA 2NUTC 3A3FA 3L9KA 4DF6A 4PM6A 4JGQA 2P9VB 1L0DA 2XEPA 2V1ZA 3LUQA 1MPLA 5F83A 3FKVA 3IH9A 5DTTA 5A92A 3VE3A 1QMFA 1I5QA 2EWWA 5AQBA 2P08A 2QJ7A 2Y91A 5D3OA 4X53A 1NZOA 2H5SA 4I38A 4CLCE 2M7UA 5E2FA 2EX6A 2Z6CA 5A90A 3OBFA 3PBOA 2PAVP 2J3TD 4EEUA 4P85A 5HL6A 4E3OA 3VP1A 4II7A 3IWOA 2V8FA 1GSWA 4DE3A 2R78A 4R38A 3DAVA 5M18A 3VP3A 5FI7A 5HAIA 1XXMA 2D01A 3NULA 1MKIA 2XF3A 2Y2IA 3N8SA 4ZBEA 1HZOA 2K31A 1CF0A 4Y17A 2ZL1B
chains in the Genus database with same CATH topology
2Y2KA 4MBKA 4JF5A 4R4RA 1ES3A 4KZ6A 4GZBA 2GDNA 2IWBA 2JE5A 1C3BA 2PU2A 1PW1A 5FSRA 3VOZA 4EUZA 3GMWA 3SH7A 3UDXA 4IVIA 3UN7A 3ZVWA 3OPHA 4S2PA 3P98A 1E3UD 3LCEA 1GHPA 3MKEA 4KENB 5FAPA 4KG6A 2JBFA 5FQQA 3FZCA 3SS3A 4OKPA 1YLZA 3D4FA 2Y2QA 1KE3A 5CTMA 3VFFA 1NZUA 4GNUA 4KG2A 4DDYA 2XH9A 3SH8A 4OQHA 3B3XA 4UA6A 1KDWA 4X56A 1BUEA 2WAEA 2Y2HA 4OQIA 3OC2A 2XLNA 4P87A 4EQIA 1ZC2A 4FCFA 1TDGA 3BFGA 3PAEA 3TOIA 5EOOA 4PM5A 3HLEA 3IXHA 4S2LA 1IKGA 3BYDA 5G18A 3HLBA 2ZC3B 3CZDA 4GDBA 4PM9A 4DE0A 5CEDA 3M6BA 5EVID 1PWGA 1O7EA 2WUQA 2G2WA 4DKIA 3VMAA 1CI9A 4MBFA 4D2OA 5HFOA 5FQ9A 3NC8A 2XK1A 3ZG7B 1L0GA 3GSGA 4Y0UA 3OCLA 4O7DA 1ESUA 1GHMA 5CTNA 1ALQA 3G31A 1PIOA 1CI8A 2Y2JA 3GVBA 3ZCZA 1JWZA 2HPBA 3N8RA 2ZQ8A 4WZ5A 1K57C 4R1GA 3UY6A 1L0EA 4C6YA 1YLTA 1YQSA 1L0FA 1CEFA 4MBHA 3BLSA 3C7UA 3ZG9B 1VM1A 2ZD8A 3PBQA 5M1AA 3AGFA 2IWDA 4ZJ2A 5JYPA 4OOLA 4ZAMA 4RYEA 2R9XA 3PBSA 4OVDA 1U60A 4WM9A 3CMZA 3JYIA 5E2HA 2H0YA 5FI6A 4B88A 5HL1A 4OPQA 3HLCA 3OPPA 4DE1A 3BFDA 2Y2LA 2Y2PA 2WADA 2ZM8A 2EXBA 3IF6A 4JXGA 2XFSA 4U0TA 4OLDA 1EWZA 3WS1A 2HP9A 3S1YA 3VP0A 2I72A 2WGWA 4FSFA 3C4PA 4GD8A 4MNRA 1K4FA 4S2IA 3GRJA 3LY4A 3MBZA 5EUAA 3WS5A 2Y2GA 1XA1A 2FFFB 2J7VA 3AGDA 1ZG6A 5DF9A 5U47A 4HBTA 2CC1A 4QY5A 3Q7VA 1I2WA 5KSHA 4EBPA 1JTDA 2ZQAA 3V3SA 2QZ6A 2V2FF 1DJCA 3HBRA 4FH2A 1W7FA 5GHZA 5BOHA 1H5XA 1K6SA 2ZLYA 4DXBA 1RCJA 4U3TA 4QD4A 1EI5A 4KZ7A 5AQ9A 3V39A 4UA9A 3OPRA 3WS0A 4LV3A 3ZVTA 2WYXA 3O87A 1J9MA 2ZC6B 4XXRA 2WK0A 3NDEA 2ZC7A 3UE1A 3G4PA 4EBLA 4BJPA 5EVIA 2WKIA 3HLDA 2Q9MA 4N9LA 4WELA 5CERA 3VSLA 3UE3A 4KZ4A 4N92A 1LI9A 1PI5A 4KG5A 3IXGA 5CXWA 4LV1A 3IF6C 1NXYA 1MWSA 1E25A 2BG1A 1WYBA 5FI2A 3CJMA 4QU3A 5EECA 3HLFA 3QHYA 4E6WA 4LENA 4P0MA 4PM7A 1PW8A 3A3IA 1NYYA 4HBUA 1MWTA 1ES2A 1Z6FA 4UA7A 1MWRA 1L2SA 1IELA 3MXSA 4FD8A 2JCHA 1I2SA 1LHYA 3N6IA 1GA9A 3N4IA 3OCNA 5FQJA 1K54A 1JWPA 3O3VA 4WEJA 4S2NC 4R0QA 5CEBA 1BTLA 3NIAA 3NY4A 5EE8A 5EVIC 1GHIA 4E3JA 1BLHA 1H8ZA 4S2OA 5CECA 1O07A 5HAPA 3NCKA 3BFCA 1BULA 3VP2A 4E3NA 4DE2A 3ISGA 1MY8A 2ZQ7A 1MXOA 1W79A 3PTEA 4DDSA 4GN2A 1N4OA 2UWXA 4EV4A 4B4XA 4K91A 3BFFA 3NI9A 4U0XA 2OV5A 3LEZA 2G2UA 1FQGA 5HAQA 5HW3A 2XD5A 3C7VA 4IBXA 3HREA 3SS4A 3PBTA 2ZQDA 3ZG8B 2HP6A 3MZEA 4OP5A 1BSGA 3DWKA 4X6TA 4GDNA 2PBYA 3RJUA 3MZFA 2XQZA 1LL5A 4B4ZA 4BL2A 3ZDJA 3BFEA 1BZAA 1TDLA 3RXWA 1KE0A 1XKZA 1KGGA 5FQMA 5TGFA 4PPRA 5FASA 1IYQA 1HVBA 4K0XA 2EFUA 2HDSA 4Q8IA 4GB7A 4QHCA 4Z9QA 1K55C 4OPYA 5FQKA 1K54C 3ZNTA 1K56D 5DVAA 3IHBA 3ZG0A 3IQAA 1QMEA 3QNCA 3A3DA 1LLBA 3NDGA 3WWXA 1DJAA 1XA7A 4WBGA 4X69A 1TEMA 4OOYA 5FQIA 3G30A 1W5DA 2DNSA 4WYYA 3DTMA 4LCMA 4WMCA 2OSUA 5DTKA 4QJGA 3MFDA 1K55A 1K57A 2XGNA 1YLYA 3G32A 2X02A 4NK3A 5KSCA 5CGSA 3IWIA 4GOGA 3IHAA 1ESIA 2WGWB 5DTSA 4BQMA 1NJ4A 3WRZA 1MWUA 4KQRA 4OH0A 4S2NA 1M40A 1BLSA 5GLBA 3MZDA 4JF6A 5TR7A 4K0WA 3SH9A 1K56A 4BD1A 3WS4A 4IVKA 1ZKJA 2WGIA 2Y59A 3SS5A 4QY6A 4BD0A 2J9PA 4QB8A 3HUNA 1YMXA 1BLCA 1LI0A 3BECA 2WGVA 3BM6A 3UDIA 3IXDA 3E2LA 4JPMA 2RCXA 3SOIA 3UPNA 4OQGA 1K38A 2J8YA 5A93A 3A3EA 1PZPA 1XPBA 2P9VA 3QNBA 2IWCA 3G34A 5TFQA 3S4XA 5KZHA 3LY3A 3C4OA 4C75A 5CHMA 3Q7VB 3DW0A 2VGKA 4ZJ3A 4H8RA 1KE4A 4MEZA 3ITBA 3WS2A 3Q1FA 3IXBA 2A3UA 4NETA 2XR0A 1NRFA 3IWQA 3Q82A 3M2JA 4Y7PA 4ZJ1A 3HUMA 1GCEA 2X71A 4EWFA 1JWVA 1PWCA 2C6WB 4WZ4A 4M3KA 2HDQA 5CGXA 2WZXA 1VQQA 1ES4A 2BLSA 4RVAA 5A91A 4E3MA 3UPOA 1N9BA 2H0TA 4GD6A 4S2JA 5AQAA 3WRTA 4KQOA 2QMIA 2EX2A 1ZG4A 4BLMA 1CEGA 4E6XA 3W4PA 4S2KA 1W8QA 3N8LA 5FA7A 1ERMA 4LCLA 2WAFA 4XUZA 5GHXA 1BLPA 3DWZA 3VP4A 2P74A 5DF8A 3FV7A 3I7JA 3V3RA 3PBNA 5GL9A 4R3BA 4KQQA 3GR2A 3FKWA 2XFTA 5FATA 3UDFA 3ZNYA 4HESA 5GLAA 4JLFA 4RX3A 3W8KA 1K25A 2ZQCA 1K4EA 2EXAA 3BRMA 3PBRA 4P6BA 4L0LA 4FH4A 1ONGA 3AGEA 2PU4A 5EVLA 1FCMA 4R23A 4DRTA 2Y2NA 3P09A 3FWLA 2ZQ9A 2EFXA 3O88A 5IHVA 1IYPA 5EOEA 1HTZA 1YLWA 3G2YA 3G35A 3HLGA 2B5RA 3S22A 3UNWA 1KDSA 4JXWA 4RX2A 1RGZA 4CJNA 4KZ8A 1W8YA 2A49A 5CRFA 5DF7A 4JKTA 1SHVA 4RA7A 3EQUA 1NY0A 2OLUA 3BEBA 3IF6B 1LL9A 1YLPA 1FR6A 1IEMA 4KZ5A 1S0WA 4ZTKA 1FR1A 5FAOA 3BLMA 3C5AA 1TVFA 2HDUA 2Q9NA 1IKIA 1YLJA 5F82A 5E43A 3M2KA 1YT4A 1Y54A 4KZ3A 3VOYA 1KGEA 3A3JA 4BL3A 1SDEA 2FFYA 4GKUA 1DY6A 3HUOA 1E4DA 1PWDA 1IYSA 3E2KA 4KZBA 5EVIB 1WE4A 1DJBA 1NYMA 4S2MA 3VSKA 3MXRA 3LO7A 1Q2QA 1YMSA 2DRWA 4CPKA 3GQZA 3UPPA 1SCWA 5GHYA 4OLGA 1IYOA 4F94A 1KGFA 