2K7SA

Human arnt c-terminal pas domain, 3 residue ib slip
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSQTAQNPYSDEIETIICTNTNVKNSSQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title ARNT PAS-B has a fragile native state structure with an alternative beta-sheet register nearby in sequence space
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 24
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2k7sA01
3LICA 3E4OA 1MZUA 3PHYA 4R3AA 4HP4A 3UMEA 4B9OA 1T18A 4H6JB 2P7JA 4BBTA 2I9VA 4E04A 4WF0A 2BASA 2VEAA 2VLGA 5DKLA 1T1CA 3E4QA 2L0WA 5TBMA 1UWPX 4LRZE 2H28A 5HD3A 1XFNA 1UGUA 1D7EA 2QHKA 2QKPA 4EERA 2ZOHA 1JNUA 5KIZA 3NOTC 4LLOB 3T50A 3K3CA 5IS1A 1OTDA 1XJ2A 2ZBBA 1Y28A 3H82B 1D06A 2PYPA 3IS2B 1LSVA 4I3AA 5DJTA 4NXGA 4JGQA 4DJ2A 2L4RA 2YKFA 1DP8A 3F1PA 1LT0A 4I5SA 4GHIA 3FC7A 4EETB 2A24B 4JGOA 2QWSA 4LPZA 5HWTA 2PD7A 5F68A 2OOLA 1DRMA 4PKYA 1N9OA 2EA9A 4HJ6A 3MXQA 2K7SA 2INWA 4HJ4A 3HJKA 1WA9A 1TS6A 3K3DA 4XT2B 2R78A 2JHEA 4M4XA 4H6JA 4NXEA 1GSXA 3UB7A 3LYXA 2QJ7A 3UE6A 1V9YA 3P7NA 4I38A 4WL9A 4L9GA 5DJUA 5J7EA 1S4SA 2WKPA 2V1AA 3LIAA 4GCZA 3LUQA 1S1YA 4EQ1A 3OLOA 4F3LB 3NOPC 1EW0A 3BY8A 4K08A 2W27A 3ULFA 3MJQA 4L9EA 4YWZA 2CMNA 3CWFA 5HDSA 3H82A 3SW1A 2PD8A 4R38A 3IS2A 1OTAA 4KUOA 3F1OB 4GS9B 3G6OA 4DJ3A 5F5YA 1GSVA 1TS0A 2QJ5A 5HDDA 4WLAA 4HQAA 2A24A 1T1AA 4JGPA 2V0UA 1F9IA 4HJ3A 5EFWA 1S66L 3NJAA 5G4YA 1LL8A 2GJ3A 2Z6CA 1T1BA 4R6LA 4HP9A 1N9LA 1KOUA 3MFXA 4LRXC 5A8BA 4XT2A 4RQ9A 4KQDA 1XJ4A 3BY9A 3LIDA 1S4RA 5F6AA 2JN7A 3BWLA 4I3JA 2YKHA 1LSWA 4WUJA 4NXFA 3ZQ5A 1NWZA 4HIAA 1TS8A 2PHYA 3LI8A 2D01A 3E4PA 3MQQA 4F3LA 4HY8A 3LIFA 4I39A 2KX6A 3VE4A 3A0VA 1BYWA 1GSWA 4MN5A 2M1CA 3H7WB 5AVEA 3NHQA 1OJGA 1OTBA 1S67L 3D72A 1OTIA 1XFQA 5HSQA 4BBUA 3FG8A 3LI9A 1XJ6A 3F1OA 4GW9A 2WKRA 4GS9A 4EXOA 1OTEA 3UMDA 1ODVA 1DP6A 1OT6A 5AVFA 3VOLA 4L9FA 1X0OA 3NOUC 4MN6A 4BBVA 4EESA 1P97A 1G28A 4EEUA 5HDCA 2VV7A 1T19A 5F69A 5J4EA 2VV8A 3F1NB 3GDIA 3KX0X 5I5LA 4HHDA 4PKYG 5HD5A 1XJ3A 3MR0A 3VE3A 2ZOIA 3RTYA 3UB8A 2V0WA 5HZHA 5HWVA 5IU1A 5DKKA 3PYPA 3LIEA 4HNBA 3H9WA 2WKQA 3CAXA 2PR6A 2D02A 3CLOA 3UB9A 2PYRA 4EW7A 2W0NA 5TBMB 5HWWA 1V9ZA 3H7WA 3IBRA 2OWJA 1UWNX 1N9NA 4NXBA 1TS7A 2PR5A 3A0SA 1LSXA 3EEHA 3C8CA 4EEPA 4HH2A 1DP9A 1S1ZA 1VB6A 3GECA 3MQOA 3B33A 3UB6A 3A0RA 4KUKA 4HH3A 1OT9A 2KDKA 2HV1A 4HOIA 3ICYA 5J3WA 2B02A 3LIBA 5G4ZA 3F1PB 2Z6DA 4JGRA 3C2WA 2L1MA 4GHIB 4I3IA 4LRYC 3RH8B 4HI4A 1P0ZA 2OWHA 3HJIA 2VV6A 1F98A 1OJ5A 2J80A 4WN5A 2PDRA 3EWKA 2V1BA 3F1NA 4R70A 2V9AA
chains in the Genus database with same CATH superfamily
1TF1A 4JLFA 3GTCA 5GHYA 5EPHA 4DE2A 3VP3A 4BQMA 1WE4A 1MZUA 4LV0A 1E4DA 1YLZA 1BT5A 4HP4A 1F2KA 2OV5A 2XFSA 4KZ4A 3CUEC 3UMEA 3W4OA 4B9OA 4BL2A 3CMZA 5TFQA 2GX5A 4A5RA 3ZYTA 4MNRA 4ME4A 3LEZA 2BASA 4P6ZM 2W3GA 2VLGA 3N4IA 4ZRRA 1IYPA 2Y2LA 2Y8HA 2VGLS 2L0WA 4KQRA 5TBMA 2H28A 5DF9A 4D2OA 4M3KA 5HPIA 1RP5A 3LR3A 4NEED 3S7PA 3KSGA 2ZQ9A 1N4OA 3Q1FA 2DNSA 4G3KA 2ZBBA 3H82B 1Y28A 5M19A 4RYEA 4R4RA 1K54A 1MWRA 4N9LA 4JGQA 4O01A 3S4XA 5GLCA 1IYSA 2H0YA 1FCNA 4GHIA 5TR7A 2HJEA 2C5WB 3EQUA 4EETB 3A3EA 3B42A 2OLVA 2XQZA 4JGOA 5M18A 1KE0A 4X68A 2ZM8A 1NRJA 3GSGA 1ZKJA 4WMCD 4ZAMA 2O0YA 4DXCA 5IHVA 2K7SA 4OP5A 5L10A 1YSQA 3HJKA 4KENB 2VZWA 1TS6A 5KMWA 2DMWA 1W8YA 2R78A 3Q07A 4K0WA 1L0GA 4GJ4A 2J3TD 1J9MA 3OCNA 4ZJ1A 3ZCZA 3UB7A 3FZCA 2QJ7A 4MCWA 2WAFA 1PWCA 1XXMA 5EOOA 4WL9A 4L9GA 4MDZA 4Y15A 1S4SA 3P98A 2WKPA 3B3XA 3LIAA 3PBTA 3IXHA 3UPNA 4G3VA 5CHMA 2HP5A 4PM7A 2HGVA 3NOPC 1XPBA 2J7VA 3CJMA 3MXSA 3A3IA 1YKDA 3MBZA 2XEPA 2JC7A 3LR4A 5HAIA 5HDSA 3CUEA 1BLCA 3EQVA 3OC2A 3H82A 1LL5A 2PD8A 5FAQA 1K56A 4KQOA 3HVFA 1K0KA 4DJ3A 4ZTKA 2RL3A 3HLEA 4UAAA 1HTZA 4Y7PA 4ZJ3A 2QJ5A 4U3TA 3TG9A 2ZLYA 4LV1A 2G2WA 3ZNYA 2Y4AA 4WM9A 3PBOA 2EWWA 3JYIA 1TVFA 4E3LA 1JWZA 2ZMAA 2QPNA 1YLTA 1TEMA 3ZG7B 2Z6CA 4QD4A 4R6LA 1H0MA 2Y2MA 5EOEA 3ZDJA 2AVXA 3ZVWA 1BUEA 2FFFB 4S2JA 2G7UA 4Y2FA 3T4SA 2Y2GA 3C5AA 2O99A 5F1GA 3BWLA 1YQSA 3MKFA 1YLJA 2VGLM 1W79A 1IKGA 4E3KA 1NWZA 3O88A 2PHYA 2D01A 3OZHA 3NECA 3ZFZA 5FQKA 1VEUB 4I39A 2Y91A 3PAGA 1OPXA 2JKTM 3MZDA 1BYWA 3BLSA 4IJGA 4YNRA 4MN5A 3WWXA 3IBJA 5CEBA 1OJGA 3G35A 1OTBA 2Z2LB 4JKTA 4DRTA 3IX3A 5HSQA 2VGJA 4MBKA 4KG6A 1U60A 1K6SA 1C3BA 3BYDA 4LCMA 5HFOA 3VOYA 3UMDA 1ODVA 5CECA 5AQ9A 3S7NA 5U47A 5FQ9A 4QY5A 2Y2NA 2V8CA 2JKRI 2VKSA 1NJ4A 4MN6A 4EESA 3IXGA 5HDCA 4DDSA 3UDXA 3VFHA 4LENA 3W4QA 5JYPA 3W2ZA 1M6KA 4Y17A 3V50A 2BG1A 3UB8A 3OPHA 1Y54A 5IU1A 3FPVA 4KZ3A 3UE1A 3PYPA 2OLUA 2J3WA 2WKQA 2PAVP 3DWKA 2Y2IA 4EW7A 5TGFA 4BWIA 3M2KA 2Z2MB 3PTEA 1ES2A 3BJNA 5EV0A 5GL9A 4MLLA 2OWJA 3T4LA 3HUMA 3A3FA 5FSRA 1DJCA 5HAQA 1S0WA 2PR5A 2OAP1 4FCFA 4EEPA 2XD5A 1I5QA 1S1ZA 5HL1A 1IFQA 2ZM2A 4NK3A 3GECA 3A0RA 4KUKA 2WKIA 2KDKA 2HV1A 2B02A 2UV0E 3V5MA 3LIBA 4N92A 4JPMA 4Y13A 5G4ZA 4QPRA 4JXVA 2XA7S 5FL3A 1BSGA 3D4FA 4H8RA 1YPRA 3KSIA 3SS3A 3HJIA 4DN0A 3LEQA 2VV6A 2O9AA 1OJ5A 3IWIA 3FV7A 4FSFA 3NDEA 2NUTC 4K91A 4GD6A 2V2FF 1GHMA 3HCYA 4PM6A 1CEFA 4S2NC 5E2EA 2IWBA 3MQ0A 1XGJA 3HBRA 5I94A 1J3WA 