2K7SA

Human arnt c-terminal pas domain, 3 residue ib slip
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSQTAQNPYSDEIETIICTNTNVKNSSQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ARNT PAS-B has a fragile native state structure with an alternative beta-sheet register nearby in sequence space
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Aryl hydrocarbon receptor nuclear translocator
total genus 24
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2k7sA01
3OLOA 2V9AA 5HZHA 1N9LA 3K3CA 3P7NA 5J4EA 4WF0A 2PYPA 3LYXA 4LLOB 2HV1A 2PR6A 2QJ7A 2V0UA 3PHYA 2OOLA 4EXOA 5HWWA 3MXQA 4R3AA 5HDSA 1N9NA 3VE4A 1TS7A 5HDDA 4EEPA 1T1AA 2JN7A 3MFXA 4HJ3A 4HI4A 3EWKA 4YWZA 5HWTA 4HH2A 4DJ2A 4GCZA 1XJ2A 1DRMA 3LI8A 3LIFA 4HQAA 4I5SA 3B33A 1EW0A 1LSVA 1OTBA 1OTDA 3LIBA 1XFQA 3E4QA 2I9VA 5DKLA 3MJQA 3VE3A 4E04A 2J80A 4LRZE 4H6JA 4HNBA 4HOIA 2L0WA 3F1PA 2VEAA 1S4RA 4RQ9A 2PD7A 2PD8A 1VB6A 2GJ3A 2PR5A 3A0SA 4NXGA 3UMDA 2QJ5A 4HH3A 4R38A 2W0NA 4LRXC 3UB9A 3UB6A 1LT0A 2YKHA 4WLAA 2M1CA 4F3LB 3UMEA 1F98A 5TBMB 1XJ3A 4I3IA 4HJ6A 4L9FA 2K7SA 5EFWA 3LI9A 2VV8A 2ZOIA 3FC7A 5IU1A 1V9YA 1GSVA 4JGQA 2QKPA 5F6AA 3F1NA 3IS2A 4JGOA 1D06A 1T19A 2EA9A 2P7JA 3CWFA 3KX0X 1OJGA 1OT6A 4GS9A 3UE6A 1UGUA 2JHEA 3FG8A 3BWLA 3MR0A 4KUOA 2V1AA 4JGPA 4LPZA 3T50A 1S1YA 3HJKA 4B9OA 4EERA 3UB7A 5DJUA 2PDRA 3ZQ5A 4XT2A 1OT9A 4GHIA 1S67L 3H7WB 4MN6A 4EETB 5J7EA 3K3DA 2WKRA 3IBRA 1DP6A 4R6LA 1LL8A 3GDIA 3CLOA 3LIAA 3NOUC 4I3AA 4H6JB 2W27A 1OJ5A 4HIAA 1TS6A 4JGRA 4K08A 3HJIA 4GW9A 2QWSA 2KX6A 4KUKA 3F1OB 2OWHA 2ZOHA 5DJTA 4BBTA 3ULFA 2CMNA 5HD5A 1TS8A 4I3JA 4R70A 4WL9A 3NOPC 3F1PB 4KQDA 1S4SA 2WKPA 3MQQA 1F9IA 2ZBBA 3CAXA 1JNUA 2D02A 4HP9A 1N9OA 5G4ZA 5F69A 1LSXA 2L4RA 5I5LA 4EQ1A 1S1ZA 1MZUA 1P97A 2A24B 3RH8B 4I38A 2VV7A 1OTIA 3NOTC 4MN5A 1LSWA 4I39A 2WKQA 1T1CA 3C2WA 5AVFA 1XJ6A 3RTYA 1UWNX 1OTAA 1BYWA 2B02A 1Y28A 4GS9B 1GSXA 4DJ3A 2V1BA 3EEHA 3F1NB 3IS2B 3H82B 1V9ZA 2A24A 3VOLA 4NXBA 4XT2B 2KDKA 2H28A 4EESA 2D01A 2PHYA 3A0RA 1KOUA 1XJ4A 1GSWA 2BASA 2OWJA 1OTEA 4HHDA 5TBMA 4L9EA 4NXFA 4HP4A 4NXEA 3BY9A 1WA9A 1D7EA 1S66L 1P0ZA 2Z6CA 2Z6DA 3F1OA 3LUQA 5J3WA 1T1BA 3G6OA 3H82A 4F3LA 2YKFA 3NHQA 1UWPX 4LRYC 4PKYA 1TS0A 4WUJA 2V0WA 3D72A 3C8CA 5A8BA 2VV6A 2INWA 5F5YA 3E4PA 5G4YA 1DP8A 1X0OA 3A0VA 3MQOA 3LICA 5F68A 4EEUA 3E4OA 5HWVA 5HSQA 1XFNA 2PYRA 5HDCA 3GECA 5IS1A 4WN5A 1DP9A 2VLGA 4PKYG 2R78A 4GHIB 4EW7A 2L1MA 4BBUA 3NJAA 1NWZA 1T18A 3PYPA 5DKKA 5KIZA 3H9WA 3H7WA 5HD3A 4BBVA 4M4XA 4L9GA 3BY8A 3LIEA 4HJ4A 1G28A 3UB8A 1ODVA 3LIDA 2QHKA 3SW1A 5AVEA 3ICYA 4HY8A
chains in the Genus database with same CATH superfamily
2V9AA 4CLCA 2Y8HA 4UAAA 1K56D 3CJMA 1PRQA 1MKMA 2HP6A 1P9WA 2HPBA 4GCZA 4Q0HA 5HPIA 1NJ4A 5DKLA 4LRZE 4PHTA 3ZYTA 1QMEA 1N9BA 4GN2A 3MBZA 4F3LB 4WELA 3Q82A 3PR6A 4QPRA 2OSUA 1XJ3A 2ZC7A 2WGWA 3OPPA 4CLCC 2JKFA 1ZC2A 3F1NA 4BLMA 3T4JA 1UGUA 4LPZA 3IWIA 3T50A 4EBPA 3M6BA 1S1YA 1Q2QA 3MQ0A 3VP2A 4KZ7A 2XR0A 3AGFA 3LIAA 3QP2A 4WMCA 4C6YA 5DF9A 2ZL1B 2ZC5B 1ZG4A 4WL9A 2XFSA 3NOPC 4HEFA 3DWKA 3QNBA 1MKIA 4I39A 2X71A 2JKRM 4P6ZM 2NUPC 3OC2A 4MBKA 2B02A 4GS9B 3BLMA 2JC7A 3BYDA 3FWLA 4XT2B 4DKIA 1GSWA 2OWJA 2RL3A 4E3JA 5FAOA 1D7EA 5J3WA 3SS4A 3VP3A 4RVAA 5E2HA 3LO7A 4WUJA 4BWIA 3UDXA 2INWA 4IHQA 1O07A 3MQOA 5HWVA 2HJEA 3CI6A 3ZG8B 2XRNA 4M3KA 2KOIA 4M4XA 3LEQA 3RFBA 1K6RA 1N9LA 3K3CA 4WF0A 1XPBA 2V0UA 5HWWA 1BLSA 2PBDP 3IX8A 3S4XA 1FCMA 3V5MA 5CERA 5F5YA 4E3LA 3IWQA 3UB5P 4P0MA 1HLUP 3N8LA 4B93A 2ZQCA 4X6TA 5HAQA 4LENA 2PR5A 2EX9A 3CMZA 4KQQA 4OQGA 4LRXC 4ZJ3A 2Z2LB 3PBQA 2BTFP 3IS2A 4GB7A 2EA9A 2X02A 3G35A 4KUOA 4S2OA 4B4XA 1S67L 1WYBA 4K08A 1RGYA 3E2KA 3DTMA 3CHWP 5KSCA 2W1TA 2Y2HA 1SCWA 1CEFA 3WS4A 3N7WA 2WKPA 2BLSA 4X56A 1P97A 3B42A 1DJAA 2Y2GA 4Y17A 4YOFA 4GJ4A 1SKOB 5AVFA 3TE8A 3C7UA 3JPUA 4KZ4A 4JF5A 2ZMFA 2C5WB 3T4LA 4WBGA 4HHDA 1LHYA 2J3TD 5TBMA 1DJCA 1NYMA 1HTZA 3G6OA 2ZC6B 3NHQA 2WADA 4KZ6A 1CI8A 1NLZA 4BL2A 1FILA 4ARZB 3QP5A 3VOZA 2ZMVA 3T4TA 4WN5A 2JE5A 3U2AA 2V20A 2B95A 1NWZA 1FSWA 5IHVA 4U3TA 5HL1A 4ME4A 3LIEA 2I72A 3OLOA 2XROA 4S2KA 2RCXA 1HVBA 1E4DA 5HDDA 1T1AA 5DFYA 3LIFA 2ZLYA 1IEMA 4OQIA 3DTIA 2XH9A 4FUWA 4X68A 3G32A 1S4RA 4GDBA 1K57C 3A0SA 5FQMA 2GNXA 4FD8A 5D3OA 4K0WA 3IX4A 1NXYA 2LB9A 4GS9A 2LB5A 4EERA 4JGPA 1DP6A 2X01A 2W27A 3GV9A 1VQQA 5DJTA 4ZBEA 2W3DA 3MF0A 4NEED 1RGZA 2Y2LA 4QU3A 1C3BA 1WYCA 4EQ1A 3T4KA 3WS5A 2J8YA 5L8MA 3HCYA 5KZHA 3ZCZA 1OTAA 5M1AA 1TF1A 4YFMA 3IS2B 1IYSA 1GHIA 2OAQ1 3IH8A 2D01A 3A0RA 5EVEA 4L9EA 4HBTA 1ESIA 3OOVA 4DRTA 4EBNA 5GLCA 3DWZA 4E3OA 4OP8A 1NY0A 2IA2A 3E4PA 1DP8A 2VJWA 3OCNA 5HW3A 3HLEA 3UY6A 1LI9A 4GHIB 5CHJA 2E8IA 1JTDA 2JKTI 3FZCA 4S2NA 3MZDA 3LIDA 4X1LA 1D1JA 4R4SA 3PHYA 2OOLA 4PPRA 2K31A 1TS7A 3KSIA 3NULA 4HJ3A 4EEPA 4EUZA 4P6BA 1ALQA 3E4QA 3CUEA 4E04A 5A93A 1BLPA 4HOIA 3QP8A 1K0KA 4E3KA 3IF6C 4LFUA 2QJ5A 1I2WA 3VSKA 5AQAA 5E2EA 4KG6A 1GSVA 2XDMA 3IWOA 2P7JA 1CF0A 3Q7VB 2OLUA 3PBRA 4B9OA 4WYYA 1BSGA 1FCNA 5FATA 5EVLA 3IBRA 4R6LA 1ESUA 3S7NA 3A3FA 1PNEA 4BBTA 3O87A 4RYEA 5TGFA 5CGWA 1W5DA 