2K7SA

Human arnt c-terminal pas domain, 3 residue ib slip
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
b'GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSQTAQNPYSDEIETIICTNTNVKNSSQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aryl hydrocarbon receptor nuclear translocator
molecule tags Transcription
source organism Homo sapiens
publication title ARNT PAS-B has a fragile native state structure with an alternative beta-sheet register nearby in sequence space
pubmed doi rcsb
total genus 24
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2k7sA01
3VOLA 1N9LA 2CMNA 4HHDA 3UB6A 4KUKA 5HDSA 5TBMA 1MZUA 1TS8A 1TS6A 3MQOA 4WF0A 1BYWA 4DJ3A 2H28A 1X0OA 4MN5A 4XT2B 1GSXA 1TS0A 2M1CA 3FC7A 3F1NA 2V0UA 2HV1A 3ULFA 3IS2B 1S67L 4HH3A 4GW9A 1S1YA 2L4RA 2ZOHA 3GDIA 4GHIB 3FG8A 1LL8A 5HDDA 3NJAA 2JHEA 1S4RA 1TS7A 2PD8A 1XFQA 3LI9A 5F5YA 5F6AA 1G28A 3LIFA 4HI4A 2R78A 1DP8A 2GJ3A 3H82A 4EEUA 4NXGA 5J7EA 5J3WA 5TBMB 1V9ZA 3H7WB 2QJ5A 4WUJA 3LUQA 4LLOB 1T1AA 2B02A 3F1OA 4WLAA 1T1CA 5DKLA 2VV6A 2D02A 4EETB 4LRYC 5HWWA 2ZOIA 2PYRA 2W0NA 4HJ6A 2QWSA 4HH2A 4RQ9A 4HQAA 5DJTA 5HWTA 3NOUC 1F98A 3UB8A 4F3LA 3LYXA 4HJ4A 2QHKA 4MN6A 1P0ZA 2WKRA 3LIDA 3H9WA 3OLOA 3PYPA 4XT2A 3UB9A 5HWVA 4NXFA 3F1NB 4HY8A 3A0SA 3LIAA 5EFWA 1OJGA 3LI8A 4HIAA 2K7SA 1VB6A 4JGPA 4EESA 4R38A 1EW0A 3C8CA 1T19A 3F1PB 3RH8B 4JGOA 1D7EA 2D01A 3E4QA 5HD5A 1V9YA 1N9NA 4LRXC 3MJQA 4NXBA 3E4OA 2WKQA 4NXEA 2V1BA 3MFXA 4KQDA 4BBVA 4EERA 4JGRA 4EQ1A 4E04A 3HJKA 4KUOA 1DP9A 1OTDA 3CLOA 1LSVA 3PHYA 3P7NA 4H6JA 2KX6A 3EEHA 1OT6A 4WL9A 5AVFA 3CWFA 3IS2A 3NOTC 3UE6A 2YKHA 5HZHA 2QJ7A 3KX0X 1LSXA 1LT0A 5F68A 3GECA 2OWHA 5F69A 3F1PA 3MXQA 4PKYG 5G4YA 3UMEA 1OTBA 1S1ZA 2YKFA 3BY9A 3ICYA 1LSWA 5A8BA 2QKPA 2I9VA 3K3DA 1XJ2A 1Y28A 3T50A 4EXOA 4JGQA 1XFNA 1GSVA 1WA9A 2A24A 3LIBA 4HNBA 4L9GA 4DJ2A 2PR6A 4LRZE 1NWZA 1T1BA 1UGUA 2Z6DA 1S66L 4PKYA 5HD3A 5HDCA 4EW7A 1UWNX 1OTIA 1XJ6A 3NHQA 3G6OA 2VV8A 4EEPA 4HP9A 4F3LB 1DP6A 1T18A 3CAXA 2PHYA 3K3CA 2W27A 4I3JA 4WN5A 4YWZA 2ZBBA 2PR5A 2L1MA 1F9IA 4I38A 2P7JA 1D06A 5I5LA 5IU1A 4B9OA 3MQQA 2L0WA 3MR0A 4L9EA 2EA9A 4R70A 2PYPA 4LPZA 2BASA 5HSQA 2OOLA 4GCZA 3NOPC 2INWA 3EWKA 3H82B 4I39A 3VE4A 3ZQ5A 3A0RA 4BBUA 5G4ZA 3E4PA 3UB7A 4R6LA 1S4SA 4HP4A 3F1OB 3C2WA 3UMDA 4GS9A 3HJIA 2VV7A 1XJ4A 2V9AA 2J80A 3RTYA 2VLGA 1ODVA 1P97A 3VE3A 4H6JB 5IS1A 3LICA 1UWPX 3BWLA 3B33A 3LIEA 4I5SA 1JNUA 2VEAA 1N9OA 2KDKA 4L9FA 2JN7A 4R3AA 1OTEA 2PD7A 4K08A 1OT9A 5AVEA 2PDRA 2V1AA 5KIZA 4HJ3A 3SW1A 2OWJA 3H7WA 4I3IA 4M4XA 3D72A 5DKKA 3IBRA 4GS9B 4GHIA 1OJ5A 2WKPA 1XJ3A 3A0VA 4BBTA 1GSWA 2A24B 4I3AA 5J4EA 1OTAA 4HOIA 5DJUA 1KOUA 3BY8A 1DRMA 2V0WA 2Z6CA
chains in the Genus database with same CATH superfamily
5TBMA 3T1RA 2VK3A 3E0YA 4EBLA 3NECA 3D9YA 4PPRA 2EXBA 3GDIA 3UE3A 3W8KA 1K6RA 5DF7A 1YLYA 5HAQA 4NXGA 4R1GA 4MEZA 4JKTA 3IWQA 3UE0A 2ZOIA 2Y55A 3A3FA 3LIAA 4Q0JA 1FSYA 1ES2A 5HFOA 5HAPA 1LL5A 4RA7A 3DBAA 4CPKA 3RJUA 3UDFA 1OTDA 4JF5A 1OT6A 3M2JA 5F68A 1J3WA 2WKIA 3BY9A 3CJMA 3SS5A 4XUZA 3MXSA 1BLCA 1K54C 2Z6DA 2CC1A 1UWNX 1XX2A 1DP6A 2ZM8A 3C4OA 1ALQA 3QP8A 3V3SA 2OSUA 1D06A 3UDIA 1J9MA 1KVLA 1CEGA 2OOLA 3EGXC 3Q07A 4N92A 4CLCE 5L07A 3OPPA 1PWCA 2KDKA 3BFFA 3G30A 4BL3A 1O07A 3IXHA 3SW1A 5FI6A 4GHIA 3EEAA 3PR6A 5TJJA 1KOUA 3ZG8B 2WGVA 3MQOA 5C5KA 3IF6C 3FPVA 3IF5A 2XQZA 1G5UA 1RCJA 5U47A 3NJAA 3OPRA 1SKFA 3TJZC 1PFLA 3MS6A 2PBDP 5HARA 1N9BA 1PW8A 2JE5A 3K2NA 4JXVA 1I2SA 5FSRA 3G2ZA 4HQAA 1JWPA 2HF6A 2Y2LA 3S1YA 3ZVWA 3H9WA 4XT2A 1ZTUA 4ETXA 4NKPA 4UA6A 2W3EA 4F94A 3T4OA 3E4OA 4KQDA 5AVFA 3PHYA 3P7NA 3UO9A 5FL3A 3WS0A 1XA1A 4CLCC 5E2HA 2HDRA 3HL9A 1Z6FA 1BTLA 3FPWA 5FAQA 4OOLA 5CXWA 3W2ZA 3R7WA 5FEFA 4GOGA 5AQ9A 1T18A 3K3CA 1BZAA 1K55A 4ETZA 4IBXA 1PIOA 4E6XA 2G2UA 1XXMA 3CPTA 5FDHA 3VE4A 1A0KA 4HBTA 3UMDA 3ZVTA 2H5SA 2K2NA 2VLGA 3NDGA 4BLMA 2E8IA 3SS4A 3B33A 3MZEA 1OPXA 5A90A 5GHXA 3IX3A 2HP9A 5DKKA 3S22A 5E43A 1SZVA 2QJ7A 5HW3A 3CPTB 2G2WA 4B88A 3ITAA 3GTCA 4KG2A 1TS6A 1KVMA 4MN5A 5CHUA 3VP2A 3RXWA 4FCFA 3LI9A 2R78A 5D3OA 4BD1A 3S7OA 5TBMB 5FQJA 4OQ0A 3ZYTA 3HUOA 3KSHA 3VP3A 5DJTA 2XFSA 2Y2PA 4OP5A 1FIKA 2XGNA 1ZKJA 3VSLA 2WKRA 1K56A 1VQQA 5HL1A 5HWVA 1YT4A 5EFWA 4DDSA 3M6BA 2R9XA 3CI6A 4DE2A 4MCWA 3MFXA 3HJKA 1TF1A 4XUXA 3CWFA 1XKZA 2YKFA 2W3DA 3WWXA 4OQGA 2HDUA 1XFNA 2J9OA 4HNBA 4S2NC 3IF6B 1EI5A 4FSFA 1GHMA 4YFMA 3UE1A 4E3LA 4EEPA 5AQBA 4WN5A 5DFXA 3MR0A 1H8ZA 2EA9A 2OAQ1 3IH9A 3SOIA 3E4PA 3UNWA 1G6AA 2WADA 2V9AA 3VE3A 4H6JB 4MN7A 4WZ5A 4Q0IA 4FTXA 2IWBA 4K08A 5A93A 3WRZA 3IWIA 1WYBA 5AVEA 2OV5A 3WRTA 3S7PA 3G2YA 3A3IA 3HLWA 4U0XA 2XROA 2IWDA 3IXGA 3FKWA 1LHYA 1ES5A 3OPHA 3IS2B 3BFCA 2L4RA 4GHIB 3TOIA 4IHQA 5EPHA 4RVAA 1XFQA 2W3FA 2Y8HA 3KSGA 5F5YA 1GCEA 4E6WA 3H82A 3DTKA 4LLOB 5L2FA 4PHTA 3N8LA 4DE1A 2JKRM 3VSKA 4E3JA 2QWSA 5EE8A 2H0YA 3OLOA 4C3QA 5F1FA 2X01A 1IEMA 3WS2A 4ZJ1A 1BSGA 4S2NA 2D01A 2ZMFA 1N9NA 4LRXC 3UPNA 2WKQA 2QYBA 3HLDA 1CK3A 3C38A 2W1RA 3GRJA 3WS4A 3SH8A 1W8YA 3KX0X 3PAGA 1SCWA 1BULA 3UPOA 5F1GA 1W8QA 1NZOA 3ISGA 1UGUA 1T1BA 3OZHA 5HD3A 