4EUZA 3R7WB 2ZC5B 3D9YA 1T18A 4G3WA 2P7JA 4PM9A 5CTMA 1SZVA 1SCWA 1YMXA 2VEAA 5EVID 3N8SA 3T4TA 4S2PA 4UA6A 2IWDA 3VP2A 1CI8A 4GKUA 2W1TB 1FR6A 1T1CA 1JVJA 1UWPX 4LRZE 5HD3A 3C4PA 1GCEA 2H10A 3NDGA 1G68A 2QKPA 3P01A 3IH8A 3S7QA 1ES5A 3WRTA 3NOTC 5A90A 4QY6A 4DE0A 1XJ2A 5DF8A 2PYPA 4RX2A 2P9VB 5CEDA 3LFVA 2HP9A 4RX3A 4Y0OA 4NXGA 2L4RA 1DP8A 3G34A 5F82A 3DWZA 3QHYA 3CG5A 3JVUA 3FC7A 2R9WA 4OP8A 3OPLA 1W8QA 4OOLA 2H5SA 3WS4A 5TJJA 3KYEA 2PU4A 3DTKA 3HLFA 2A24B 4AFIA 3QP5A 2PD7A 2V20A 3SOIA 3DAVA 3EOIA 4LFUA 4DE3A 2OOLA 4OPZA 4PKYA 1PZPA 2WZXA 1L2SA 4IHQA 4EBPA 3MXQA 1DY6A 2INWA 4O8GA 4HJ4A 3V67A 5CHJA 3NY4A 3PBSA 1WA9A 1K55C 5KSCA 3K3DA 1S6RA 3R7WA 4XT2B 1BZAA 4LCLA 1FSWA 2P04A 5G18A 3PXPA 4BMWA 3CPTB 3DTEA 5FQQA 4KZAA 3EGDC 3UE6A 1ES4A 3BLMA 4OH0A 1K38A 5J7EA 4OQGA 2V1AA 3T4OA 4NG2A 2W1TA 4EUVA 3R4KA 1FQGA 3GMWA 2ZD8A 1FCMA 4S2OA 3LUQA 1FILA 3UDFA 3OLOA 1PWDA 4WMCA 4F3LB 5L07A 1EW0A 3W8KA 2W27A 2R9XA 4S2NA 3ULFA 1VHMA 3JPUA 3MJQA 4L9EA 4YWZA 5A92A 2Y2JA 5F83A 2CMNA 4PM5A 4DKIA 5FQMA 2JKFA 4O7DA 1PI5A 4BL3A 3SS5A 2B95A 2P9VA 5KSHA 2VA0A 3V3SA 2JKRM 2XA7M 2XH9A 3SH7A 5EVLA 1OTAA 4CQHA 4YFMA 4KUOA 3UB5P 3F1OB 3QNCA 5A93A 4X1LA 1LL9A 5LBRA 3BFEA 1G6OA 1Z6FA 4IVKA 5F5YA 1FSYA 1TS0A 5E2FA 2PT7A 1IYQA 4N9KA 5HDDA 1K57A 2XRNA 3IXBA 2A24A 4JGPA 5AQBA 2Y79A 2V0UA 1F9IA 1SDNA 2HJ9C 1E3UD 5EVEA 1T1BA 1YLYA 3LY4A 2A49A 1XX2A 1KOUA 5HAPA 4LRXC 4XT2A 5J8XA 4RQ9A 3VOZA 4KQDA 3SH9A 3TSGA 1XJ4A 4C6YA 3BY9A 1VQQA 3CPTA 2W3EA 2ZMVA 4I3JA 2XF3A 2XK1A 3ZQ5A 1TS8A 3LI8A 3O86A 2M7VA 3MQQA 2GDNA 1PFLA 4F3LA 4HY8A 1ONGA 2VGKA 2P08A 3UPPA 2QMIA 1KGEA 4R4SA 3LCEA 1LHYA 1O07A 2J9PA 5FDHA 2MJ6A 3H7WB 3NHQA 4WZ5C 3ZG5A 3I7JA 5CRFA 3KO6A 3D72A 3ITAA 1OTIA 3UE3A 1CI9A 4P85A 2VJWA 1NLYA 3FG8A 5E43A 2ZL1B 3F1OA 2WKRA 3E98A 4C75A 1OTEA 4C3QA 2O9BA 4JF4A 1HLUP 2OAQ1 5FI6A 4E6XA 3QP8A 5AVFA 1ZC2A 3A3JA 3VOLA 3D3OA 4LV2A 3O87A 2GZAA 2A3UA 4YOFA 3HUOA 1DJBA 4OVDA 5DFYA 5DF7A 3G2ZA 4BBVA 4Q0HA 4EEUA 3SH8A 1T19A 3IT9A 4WYYA 1N9BA 3F1NB 1JWPA 2WK0A 3KX0X 4MBFA 2A2LA 4KZ6A 3T12B 1XP4A 4CLCC 3U4LP 1MWUA 3RTYA 1KGGA 4KZ9A 4HBUA 3PAEA 3TE8A 4X55A 4CLCE 3NI9A 4OLDA 2EX6A 4FH2A 1ZHHB 4OPQA 2PR6A 3GRJA 5EVIC 3K2NA 2B18A 3OOVA 3CLOA 4E3IA 1CEGA 2X71A 1KDWA 4E3MA 3HLGA 4ESPA 1M40A 1V9ZA 5DTSA 4X69A 3H7WA 3IBRA 3EGXC 1UWNX 3UPOA 4NXBA 1TS7A 1YAXA 3HLDA 3E2KA 4CLCB 5GLDA 1DP9A 1VB6A 4IEDA 4XXRA 1EWZA 3MQOA 2ZL1A 1PYYA 5DTKA 4X56A 4Y5FA 4L0LA 5GHXA 3ICYA 5J3WA 5GHZA 1I2WA 2EXBA 3T1RA 1QMEA 5EVIB 5CGSA 4X53A 4MBHA 4S2IA 3Q7ZA 3HLWA 4R23A 4DF6A 1RCJA 2X01A 4LRYC 4WZ5A 4RA7A 1P0ZA 4Z9QA 3S22A 2J80A 1CK3A 2PDRA 2HDQA 3HL9A 2V1BA 1O7EA 1K56D 3F1NA 3FYZA 5AJGA 2IA2A 2V9AA 4OONA 5E2GA 3LICA 4KZ5A 2WADA 4E3OA 1ESIA 5CGWA 1ES3A 1K4FA 3VP4A 3IWOA 4FTXA 5F1FA 2LB9A 4PPRA 3KSFA 1SKOB 3UDIA 3N6IA 4BBTA 2I9VA 1YMSA 2VX8A 1SDEA 2K31A 4WF0A 4ID4A 4R0QA 3RFBA 1TD5A 4D60A 5DKLA 3WS2A 4U0TA 1W7FA 1W5DA 3IX4A 5FA7A 3B47A 4Q0JA 1MKIA 1UGUA 1PWGA 1BLSA 3UN7A 2Y2QA 3WS5A 4CLCA 4EERA 1OMEA 2ZOHA 3G32A 5KIZA 1JWVA 4LLOB 3WS0A 3UY6A 3K3CA 1OTDA 4WEKA 3L7HA 1VEUA 1EROA 2ZJ9A 4Y0UA 1D06A 1ERMA 3DTMA 3IF6C 4EBLA 1BTLA 1F5MA 5E2HA 2WUQA 1AWIA 2X02A 4GB7A 1LSVA 3EEAA 4I3AA 5EVIA 2EX9A 3BFCA 5DJTA 2ZQ7A 1CF0A 2YKFA 2EWVA 1WYBA 2J9OA 1LT0A 3UO9A 2B5RA 5EE8A 3BFDA 4P87A 1L3LA 2WKHA 1MBLA 4XUZA 4Y0TA 3U2AA 1FR1A 4Y3IA 5F68A 3O5YA 1H8YA 2QZ6A 2Q9NA 1DRMA 1G6AA 2ZQAA 4FOFA 1N9OA 2EA9A 5FAPA 4NETA 2ACGA 4DMZA 1PI4A 3WS1A 4E6WA 4B93A 5CX7A 3KSHA 1SKOA 3QP1A 4M4XA 2KOIA 4NXEA 3LYXA 3CZDA 1AXBA 1V9YA 3P7NA 3Q82A 4I38A 5HX9A 3BFFA 1FIKA 3C30A 3G30A 4GCZA 1VM1A 5A91A 3BY8A 4DE1A 4K08A 2J3TC 2JKGA 5CTNA 3MFDA 1DJAA 3TW8A 3BW6A 5FQIA 2W3DA 5IT5A 2XROA 2HF6A 3SW1A 3LGOA 4R38A 2ZC3B 1SKFA 4OPYA 3VMAA 4S2KA 4BENA 2PU2A 3ZNTA 1MWSA 5L09A 4HQAA 4JXWA 1GHPA 1LLBA 2WZZA 3HLBA 4S2MA 5EFWA 3NJAA 5G4YA 5L8MA 4HESA 2H0TA 1PZOA 4P0MA 1K54C 4GN2A 4HP9A 5D3OA 3ZG9B 2FFYA 1N9LA 1HVBA 1MKMA 1H3QA 4ZJ2A 3IH9A 2HP6A 5A8BA 5FEGA 3NBLA 2NUPC 3QP4A 4R1GA 3VP0A 4R3BA 4EU0A 1NRFA 2JN7A 3TJZC 4ARZB 1LSWA 3MSHA 1VETB 3VSLA 4NXFA 1SHVA 2JBFA 4DXBA 3E4PA 3GV9A 4OOYA 1K25A 2KX6A 1IEMA 1HD8A 5GLAA 1KVMA 4GOGA 2W3FA 3P09A 3BRMA 3MMHA 4GD8A 3AGDA 5FEFA 4F94A 2LB5A 1S67L 2Y59A 2XD1A 3W4PA 2EX2A 3LI9A 3PR6A 2Q9MA 4PAUA 2EXAA 1DP6A 3LY3A 2ZMFA 3C7UA 3HUNA 1OT6A 5DFXA 4KZ8A 3IHBA 3GQZA 1JTDA 1NLZA 1X0OA 3G2YA 5MC7A 2W3HA 4BD0A 1P97A 1G28A 3A3DA 4OPRA 3MZFA 4Q0IA 2VV7A 5F69A 1TDGA 1ACFA 5J4EA 2ZM0A 1H8ZA 3GDIA 1YT4A 1BLPA 3ZG8B 3LO7A 5I5LA 1MXOA 1P9RA 1XJ3A 3GR2A 1NZUA 3MR0A 3T4KA 2HDSA 2V0WA 5HZHA 1YLWA 3T4JA 3N7WA 4FD8A 2C6WB 2Y2PA 4OLGA 4HNBA 1ZG4A 4ARZA 4QJGA 4B4ZA 3C38A 3H9WA 2HDRA 1VETA 1IELA 4WBGA 4PM8A 1W63M 1H8MA 3UB9A 2EFUA 1FCOA 5EUAA 2KLIA 5CERA 1Q2PA 1W63Q 3IWQA 1ZG6A 4O0PA 5CGXA 3BECA 4X6TA 1LSXA 1NXYA 3DTIA 4LGWA 3V39A 1Y4OA 3KYQA 1GA0A 1IYOA 4CPKA 3UB6A 3B33A 3MF0A 3NULA 1A0KA 4KG5A 1OT9A 4II7A 3WRZA 4PMAA 3M6HA 3FPWA 2IWCA 2Y2KA 3T1XA 2ZC6B 3F1PB 1K55A 2Y2OA 4GNUA 2W1RA 1MC0A 2L1MA 4UEYA 2FZ0A 3RH8B 4HI4A 4JF6A 2JE5A 1XA7A 