5J8XA 1G68A 1HD8A 1OMEA 4XUXA 2Z2LB 4E3LA 2EX8A 3OPLA 1AXBA 4OPRA 1PZOA 3Q07A 2Y2OA 4UHUA 4WZ5C 1MBLA 5FDHA 3V50A 2QPNA 4ID4A 4OPZA 4JXSA 2DCFA 1SDNA 1S6RA 4LV0A 5HARA 3UO9A 4HEFA 4OOMA 2RL3A 4WMCD 4DXCA 1RGYA 2HDRA 2WKHA 2ZM0A 1PYYA 1FCNA 4N1XA 5I94A 3RXXA 3A3FA 1SKFA 3FYZA 1GA0A 2Y2MA 4DF6A 4PM6A 4MLLA 3HL9A 2P9VB 4E3KA 2XDMA 1L0DA 4R3JA 4E3IA 2XEPA 2V1ZA 2VGJA 1MPLA 2ZJ9A 3IT9A 3M6HA 4KZ9A 1CK3A 5F83A 5KMWA 2JC7A 3FKVA 3IH9A 5DTTA 5F1GA 5A92A 4Y0TA 5GLDA 1QMFA 4R4SA 3ZHHA 3HLWA 1ONHA 2J9OA 1I5QA 3GTCA 5FAQA 5AQBA 1EROA 2ZC4B 4OONA 1JVJA 2ZC5B 5E2EA 3MKFA 4BENA 1WYCA 3ZFZA 2Y91A 1BT5A 4X53A 1H8YA 5D3OA 1NZOA 2H5SA 1XP4A 5E2GA 3ITAA 3O86A 1RP5A 2ZM2A 2Z2MB 4C3QA 3IH8A 3TSGA 5EPHA 1YM1A 4JBFA 5E2FA 1FSYA 4UAAA 1KVLA 2EX9A 2EX6A 2H10A 2WKEA 3GV9A 5F1FA 5CGWA 5M19A 4WEKA 4IBRA 3IF5A 3NBLA 1PI4A 1K6RA 2OLVA 2Y55A 5CHJA 3OZHA 3G2ZA 5A90A 4A5RA 3PBOA 4OQ0A 3Q81A 4JF4A 2R9WA 4N1HA 4P85A 4PMAA 2XD1A 4E3OA 1FCOA 3VP1A 3IWOA 5L2FA 1FSWA 2X01A 3ZG5A 4LV2A 2C5WB 3EQVA 1ERQA 1G6AA 4DE3A 2WZZA 3TG9A 5CHUA 4N9KA 3Q7ZA 5M18A 3VP3A 1KVMA 4IEDA 5FI7A 5HAIA 5GLCA 1JTGA 3VFHA 1XXMA 1Q2PA 4JXVA 5HX9A 5JYOA 4YFMA 3UE0A 2V20A 3N7WA 2E8IA 3V5MA 1MKIA 4PM8A 1XGJA 2XF3A 2Y2IA 1XGIA 3N8SA 4X55A 4ZBEA 3PAGA 5AQ7A 3CG5A 1E3UA 3HVFA 4YINA 3W4QA 1M6KA 4ZDXA 1HZOA 1ES5A 4X68A 4OP8A 3ZGAB 4KZAA 4Y0OA 2ZMAA 2Y4AA 3W4OA 4EBNA 1XX2A 2HP5A 1FOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y2K A;  4MBK A;  4JF5 A;  4R4R A;  1ES3 A;  4KZ6 A;  4GZB A;  2GDN A;  2IWB A;  2JE5 A;  1C3B A;  2PU2 A;  1PW1 A;  5FSR A;  3VOZ A;  4EUZ A;  3GMW A;  3SH7 A;  3UDX A;  4IVI A;  3UN7 A;  3ZVW A;  3OPH A;  4S2P A;  3P98 A;  1E3U D;  3LCE A;  1GHP A;  3MKE A;  4KEN B;  5FAP A;  4KG6 A;  2JBF A;  5FQQ A;  3FZC A;  3SS3 A;  4OKP A;  1YLZ A;  3D4F A;  2Y2Q A;  1KE3 A;  5CTM A;  3VFF A;  1NZU A;  4GNU A;  4KG2 A;  4DDY A;  2XH9 A;  3SH8 A;  4OQH A;  3B3X A;  4UA6 A;  1KDW A;  4X56 A;  1BUE A;  2WAE A;  2Y2H A;  4OQI A;  3OC2 A;  2XLN A;  4P87 A;  4EQI A;  1ZC2 A;  4FCF A;  1TDG A;  3BFG A;  3PAE A;  3TOI A;  5EOO A;  4PM5 A;  3HLE A;  3IXH A;  4S2L A;  1IKG A;  3BYD A;  5G18 A;  3HLB A;  2ZC3 B;  3CZD A;  4GDB A;  4PM9 A;  4DE0 A;  5CED A;  3M6B A;  5EVI D;  1PWG A;  1O7E A;  2WUQ A;  2G2W A;  4DKI A;  3VMA A;  1CI9 A;  4MBF A;  4D2O A;  5HFO A;  5FQ9 A;  3NC8 A;  2XK1 A;  3ZG7 B;  1L0G A;  3GSG A;  4Y0U A;  3OCL A;  4O7D A;  1ESU A;  1GHM A;  5CTN A;  1ALQ A;  3G31 A;  1PIO A;  1CI8 A;  2Y2J A;  3GVB A;  3ZCZ A;  1JWZ A;  2HPB A;  3N8R A;  2ZQ8 A;  4WZ5 A;  1K57 C;  4R1G A;  3UY6 A;  1L0E A;  4C6Y A;  1YLT A;  1YQS A;  1L0F A;  1CEF A;  4MBH A;  3BLS A;  3C7U A;  3ZG9 B;  1VM1 A;  2ZD8 A;  3PBQ A;  5M1A A;  3AGF A;  2IWD A;  4ZJ2 A;  5JYP A;  4OOL A;  4ZAM A;  4RYE A;  2R9X A;  3PBS A;  4OVD A;  1U60 A;  4WM9 A;  3CMZ A;  3JYI A;  5E2H A;  2H0Y A;  5FI6 A;  4B88 A;  5HL1 A;  4OPQ A;  3HLC A;  3OPP A;  4DE1 A;  3BFD A;  2Y2L A;  2Y2P A;  2WAD A;  2ZM8 A;  2EXB A;  3IF6 A;  4JXG A;  2XFS A;  4U0T A;  4OLD A;  1EWZ A;  3WS1 A;  2HP9 A;  3S1Y A;  3VP0 A;  2I72 A;  2WGW A;  4FSF A;  3C4P A;  4GD8 A;  4MNR A;  1K4F A;  4S2I A;  3GRJ A;  3LY4 A;  3MBZ A;  5EUA A;  3WS5 A;  2Y2G A;  1XA1 A;  2FFF B;  2J7V A;  3AGD A;  1ZG6 A;  5DF9 A;  5U47 A;  4HBT A;  2CC1 A;  4QY5 A;  3Q7V A;  1I2W A;  5KSH A;  4EBP A;  1JTD A;  2ZQA A;  3V3S A;  2QZ6 A;  2V2F F;  1DJC A;  3HBR A;  4FH2 A;  1W7F A;  5GHZ A;  5BOH A;  1H5X A;  1K6S A;  2ZLY A;  4DXB A;  1RCJ A;  4U3T A;  4QD4 A;  1EI5 A;  4KZ7 A;  5AQ9 A;  3V39 A;  4UA9 A;  3OPR A;  3WS0 A;  4LV3 A;  3ZVT A;  2WYX A;  3O87 A;  1J9M A;  2ZC6 B;  4XXR A;  2WK0 A;  3NDE A;  2ZC7 A;  3UE1 A;  3G4P A;  4EBL A;  4BJP A;  5EVI A;  2WKI A;  3HLD A;  2Q9M A;  4N9L A;  4WEL A;  5CER A;  3VSL A;  3UE3 A;  4KZ4 A;  4N92 A;  1LI9 A;  1PI5 A;  4KG5 A;  3IXG A;  5CXW A;  4LV1 A;  3IF6 C;  1NXY A;  1MWS A;  1E25 A;  2BG1 A;  1WYB A;  5FI2 A;  3CJM A;  4QU3 A;  5EEC A;  3HLF A;  3QHY A;  4E6W A;  4LEN A;  4P0M A;  4PM7 A;  1PW8 A;  3A3I A;  1NYY A;  4HBU A;  1MWT A;  1ES2 A;  1Z6F A;  4UA7 A;  1MWR A;  1L2S A;  1IEL A;  3MXS A;  4FD8 A;  2JCH A;  1I2S A;  1LHY A;  3N6I A;  1GA9 A;  3N4I A;  3OCN A;  5FQJ A;  1K54 A;  1JWP A;  3O3V A;  4WEJ A;  4S2N C;  4R0Q A;  5CEB A;  1BTL A;  3NIA A;  3NY4 A;  5EE8 A;  5EVI C;  1GHI A;  4E3J A;  1BLH A;  1H8Z A;  4S2O A;  5CEC A;  1O07 A;  5HAP A;  3NCK A;  3BFC A;  1BUL A;  3VP2 A;  4E3N A;  4DE2 A;  3ISG A;  1MY8 A;  2ZQ7 A;  1MXO A;  1W79 A;  3PTE A;  4DDS A;  4GN2 A;  1N4O A;  2UWX A;  4EV4 A;  4B4X A;  4K91 A;  3BFF A;  3NI9 A;  4U0X A;  2OV5 A;  3LEZ A;  2G2U A;  1FQG A;  5HAQ A;  5HW3 A;  2XD5 A;  3C7V A;  4IBX A;  3HRE A;  3SS4 A;  3PBT A;  2ZQD A;  3ZG8 B;  2HP6 A;  3MZE A;  4OP5 A;  1BSG A;  3DWK A;  