3BECA 4E6WA 3U4LP 3W8KA 2P08A 3NOTC 4MNRA 3IHBA 3BFGA 3ISGA 3ZDJA 4K0XA 1YLWA 2XD5A 5CXWA 3H82B 1KVLA 1W63M 1YQSA 4E3MA 2AVXA 3BM6A 3OZHA 3HLGA 4LRYC 5JYPA 4PKYA 3MKEA 2WAEA 2WGVA 3UPNA 3IXGA 5F68A 4C75A 3C4PA 4PKYG 3ITBA 4BBUA 5DKKA 3FKVA 2P04A 2EX8A 2WZZA 4P87A 4L9GA 1G28A 2FFYA 3G30A 2XQZA 3T12B 4KZAA 2HGVA 1U60A 1ES5A 1TDLA 3V3SA 3B33A 3CPTB 2Y2MA 3VOYA 1EI5A 3T4OA 3UPOA 3DBAA 1L0FA 4KG2A 3NCKA 1LT0A 2JKGA 3KYEA 5HAPA 4OLDA 5HFOA 3HBRA 4DN0A 4XUXA 4WEKA 4JGQA 3RJUA 3SH8A 3BWLA 5CECA 3ZG5A 4DDYA 4R23A 5EUAA 3UB7A 1W8QA 5FEFA 3H7WB 4MN6A 5F1FA 3GTCA 2W1RA 4EWFA 4GW9A 1K54A 1DJBA 1G5UA 3C5AA 3D3OA 3T1RA 2XLNA 1JNUA 2L4RA 4Z9QA 1O7EA 3DTEA 3WRTA 2ZC4B 2ZM8A 1Y28A 2PT7A 1MPLA 1FSYA 4MMNA 2WKEA 1OTEA 4OPYA 2H5SA 5FI6A 4Y13A 1W79A 4IVKA 2GZAA 4Y0UA 4IVIA 3VP0A 4OH0A 3JYIA 3MMHA 1YMSA 3HUNA 5HD3A 4BL3A 2UWXA 3UB8A 2QHKA 3BQ8A 3NBLA 4OOLA 4JXVA 5HWTA 4HH2A 5M18A 1NLYA 1L0DA 4ZRRA 2VEAA 4RQ9A 4P85A 2PD7A 1WE4A 5L07A 5FL3A 4IBXA 3IXHA 1F98A 3DTKA 4HJ6A 4ZTKA 2K7SA 4S2MA 5M19A 5GLAA 3ZQ5A 5J7EA 5DVAA 3BFFA 3HJIA 3LR4A 4CLCD 2OWHA 2ZOHA 4Q8IA 4X55A 2ZQAA 4OLGA 4F94A 5FQIA 2D02A 3RH8B 1H3QA 1G6AA 1T1CA 1I2SA 3C2WA 3RXXA 1TEMA 1VM1A 2WGWB 3RTYA 1SDNA 3F1NB 4R0QA 2A24A 1PI4A 1XXMA 1XJ4A 3BY9A 4RX3A 3F1OA 1PIOA 4LV2A 4D2OA 2YKFA 2NUTC 1MWUA 5A8BA 3E4OA 5HDCA 2ZC3B 3JVVA 3V50A 3TJZC 5KIZA 4UQIS 2EFUA 1PW8A 4JXSA 4HBUA 4OQ0A 2CC1A 1L3LA 4EXOA 2Y79A 3VE4A 4YWZA 1OMEA 5FEGA 3S7QA 3VE3A 4MDZA 5EM0A 3WS2A 4II7A 2GX5A 3M2KA 3ZNYA 2A2LA 4H8RA 4ZDXA 4I3IA 1NYYA 3BW6A 2O9BA 3CWFA 1IYQA 4QHCA 1JWZA 3C38A 3SOIA 2QZ6A 2WGIA 3GDIA 4QY6A 4I3AA 4JPMA 3ULFA 4KQOA 5EPHA 2Q9NA 3O5YA 3W4PA 1KVMA 3WRZA 1K54C 4ZJ2A 1RCJA 2Q0OA 2C6WB 2O9AA 2FH5A 5HL6A 3VOLA 3HVFA 1PZOA 2OAP1 4U0TA 1TVFA 2O99A 2Y59A 3A3DA 5FQ9A 3EEAA 2Z6DA 3ZVWA 3M2JA 2V0WA 3FKWA 2V8FA 2PU4A 3IXBA 3EGDC 3GECA 1DP9A 3QP6A 4G3WA 2R78A 2L1MA 2Y2OA 4JXWA 4OPRA 3MKFA 2KLIA 1ACFA 4GLQA 1ODVA 5L10A 3QP4A 4O7DA 4LGWA 3P7NA 2HV1A 1YPRA 3KYQA 4DJ2A 3W4OA 2OV5A 1EW0A 1OTBA 1VETB 3MJQA 4ARZA 3UO9A 1XKZA 5EVIB 2V8CA 1M6KA 1GA0A 2J9OA 4L9FA 1VEUA 4Y0OA 1YMXA 5F6AA 2HDUA 2V1AA 1KGFA 1YLJA 2EX2A 2V2FF 3UN7A 2WKRA 4MBFA 1JTGA 5DTTA 3GQZA 3GRJA 4KUKA 5LBRA 3F1OB 2CMNA 5L09A 4OPQA 2ZM2A 5GLBA 3R7WA 1DY6A 4C3QA 4Y15A 4R4RA 3SH9A 2ZMAA 4YINA 4FH2A 5GHXA 2VV7A 3UNWA 2VZWA 3OCLA 1MY8A 3L7HA 2O0YA 2IWCA 5AJGA 3LR0A 3T1SA 3A3EA 1GSXA 2BG1A 3PAEA 1GHPA 1IKGA 2BASA 1N4OA 3V3RA 4S2PA 1IFQA 4RA7A 1TS0A 3D72A 2DRWA 4EBLA 1H5XA 3TW8A 1YLYA 4CLCB 2G2UA 1T18A 3BQAA 5FQJA 3WS1A 4EUVA 3TG9A 5HX9A 4OQHA 4KENB 5KMWA 1IOUA 4UQIM 4G3VA 1AWIA 3LYXA 4LLOB 4JF4A 3E98A 4Y2FA 4NG2A 5F83A 3LI8A 5CRFA 5EVID 3OBFA 1PWDA 1PW1A 1NZOA 1JWPA 4KQRA 5K5BA 4HH3A 4Y3IA 1TDGA 1K25A 2Q9MA 4LV0A 1IELA 1MC0A 3UE1A 1V9YA 2QKPA 3IBJA 3IXDA 2JHEA 2M7UA 5HAIA 2PDRA 4GDNA 2ZQ7A 1STZA 4EETB 3P98A 4JGRA 2ACGA 2KX6A 4S2NC 4N9LA 1NZUA 1KGGA 4FOFA 1H0MA 3S7OA 5F69A 1MZUA 1W63Q 2XF3A 1CEGA 3EQVA 2XFTA 3Q7VA 4UHUA 2WKHA 4QY5A 1KGEA 3BJNA 3W4QA 1T1BA 2W3FA 4ETZA 2R9XA 4E3IA 3BFEA 2JKRI 4DE3A 1X0OA 2XK1A 4CLCE 4GD6A 4MN7A 4BMWA 3MXRA 5EVIA 3GR2A 1PWGA 2PRFA 1LL9A 4BBVA 1CJFA 1EROA 1CI9A 1F2KA 4GZBA 4O01A 3VMAA 2QJ7A 4NK3A 4R3AA 2WKIA 2JN7A 1RP5A 4HI4A 4MBHA 1XJ2A 1ONGA 3LIBA 1XFQA 3VP4A 4PM8A 1TD5A 5IT5A 3T1XA 4NXGA 3UMDA 4R38A 2W0NA 2DCFA 1PZPA 3UMEA 4EU0A 5TBMB 2ZD8A 4PM9A 5EFWA 1L0GA 3GMWA 5FDSA 3MR0A 4JBFA 5GLDA 3PBNA 2QYBA 5MC7A 1ONHA 2J3WA 3LR3A 2XA7S 1H8MA 1S4SA 4WEJA 1F9IA 3CAXA 4EQIA 4RX2A 3KSGA 4OPZA 1S1ZA 1BTLA 4WZ5A 1XA1A 3HLBA 4UA9A 2W3EA 4WM9A 1V9ZA 4MLLA 3MS6A 2WK0A 4JLFA 2H28A 2PHYA 1KDWA 5GHZA 2HDQA 3G31A 5AQBA 3IF6B 3B3XA 3UE3A 1Y54A 2M7VA 3ZG9B 1BLCA 5HSQA 3JVUA 3LICA 1ZKJA 3T4SA 5BOHA 5IS1A 4PMAA 2PBYA 1YLTA 3KSHA 3NJAA 3Q1FA 1F5MA 1PWCA 5CHUA 3EOIA 5EOEA 2XA7M 2PAVP 5AVEA 4HY8A 2VGJA 2ZJ9A 1MWSA 3I7JA 2EX6A 1YLZA 1N9NA 4JKTA 2HP9A 3M6HA 4GKUA 2JKTM 4HQAA 3QP1A 3NC8A 4BQMA 3P01A 3R4KA 1K4FA 4U0XA 3MZEA 2Y2PA 2IWDA 3LFVA 1FOFA 3Q7ZA 4GOGA 1T19A 2PU2A 3UDFA 1LI0A 4QWOA 3FG8A 2HZ5A 1PYYA 2WAFA 5FI2A 4Q0JA 4UA7A 4MN5A 2QWSA 1YM1A 5HD5A 2Y91A 1YKDA 3BEBA 3N8SA 4N1XA 2ZBBA 5I5LA 3HREA 1PFLA 1Z09A 3V67A 1BULA 1LSWA 2WKQA 2VK3A 3HLFA 3ZHHA 1MXOA 4E6XA 1J3WA 5FQKA 4DJ3A 2V1BA 3WWXA 4PM7A 4Y5FA 4FTXA 4HP4A 2Z6CA 2Y2QA 4IUHA 2J7VA 5J8XA 2HJ9C 2XD1A 4XUZA 4EW7A 1YSQA 3VV4A 4Q0IA 5JYOA 1XA7A 2ZQ9A 2Y55A 3NI9A 2B5RA 1JVJA 1MBLA 3OPHA 1K6SA 2H0YA 5CGXA 2UV0E 1YAXA 2B18A 3PTEA 4IEDA 3NY4A 1K4EA 2A49A 4I5SA 1LSVA 1OTDA 2VGKA 4ESPA 3MXSA 3TOIA 3GSGA 3F1PA 4DF6A 4IJGA 2A3UA 4NKPA 4WLAA 3UDIA 1G68A 4AFIA 1S0WA 3LI9A 2VV8A 3FC7A 3L9KA 5IU1A 3VFHA 1ES3A 3V39A 4IBRA 1AXBA 3ZG0A 3PBSA 3CLOA 3NOUC 5EE8A 1M40A 4A5RA 4Y0TA 3LGOA 2W3HA 3G34A 4OOYA 1L0EA 3MQQA 4FH4A 1N9OA 3BFCA 3DW0A 1OTIA 3NDEA 3NECA 4L0LA 2JCHA 2HP5A 3OPLA 1H8YA 4NXBA 1G6OA 2HDRA 4EESA 2FFFB 3K2NA 4XXRA 5F82A 3S1YA 4NXEA 1S66L 4F3LA 1LLBA 2QMIA 3SS5A 1FQGA 4R1GA 4Y7PA 4QB8A 4E3NA 1I5QA 3AGEA 3N6IA 3H7WA 4X1MA 1CQAA 1K38A 3BY8A 3G2YA 2QPNA 3KX0X 5F1GA 4R3BA 1Q2PA 1XP4A 4WMCD 5A90A 3CPTA 2PR6A 4LCLA 