2OWHA 3S7OA 1XGIA 1F98A 2Y2HA 1K4EA 4WN5A 3EWKA 4GDBA 1YM1A 3PBRA 4WELA 2V8FA 3IQAA 5FDSA 3CITA 3M6BA 2FH5A 3DBAA 3T4QA 3E4OA 2WKEA 5FASA 4QB8A 3PBQA 3FKVA 3PHYA 4R3AA 3E0YA 1MPLA 3GVBA 4H6JB 3MKEA 1NY0A 4E04A 4Q8IA 4OOMA 3VSKA 2PBDP 4FUWA 3T1QB 2J8YA 4BLMA 3LR5A 2O9CA 3OPRA 4OKPA 4UHUA 3E4QA 2Q0OA 1XFNA 1BLHA 3IF5A 3IXDA 1EI5A 1D7EA 5FI7A 1HZOA 2QHKA 3VP1A 1I2SA 3HREA 1H5XA 1RGZA 5CHUA 2CC1A 1JNUA 1YSPA 4QU3A 3T50A 5IS1A 3SS4A 1PW1A 3O3VA 4EV4A 3LR0A 3IX8A 1XA1A 2UWXA 3OCLA 3IS2B 3NIAA 2K2NA 5HL6A 4OQIA 4ETXA 3AGEA 4B4XA 3BQ8A 2WGVA 5HPFA 4DJ2A 3F1PA 4QWOA 4I5SA 1IKIA 4KZBA 2M7UA 5AQAA 3C4OA 5CXWA 2XSSA 2Y55A 2P74A 3MXRA 2GNXA 2QWSA 4LPZA 5HWTA 3JVVA 4OQ0A 4HJ6A 4IVIA 2WAEA 3OPPA 4NKPA 2XR0A 4QHCA 2PRFA 2HZ5A 3HLCA 2JHEA 4H6JA 3FWLA 3AGFA 1GSXA 3ZHHA 3ISGA 3N8LA 1L0EA 5DJUA 4IBXA 3QNBA 1LI0A 2DRWA 3ZGAB 4EQ1A 1S1YA 3CI6A 2WGIA 3MS6A 1JTGA 3M2JA 4OQHA 3T1SA 1RGYA 2EFXA 3VFFA 3BFGA 2EX8A 4EQIA 4UQIS 1BULA 2G2UA 1KDSA 1KGFA 1MWTA 3CWFA 1ALQA 4R3JA 3SZTA 4UA7A 3IS2A 2BLSA 3L9KA 4GZBA 3ZG0A 4LV3A 4X25A 4GS9B 3G6OA 2ZC4B 1GSVA 5HW3A 3ITBA 4B88A 2E8JA 5DTTA 4WLAA 3FKWA 5HARA 2V1ZA 1T1AA 4K0XA 5JYOA 5AQ7A 2I72A 4HJ3A 1KE3A 1YLPA 2DCFA 1S66L 1LL8A 2GJ3A 5C5KA 3Q7VB 5EM0A 4JXSA 1CQAA 1Z09A 1PRQA 3RJUA 1K6RA 2QYBA 4X1MA 4ETZA 1PNEA 1LI9A 1PIOA 4YINA 3MFXA 4DDYA 3G31A 3N8RA 3LIDA 4UA9A 1S4RA 5F6AA 4KZ7A 1IOUA 2YKHA 4WUJA 5FI2A 4HIAA 3IF6B 1WYCA 2ZQ8A 4HEFA 3E2LA 3LIFA 3UNWA 3NCKA 4P6ZS 3VE4A 3A0VA 5M1AA 3S1YA 1QMFA 1GSWA 4Z1WA 1PW8A 2M1CA 5AVEA 4JXGA 3QP6A 2XGNA 5DVAA 3BM6A 2JCHA 4GDNA 4FH4A 3NC8A 4CJNA 2ZC7A 1XFQA 4BBUA 3BQAA 3RXXA 1XJ6A 4IUHA 4GW9A 1ERQA 4GS9A 4EXOA 1D1JA 4U0XA 3C7VA 4MN7A 4E3NA 4E3JA 1XKZA 1Q2QA 2XFTA 5KZHA 3PBNA 4L9FA 2WGWB 4CLCD 3NOUC 2WYXA 1L0DA 2VK3A 3VV4A 4GLQA 2HPBA 3Q7VA 5EECA 3TRCA 4BD1A 1E25A 3CHWP 2VV8A 1STZA 4ZBEA 4HBTA 1G5UA 4HHDA 4PKYG 5HD5A 3VE3A 2ZOIA 5HWVA 3MZEA 1K57C 3TOIA 3UE0A 5DKKA 3LIEA 5FQJA 3OBFA 4N1HA 1CJFA 4PHTA 1GA9A 3CAXA 2XDMA 4ZDXA 2D02A 3IF6A 4P6BA 1NYYA 2PYRA 2W0NA 5FATA 5L2FA 3BEBA 1TDLA 5TBMB 1MY8A 4UQIM 5HWWA 5BOHA 2OSUA 1L0FA 3RXWA 5K5BA 1N9NA 4WZ4A 4MEZA 3A0SA 4BJPA 4IBRA 3EEHA 3C8CA 4KQQA 3G4PA 4HH2A 1ONHA 4JBFA 1P9WA 4XUXA 1E3UA 2PBYA 3IHAA 2XLNA 1GHIA 2JKTI 1KE4A 1ZTUA 4JF5A 3QP2A 4HH3A 2E8IA 4HOIA 4EWFA 3KYZA 4N1XA 3V3RA 4KG2A 4S2LA 2HDUA 3ZVTA 2ZQDA 2Z6DA 4JGRA 2RCXA 4IUKA 3C2WA 2ZQCA 4EBNA 3Q81A 1FOFA 2WGWA 3DW0A 4GHIB 4I3IA 2BTFP 4RVAA 1KVLA 1NZOA 1NYMA 5EM1A 5FAOA 4MMNA 5GLBA 4WEJA 1ESUA 4R70A
chains in the Genus database with same CATH topology
1TF1A 3LICA 3T4QA 3HCYA 3E4OA 3MQ0A 1MZUA 3PBQA 3PHYA 2LB9A 3KSFA 4R3AA 3E0YA 4HP4A 3R7WB 3CUEC 3UMEA 4B9OA 1T18A 4H6JB 4G3WA 2GX5A 2P7JA 4BBTA 2I9VA 3ZYTA 2VX8A 4E04A 2K31A 4OOMA 4ME4A 4WF0A 2BASA 2VEAA 4P6ZM 2W3GA 3LR5A 3T4TA 2VLGA 3RFBA 2O9CA 4ZRRA 1TD5A 2W1TB 5DKLA 1T1CA 2Y8HA 2VGLS 2L0WA 3E4QA 5TBMA 1UWPX 4LRZE 2H28A 5HD3A 3B47A 1XFNA 4Q0JA 5DF9A 1UGUA 1D7EA 5HPIA 2QHKA 4CLCA 3LR3A 2QKPA 4EERA 3P01A 2ZOHA 4NEED 3S7PA 1JNUA 3S7QA 1YSPA 5KIZA 3NOTC 4LLOB 3KSGA 3T50A 3K3CA 5IS1A 1OTDA 4WEKA 4G3KA 1XJ2A 2ZBBA 1Y28A 3H82B 3LR0A 1D06A 2PYPA 3OCLA 1F5MA 3IS2B 2K2NA 1LSVA 3EEAA 3LFVA 4I3AA 5HL6A 4ETXA 5DJTA 3BQ8A 5HPFA 4NXGA 4JGQA 4O01A 2L4RA 2YKFA 4DJ2A 2EWVA 1DP8A 3F1PA 5AJGA 1LT0A 4I5SA 2M7UA 3JVUA 4GHIA 2XSSA 3FC7A 2HJEA 4OOLA 3EQUA 4EETB 5TJJA 3B42A 2A24B 4AFIA 3U2AA 2GNXA 4JGOA 2QWSA 4LPZA 5HWTA 2PD7A 4Y3IA 3JVVA 1NRJA 3O5YA 5F68A 3EOIA 2OOLA 1DRMA 4PKYA 4FOFA 1N9OA 2EA9A 4IHQA 4HJ6A 2O0YA 3MXQA 2K7SA 2INWA 4O8GA 4DMZA 4HJ4A 1YSQA 3HJKA 3V67A 3PBSA 4B93A 2VZWA 1WA9A 4NKPA 5CX7A 1TS6A 3KSHA 3K3DA 3R7WA 4XT2B 2DMWA 2R78A 2JHEA 4M4XA 2P04A 4GJ4A 4H6JA 2J3TD 3OCNA 3PXPA 2KOIA 4BMWA 4NXEA 1GSXA 3UB7A 3EGDC 3LYXA 2QJ7A 4MCWA 3UE6A 1V9YA 3P7NA 4I38A 4WL9A 4L9GA 5DJUA 4MDZA 5J7EA 1S4SA 2WKPA 2V1AA 3T4OA 3LIAA 3PBTA 2W1TA 4G3VA 4EUVA 3R4KA 3C30A 4GCZA 3LUQA 1S1YA 4EQ1A 3CI6A 3OLOA 2HGVA 4F3LB 3NOPC 1EW0A 3BY8A 4K08A 2J3TC 2W27A 3ULFA 1VHMA 3MJQA 4L9EA 3TW8A 4YWZA 3BW6A 1YKDA 2CMNA 4UQIS 2W3DA 3LR4A 5IT5A 3CWFA 3CUEA 5HDSA 2XROA 2HF6A 3EQVA 3OC2A 3H82A 3SW1A 2PD8A 4R38A 3IS2A 5KSHA 2VA0A 2JKRM 2XA7M 1OTAA 4CQHA 4KUOA 3F1OB 4KQOA 4GS9B 3G6OA 4DJ3A 5LBRA 1G6OA 5F5YA 1GSVA 1TS0A 2PT7A 2QJ5A 5HDDA 4WLAA 2XRNA 4HQAA 2A24A 1T1AA 4JGPA 2Y79A 3PBOA 2EWWA 1F9IA 2V0UA 4HJ3A 2HJ9C 5EFWA 1S66L 3NJAA 5G4YA 1LL8A 2GJ3A 5L8MA 5C5KA 2Z6CA 1T1BA 4R6LA 4HP9A 2QYBA 1N9LA 4ETZA 1KOUA 1MKMA 1H3QA 3MFXA 4LRXC 5A8BA 4XT2A 4RQ9A 4KQDA 2NUPC 1XJ4A 2G7UA 3BY9A 3LIDA 4Y2FA 4EU0A 3T4SA 1S4RA 5F6AA 2W3EA 2ZMVA 2JN7A 2O99A 3TJZC 3BWLA 4I3JA 4ARZB 1IOUA 2YKHA 1LSWA 2VGLM 4WUJA 4NXFA 3ZQ5A 1NWZA 4HIAA 1TS8A 2PHYA 3LI8A 2M7VA 2D01A 3E4PA 3MQQA 4F3LA 4HY8A 3LIFA 4I39A 2KX6A 2P08A 4P6ZS 3VE4A 1OPXA 2JKTM 3A0VA 1BYWA 2W3FA 1GSWA 4Z1WA 4IJGA 4YNRA 4MN5A 2M1CA 2MJ6A 3H7WB 3NHQA 5AVEA 3MMHA 3IBJA 1OJGA 1OTBA 2LB5A 3KO6A 1S67L 3D72A 1OTIA 3UE3A 2VJWA 1XFQA 5HSQA 1NLYA 4BBUA 3BQAA 3FG8A 3LI9A 1XJ6A 3PR6A 4IUHA 3F1OA 4GW9A 2WKRA 3E98A 4GS9A 4PAUA 4EXOA 1OTEA 3UMDA 