4X6T A;  4GDN A;  2PBY A;  3RJU A;  3MZF A;  2XQZ A;  1LL5 A;  4B4Z A;  4BL2 A;  3ZDJ A;  3BFE A;  1BZA A;  1TDL A;  3RXW A;  1KE0 A;  1XKZ A;  1KGG A;  5FQM A;  5TGF A;  4PPR A;  5FAS A;  1IYQ A;  1HVB A;  4K0X A;  2EFU A;  2HDS A;  4Q8I A;  4GB7 A;  4QHC A;  4Z9Q A;  1K55 C;  4OPY A;  5FQK A;  1K54 C;  3ZNT A;  1K56 D;  5DVA A;  3IHB A;  3ZG0 A;  3IQA A;  1QME A;  3QNC A;  3A3D A;  1LLB A;  3NDG A;  3WWX A;  1DJA A;  1XA7 A;  4WBG A;  4X69 A;  1TEM A;  4OOY A;  5FQI A;  3G30 A;  1W5D A;  2DNS A;  4WYY A;  3DTM A;  4LCM A;  4WMC A;  2OSU A;  5DTK A;  4QJG A;  3MFD A;  1K55 A;  1K57 A;  2XGN A;  1YLY A;  3G32 A;  2X02 A;  4NK3 A;  5KSC A;  5CGS A;  3IWI A;  4GOG A;  3IHA A;  1ESI A;  2WGW B;  5DTS A;  4BQM A;  1NJ4 A;  3WRZ A;  1MWU A;  4KQR A;  4OH0 A;  4S2N A;  1M40 A;  1BLS A;  5GLB A;  3MZD A;  4JF6 A;  5TR7 A;  4K0W A;  3SH9 A;  1K56 A;  4BD1 A;  3WS4 A;  4IVK A;  1ZKJ A;  2WGI A;  2Y59 A;  3SS5 A;  4QY6 A;  4BD0 A;  2J9P A;  4QB8 A;  3HUN A;  1YMX A;  1BLC A;  1LI0 A;  3BEC A;  2WGV A;  3BM6 A;  3UDI A;  3IXD A;  3E2L A;  4JPM A;  2RCX A;  3SOI A;  3UPN A;  4OQG A;  1K38 A;  2J8Y A;  5A93 A;  3A3E A;  1PZP A;  1XPB A;  2P9V A;  3QNB A;  2IWC A;  3G34 A;  5TFQ A;  3S4X A;  5KZH A;  3LY3 A;  3C4O A;  4C75 A;  5CHM A;  3Q7V B;  3DW0 A;  2VGK A;  4ZJ3 A;  4H8R A;  1KE4 A;  4MEZ A;  3ITB A;  3WS2 A;  3Q1F A;  3IXB A;  2A3U A;  4NET A;  2XR0 A;  1NRF A;  3IWQ A;  3Q82 A;  3M2J A;  4Y7P A;  4ZJ1 A;  3HUM A;  1GCE A;  2X71 A;  4EWF A;  1JWV A;  1PWC A;  2C6W B;  4WZ4 A;  4M3K A;  2HDQ A;  5CGX A;  2WZX A;  1VQQ A;  1ES4 A;  2BLS A;  4RVA A;  5A91 A;  4E3M A;  3UPO A;  1N9B A;  2H0T A;  4GD6 A;  4S2J A;  5AQA A;  3WRT A;  4KQO A;  2QMI A;  2EX2 A;  1ZG4 A;  4BLM A;  1CEG A;  4E6X A;  3W4P A;  4S2K A;  1W8Q A;  3N8L A;  5FA7 A;  1ERM A;  4LCL A;  2WAF A;  4XUZ A;  5GHX A;  1BLP A;  3DWZ A;  3VP4 A;  2P74 A;  5DF8 A;  3FV7 A;  3I7J A;  3V3R A;  3PBN A;  5GL9 A;  4R3B A;  4KQQ A;  3GR2 A;  3FKW A;  2XFT A;  5FAT A;  3UDF A;  3ZNY A;  4HES A;  5GLA A;  4JLF A;  4RX3 A;  3W8K A;  1K25 A;  2ZQC A;  1K4E A;  2EXA A;  3BRM A;  3PBR A;  4P6B A;  4L0L A;  4FH4 A;  1ONG A;  3AGE A;  2PU4 A;  5EVL A;  1FCM A;  4R23 A;  4DRT A;  2Y2N A;  3P09 A;  3FWL A;  2ZQ9 A;  2EFX A;  3O88 A;  5IHV A;  1IYP A;  5EOE A;  1HTZ A;  1YLW A;  3G2Y A;  3G35 A;  3HLG A;  2B5R A;  3S22 A;  3UNW A;  1KDS A;  4JXW A;  4RX2 A;  1RGZ A;  4CJN A;  4KZ8 A;  1W8Y A;  2A49 A;  5CRF A;  5DF7 A;  4JKT A;  1SHV A;  4RA7 A;  3EQU A;  1NY0 A;  2OLU A;  3BEB A;  3IF6 B;  1LL9 A;  1YLP A;  1FR6 A;  1IEM A;  4KZ5 A;  1S0W A;  4ZTK A;  1FR1 A;  5FAO A;  3BLM A;  3C5A A;  1TVF A;  2HDU A;  2Q9N A;  1IKI A;  1YLJ A;  5F82 A;  5E43 A;  3M2K A;  1YT4 A;  1Y54 A;  4KZ3 A;  3VOY A;  1KGE A;  3A3J A;  4BL3 A;  1SDE A;  2FFY A;  4GKU A;  1DY6 A;  3HUO A;  1E4D A;  1PWD A;  1IYS A;  3E2K A;  4KZB A;  5EVI B;  1WE4 A;  1DJB A;  1NYM A;  4S2M A;  3VSK A;  3MXR A;  3LO7 A;  1Q2Q A;  1YMS A;  2DRW A;  4CPK A;  3GQZ A;  3UPP A;  1SCW A;  5GHY A;  4OLG A;  1IYO A;  4F94 A;  1KGF A;  5J8X A;  1G68 A;  1HD8 A;  1OME A;  4XUX A;  2Z2L B;  4E3L A;  2EX8 A;  3OPL A;  1AXB A;  4OPR A;  1PZO A;  3Q07 A;  2Y2O A;  4UHU A;  4WZ5 C;  1MBL A;  5FDH A;  3V50 A;  2QPN A;  4ID4 A;  4OPZ A;  4JXS A;  2DCF A;  1SDN A;  1S6R A;  4LV0 A;  5HAR A;  3UO9 A;  4HEF A;  4OOM A;  2RL3 A;  4WMC D;  4DXC A;  1RGY A;  2HDR A;  2WKH A;  2ZM0 A;  1PYY A;  1FCN A;  4N1X A;  5I94 A;  3RXX A;  3A3F A;  1SKF A;  3FYZ A;  1GA0 A;  2Y2M A;  4DF6 A;  4PM6 A;  4MLL A;  3HL9 A;  2P9V B;  4E3K A;  2XDM A;  1L0D A;  4R3J A;  4E3I A;  2XEP A;  2V1Z A;  2VGJ A;  1MPL A;  2ZJ9 A;  3IT9 A;  3M6H A;  4KZ9 A;  1CK3 A;  5F83 A;  5KMW A;  2JC7 A;  3FKV A;  3IH9 A;  5DTT A;  5F1G A;  5A92 A;  4Y0T A;  5GLD A;  1QMF A;  4R4S A;  3ZHH A;  3HLW A;  1ONH A;  2J9O A;  1I5Q A;  3GTC A;  5FAQ A;  5AQB A;  1ERO A;  2ZC4 B;  4OON A;  1JVJ A;  2ZC5 B;  5E2E A;  3MKF A;  4BEN A;  1WYC A;  3ZFZ A;  2Y91 A;  1BT5 A;  4X53 A;  1H8Y A;  5D3O A;  1NZO A;  2H5S A;  1XP4 A;  5E2G A;  3ITA A;  3O86 A;  1RP5 A;  2ZM2 A;  2Z2M B;  4C3Q A;  3IH8 A;  3TSG A;  5EPH A;  1YM1 A;  4JBF A;  5E2F A;  1FSY A;  4UAA A;  1KVL A;  2EX9 A;  2EX6 A;  2H10 A;  2WKE A;  3GV9 A;  5F1F A;  5CGW A;  5M19 A;  4WEK A;  4IBR A;  3IF5 A;  3NBL A;  1PI4 A;  1K6R A;  2OLV A;  2Y55 A;  5CHJ A;  3OZH A;  3G2Z A;  5A90 A;  4A5R A;  3PBO A;  4OQ0 A;  3Q81 A;  4JF4 A;  2R9W A;  4N1H A;  4P85 A;  4PMA A;  2XD1 A;  4E3O A;  1FCO A;  3VP1 A;  3IWO A;  5L2F A;  1FSW A;  2X01 A;  3ZG5 A;  4LV2 A;  2C5W B;  3EQV A;  1ERQ A;  1G6A A;  4DE3 A;  2WZZ A;  3TG9 A;  5CHU A;  4N9K A;  3Q7Z A;  5M18 A;  3VP3 A;  1KVM A;  4IED A;  5FI7 A;  5HAI A;  5GLC A;  1JTG A;  3VFH A;  1XXM A;  1Q2P A;  4JXV A;  5HX9 A;  5JYO A;  4YFM A;  3UE0 A;  2V20 A;  3N7W A;  2E8I A;  3V5M A;  1MKI A;  4PM8 A;  1XGJ A;  2XF3 A;  2Y2I A;  1XGI A;  3N8S A;  4X55 A;  4ZBE A;  3PAG A;  5AQ7 A;  3CG5 A;  1E3U A;  3HVF A;  4YIN A;  3W4Q A;  1M6K A;  4ZDX A;  1HZO A;  1ES5 A;  4X68 A;  4OP8 A;  3ZGA B;  4KZA A;  4Y0O A;  2ZMA A;  2Y4A A;  3W4O A;  4EBN A;  1XX2 A;  2HP5 A;  1FOF A; 
