2K7SA

Human arnt c-terminal pas domain, 3 residue ib slip
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSQTAQNPYSDEIETIICTNTNVKNSSQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ARNT PAS-B has a fragile native state structure with an alternative beta-sheet register nearby in sequence space
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Aryl hydrocarbon receptor nuclear translocator
total genus 24
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2k7sA01
3F1OA 3D72A 4I5SA 2A24B 3FG8A 5HD5A 1S1ZA 3IBRA 3F1PA 2D01A 4GCZA 2INWA 2OOLA 4H6JB 4HQAA 2HV1A 4GHIA 5J7EA 1TS0A 4L9GA 3BY8A 3K3CA 4XT2B 2WKQA 3NJAA 3NOPC 1OTAA 4L9EA 5HDSA 4YWZA 4WN5A 3UB9A 1OT6A 5HD3A 4HH3A 1OTDA 4LPZA 2KDKA 1T18A 1S1YA 1LL8A 2P7JA 3H7WA 1OTBA 2YKFA 4HOIA 4HY8A 4I3AA 4MN6A 4H6JA 1JNUA 3A0VA 4WUJA 3UMDA 1F9IA 5HDDA 1XJ3A 1OTIA 3E4PA 3UMEA 4E04A 3UE6A 4EEPA 5I5LA 2EA9A 1D7EA 1ODVA 2WKRA 3LIAA 4LRZE 4LRYC 5TBMB 4HH2A 3PHYA 4HJ6A 4I3JA 3NOTC 3LI8A 3H7WB 2VLGA 3FC7A 3LI9A 2V0UA 2ZOHA 3F1OB 3LIBA 3NOUC 1GSXA 4JGRA 4HIAA 5EFWA 4BBUA 5HWTA 3ICYA 4F3LB 3MR0A 1N9OA 3KX0X 3K3DA 3EEHA 4HI4A 5DJTA 3UB6A 3E4OA 1VB6A 1XJ4A 1MZUA 2PDRA 4I3IA 3VE4A 5A8BA 4HHDA 3G6OA 5F6AA 4GS9A 2OWHA 4DJ2A 3BWLA 4JGQA 3HJIA 2BASA 5F5YA 2PYPA 4F3LA 4LLOB 1EW0A 4WF0A 5DKKA 3ULFA 3ZQ5A 4EERA 2PR6A 1KOUA 1LT0A 1DRMA 1NWZA 1P97A 4NXFA 2V1AA 4WLAA 2PHYA 5F69A 1Y28A 4KUKA 1S67L 2L0WA 2QJ5A 4M4XA 4EXOA 2W0NA 2JN7A 3F1NB 3RH8B 4DJ3A 4LRXC 4JGOA 2QJ7A 5HSQA 4B9OA 2KX6A 3LICA 5DKLA 1LSXA 1XJ6A 2PYRA 5F68A 1LSVA 3LIFA 1UGUA 2A24A 1DP8A 1S4SA 1OTEA 2VEAA 1P0ZA 4NXEA 3UB8A 1UWNX 1TS7A 3EWKA 3H9WA 2Z6CA 3PYPA 4GHIB 4WL9A 3P7NA 3GECA 2B02A 3SW1A 3NHQA 2V9AA 4PKYG 2V1BA 4HNBA 1T1AA 1TS6A 1LSWA 4KUOA 1DP6A 5HWWA 4KQDA 1OT9A 1X0OA 2VV7A 4HJ4A 4EETB 1G28A 3B33A 1T19A 2OWJA 2VV6A 1D06A 2J80A 1S66L 2ZOIA 2JHEA 2PR5A 4R38A 1OJ5A 2YKHA 4R6LA 3VE3A 5HWVA 1XFNA 2H28A 3LIEA 3MQOA 2ZBBA 4L9FA 3CWFA 3UB7A 5HZHA 4HP4A 