1ODVA 1DP6A 2O9BA 2ZMFA 4MN7A 1OT6A 2OAQ1 5DFXA 3S7NA 5AVFA 3VOLA 1NLZA 3D3OA 3PBNA 4L9FA 4CLCD 1X0OA 3NOUC 5MC7A 2JKRI 2GZAA 2W3HA 4YOFA 2VKSA 5DFYA 3VV4A 4MN6A 4BBVA 4GLQA 4EESA 1P97A 4Q0HA 1G28A 4EEUA 5HDCA 4Q0IA 2VV7A 1T19A 5F69A 3TRCA 5J4EA 2VV8A 1STZA 3F1NB 3GDIA 3KX0X 2A2LA 5I5LA 4HHDA 4PKYG 5HD5A 3W2ZA 1P9RA 1XJ3A 3MR0A 3VE3A 4CLCC 3T4KA 2ZOIA 3RTYA 3UB8A 2V0WA 5HZHA 5HWVA 5IU1A 3FPVA 3T4JA 3TE8A 5DKKA 4CLCE 3PYPA 3LIEA 4HNBA 3OBFA 4ARZA 2IA2A 3C38A 2J3WA 3H9WA 2WKQA 4PHTA 1ZHHB 3CAXA 2PR6A 2D02A 3K2NA 2B18A 3OOVA 3CLOA 1W63M 1H8MA 3UB9A 2PYRA 4EW7A 2W0NA 4BWIA 2KLIA 3BJNA 1W63Q 5TBMB 4UQIM 5HWWA 1V9ZA 3H7WA 3IBRA 4O0PA 2OWJA 3T4LA 3EGXC 1UWNX 5K5BA 1N9NA 4NXBA 1TS7A 1YAXA 2PR5A 3A0SA 4BJPA 4CLCB 1LSXA 3EEHA 2OAP1 3C8CA 4EEPA 4HH2A 1DP9A 1S1ZA 3KYQA 1VB6A 1IFQA 1P9WA 3GECA 3MQOA 3B33A 3UB6A 3MF0A 3A0RA 4KUKA 2JKTI 1ZTUA 4Y5FA 4HH3A 4L0LA 1OT9A 2KDKA 4II7A 2HV1A 4HOIA 3ICYA 5J3WA 2B02A 3FPWA 3LIBA 3KYZA 5G4ZA 4QPRA 2XA7S 3F1PB 5FL3A 2Z6DA 4JGRA 2W1RA 4IUKA 3C2WA 1MC0A 2L1MA 4UEYA 4GHIB 4I3IA 4LRYC 2FZ0A 3RH8B 4HI4A 3KSIA 1P0ZA 2OWHA 3HJIA 4DN0A 3S7OA 2VV6A 2O9AA 1F98A 1OJ5A 2J80A 4WN5A 2PDRA 3EWKA 4FSFA 3PBRA 4WELA 2V1BA 4MMNA 2NUTC 4WEJA 3F1NA 4R70A 3CITA 2V9AA 2FH5A 3DBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIC A;  3E4O A;  1MZU A;  3PHY A;  4R3A A;  4HP4 A;  3UME A;  4B9O A;  1T18 A;  4H6J B;  2P7J A;  4BBT A;  2I9V A;  4E04 A;  4WF0 A;  2BAS A;  2VEA A;  2VLG A;  5DKL A;  1T1C A;  3E4Q A;  2L0W A;  5TBM A;  1UWP X;  4LRZ E;  2H28 A;  5HD3 A;  1XFN A;  1UGU A;  1D7E A;  2QHK A;  2QKP A;  4EER A;  2ZOH A;  1JNU A;  5KIZ A;  3NOT C;  4LLO B;  3T50 A;  3K3C A;  5IS1 A;  1OTD A;  1XJ2 A;  2ZBB A;  1Y28 A;  3H82 B;  1D06 A;  2PYP A;  3IS2 B;  1LSV A;  4I3A A;  5DJT A;  4NXG A;  4JGQ A;  4DJ2 A;  2L4R A;  2YKF A;  1DP8 A;  3F1P A;  1LT0 A;  4I5S A;  4GHI A;  3FC7 A;  4EET B;  2A24 B;  4JGO A;  2QWS A;  4LPZ A;  5HWT A;  2PD7 A;  5F68 A;  2OOL A;  1DRM A;  4PKY A;  1N9O A;  2EA9 A;  4HJ6 A;  3MXQ A;  2K7S A;  2INW A;  4HJ4 A;  3HJK A;  1WA9 A;  1TS6 A;  3K3D A;  4XT2 B;  2R78 A;  2JHE A;  4M4X A;  4H6J A;  4NXE A;  1GSX A;  3UB7 A;  3LYX A;  2QJ7 A;  3UE6 A;  1V9Y A;  3P7N A;  4I38 A;  4WL9 A;  4L9G A;  5DJU A;  5J7E A;  1S4S A;  2WKP A;  2V1A A;  3LIA A;  4GCZ A;  3LUQ A;  1S1Y A;  4EQ1 A;  3OLO A;  4F3L B;  3NOP C;  1EW0 A;  3BY8 A;  4K08 A;  2W27 A;  3ULF A;  3MJQ A;  4L9E A;  4YWZ A;  2CMN A;  3CWF A;  5HDS A;  3H82 A;  3SW1 A;  2PD8 A;  4R38 A;  3IS2 A;  1OTA A;  4KUO A;  3F1O B;  4GS9 B;  3G6O A;  4DJ3 A;  5F5Y A;  1GSV A;  1TS0 A;  2QJ5 A;  5HDD A;  4WLA A;  4HQA A;  2A24 A;  1T1A A;  4JGP A;  2V0U A;  1F9I A;  4HJ3 A;  5EFW A;  1S66 L;  3NJA A;  5G4Y A;  1LL8 A;  2GJ3 A;  2Z6C A;  1T1B A;  4R6L A;  4HP9 A;  1N9L A;  1KOU A;  3MFX A;  4LRX C;  5A8B A;  4XT2 A;  4RQ9 A;  4KQD A;  1XJ4 A;  3BY9 A;  3LID A;  1S4R A;  5F6A A;  2JN7 A;  3BWL A;  4I3J A;  2YKH A;  1LSW A;  4WUJ A;  4NXF A;  3ZQ5 A;  1NWZ A;  4HIA A;  1TS8 A;  2PHY A;  3LI8 A;  2D01 A;  3E4P A;  3MQQ A;  4F3L A;  4HY8 A;  3LIF A;  4I39 A;  2KX6 A;  3VE4 A;  3A0V A;  1BYW A;  1GSW A;  4MN5 A;  2M1C A;  3H7W B;  5AVE A;  3NHQ A;  1OJG A;  1OTB A;  1S67 L;  3D72 A;  1OTI A;  1XFQ A;  5HSQ A;  4BBU A;  3FG8 A;  3LI9 A;  1XJ6 A;  3F1O A;  4GW9 A;  2WKR A;  4GS9 A;  4EXO A;  1OTE A;  3UMD A;  1ODV A;  1DP6 A;  1OT6 A;  5AVF A;  3VOL A;  4L9F A;  1X0O A;  3NOU C;  4MN6 A;  4BBV A;  4EES A;  1P97 A;  1G28 A;  4EEU A;  5HDC A;  2VV7 A;  1T19 A;  5F69 A;  5J4E A;  2VV8 A;  3F1N B;  3GDI A;  3KX0 X;  5I5L A;  4HHD A;  4PKY G;  5HD5 A;  1XJ3 A;  3MR0 A;  3VE3 A;  2ZOI A;  3RTY A;  3UB8 A;  2V0W A;  5HZH A;  5HWV A;  5IU1 A;  5DKK A;  3PYP A;  3LIE A;  4HNB A;  3H9W A;  2WKQ A;  3CAX A;  2PR6 A;  2D02 A;  3CLO A;  3UB9 A;  2PYR A;  4EW7 A;  2W0N A;  5TBM B;  5HWW A;  1V9Z A;  3H7W A;  3IBR A;  2OWJ A;  1UWN X;  1N9N A;  4NXB A;  1TS7 A;  2PR5 A;  3A0S A;  1LSX A;  3EEH A;  3C8C A;  4EEP A;  4HH2 A;  1DP9 A;  1S1Z A;  1VB6 A;  3GEC A;  3MQO A;  3B33 A;  3UB6 A;  3A0R A;  4KUK A;  4HH3 A;  1OT9 A;  2KDK A;  2HV1 A;  4HOI A;  3ICY A;  5J3W A;  2B02 A;  3LIB A;  5G4Z A;  3F1P B;  2Z6D A;  4JGR A;  3C2W A;  2L1M A;  4GHI B;  4I3I A;  4LRY C;  3RH8 B;  4HI4 A;  1P0Z A;  2OWH A;  3HJI A;  2VV6 A;  1F98 A;  1OJ5 A;  2J80 A;  4WN5 A;  2PDR A;  3EWK A;  2V1B A;  3F1N A;  4R70 A;  2V9A A; 
#chains in the Genus database with same CATH topology