1SZVA 3MFXA 2W1TB 1XGJA 2ZQ8A 3IF5A 2L0WA 4OP5A 2PD8A 1VB6A 5G18A 1K55C 5HPFA 1IYPA 2EWVA 4LV1A 4PAUA 3LY3A 2EFXA 2H0TA 2DNSA 3LY4A 5CEDA 4X53A 1L2SA 1OT6A 1YSPA 3HJKA 3K3DA 3HUMA 2Y2KA 4H6JB 4N92A 3QNCA 4IUKA 1BT5A 3S7PA 2IWBA 4S2IA 3SZTA 3F1PB 4R3JA 4MCWA 4HP9A 5U47A 5DTKA 3ZVTA 1NRFA 3D4FA 2O9CA 5E2GA 5DTSA 2FZ0A 3EGXC 3HLWA 1ZTUA 4KZBA 1ERMA 3WS0A 2R9WA 4FSFA 5AQ7A 1KOUA 5CX7A 2Y2IA 4O0PA 3IHAA 3P09A 2VGLM 3RXWA 2H10A 1K56A 2WYXA 2P9VA 4OOMA 1OPXA 4EEUA 4D60A 1SKFA 4KG5A 4MEZA 2PYRA 3MFDA 3R7WB 3G4PA 4CPKA 4QJGA 3SS3A 1P9RA 3D9YA 4DE0A 3MZFA 5CHMA 2G2WA 5J4EA 3LEZA 4FCFA 4DE1A 4LCMA 2EXAA 3MXQA 3T1QB 4DXCA 3A3IA 1SKOA 3CZDA 2GJ3A 5DFXA 1SDEA 4ZJ1A 5FA7A 4KZ3A 4Z1WA 1Y4OA 2XEPA 1A0KA 5EVIC 5EECA 4BJPA 1W7FA 2WZXA 5EV0A 1IYOA 1CK3A 1GA9A 3PAGA 4KZ8A 4JF6A 4OKPA 1NRJA 4OVDA 1MWTA 3TRCA 1GCEA 3C30A 1GHMA 4R70A 3VP1A 4N9KA 4X69A 5EOOA 1BZAA 3FPVA 1E3UA 2A24B 3C7VA 4BD0A 5CEBA 2HDSA 4B88A 1XJ6A 1UWNX 3B47A 2OLVA 3VSLA 3SH7A 4ETXA 3IQAA 4S2JA 4GNUA 3ZFZA 1XX2A 2KDKA 1ZHHB 3W2ZA 4KZ5A 4NXFA 2W3GA 1WA9A 1P0ZA 3FV7A 2ZQDA 1UWPX 5TFQA 5FSRA 2J9PA 5FQQA 1KE4A 2VV6A 3S22A 1KDSA 1IKIA 3KSFA 3CITA 3VFFA 2P74A 3LR5A 4OONA 2VKSA 3QHYA 2J3TC 5TR7A 3ICYA 5HZHA 1PI5A 4DMZA 3NDGA 1K55A 3IX3A 4DE2A 4P6ZS 4YNRA 2MJ6A 3ITAA 4ID4A 3EWKA 4PM5A 1DRMA 1K57A 2JBFA 2DMWA 4G3KA 2I9VA 4UEYA 1W8YA 4H6JA 3DAVA 3GVBA 5TJJA 2EXBA 1XGIA 4UA6A 3E2LA 1KE3A 3UB9A 3UB6A 4BD1A 2M1CA 1KE0A 4DXBA 1ZG6A 3G2ZA 3PBOA 3T4QA 1OJGA 5FDHA 4CQHA 5FAPA 3KO6A 4EV4A 1MWRA 3FYZA 5DJUA 4XT2A 4GHIA 3O86A 1BLHA 3O88A 5E43A 2WUQA 2XGNA 3A3JA 4HESA 1S6RA 1BUEA 4I3JA 1VHMA 4K91A 4KQDA 5A91A 5CTNA 1FCOA 5G4ZA 4KZ9A 3TSGA 4I38A 5AQ9A 2VA0A 5EM1A 4PM6A 3HLDA 3BRMA 1BYWA 3ZGAB 5DF7A 4X25A 1EWZA 3EEHA 1JWVA 4GD8A 3IH9A 4N1HA 3ZG7B 5FI7A 2Y2JA 3BFDA 1LL5A 3IT9A 2ZL1A 2VX8A 4O8GA 2EWWA 3C8CA 3NIAA 2VGLS 3Q81A 5G4YA 5L2FA 1XFNA 5I94A 2G7UA 3PYPA 3HUOA 3H9WA 4HJ4A 2VLGA 4QD4A 3HLCA 3O3VA 2PYPA 3KYZA 5GL9A 2Z2MB 2K2NA 5HDSA 4S2LA 4LV3A 3HL9A 2P9VB 3IF6A 1H8ZA 3Q07A 2J80A 4HNBA 3CUEC 5KSHA 5FAQA 4BENA 4DDSA 2YKHA 1VETA 4WZ4A 5CTMA 5GHYA 2XSSA 3UE0A 2ZM0A 2ZOIA 1ERQA 4NETA 5FASA 1E25A 3OPRA 4JGOA 1D06A 1FR1A 2HF6A 3UE6A 5DF8A 5HARA 4B4ZA 2GDNA 2Y4AA 1YT4A 4WZ5C 3AGDA 1OT9A 3MSHA 5CGSA 1LL8A 3LCEA 4HIAA 1OJ5A 1ES2A 1TS6A 1TS8A 1E3UD 3FPWA 1LSXA 3C4OA 4JXGA 1FIKA 4ZAMA 1HZOA 1J9MA 3ZNTA 1SHVA 5C5KA 3CG5A 3N4IA 1YLPA 3PXPA 2Y2NA 3EQUA 3BLSA 2E8JA 3LUQA 1VEUB 1QMFA 3H82A 3N8RA 5A92A 1FR6A 4CJNA 2V1ZA 3A0VA 3E0YA 1Z6FA 3UPPA 1ES4A 5E2FA 3PBTA 1HD8A 3SW1A
chains in the Genus database with same CATH topology
2V9AA 1IOUA 4UQIM 4CLCA 2HGVA 2Y8HA 4G3VA 3LYXA 4LLOB 2PR6A 3E98A 4Y2FA 1MKMA 1P9WA 3MFXA 4GCZA 3LI8A 4Q0HA 3B33A 5HPIA 2W1TB 5DKLA 4LRZE 3OBFA 4PHTA 3T4OA 2L0WA 3DBAA 2PD8A 1VB6A 3ZYTA 5K5BA 5HPFA 4HH3A 4Y3IA 1LT0A 2EWVA 4WELA 4F3LB 4QPRA 3PR6A 1XJ3A 4PAUA 1MC0A 4DN0A 4WEKA 1V9YA 4CLCC 4JGQA 2QKPA 3F1NA 3IBJA 1OT6A 3T4JA 1UGUA 2JHEA 4LPZA 3BWLA 2M7UA 1YSPA 3T50A 1S1YA 3HJKA 3UB7A 3MQ0A 2PDRA 1STZA 4EETB 3H7WB 4MN6A 3K3DA 2W1RA 3LIAA 4H6JB 4JGRA 4GW9A 2KX6A 4IUKA 5DF9A 3S7PA 4WL9A 3D3OA 3NOPC 3F1PB 4FOFA 4MCWA 3S7OA 1JNUA 4HP9A 5F69A 2L4RA 1MZUA 4I39A 2JKRM 4P6ZM 2NUPC 1W63Q 2O9CA 3OC2A 3EQVA 2FZ0A 3EGXC 2B02A 1Y28A 4GS9B 1ZTUA 2PT7A 4XT2B 4FSFA 4MMNA 1KOUA 1GSWA 2OWJA 5CX7A 3BJNA 1OTEA 4O0PA 1D7EA 5J3WA 2VGLM 1T1BA 2W3FA 4ETZA 4WUJA 4OOMA 4BWIA 2JKRI 1OPXA 2INWA 1X0OA 3MQOA 2GZAA 4IHQA 4EEUA 5HWVA 2HJEA 3CI6A 2PYRA 3R7WB 2XRNA 4CLCE 1P9RA 3MMHA 4MN7A 4BMWA 5HD3A 4BBVA 2KOIA 4M4XA 3UB8A 2QHKA 3RFBA 3BQ8A 1N9LA 3K3CA 5J4EA 4WF0A 4O01A 4OOLA 2QJ7A 2V0UA 5HWWA 3MXQA 4R3AA 2JN7A 5HWTA 4HI4A 4HH2A 1NLYA 1XJ2A 5F5YA 3LIBA 1XFQA 4B93A 4ZRRA 2VEAA 4RQ9A 2PD7A 2GJ3A 5FL3A 1TD5A 5DFXA 5IT5A 2PR5A 4NXGA 3UMDA 4R38A 2W0NA 4LRXC 3UMEA 1F98A 4EU0A 5TBMB 3PBQA 4Z1WA 4HJ6A 2K7SA 5EFWA 3IS2A 4BJPA 2EA9A 4KUOA 3MR0A 3PBNA 3ZQ5A 2QYBA 5MC7A 1S67L 5J7EA 1NRJA 4K08A 3HJIA 3TRCA 3LR4A 2W1TA 4CLCD 2OWHA 2J3WA 2ZOHA 3LR3A 2XA7S 3C30A 4R70A 1H8MA 1S4SA 2WKPA 4WEJA 1F9IA 3CAXA 2D02A 3KSGA 1S1ZA 3FPVA 1P97A 2A24B 3RH8B 1H3QA 3B42A 1T1CA 3C2WA 4YOFA 4GJ4A 5AVFA 3TE8A 1XJ6A 3RTYA 1UWNX 3B47A 2W3EA 4ETXA 3F1NB 1V9ZA 2A24A 2ZMFA 3T4LA 2KDKA 1ZHHB 2H28A 2PHYA 1XJ4A 3W2ZA 4HHDA 2J3TD 5TBMA 4NXFA 2W3GA 1WA9A 3BY9A 1P0ZA 3F1OA 3G6OA 2YKFA 3NHQA 1UWPX 3UE3A 2NUTC 2M7VA 1NLZA 5A8BA 2VV6A 4ARZB 5HSQA 3JVUA 3LICA 3E4OA 3T4SA 2ZMVA 5HDCA 5IS1A 3T4TA 4WN5A 3JVVA 3KSFA 3CITA 3LR5A 3U2AA 3KSHA 3NJAA 2VKSA 1F5MA 1NWZA 3TJZC 5KIZA 3EOIA 2XA7M 4UQIS 4ME4A 3LIEA 2J3TC 5AVEA 3ICYA 4HY8A 3OLOA 5HZHA 2XROA 4DMZA 4EXOA 4P6ZS 4YNRA 1N9NA 2Y79A 3VE4A 2MJ6A 5HDDA 1T1AA 4YWZA 3EWKA 5DFYA 1DRMA 2JKTM 3LIFA 4HQAA 2DMWA 4G3KA 2I9VA 4UEYA 3S7QA 3VE3A 4H6JA 3P01A 4MDZA 3R4KA 5TJJA 1S4RA 4II7A 2GX5A 3A0SA 2GNXA 3UB9A 3UB6A 2A2LA 2M1CA 4I3IA 3LFVA 3BW6A 3PBOA 2O9BA 2LB9A 3T4QA 1T19A 3CWFA 1OJGA 4GS9A 4CQHA 2LB5A 3FG8A 4EERA 3KO6A 4JGPA 3C38A 4Q0JA 5DJUA 4XT2A 4GHIA 1DP6A 3GDIA 4MN5A 4I3AA 2W27A 2QWSA 5DJTA 3ULFA 5HD5A 1YKDA 4I3JA 4KQOA 1VHMA 2W3DA 