1OJGA 2L1MA 1V9YA 3LYXA 1XFQA 2D02A 1TS8A 4I38A 4JGPA 3H82B 4NXBA 3C2WA 5TBMA 5KIZA 4HP9A 3F1NA 1N9NA 3GDIA 2Z6DA 5G4YA 4BBTA 2GJ3A 3CAXA 1XJ2A 1WA9A 3IS2A 4EQ1A 4NXGA 2R78A 4GW9A 3BY9A 2QWSA 5IS1A 3MFXA 1DP9A 4R70A 5AVFA 3MQQA 4K08A 5J3WA 4EEUA 4MN5A 4BBVA 1F98A 2I9VA 2QHKA 5G4ZA 3OLOA 1GSWA 4GS9B 1T1CA 5HDCA 1UWPX 1T1BA 2V0WA 2M1CA 3E4QA 3LIDA 2PD8A 2L4RA 5DJUA 4I39A 3MJQA 3IS2B 2VV8A 4HJ3A 4PKYA 4R3AA 4EW7A 1V9ZA 5AVEA 2WKPA 1S4RA 2QKPA 3F1PB 5IU1A 3RTYA 3A0SA 3VOLA 1N9LA 1GSVA 2CMNA 5J4EA 4RQ9A 2K7SA 3LUQA 4XT2A 3MXQA 2PD7A 3CLOA 4EESA 3T50A 1BYWA 3HJKA 3C8CA 3A0RA 3H82A 2W27A
chains in the Genus database with same CATH superfamily
3D72A 3B3XA 4H6JB 4GHIA 1M40A 2ZMFA 1IYOA 4KG6A 4BD0A 3ITAA 1W5DA 4ZTKA 3UMDA 1K54C 3SS4A 1FSYA 2WKRA 3PHYA 5M19A 3JVUA 4OQ0A 3UB6A 3SOIA 2GNXA 1PI4A 1L0FA 4B88A 1BULA 1FR6A 1A0KA 4BD1A 2Y2OA 1Y28A 2V20A 2Y2PA 4DJ3A 2JN7A 1W8QA 3BFFA 1YLPA 4Y7PA 1KE0A 4NXEA 3CPTB 2KLIA 4K91A 2HDSA 3OOVA 2V9AA 3IWOA 2W3EA 2WADA 5FDSA 4R38A 3FZCA 4E3MA 4JGPA 2M7VA 3T4LA 4HP9A 3UDFA 2QWSA 4CQHA 4KZ6A 5F83A 1F98A 2ZC4B 5FQ9A 4WMCA 1JTGA 5DJUA 4KZ5A 5DVAA 3GSGA 5CGWA 1HVBA 5FATA 3T50A 1C3BA 4CLCB 2LB5A 5HD5A 1GHMA 4L9GA 2Y2MA 1K38A 4L9EA 3UO9A 1PZOA 1LL8A 3EGDC 2FZ0A 1F9IA 1DJAA 2LB9A 1OTIA 2AVXA 2XFTA 3VSKA 1G5UA 3A3IA 1KVLA 1I2WA 4JXVA 1VEUB 1K54A 1K55A 1XKZA 4Q0IA 3LO7A 3LIBA 4C6YA 5LBRA 1NLYA 2E8IA 2ZL1A 5KZHA 4KG2A 2PDRA 3IT9A 2EFUA 3SH9A 3ULFA 1BT5A 1ZTUA 3ZQ5A 4FSFA 3JPUA 4M3KA 2K31A 2XD1A 3SS3A 3T4QA 5A91A 3S22A 4JGOA 4K0WA 1JVJA 3KSIA 2WZXA 1NRJA 5FAQA 1F5MA 2C6WB 1NJ4A 2HP9A 3GECA 5FQKA 3NHQA 3NECA 4FD8A 3ZCZA 2B5RA 1DP6A 4Y0TA 3S7NA 3QNCA 3NDEA 3LYXA 1TS8A 1YQSA 4BBTA 2GJ3A 3CAXA 3NI9A 5GLBA 5L09A 3NBLA 5EVEA 3GV9A 2QHKA 4KZ9A 3MXRA 1UWPX 5EM1A 4UEYA 4PMAA 2A3UA 4U0XA 1V9ZA 4RQ9A 4S2JA 3OZHA 1P9WA 4QHCA 4KZ8A 2G2UA 2D01A 4GCZA 3K3CA 3HCYA 1FILA 2WKQA 3NOPC 4DE3A 3MMHA 3IXHA 5HD3A 2G7UA 5GHYA 1OTDA 1EI5A 5D3OA 1ES4A 3Q7VA 