 1TF1 A;  4JLF A;  3GTC A;  5GHY A;  5EPH A;  4DE2 A;  3VP3 A;  4BQM A;  1WE4 A;  1MZU A;  4LV0 A;  1E4D A;  1YLZ A;  1BT5 A;  4HP4 A;  1F2K A;  2OV5 A;  2XFS A;  4KZ4 A;  3CUE C;  3UME A;  3W4O A;  4B9O A;  4BL2 A;  3CMZ A;  5TFQ A;  2GX5 A;  4A5R A;  3ZYT A;  4MNR A;  4ME4 A;  3LEZ A;  2BAS A;  4P6Z M;  2W3G A;  2VLG A;  3N4I A;  4ZRR A;  1IYP A;  2Y2L A;  2Y8H A;  2VGL S;  2L0W A;  4KQR A;  5TBM A;  2H28 A;  5DF9 A;  4D2O A;  4M3K A;  5HPI A;  1RP5 A;  3LR3 A;  4NEE D;  3S7P A;  3KSG A;  2ZQ9 A;  1N4O A;  3Q1F A;  2DNS A;  4G3K A;  2ZBB A;  3H82 B;  1Y28 A;  5M19 A;  4RYE A;  4R4R A;  1K54 A;  1MWR A;  4N9L A;  4JGQ A;  4O01 A;  3S4X A;  5GLC A;  1IYS A;  2H0Y A;  1FCN A;  4GHI A;  5TR7 A;  2HJE A;  2C5W B;  3EQU A;  4EET B;  3A3E A;  3B42 A;  2OLV A;  2XQZ A;  4JGO A;  5M18 A;  1KE0 A;  4X68 A;  2ZM8 A;  1NRJ A;  3GSG A;  1ZKJ A;  4WMC D;  4ZAM A;  2O0Y A;  4DXC A;  5IHV A;  2K7S A;  4OP5 A;  5L10 A;  1YSQ A;  3HJK A;  4KEN B;  2VZW A;  1TS6 A;  5KMW A;  2DMW A;  1W8Y A;  2R78 A;  3Q07 A;  4K0W A;  1L0G A;  4GJ4 A;  2J3T D;  1J9M A;  3OCN A;  4ZJ1 A;  3ZCZ A;  3UB7 A;  3FZC A;  2QJ7 A;  4MCW A;  2WAF A;  1PWC A;  1XXM A;  5EOO A;  4WL9 A;  4L9G A;  4MDZ A;  4Y15 A;  1S4S A;  3P98 A;  2WKP A;  3B3X A;  3LIA A;  3PBT A;  3IXH A;  3UPN A;  4G3V A;  5CHM A;  2HP5 A;  4PM7 A;  2HGV A;  3NOP C;  1XPB A;  2J7V A;  3CJM A;  3MXS A;  3A3I A;  1YKD A;  3MBZ A;  2XEP A;  2JC7 A;  3LR4 A;  5HAI A;  5HDS A;  3CUE A;  1BLC A;  3EQV A;  3OC2 A;  3H82 A;  1LL5 A;  2PD8 A;  5FAQ A;  1K56 A;  4KQO A;  3HVF A;  1K0K A;  4DJ3 A;  4ZTK A;  2RL3 A;  3HLE A;  4UAA A;  1HTZ A;  4Y7P A;  4ZJ3 A;  2QJ5 A;  4U3T A;  3TG9 A;  2ZLY A;  4LV1 A;  2G2W A;  3ZNY A;  2Y4A A;  4WM9 A;  3PBO A;  2EWW A;  3JYI A;  1TVF A;  4E3L A;  1JWZ A;  2ZMA A;  2QPN A;  1YLT A;  1TEM A;  3ZG7 B;  2Z6C A;  4QD4 A;  4R6L A;  1H0M A;  2Y2M A;  5EOE A;  3ZDJ A;  2AVX A;  3ZVW A;  1BUE A;  2FFF B;  4S2J A;  2G7U A;  4Y2F A;  3T4S A;  2Y2G A;  3C5A A;  2O99 A;  5F1G A;  3BWL A;  1YQS A;  3MKF A;  1YLJ A;  2VGL M;  1W79 A;  1IKG A;  4E3K A;  1NWZ A;  3O88 A;  2PHY A;  2D01 A;  3OZH A;  3NEC A;  3ZFZ A;  5FQK A;  1VEU B;  4I39 A;  2Y91 A;  3PAG A;  1OPX A;  2JKT M;  3MZD A;  1BYW A;  3BLS A;  4IJG A;  4YNR A;  4MN5 A;  3WWX A;  3IBJ A;  5CEB A;  1OJG A;  3G35 A;  1OTB A;  2Z2L B;  4JKT A;  4DRT A;  3IX3 A;  5HSQ A;  2VGJ A;  4MBK A;  4KG6 A;  1U60 A;  1K6S A;  1C3B A;  3BYD A;  4LCM A;  5HFO A;  3VOY A;  3UMD A;  1ODV A;  5CEC A;  5AQ9 A;  3S7N A;  5U47 A;  5FQ9 A;  4QY5 A;  2Y2N A;  2V8C A;  2JKR I;  2VKS A;  1NJ4 A;  4MN6 A;  4EES A;  3IXG A;  5HDC A;  4DDS A;  3UDX A;  3VFH A;  4LEN A;  3W4Q A;  5JYP A;  3W2Z A;  1M6K A;  4Y17 A;  3V50 A;  2BG1 A;  3UB8 A;  3OPH A;  1Y54 A;  5IU1 A;  3FPV A;  4KZ3 A;  3UE1 A;  3PYP A;  2OLU A;  2J3W A;  2WKQ A;  2PAV P;  3DWK A;  2Y2I A;  4EW7 A;  5TGF A;  4BWI A;  3M2K A;  2Z2M B;  3PTE A;  1ES2 A;  3BJN A;  5EV0 A;  5GL9 A;  4MLL A;  2OWJ A;  3T4L A;  3HUM A;  3A3F A;  5FSR A;  1DJC A;  5HAQ A;  1S0W A;  2PR5 A;  2OAP 1;  4FCF A;  4EEP A;  2XD5 A;  1I5Q A;  1S1Z A;  5HL1 A;  1IFQ A;  2ZM2 A;  4NK3 A;  3GEC A;  3A0R A;  4KUK A;  2WKI A;  2KDK A;  2HV1 A;  2B02 A;  2UV0 E;  3V5M A;  3LIB A;  4N92 A;  4JPM A;  4Y13 A;  5G4Z A;  4QPR A;  4JXV A;  2XA7 S;  5FL3 A;  1BSG A;  3D4F A;  4H8R A;  1YPR A;  3KSI A;  3SS3 A;  3HJI A;  4DN0 A;  3LEQ A;  2VV6 A;  2O9A A;  1OJ5 A;  3IWI A;  3FV7 A;  4FSF A;  3NDE A;  2NUT C;  4K91 A;  4GD6 A;  2V2F F;  1GHM A;  3HCY A;  4PM6 A;  1CEF A;  4S2N C;  5E2E A;  2IWB A;  3MQ0 A;  1XGJ A;  3HBR A;  5I94 A;  1J3W A;  4EUZ A;  3R7W B;  2ZC5 B;  3D9Y A;  1T18 A;  4G3W A;  2P7J A;  4PM9 A;  5CTM A;  1SZV A;  1SCW A;  1YMX A;  2VEA A;  5EVI D;  3N8S A;  3T4T A;  4S2P A;  4UA6 A;  2IWD A;  3VP2 A;  1CI8 A;  4GKU A;  2W1T B;  1FR6 A;  1T1C A;  1JVJ A;  1UWP X;  4LRZ E;  5HD3 A;  3C4P A;  1GCE A;  2H10 A;  3NDG A;  1G68 A;  2QKP A;  3P01 A;  3IH8 A;  3S7Q A;  1ES5 A;  3WRT A;  3NOT C;  5A90 A;  4QY6 A;  4DE0 A;  1XJ2 A;  5DF8 A;  2PYP A;  4RX2 A;  2P9V B;  5CED A;  3LFV A;  2HP9 A;  4RX3 A;  4Y0O A;  4NXG A;  2L4R A;  1DP8 A;  3G34 A;  5F82 A;  3DWZ A;  3QHY A;  3CG5 A;  3JVU A;  3FC7 A;  2R9W A;  4OP8 A;  3OPL A;  1W8Q A;  4OOL A;  2H5S A;  3WS4 A;  5TJJ A;  3KYE A;  2PU4 A;  3DTK A;  3HLF A;  2A24 B;  4AFI A;  3QP5 A;  2PD7 A;  2V20 A;  3SOI A;  3DAV A;  3EOI A;  4LFU A;  4DE3 A;  2OOL A;  4OPZ A;  4PKY A;  1PZP A;  2WZX A;  1L2S A;  4IHQ A;  4EBP A;  3MXQ A;  1DY6 A;  2INW A;  4O8G A;  4HJ4 A;  3V67 A;  5CHJ A;  3NY4 A;  3PBS A;  1WA9 A;  1K55 C;  5KSC A;  3K3D A;  1S6R A;  3R7W A;  4XT2 B;  1BZA A;  4LCL A;  1FSW A;  2P04 A;  5G18 A;  3PXP A;  4BMW A;  3CPT B;  3DTE A;  5FQQ A;  4KZA A;  3EGD C;  3UE6 A;  1ES4 A;  3BLM A;  4OH0 A;  1K38 A;  5J7E A;  4OQG A;  2V1A A;  3T4O A;  4NG2 A;  2W1T A;  4EUV A;  3R4K A;  1FQG A;  3GMW A;  2ZD8 A;  1FCM A;  4S2O A;  3LUQ A;  1FIL A;  3UDF A;  3OLO A;  1PWD A;  4WMC A;  4F3L B;  5L07 A;  1EW0 A;  3W8K A;  2W27 A;  2R9X A;  4S2N A;  3ULF A;  1VHM A;  3JPU A;  3MJQ A;  4L9E A;  4YWZ A;  5A92 A;  2Y2J A;  5F83 A;  2CMN A;  4PM5 A;  4DKI A;  5FQM A;  2JKF A;  4O7D A;  1PI5 A;  4BL3 A;  3SS5 A;  2B95 A;  2P9V A;  5KSH A;  2VA0 A;  3V3S A;  2JKR M;  2XA7 M;  2XH9 A;  3SH7 A;  5EVL A;  1OTA A;  4CQH A;  4YFM A;  4KUO A;  3UB5 P;  3F1O B;  3QNC A;  5A93 A;  4X1L A;  1LL9 A;  5LBR A;  3BFE A;  1G6O A;  1Z6F A;  4IVK A;  5F5Y A;  1FSY A;  1TS0 A;  5E2F A;  2PT7 A;  1IYQ A;  4N9K