#chains in the Genus database with same CATH topology
 4MBK A;  4KZ6 A;  4GCZ A;  5L10 A;  3UB6 A;  2GDN A;  1C3B A;  3GMW A;  3A0V A;  3OPH A;  4S2P A;  1T1A A;  5EFW A;  5FAP A;  3SS3 A;  4OKP A;  2Y2Q A;  5CTM A;  1Z09 A;  2J3W A;  5CX7 A;  3SH8 A;  2DMW A;  3LI8 A;  5HD3 A;  4MMN A;  1KDW A;  4X56 A;  1BUE A;  3TOI A;  4CLC D;  3BFG A;  3BQ8 A;  2VEA A;  4LGW A;  4DN0 A;  1IKG A;  5G18 A;  2ZC3 B;  4DE0 A;  1PWG A;  3R4K A;  3VMA A;  4IUK A;  5FQ9 A;  3NC8 A;  3F1P B;  5F5Y A;  4JGP A;  5TBM A;  3G31 A;  1JWZ A;  4EER A;  2QHK A;  1VET B;  1L0F A;  4MBH A;  1LSW A;  4AFI A;  3AGF A;  4ZJ2 A;  3FPW A;  4WM9 A;  2W3E A;  5E2H A;  4B88 A;  5HL1 A;  4OPQ A;  3HLC A;  4X25 A;  2VGL S;  4ESP A;  4JXG A;  4OLD A;  1UWP X;  2I72 A;  4FSF A;  4MNR A;  1JNU A;  5HDS A;  4GS9 A;  3BQA A;  4FOF A;  1XA1 A;  2J7V A;  1ZG6 A;  5U47 A;  2CC1 A;  1I2W A;  5G4Z A;  2W3D A;  4BWI A;  1JTD A;  2LB9 A;  5EM1 A;  1DJC A;  5BOH A;  4WUJ A;  5AQ9 A;  1S4S A;  1XJ4 A;  2ZC6 B;  2WK0 A;  1VEU B;  4EBL A;  4BJP A;  2Q9M A;  4Y3I A;  5CER A;  2O9C A;  2W1R A;  5EM0 A;  3IS2 A;  3LIF A;  3QP6 A;  1MC0 A;  1E25 A;  3H7W B;  4QU3 A;  3U2A A;  3HLF A;  4LEN A;  4PM7 A;  3A3I A;  1NYY A;  4HBU A;  4UA7 A;  2W1T B;  2ZL1 A;  3MXS A;  2JCH A;  1GA9 A;  2Y8H A;  3OCN A;  1JWP A;  5DFX A;  3NIA A;  3NY4 A;  1OTI A;  4PHT A;  1BLH A;  4L9F A;  3VP2 A;  3ISG A;  3MF0 A;  1N4O A;  4B4X A;  2KOI A;  4GJ4 A;  4U0X A;  2G2U A;  3EGD C;  3B47 A;  3MZE A;  1BSG A;  5TBM B;  1LL5 A;  4EQ1 A;  4G3K A;  2VZW A;  2V1A A;  3RXW A;  3BW6 A;  1XKZ A;  3FC7 A;  5FQM A;  5TGF A;  3PR6 A;  3E4O A;  3QP5 A;  4Q8I A;  1N9N A;  3ZNT A;  1K55 C;  4OPY A;  1K56 D;  5DVA A;  3QNC A;  3A3D A;  5L8M A;  5FQI A;  2DNS A;  1P9W A;  5F68 A;  5DTK A;  4QJG A;  3MFD A;  4Y5F A;  4BQM A;  2CMN A;  4NXE A;  1BLS A;  5TR7 A;  4HOI A;  4K0W A;  3SH9 A;  1CJF A;  4BD1 A;  4Q0I A;  3EWK A;  1ZKJ A;  2Y59 A;  1OTD A;  3IXD A;  3E2L A;  2RCX A;  2GZA A;  3GDI A;  2HF6 A;  4PAU A;  2IWC A;  3G34 A;  3IBJ A;  3T4Q A;  5TFQ A;  4EET B;  5KZH A;  3DW0 A;  4H8R A;  3S7O A;  4NET A;  3W2Z A;  2XR0 A;  3FPV A;  2I9V A;  2ZBB A;  3IWQ A;  3MJQ A;  4ZJ1 A;  1OJ5 A;  2C6W B;  4GHI B;  4M3K A;  2BTF P;  1ES4 A;  3O5Y A;  3PXP A;  5AQA A;  3WRT A;  1ZG4 A;  2PD7 A;  4E6X A;  1ERM A;  5EV0 A;  2WAF A;  4XUZ A;  5GHX A;  3DWZ A;  3FV7 A;  1NLZ A;  1XFN A;  1N9L A;  3PBN A;  2XFT A;  4UEY A;  3UDF A;  5HWW A;  4HES A;  3T4K A;  1H8M A;  2QKP A;  1K4E A;  2EXA A;  3BRM A;  4P6B A;  4L0L A;  2B02 A;  1WA9 A;  1ONG A;  5DJU A;  1KOU A;  1H0M A;  3BJN A;  2PU4 A;  5FDS A;  2YKF A;  2Y2N A;  4DRT A;  4GLQ A;  4HY8 A;  1HTZ A;  1YLW A;  3IX3 A;  3EGX C;  3G35 A;  4LFU A;  2B5R A;  4RX2 A;  4MCW A;  2A49 A;  1SHV A;  3BY8 A;  3UB8 A;  1LT0 A;  5K5B A;  3BEB A;  5IT5 A;  1S0W A;  1FR1 A;  1TVF A;  3DTI A;  1IKI A;  2NUP C;  4HP9 A;  1YT4 A;  4KZ3 A;  1KGE A;  4BL3 A;  4GKU A;  4R6L A;  2YKH A;  1MZU A;  4KZB A;  5L09 A;  3ZYT A;  3S7P A;  4S2M A;  3MR0 A;  3QP8 A;  1Q2Q A;  3LR3 A;  3UPP A;  2B18 A;  4OLG A;  4F94 A;  1SKO B;  1OME A;  5J3W A;  3Q07 A;  1GSV A;  2W1T A;  4UHU A;  5FDH A;  1VEU A;  4WF0 A;  1SDN A;  1YSP A;  1Y28 A;  2HDR A;  1LSV A;  3CPT A;  3CI6 A;  4N1X A;  3IS2 B;  4I3I A;  1GA0 A;  4E3K A;  2QJ5 A;  2XDM A;  2ZJ9 A;  3M6H A;  1CK3 A;  2XA7 M;  2JC7 A;  5F1G A;  4Y0T A;  5GLD A;  3ZHH A;  1ONH A;  2EA9 A;  3T4L A;  4ETX A;  1FIL A;  1S4R A;  3ZFZ A;  1BT5 A;  3KX0 X;  4HJ3 A;  5HWV A;  5E2G A;  4LPZ A;  2Z2M B;  4C3Q A;  3IH8 A;  3TSG A;  5EPH A;  4JBF A;  2P7J A;  3E0Y A;  3LI9 A;  4Q0H A;  1KVL A;  2WKP A;  2WKE A;  5CGW A;  5M19 A;  4IBR A;  1PI4 A;  2Y55 A;  2OOL A;  4A5R A;  2JKR I;  3VE4 A;  3ZG5 A;  1ERQ A;  2HZ5 A;  4R70 A;  4N9K A;  1Q2P A;  4YFM A;  3UE0 A;  2V20 A;  3N7W A;  4PM8 A;  1FIK A;  1X0O A;  1F9I A;  3MQO A;  3PAG A;  1E3U A;  3W4Q A;  1G5U A;  1M6K A;  4ZDX A;  4KZA A;  2ZMA A;  3E4P A;  3W4O A;  3K3C A;  2ZOI A;  1FOF A;  2OWJ A;  4R4R A;  2JHE A;  2J80 A;  5AVE A;  2IWB A;  3S7N A;  2PU2 A;  1PW1 A;  4EUZ A;  3SH7 A;  3GEC A;  1IFQ A;  4IJG A;  1GHP A;  2ZMF A;  4KEN B;  5FQQ A;  2JBF A;  3MXQ A;  1KE3 A;  3VFF A;  1NZU A;  4KG2 A;  5F69 A;  4CLC C;  4DDY A;  2XH9 A;  4UA6 A;  4PKY A;  2GJ3 A;  3G6O A;  4OQI A;  3PAE A;  5DJT A;  4PM5 A;  3IXH A;  3BYD A;  3HLB A;  3R7W B;  4GDB A;  4K08 A;  