5I5LA 5KMWA 4HBTA 2V0UA 3KSFA 5EFWA 3CG5A 5C5KA 3OC2A 3T12B 3E4OA 4LCLA 1GA0A 3BWLA 5F5YA 1SKFA 4G3KA 2G2WA 3VP1A 1P97A 4NK3A 1YLYA 4GJ4A 3ZYTA 1HD8A 2P04A 1PWGA 4B4XA 4XUXA 5I94A 5EECA 3DBAA 1OT9A 2EX6A 2VX8A 1OJ5A 4ETXA 3TG9A 1IFQA 3WS4A 5TBMA 3H82B 2O9AA 4FTXA 3BFDA 4CJNA 4QD4A 3LCEA 3HLWA 5IS1A 4N9KA 3EOIA 2JE5A 2M1CA 2VGJA 1S4RA 3MBZA 3T1SA 3EQUA 1K6RA 3MXQA 1BYWA 3C30A 3FWLA 1BZAA 3MS6A 1J3WA 2OOLA 3UPOA 2HDRA 4R70A 4AFIA 4LCMA 2JCHA 2NUPC 2VA0A 1HTZA 2DMWA 5A93A 2O9CA 3QHYA 4GD6A 2ZOHA 5FA7A 2IWDA 3IX4A 2A2LA 5HWTA 3MR0A 3E98A 2P74A 3ZDJA 3W4OA 4DJ2A 1ZHHB 3L9KA 2JKTM 5GLAA 4X6TA 5IHVA 4FH4A 5FI6A 5GLDA 1LI0A 2ZM2A 2H0TA 4KUKA 2VKSA 1QMFA 3C38A 4OVDA 4HESA 1JWVA 1UGUA 3A3FA 4WZ4A 4BL3A 3WS1A 1P0ZA 4MLLA 4ESPA 1FIKA 2ZQAA 3TW8A 3W4PA 3BQ8A 2XH9A 5EVIB 3V3SA 5HWVA 3O86A 1O7EA 4L9FA 4O7DA 5EVID 4I38A 4KENB 1XFQA 2ZC6B 1P9RA 3ZVTA 3MF0A 3T1RA 4WYYA 4PM9A 2P9VB 1BLCA 1K55C 5EUAA 4EEUA 3IF5A 4LFUA 3RXXA 3UN7A 2WGWA 5L10A 2EX2A 2P9VA 3MZFA 2EX8A 1PW8A 3GR2A 5EV0A 4CPKA 1H8ZA 3CZDA 2R9WA 3PAEA 3CJMA 2WGIA 3F1OA 4JF5A 2BLSA 2XSSA 2Z2LB 2Z2MB 4EBPA 3R4KA 5CHUA 3ZVWA 4MBKA 1NZOA 5DTKA 4MBFA 4HOIA 3LR3A 4KQQA 3JVVA 1E4DA 3E4PA 2XFSA 1D7EA 2HJ9C 3LIAA 4LRYC 3RJUA 1L0EA 3MQ0A 4PM8A 3BFCA 3QP4A 1ACFA 1KVMA 3ICYA 4B93A 2ACGA 2B95A 1RCJA 4CLCC 3Q7ZA 5A8BA 4GS9A 1IKIA 2OWHA 3PBRA 1SKOB 1XGJA 4P87A 4ETZA 4GLQA 2WKHA 1TF1A 4EU0A 1RGYA 1DRMA 3MKFA 4JXWA 3D4FA 2ZJ9A 3FV7A 2QJ7A 5E43A 1SCWA 2KX6A 4Y0UA 4BWIA 4R1GA 3M6BA 4X1LA 2OV5A 2W3DA 1BLSA 5HAIA 1T1AA 4DDSA 5HWWA 4NEED 3VE3A 2ZC3B 1K4EA 1V9YA 3IQAA 1W63M 4P6ZM 4UAAA 3HLFA 2Q0OA 2XD5A 5EOEA 5HPIA 1DY6A 2RL3A 2R78A 2XDMA 3ZHHA 3BW6A 4IEDA 2OAP1 4LV1A 3UE0A 1GSWA 2EWWA 5HW3A 4EQIA 3N8SA 1Q2QA 5AQAA 2VV8A 3WWXA 3VSLA 4N92A 2CMNA 4C75A 3C4OA 5HFOA 1KE4A 1YAXA 4YFMA 5GLCA 4BL2A 3O5YA 3H82A 1H8MA 1ERQA 5E2EA 4UHUA 1S1ZA 3IBRA 4JBFA 5CTNA 4BENA 1MWRA 1G6AA 1OTAA 3ISGA 3IF6B 3M6HA 1PW1A 1YPRA 4IUKA 4HY8A 1JNUA 4WELA 