A;  5HDD A;  1K57 A;  2XRN A;  3IXB A;  2A24 A;  4JGP A;  5AQB A;  2Y79 A;  2V0U A;  1F9I A;  1SDN A;  2HJ9 C;  1E3U D;  5EVE A;  1T1B A;  1YLY A;  3LY4 A;  2A49 A;  1XX2 A;  1KOU A;  5HAP A;  4LRX C;  4XT2 A;  5J8X A;  4RQ9 A;  3VOZ A;  4KQD A;  3SH9 A;  3TSG A;  1XJ4 A;  4C6Y A;  3BY9 A;  1VQQ A;  3CPT A;  2W3E A;  2ZMV A;  4I3J A;  2XF3 A;  2XK1 A;  3ZQ5 A;  1TS8 A;  3LI8 A;  3O86 A;  2M7V A;  3MQQ A;  2GDN A;  1PFL A;  4F3L A;  4HY8 A;  1ONG A;  2VGK A;  2P08 A;  3UPP A;  2QMI A;  1KGE A;  4R4S A;  3LCE A;  1LHY A;  1O07 A;  2J9P A;  5FDH A;  2MJ6 A;  3H7W B;  3NHQ A;  4WZ5 C;  3ZG5 A;  3I7J A;  5CRF A;  3KO6 A;  3D72 A;  3ITA A;  1OTI A;  3UE3 A;  1CI9 A;  4P85 A;  2VJW A;  1NLY A;  3FG8 A;  5E43 A;  2ZL1 B;  3F1O A;  2WKR A;  3E98 A;  4C75 A;  1OTE A;  4C3Q A;  2O9B A;  4JF4 A;  1HLU P;  2OAQ 1;  5FI6 A;  4E6X A;  3QP8 A;  5AVF A;  1ZC2 A;  3A3J A;  3VOL A;  3D3O A;  4LV2 A;  3O87 A;  2GZA A;  2A3U A;  4YOF A;  3HUO A;  1DJB A;  4OVD A;  5DFY A;  5DF7 A;  3G2Z A;  4BBV A;  4Q0H A;  4EEU A;  3SH8 A;  1T19 A;  3IT9 A;  4WYY A;  1N9B A;  3F1N B;  1JWP A;  2WK0 A;  3KX0 X;  4MBF A;  2A2L A;  4KZ6 A;  3T12 B;  1XP4 A;  4CLC C;  3U4L P;  1MWU A;  3RTY A;  1KGG A;  4KZ9 A;  4HBU A;  3PAE A;  3TE8 A;  4X55 A;  4CLC E;  3NI9 A;  4OLD A;  2EX6 A;  4FH2 A;  1ZHH B;  4OPQ A;  2PR6 A;  3GRJ A;  5EVI C;  3K2N A;  2B18 A;  3OOV A;  3CLO A;  4E3I A;  1CEG A;  2X71 A;  1KDW A;  4E3M A;  3HLG A;  4ESP A;  1M40 A;  1V9Z A;  5DTS A;  4X69 A;  3H7W A;  3IBR A;  3EGX C;  1UWN X;  3UPO A;  4NXB A;  1TS7 A;  1YAX A;  3HLD A;  3E2K A;  4CLC B;  5GLD A;  1DP9 A;  1VB6 A;  4IED A;  4XXR A;  1EWZ A;  3MQO A;  2ZL1 A;  1PYY A;  5DTK A;  4X56 A;  4Y5F A;  4L0L A;  5GHX A;  3ICY A;  5J3W A;  5GHZ A;  1I2W A;  2EXB A;  3T1R A;  1QME A;  5EVI B;  5CGS A;  4X53 A;  4MBH A;  4S2I A;  3Q7Z A;  3HLW A;  4R23 A;  4DF6 A;  1RCJ A;  2X01 A;  4LRY C;  4WZ5 A;  4RA7 A;  1P0Z A;  4Z9Q A;  3S22 A;  2J80 A;  1CK3 A;  2PDR A;  2HDQ A;  3HL9 A;  2V1B A;  1O7E A;  1K56 D;  3F1N A;  3FYZ A;  5AJG A;  2IA2 A;  2V9A A;  4OON A;  5E2G A;  3LIC A;  4KZ5 A;  2WAD A;  4E3O A;  1ESI A;  5CGW A;  1ES3 A;  1K4F A;  3VP4 A;  3IWO A;  4FTX A;  5F1F A;  2LB9 A;  4PPR A;  3KSF A;  1SKO B;  3UDI A;  3N6I A;  4BBT A;  2I9V A;  1YMS A;  2VX8 A;  1SDE A;  2K31 A;  4WF0 A;  4ID4 A;  4R0Q A;  3RFB A;  1TD5 A;  4D60 A;  5DKL A;  3WS2 A;  4U0T A;  1W7F A;  1W5D A;  3IX4 A;  5FA7 A;  3B47 A;  4Q0J A;  1MKI A;  1UGU A;  1PWG A;  1BLS A;  3UN7 A;  2Y2Q A;  3WS5 A;  4CLC A;  4EER A;  1OME A;  2ZOH A;  3G32 A;  5KIZ A;  1JWV A;  4LLO B;  3WS0 A;  3UY6 A;  3K3C A;  1OTD A;  4WEK A;  3L7H A;  1VEU A;  1ERO A;  2ZJ9 A;  4Y0U A;  1D06 A;  1ERM A;  3DTM A;  3IF6 C;  4EBL A;  1BTL A;  1F5M A;  5E2H A;  2WUQ A;  1AWI A;  2X02 A;  4GB7 A;  1LSV A;  3EEA A;  4I3A A;  5EVI A;  2EX9 A;  3BFC A;  5DJT A;  2ZQ7 A;  1CF0 A;  2YKF A;  2EWV A;  1WYB A;  2J9O A;  1LT0 A;  3UO9 A;  2B5R A;  5EE8 A;  3BFD A;  4P87 A;  1L3L A;  2WKH A;  1MBL A;  4XUZ A;  4Y0T A;  3U2A A;  1FR1 A;  4Y3I A;  5F68 A;  3O5Y A;  1H8Y A;  2QZ6 A;  2Q9N A;  1DRM A;  1G6A A;  2ZQA A;  4FOF A;  1N9O A;  2EA9 A;  5FAP A;  4NET A;  2ACG A;  4DMZ A;  1PI4 A;  3WS1 A;  4E6W A;  4B93 A;  5CX7 A;  3KSH A;  1SKO A;  3QP1 A;  4M4X A;  2KOI A;  4NXE A;  3LYX A;  3CZD A;  1AXB A;  1V9Y A;  3P7N A;  3Q82 A;  4I38 A;  5HX9 A;  3BFF A;  1FIK A;  3C30 A;  3G30 A;  4GCZ A;  1VM1 A;  5A91 A;  3BY8 A;  4DE1 A;  4K08 A;  2J3T C;  2JKG A;  5CTN A;  3MFD A;  1DJA A;  3TW8 A;  3BW6 A;  5FQI A;  2W3D A;  5IT5 A;  2XRO A;  2HF6 A;  3SW1 A;  3LGO A;  4R38 A;  2ZC3 B;  1SKF A;  4OPY A;  3VMA A;  4S2K A;  4BEN A;  2PU2 A;  3ZNT A;  1MWS A;  5L09 A;  4HQA A;  4JXW A;  1GHP A;  1LLB A;  2WZZ A;  3HLB A;  4S2M A;  5EFW A;  3NJA A;  5G4Y A;  5L8M A;  4HES A;  2H0T A;  1PZO A;  4P0M A;  1K54 C;  4GN2 A;  4HP9 A;  5D3O A;  3ZG9 B;  2FFY A;  1N9L A;  1HVB A;  1MKM A;  1H3Q A;  4ZJ2 A;  3IH9 A;  2HP6 A;  5A8B A;  5FEG A;  3NBL A;  2NUP C;  3QP4 A;  4R1G A;  3VP0 A;  4R3B A;  4EU0 A;  1NRF A;  2JN7 A;  3TJZ C;  4ARZ B;  1LSW A;  3MSH A;  1VET B;  3VSL A;  4NXF A;  1SHV A;  2JBF A;  4DXB A;  3E4P A;  3GV9 A;  4OOY A;  1K25 A;  2KX6 A;  1IEM A;  1HD8 A;  5GLA A;  1KVM A;  4GOG A;  2W3F A;  3P09 A;  3BRM A;  3MMH A;  4GD8 A;  3AGD A;  5FEF A;  4F94 A;  2LB5 A;  1S67 L;  2Y59 A;  2XD1 A;  3W4P A;  2EX2 A;  3LI9 A;  3PR6 A;  2Q9M A;  4PAU A;  2EXA A;  1DP6 A;  3LY3 A;  2ZMF A;  3C7U A;  3HUN A;  1OT6 A;  5DFX A;  4KZ8 A;  3IHB A;  3GQZ A;  1JTD A;  1NLZ A;  1X0O A;  3G2Y A;  5MC7 A;  2W3H A;  4BD0 A;  1P97 A;  1G28 A;  3A3D A;  4OPR A;  3MZF A;  4Q0I A;  2VV7 A;  5F69 A;  1TDG A;  1ACF A;  5J4E A;  2ZM0 A;  1H8Z A;  3GDI A;  1YT4 A;  1BLP A;  3ZG8 B;  3LO7 A;  5I5L A;  1MXO A;  1P9R A;  1XJ3 A;  3GR2 A;  1NZU A;  3MR0 A;  3T4K A;  2HDS A;  2V0W A;  5HZH A;  1YLW A;  3T4J A;  3N7W A;  4FD8 A;  2C6W B;  2Y2P A;  4OLG A;  4HNB A;  1ZG4 A;  4ARZ A;  4QJG A;  4B4Z