1IKGA 4I3JA 2EFUA 4HEFA 4KQQA 3VP1A 1D1JA 2XD5A 3MQQA 4R4RA 1NY0A 4JXGA 1SDNA 3E2LA 3F1OB 2P9VB 1FOFA 5IHVA 3LIEA 3HUNA 4EBPA 1NLZA 3LY4A 4GS9B 2VGJA 2W1TB 3GMWA 4HOIA 5DJUA 2CMNA 2VX8A 2ACGA 1LLBA 4WF0A 4DJ3A 1M40A 4XT2B 4DE3A 4E3NA 1VHMA 3VP0A 4ARZA 4O01A 2ZQDA 4HH3A 3VFHA 3IHBA 2PD8A 5F6AA 2ZQAA 2A49A 5J7EA 3O3VA 4WEJA 2HDSA 3QP4A 1RGZA 3BFGA 4UQIM 4RQ9A 2ZQ9A 4F3LA 5KSCA 2Q9NA 1L0EA 1G68A 4S2JA 3LI8A 5KSHA 3DAVA 1ZHHB 4Y17A 2EFXA 1K54A 4JGRA 4GLQA 4E3IA 4B4XA 4E04A 3S4XA 3NCKA 4G3VA 4Z1WA 2Y2HA 4B93A 3SZTA 2JBFA 2HDQA 1ES3A 1WA9A 5A92A 4A5RA 2Y79A 4U0TA 5HDCA 2VKSA 4C6YA 1QMEA 4QD4A 1P9WA 3KYQA 1XA7A 2Z2MB 3ZG5A 4QJGA 1F9IA 1U60A 2P7JA 4IUHA 4M3KA 4B9OA 1EROA 4QPRA 4AFIA 5FI2A 1IFQA 3EWKA 4BBUA 1MC0A 4KG5A 4GDNA 1NRFA 4EV4A 4N9KA 3VFFA 1O7EA 1BLSA 1YMXA 2EX6A 3V67A 1YKDA 1PI4A 3H7WA 1KGGA 1JVJA 5M18A 2O0YA 1GSWA 4I3AA 4KZ6A 4JF6A 1DRMA 2Z6CA 4ZDXA 4HHDA 1MZUA 2VA0A 1TS8A 3RXXA 3B42A 1ZG4A 2V0UA 1H3QA 3P09A 2PU4A 2HP6A 4GW9A 3QNBA 5L09A 4X55A 2GJ3A 2P04A 4WUJA 5J8XA 1T1AA 3T1QB 1ERMA 2VV6A 4Y5FA 4QU3A 4FH4A 5EVLA 5HWTA 3OBFA 4L0LA 5I94A 4HBUA 1P0ZA 1W5DA 4U3TA 3FV7A 4H8RA 4HY8A 1PW1A 1VM1A 3C8CA 4R4SA 2V20A 4Y13A 4C75A 4QHCA 1PWGA 5J4EA 1XPBA 2HPBA 1TD5A 4JXSA 3HBRA 5CGXA 1STZA 4Y0UA 5E2GA 3MSHA 4GD8A 4LENA 4N1XA 1YAXA 1VEUB 4CQHA 1Y28A 2ZMVA 5KMWA 3T1SA 2VGLS 3D3OA 5DF8A 1W63Q 3T4SA 2KLIA 3QP6A 5E2EA 4OOMA 2PAVP 4I39A 3BJNA 4EUZA 1SKOA 1TDGA 2HP5A 1P97A 3N8RA 2XEPA 3PTEA 1IYPA 2ZC4B 4X69A 1LI0A 5HDSA 1Y4OA 3MF0A 1PNEA 3IWOA 3OC2A 4GKUA 3IXBA 4P6ZM 1LL8A 1HLUP 4BD0A 3LIFA 2Y59A 2OLVA 1IOUA 2B18A 2H0TA 3T4TA 5DKLA 3CUEA 1N4OA 3OPLA 3HLGA 1Q2QA 3LIDA 1ESIA 2BG1A 1K4EA 3TG9A 4HIAA 4OLGA 4YOFA 1D7EA 2ZC6B 2XA7S 5EM1A 4EERA 2ZC5B 1MKMA 5TR7A 4H6JA 1G6OA 1OTBA 2WZZA 3GR2A 3ICYA 4MBHA 3A3DA 4KZ7A 2XFTA 2A24A 2PR6A 3ZG7B 1CI9A 3VOZA 1KGFA 2VV8A 5FQMA 3CAXA 5DF9A 1WYCA 4Y0TA 1TDLA 2PT7A 4MDZA 5I5LA 3N4IA 2L0WA 3SH9A 3ZFZA 3H82B 4X25A 1DJCA 2VV7A 3L9KA 3LICA 3T4KA 3BWLA 1JNUA 3MKEA 4R3AA 2O99A 2PD7A 3NBLA 4BWIA 1OT9A 3ZNYA 3IBRA 1C3BA 5FI7A 2ZQ8A 4GNUA 4UAAA 5CX7A 4P85A 3UB6A 2H28A 5KZHA 3V39A 1FILA 4MLLA 3BLMA 2ZOHA 1FCOA 1ONHA 3UN7A 3FG8A 2JKRI 3PAEA 5AQAA 1G28A 4DMZA 4GD6A 1JTGA 3LUQA 1DJAA 1JWVA 5TGFA 2XLNA 2I72A 2XF3A 3IT9A 4MN6A 4EXOA 3KO6A 3IBJA 3MFDA 1FSWA 3M6HA 3VP4A 1IKIA 1FCMA 4QWOA 4IVKA 4BMWA 2EWWA 4JGOA 3R7WB 4KQOA 1FR6A 4E3KA 1CQAA 5EOOA 1AXBA 2JKTI 3M2KA 3KSFA 1HD8A 4JF4A 2OWHA 3UMEA 3OOVA 3HLCA 5FEGA 3GV9A 4NG2A 2I9VA 3HVFA 3C7UA 5HX9A 1YLWA 2RL3A 3O88A 3LO7A 3LEQA 3G6OA 2IA2A 4FOFA 3UDXA 4LPZA 5F83A 2FFYA 1HTZA 3A0RA 5EUAA 4GS9A 1XJ4A 2J80A 5IS1A 4UA7A 1LL9A 1K55C 3CG5A 4LV0A 2G7UA 4FUWA 4ESPA 3FWLA 5CEBA 3CUEC 2WK0A 4IVIA 3UPPA 2KOIA 2ZC3B 4FH2A 4BL2A 3BM6A 1P9RA 3FC7A 4X6TA 2HV1A 4S2KA 4S2MA 3FZCA 4UQIS 4EEUA 3MXRA 5DTKA 2QMIA 1T1CA 1MWTA 3QP1A 5EVIB 3EQVA 4LRYC 3N8SA 3VMAA 3U4LP 2HJ9C 3TE8A 4BQMA 2JKFA 1ES4A 4KZAA 2V2FF 4CLCD 2HJEA 3BEBA 4R38A 2PRFA 3FYZA 5HD5A 4LV3A 4NXEA 1YSQA 4JLFA 1BUEA 4WL9A 2J7VA 2YKHA 4KZ8A 4RX3A 3ZCZA 1MWUA 3L7HA 2Y2MA 2H10A 4K0XA 1NZUA 4Y3IA 1XGJA 1H5XA 1PWDA 4DJ2A 5GHYA 1KDWA 3BW6A 4P0MA 1KE0A 1K56D 2Y91A 5HPFA 2L1MA 4KZBA 4NK3A 5HSQA 4R3BA 4DXBA 4HP4A 3OCNA 1ZC2A 2X02A 2WAFA 4OPYA 5JYOA 1PZOA 1S6RA 5CGWA 1OTEA 2V1AA 3LY3A 2EX9A 3AGFA 3QP5A 2WKPA 3T4QA 2ZL1B 3Q7VB 5GLBA 3HUMA 1CEFA 3SH7A 5M1AA 1PRQA 2ZMAA 2Y2QA 3IHAA 1X0OA 3A3JA 1K38A 2JHEA 1FCNA 3C7VA 1V9ZA 4O0PA 4PM9A 5HWWA 1GA0A 1F98A 2QHKA 4MBFA 2Q9MA 1ESUA 4OPZA 1XGIA 1W63M 1YMSA 3DWZA 4JGPA 1ZG6A 4X68A 2ZQ7A 2V1BA 3UB5P 1DP9A 2WGWA 3CLOA 3EEHA 2FFFB 1E4DA 2EWVA 3T12B 1MXOA 3F1PA 3MXQA 3WS1A 3LR3A 4P87A 1E25A 4KZ4A 2J3TC 1ACFA 5A8BA 3K3DA 4GJ4A 4OKPA 4NETA 4PM7A 3HLBA 5CGSA 1S66L 5FDSA 4G3WA 3S7NA 1L0FA 1XJ6A 5CHMA 3N7WA 1MBLA 2XSSA 4X1LA 3PBSA 2XR0A 2J8YA 5CHJA 2P74A 2JCHA 3GVBA 4OONA 3HJIA 4WZ4A 2WAEA 2ZL1A 3ZDJA 3RTYA 3Q7VA 5GLDA 5F82A 4IUKA 3Q81A 3JVUA 4L9FA 4MNRA 1VETB 2ZM0A 3DW0A 5FQIA 4JXWA 3ZNTA 4QB8A 5EVEA 1N9LA 5M19A 1WE4A 1GSXA 3F1NA 5FATA 1BLPA 1TEMA 3IF6A 4DF6A 1K57C 3IXDA 3ZG9B 1IYSA 3LR4A 2QJ5A 3ZG0A 5FAOA 4EETB 4O8GA 3UB8A 4P6ZS 3F1NB 1NJ4A 3O86A 4WMCA 1GA9A 3W4PA 3MZFA 3MKFA 2QZ6A 3IX4A 1YLTA 2R9WA 4EQ1A 4IJGA 2E8JA 4PM8A 4DDYA 3UE6A 4PKYG 1FR1A 5CECA 4EWFA 4UEYA 4OOYA 1W7FA 1GSVA 3B47A 2ZD8A 2ZJ9A 4LRZE 1NWZA 2J3WA 4PKYA 3KYZA 4HP9A 3ZHHA 2Y2NA 1EWZA 1YLJA 3CITA 4OH0A 3JPUA 5IU1A 4R70A 3NY4A 4Y7PA 3ZQ5A 3NIAA 2W3GA 3A3EA 1KDSA 1K6SA 3T4LA 5K5BA 4WYYA 2JN7A 1K57A 4Y2FA 4UHUA 1MKIA 1L0DA 4ID4A 4OP8A 2P08A 4ZRRA 4GN2A 5EVIC 4OQHA 3HLEA 4QY6A 4KZ3A 1ERQA 1RGYA 2WUQA 1S67L 1CF0A 2C6WB 5LBRA 5HDDA 4Y0OA 5GLAA 2LB9A 1NYYA 2Y2JA 5MC7A 1H0MA 2GZAA 2VGKA 3P98A 3LGOA 2W1TA 3W4QA 2PYRA 3NOUC 3LYXA 3Q82A 3PYPA 2HZ5A 4D2OA 5BOHA 1K0KA 4E3MA 4EBNA 2K7SA 1VB6A 4JPMA 4LV1A 4EESA 1T19A 3RFBA 3E4QA 1V9YA 2BLSA 1PZPA 4DN0A 3TW8A 2EX8A 1LSVA 1RP5A 4LCLA 5HZHA 2M7UA 3BQ8A 3GSGA 3G35A 1MWRA 2QKPA 1HVBA 4P6BA 3LIBA 5EVID 1DJBA 3ZGAB 4E3OA 4PAUA 3EOIA 3NULA 4QY5A 5HAIA 4WMCD 2LB5A 4L9EA 4OPQA 2PYPA 2M7VA 4LV2A 2DNSA 5G4ZA 3LR0A 1SDEA 3C2WA 