5HDDA 3EEAA 1XJ3A 4PM7A 1JWZA 3EQVA 3IF6A 2Y2GA 2W1TB 3BFGA 2K2NA 1L0DA 3GTCA 4HIAA 3VFHA 3ZG9B 1D1JA 4PM5A 4U0TA 2O0YA 4X1MA 3HJIA 4Q0JA 2PYPA 2VGKA 4X55A 2Y2QA 5A90A 1NZUA 2XRNA 1KOUA 3E2KA 4OP8A 3C7UA 3CI6A 3SH8A 4OLDA 1UWNX 1MXOA 4WEKA 1FCOA 4HNBA 4KUOA 1TS6A 3NIAA 1PNEA 3IHBA 5M18A 5EE8A 1ONGA 1S66L 4JXGA 1XFNA 4R23A 3R7WA 2H0YA 3G30A 3HREA 1Q2PA 2OLVA 1CI8A 4UA7A 3SZTA 4FOFA 4NG2A 3HL9A 4QY5A 2J3TD 4PM6A 3S1YA 2ZC7A 2ZQ9A 1KDWA 2ZQDA 4DE2A 1J9MA 4MDZA 3NULA 5HARA 3G31A 4Y3IA 3HLEA 2EFXA 3FYZA 4S2OA 4XUZA 2EXBA 2EWVA 4LGWA 1KGGA 3MSHA 1YLZA 1G6OA 4HH3A 4P85A 2J9OA 1YMXA 2EX9A 3AGDA 5GHXA 2WAFA 4WUJA 2Q9NA 1ODVA 4LRZE 1ALQA 3F1OB 3IF6C 4WZ5C 1LL5A 2VZWA 3Q82A 4LV2A 4MMNA 3KYEA 5F6AA 1YLJA 3DTKA 2ZLYA 5M1AA 2BASA 2PT7A 5E2FA 4KZ4A 3VFFA 1NWZA 4QPRA 3SH7A 2QJ5A 2FFYA 3NDGA 3W8KA 4ZRRA 1XJ6A 1CQAA 5HX9A 3TRCA 3JYIA 2Y59A 3EWKA 2Z6CA 3SW1A 5HL1A 4KQDA 3B33A 3PBSA 2VV6A 1D06A 2ZOIA 4E3JA 1BLPA 3G32A 1KGFA 2RCXA 5KIZA 1RGZA 3ZG5A 1VEUA 3UDXA 1Z6FA 4NETA 3TE8A 2HF6A 1PWDA 2VJWA 3O3VA 5G4ZA 3HLCA 1ZG6A 4CLCA 2E8JA 3MJQA 3IS2B 1ESUA 3PBTA 4MEZA 2GDNA 3SS5A 4Y5FA 1H3QA 3A0RA 1ES2A 1OPXA 3ZGAB 5E2HA 3FG8A 2XA7S 4GKUA 2GZAA 5EVIC 1PZPA 1OT6A 3H7WA 1S1YA 4MN6A 4JKTA 3NY4A 2XA7M 5CTMA 4S2PA 3UE6A 1YSQA 5DF8A 1KE3A 4GDBA 1NYYA 3H7WB 4XXRA 5CGXA 3T4OA 4QB8A 4HI4A 1FR1A 3EEHA 4ZBEA 5FI7A 4I3IA 4OP5A 4L0LA 1YLTA 1ERMA 2W3HA 1W8YA 3HBRA 3IHAA 1XP4A 5AQ9A 4WF0A 2PBDP 3S7OA 5HSQA 5DKLA 2JKFA 5AQBA 2JKTI 5TJJA 5BOHA 4Z1WA 3LEQA 2V1BA 5EVLA 1AWIA 1IYQA 5F82A 5JYPA 3DTIA 3MZDA 2J80A 1FCMA 1AXBA 4Z9QA 5HZHA 2JKGA 1N9NA 2Z6DA 4NXGA 3VOYA 3MFXA 5AVFA 1K4FA 3BECA 4OH0A 2W1RA 3AGFA 3LR0A 3BRMA 5HDCA 3HLDA 3LIDA 1N9BA 3IXGA 4HJ3A 1IOUA 5IU1A 3LUQA 3IX3A 2HGVA 2FFFB 3D9YA 5HL6A 2A24B 3G4PA 3N8LA 4ZJ1A 1G68A 2INWA 1H5XA 5J7EA 2HV1A 5MC7A 1JWPA 3G35A 4GZBA 4S2MA 2JKRI 3P09A 2KDKA 4EXOA 2Y2IA 3V3RA 4I3AA 4S2NC 4D60A 5EVIA 2KOIA 3A0VA 1L3LA 3IWQA 3T4SA 4NKPA 3OCNA 2PU4A 3LY4A 