3MF0A 4KQDA 4NEED 2ZBBA 5G4ZA 5I5LA 4EQ1A 3O5YA 4I38A 3V67A 2VA0A 1LSWA 3T4KA 2WKQA 5L8MA 3HCYA 2O9AA 1OTAA 1BYWA 2FH5A 1TF1A 4DJ3A 2V1BA 3EEHA 3IS2B 5HL6A 3VOLA 4Y5FA 2OAQ1 2OAP1 2O99A 2D01A 3A0RA 3EEAA 4L9EA 4HP4A 2Z6DA 2Z6CA 3OOVA 2VX8A 2V0WA 4O8GA 4IUHA 2EWWA 3C8CA 2VGLS 2HJ9C 2IA2A 1DP8A 3E4PA 5G4YA 2VJWA 3OCNA 1XFNA 3EGDC 3GECA 2G7UA 1DP9A 4G3WA 2R78A 4GHIB 4EW7A 1YSQA 2L1MA 3VV4A 4Q0IA 3PYPA 3H9WA 2JKTI 2KLIA 4GLQA 4HJ4A 2VLGA 1ODVA 3LIDA 1YAXA 2B18A 3P7NA 2PYPA 3KYZA 2HV1A 3PHYA 2OOLA 2K2NA 5HDSA 2K31A 1TS7A 3KSIA 4HJ3A 4EEPA 3KYQA 4DJ2A 4I5SA 1EW0A 1LSVA 1OTBA 1OTDA 3E4QA 3CUEA 4E04A 3MJQA 2J80A 4ARZA 4HNBA 4HOIA 3CUEC 5KSHA 3F1PA 4IJGA 4NKPA 2QJ5A 2YKHA 4WLAA 4L9FA 4AFIA 3LI9A 2XSSA 2VV8A 2ZOIA 3FC7A 5IU1A 1GSVA 5F6AA 4JGOA 1D06A 2P7JA 2HF6A 3UE6A 2V1AA 3PBRA 4B9OA 1OT9A 3PBSA 2WKRA 3IBRA 4R6LA 1LL8A 3CLOA 3NOUC 4HIAA 1OJ5A 3S7NA 1TS6A 5LBRA 2W3HA 4KUKA 3F1OB 4BBTA 2CMNA 1TS8A 3FPWA 3MQQA 3R7WA 1N9OA 1LSXA 2P08A 2VV7A 1OTIA 3NOTC 2VZWA 3OCLA 2O0YA 4L0LA 5AJGA 3LR0A 5C5KA 1GSXA 3H82B 1W63M 3PXPA 4NXBA 1G6OA 3EQUA 4EESA 3K2NA 2BASA 4NXEA 3LUQA 1S66L 4F3LA 1IFQA 3H82A 4LRYC 4PKYA 1TS0A 3D72A 5F68A 3A0VA 3E0YA 3TW8A 4PKYG 4CLCB 4BBUA 1T18A 3BQAA 5DKKA 2P04A 3H7WA 4EUVA 3PBTA 4L9GA 3BY8A 1G28A 3SW1A 3KX0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OLO A;  2V9A A;  5HZH A;  1N9L A;  3K3C A;  3P7N A;  5J4E A;  4WF0 A;  2PYP A;  3LYX A;  4LLO B;  2HV1 A;  2PR6 A;  2QJ7 A;  2V0U A;  3PHY A;  2OOL A;  4EXO A;  5HWW A;  3MXQ A;  4R3A A;  5HDS A;  1N9N A;  3VE4 A;  1TS7 A;  5HDD A;  4EEP A;  1T1A A;  2JN7 A;  3MFX A;  4HJ3 A;  4HI4 A;  3EWK A;  4YWZ A;  5HWT A;  4HH2 A;  4DJ2 A;  4GCZ A;  1XJ2 A;  1DRM A;  3LI8 A;  3LIF A;  4HQA A;  4I5S A;  3B33 A;  1EW0 A;  1LSV A;  1OTB A;  1OTD A;  3LIB A;  1XFQ A;  3E4Q A;  2I9V A;  5DKL A;  3MJQ A;  3VE3 A;  4E04 A;  2J80 A;  4LRZ E;  4H6J A;  4HNB A;  4HOI A;  2L0W A;  3F1P A;  2VEA A;  1S4R A;  4RQ9 A;  2PD7 A;  2PD8 A;  1VB6 A;  2GJ3 A;  2PR5 A;  3A0S A;  4NXG A;  3UMD A;  2QJ5 A;  4HH3 A;  4R38 A;  2W0N A;  4LRX C;  3UB9 A;  3UB6 A;  1LT0 A;  2YKH A;  4WLA A;  2M1C A;  4F3L B;  3UME A;  1F98 A;  5TBM B;  1XJ3 A;  4I3I A;  4HJ6 A;  4L9F A;  2K7S A;  5EFW A;  3LI9 A;  2VV8 A;  2ZOI A;  3FC7 A;  5IU1 A;  1V9Y A;  1GSV A;  4JGQ A;  2QKP A;  5F6A A;  3F1N A;  3IS2 A;  4JGO A;  1D06 A;  1T19 A;  2EA9 A;  2P7J A;  3CWF A;  3KX0 X;  1OJG A;  1OT6 A;  4GS9 A;  3UE6 A;  1UGU A;  2JHE A;  3FG8 A;  3BWL A;  3MR0 A;  4KUO A;  2V1A A;  4JGP A;  4LPZ A;  3T50 A;  1S1Y A;  3HJK A;  4B9O A;  4EER A;  3UB7 A;  5DJU A;  2PDR A;  3ZQ5 A;  4XT2 A;  1OT9 A;  4GHI A;  1S67 L;  3H7W B;  4MN6 A;  4EET B;  5J7E A;  3K3D A;  2WKR A;  3IBR A;  1DP6 A;  4R6L A;  1LL8 A;  3GDI A;  3CLO A;  3LIA A;  3NOU C;  4I3A A;  4H6J B;  2W27 A;  1OJ5 A;  4HIA A;  1TS6 A;  4JGR A;  4K08 A;  3HJI A;  4GW9 A;  2QWS A;  2KX6 A;  4KUK A;  3F1O B;  2OWH A;  2ZOH A;  5DJT A;  4BBT A;  3ULF A;  2CMN A;  5HD5 A;  1TS8 A;  4I3J A;  4R70 A;  4WL9 A;  3NOP C;  3F1P B;  4KQD A;  1S4S A;  2WKP A;  3MQQ A;  1F9I A;  2ZBB A;  3CAX A;  1JNU A;  2D02 A;  4HP9 A;  1N9O A;  5G4Z A;  5F69 A;  1LSX A;  2L4R A;  5I5L A;  4EQ1 A;  1S1Z A;  1MZU A;  1P97 A;  2A24 B;  3RH8 B;  4I38 A;  2VV7 A;  1OTI A;  3NOT C;  4MN5 A;  1LSW A;  4I39 A;  2WKQ A;  1T1C A;  3C2W A;  5AVF A;  1XJ6 A;  3RTY A;  1UWN X;  1OTA A;  1BYW A;  2B02 A;  1Y28 A;  4GS9 B;  1GSX A;  4DJ3 A;  2V1B A;  3EEH A;  3F1N B;  3IS2 B;  3H82 B;  1V9Z A;  2A24 A;  3VOL A;  4NXB A;  4XT2 B;  2KDK A;  2H28 A;  4EES A;  2D01 A;  2PHY A;  3A0R A;  1KOU A;  1XJ4 A;  1GSW A;  2BAS A;  2OWJ A;  1OTE A;  4HHD A;  5TBM A;  4L9E A;  4NXF A;  4HP4 A;  4NXE A;  3BY9 A;  1WA9 A;  1D7E A;  1S66 L;  1P0Z A;  2Z6C A;  2Z6D A;  3F1O A;  3LUQ A;  5J3W A;  1T1B A;  3G6O A;  3H82 A;  4F3L A;  2YKF A;  3NHQ A;  1UWP X;  4LRY C;  4PKY A;  1TS0 A;  4WUJ A;  2V0W A;  3D72 A;  3C8C A;  5A8B A;  2VV6 A;  2INW A;  5F5Y A;  3E4P A;  5G4Y A;  1DP8 A;  1X0O A;  3A0V A;  3MQO A;  3LIC A;  5F68 A;  4EEU A;  3E4O A;  5HWV A;  5HSQ A;  1XFN A;  2PYR A;  5HDC A;  3GEC A;  5IS1 A;  4WN5 A;  1DP9 A;  2VLG A;  4PKY G;  2R78 A;  4GHI B;  4EW7 A;  2L1M A;  4BBU A;  3NJA A;  1NWZ A;  1T18 A;  3PYP A;  5DKK A;  5KIZ A;  3H9W A;  3H7W A;  5HD3 A;  4BBV A;  4M4X A;  4L9G A;  3BY8 A;  3LIE A;  4HJ4 A;  1G28 A;  3UB8 A;  1ODV A;  3LID A;  2QHK A;  3SW1 A;  5AVE A;  3ICY A;  4HY8 A; 
#chains in the Genus database with same CATH topology