5EVIA 2QPNA 2GNXA 4GB7A 2V1ZA 3NI9A 5KIZA 4I3IA 3DTIA 3G4PA 1H8MA 2JC7A 2UV0E 2XDMA 2B95A 3V5MA 3LEZA 1CJFA 1FQGA 1GHPA 3PBQA 1H8YA 3ULFA 2FZ0A 3TSGA 4S2IA 3BFDA 3CZDA 3QP2A 4KZ9A 3MQ0A 2PU2A 2OAP1 4BJPA 2W0NA 4HJ6A 2Y2IA 5CTNA 1E3UD 5HPIA 5JYPA 2XRNA 4OPRA 4R3JA 3VOYA 1LI9A 1F5MA 3V50A 5FQ9A 1IYQA 5DFYA 1MPLA 4X53A 2DCFA 3MJQA 1KE4A 4Q8IA 2J3TD 3EQUA 3NOTC 4O7DA 3PBTA 3GECA 5G4YA 5AJGA 1XJ2A 2P9VA 4ARZB 3AGEA 1BT5A 4X1MA 4KENB 2NUTC 3T1XA 1HZOA 3KSIA 2XA7M 1OMEA 4EU0A 3NOPC 2INWA 2O9BA 1NXYA 5GLCA 3D4FA 4GDBA 4KG6A 1ODVA 4CLCB 2ZLYA 1UWPX 2V8FA 2VEAA 4N9LA 3EGDC 3MMHA 3KYEA 5L10A 1GHIA 4Y15A 2PBYA 1OTAA 3BY8A 2IWCA 3LR5A 3R4KA 1K25A 1K4FA 2AVXA 5G18A 4ZJ3A 1BYWA 1TS0A 2M1CA 4D60A 1CI8A 1M6KA 3HLFA 3C5AA 5EV0A 4II7A 4WM9A 1TS7A 4HI4A 3BFEA 3PBNA 3F1OA 2O9CA 4LGWA 4JBFA 1AWIA 2B5RA 2A2LA 4ZJ2A 4Z9QA 5AQ7A 3HREA 4HJ4A 3O87A 3JYIA 2C5WB 4PMAA 4N1HA 3A0SA 1SHVA 4OQIA 1EW0A 3F1PB 3RH8B 3SS3A 3U2AA 3LFVA 3PBOA 4WBGA 1Z09A 4CJNA 2Y2OA 1NLYA 2W3HA 3P01A 3QHYA 3DTMA 3E2KA 5F69A 1IYOA 1JWZA 5CEDA 2EX2A 2MJ6A 1LSWA 4S2OA 4UA9A 4IEDA 4XXRA 4WEKA 3NHQA 3BLSA 4F3LB 1W79A 2PHYA 2W27A 2ZBBA 2WKHA 1XP4A 5CRFA 4CLCA 1YLZA 4X56A 3C30A 3G31A 1S4SA 4K0WA 5HL6A 3G34A 1MY8A 2VGLM 2GDNA 2DRWA 3S7QA 2WZXA 4EQIA 5FQKA 4RYEA 4I5SA 5GHZA 3DTEA 4G3KA 1YQSA 1I5QA 3QNCA 1BLHA 4EUVA 4K91A 3D72A 4M4XA 3A0VA 2FH5A 3E98A 3O5YA 1S0WA 1L3LA 4ZAMA 3B3XA 4HJ3A 2V8CA 4KUKA 2VJWA 1NYMA 3Q7ZA 1S1YA 3WS5A 3NC8A 1YSPA 4YINA 5J3WA 3UY6A 3C4PA 2B02A 5DVAA 4WLAA 1L2SA 4R0QA 4HH2A 5E2FA 4DRTA 1JTDA 3UB9A 3PXPA 4NXFA 1SKOB 1PI5A 2ZC7A 1OJGA 5FQQA 5IT5A 3IX8A 3T4JA 1F2KA 4LFUA 2HGVA 2XK1A 4NXBA 4BBVA 3AGDA 2KX6A 1LSXA 1LT0A 1Q2PA 3N6IA 2BTFP 3W4OA 2WGIA 3ITBA 3T50A 5FASA 4JGQA 2DMWA 1YPRA 4KZ5A 3TRCA 4EW7A 1OTIA 4YNRA 2XH9A 5FA7A 1E3UA 3BYDA 4WZ5C 1IELA 2Q0OA 5GL9A 1ONGA 1I2WA 3V3RA 2BASA 4HESA 3CMZA 2Z2LB 2ZM2A 4ME4A 1KGEA 4DE0A 4S2LA 2NUPC 2XD1A 2PDRA 3PBRA 4MBKA 2JKTM 4GZBA 1OJ5A 3IQAA 1XJ3A 5FAPA 2K31A 4OVDA 1YLPA 4KQRA 2V0WA 3VOLA 4MMNA 4NEED 3GQZA 2GX5A 1VETA 5EM0A 4IBRA 4S2PA 5CTMA 1S4RA 1DY6A 1VEUA 3DWKA 1DP8A 4R23A 3H7WB 3BECA 2D02A 2WGWB 4B4ZA 4PM5A 3Q1FA 3BRMA 4LCMA 2WKEA 2ZQCA 2J9PA 1KE3A 1TVFA 4WELA 4ZBEA 3I7JA 4OLDA 2Y4AA 1L0GA 3BQAA 5EOEA 4BENA 3MBZA 4DKIA 5EECA 4KUOA 3LCEA 3NDEA 3JVVA 4FD8A 3HCYA 3IS2A 3G32A 5DTTA 1S1ZA 2X71A 4ZTKA 2OLUA 4L9GA 2Y2KA 5L8MA 1NRJA 2O9AA 4DXCA 1YM1A 2VZWA 4YWZA 2JKGA 2PR5A 4I38A 3CHWP 3FKVA 2RCXA 2EXAA 1Y54A 2UWXA 4GCZA 5DTSA 1PYYA 3OCLA 4R6LA 3UB7A 2WYXA 3MZDA 5A91A 1N9OA 1MWSA 2A3UA 4PM6A 4RX2A 5TFQA 2OWJA 3VV4A 3IH8A 2Y2GA 1QMFA 4BBTA 2A24B 4Q0HA 5CERA
chains in the Genus database with same CATH topology
2CMNA 2VX8A 5TBMA 2KOIA 4WF0A 4DJ3A 4XT2B 1P9RA 3E0YA 1VHMA 3PBQA 4ARZA 3FC7A 2HV1A 3ULFA 4O01A 2FZ0A 4HH3A 3GDIA 3UE3A 2PD8A 5F6AA 3MQ0A 4UQIS 4EEUA 4NXGA 5J7EA 2OAP1 4WEJA 1T1CA 4BJPA 3EQVA 4LRYC 2ZOIA 4UQIM 2W0NA 4HJ6A 4RQ9A 4F3LA 2HJ9C 3TE8A 5HPIA 2XRNA 3LIAA 4Q0JA 1F5MA 3LI8A 5KSHA 4CLCD 2HJEA 4R38A 1ZHHB 5DFYA 5HD5A 3DBAA 3MJQA 4NXEA 4JGRA 4GLQA 2J3TD 3EQUA 4E04A 1YSQA 1OTDA 1OT6A 4G3VA 4WL9A 3NOTC 4Z1WA 4B93A 2YKHA 3PBTA 5F68A 3GECA 5G4YA 5AJGA 3BY9A 4Y3IA 1XJ2A 1WA9A 4ARZB 4DJ2A 3BW6A 2Z6DA 2Y79A 5HDCA 1UWNX 2VKSA 1DP6A 1P9WA 3KYQA 2NUTC 5HPFA 2L1MA 1F9IA 2P7JA 1D06A 4IUHA 4B9OA 4QPRA 3KSIA 4AFIA 5HSQA 2OOLA 2XA7M 1IFQA 3NOPC 4EU0A 2INWA 2O9BA 3EWKA 4BBUA 1MC0A 4HP4A 3OCNA 3EGXC 1ODVA 4CLCB 1UWPX 4CLCE 2VEAA 2KDKA 3EGDC 1OTEA 3MMHA 3V67A 1YKDA 2V1AA 3SW1A 3H7WA 4GHIA 3EEAA 2WKPA 2O0YA 3PR6A 3T4QA 1GSWA 4I3AA 5TJJA 1OTAA 1KOUA 3LR5A 3BY8A 1DRMA 3R4KA 2Z6CA 4HHDA 1MZUA 2VA0A 1TS8A 3MQOA 1BYWA 1X0OA 5C5KA 3B42A 1TS0A 2M1CA 3FPVA 2V0UA 1H3QA 4GW9A 4II7A 3NJAA 2JHEA 1TS7A 3TJZC 4HI4A 2GJ3A 2P04A 1V9ZA 4WUJA 3K2NA 3PBNA 1T1AA 3F1OA 2O9CA 4O0PA 2VV6A 4Y5FA 5HWWA 2A2LA 4HQAA 5HWTA 1F98A 3OBFA 2HF6A 4L0LA 4HJ4A 2QHKA 1P0ZA 3H9WA 4XT2A 1ZTUA 4HY8A 3A0SA 1W63M 4JGPA 4ETXA 1EW0A 3C8CA 3F1PB 4NKPA 3RH8B 2W3EA 3U2AA 3LFVA 3PBOA 3T4OA 1NLYA 2W3HA 3E4OA 3P01A 2V1BA 4KQDA 1DP9A 3CLOA 5AVFA 3PHYA 3P7NA 3EEHA 5J4EA 5FL3A 1TD5A 2EWVA 4CLCC 1STZA 5F69A 3F1PA 3MXQA 3LR3A 1YAXA 3FPWA 2MJ6A 2J3TC 4OOLA 4CQHA 1LSWA 5A8BA 3K3DA 4GJ4A 1Y28A 2ZMVA 3W2ZA 3R7WA 2VGLS 1S66L 3D3OA 4G3WA 3S7NA 4WEKA 3NHQA 1XJ6A 4F3LB 1T18A 2PHYA 3K3CA 1W63Q 2W27A 2ZBBA 3T4SA 4ETZA 2KLIA 4CLCA 2XSSA 3PBSA 4OOMA 3C30A 4I39A 3VE4A 3BJNA 1S4SA 5HL6A 3UMDA 2VGLM 3HJIA 3S7QA 2K2NA 2VLGA 1P97A 3RTYA 4I5SA 3B33A 4IUKA 4G3KA 3JVUA 4L9FA 1OPXA 4EUVA 4M4XA 3D72A 5DKKA 3A0VA 2FH5A 3E98A 3O5YA 2QJ7A 4HJ3A 1N9LA 4KUKA 5HDSA 2VJWA 3MF0A 1TS6A 3OC2A 4MN5A 1GSXA 3F1NA 1S1YA 4P6ZM 1LL8A 3LI9A 1YSPA 3LIFA 2R78A 1IOUA 2B18A 5J3WA 5TBMB 3S7OA 3LR4A 2QJ5A 2B02A 3ZYTA 3KSHA 4WLAA 3T4TA 5DKLA 3CUEA 4EETB 4O8GA 4HH2A 5DJTA 3UB8A 3UB9A 2WKRA 3LIDA 3PXPA 4P6ZS 5HWVA 4NXFA 3F1NB 5EFWA 1OJGA 5IT5A 4HIAA 3T4JA 4YOFA 2HGVA 1D7EA 3CI6A 2XA7S 4NXBA 4MCWA 3MFXA 4EERA 4EQ1A 4BBVA 3HJKA 1MKMA 1TF1A 4IJGA 4H6JA 2KX6A 3CWFA 3UE6A 1LSXA 1G6OA 1LT0A 4PKYG 1OTBA 2YKFA 2W3DA 3ICYA 4UEYA 3T50A 4JGQA 2DMWA 1XFNA 