4EBLA 4O0PA 4YINA 3UE1A 4BJPA 1VB6A 4E3OA 5DTTA 1PYYA 1ZKJA 1OMEA 4OOLA 4D2OA 1K6SA 1HLUP 4BLMA 3E0YA 1SHVA 3B47A 2XROA 3BQAA 4KZ7A 3D3OA 3CUEC 3QP8A 2X01A 3VP3A 4Q0HA 4IBRA 2PYRA 4IVKA 1OTEA 4HEFA 4WL9A 3WRTA 4PKYG 3GQZA 4II7A 3V5MA 2XGNA 1YM1A 4B4ZA 4R6LA 3AGEA 4GB7A 4KQOA 1OJGA 1KGEA 2OLUA 4Y17A 1MKIA 3CITA 3C2WA 1L2SA 1NXYA 3F1NA 2J3TC 4IVIA 2XLNA 1K56D 1ESIA 4KZAA 1L0GA 2Y8HA 1WA9A 4BQMA 4GW9A 2J3WA 2OSUA 3UPNA 5FEFA 3KSGA 4GS9B 4WZ5A 2L4RA 5FL3A 3HVFA 5AQ7A 4OQIA 1SDNA 5FQMA 1N9LA 3CLOA 3VP2A 3MFDA 4GNUA 5F1FA 4IJGA 2GX5A 3M2JA 4RYEA 4MCWA 4G3WA 4WN5A 4JF4A 5CHMA 2QMIA 5CERA 3RXWA 2P7JA 4LRXC 1OTBA 2YKFA 3ITBA 2B18A 5FDHA 2H5SA 3C5AA 1K25A 4S2NA 4P6ZS 3CMZA 3PTEA 5K5BA 1PWCA 3NOUC 4JGRA 3UNWA 4OQHA 1I5QA 4OKPA 3W2ZA 4F3LA 4WBGA 4EERA 4OPZA 4U3TA 3OPRA 5DTSA 1ES5A 3ZG7B 2WAEA 3LICA 1LSXA 2V8CA 2Y2HA 4ID4A 1S4SA 2VEAA 1TS7A 3H9WA 1IKGA 3PBNA 2Y2NA 3NC8A 2Y91A 1ZG4A 3HLGA 4DKIA 5DF9A 4ME4A 4OPYA 4P0MA 2V2FF 3UB5P 4H8RA 1S6RA 3KSHA 5HPFA 5G4YA 1DJBA 4QWOA 4EQ1A 1BSGA 4DRTA 2JKRM 4BBVA 1SZVA 2QZ6A 4E3KA 2ZC5B 4DMZA 5AVEA 3ZG8B 4DN0A 1IYPA 1TEMA 2W27A 4WM9A 1CJFA 2HJEA 1K0KA 5TFQA 2ZM0A 5HDSA 4WEJA 5A92A 1LI9A 3UDIA 1N4OA 4H6JA 4E3IA 4MBHA 1CF0A 4OLGA 3WRZA 2JBFA 4S2IA 4KZ3A 4HJ6A 4BMWA 4MN7A 2UWXA 5FQJA 5DJTA 3KX0X 3K3DA 3PAGA 2HP6A 3NCKA 1YT4A 2Y2LA 4LLOB 4WLAA 4EWFA 2WYXA 1XA7A 1U60A 2XK1A 1LL9A 5CXWA 1K56A 4OPRA 1KDSA 5GHZA 2VK3A 4OOMA 2VGLM 2ZMVA 1NY0A 4X56A 4EUVA 3GMWA 3PYPA 4N1HA 4CLCE 2CC1A 2NUTC 4HJ4A 1T19A 2OWJA 1VHMA 2JHEA 2PR5A 3CPTA 3CWFA 4HP4A 2L1MA 2V1ZA 2HZ5A 2W1TA 3EGXC 3QNBA 3P01A 1QMEA 4X25A 2ZD8A 3BY9A 4IBXA 3MQQA 3N8RA 4GOGA 4PPRA 5J3WA 3E4QA 3L7HA 1DJCA 3LGOA 5KSCA 4C3QA 5EM0A 2EXAA 2PD7A 4QU3A 3C8CA 5CHJA 3CUEA 4I5SA 4ARZB 3CHWP 1PIOA 4KG5A 4EUZA 2WGVA 1IEMA 4HQAA 1Z09A 4XT2B 2I72A 2WK0A 3DAVA 4YWZA 4ARZA 1PI5A 2BG1A 2XQZA 3DTMA 3UMEA 5CEDA 4EEPA 2EA9A 5E2GA 3V39A 3PXPA 4I3JA 1F2KA 3LI8A 3UPPA 1Y54A 3FC7A 4N1XA 3S4XA 1GSXA 