3CPT B;  1CI9 A;  5HFO A;  3GSG A;  4Y0U A;  3OCL A;  4O7D A;  1GHM A;  1YAX A;  2V9A A;  1D1J A;  1PIO A;  1CI8 A;  3N8R A;  2HPB A;  4WZ5 A;  2HGV A;  4GW9 A;  2A24 A;  3KSI A;  4NXB A;  1VM1 A;  4RYE A;  2R9X A;  4OVD A;  3JYI A;  2OAQ 1;  2JN7 A;  3OPP A;  4NKP A;  3BFD A;  4DE1 A;  2VK3 A;  2EXB A;  5HSQ A;  1T1C A;  2WGW A;  4S2I A;  3GRJ A;  3QP4 A;  1STZ A;  4I3A A;  3Q7V A;  1MKM A;  1LL8 A;  3F1O B;  2QZ6 A;  3HBR A;  4FH2 A;  5GHZ A;  1OT9 A;  4U3T A;  1EI5 A;  3MMH A;  4KZ7 A;  4UA9 A;  3OPR A;  4LV3 A;  4BBT A;  3O87 A;  4ARZ B;  3UE1 A;  3NHQ A;  4I3J A;  1OPX A;  3HLD A;  4WEL A;  4KZ4 A;  1PI5 A;  3IXG A;  1XJ6 A;  3KSG A;  1NXY A;  2IA2 A;  4E6W A;  1MWT A;  1Z6F A;  1MWR A;  2PBD P;  1L2S A;  1IEL A;  4FD8 A;  3N4I A;  5FQJ A;  4Q0J A;  3IBR A;  4B93 A;  3NEC A;  5CEB A;  1BTL A;  1P9R A;  1UWN X;  5CEC A;  2EWV A;  4YOF A;  4E3N A;  4DE2 A;  1MY8 A;  1W79 A;  4EV4 A;  4K91 A;  1NLY A;  2ACG A;  3BFF A;  3CAX A;  3NI9 A;  3CLO A;  3JPU A;  3LEZ A;  3C7V A;  4IBX A;  1OTA A;  3PBT A;  3F1N A;  3ZG8 B;  3FG8 A;  4X6T A;  4E04 A;  4B4Z A;  4BL2 A;  4CLC B;  1TDL A;  4DJ3 A;  1ZHH B;  1KE0 A;  1KGG A;  2VV6 A;  2KX6 A;  1OTB A;  3SZT A;  4K0X A;  1HVB A;  1ACF A;  4GB7 A;  2HJE A;  2INW A;  4QPR A;  3IHB A;  3IQA A;  1PNE A;  2P04 A;  3NDG A;  1DJA A;  1XA7 A;  4WBG A;  4OOY A;  4WYY A;  4D60 A;  4MDZ A;  1K55 A;  3NOT C;  4GOG A;  3IHA A;  5DTS A;  1NJ4 A;  1M40 A;  5GLB A;  1EW0 A;  2WGI A;  3SS5 A;  4BD0 A;  5HWT A;  2J9P A;  4QB8 A;  1YMX A;  1BLC A;  3BEC A;  2BAS A;  3CUE A;  4FTX A;  2V1B A;  4JPM A;  3SOI A;  3UPN A;  4OQG A;  1Y4O A;  3A3E A;  3JVU A;  5CHM A;  1P0Z A;  2VGK A;  5HD5 A;  5F6A A;  2H28 A;  4MEZ A;  4PKY G;  3IXB A;  2A3U A;  3RFB A;  1GCE A;  2QYB A;  3PHY A;  1ZTU A;  2HDQ A;  3LID A;  3C2W A;  4GD6 A;  2QMI A;  2EX2 A;  4BLM A;  3C8C A;  3TJZ C;  5AVF A;  3ULF A;  2JKR M;  1YSQ A;  3VP4 A;  1HLU P;  4O8G A;  3I7J A;  3V3R A;  4R3B A;  3FKW A;  5GLA A;  4JLF A;  4RX3 A;  1K25 A;  2ZQC A;  2PT7 A;  3RTY A;  2KLI A;  5EVL A;  4ETZ A;  3P09 A;  5IHV A;  2ZQ9 A;  3O88 A;  1IYP A;  5EOE A;  4KUK A;  3G2Y A;  3HLG A;  1OT6 A;  2V0W A;  5HPI A;  5IU1 A;  4JKT A;  1UGU A;  3A0S A;  2OLU A;  1FR6 A;  3BLM A;  3C5A A;  4X1L A;  3LEQ A;  3HJK A;  4M4X A;  5F82 A;  2Q0O A;  2W3G A;  3UB5 P;  3VOY A;  3A3J A;  1DY6 A;  3HUO A;  3T1R A;  1IYS A;  3E2K A;  3PYP A;  5DKK A;  3LYX A;  3U4L P;  3KO6 A;  2XRN A;  1YMS A;  1J3W A;  4LLO B;  3T1S A;  1IYO A;  2GNX A;  4XUX A;  1VHM A;  3MFX A;  3HJI A;  4E3L A;  2Y2O A;  1MBL A;  4HEF A;  5HDD A;  2WKH A;  2HV1 A;  1S1Y A;  3FYZ A;  4MLL A;  3T50 A;  1VB6 A;  2A24 B;  4XT2 B;  4E3I A;  4O01 A;  2VGJ A;  2QWS A;  4KZ9 A;  3HLW A;  3GTC A;  5FAQ A;  2Z6D A;  4OON A;  1NRJ A;  4BEN A;  1WYC A;  3H82 A;  1H8Y A;  1N9O A;  4GHI A;  3MQQ A;  4HIA A;  1YM1 A;  1FSY A;  4UAA A;  2PYR A;  3GV9 A;  1W63 Q;  2VJW A;  5CHJ A;  3F1N B;  2FZ0 A;  4JF4 A;  2R9W A;  4PMA A;  1FCO A;  5L2F A;  1FSW A;  1T19 A;  3EQV A;  1G6A A;  4X1M A;  2WZZ A;  4MN5 A;  5CHU A;  1KVM A;  5J7E A;  4HJ4 A;  4IED A;  2XSS A;  4JXV A;  5HX9 A;  5JYO A;  1H3Q A;  3V5M A;  1XGJ A;  4X55 A;  1XGI A;  2LB5 A;  3CG5 A;  3H7W A;  2O99 A;  1ES5 A;  4OP8 A;  3ZGA B;  4Y0O A;  2Y4A A;  2HP5 A;  3UE6 A;  1YPR A;  4LRY C;  2Y2K A;  4JF5 A;  1ES3 A;  4I39 A;  5FSR A;  3TRC A;  4CQH A;  3UDX A;  4IVI A;  3UN7 A;  2JKF A;  1BYW A;  3FZC A;  1G28 A;  3D4F A;  4EXO A;  5DFY A;  2WAE A;  3OC2 A;  5EOO A;  3HLE A;  4S2L A;  5CED A;  2G2W A;  4DKI A;  2XRO A;  2D02 A;  4EW7 A;  3VV4 A;  1ESU A;  5CTN A;  1ALQ A;  4QWO A;  3NJA A;  3GVB A;  4ARZ A;  3DTK A;  1YLT A;  3QP2 A;  3D72 A;  2JKT M;  3BLS A;  3C7U A;  4NXG A;  3ZG9 B;  4OOL A;  4ZAM A;  2PR6 A;  3PBS A;  1DRM A;  1GSX A;  2Y2L A;  2WAD A;  2ZM8 A;  3IF6 A;  3H82 B;  1EWZ A;  3WS1 A;  4GD8 A;  1K4F A;  2W27 A;  3WS5 A;  2Y2G A;  5AJG A;  5DF9 A;  3AGD A;  3L7H A;  4Y13 A;  2ZQA A;  3V3S A;  1PRQ A;  2ZLY A;  4DXB A;  1RCJ A;  1DP9 A;  3DBA A;  4QD4 A;  3WS0 A;  1XJ2 A;  2WYX A;  4P6Z M;  2A2L A;  4F3L A;  3NDE A;  2AVX A;  2WKI A;  4N9L A;  2GX5 A;  4LRX C;  3UE3 A;  4N92 A;  4KG5 A;  2ZMV A;  5CXW A;  4LV1 A;  1F98 A;  5FI2 A;  3EEH A;  1SKO A;  3T1X A;  4P0M A;  1PW8 A;  2Y79 A;  1K54 A;  4Y15 A;  2VX8 A;  3O3V A;  3D3O A;  4WEJ A;  4S2N C;  5EE8 A;  3KYQ A;  4E3J A;  1H8Z A;  5HAP A;  4S2O A;  4Y2F A;  1BUL A;  1S1Z A;  2L0W A;  3PTE A;  1OTE A;  2UWX A;  3LR4 A;  2OV5 A;  5HAQ A;  1FQG A;  3UMD A;  1K0K A;  2ZQD A;  3T1Q B;  4OP5 A;  1TS7 A;  4GDN A;  3S7Q A;  2PBY A;  4BBV A;  3BFE A;  4KQD A;  3EOI A;  5I5L A;  1IYQ A;  2HDS A;  4QHC A;  4Z9Q A;  3LR0 A;  5FQK A;  1K54 C;  1QME A;  3P01 A;  1LLB A;  3WWX A;  4X69 A;  1F5M A;  2V8C A;  