1GSVA 3B47A 2A24A 4HNBA 2PR6A 4LRZE 1NWZA 2J3WA 4FSFA 4PKYA 3TRCA 4EW7A 1OTIA 4YNRA 3KYZA 2VV8A 4EEPA 4HP9A 3CAXA 5DF9A 4WN5A 5DFXA 3CITA 2PT7A 4MDZA 5I5LA 5IU1A 2L0WA 3MR0A 2EA9A 4R70A 2OAQ1 2BASA 3H82B 3ZQ5A 2W3GA 3E4PA 4ME4A 2VV7A 2V9AA 3VE3A 4H6JB 4MN7A 3LICA 3T4KA 3T4LA 3BWLA 1JNUA 5K5BA 4R3AA 2JN7A 2NUPC 4Q0IA 2O99A 2PD7A 4K08A 4BWIA 1OT9A 5AVEA 2PDRA 4Y2FA 3PBRA 3IBRA 2JKTM 1OJ5A 1XJ3A 2K31A 3S7PA 2V0WA 5CX7A 3VOLA 4MMNA 4NEED 3UB6A 2P08A 2XROA 4ZRRA 2GX5A 2H28A 3IS2B 1S67L 2L4RA 2ZOHA 4GHIB 3FG8A 5LBRA 5HDDA 4IHQA 2JKRI 1S4RA 1XFQA 2W3FA 2Y8HA 3KSGA 5F5YA 1G28A 2LB9A 1DP8A 3H82A 4DMZA 5MC7A 3H7WB 2GZAA 3LUQA 4LLOB 4PHTA 2W1TA 2D02A 2JKRM 2PYRA 2QWSA 3NOUC 3LYXA 4MN6A 4EXOA 3PYPA 3OLOA 3KO6A 3IBJA 4WELA 2K7SA 1VB6A 4EESA 1T19A 4BMWA 2EWWA 3BQAA 4JGOA 3R7WB 3RFBA 2D01A 2ZMFA 3E4QA 1V9YA 1N9NA 4KQOA 4LRXC 4DN0A 2WKQA 3TW8A 2QYBA 4KUOA 2JKTI 1LSVA 3C38A 2W1RA 3JVVA 3HCYA 3IS2A 5HZHA 3KX0X 2M7UA 3KSFA 3UMEA 2OWHA 3BQ8A 3OOVA 1S1ZA 2QKPA 2I9VA 3LIBA 4L9GA 5L8MA 1NRJA 2O9AA 1UGUA 1T1BA 5HD3A 4PAUA 3G6OA 2VZWA 3EOIA 4YWZA 4I3JA 2PR5A 2IA2A 4I38A 4FOFA 2LB5A 3MQQA 4L9EA 2PYPA 4LPZA 4GCZA 2M7VA 3A0RA 5G4ZA 3LR0A 3OCLA 3UB7A 4R6LA 3F1OB 3C2WA 4GS9A 1XJ4A 2J80A 5IS1A 3LIEA 1N9OA 2GNXA 1NLZA 2G7UA 5KIZA 2OWJA 4I3IA 3VV4A 4GS9B 2W1TB 4BBTA 2A24B 1H8MA 4Q0HA 4HOIA 5DJUA 3CUEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VOL A;  1N9L A;  2CMN A;  4HHD A;  3UB6 A;  4KUK A;  5HDS A;  5TBM A;  1MZU A;  1TS8 A;  1TS6 A;  3MQO A;  4WF0 A;  1BYW A;  4DJ3 A;  2H28 A;  1X0O A;  4MN5 A;  4XT2 B;  1GSX A;  1TS0 A;  2M1C A;  3FC7 A;  3F1N A;  2V0U A;  2HV1 A;  3ULF A;  3IS2 B;  1S67 L;  4HH3 A;  4GW9 A;  1S1Y A;  2L4R A;  2ZOH A;  3GDI A;  4GHI B;  3FG8 A;  1LL8 A;  5HDD A;  3NJA A;  2JHE A;  1S4R A;  1TS7 A;  2PD8 A;  1XFQ A;  3LI9 A;  5F5Y A;  5F6A A;  1G28 A;  3LIF A;  4HI4 A;  2R78 A;  1DP8 A;  2GJ3 A;  3H82 A;  4EEU A;  4NXG A;  5J7E A;  5J3W A;  5TBM B;  1V9Z A;  3H7W B;  2QJ5 A;  4WUJ A;  3LUQ A;  4LLO B;  1T1A A;  2B02 A;  3F1O A;  4WLA A;  1T1C A;  5DKL A;  2VV6 A;  2D02 A;  4EET B;  4LRY C;  5HWW A;  2ZOI A;  2PYR A;  2W0N A;  4HJ6 A;  2QWS A;  4HH2 A;  4RQ9 A;  4HQA A;  5DJT A;  5HWT A;  3NOU C;  1F98 A;  3UB8 A;  4F3L A;  3LYX A;  4HJ4 A;  2QHK A;  4MN6 A;  1P0Z A;  2WKR A;  3LID A;  3H9W A;  3OLO A;  3PYP A;  4XT2 A;  3UB9 A;  5HWV A;  4NXF A;  3F1N B;  4HY8 A;  3A0S A;  3LIA A;  5EFW A;  1OJG A;  3LI8 A;  4HIA A;  2K7S A;  1VB6 A;  4JGP A;  4EES A;  4R38 A;  1EW0 A;  3C8C A;  1T19 A;  3F1P B;  3RH8 B;  4JGO A;  1D7E A;  2D01 A;  3E4Q A;  5HD5 A;  1V9Y A;  1N9N A;  4LRX C;  3MJQ A;  4NXB A;  3E4O A;  2WKQ A;  4NXE A;  2V1B A;  3MFX A;  4KQD A;  4BBV A;  4EER A;  4JGR A;  4EQ1 A;  4E04 A;  3HJK A;  4KUO A;  1DP9 A;  1OTD A;  3CLO A;  1LSV A;  3PHY A;  3P7N A;  4H6J A;  2KX6 A;  3EEH A;  1OT6 A;  4WL9 A;  5AVF A;  3CWF A;  3IS2 A;  3NOT C;  3UE6 A;  2YKH A;  5HZH A;  2QJ7 A;  3KX0 X;  1LSX A;  1LT0 A;  5F68 A;  3GEC A;  2OWH A;  5F69 A;  3F1P A;  3MXQ A;  4PKY G;  5G4Y A;  3UME A;  1OTB A;  1S1Z A;  2YKF A;  3BY9 A;  3ICY A;  1LSW A;  5A8B A;  2QKP A;  2I9V A;  3K3D A;  1XJ2 A;  1Y28 A;  3T50 A;  4EXO A;  4JGQ A;  1XFN A;  1GSV A;  1WA9 A;  2A24 A;  3LIB A;  4HNB A;  4L9G A;  4DJ2 A;  2PR6 A;  4LRZ E;  1NWZ A;  1T1B A;  1UGU A;  2Z6D A;  1S66 L;  4PKY A;  5HD3 A;  5HDC A;  4EW7 A;  1UWN X;  1OTI A;  1XJ6 A;  3NHQ A;  3G6O A;  2VV8 A;  4EEP A;  4HP9 A;  4F3L B;  1DP6 A;  1T18 A;  3CAX A;  2PHY A;  3K3C A;  2W27 A;  4I3J A;  4WN5 A;  4YWZ A;  2ZBB A;  2PR5 A;  2L1M A;  1F9I A;  4I38 A;  2P7J A;  1D06 A;  5I5L A;  5IU1 A;  4B9O A;  3MQQ A;  2L0W A;  3MR0 A;  4L9E A;  2EA9 A;  4R70 A;  2PYP A;  4LPZ A;  2BAS A;  5HSQ A;  2OOL A;  4GCZ A;  3NOP C;  2INW A;  3EWK A;  3H82 B;  4I39 A;  3VE4 A;  3ZQ5 A;  3A0R A;  4BBU A;  5G4Z A;  3E4P A;  3UB7 A;  4R6L A;  1S4S A;  4HP4 A;  3F1O B;  3C2W A;  3UMD A;  4GS9 A;  3HJI A;  2VV7 A;  1XJ4 A;  2V9A A;  2J80 A;  3RTY A;  2VLG A;  1ODV A;  1P97 A;  3VE3 A;  4H6J B;  5IS1 A;  3LIC A;  1UWP X;  3BWL A;  3B33 A;  3LIE A;  4I5S A;  1JNU A;  2VEA A;  1N9O A;  2KDK A;  4L9F A;  2JN7 A;  4R3A A;  1OTE A;  2PD7 A;  4K08 A;  1OT9 A;  5AVE A;  2PDR A;  2V1A A;  5KIZ A;  4HJ3 A;  3SW1 A;  2OWJ A;  3H7W A;  4I3I A;  4M4X A;  3D72 A;  5DKK A;  3IBR A;  4GS9 B;  4GHI A;  1OJ5 A;  2WKP A;  1XJ3 A;  3A0V A;  4BBT A;  1GSW A;  2A24 B;  4I3A A;  5J4E A;  1OTA A;  4HOI A;  5DJU A;  1KOU A;  3BY8 A;  1DRM A;  2V0W A;  2Z6C A; 
#chains in the Genus database with same CATH topology