4BBUA 1MZUA 3G6OA 2IWCA 5TGFA 4P6BA 1EW0A 4R3JA 3PR6A 1JTDA 2J9PA 4E3LA 5F69A 4Y2FA 2V1AA 2PHYA 3RH8B 5EOOA 5F68A 4K0XA 3BLSA 1DP8A 2X02A 4GHIB 3P7NA 2XR0A 3FKVA 4EETB 3E2LA 5HAQA 4GD8A 4R0QA 4IUHA 5FI2A 4UA9A 2Y55A 2XF3A 4NXBA 1O07A 5DF7A 4R3BA 2A49A 3GDIA 1WYCA 1XJ2A 1HZOA 4ZJ2A 3A3JA 3TSGA 1YSPA 5GL9A 1S0WA 1T1BA 4E6WA 1ZC2A 3HLBA 2IWBA 3RTYA 4JPMA 1RP5A 4XT2A 2ZMAA 3OPLA 2PAVP 4DE1A 4OPQA 1FOFA 3VMAA 1TS0A 1MPLA 2QYBA 3HUOA 2J7VA 4OQGA 3DTEA 4LPZA 3VP4A 4UA6A 3ZNYA 3G2ZA 1EROA 4E6XA 3BYDA 3LFVA 5J8XA 2Y4AA 1GHPA 3VV4A 3LI9A 3ZFZA 3QP1A 1M6KA 3IXDA 4MNRA 1VQQA 1XJ4A 4HHDA 2ZM8A 3LR5A 3V67A 2PR6A 1PRQA 4OOYA 4NXFA 4PAUA 3V50A 1FQGA 1CK3A 3F1NB 1E3UA 5DFXA 3O88A 2A24A 3IH8A 3TJZC 1GHIA 3M2KA 1CI9A 2B02A 3KYQA 4RA7A 3PBQA 5FEGA 2JC7A 2BTFP 4A5RA 3DWZA 4GDNA 5F1GA 3WS2A 1WYBA 1YKDA 4FUWA 2UV0E 3FKWA 1TDLA 2PRFA 3BEBA 2ZL1B 4UQIS 1XXMA 1DP9A 3IH9A 4O01A 5CECA 1T1CA 3HUMA 2FH5A 2WKIA 1XA1A 1ES3A 4O8GA 3IBJA 2WGWB 1XPBA 4LV3A 5TR7A 3BY8A 3I7JA 4QJGA 3LY3A 2Q9MA 1SDEA 3MZEA 1XGIA 3C4PA 3OPPA 1BLHA 5TBMB 3IX8A 4HH2A 1VETB 3A3DA 3QP5A 2VLGA 1Y4OA 4JLFA 4QY6A 2HPBA 4JXSA 4DE0A 1K57A 3T4KA 4JGQA 5FASA 3LEZA 5DKKA 3T1XA 1NRFA 2W0NA 4E3NA 1BTLA 1NYMA 3BM6A 4S2KA 1LSVA 3LIFA 4LENA 1E25A 2HDQA 4X69A 5CRFA 2Y79A 1LSWA 1W79A 1X0OA 2VV7A 1GCEA 1G28A 1PFLA 2YKHA 4UQIM 3MQOA 3LIEA 2ZBBA 4OONA 3Q7VB 4Y13A 4RX2A 2Y2JA 3MXSA 4RVAA 4ZDXA 1MY8A 3Q81A 2IA2A 3IS2A 4DDYA 2H10A 2X71A 3WS5A 1W7FA 4K08A 4G3VA 4Y15A 1H0MA 2DCFA 2WZZA 3N7WA 1LLBA 4I39A 1IYSA 4R3AA 4CLCD 3A0SA 1TDGA 1GSVA 2HDUA 3W4QA 5J4EA 3N4IA 5CEBA 3DW0A 3HJKA 3K2NA 4YOFA 5CGSA 2QPNA 2ZQ7A 5IT5A 4R4SA 4X68A 3OCLA 5L07A 1TVFA 3LR4A 1CEGA 4Y0OA 1STZA 2MJ6A 5AJGA 3OPHA 3NOTC 3VP0A 4S2LA 5DFYA 1I2SA 2DNSA 1N9OA 3UY6A 2OAQ1 3VE4A 3IWIA 2WKEA 3OBFA 1MC0A 1K57C 4JF6A 3Q1FA 3B42A 2M7UA 1S67L 4M4XA 3BFEA 3UE3A 3C7VA 4YNRA 1W63Q 5FAPA 2PU2A 3UB8A 5CX7A 3UB7A 3U4LP 4X53A 4DF6A 1GA9A 1MKMA 3FPWA 5FAOA 2H28A 3G2YA 3KYZA 