3G30 A;  4LCM A;  2OSU A;  4MN6 A;  1K57 A;  4NK3 A;  5CGS A;  3WRZ A;  4EUV A;  4JF6 A;  4L9G A;  1K56 A;  2WKQ A;  3WS4 A;  4IVK A;  4WN5 A;  4QY6 A;  5FEG A;  1LI0 A;  2WGV A;  3UDI A;  3C30 A;  2J8Y A;  1PZP A;  1XPB A;  3QNB A;  3S4X A;  4C75 A;  3Q7V B;  2VV8 A;  2W3H A;  3ITB A;  3Q82 A;  3M2J A;  4Y7P A;  2X71 A;  4HP4 A;  4EWF A;  1PWC A;  4WZ4 A;  4HNB A;  5CGX A;  2WZX A;  1VQQ A;  5A91 A;  4RVA A;  1V9Z A;  2H0T A;  3HCY A;  4S2J A;  4KQO A;  5MC7 A;  2VV7 A;  1W8Q A;  5HPF A;  4LCL A;  5FL3 A;  1BLP A;  3LIE A;  2P74 A;  1TS8 A;  3C38 A;  3T4O A;  1CQA A;  5FAT A;  3ZNY A;  5FEF A;  3W8K A;  1SZV A;  3F1P A;  3PBR A;  2VGL M;  2PD8 A;  4G3V A;  1TS6 A;  2PDR A;  1FCM A;  2HJ9 C;  2EFX A;  3D9Y A;  3UNW A;  1RGZ A;  5HDC A;  3B42 A;  4CJN A;  3H9W A;  1NY0 A;  3MSH A;  1YLP A;  2OAP 1;  4BBU A;  2MJ6 A;  5TJJ A;  5FAO A;  2HDU A;  2Q9N A;  5E43 A;  3M2K A;  1Y54 A;  3VOL A;  4CLC A;  3DTE A;  1E4D A;  4HH2 A;  1WE4 A;  2L4R A;  2DRW A;  3GQZ A;  5GHY A;  1KGF A;  5J8X A;  1HD8 A;  4NXF A;  4H6J A;  2EX8 A;  3OPL A;  4YNR A;  1DP6 A;  4ID4 A;  2DCF A;  4DJ2 A;  5HAR A;  3UO9 A;  2KDK A;  4OOM A;  2RL3 A;  4DXC A;  1RGY A;  2ZM0 A;  1PYY A;  1FCN A;  5I94 A;  3RXX A;  1SKF A;  3UME A;  2Y2M A;  3OOV A;  1D06 A;  3HL9 A;  4R3J A;  3KYZ A;  3IT9 A;  2M1C A;  5KMW A;  3QP1 A;  4R4S A;  2J9O A;  3E4Q A;  1ERO A;  2ZC4 B;  5E2E A;  1JVJ A;  2ZC5 B;  4WL9 A;  3MKF A;  4EES A;  1XP4 A;  5L07 A;  3ITA A;  3O86 A;  1RP5 A;  2ZM2 A;  3KSF A;  2EX9 A;  2H10 A;  2K2N A;  5F1F A;  4WEK A;  3IF5 A;  3NBL A;  1K6R A;  2O0Y A;  2OLV A;  3OZH A;  3G2Z A;  3RH8 B;  2JKT I;  4OQ0 A;  3Q81 A;  4KUO A;  4N1H A;  2XD1 A;  4HJ6 A;  2X01 A;  4LV2 A;  2C5W B;  3TG9 A;  3Q7Z A;  1T1B A;  2PHY A;  5GLC A;  1JTG A;  3VFH A;  3LIC A;  2E8I A;  4XT2 A;  5AQ7 A;  3HVF A;  4YIN A;  2PR5 A;  4UQI M;  4X68 A;  3EEA A;  4EBN A;  1XX2 A;  5LBR A;  4NG2 A;  2VLG A;  4GZB A;  2JE5 A;  3VOZ A;  2OWH A;  1PFL A;  3ZVW A;  4MN7 A;  5G4Y A;  3P98 A;  1E3U D;  5C5K A;  3LCE A;  3MKE A;  3IX8 A;  4KG6 A;  1YLZ A;  1G6O A;  4R3A A;  4GNU A;  4OQH A;  3B3X A;  3E98 A;  3K3D A;  1S67 L;  2Y2H A;  3CHW P;  2XLN A;  4P87 A;  4H6J B;  4EQI A;  1ZC2 A;  4FCF A;  1TDG A;  2PYP A;  2V0U A;  3IX4 A;  3ICY A;  4L9E A;  3CZD A;  4PM9 A;  3M6B A;  5EVI D;  1O7E A;  2W0N A;  2WUQ A;  4ZRR A;  1ODV A;  4MBF A;  3UB7 A;  4D2O A;  2XK1 A;  3ZG7 B;  2FH5 A;  1L0G A;  2Y2J A;  4EEP A;  2W3F A;  3ZCZ A;  1TS0 A;  2ZQ8 A;  2B95 A;  1K57 C;  1YKD A;  4R1G A;  3UY6 A;  1L0E A;  4C6Y A;  3MS6 A;  1YQS A;  4NEE D;  1CEF A;  4JGR A;  2ZD8 A;  3PBQ A;  5M1A A;  5JYP A;  2IWD A;  3OLO A;  1U60 A;  3CMZ A;  2H0Y A;  4HHD A;  5FI6 A;  1L3L A;  2Y2P A;  2XFS A;  4U0T A;  2HP9 A;  3S1Y A;  3LFV A;  3VP0 A;  3C4P A;  3LY4 A;  3MBZ A;  5EUA A;  3LR5 A;  4HI4 A;  2FFF B;  2PRF A;  4HBT A;  4QY5 A;  3R7W A;  5KSH A;  4EBP A;  5J4E A;  1TF1 A;  3LGO A;  2V2F F;  3MQ0 A;  1W7F A;  1H5X A;  1K6S A;  2K7S A;  3TW8 A;  1AWI A;  3T4T A;  3V39 A;  3ZVT A;  1J9M A;  3CIT A;  4XXR A;  2ZC7 A;  3G4P A;  5EVI A;  3VSL A;  1LI9 A;  5HZH A;  3JVV A;  1V9Y A;  3IF6 C;  3A0R A;  1MWS A;  2BG1 A;  1WYB A;  5EEC A;  3CJM A;  3QHY A;  5DKL A;  1ES2 A;  3CUE C;  5EVE A;  1I2S A;  1LHY A;  3N6I A;  3SW1 A;  1IOU A;  4IUH A;  4R0Q A;  3B33 A;  3LIB A;  5EVI C;  4EU0 A;  1GHI A;  1XJ3 A;  1O07 A;  3NCK A;  3BFC A;  2ZQ7 A;  1MXO A;  3K2N A;  4DDS A;  3ZQ5 A;  4GN2 A;  5HW3 A;  2XD5 A;  3HRE A;  3SS4 A;  1NWZ A;  4HH3 A;  2HP6 A;  3DWK A;  2M7V A;  3RJU A;  3MZF A;  2XQZ A;  3ZDJ A;  1XFQ A;  1BZA A;  3KYE A;  4I5S A;  4PPR A;  5FAS A;  3T4J A;  2EFU A;  1P97 A;  4JGO A;  1F2K A;  1DP8 A;  1A0K A;  3ZG0 A;  2VA0 A;  1TEM A;  1VET A;  1W5D A;  3DTM A;  4P6Z S;  4WMC A;  4BMW A;  2WKR A;  2G7U A;  2XGN A;  3V67 A;  1YLY A;  3G32 A;  2X02 A;  5KSC A;  3IWI A;  1ESI A;  2WGW B;  4IHQ A;  1MWU A;  4KQR A;  4OH0 A;  4S2N A;  2L1M A;  3MZD A;  3KSH A;  1W63 M;  4UQI S;  3HUN A;  3BM6 A;  3NOU C;  1K38 A;  5A93 A;  2P9V A;  3LY3 A;  3C4O A;  4ZJ3 A;  4FUW A;  1KE4 A;  2UV0 E;  3WS2 A;  4ME4 A;  3Q1F A;  3T12 B;  4HQA A;  1NRF A;  3HUM A;  1JWV A;  2BLS A;  4E3M A;  3UPO A;  1N9B A;  5IS1 A;  3BY9 A;  1CEG A;  3W4P A;  3BWL A;  2JKG A;  4S2K A;  3N8L A;  5FA7 A;  2E8J A;  3P7N A;  5DF8 A;  3T4S A;  2ZOH A;  5GL9 A;  4KQQ A;  3GR2 A;  2O9B A;  4DMZ A;  4FH4 A;  2XA7 S;  3AGE A;  4R23 A;  3FWL A;  2VKS A;  5KIZ A;  5A8B A;  1D7E A;  3TE8 A;  4YWZ A;  1OJG A;  3S22 A;  1KDS A;  4JXW A;  3LIA A;  4KZ8 A;  1W8Y A;  5CRF A;  5DF7 A;  3NOP C;  2O9A A;  4RA7 A;  3EQU A;  4Z1W A;  3IF6 B;  1LL9 A;  1IEM A;  3F1O A;  4KZ5 A;  4ZTK A;  1YLJ A;  4GS9 B;  4G3W A;  1SDE A;  2FFY A;  2J3T C;  4WLA A;  4F3L B;  1PWD A;  5EVI