 5TBM A;  3T1R A;  2VK3 A;  3E0Y A;  4EBL A;  3NEC A;  3D9Y A;  4PPR A;  2EXB A;  3GDI A;  3UE3 A;  3W8K A;  1K6R A;  5DF7 A;  1YLY A;  5HAQ A;  4NXG A;  4R1G A;  4MEZ A;  4JKT A;  3IWQ A;  3UE0 A;  2ZOI A;  2Y55 A;  3A3F A;  3LIA A;  4Q0J A;  1FSY A;  1ES2 A;  5HFO A;  5HAP A;  1LL5 A;  4RA7 A;  3DBA A;  4CPK A;  3RJU A;  3UDF A;  1OTD A;  4JF5 A;  1OT6 A;  3M2J A;  5F68 A;  1J3W A;  2WKI A;  3BY9 A;  3CJM A;  3SS5 A;  4XUZ A;  3MXS A;  1BLC A;  1K54 C;  2Z6D A;  2CC1 A;  1UWN X;  1XX2 A;  1DP6 A;  2ZM8 A;  3C4O A;  1ALQ A;  3QP8 A;  3V3S A;  2OSU A;  1D06 A;  3UDI A;  1J9M A;  1KVL A;  1CEG A;  2OOL A;  3EGX C;  3Q07 A;  4N92 A;  4CLC E;  5L07 A;  3OPP A;  1PWC A;  2KDK A;  3BFF A;  3G30 A;  4BL3 A;  1O07 A;  3IXH A;  3SW1 A;  5FI6 A;  4GHI A;  3EEA A;  3PR6 A;  5TJJ A;  1KOU A;  3ZG8 B;  2WGV A;  3MQO A;  5C5K A;  3IF6 C;  3FPV A;  3IF5 A;  2XQZ A;  1G5U A;  1RCJ A;  5U47 A;  3NJA A;  3OPR A;  1SKF A;  3TJZ C;  1PFL A;  3MS6 A;  2PBD P;  5HAR A;  1N9B A;  1PW8 A;  2JE5 A;  3K2N A;  4JXV A;  1I2S A;  5FSR A;  3G2Z A;  4HQA A;  1JWP A;  2HF6 A;  2Y2L A;  3S1Y A;  3ZVW A;  3H9W A;  4XT2 A;  1ZTU A;  4ETX A;  4NKP A;  4UA6 A;  2W3E A;  4F94 A;  3T4O A;  3E4O A;  4KQD A;  5AVF A;  3PHY A;  3P7N A;  3UO9 A;  5FL3 A;  3WS0 A;  1XA1 A;  4CLC C;  5E2H A;  2HDR A;  3HL9 A;  1Z6F A;  1BTL A;  3FPW A;  5FAQ A;  4OOL A;  5CXW A;  3W2Z A;  3R7W A;  5FEF A;  4GOG A;  5AQ9 A;  1T18 A;  3K3C A;  1BZA A;  1K55 A;  4ETZ A;  4IBX A;  1PIO A;  4E6X A;  2G2U A;  1XXM A;  3CPT A;  5FDH A;  3VE4 A;  1A0K A;  4HBT A;  3UMD A;  3ZVT A;  2H5S A;  2K2N A;  2VLG A;  3NDG A;  4BLM A;  2E8I A;  3SS4 A;  3B33 A;  3MZE A;  1OPX A;  5A90 A;  5GHX A;  3IX3 A;  2HP9 A;  5DKK A;  3S22 A;  5E43 A;  1SZV A;  2QJ7 A;  5HW3 A;  3CPT B;  2G2W A;  4B88 A;  3ITA A;  3GTC A;  4KG2 A;  1TS6 A;  1KVM A;  4MN5 A;  5CHU A;  3VP2 A;  3RXW A;  4FCF A;  3LI9 A;  2R78 A;  5D3O A;  4BD1 A;  3S7O A;  5TBM B;  5FQJ A;  4OQ0 A;  3ZYT A;  3HUO A;  3KSH A;  3VP3 A;  5DJT A;  2XFS A;  2Y2P A;  4OP5 A;  1FIK A;  2XGN A;  1ZKJ A;  3VSL A;  2WKR A;  1K56 A;  1VQQ A;  5HL1 A;  5HWV A;  1YT4 A;  5EFW A;  4DDS A;  3M6B A;  2R9X A;  3CI6 A;  4DE2 A;  4MCW A;  3MFX A;  3HJK A;  1TF1 A;  4XUX A;  3CWF A;  1XKZ A;  2YKF A;  2W3D A;  3WWX A;  4OQG A;  2HDU A;  1XFN A;  2J9O A;  4HNB A;  4S2N C;  3IF6 B;  1EI5 A;  4FSF A;  1GHM A;  4YFM A;  3UE1 A;  4E3L A;  4EEP A;  5AQB A;  4WN5 A;  5DFX A;  3MR0 A;  1H8Z A;  2EA9 A;  2OAQ 1;  3IH9 A;  3SOI A;  3E4P A;  3UNW A;  1G6A A;  2WAD A;  2V9A A;  3VE3 A;  4H6J B;  4MN7 A;  4WZ5 A;  4Q0I A;  4FTX A;  2IWB A;  4K08 A;  5A93 A;  3WRZ A;  3IWI A;  1WYB A;  5AVE A;  2OV5 A;  3WRT A;  3S7P A;  3G2Y A;  3A3I A;  3HLW A;  4U0X A;  2XRO A;  2IWD A;  3IXG A;  3FKW A;  1LHY A;  1ES5 A;  3OPH A;  3IS2 B;  3BFC A;  2L4R A;  4GHI B;  3TOI A;  4IHQ A;  5EPH A;  4RVA A;  1XFQ A;  2W3F A;  2Y8H A;  3KSG A;  5F5Y A;  1GCE A;  4E6W A;  3H82 A;  3DTK A;  4LLO B;  5L2F A;  4PHT A;  3N8L A;  4DE1 A;  2JKR M;  3VSK A;  4E3J A;  2QWS A;  5EE8 A;  2H0Y A;  3OLO A;  4C3Q A;  5F1F A;  2X01 A;  1IEM A;  3WS2 A;  4ZJ1 A;  1BSG A;  4S2N A;  2D01 A;  2ZMF A;  1N9N A;  4LRX C;  3UPN A;  2WKQ A;  2QYB A;  3HLD A;  1CK3 A;  3C38 A;  2W1R A;  3GRJ A;  3WS4 A;  3SH8 A;  1W8Y A;  3KX0 X;  3PAG A;  1SCW A;  1BUL A;  3UPO A;  5F1G A;  1W8Q A;  1NZO A;  3ISG A;  1UGU A;  1T1B A;  3OZH A;  5HD3 A;  1IKG A;  4I3J A;  2EFU A;  4HEF A;  4KQQ A;  3VP1 A;  1D1J A;  2XD5 A;  3MQQ A;  4R4R A;  1NY0 A;  4JXG A;  1SDN A;  3E2L A;  3F1O B;  2P9V B;  1FOF A;  5IHV A;  3LIE A;  3HUN A;  4EBP A;  1NLZ A;  3LY4 A;  4GS9 B;  2VGJ A;  2W1T B;  3GMW A;  4HOI A;  5DJU A;  2CMN A;  2VX8 A;  2ACG A;  1LLB A;  4WF0 A;  4DJ3 A;  1M40 A;  4XT2 B;  4DE3 A;  4E3N A;  1VHM A;  3VP0 A;  4ARZ A;  4O01 A;  2ZQD A;  4HH3 A;  3VFH A;  3IHB A;  2PD8 A;  5F6A A;  2ZQA A;  2A49 A;  5J7E A;  3O3V A;  4WEJ A;  2HDS A;  3QP4 A;  1RGZ A;  3BFG A;  4UQI M;  4RQ9 A;  2ZQ9 A;  4F3L A;  5KSC A;  2Q9N A;  1L0E A;  1G68 A;  4S2J A;  3LI8 A;  5KSH A;  3DAV A;  1ZHH B;  4Y17 A;  2EFX A;  1K54 A;  4JGR A;  4GLQ A;  4E3I A;  4B4X A;  4E04 A;  3S4X A;  3NCK A;  4G3V A;  4Z1W A;  2Y2H A;  4B93 A;  3SZT A;  2JBF A;  2HDQ A;  1ES3 A;  1WA9 A;  5A92 A;  4A5R A;  2Y79 A;  4U0T A;  5HDC A;  2VKS A;  4C6Y A;  1QME A;  4QD4 A;  1P9W A;  3KYQ A;  1XA7 A;  2Z2M B;  3ZG5 A;  4QJG A;  1F9I A;  1U60 A;  2P7J A;  4IUH A;  4M3K A;  4B9O A;  1ERO A;  4QPR A;  4AFI A;  5FI2 A;  1IFQ A;  3EWK A;  4BBU A;  1MC0 A;  4KG5 A;  4GDN A;  1NRF A;  4EV4 A;  4N9K A;  3VFF A;  1O7E A;  1BLS A;  1YMX A;  2EX6 A;  3V67 A;  1YKD A;  1PI4 A;  3H7W A;  1KGG A;  1JVJ A;  5M18 A;  2O0Y A;  1GSW A;  4I3A A;  4KZ6 A;  4JF6 A;  1DRM A;  2Z6C A;  4ZDX A;  4HHD A;  1MZU A;  2VA0 A;  1TS8 A;  3RXX A;  3B42 A;  1ZG4 A;  2V0U A;  1H3Q A;  3P09 A;  2PU4 A;  2HP6 A;  4GW9 A;  3QNB A;  5L09 A;  4X55 A;  2GJ3 A;  2P04 A;  4WUJ A;  5J8X A;  1T1A A;  3T1Q B;  1ERM A;  2VV6 A;  4Y5F A;  4QU3 A;  4FH4 A;  5EVL A;  5HWT A;  3OBF A;  4L0L A;  5I94 A;  4HBU A;  1P0Z A;  1W5D A;  4U3T A;  3FV7 A;  4H8R A;  4HY8 A;  1PW1 A;  1VM1 A;  3C8C A;  4R4S A;  2V20 A;  4Y13 A;  4C75 A;  4QHC A;  1PWG A;  5J4E A;  1XPB A;  2HPB A;  1TD5 A;  4JXS A;  3HBR A;  5CGX A;  1STZ A;  4Y0U A;  5E2G A;  3MSH A;  4GD8 A;  4LEN A;  4N1X A;  1YAX A;  1VEU B;  4CQH A;  1Y28 A;  2ZMV A;  5KMW A;  3T1S A;  2VGL S;  3D3O A;  5DF8 A;  1W63 Q;  3T4S A;  2KLI