5FQQA 3T4TA 2D02A 3P98A 2O9BA 3O87A 1BUEA 2R9XA 2V8FA 3T4JA 2I9VA 3OLOA 5L2FA 3DWKA 1SKOA 2PD8A 4EW7A 4PHTA 3S7PA 3F1PB 4R4RA 3VOLA 2K7SA 2DRWA 2P08A 3QP6A 4EESA 2WUQA 3PBOA 3RFBA 3F1PA 1NLZA 4HBUA 4ZJ3A 5HAPA 3NJAA 3A3EA 4ZAMA 3UB9A 1MWTA 5FSRA 3TOIA 1T18A 4Q8IA 3U2AA 3N6IA 1CEFA 2XEPA 4EV4A 1MWSA 3ZG0A 4E04A 2HP5A 3BLMA 3QP2A 4F3LB 2ZQCA 3ZNTA 3HUNA 2ZQ8A 4KQRA 4IHQA 3FPVA 5FQIA 4LV0A 4DXBA 1WE4A 3WS0A 1YMSA 2W3FA 1LHYA 3GRJA 5JYOA 1LT0A 1EWZA 2L0WA 4B9OA 1VETA 2Y2KA 4FH2A 4GN2A 5U47A 4WMCD 2O99A 4FCFA 3MKEA 4DXCA 1XX2A 2J8YA 2W3GA 1VM1A 2VGLS 3IXBA 3GVBA 1E3UD 4RX3A 3BJNA 1IELA 2C5WB 3VOZA 4EBNA 1TD5A 3S7QA 4N9LA 1FCNA 5EPHA 4KZBA 3R7WB 1MWUA 2PBYA 4MN5A 3T1QB 3KO6A 3Q07A 2V0WA 1FSWA 3G34A 5G18A 4PKYA 4F94A 2WKPA 2QKPA 1H8YA 1YLWA 5L8MA 1MBLA 5KSHA 1ONHA
chains in the Genus database with same CATH topology
5HL6A 3F1OA 3D72A 2A24B 2XSSA 2INWA 4H6JB 5J7EA 2HV1A 4GHIA 1TS0A 3R4KA 2QYBA 5MC7A 2ZMFA 2JKRI 4LPZA 2KDKA 4HOIA 4EXOA 3LR3A 4I3AA 2KOIA 3A0VA 3UMDA 3JVVA 3LFVA 3E4PA 3T4SA 4NKPA 3OCNA 1D7EA 2HJ9C 2WKRA 3LIAA 4LRYC 3PHYA 3VV4A 3JVUA 3LI9A 3MQ0A 3ICYA 4O0PA 4B93A 3UB6A 4BJPA 1VB6A 1XJ4A 2GNXA 4CLCC 5A8BA 4HHDA 4GS9A 2OWHA 3PBRA 4OOLA 3LR5A 3V67A 4ETZA 2XROA 3E0YA 3B47A 3BQAA 4GLQA 1TF1A 2PR6A 4EU0A 3D3OA 4NXFA 1DRMA 3CUEC 4PAUA 1Y28A 4Q0HA 4DJ3A 2JN7A 3F1NB 2QJ7A 2KX6A 4BWIA 2PYRA 5DFXA 2A24A 3TJZC 1OTEA 4NXEA 4WL9A 2W3DA 2KLIA 2B02A 3OOVA 2V9AA 3KYQA 4PKYG 1T1AA 2W3EA 4II7A 3PBQA 5HWWA 4NEED 4R6LA 4R38A 3VE3A 1YKDA 4KQOA 1OJGA 1V9YA 4JGPA 3CITA 3C2WA 2M7VA 3T4LA 4HP9A 1W63M 3F1NA 4P6ZM 2J3TC 5HPIA 2Y8HA 1WA9A 2R78A 2J3WA 4GW9A 2QWSA 4CQHA 4UQIS 1DP9A 4O01A 3BW6A 2OAP1 1F98A 3KSGA 1GSWA 2EWWA 1T1CA 4GS9B 2L4RA 5DJUA 5FL3A 2VV8A 2FH5A 1N9LA 2CMNA 3CLOA 4O8GA 3T50A 1YAXA 3O5YA 4CLCB 3H82A 3IBJA 4IJGA 2LB5A 1H8MA 2GX5A 5HD5A 1S1ZA 3IBRA 4MCWA 4G3WA 3BY8A 4L9GA 4L9EA 1OTAA 4WN5A 4IUKA 2P7JA 4LRXC 1LL8A 3EGDC 1OTBA 2YKFA 4HY8A 2FZ0A 1JNUA 4WELA 2B18A 