B;  1TD5 A;  1DJB A;  1NYM A;  3VSK A;  1T18 A;  3MXR A;  3LO7 A;  1LSX A;  4CPK A;  1SCW A;  1G68 A;  1S66 L;  4B9O A;  2Z2L B;  4LRZ E;  3UB9 A;  4OPR A;  1AXB A;  1PZO A;  4WZ5 C;  3V50 A;  2QPN A;  4OPZ A;  4JXS A;  4RQ9 A;  1S6R A;  4LV0 A;  4O0P A;  4WMC D;  3CWF A;  2NUT C;  3A3F A;  3L9K A;  4DF6 A;  4PM6 A;  4JGQ A;  2P9V B;  1L0D A;  2XEP A;  2V1Z A;  3LUQ A;  1MPL A;  5F83 A;  3FKV A;  3IH9 A;  5DTT A;  5A92 A;  3VE3 A;  1QMF A;  1I5Q A;  2EWW A;  5AQB A;  2P08 A;  2QJ7 A;  2Y91 A;  5D3O A;  4X53 A;  1NZO A;  2H5S A;  4I38 A;  4CLC E;  2M7U A;  5E2F A;  2EX6 A;  2Z6C A;  5A90 A;  3OBF A;  3PBO A;  2PAV P;  2J3T D;  4EEU A;  4P85 A;  5HL6 A;  4E3O A;  3VP1 A;  4II7 A;  3IWO A;  2V8F A;  1GSW A;  4DE3 A;  2R78 A;  4R38 A;  3DAV A;  5M18 A;  3VP3 A;  5FI7 A;  5HAI A;  1XXM A;  2D01 A;  3NUL A;  1MKI A;  2XF3 A;  2Y2I A;  3N8S A;  4ZBE A;  1HZO A;  2K31 A;  1CF0 A;  4Y17 A;  2ZL1 B; 
#chains in the Genus database with same CATH homology
 2Y2K A;  4MBK A;  4JF5 A;  4R4R A;  1ES3 A;  4KZ6 A;  4GZB A;  2GDN A;  2IWB A;  2JE5 A;  1C3B A;  2PU2 A;  1PW1 A;  5FSR A;  3VOZ A;  4EUZ A;  3GMW A;  3SH7 A;  3UDX A;  4IVI A;  3UN7 A;  3ZVW A;  3OPH A;  4S2P A;  3P98 A;  1E3U D;  3LCE A;  1GHP A;  3MKE A;  4KEN B;  5FAP A;  4KG6 A;  2JBF A;  5FQQ A;  3FZC A;  3SS3 A;  4OKP A;  1YLZ A;  3D4F A;  2Y2Q A;  1KE3 A;  5CTM A;  3VFF A;  1NZU A;  4GNU A;  4KG2 A;  4DDY A;  2XH9 A;  3SH8 A;  4OQH A;  3B3X A;  4UA6 A;  1KDW A;  4X56 A;  1BUE A;  2WAE A;  2Y2H A;  4OQI A;  3OC2 A;  2XLN A;  4P87 A;  4EQI A;  1ZC2 A;  4FCF A;  1TDG A;  3BFG A;  3PAE A;  3TOI A;  5EOO A;  4PM5 A;  3HLE A;  3IXH A;  4S2L A;  1IKG A;  3BYD A;  5G18 A;  3HLB A;  2ZC3 B;  3CZD A;  4GDB A;  4PM9 A;  4DE0 A;  5CED A;  3M6B A;  5EVI D;  1PWG A;  1O7E A;  2WUQ A;  2G2W A;  4DKI A;  3VMA A;  1CI9 A;  4MBF A;  4D2O A;  5HFO A;  5FQ9 A;  3NC8 A;  2XK1 A;  3ZG7 B;  1L0G A;  3GSG A;  4Y0U A;  3OCL A;  4O7D A;  1ESU A;  1GHM A;  5CTN A;  1ALQ A;  3G31 A;  1PIO A;  1CI8 A;  2Y2J A;  3GVB A;  3ZCZ A;  1JWZ A;  2HPB A;  3N8R A;  2ZQ8 A;  4WZ5 A;  1K57 C;  4R1G A;  3UY6 A;  1L0E A;  4C6Y A;  1YLT A;  1YQS A;  1L0F A;  1CEF A;  4MBH A;  3BLS A;  3C7U A;  3ZG9 B;  1VM1 A;  2ZD8 A;  3PBQ A;  5M1A A;  3AGF A;  2IWD A;  4ZJ2 A;  5JYP A;  4OOL A;  4ZAM A;  4RYE A;  2R9X A;  3PBS A;  4OVD A;  1U60 A;  4WM9 A;  3CMZ A;  3JYI A;  5E2H A;  2H0Y A;  5FI6 A;  4B88 A;  5HL1 A;  4OPQ A;  3HLC A;  3OPP A;  4DE1 A;  3BFD A;  2Y2L A;  2Y2P A;  2WAD A;  2ZM8 A;  2EXB A;  3IF6 A;  4JXG A;  2XFS A;  4U0T A;  4OLD A;  1EWZ A;  3WS1 A;  2HP9 A;  3S1Y A;  3VP0 A;  2I72 A;  2WGW A;  4FSF A;  3C4P A;  4GD8 A;  4MNR A;  1K4F A;  4S2I A;  3GRJ A;  3LY4 A;  3MBZ A;  5EUA A;  3WS5 A;  2Y2G A;  1XA1 A;  2FFF B;  2J7V A;  3AGD A;  1ZG6 A;  5DF9 A;  5U47 A;  4HBT A;  2CC1 A;  4QY5 A;  3Q7V A;  1I2W A;  5KSH A;  4EBP A;  1JTD A;  2ZQA A;  3V3S A;  2QZ6 A;  2V2F F;  1DJC A;  3HBR A;  4FH2 A;  1W7F A;  5GHZ A;  5BOH A;  1H5X A;  1K6S A;  2ZLY A;  4DXB A;  1RCJ A;  4U3T A;  4QD4 A;  1EI5 A;  4KZ7 A;  5AQ9 A;  3V39 A;  4UA9 A;  3OPR A;  3WS0 A;  4LV3 A;  3ZVT A;  2WYX A;  3O87 A;  1J9M A;  2ZC6 B;  4XXR A;  2WK0 A;  3NDE A;  2ZC7 A;  3UE1 A;  3G4P A;  4EBL A;  4BJP A;  5EVI A;  2WKI A;  3HLD A;  2Q9M A;  4N9L A;  4WEL A;  5CER A;  3VSL A;  3UE3 A;  4KZ4 A;  4N92 A;  1LI9 A;  1PI5 A;  4KG5 A;  3IXG A;  5CXW A;  4LV1 A;  3IF6 C;  1NXY A;  1MWS A;  1E25 A;  2BG1 A;  1WYB A;  5FI2 A;  3CJM A;  4QU3 A;  5EEC A;  3HLF A;  3QHY A;  4E6W A;  4LEN A;  4P0M A;  4PM7 A;  1PW8 A;  3A3I A;  1NYY A;  4HBU A;  1MWT A;  1ES2 A;  1Z6F A;  4UA7 A;  1MWR A;  1L2S A;  1IEL A;  3MXS A;  4FD8 A;  2JCH A;  1I2S A;  1LHY A;  3N6I A;  1GA9 A;  3N4I A;  3OCN A;  5FQJ A;  1K54 A;  1JWP A;  3O3V A;  4WEJ A;  4S2N C;  4R0Q A;  5CEB A;  1BTL A;  3NIA A;  3NY4 A;  5EE8 A;  5EVI C;  1GHI A;  4E3J A;  1BLH A;  1H8Z A;  4S2O A;  5CEC A;  1O07 A;  5HAP A;  3NCK A;  3BFC A;  1BUL A;  3VP2 A;  4E3N A;  4DE2 A;  3ISG A;  1MY8 A;  2ZQ7 A;  1MXO A;  1W79 A;  3PTE A;  4DDS A;  4GN2 A;  1N4O A;  2UWX A;  4EV4 A;  4B4X A;  4K91 A;  3BFF A;  3NI9 A;  4U0X A;  2OV5 A;  3LEZ A;  2G2U A;  1FQG A;  5HAQ A;  5HW3 A;  2XD5 A;  3C7V A;  4IBX A;  3HRE A;  3SS4 A;  3PBT A;  2ZQD A;  3ZG8 B;  2HP6 A;  3MZE A;  4OP5 A;  1BSG A;  3DWK A;  4X6T A;  4GDN A;  2PBY A;  3RJU A;  3MZF A;  2XQZ A;  1LL5 A;  4B4Z A;  4BL2 A;  3ZDJ A;  3BFE A;  1BZA A;  1TDL A;  3RXW A;  1KE0 A;  1XKZ A;  1KGG A;  5FQM A;  5TGF A;  4PPR A;  5FAS A;  1IYQ A;  1HVB A;  4K0X A;  2EFU A;  2HDS A;  4Q8I A;  4GB7 A;  4QHC A;  4Z9Q A;  1K55 C;  4OPY A;  5FQK A;  1K54 C;  3ZNT A;  1K56 D;  5DVA A;  3IHB A;  3ZG0 A;  3IQA A;  1QME A;  3QNC A;  3A3D A;  1LLB A;  3NDG A;  3WWX A;  1DJA A;  