A;  3C38 A;  3H9W A;  2HDR A;  1VET A;  1IEL A;  4WBG A;  4PM8 A;  1W63 M;  1H8M A;  3UB9 A;  2EFU A;  1FCO A;  5EUA A;  2KLI A;  5CER A;  1Q2P A;  1W63 Q;  3IWQ A;  1ZG6 A;  4O0P A;  5CGX A;  3BEC A;  4X6T A;  1LSX A;  1NXY A;  3DTI A;  4LGW A;  3V39 A;  1Y4O A;  3KYQ A;  1GA0 A;  1IYO A;  4CPK A;  3UB6 A;  3B33 A;  3MF0 A;  3NUL A;  1A0K A;  4KG5 A;  1OT9 A;  4II7 A;  3WRZ A;  4PMA A;  3M6H A;  3FPW A;  2IWC A;  2Y2K A;  3T1X A;  2ZC6 B;  3F1P B;  1K55 A;  2Y2O A;  4GNU A;  2W1R A;  1MC0 A;  2L1M A;  4UEY A;  2FZ0 A;  3RH8 B;  4HI4 A;  4JF6 A;  2JE5 A;  1XA7 A;  2OWH A;  3S7O A;  1XGI A;  1F98 A;  2Y2H A;  1K4E A;  4WN5 A;  3EWK A;  4GDB A;  1YM1 A;  3PBR A;  4WEL A;  2V8F A;  3IQA A;  5FDS A;  3CIT A;  3M6B A;  2FH5 A;  3DBA A;  3T4Q A;  3E4O A;  2WKE A;  5FAS A;  4QB8 A;  3PBQ A;  3FKV A;  3PHY A;  4R3A A;  3E0Y A;  1MPL A;  3GVB A;  4H6J B;  3MKE A;  1NY0 A;  4E04 A;  4Q8I A;  4OOM A;  3VSK A;  2PBD P;  4FUW A;  3T1Q B;  2J8Y A;  4BLM A;  3LR5 A;  2O9C A;  3OPR A;  4OKP A;  4UHU A;  3E4Q A;  2Q0O A;  1XFN A;  1BLH A;  3IF5 A;  3IXD A;  1EI5 A;  1D7E A;  5FI7 A;  1HZO A;  2QHK A;  3VP1 A;  1I2S A;  3HRE A;  1H5X A;  1RGZ A;  5CHU A;  2CC1 A;  1JNU A;  1YSP A;  4QU3 A;  3T50 A;  5IS1 A;  3SS4 A;  1PW1 A;  3O3V A;  4EV4 A;  3LR0 A;  3IX8 A;  1XA1 A;  2UWX A;  3OCL A;  3IS2 B;  3NIA A;  2K2N A;  5HL6 A;  4OQI A;  4ETX A;  3AGE A;  4B4X A;  3BQ8 A;  2WGV A;  5HPF A;  4DJ2 A;  3F1P A;  4QWO A;  4I5S A;  1IKI A;  4KZB A;  2M7U A;  5AQA A;  3C4O A;  5CXW A;  2XSS A;  2Y55 A;  2P74 A;  3MXR A;  2GNX A;  2QWS A;  4LPZ A;  5HWT A;  3JVV A;  4OQ0 A;  4HJ6 A;  4IVI A;  2WAE A;  3OPP A;  4NKP A;  2XR0 A;  4QHC A;  2PRF A;  2HZ5 A;  3HLC A;  2JHE A;  4H6J A;  3FWL A;  3AGF A;  1GSX A;  3ZHH A;  3ISG A;  3N8L A;  1L0E A;  5DJU A;  4IBX A;  3QNB A;  1LI0 A;  2DRW A;  3ZGA B;  4EQ1 A;  1S1Y A;  3CI6 A;  2WGI A;  3MS6 A;  1JTG A;  3M2J A;  4OQH A;  3T1S A;  1RGY A;  2EFX A;  3VFF A;  3BFG A;  2EX8 A;  4EQI A;  4UQI S;  1BUL A;  2G2U A;  1KDS A;  1KGF A;  1MWT A;  3CWF A;  1ALQ A;  4R3J A;  3SZT A;  4UA7 A;  3IS2 A;  2BLS A;  3L9K A;  4GZB A;  3ZG0 A;  4LV3 A;  4X25 A;  4GS9 B;  3G6O A;  2ZC4 B;  1GSV A;  5HW3 A;  3ITB A;  4B88 A;  2E8J A;  5DTT A;  4WLA A;  3FKW A;  5HAR A;  2V1Z A;  1T1A A;  4K0X A;  5JYO A;  5AQ7 A;  2I72 A;  4HJ3 A;  1KE3 A;  1YLP A;  2DCF A;  1S66 L;  1LL8 A;  2GJ3 A;  5C5K A;  3Q7V B;  5EM0 A;  4JXS A;  1CQA A;  1Z09 A;  1PRQ A;  3RJU A;  1K6R A;  2QYB A;  4X1M A;  4ETZ A;  1PNE A;  1LI9 A;  1PIO A;  4YIN A;  3MFX A;  4DDY A;  3G31 A;  3N8R A;  3LID A;  4UA9 A;  1S4R A;  5F6A A;  4KZ7 A;  1IOU A;  2YKH A;  4WUJ A;  5FI2 A;  4HIA A;  3IF6 B;  1WYC A;  2ZQ8 A;  4HEF A;  3E2L A;  3LIF A;  3UNW A;  3NCK A;  4P6Z S;  3VE4 A;  3A0V A;  5M1A A;  3S1Y A;  1QMF A;  1GSW A;  4Z1W A;  1PW8 A;  2M1C A;  5AVE A;  4JXG A;  3QP6 A;  2XGN A;  5DVA A;  3BM6 A;  2JCH A;  4GDN A;  4FH4 A;  3NC8 A;  4CJN A;  2ZC7 A;  1XFQ A;  4BBU A;  3BQA A;  3RXX A;  1XJ6 A;  4IUH A;  4GW9 A;  1ERQ A;  4GS9 A;  4EXO A;  1D1J A;  4U0X A;  3C7V A;  4MN7 A;  4E3N A;  4E3J A;  1XKZ A;  1Q2Q A;  2XFT A;  5KZH A;  3PBN A;  4L9F A;  2WGW B;  4CLC D;  3NOU C;  2WYX A;  1L0D A;  2VK3 A;  3VV4 A;  4GLQ A;  2HPB A;  3Q7V A;  5EEC A;  3TRC A;  4BD1 A;  1E25 A;  3CHW P;  2VV8 A;  1STZ A;  4ZBE A;  4HBT A;  1G5U A;  4HHD A;  4PKY G;  5HD5 A;  3VE3 A;  2ZOI A;  5HWV A;  3MZE A;  1K57 C;  3TOI A;  3UE0 A;  5DKK A;  3LIE A;  5FQJ A;  3OBF A;  4N1H A;  1CJF A;  4PHT A;  1GA9 A;  3CAX A;  2XDM A;  4ZDX A;  2D02 A;  3IF6 A;  4P6B A;  1NYY A;  2PYR A;  2W0N A;  5FAT A;  5L2F A;  3BEB A;  1TDL A;  5TBM B;  1MY8 A;  4UQI M;  5HWW A;  5BOH A;  2OSU A;  1L0F A;  3RXW A;  5K5B A;  1N9N A;  4WZ4 A;  4MEZ A;  3A0S A;  4BJP A;  4IBR A;  3EEH A;  3C8C A;  4KQQ A;  3G4P A;  4HH2 A;  1ONH A;  4JBF A;  1P9W A;  4XUX A;  1E3U A;  2PBY A;  3IHA A;  2XLN A;  1GHI A;  2JKT I;  1KE4 A;  1ZTU A;  4JF5 A;  3QP2 A;  4HH3 A;  2E8I A;  4HOI A;  4EWF A;  3KYZ A;  4N1X A;  3V3R A;  4KG2 A;  4S2L A;  2HDU A;  3ZVT A;  2ZQD A;  2Z6D A;  4JGR A;  2RCX A;  4IUK A;  3C2W A;  2ZQC A;  4EBN A;  3Q81 A;  1FOF A;  2WGW A;  3DW0 A;  4GHI B;  4I3I A;  2BTF P;  4RVA A;  1KVL A;  1NZO A;  1NYM A;  5EM1 A;  5FAO A;  4MMN A;  5GLB A;  4WEJ A;  1ESU A;  4R70 A; 
#chains in the Genus database with same CATH homology