A;  3QP6 A;  5E2E A;  4OOM A;  2PAV P;  4I39 A;  3BJN A;  4EUZ A;  1SKO A;  1TDG A;  2HP5 A;  1P97 A;  3N8R A;  2XEP A;  3PTE A;  1IYP A;  2ZC4 B;  4X69 A;  1LI0 A;  5HDS A;  1Y4O A;  3MF0 A;  1PNE A;  3IWO A;  3OC2 A;  4GKU A;  3IXB A;  4P6Z M;  1LL8 A;  1HLU P;  4BD0 A;  3LIF A;  2Y59 A;  2OLV A;  1IOU A;  2B18 A;  2H0T A;  3T4T A;  5DKL A;  3CUE A;  1N4O A;  3OPL A;  3HLG A;  1Q2Q A;  3LID A;  1ESI A;  2BG1 A;  1K4E A;  3TG9 A;  4HIA A;  4OLG A;  4YOF A;  1D7E A;  2ZC6 B;  2XA7 S;  5EM1 A;  4EER A;  2ZC5 B;  1MKM A;  5TR7 A;  4H6J A;  1G6O A;  1OTB A;  2WZZ A;  3GR2 A;  3ICY A;  4MBH A;  3A3D A;  4KZ7 A;  2XFT A;  2A24 A;  2PR6 A;  3ZG7 B;  1CI9 A;  3VOZ A;  1KGF A;  2VV8 A;  5FQM A;  3CAX A;  5DF9 A;  1WYC A;  4Y0T A;  1TDL A;  2PT7 A;  4MDZ A;  5I5L A;  3N4I A;  2L0W A;  3SH9 A;  3ZFZ A;  3H82 B;  4X25 A;  1DJC A;  2VV7 A;  3L9K A;  3LIC A;  3T4K A;  3BWL A;  1JNU A;  3MKE A;  4R3A A;  2O99 A;  2PD7 A;  3NBL A;  4BWI A;  1OT9 A;  3ZNY A;  3IBR A;  1C3B A;  5FI7 A;  2ZQ8 A;  4GNU A;  4UAA A;  5CX7 A;  4P85 A;  3UB6 A;  2H28 A;  5KZH A;  3V39 A;  1FIL A;  4MLL A;  3BLM A;  2ZOH A;  1FCO A;  1ONH A;  3UN7 A;  3FG8 A;  2JKR I;  3PAE A;  5AQA A;  1G28 A;  4DMZ A;  4GD6 A;  1JTG A;  3LUQ A;  1DJA A;  1JWV A;  5TGF A;  2XLN A;  2I72 A;  2XF3 A;  3IT9 A;  4MN6 A;  4EXO A;  3KO6 A;  3IBJ A;  3MFD A;  1FSW A;  3M6H A;  3VP4 A;  1IKI A;  1FCM A;  4QWO A;  4IVK A;  4BMW A;  2EWW A;  4JGO A;  3R7W B;  4KQO A;  1FR6 A;  4E3K A;  1CQA A;  5EOO A;  1AXB A;  2JKT I;  3M2K A;  3KSF A;  1HD8 A;  4JF4 A;  2OWH A;  3UME A;  3OOV A;  3HLC A;  5FEG A;  3GV9 A;  4NG2 A;  2I9V A;  3HVF A;  3C7U A;  5HX9 A;  1YLW A;  2RL3 A;  3O88 A;  3LO7 A;  3LEQ A;  3G6O A;  2IA2 A;  4FOF A;  3UDX A;  4LPZ A;  5F83 A;  2FFY A;  1HTZ A;  3A0R A;  5EUA A;  4GS9 A;  1XJ4 A;  2J80 A;  5IS1 A;  4UA7 A;  1LL9 A;  1K55 C;  3CG5 A;  4LV0 A;  2G7U A;  4FUW A;  4ESP A;  3FWL A;  5CEB A;  3CUE C;  2WK0 A;  4IVI A;  3UPP A;  2KOI A;  2ZC3 B;  4FH2 A;  4BL2 A;  3BM6 A;  1P9R A;  3FC7 A;  4X6T A;  2HV1 A;  4S2K A;  4S2M A;  3FZC A;  4UQI S;  4EEU A;  3MXR A;  5DTK A;  2QMI A;  1T1C A;  1MWT A;  3QP1 A;  5EVI B;  3EQV A;  4LRY C;  3N8S A;  3VMA A;  3U4L P;  2HJ9 C;  3TE8 A;  4BQM A;  2JKF A;  1ES4 A;  4KZA A;  2V2F F;  4CLC D;  2HJE A;  3BEB A;  4R38 A;  2PRF A;  3FYZ A;  5HD5 A;  4LV3 A;  4NXE A;  1YSQ A;  4JLF A;  1BUE A;  4WL9 A;  2J7V A;  2YKH A;  4KZ8 A;  4RX3 A;  3ZCZ A;  1MWU A;  3L7H A;  2Y2M A;  2H10 A;  4K0X A;  1NZU A;  4Y3I A;  1XGJ A;  1H5X A;  1PWD A;  4DJ2 A;  5GHY A;  1KDW A;  3BW6 A;  4P0M A;  1KE0 A;  1K56 D;  2Y91 A;  5HPF A;  2L1M A;  4KZB A;  4NK3 A;  5HSQ A;  4R3B A;  4DXB A;  4HP4 A;  3OCN A;  1ZC2 A;  2X02 A;  2WAF A;  4OPY A;  5JYO A;  1PZO A;  1S6R A;  5CGW A;  1OTE A;  2V1A A;  3LY3 A;  2EX9 A;  3AGF A;  3QP5 A;  2WKP A;  3T4Q A;  2ZL1 B;  3Q7V B;  5GLB A;  3HUM A;  1CEF A;  3SH7 A;  5M1A A;  1PRQ A;  2ZMA A;  2Y2Q A;  3IHA A;  1X0O A;  3A3J A;  1K38 A;  2JHE A;  1FCN A;  3C7V A;  1V9Z A;  4O0P A;  4PM9 A;  5HWW A;  1GA0 A;  1F98 A;  2QHK A;  4MBF A;  2Q9M A;  1ESU A;  4OPZ A;  1XGI A;  1W63 M;  1YMS A;  3DWZ A;  4JGP A;  1ZG6 A;  4X68 A;  2ZQ7 A;  2V1B A;  3UB5 P;  1DP9 A;  2WGW A;  3CLO A;  3EEH A;  2FFF B;  1E4D A;  2EWV A;  3T12 B;  1MXO A;  3F1P A;  3MXQ A;  3WS1 A;  3LR3 A;  4P87 A;  1E25 A;  4KZ4 A;  2J3T C;  1ACF A;  5A8B A;  3K3D A;  4GJ4 A;  4OKP A;  4NET A;  4PM7 A;  3HLB A;  5CGS A;  1S66 L;  5FDS A;  4G3W A;  3S7N A;  1L0F A;  1XJ6 A;  5CHM A;  3N7W A;  1MBL A;  2XSS A;  4X1L A;  3PBS A;  2XR0 A;  2J8Y A;  5CHJ A;  2P74 A;  2JCH A;  3GVB A;  4OON A;  3HJI A;  4WZ4 A;  2WAE A;  2ZL1 A;  3ZDJ A;  3RTY A;  3Q7V A;  5GLD A;  5F82 A;  4IUK A;  3Q81 A;  3JVU A;  4L9F A;  4MNR A;  1VET B;  2ZM0 A;  3DW0 A;  5FQI A;  4JXW A;  3ZNT A;  4QB8 A;  5EVE A;  1N9L A;  5M19 A;  1WE4 A;  1GSX A;  3F1N A;  5FAT A;  1BLP A;  1TEM A;  3IF6 A;  4DF6 A;  1K57 C;  3IXD A;  3ZG9 B;  1IYS A;  3LR4 A;  2QJ5 A;  3ZG0 A;  5FAO A;  4EET B;  4O8G A;  3UB8 A;  4P6Z S;  3F1N B;  1NJ4 A;  3O86 A;  4WMC A;  1GA9 A;  3W4P A;  3MZF A;  3MKF A;  2QZ6 A;  3IX4 A;  1YLT A;  2R9W A;  4EQ1 A;  4IJG A;  2E8J A;  4PM8 A;  4DDY A;  3UE6 A;  4PKY G;  1FR1 A;  5CEC A;  4EWF A;  4UEY A;  4OOY A;  1W7F A;  1GSV A;  3B47 A;  2ZD8 A;  2ZJ9 A;  4LRZ E;  1NWZ A;  2J3W A;  4PKY A;  3KYZ A;  4HP9 A;  3ZHH A;  2Y2N A;  1EWZ A;  1YLJ A;  3CIT A;  4OH0 A;  3JPU A;  5IU1 A;  4R70 A;  3NY4 A;  4Y7P A;  3ZQ5 A;  3NIA A;  2W3G A;  3A3E A;  1KDS A;  1K6S A;  3T4L A;  5K5B A;  4WYY A;  2JN7 A;  1K57 A;  4Y2F A;  4UHU A;  1MKI A;  1L0D A;  4ID4 A;  4OP8 A;  2P08 A;  4ZRR A;  4GN2 A;  5EVI C;  4OQH A;  3HLE A;  4QY6 A;  4KZ3 A;  1ERQ A;  1RGY A;  2WUQ A;  1S67 L;  1CF0 A;  2C6W B;  5LBR A;  5HDD A;  4Y0O A;  5GLA A;  2LB9 A;  1NYY A;  2Y2J A;  5MC7 A;  1H0M A;  2GZA A;  2VGK A;  3P98 A;  3LGO A;  2W1T A;  3W4Q A;  2PYR A;  3NOU C;  3LYX A;  3Q82 A;  3PYP A;  2HZ5 A;  4D2O A;  5BOH A;  1K0K A;  4E3M