 2V9A A;  4CLC A;  2Y8H A;  4UAA A;  1K56 D;  3CJM A;  1PRQ A;  1MKM A;  2HP6 A;  1P9W A;  2HPB A;  4GCZ A;  4Q0H A;  5HPI A;  1NJ4 A;  5DKL A;  4LRZ E;  4PHT A;  3ZYT A;  1QME A;  1N9B A;  4GN2 A;  3MBZ A;  4F3L B;  4WEL A;  3Q82 A;  3PR6 A;  4QPR A;  2OSU A;  1XJ3 A;  2ZC7 A;  2WGW A;  3OPP A;  4CLC C;  2JKF A;  1ZC2 A;  3F1N A;  4BLM A;  3T4J A;  1UGU A;  4LPZ A;  3IWI A;  3T50 A;  4EBP A;  3M6B A;  1S1Y A;  1Q2Q A;  3MQ0 A;  3VP2 A;  4KZ7 A;  2XR0 A;  3AGF A;  3LIA A;  3QP2 A;  4WMC A;  4C6Y A;  5DF9 A;  2ZL1 B;  2ZC5 B;  1ZG4 A;  4WL9 A;  2XFS A;  3NOP C;  4HEF A;  3DWK A;  3QNB A;  1MKI A;  4I39 A;  2X71 A;  2JKR M;  4P6Z M;  2NUP C;  3OC2 A;  4MBK A;  2B02 A;  4GS9 B;  3BLM A;  2JC7 A;  3BYD A;  3FWL A;  4XT2 B;  4DKI A;  1GSW A;  2OWJ A;  2RL3 A;  4E3J A;  5FAO A;  1D7E A;  5J3W A;  3SS4 A;  3VP3 A;  4RVA A;  5E2H A;  3LO7 A;  4WUJ A;  4BWI A;  3UDX A;  2INW A;  4IHQ A;  1O07 A;  3MQO A;  5HWV A;  2HJE A;  3CI6 A;  3ZG8 B;  2XRN A;  4M3K A;  2KOI A;  4M4X A;  3LEQ A;  3RFB A;  1K6R A;  1N9L A;  3K3C A;  4WF0 A;  1XPB A;  2V0U A;  5HWW A;  1BLS A;  2PBD P;  3IX8 A;  3S4X A;  1FCM A;  3V5M A;  5CER A;  5F5Y A;  4E3L A;  3IWQ A;  3UB5 P;  4P0M A;  1HLU P;  3N8L A;  4B93 A;  2ZQC A;  4X6T A;  5HAQ A;  4LEN A;  2PR5 A;  2EX9 A;  3CMZ A;  4KQQ A;  4OQG A;  4LRX C;  4ZJ3 A;  2Z2L B;  3PBQ A;  2BTF P;  3IS2 A;  4GB7 A;  2EA9 A;  2X02 A;  3G35 A;  4KUO A;  4S2O A;  4B4X A;  1S67 L;  1WYB A;  4K08 A;  1RGY A;  3E2K A;  3DTM A;  3CHW P;  5KSC A;  2W1T A;  2Y2H A;  1SCW A;  1CEF A;  3WS4 A;  3N7W A;  2WKP A;  2BLS A;  4X56 A;  1P97 A;  3B42 A;  1DJA A;  2Y2G A;  4Y17 A;  4YOF A;  4GJ4 A;  1SKO B;  5AVF A;  3TE8 A;  3C7U A;  3JPU A;  4KZ4 A;  4JF5 A;  2ZMF A;  2C5W B;  3T4L A;  4WBG A;  4HHD A;  1LHY A;  2J3T D;  5TBM A;  1DJC A;  1NYM A;  1HTZ A;  3G6O A;  2ZC6 B;  3NHQ A;  2WAD A;  4KZ6 A;  1CI8 A;  1NLZ A;  4BL2 A;  1FIL A;  4ARZ B;  3QP5 A;  3VOZ A;  2ZMV A;  3T4T A;  4WN5 A;  2JE5 A;  3U2A A;  2V20 A;  2B95 A;  1NWZ A;  1FSW A;  5IHV A;  4U3T A;  5HL1 A;  4ME4 A;  3LIE A;  2I72 A;  3OLO A;  2XRO A;  4S2K A;  2RCX A;  1HVB A;  1E4D A;  5HDD A;  1T1A A;  5DFY A;  3LIF A;  2ZLY A;  1IEM A;  4OQI A;  3DTI A;  2XH9 A;  4FUW A;  4X68 A;  3G32 A;  1S4R A;  4GDB A;  1K57 C;  3A0S A;  5FQM A;  2GNX A;  4FD8 A;  5D3O A;  4K0W A;  3IX4 A;  1NXY A;  2LB9 A;  4GS9 A;  2LB5 A;  4EER A;  4JGP A;  1DP6 A;  2X01 A;  2W27 A;  3GV9 A;  1VQQ A;  5DJT A;  4ZBE A;  2W3D A;  3MF0 A;  4NEE D;  1RGZ A;  2Y2L A;  4QU3 A;  1C3B A;  1WYC A;  4EQ1 A;  3T4K A;  3WS5 A;  2J8Y A;  5L8M A;  3HCY A;  5KZH A;  3ZCZ A;  1OTA A;  5M1A A;  1TF1 A;  4YFM A;  3IS2 B;  1IYS A;  1GHI A;  2OAQ 1;  3IH8 A;  2D01 A;  3A0R A;  5EVE A;  4L9E A;  4HBT A;  1ESI A;  3OOV A;  4DRT A;  4EBN A;  5GLC A;  3DWZ A;  4E3O A;  4OP8 A;  1NY0 A;  2IA2 A;  3E4P A;  1DP8 A;  2VJW A;  3OCN A;  5HW3 A;  3HLE A;  3UY6 A;  1LI9 A;  4GHI B;  5CHJ A;  2E8I A;  1JTD A;  2JKT I;  3FZC A;  4S2N A;  3MZD A;  3LID A;  4X1L A;  1D1J A;  4R4S A;  3PHY A;  2OOL A;  4PPR A;  2K31 A;  1TS7 A;  3KSI A;  3NUL A;  4HJ3 A;  4EEP A;  4EUZ A;  4P6B A;  1ALQ A;  3E4Q A;  3CUE A;  4E04 A;  5A93 A;  1BLP A;  4HOI A;  3QP8 A;  1K0K A;  4E3K A;  3IF6 C;  4LFU A;  2QJ5 A;  1I2W A;  3VSK A;  5AQA A;  5E2E A;  4KG6 A;  1GSV A;  2XDM A;  3IWO A;  2P7J A;  1CF0 A;  3Q7V B;  2OLU A;  3PBR A;  4B9O A;  4WYY A;  1BSG A;  1FCN A;  5FAT A;  5EVL A;  3IBR A;  4R6L A;  1ESU A;  3S7N A;  3A3F A;  1PNE A;  4BBT A;  3O87 A;  4RYE A;  5TGF A;  5CGW A;  1W5D A;  3BEC A;  4E6W A;  3U4L P;  3W8K A;  2P08 A;  3NOT C;  4MNR A;  3IHB A;  3BFG A;  3ISG A;  3ZDJ A;  4K0X A;  1YLW A;  2XD5 A;  5CXW A;  3H82 B;  1KVL A;  1W63 M;  1YQS A;  4E3M A;  2AVX A;  3BM6 A;  3OZH A;  3HLG A;  4LRY C;  5JYP A;  4PKY A;  3MKE A;  2WAE A;  2WGV A;  3UPN A;  3IXG A;  5F68 A;  4C75 A;  3C4P A;  4PKY G;  3ITB A;  4BBU A;  5DKK A;  3FKV A;  2P04 A;  2EX8 A;  2WZZ A;  4P87 A;  4L9G A;  1G28 A;  2FFY A;  3G30 A;  2XQZ A;  3T12 B;  4KZA A;  2HGV A;  1U60 A;  1ES5 A;  1TDL A;  3V3S A;  3B33 A;  3CPT B;  2Y2M A;  3VOY A;  1EI5 A;  3T4O A;  3UPO A;  3DBA A;  1L0F A;  4KG2 A;  3NCK A;  1LT0 A;  2JKG A;  3KYE A;  5HAP A;  4OLD A;  5HFO A;  3HBR A;  4DN0 A;  4XUX A;  4WEK A;  4JGQ A;  3RJU A;  3SH8 A;  3BWL A;  5CEC A;  3ZG5 A;  4DDY A;  4R23 A;  5EUA A;  3UB7 A;  1W8Q A;  5FEF A;  3H7W B;  4MN6 A;  5F1F A;  3GTC A;  2W1R A;  4EWF A;  4GW9 A;  1K54 A;  1DJB A;  1G5U A;  3C5A A;  3D3O A;  3T1R A;  2XLN A;  1JNU A;  2L4R A;  4Z9Q A;  1O7E A;  3DTE A;  3WRT A;  2ZC4 B;  2ZM8 A;  1Y28 A;  2PT7 A;  1MPL A;  1FSY A;  4MMN A;  2WKE A;  1OTE A;  4OPY A;  2H5S A;  5FI6 A;  4Y13 A;  1W79 A;  4IVK A;  2GZA A;  4Y0U A;  4IVI A;  3VP0 A;  4OH0 A;  3JYI A;  3MMH A;  1YMS A;  3HUN A;  5HD3 A;  4BL3 A;  2UWX A;  3UB8 A;  2QHK A;  3BQ8 A;  3NBL A;  4OOL A;  4JXV A;  5HWT A;  4HH2 A;  5M18 A;  1NLY A;  1L0D A;  4ZRR A;  2VEA A;  4RQ9 A;  4P85 A;  2PD7 A;  1WE4 A;  5L07 A;  5FL3 A;  4IBX A;  3IXH A;  1F98 A;  3DTK A;  4HJ6 A;  4ZTK A;  2K7S A;  4S2M A;  5M19 A;  5GLA A;  3ZQ5 A;  5J7E A;  5DVA A;  3BFF A;  3HJI A;  3LR4 A;  4CLC D;  2OWH A;  2ZOH A;  4Q8I A;  4X55 A;  2ZQA A;  4OLG A;  4F94 A;  5FQI A;  2D02 A;  3RH8 B;  1H3Q A;  1G6A A;  1T1C A;  1I2S A;  3C2W A;  3RXX A;  1TEM A;  1VM1 A;  2WGW B;  3RTY A;  1SDN A;  3F1N B;  4R0Q A;  2A24 A;  1PI4 A;  1XXM A;  1XJ4 A;  3BY9 A;  4RX3 A;  3F1O A;  1PIO A;  4LV2 A;  4D2O A;  2YKF A;  2NUT C;  1MWU A;  