 1TF1 A;  3LIC A;  3T4Q A;  3HCY A;  3E4O A;  3MQ0 A;  1MZU A;  3PBQ A;  3PHY A;  2LB9 A;  3KSF A;  4R3A A;  3E0Y A;  4HP4 A;  3R7W B;  3CUE C;  3UME A;  4B9O A;  1T18 A;  4H6J B;  4G3W A;  2GX5 A;  2P7J A;  4BBT A;  2I9V A;  3ZYT A;  2VX8 A;  4E04 A;  2K31 A;  4OOM A;  4ME4 A;  4WF0 A;  2BAS A;  2VEA A;  4P6Z M;  2W3G A;  3LR5 A;  3T4T A;  2VLG A;  3RFB A;  2O9C A;  4ZRR A;  1TD5 A;  2W1T B;  5DKL A;  1T1C A;  2Y8H A;  2VGL S;  2L0W A;  3E4Q A;  5TBM A;  1UWP X;  4LRZ E;  2H28 A;  5HD3 A;  3B47 A;  1XFN A;  4Q0J A;  5DF9 A;  1UGU A;  1D7E A;  5HPI A;  2QHK A;  4CLC A;  3LR3 A;  2QKP A;  4EER A;  3P01 A;  2ZOH A;  4NEE D;  3S7P A;  1JNU A;  3S7Q A;  1YSP A;  5KIZ A;  3NOT C;  4LLO B;  3KSG A;  3T50 A;  3K3C A;  5IS1 A;  1OTD A;  4WEK A;  4G3K A;  1XJ2 A;  2ZBB A;  1Y28 A;  3H82 B;  3LR0 A;  1D06 A;  2PYP A;  3OCL A;  1F5M A;  3IS2 B;  2K2N A;  1LSV A;  3EEA A;  3LFV A;  4I3A A;  5HL6 A;  4ETX A;  5DJT A;  3BQ8 A;  5HPF A;  4NXG A;  4JGQ A;  4O01 A;  2L4R A;  2YKF A;  4DJ2 A;  2EWV A;  1DP8 A;  3F1P A;  5AJG A;  1LT0 A;  4I5S A;  2M7U A;  3JVU A;  4GHI A;  2XSS A;  3FC7 A;  2HJE A;  4OOL A;  3EQU A;  4EET B;  5TJJ A;  3B42 A;  2A24 B;  4AFI A;  3U2A A;  2GNX A;  4JGO A;  2QWS A;  4LPZ A;  5HWT A;  2PD7 A;  4Y3I A;  3JVV A;  1NRJ A;  3O5Y A;  5F68 A;  3EOI A;  2OOL A;  1DRM A;  4PKY A;  4FOF A;  1N9O A;  2EA9 A;  4IHQ A;  4HJ6 A;  2O0Y A;  3MXQ A;  2K7S A;  2INW A;  4O8G A;  4DMZ A;  4HJ4 A;  1YSQ A;  3HJK A;  3V67 A;  3PBS A;  4B93 A;  2VZW A;  1WA9 A;  4NKP A;  5CX7 A;  1TS6 A;  3KSH A;  3K3D A;  3R7W A;  4XT2 B;  2DMW A;  2R78 A;  2JHE A;  4M4X A;  2P04 A;  4GJ4 A;  4H6J A;  2J3T D;  3OCN A;  3PXP A;  2KOI A;  4BMW A;  4NXE A;  1GSX A;  3UB7 A;  3EGD C;  3LYX A;  2QJ7 A;  4MCW A;  3UE6 A;  1V9Y A;  3P7N A;  4I38 A;  4WL9 A;  4L9G A;  5DJU A;  4MDZ A;  5J7E A;  1S4S A;  2WKP A;  2V1A A;  3T4O A;  3LIA A;  3PBT A;  2W1T A;  4G3V A;  4EUV A;  3R4K A;  3C30 A;  4GCZ A;  3LUQ A;  1S1Y A;  4EQ1 A;  3CI6 A;  3OLO A;  2HGV A;  4F3L B;  3NOP C;  1EW0 A;  3BY8 A;  4K08 A;  2J3T C;  2W27 A;  3ULF A;  1VHM A;  3MJQ A;  4L9E A;  3TW8 A;  4YWZ A;  3BW6 A;  1YKD A;  2CMN A;  4UQI S;  2W3D A;  3LR4 A;  5IT5 A;  3CWF A;  3CUE A;  5HDS A;  2XRO A;  2HF6 A;  3EQV A;  3OC2 A;  3H82 A;  3SW1 A;  2PD8 A;  4R38 A;  3IS2 A;  5KSH A;  2VA0 A;  2JKR M;  2XA7 M;  1OTA A;  4CQH A;  4KUO A;  3F1O B;  4KQO A;  4GS9 B;  3G6O A;  4DJ3 A;  5LBR A;  1G6O A;  5F5Y A;  1GSV A;  1TS0 A;  2PT7 A;  2QJ5 A;  5HDD A;  4WLA A;  2XRN A;  4HQA A;  2A24 A;  1T1A A;  4JGP A;  2Y79 A;  3PBO A;  2EWW A;  1F9I A;  2V0U A;  4HJ3 A;  2HJ9 C;  5EFW A;  1S66 L;  3NJA A;  5G4Y A;  1LL8 A;  2GJ3 A;  5L8M A;  5C5K A;  2Z6C A;  1T1B A;  4R6L A;  4HP9 A;  2QYB A;  1N9L A;  4ETZ A;  1KOU A;  1MKM A;  1H3Q A;  3MFX A;  4LRX C;  5A8B A;  4XT2 A;  4RQ9 A;  4KQD A;  2NUP C;  1XJ4 A;  2G7U A;  3BY9 A;  3LID A;  4Y2F A;  4EU0 A;  3T4S A;  1S4R A;  5F6A A;  2W3E A;  2ZMV A;  2JN7 A;  2O99 A;  3TJZ C;  3BWL A;  4I3J A;  4ARZ B;  1IOU A;  2YKH A;  1LSW A;  2VGL M;  4WUJ A;  4NXF A;  3ZQ5 A;  1NWZ A;  4HIA A;  1TS8 A;  2PHY A;  3LI8 A;  2M7V A;  2D01 A;  3E4P A;  3MQQ A;  4F3L A;  4HY8 A;  3LIF A;  4I39 A;  2KX6 A;  2P08 A;  4P6Z S;  3VE4 A;  1OPX A;  2JKT M;  3A0V A;  1BYW A;  2W3F A;  1GSW A;  4Z1W A;  4IJG A;  4YNR A;  4MN5 A;  2M1C A;  2MJ6 A;  3H7W B;  3NHQ A;  5AVE A;  3MMH A;  3IBJ A;  1OJG A;  1OTB A;  2LB5 A;  3KO6 A;  1S67 L;  3D72 A;  1OTI A;  3UE3 A;  2VJW A;  1XFQ A;  5HSQ A;  1NLY A;  4BBU A;  3BQA A;  3FG8 A;  3LI9 A;  1XJ6 A;  3PR6 A;  4IUH A;  3F1O A;  4GW9 A;  2WKR A;  3E98 A;  4GS9 A;  4PAU A;  4EXO A;  1OTE A;  3UMD A;  1ODV A;  1DP6 A;  2O9B A;  2ZMF A;  4MN7 A;  1OT6 A;  2OAQ 1;  5DFX A;  3S7N A;  5AVF A;  3VOL A;  1NLZ A;  3D3O A;  3PBN A;  4L9F A;  4CLC D;  1X0O A;  3NOU C;  5MC7 A;  2JKR I;  2GZA A;  2W3H A;  4YOF A;  2VKS A;  5DFY A;  3VV4 A;  4MN6 A;  4BBV A;  4GLQ A;  4EES A;  1P97 A;  4Q0H A;  1G28 A;  4EEU A;  5HDC A;  4Q0I A;  2VV7 A;  1T19 A;  5F69 A;  3TRC A;  5J4E A;  2VV8 A;  1STZ A;  3F1N B;  3GDI A;  3KX0 X;  2A2L A;  5I5L A;  4HHD A;  4PKY G;  5HD5 A;  3W2Z A;  1P9R A;  1XJ3 A;  3MR0 A;  3VE3 A;  4CLC C;  3T4K A;  2ZOI A;  3RTY A;  3UB8 A;  2V0W A;  5HZH A;  5HWV A;  5IU1 A;  3FPV A;  3T4J A;  3TE8 A;  5DKK A;  4CLC E;  3PYP A;  3LIE A;  4HNB A;  3OBF A;  4ARZ A;  2IA2 A;  3C38 A;  2J3W A;  3H9W A;  2WKQ A;  4PHT A;  1ZHH B;  3CAX A;  2PR6 A;  2D02 A;  3K2N A;  2B18 A;  3OOV A;  3CLO A;  1W63 M;  1H8M A;  3UB9 A;  2PYR A;  4EW7 A;  2W0N A;  4BWI A;  2KLI A;  3BJN A;  1W63 Q;  5TBM B;  4UQI M;  5HWW A;  1V9Z A;  3H7W A;  3IBR A;  4O0P A;  2OWJ A;  3T4L A;  3EGX C;  1UWN X;  5K5B A;  1N9N A;  4NXB A;  1TS7 A;  1YAX A;  2PR5 A;  3A0S A;  4BJP A;  4CLC B;  1LSX A;  3EEH A;  2OAP 1;  3C8C A;  4EEP A;  4HH2 A;  1DP9 A;  1S1Z A;  3KYQ A;  1VB6 A;  1IFQ A;  1P9W A;  3GEC A;  3MQO A;  3B33 A;  3UB6 A;  3MF0 A;  3A0R A;  4KUK A;  2JKT I;  1ZTU A;  4Y5F A;  4HH3 A;  4L0L A;  1OT9 A;  2KDK A;  4II7 A;  2HV1 A;  4HOI A;  3ICY A;  5J3W A;  2B02 A;  3FPW A;  3LIB A;  3KYZ A;  5G4Z A;  4QPR A;  2XA7 S;  3F1P B;  5FL3 A;  2Z6D A;  4JGR A;  2W1R A;  4IUK A;  3C2W A;  1MC0 A;  2L1M A;  4UEY A;  4GHI B;  4I3I A;  4LRY C;  2FZ0 A;  3RH8 B;  4HI4 A;  3KSI A;  1P0Z A;  2OWH A;  3HJI A;  4DN0 A;  3S7O A;  2VV6 A;  2O9A A;  1F98 A;  1OJ5 A;  2J80 A;  4WN5 A;  2PDR A;  3EWK A;  4FSF A;  3PBR A;  4WEL A;  2V1B A;  4MMN A;  2NUT C;  4WEJ A;  3F1N A;  4R70 A;  3CIT A;  2V9A A;  2FH5 A;  3DBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...