A;  4EBN A;  2K7S A;  1VB6 A;  4JPM A;  4LV1 A;  4EES A;  1T19 A;  3RFB A;  3E4Q A;  1V9Y A;  2BLS A;  1PZP A;  4DN0 A;  3TW8 A;  2EX8 A;  1LSV A;  1RP5 A;  4LCL A;  5HZH A;  2M7U A;  3BQ8 A;  3GSG A;  3G35 A;  1MWR A;  2QKP A;  1HVB A;  4P6B A;  3LIB A;  5EVI D;  1DJB A;  3ZGA B;  4E3O A;  4PAU A;  3EOI A;  3NUL A;  4QY5 A;  5HAI A;  4WMC D;  2LB5 A;  4L9E A;  4OPQ A;  2PYP A;  2M7V A;  4LV2 A;  2DNS A;  5G4Z A;  3LR0 A;  1SDE A;  3C2W A;  5EVI A;  2QPN A;  2GNX A;  4GB7 A;  2V1Z A;  3NI9 A;  5KIZ A;  4I3I A;  3DTI A;  3G4P A;  1H8M A;  2JC7 A;  2UV0 E;  2XDM A;  2B95 A;  3V5M A;  3LEZ A;  1CJF A;  1FQG A;  1GHP A;  3PBQ A;  1H8Y A;  3ULF A;  2FZ0 A;  3TSG A;  4S2I A;  3BFD A;  3CZD A;  3QP2 A;  4KZ9 A;  3MQ0 A;  2PU2 A;  2OAP 1;  4BJP A;  2W0N A;  4HJ6 A;  2Y2I A;  5CTN A;  1E3U D;  5HPI A;  5JYP A;  2XRN A;  4OPR A;  4R3J A;  3VOY A;  1LI9 A;  1F5M A;  3V50 A;  5FQ9 A;  1IYQ A;  5DFY A;  1MPL A;  4X53 A;  2DCF A;  3MJQ A;  1KE4 A;  4Q8I A;  2J3T D;  3EQU A;  3NOT C;  4O7D A;  3PBT A;  3GEC A;  5G4Y A;  5AJG A;  1XJ2 A;  2P9V A;  4ARZ B;  3AGE A;  1BT5 A;  4X1M A;  4KEN B;  2NUT C;  3T1X A;  1HZO A;  3KSI A;  2XA7 M;  1OME A;  4EU0 A;  3NOP C;  2INW A;  2O9B A;  1NXY A;  5GLC A;  3D4F A;  4GDB A;  4KG6 A;  1ODV A;  4CLC B;  2ZLY A;  1UWP X;  2V8F A;  2VEA A;  4N9L A;  3EGD C;  3MMH A;  3KYE A;  5L10 A;  1GHI A;  4Y15 A;  2PBY A;  1OTA A;  3BY8 A;  2IWC A;  3LR5 A;  3R4K A;  1K25 A;  1K4F A;  2AVX A;  5G18 A;  4ZJ3 A;  1BYW A;  1TS0 A;  2M1C A;  4D60 A;  1CI8 A;  1M6K A;  3HLF A;  3C5A A;  5EV0 A;  4II7 A;  4WM9 A;  1TS7 A;  4HI4 A;  3BFE A;  3PBN A;  3F1O A;  2O9C A;  4LGW A;  4JBF A;  1AWI A;  2B5R A;  2A2L A;  4ZJ2 A;  4Z9Q A;  5AQ7 A;  3HRE A;  4HJ4 A;  3O87 A;  3JYI A;  2C5W B;  4PMA A;  4N1H A;  3A0S A;  1SHV A;  4OQI A;  1EW0 A;  3F1P B;  3RH8 B;  3SS3 A;  3U2A A;  3LFV A;  3PBO A;  4WBG A;  1Z09 A;  4CJN A;  2Y2O A;  1NLY A;  2W3H A;  3P01 A;  3QHY A;  3DTM A;  3E2K A;  5F69 A;  1IYO A;  1JWZ A;  5CED A;  2EX2 A;  2MJ6 A;  1LSW A;  4S2O A;  4UA9 A;  4IED A;  4XXR A;  4WEK A;  3NHQ A;  3BLS A;  4F3L B;  1W79 A;  2PHY A;  2W27 A;  2ZBB A;  2WKH A;  1XP4 A;  5CRF A;  4CLC A;  1YLZ A;  4X56 A;  3C30 A;  3G31 A;  1S4S A;  4K0W A;  5HL6 A;  3G34 A;  1MY8 A;  2VGL M;  2GDN A;  2DRW A;  3S7Q A;  2WZX A;  4EQI A;  5FQK A;  4RYE A;  4I5S A;  5GHZ A;  3DTE A;  4G3K A;  1YQS A;  1I5Q A;  3QNC A;  1BLH A;  4EUV A;  4K91 A;  3D72 A;  4M4X A;  3A0V A;  2FH5 A;  3E98 A;  3O5Y A;  1S0W A;  1L3L A;  4ZAM A;  3B3X A;  4HJ3 A;  2V8C A;  4KUK A;  2VJW A;  1NYM A;  3Q7Z A;  1S1Y A;  3WS5 A;  3NC8 A;  1YSP A;  4YIN A;  5J3W A;  3UY6 A;  3C4P A;  2B02 A;  5DVA A;  4WLA A;  1L2S A;  4R0Q A;  4HH2 A;  5E2F A;  4DRT A;  1JTD A;  3UB9 A;  3PXP A;  4NXF A;  1SKO B;  1PI5 A;  2ZC7 A;  1OJG A;  5FQQ A;  5IT5 A;  3IX8 A;  3T4J A;  1F2K A;  4LFU A;  2HGV A;  2XK1 A;  4NXB A;  4BBV A;  3AGD A;  2KX6 A;  1LSX A;  1LT0 A;  1Q2P A;  3N6I A;  2BTF P;  3W4O A;  2WGI A;  3ITB A;  3T50 A;  5FAS A;  4JGQ A;  2DMW A;  1YPR A;  4KZ5 A;  3TRC A;  4EW7 A;  1OTI A;  4YNR A;  2XH9 A;  5FA7 A;  1E3U A;  3BYD A;  4WZ5 C;  1IEL A;  2Q0O A;  5GL9 A;  1ONG A;  1I2W A;  3V3R A;  2BAS A;  4HES A;  3CMZ A;  2Z2L B;  2ZM2 A;  4ME4 A;  1KGE A;  4DE0 A;  4S2L A;  2NUP C;  2XD1 A;  2PDR A;  3PBR A;  4MBK A;  2JKT M;  4GZB A;  1OJ5 A;  3IQA A;  1XJ3 A;  5FAP A;  2K31 A;  4OVD A;  1YLP A;  4KQR A;  2V0W A;  3VOL A;  4MMN A;  4NEE D;  3GQZ A;  2GX5 A;  1VET A;  5EM0 A;  4IBR A;  4S2P A;  5CTM A;  1S4R A;  1DY6 A;  1VEU A;  3DWK A;  1DP8 A;  4R23 A;  3H7W B;  3BEC A;  2D02 A;  2WGW B;  4B4Z A;  4PM5 A;  3Q1F A;  3BRM A;  4LCM A;  2WKE A;  2ZQC A;  2J9P A;  1KE3 A;  1TVF A;  4WEL A;  4ZBE A;  3I7J A;  4OLD A;  2Y4A A;  1L0G A;  3BQA A;  5EOE A;  4BEN A;  3MBZ A;  4DKI A;  5EEC A;  4KUO A;  3LCE A;  3NDE A;  3JVV A;  4FD8 A;  3HCY A;  3IS2 A;  3G32 A;  5DTT A;  1S1Z A;  2X71 A;  4ZTK A;  2OLU A;  4L9G A;  2Y2K A;  5L8M A;  1NRJ A;  2O9A A;  4DXC A;  1YM1 A;  2VZW A;  4YWZ A;  2JKG A;  2PR5 A;  4I38 A;  3CHW P;  3FKV A;  2RCX A;  2EXA A;  1Y54 A;  2UWX A;  4GCZ A;  5DTS A;  1PYY A;  3OCL A;  4R6L A;  3UB7 A;  2WYX A;  3MZD A;  5A91 A;  1N9O A;  1MWS A;  2A3U A;  4PM6 A;  4RX2 A;  5TFQ A;  2OWJ A;  3VV4 A;  3IH8 A;  2Y2G A;  1QMF A;  4BBT A;  2A24 B;  4Q0H A;  5CER A; 
#chains in the Genus database with same CATH homology