5A8B A;  3E4O A;  5HDC A;  2ZC3 B;  3JVV A;  3V50 A;  3TJZ C;  5KIZ A;  4UQI S;  2EFU A;  1PW8 A;  4JXS A;  4HBU A;  4OQ0 A;  2CC1 A;  1L3L A;  4EXO A;  2Y79 A;  3VE4 A;  4YWZ A;  1OME A;  5FEG A;  3S7Q A;  3VE3 A;  4MDZ A;  5EM0 A;  3WS2 A;  4II7 A;  2GX5 A;  3M2K A;  3ZNY A;  2A2L A;  4H8R A;  4ZDX A;  4I3I A;  1NYY A;  3BW6 A;  2O9B A;  3CWF A;  1IYQ A;  4QHC A;  1JWZ A;  3C38 A;  3SOI A;  2QZ6 A;  2WGI A;  3GDI A;  4QY6 A;  4I3A A;  4JPM A;  3ULF A;  4KQO A;  5EPH A;  2Q9N A;  3O5Y A;  3W4P A;  1KVM A;  3WRZ A;  1K54 C;  4ZJ2 A;  1RCJ A;  2Q0O A;  2C6W B;  2O9A A;  2FH5 A;  5HL6 A;  3VOL A;  3HVF A;  1PZO A;  2OAP 1;  4U0T A;  1TVF A;  2O99 A;  2Y59 A;  3A3D A;  5FQ9 A;  3EEA A;  2Z6D A;  3ZVW A;  3M2J A;  2V0W A;  3FKW A;  2V8F A;  2PU4 A;  3IXB A;  3EGD C;  3GEC A;  1DP9 A;  3QP6 A;  4G3W A;  2R78 A;  2L1M A;  2Y2O A;  4JXW A;  4OPR A;  3MKF A;  2KLI A;  1ACF A;  4GLQ A;  1ODV A;  5L10 A;  3QP4 A;  4O7D A;  4LGW A;  3P7N A;  2HV1 A;  1YPR A;  3KYQ A;  4DJ2 A;  3W4O A;  2OV5 A;  1EW0 A;  1OTB A;  1VET B;  3MJQ A;  4ARZ A;  3UO9 A;  1XKZ A;  5EVI B;  2V8C A;  1M6K A;  1GA0 A;  2J9O A;  4L9F A;  1VEU A;  4Y0O A;  1YMX A;  5F6A A;  2HDU A;  2V1A A;  1KGF A;  1YLJ A;  2EX2 A;  2V2F F;  3UN7 A;  2WKR A;  4MBF A;  1JTG A;  5DTT A;  3GQZ A;  3GRJ A;  4KUK A;  5LBR A;  3F1O B;  2CMN A;  5L09 A;  4OPQ A;  2ZM2 A;  5GLB A;  3R7W A;  1DY6 A;  4C3Q A;  4Y15 A;  4R4R A;  3SH9 A;  2ZMA A;  4YIN A;  4FH2 A;  5GHX A;  2VV7 A;  3UNW A;  2VZW A;  3OCL A;  1MY8 A;  3L7H A;  2O0Y A;  2IWC A;  5AJG A;  3LR0 A;  3T1S A;  3A3E A;  1GSX A;  2BG1 A;  3PAE A;  1GHP A;  1IKG A;  2BAS A;  1N4O A;  3V3R A;  4S2P A;  1IFQ A;  4RA7 A;  1TS0 A;  3D72 A;  2DRW A;  4EBL A;  1H5X A;  3TW8 A;  1YLY A;  4CLC B;  2G2U A;  1T18 A;  3BQA A;  5FQJ A;  3WS1 A;  4EUV A;  3TG9 A;  5HX9 A;  4OQH A;  4KEN B;  5KMW A;  1IOU A;  4UQI M;  4G3V A;  1AWI A;  3LYX A;  4LLO B;  4JF4 A;  3E98 A;  4Y2F A;  4NG2 A;  5F83 A;  3LI8 A;  5CRF A;  5EVI D;  3OBF A;  1PWD A;  1PW1 A;  1NZO A;  1JWP A;  4KQR A;  5K5B A;  4HH3 A;  4Y3I A;  1TDG A;  1K25 A;  2Q9M A;  4LV0 A;  1IEL A;  1MC0 A;  3UE1 A;  1V9Y A;  2QKP A;  3IBJ A;  3IXD A;  2JHE A;  2M7U A;  5HAI A;  2PDR A;  4GDN A;  2ZQ7 A;  1STZ A;  4EET B;  3P98 A;  4JGR A;  2ACG A;  2KX6 A;  4S2N C;  4N9L A;  1NZU A;  1KGG A;  4FOF A;  1H0M A;  3S7O A;  5F69 A;  1MZU A;  1W63 Q;  2XF3 A;  1CEG A;  3EQV A;  2XFT A;  3Q7V A;  4UHU A;  2WKH A;  4QY5 A;  1KGE A;  3BJN A;  3W4Q A;  1T1B A;  2W3F A;  4ETZ A;  2R9X A;  4E3I A;  3BFE A;  2JKR I;  4DE3 A;  1X0O A;  2XK1 A;  4CLC E;  4GD6 A;  4MN7 A;  4BMW A;  3MXR A;  5EVI A;  3GR2 A;  1PWG A;  2PRF A;  1LL9 A;  4BBV A;  1CJF A;  1ERO A;  1CI9 A;  1F2K A;  4GZB A;  4O01 A;  3VMA A;  2QJ7 A;  4NK3 A;  4R3A A;  2WKI A;  2JN7 A;  1RP5 A;  4HI4 A;  4MBH A;  1XJ2 A;  1ONG A;  3LIB A;  1XFQ A;  3VP4 A;  4PM8 A;  1TD5 A;  5IT5 A;  3T1X A;  4NXG A;  3UMD A;  4R38 A;  2W0N A;  2DCF A;  1PZP A;  3UME A;  4EU0 A;  5TBM B;  2ZD8 A;  4PM9 A;  5EFW A;  1L0G A;  3GMW A;  5FDS A;  3MR0 A;  4JBF A;  5GLD A;  3PBN A;  2QYB A;  5MC7 A;  1ONH A;  2J3W A;  3LR3 A;  2XA7 S;  1H8M A;  1S4S A;  4WEJ A;  1F9I A;  3CAX A;  4EQI A;  4RX2 A;  3KSG A;  4OPZ A;  1S1Z A;  1BTL A;  4WZ5 A;  1XA1 A;  3HLB A;  4UA9 A;  2W3E A;  4WM9 A;  1V9Z A;  4MLL A;  3MS6 A;  2WK0 A;  4JLF A;  2H28 A;  2PHY A;  1KDW A;  5GHZ A;  2HDQ A;  3G31 A;  5AQB A;  3IF6 B;  3B3X A;  3UE3 A;  1Y54 A;  2M7V A;  3ZG9 B;  1BLC A;  5HSQ A;  3JVU A;  3LIC A;  1ZKJ A;  3T4S A;  5BOH A;  5IS1 A;  4PMA A;  2PBY A;  1YLT A;  3KSH A;  3NJA A;  3Q1F A;  1F5M A;  1PWC A;  5CHU A;  3EOI A;  5EOE A;  2XA7 M;  2PAV P;  5AVE A;  4HY8 A;  2VGJ A;  2ZJ9 A;  1MWS A;  3I7J A;  2EX6 A;  1YLZ A;  1N9N A;  4JKT A;  2HP9 A;  3M6H A;  4GKU A;  2JKT M;  4HQA A;  3QP1 A;  3NC8 A;  4BQM A;  3P01 A;  3R4K A;  1K4F A;  4U0X A;  3MZE A;  2Y2P A;  2IWD A;  3LFV A;  1FOF A;  3Q7Z A;  4GOG A;  1T19 A;  2PU2 A;  3UDF A;  1LI0 A;  4QWO A;  3FG8 A;  2HZ5 A;  1PYY A;  2WAF A;  5FI2 A;  4Q0J A;  4UA7 A;  4MN5 A;  2QWS A;  1YM1 A;  5HD5 A;  2Y91 A;  1YKD A;  3BEB A;  3N8S A;  4N1X A;  2ZBB A;  5I5L A;  3HRE A;  1PFL A;  1Z09 A;  3V67 A;  1BUL A;  1LSW A;  2WKQ A;  2VK3 A;  3HLF A;  3ZHH A;  1MXO A;  4E6X A;  1J3W A;  5FQK A;  4DJ3 A;  2V1B A;  3WWX A;  4PM7 A;  4Y5F A;  4FTX A;  4HP4 A;  2Z6C A;  2Y2Q A;  4IUH A;  2J7V A;  5J8X A;  2HJ9 C;  2XD1 A;  4XUZ A;  4EW7 A;  1YSQ A;  3VV4 A;  4Q0I A;  5JYO A;  1XA7 A;  2ZQ9 A;  2Y55 A;  3NI9 A;  2B5R A;  1JVJ A;  1MBL A;  3OPH A;  1K6S A;  2H0Y A;  5CGX A;  2UV0 E;  1YAX A;  2B18 A;  3PTE A;  4IED A;  3NY4 A;  1K4E A;  2A49 A;  4I5S A;  1LSV A;  1OTD A;  2VGK A;  4ESP A;  3MXS A;  3TOI A;  3GSG A;  3F1P A;  4DF6 A;  4IJG A;  2A3U A;  4NKP A;  4WLA A;  3UDI A;  1G68 A;  4AFI A;  1S0W A;  3LI9 A;  2VV8 A;  3FC7 A;  3L9K A;  5IU1 A;  3VFH A;  1ES3 A;  3V39 A;  4IBR A;  1AXB A;  3ZG0 A;  3PBS A;  3CLO A;  3NOU C;  5EE8 A;  1M40 A;  4A5R A;  