1XA7 A;  4WBG A;  4X69 A;  1TEM A;  4OOY A;  5FQI A;  3G30 A;  1W5D A;  2DNS A;  4WYY A;  3DTM A;  4LCM A;  4WMC A;  2OSU A;  5DTK A;  4QJG A;  3MFD A;  1K55 A;  1K57 A;  2XGN A;  1YLY A;  3G32 A;  2X02 A;  4NK3 A;  5KSC A;  5CGS A;  3IWI A;  4GOG A;  3IHA A;  1ESI A;  2WGW B;  5DTS A;  4BQM A;  1NJ4 A;  3WRZ A;  1MWU A;  4KQR A;  4OH0 A;  4S2N A;  1M40 A;  1BLS A;  5GLB A;  3MZD A;  4JF6 A;  5TR7 A;  4K0W A;  3SH9 A;  1K56 A;  4BD1 A;  3WS4 A;  4IVK A;  1ZKJ A;  2WGI A;  2Y59 A;  3SS5 A;  4QY6 A;  4BD0 A;  2J9P A;  4QB8 A;  3HUN A;  1YMX A;  1BLC A;  1LI0 A;  3BEC A;  2WGV A;  3BM6 A;  3UDI A;  3IXD A;  3E2L A;  4JPM A;  2RCX A;  3SOI A;  3UPN A;  4OQG A;  1K38 A;  2J8Y A;  5A93 A;  3A3E A;  1PZP A;  1XPB A;  2P9V A;  3QNB A;  2IWC A;  3G34 A;  5TFQ A;  3S4X A;  5KZH A;  3LY3 A;  3C4O A;  4C75 A;  5CHM A;  3Q7V B;  3DW0 A;  2VGK A;  4ZJ3 A;  4H8R A;  1KE4 A;  4MEZ A;  3ITB A;  3WS2 A;  3Q1F A;  3IXB A;  2A3U A;  4NET A;  2XR0 A;  1NRF A;  3IWQ A;  3Q82 A;  3M2J A;  4Y7P A;  4ZJ1 A;  3HUM A;  1GCE A;  2X71 A;  4EWF A;  1JWV A;  1PWC A;  2C6W B;  4WZ4 A;  4M3K A;  2HDQ A;  5CGX A;  2WZX A;  1VQQ A;  1ES4 A;  2BLS A;  4RVA A;  5A91 A;  4E3M A;  3UPO A;  1N9B A;  2H0T A;  4GD6 A;  4S2J A;  5AQA A;  3WRT A;  4KQO A;  2QMI A;  2EX2 A;  1ZG4 A;  4BLM A;  1CEG A;  4E6X A;  3W4P A;  4S2K A;  1W8Q A;  3N8L A;  5FA7 A;  1ERM A;  4LCL A;  2WAF A;  4XUZ A;  5GHX A;  1BLP A;  3DWZ A;  3VP4 A;  2P74 A;  5DF8 A;  3FV7 A;  3I7J A;  3V3R A;  3PBN A;  5GL9 A;  4R3B A;  4KQQ A;  3GR2 A;  3FKW A;  2XFT A;  5FAT A;  3UDF A;  3ZNY A;  4HES A;  5GLA A;  4JLF A;  4RX3 A;  3W8K A;  1K25 A;  2ZQC A;  1K4E A;  2EXA A;  3BRM A;  3PBR A;  4P6B A;  4L0L A;  4FH4 A;  1ONG A;  3AGE A;  2PU4 A;  5EVL A;  1FCM A;  4R23 A;  4DRT A;  2Y2N A;  3P09 A;  3FWL A;  2ZQ9 A;  2EFX A;  3O88 A;  5IHV A;  1IYP A;  5EOE A;  1HTZ A;  1YLW A;  3G2Y A;  3G35 A;  3HLG A;  2B5R A;  3S22 A;  3UNW A;  1KDS A;  4JXW A;  4RX2 A;  1RGZ A;  4CJN A;  4KZ8 A;  1W8Y A;  2A49 A;  5CRF A;  5DF7 A;  4JKT A;  1SHV A;  4RA7 A;  3EQU A;  1NY0 A;  2OLU A;  3BEB A;  3IF6 B;  1LL9 A;  1YLP A;  1FR6 A;  1IEM A;  4KZ5 A;  1S0W A;  4ZTK A;  1FR1 A;  5FAO A;  3BLM A;  3C5A A;  1TVF A;  2HDU A;  2Q9N A;  1IKI A;  1YLJ A;  5F82 A;  5E43 A;  3M2K A;  1YT4 A;  1Y54 A;  4KZ3 A;  3VOY A;  1KGE A;  3A3J A;  4BL3 A;  1SDE A;  2FFY A;  4GKU A;  1DY6 A;  3HUO A;  1E4D A;  1PWD A;  1IYS A;  3E2K A;  4KZB A;  5EVI B;  1WE4 A;  1DJB A;  1NYM A;  4S2M A;  3VSK A;  3MXR A;  3LO7 A;  1Q2Q A;  1YMS A;  2DRW A;  4CPK A;  3GQZ A;  3UPP A;  1SCW A;  5GHY A;  4OLG A;  1IYO A;  4F94 A;  1KGF A;  5J8X A;  1G68 A;  1HD8 A;  1OME A;  4XUX A;  2Z2L B;  4E3L A;  2EX8 A;  3OPL A;  1AXB A;  4OPR A;  1PZO A;  3Q07 A;  2Y2O A;  4UHU A;  4WZ5 C;  1MBL A;  5FDH A;  3V50 A;  2QPN A;  4ID4 A;  4OPZ A;  4JXS A;  2DCF A;  1SDN A;  1S6R A;  4LV0 A;  5HAR A;  3UO9 A;  4HEF A;  4OOM A;  2RL3 A;  4WMC D;  4DXC A;  1RGY A;  2HDR A;  2WKH A;  2ZM0 A;  1PYY A;  1FCN A;  4N1X A;  5I94 A;  3RXX A;  3A3F A;  1SKF A;  3FYZ A;  1GA0 A;  2Y2M A;  4DF6 A;  4PM6 A;  4MLL A;  3HL9 A;  2P9V B;  4E3K A;  2XDM A;  1L0D A;  4R3J A;  4E3I A;  2XEP A;  2V1Z A;  2VGJ A;  1MPL A;  2ZJ9 A;  3IT9 A;  3M6H A;  4KZ9 A;  1CK3 A;  5F83 A;  5KMW A;  2JC7 A;  3FKV A;  3IH9 A;  5DTT A;  5F1G A;  5A92 A;  4Y0T A;  5GLD A;  1QMF A;  4R4S A;  3ZHH A;  3HLW A;  1ONH A;  2J9O A;  1I5Q A;  3GTC A;  5FAQ A;  5AQB A;  1ERO A;  2ZC4 B;  4OON A;  1JVJ A;  2ZC5 B;  5E2E A;  3MKF A;  4BEN A;  1WYC A;  3ZFZ A;  2Y91 A;  1BT5 A;  4X53 A;  1H8Y A;  5D3O A;  1NZO A;  2H5S A;  1XP4 A;  5E2G A;  3ITA A;  3O86 A;  1RP5 A;  2ZM2 A;  2Z2M B;  4C3Q A;  3IH8 A;  3TSG A;  5EPH A;  1YM1 A;  4JBF A;  5E2F A;  1FSY A;  4UAA A;  1KVL A;  2EX9 A;  2EX6 A;  2H10 A;  2WKE A;  3GV9 A;  5F1F A;  5CGW A;  5M19 A;  4WEK A;  4IBR A;  3IF5 A;  3NBL A;  1PI4 A;  1K6R A;  2OLV A;  2Y55 A;  5CHJ A;  3OZH A;  3G2Z A;  5A90 A;  4A5R A;  3PBO A;  4OQ0 A;  3Q81 A;  4JF4 A;  2R9W A;  4N1H A;  4P85 A;  4PMA A;  2XD1 A;  4E3O A;  1FCO A;  3VP1 A;  3IWO A;  5L2F A;  1FSW A;  2X01 A;  3ZG5 A;  4LV2 A;  2C5W B;  3EQV A;  1ERQ A;  1G6A A;  4DE3 A;  2WZZ A;  3TG9 A;  5CHU A;  4N9K A;  3Q7Z A;  5M18 A;  3VP3 A;  1KVM A;  4IED A;  5FI7 A;  5HAI A;  5GLC A;  1JTG A;  3VFH A;  1XXM A;  1Q2P A;  4JXV A;  5HX9 A;  5JYO A;  4YFM A;  3UE0 A;  2V20 A;  3N7W A;  2E8I A;  3V5M A;  1MKI A;  4PM8 A;  1XGJ A;  2XF3 A;  2Y2I A;  1XGI A;  3N8S A;  4X55 A;  4ZBE A;  3PAG A;  5AQ7 A;  3CG5 A;  1E3U A;  3HVF A;  4YIN A;  3W4Q A;  1M6K A;  4ZDX A;  1HZO A;  1ES5 A;  4X68 A;  4OP8 A;  3ZGA B;  4KZA A;  4Y0O A;  2ZMA A;  2Y4A A;  3W4O A;  4EBN A;  1XX2 A;  2HP5 A;  1FOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...