 2CMN A;  2VX8 A;  5TBM A;  2KOI A;  4WF0 A;  4DJ3 A;  4XT2 B;  1P9R A;  3E0Y A;  1VHM A;  3PBQ A;  4ARZ A;  3FC7 A;  2HV1 A;  3ULF A;  4O01 A;  2FZ0 A;  4HH3 A;  3GDI A;  3UE3 A;  2PD8 A;  5F6A A;  3MQ0 A;  4UQI S;  4EEU A;  4NXG A;  5J7E A;  2OAP 1;  4WEJ A;  1T1C A;  4BJP A;  3EQV A;  4LRY C;  2ZOI A;  4UQI M;  2W0N A;  4HJ6 A;  4RQ9 A;  4F3L A;  2HJ9 C;  3TE8 A;  5HPI A;  2XRN A;  3LIA A;  4Q0J A;  1F5M A;  3LI8 A;  5KSH A;  4CLC D;  2HJE A;  4R38 A;  1ZHH B;  5DFY A;  5HD5 A;  3DBA A;  3MJQ A;  4NXE A;  4JGR A;  4GLQ A;  2J3T D;  3EQU A;  4E04 A;  1YSQ A;  1OTD A;  1OT6 A;  4G3V A;  4WL9 A;  3NOT C;  4Z1W A;  4B93 A;  2YKH A;  3PBT A;  5F68 A;  3GEC A;  5G4Y A;  5AJG A;  3BY9 A;  4Y3I A;  1XJ2 A;  1WA9 A;  4ARZ B;  4DJ2 A;  3BW6 A;  2Z6D A;  2Y79 A;  5HDC A;  1UWN X;  2VKS A;  1DP6 A;  1P9W A;  3KYQ A;  2NUT C;  5HPF A;  2L1M A;  1F9I A;  2P7J A;  1D06 A;  4IUH A;  4B9O A;  4QPR A;  3KSI A;  4AFI A;  5HSQ A;  2OOL A;  2XA7 M;  1IFQ A;  3NOP C;  4EU0 A;  2INW A;  2O9B A;  3EWK A;  4BBU A;  1MC0 A;  4HP4 A;  3OCN A;  3EGX C;  1ODV A;  4CLC B;  1UWP X;  4CLC E;  2VEA A;  2KDK A;  3EGD C;  1OTE A;  3MMH A;  3V67 A;  1YKD A;  2V1A A;  3SW1 A;  3H7W A;  4GHI A;  3EEA A;  2WKP A;  2O0Y A;  3PR6 A;  3T4Q A;  1GSW A;  4I3A A;  5TJJ A;  1OTA A;  1KOU A;  3LR5 A;  3BY8 A;  1DRM A;  3R4K A;  2Z6C A;  4HHD A;  1MZU A;  2VA0 A;  1TS8 A;  3MQO A;  1BYW A;  1X0O A;  5C5K A;  3B42 A;  1TS0 A;  2M1C A;  3FPV A;  2V0U A;  1H3Q A;  4GW9 A;  4II7 A;  3NJA A;  2JHE A;  1TS7 A;  3TJZ C;  4HI4 A;  2GJ3 A;  2P04 A;  1V9Z A;  4WUJ A;  3K2N A;  3PBN A;  1T1A A;  3F1O A;  2O9C A;  4O0P A;  2VV6 A;  4Y5F A;  5HWW A;  2A2L A;  4HQA A;  5HWT A;  1F98 A;  3OBF A;  2HF6 A;  4L0L A;  4HJ4 A;  2QHK A;  1P0Z A;  3H9W A;  4XT2 A;  1ZTU A;  4HY8 A;  3A0S A;  1W63 M;  4JGP A;  4ETX A;  1EW0 A;  3C8C A;  3F1P B;  4NKP A;  3RH8 B;  2W3E A;  3U2A A;  3LFV A;  3PBO A;  3T4O A;  1NLY A;  2W3H A;  3E4O A;  3P01 A;  2V1B A;  4KQD A;  1DP9 A;  3CLO A;  5AVF A;  3PHY A;  3P7N A;  3EEH A;  5J4E A;  5FL3 A;  1TD5 A;  2EWV A;  4CLC C;  1STZ A;  5F69 A;  3F1P A;  3MXQ A;  3LR3 A;  1YAX A;  3FPW A;  2MJ6 A;  2J3T C;  4OOL A;  4CQH A;  1LSW A;  5A8B A;  3K3D A;  4GJ4 A;  1Y28 A;  2ZMV A;  3W2Z A;  3R7W A;  2VGL S;  1S66 L;  3D3O A;  4G3W A;  3S7N A;  4WEK A;  3NHQ A;  1XJ6 A;  4F3L B;  1T18 A;  2PHY A;  3K3C A;  1W63 Q;  2W27 A;  2ZBB A;  3T4S A;  4ETZ A;  2KLI A;  4CLC A;  2XSS A;  3PBS A;  4OOM A;  3C30 A;  4I39 A;  3VE4 A;  3BJN A;  1S4S A;  5HL6 A;  3UMD A;  2VGL M;  3HJI A;  3S7Q A;  2K2N A;  2VLG A;  1P97 A;  3RTY A;  4I5S A;  3B33 A;  4IUK A;  4G3K A;  3JVU A;  4L9F A;  1OPX A;  4EUV A;  4M4X A;  3D72 A;  5DKK A;  3A0V A;  2FH5 A;  3E98 A;  3O5Y A;  2QJ7 A;  4HJ3 A;  1N9L A;  4KUK A;  5HDS A;  2VJW A;  3MF0 A;  1TS6 A;  3OC2 A;  4MN5 A;  1GSX A;  3F1N A;  1S1Y A;  4P6Z M;  1LL8 A;  3LI9 A;  1YSP A;  3LIF A;  2R78 A;  1IOU A;  2B18 A;  5J3W A;  5TBM B;  3S7O A;  3LR4 A;  2QJ5 A;  2B02 A;  3ZYT A;  3KSH A;  4WLA A;  3T4T A;  5DKL A;  3CUE A;  4EET B;  4O8G A;  4HH2 A;  5DJT A;  3UB8 A;  3UB9 A;  2WKR A;  3LID A;  3PXP A;  4P6Z S;  5HWV A;  4NXF A;  3F1N B;  5EFW A;  1OJG A;  5IT5 A;  4HIA A;  3T4J A;  4YOF A;  2HGV A;  1D7E A;  3CI6 A;  2XA7 S;  4NXB A;  4MCW A;  3MFX A;  4EER A;  4EQ1 A;  4BBV A;  3HJK A;  1MKM A;  1TF1 A;  4IJG A;  4H6J A;  2KX6 A;  3CWF A;  3UE6 A;  1LSX A;  1G6O A;  1LT0 A;  4PKY G;  1OTB A;  2YKF A;  2W3D A;  3ICY A;  4UEY A;  3T50 A;  4JGQ A;  2DMW A;  1XFN A;  1GSV A;  3B47 A;  2A24 A;  4HNB A;  2PR6 A;  4LRZ E;  1NWZ A;  2J3W A;  4FSF A;  4PKY A;  3TRC A;  4EW7 A;  1OTI A;  4YNR A;  3KYZ A;  2VV8 A;  4EEP A;  4HP9 A;  3CAX A;  5DF9 A;  4WN5 A;  5DFX A;  3CIT A;  2PT7 A;  4MDZ A;  5I5L A;  5IU1 A;  2L0W A;  3MR0 A;  2EA9 A;  4R70 A;  2OAQ 1;  2BAS A;  3H82 B;  3ZQ5 A;  2W3G A;  3E4P A;  4ME4 A;  2VV7 A;  2V9A A;  3VE3 A;  4H6J B;  4MN7 A;  3LIC A;  3T4K A;  3T4L A;  3BWL A;  1JNU A;  5K5B A;  4R3A A;  2JN7 A;  2NUP C;  4Q0I A;  2O99 A;  2PD7 A;  4K08 A;  4BWI A;  1OT9 A;  5AVE A;  2PDR A;  4Y2F A;  3PBR A;  3IBR A;  2JKT M;  1OJ5 A;  1XJ3 A;  2K31 A;  3S7P A;  2V0W A;  5CX7 A;  3VOL A;  4MMN A;  4NEE D;  3UB6 A;  2P08 A;  2XRO A;  4ZRR A;  2GX5 A;  2H28 A;  3IS2 B;  1S67 L;  2L4R A;  2ZOH A;  4GHI B;  3FG8 A;  5LBR A;  5HDD A;  4IHQ A;  2JKR I;  1S4R A;  1XFQ A;  2W3F A;  2Y8H A;  3KSG A;  5F5Y A;  1G28 A;  2LB9 A;  1DP8 A;  3H82 A;  4DMZ A;  5MC7 A;  3H7W B;  2GZA A;  3LUQ A;  4LLO B;  4PHT A;  2W1T A;  2D02 A;  2JKR M;  2PYR A;  2QWS A;  3NOU C;  3LYX A;  4MN6 A;  4EXO A;  3PYP A;  3OLO A;  3KO6 A;  3IBJ A;  4WEL A;  2K7S A;  1VB6 A;  4EES A;  1T19 A;  4BMW A;  2EWW A;  3BQA A;  4JGO A;  3R7W B;  3RFB A;  2D01 A;  2ZMF A;  3E4Q A;  1V9Y A;  1N9N A;  4KQO A;  4LRX C;  4DN0 A;  2WKQ A;  3TW8 A;  2QYB A;  4KUO A;  2JKT I;  1LSV A;  3C38 A;  2W1R A;  3JVV A;  3HCY A;  3IS2 A;  5HZH A;  3KX0 X;  2M7U A;  3KSF A;  3UME A;  2OWH A;  3BQ8 A;  3OOV A;  1S1Z A;  2QKP A;  2I9V A;  3LIB A;  4L9G A;  5L8M A;  1NRJ A;  2O9A A;  1UGU A;  1T1B A;  5HD3 A;  4PAU A;  3G6O A;  2VZW A;  3EOI A;  4YWZ A;  4I3J A;  2PR5 A;  2IA2 A;  4I38 A;  4FOF A;  2LB5 A;  3MQQ A;  4L9E A;  2PYP A;  4LPZ A;  4GCZ A;  2M7V A;  3A0R A;  5G4Z A;  3LR0 A;  3OCL A;  3UB7 A;  4R6L A;  3F1O B;  3C2W A;  4GS9 A;  1XJ4 A;  2J80 A;  5IS1 A;  3LIE A;  1N9O A;  2GNX A;  1NLZ A;  2G7U A;  5KIZ A;  2OWJ A;  4I3I A;  3VV4 A;  4GS9 B;  2W1T B;  4BBT A;  2A24 B;  1H8M A;  4Q0H A;  4HOI A;  5DJU A;  3CUE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...