4Y0T A;  3LGO A;  2W3H A;  3G34 A;  4OOY A;  1L0E A;  3MQQ A;  4FH4 A;  1N9O A;  3BFC A;  3DW0 A;  1OTI A;  3NDE A;  3NEC A;  4L0L A;  2JCH A;  2HP5 A;  3OPL A;  1H8Y A;  4NXB A;  1G6O A;  2HDR A;  4EES A;  2FFF B;  3K2N A;  4XXR A;  5F82 A;  3S1Y A;  4NXE A;  1S66 L;  4F3L A;  1LLB A;  2QMI A;  3SS5 A;  1FQG A;  4R1G A;  4Y7P A;  4QB8 A;  4E3N A;  1I5Q A;  3AGE A;  3N6I A;  3H7W A;  4X1M A;  1CQA A;  1K38 A;  3BY8 A;  3G2Y A;  2QPN A;  3KX0 X;  5F1G A;  4R3B A;  1Q2P A;  1XP4 A;  4WMC D;  5A90 A;  3CPT A;  2PR6 A;  4LCL A;  1SZV A;  3MFX A;  2W1T B;  1XGJ A;  2ZQ8 A;  3IF5 A;  2L0W A;  4OP5 A;  2PD8 A;  1VB6 A;  5G18 A;  1K55 C;  5HPF A;  1IYP A;  2EWV A;  4LV1 A;  4PAU A;  3LY3 A;  2EFX A;  2H0T A;  2DNS A;  3LY4 A;  5CED A;  4X53 A;  1L2S A;  1OT6 A;  1YSP A;  3HJK A;  3K3D A;  3HUM A;  2Y2K A;  4H6J B;  4N92 A;  3QNC A;  4IUK A;  1BT5 A;  3S7P A;  2IWB A;  4S2I A;  3SZT A;  3F1P B;  4R3J A;  4MCW A;  4HP9 A;  5U47 A;  5DTK A;  3ZVT A;  1NRF A;  3D4F A;  2O9C A;  5E2G A;  5DTS A;  2FZ0 A;  3EGX C;  3HLW A;  1ZTU A;  4KZB A;  1ERM A;  3WS0 A;  2R9W A;  4FSF A;  5AQ7 A;  1KOU A;  5CX7 A;  2Y2I A;  4O0P A;  3IHA A;  3P09 A;  2VGL M;  3RXW A;  2H10 A;  1K56 A;  2WYX A;  2P9V A;  4OOM A;  1OPX A;  4EEU A;  4D60 A;  1SKF A;  4KG5 A;  4MEZ A;  2PYR A;  3MFD A;  3R7W B;  3G4P A;  4CPK A;  4QJG A;  3SS3 A;  1P9R A;  3D9Y A;  4DE0 A;  3MZF A;  5CHM A;  2G2W A;  5J4E A;  3LEZ A;  4FCF A;  4DE1 A;  4LCM A;  2EXA A;  3MXQ A;  3T1Q B;  4DXC A;  3A3I A;  1SKO A;  3CZD A;  2GJ3 A;  5DFX A;  1SDE A;  4ZJ1 A;  5FA7 A;  4KZ3 A;  4Z1W A;  1Y4O A;  2XEP A;  1A0K A;  5EVI C;  5EEC A;  4BJP A;  1W7F A;  2WZX A;  5EV0 A;  1IYO A;  1CK3 A;  1GA9 A;  3PAG A;  4KZ8 A;  4JF6 A;  4OKP A;  1NRJ A;  4OVD A;  1MWT A;  3TRC A;  1GCE A;  3C30 A;  1GHM A;  4R70 A;  3VP1 A;  4N9K A;  4X69 A;  5EOO A;  1BZA A;  3FPV A;  1E3U A;  2A24 B;  3C7V A;  4BD0 A;  5CEB A;  2HDS A;  4B88 A;  1XJ6 A;  1UWN X;  3B47 A;  2OLV A;  3VSL A;  3SH7 A;  4ETX A;  3IQA A;  4S2J A;  4GNU A;  3ZFZ A;  1XX2 A;  2KDK A;  1ZHH B;  3W2Z A;  4KZ5 A;  4NXF A;  2W3G A;  1WA9 A;  1P0Z A;  3FV7 A;  2ZQD A;  1UWP X;  5TFQ A;  5FSR A;  2J9P A;  5FQQ A;  1KE4 A;  2VV6 A;  3S22 A;  1KDS A;  1IKI A;  3KSF A;  3CIT A;  3VFF A;  2P74 A;  3LR5 A;  4OON A;  2VKS A;  3QHY A;  2J3T C;  5TR7 A;  3ICY A;  5HZH A;  1PI5 A;  4DMZ A;  3NDG A;  1K55 A;  3IX3 A;  4DE2 A;  4P6Z S;  4YNR A;  2MJ6 A;  3ITA A;  4ID4 A;  3EWK A;  4PM5 A;  1DRM A;  1K57 A;  2JBF A;  2DMW A;  4G3K A;  2I9V A;  4UEY A;  1W8Y A;  4H6J A;  3DAV A;  3GVB A;  5TJJ A;  2EXB A;  1XGI A;  4UA6 A;  3E2L A;  1KE3 A;  3UB9 A;  3UB6 A;  4BD1 A;  2M1C A;  1KE0 A;  4DXB A;  1ZG6 A;  3G2Z A;  3PBO A;  3T4Q A;  1OJG A;  5FDH A;  4CQH A;  5FAP A;  3KO6 A;  4EV4 A;  1MWR A;  3FYZ A;  5DJU A;  4XT2 A;  4GHI A;  3O86 A;  1BLH A;  3O88 A;  5E43 A;  2WUQ A;  2XGN A;  3A3J A;  4HES A;  1S6R A;  1BUE A;  4I3J A;  1VHM A;  4K91 A;  4KQD A;  5A91 A;  5CTN A;  1FCO A;  5G4Z A;  4KZ9 A;  3TSG A;  4I38 A;  5AQ9 A;  2VA0 A;  5EM1 A;  4PM6 A;  3HLD A;  3BRM A;  1BYW A;  3ZGA B;  5DF7 A;  4X25 A;  1EWZ A;  3EEH A;  1JWV A;  4GD8 A;  3IH9 A;  4N1H A;  3ZG7 B;  5FI7 A;  2Y2J A;  3BFD A;  1LL5 A;  3IT9 A;  2ZL1 A;  2VX8 A;  4O8G A;  2EWW A;  3C8C A;  3NIA A;  2VGL S;  3Q81 A;  5G4Y A;  5L2F A;  1XFN A;  5I94 A;  2G7U A;  3PYP A;  3HUO A;  3H9W A;  4HJ4 A;  2VLG A;  4QD4 A;  3HLC A;  3O3V A;  2PYP A;  3KYZ A;  5GL9 A;  2Z2M B;  2K2N A;  5HDS A;  4S2L A;  4LV3 A;  3HL9 A;  2P9V B;  3IF6 A;  1H8Z A;  3Q07 A;  2J80 A;  4HNB A;  3CUE C;  5KSH A;  5FAQ A;  4BEN A;  4DDS A;  2YKH A;  1VET A;  4WZ4 A;  5CTM A;  5GHY A;  2XSS A;  3UE0 A;  2ZM0 A;  2ZOI A;  1ERQ A;  4NET A;  5FAS A;  1E25 A;  3OPR A;  4JGO A;  1D06 A;  1FR1 A;  2HF6 A;  3UE6 A;  5DF8 A;  5HAR A;  4B4Z A;  2GDN A;  2Y4A A;  1YT4 A;  4WZ5 C;  3AGD A;  1OT9 A;  3MSH A;  5CGS A;  1LL8 A;  3LCE A;  4HIA A;  1OJ5 A;  1ES2 A;  1TS6 A;  1TS8 A;  1E3U D;  3FPW A;  1LSX A;  3C4O A;  4JXG A;  1FIK A;  4ZAM A;  1HZO A;  1J9M A;  3ZNT A;  1SHV A;  5C5K A;  3CG5 A;  3N4I A;  1YLP A;  3PXP A;  2Y2N A;  3EQU A;  3BLS A;  2E8J A;  3LUQ A;  1VEU B;  1QMF A;  3H82 A;  3N8R A;  5A92 A;  1FR6 A;  4CJN A;  2V1Z A;  3A0V A;  3E0Y A;  1Z6F A;  3UPP A;  1ES4 A;  5E2F A;  3PBT A;  1HD8 A;  3SW1 A; 
#chains in the Genus database with same CATH homology
 2V9A A;  1IOU A;  4UQI M;  4CLC A;  2HGV A;  2Y8H A;  4G3V A;  3LYX A;  4LLO B;  2PR6 A;  3E98 A;  4Y2F A;  1MKM A;  1P9W A;  3MFX A;  4GCZ A;  3LI8 A;  4Q0H A;  3B33 A;  5HPI A;  2W1T B;  5DKL A;  4LRZ E;  3OBF A;  4PHT A;  3T4O A;  2L0W A;  3DBA A;  2PD8 A;  1VB6 A;  3ZYT A;  5K5B A;  5HPF A;  4HH3 A;  4Y3I A;  1LT0 A;  2EWV A;  4WEL A;  4F3L B;  4QPR A;  3PR6 A;  1XJ3 A;  4PAU A;  1MC0 A;  4DN0 A;  4WEK A;  1V9Y A;  4CLC C;  4JGQ A;  2QKP A;  3F1N A;  3IBJ A;  1OT6 A;  3T4J A;  1UGU A;  2JHE A;  4LPZ A;  3BWL A;  2M7U A;  1YSP A;  3T50 A;  1S1Y A;  3HJK A;  3UB7 A;  3MQ0 A;  2PDR A;  1STZ A;  4EET B;  3H7W B;  4MN6 A;  3K3D A;  2W1R A;  3LIA A;  4H6J B;  4JGR A;  4GW9 A;  2KX6 A;  4IUK A;  5DF9 A;  3S7P A;  4WL9 A;  3D3O A;  3NOP C;  3F1P B;  4FOF A;  4MCW A;  3S7O A;  1JNU A;  4HP9 A;  5F69 A;  2L4R A;  1MZU A;  4I39 A;  2JKR M;  4P6Z M;  2NUP C;  1W63 Q;  2O9C A;  3OC2 A;  3EQV A;  2FZ0 A;  3EGX C;  2B02 A;  1Y28 A;  4GS9 B;  1ZTU A;  2PT7 A;  4XT2 B;  4FSF A;  4MMN A;  1KOU A;  1GSW A;  2OWJ A;  5CX7 A;  3BJN A;  1OTE A;  4O0P A;  1D7E A;  5J3W A;  2VGL M;  1T1B A;  2W3F A;  4ETZ A;  4WUJ A;  4OOM A;  4BWI A;  2JKR I;  1OPX A;  2INW A;  1X0O A;  3MQO A;  2GZA A;  4IHQ A;  4EEU A;  5HWV A;  2HJE A;  3CI6 A;  2PYR A;  3R7W B;  2XRN A;  4CLC E;  1P9R A;  3MMH A;  4MN7 A;  4BMW A;  5HD3 A;  4BBV A;  2KOI A;  4M4X A;  3UB8 A;  2QHK A;  3RFB A;  3BQ8 A;  1N9L A;  3K3C A;  5J4E A;  4WF0 A;  4O01 A;  4OOL A;  2QJ7 A;  2V0U A;  5HWW A;  3MXQ A;  4R3A A;  2JN7 A;  5HWT A;  4HI4 A;  4HH2 A;  1NLY A;  1XJ2 A;  5F5Y A;  3LIB A;  1XFQ A;  4B93 A;  4ZRR A;  2VEA A;  4RQ9 A;  2PD7 A;  2GJ3 A;  5FL3 A;  1TD5 A;  5DFX A;  5IT5 A;  2PR5 A;  4NXG A;  3UMD A;  4R38 A;  2W0N A;  4LRX C;  3UME A;  1F98 A;  4EU0 A;  5TBM B;  3PBQ A;  4Z1W A;  4HJ6 A;  2K7S A;  5EFW A;  3IS2 A;  4BJP A;  2EA9 A;  4KUO A;  3MR0 A;  3PBN A;  3ZQ5 A;  2QYB A;  5MC7 A;  1S67 L;  5J7E A;  1NRJ A;  4K08 A;  3HJI A;  3TRC A;  3LR4 A;  2W1T A;  4CLC D;  2OWH A;  2J3W A;  2ZOH A;  3LR3 A;  2XA7 S;  3C30 A;  4R70 A;  1H8M A;  1S4S A;  2WKP A;  4WEJ A;  1F9I A;  3CAX A;  2D02 A;  3KSG A;  1S1Z A;  3FPV A;  1P97 A;  2A24 B;  3RH8 B;  1H3Q A;  3B42 A;  1T1C A;  3C2W A;  4YOF A;  4GJ4 A;  5AVF A;  3TE8 A;  1XJ6 A;  3RTY A;  1UWN X;  3B47 A;  2W3E A;  4ETX A;  3F1N B;  1V9Z A;  2A24 A;  2ZMF A;  3T4L A;  2KDK A;  1ZHH B;  2H28 A;  2PHY A;  1XJ4 A;  3W2Z A;  4HHD A;  2J3T D;  5TBM A;  4NXF A;  2W3G A;  1WA9 A;  3BY9 A;  1P0Z A;  3F1O A;  3G6O A;  2YKF A;  3NHQ A;  1UWP X;  3UE3 A;  2NUT C;  2M7V A;  1NLZ A;  5A8B A;  2VV6 A;  4ARZ B;  5HSQ A;  3JVU A;  3LIC A;  3E4O A;  3T4S A;  2ZMV A;  5HDC A;  5IS1 A;  3T4T A;  4WN5 A;  3JVV A;  3KSF A;  3CIT A;  3LR5 A;  3U2A A;  3KSH A;  3NJA A;  2VKS A;  1F5M A;  1NWZ A;  3TJZ C;  5KIZ A;  3EOI A;  2XA7 M;  4UQI S;  4ME4 A;  3LIE A;  2J3T C;  5AVE A;  3ICY A;  4HY8 A;  3OLO A;  5HZH A;  2XRO A;  4DMZ A;  4EXO A;  4P6Z S;  4YNR A;  1N9N A;  2Y79 A;  3VE4 A;  2MJ6 A;  5HDD A;  1T1A A;  4YWZ A;  3EWK A;  5DFY A;  1DRM A;  2JKT M;  3LIF A;  4HQA A;  2DMW A;  4G3K A;  2I9V A;  4UEY A;  3S7Q A;  3VE3 A;  4H6J A;  3P01 A;  4MDZ A;  3R4K A;  5TJJ A;  1S4R A;  4II7 A;  2GX5 A;  3A0S A;  2GNX A;  3UB9 A;  3UB6 A;  2A2L A;  2M1C A;  4I3I A;  3LFV A;  3BW6 A;  3PBO A;  2O9B A;  2LB9 A;  3T4Q A;  1T19 A;  3CWF A;  1OJG A;  4GS9 A;  4CQH A;  2LB5 A;  3FG8 A;  4EER A;  3KO6 A;  4JGP A;  3C38 A;  4Q0J A;  5DJU A;  4XT2 A;  4GHI A;  1DP6 A;  3GDI A;  4MN5 A;  4I3A A;  2W27 A;  2QWS A;  5DJT A;  3ULF A;  5HD5 A;  1YKD A;  4I3J A;  4KQO A;  1VHM A;  2W3D A;  3MF0 A;  4KQD A;  4NEE D;  2ZBB A;  5G4Z A;  5I5L A;  4EQ1 A;  3O5Y A;  4I38 A;  3V67 A;  2VA0 A;  1LSW A;  3T4K A;  2WKQ A;  5L8M A;  3HCY A;  2O9A A;  1OTA A;  1BYW A;  2FH5 A;  1TF1 A;  4DJ3 A;  2V1B A;  3EEH A;  3IS2 B;  5HL6 A;  3VOL A;  4Y5F A;  2OAQ 1;  2OAP 1;  2O99 A;  2D01 A;  3A0R A;  3EEA A;  4L9E A;  4HP4 A;  2Z6D A;  2Z6C A;  3OOV A;  2VX8 A;  2V0W A;  4O8G A;  4IUH A;  2EWW A;  3C8C A;  2VGL S;  2HJ9 C;  2IA2 A;  1DP8 A;  3E4P A;  5G4Y A;  2VJW A;  3OCN A;  1XFN A;  3EGD C;  3GEC A;  2G7U A;  1DP9 A;  4G3W A;  2R78 A;  4GHI B;  4EW7 A;  1YSQ A;  2L1M A;  3VV4 A;  4Q0I A;  3PYP A;  3H9W A;  2JKT I;  2KLI A;  4GLQ A;  4HJ4 A;  2VLG A;  1ODV A;  3LID A;  1YAX A;  2B18 A;  3P7N A;  2PYP A;  3KYZ A;  2HV1 A;  3PHY A;  2OOL A;  2K2N A;  5HDS A;  2K31 A;  1TS7 A;  3KSI A;  4HJ3 A;  4EEP A;  3KYQ A;  4DJ2 A;  4I5S A;  1EW0 A;  1LSV A;  1OTB A;  1OTD A;  3E4Q A;  3CUE A;  4E04 A;  3MJQ A;  2J80 A;  4ARZ A;  4HNB A;  4HOI A;  3CUE C;  5KSH A;  3F1P A;  4IJG A;  4NKP A;  2QJ5 A;  2YKH A;  4WLA A;  4L9F A;  4AFI A;  3LI9 A;  2XSS A;  2VV8 A;  2ZOI A;  3FC7 A;  5IU1 A;  1GSV A;  5F6A A;  4JGO A;  1D06 A;  2P7J A;  2HF6 A;  3UE6 A;  2V1A A;  3PBR A;  4B9O A;  1OT9 A;  3PBS A;  2WKR A;  3IBR A;  4R6L A;  1LL8 A;  3CLO A;  3NOU C;  4HIA A;  1OJ5 A;  3S7N A;  1TS6 A;  5LBR A;  2W3H A;  4KUK A;  3F1O B;  4BBT A;  2CMN A;  1TS8 A;  3FPW A;  3MQQ A;  3R7W A;  1N9O A;  1LSX A;  2P08 A;  2VV7 A;  1OTI A;  3NOT C;  2VZW A;  3OCL A;  2O0Y A;  4L0L A;  5AJG A;  3LR0 A;  5C5K A;  1GSX A;  3H82 B;  1W63 M;  3PXP A;  4NXB A;  1G6O A;  3EQU A;  4EES A;  3K2N A;  2BAS A;  4NXE A;  3LUQ A;  1S66 L;  4F3L A;  1IFQ A;  3H82 A;  4LRY C;  4PKY A;  1TS0 A;  3D72 A;  5F68 A;  3A0V A;  3E0Y A;  3TW8 A;  4PKY G;  4CLC B;  4BBU A;  1T18 A;  3BQA A;  5DKK A;  2P04 A;  3H7W A;  4EUV A;  3PBT A;  4L9G A;  3BY8 A;  1G28 A;  3SW1 A;  3KX0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...