1F9IA 3EEAA 1XJ3A 1OTIA 2LB9A 5HDDA 3EQVA 5TBMB 4P6ZS 4HH2A 2W1TB 5K5BA 2VLGA 4Q0IA 3LIBA 3NOUC 2K2NA 4HIAA 4JGRA 5LBRA 1NLYA 3T4KA 2PDRA 2O0YA 4JGQA 3HJIA 4Q0JA 2PYPA 3W2ZA 4F3LA 5DKKA 3ULFA 1ZTUA 3ZQ5A 4FSFA 4EERA 2XRNA 2K31A 1KOUA 3T4QA 2W0NA 4JGOA 3CI6A 3LICA 3KSIA 1LSXA 1NRJA 1LSVA 3LIFA 1F5MA 1S4SA 2VEAA 1UWNX 1TS7A 3H9WA 4WEKA 3GECA 2Y79A 3NHQA 3PBNA 4HNBA 4KUOA 1TS6A 1LSWA 1DP6A 3S7NA 1X0OA 2VV7A 1G28A 1S66L 2YKHA 4UQIM 1XFNA 3LIEA 3MQOA 2ZBBA 5DF9A 4ME4A 3LYXA 3R7WA 1TS8A 3KSHA 4FOFA 5HPFA 5G4YA 4BBTA 2GJ3A 3CAXA 2J3TD 2IA2A 3IS2A 4EQ1A 4K08A 2JKRM 4G3VA 4BBVA 2QHKA 4MDZA 1UWPX 4UEYA 4I39A 4R3AA 4DMZA 4CLCD 4Y3IA 1V9ZA 5AVEA 3A0SA 1GSVA 5J4EA 4RQ9A 4DN0A 3HJKA 1P9WA 2W27A 3K2NA 4YOFA 2HJEA 2D01A 4GCZA 2EWVA 3K3CA 3HCYA 2WKQA 3NOPC 5HDSA 5IT5A 3MMHA 4WEJA 1G6OA 5HD3A 4HH3A 2G7UA 1OTDA 3OCLA 4H6JA 4WUJA 3LR4A 1STZA 5I5LA 1ODVA 2MJ6A 4LRZE 5AJGA 4HJ6A 3NOTC 4BMWA 2V0UA 3KSFA 5DFYA 3F1OB 5EFWA 4MN7A 5C5KA 5DJTA 1N9OA 3KX0X 3K3DA 3OC2A 3E4OA 2OAQ1 3VE4A 2VZWA 4MMNA 3OBFA 5F6AA 3BWLA 1MC0A 2BASA 5F5YA 4G3KA 2PT7A 4LLOB 3B42A 1NWZA 4QPRA 4WLAA 1P97A 2M7UA 1S67L 4M4XA 2QJ5A 4GJ4A 3UE3A 3ZYTA 4ZRRA 4YNRA 1XJ6A 2P04A 4OOMA 1W63Q 2VGLM 3TRCA 2ZMVA 5CX7A 3EWKA 3UB8A 3UB7A 2Z6CA 3PYPA 4EUVA 3SW1A 3DBAA 1MKMA 4CLCE 4KQDA 1OT9A 2NUTC 4HJ4A 3B33A 3PBSA 1T19A 2OWJA 2VV6A 1D06A 1VHMA 2ZOIA 2JHEA 2VX8A 3FPWA 2PR5A 1OJ5A 4ETXA 2H28A 3CWFA 1IFQA 3KYZA 4HP4A 5KIZA 2L1MA 3T4TA 2D02A 5TBMA 2O9BA 3H82B 2O9AA 2W1TA 3EGXC 3P01A 3BY9A 3TE8A 5IS1A 2HF6A 3MQQA 5J3WA 3T4JA 2VJWA 2I9VA 5G4ZA 3OLOA 3EOIA 3E4QA 2M1CA 4CLCA 2PD8A 3MJQA 3IS2B 4EW7A 4PHTA 3S7PA 1S4RA 3F1PB 3PBTA 3VOLA 3EQUA 2K7SA 3MXQA 2PD7A 4Y5FA 1BYWA 1H3QA 3C30A 2P08A 3C8CA 3A0RA 1OPXA 4EESA 3CUEA 4I5SA 4ARZB 3FG8A 3PBOA 3RFBA 3F1PA 2XA7S 1NLZA 2OOLA 4HQAA 4XT2B 2GZAA 3NJAA 4YWZA 3UB9A 1OT6A 4ARZA 1T18A 1S1YA 3H7WA 4MN6A 4R70A 4AFIA 2NUPC 2VA0A 3U2AA 2XA7M 2DMWA 4E04A 3UMEA 3UE6A 4EEPA 1YSQA 2EA9A 2O9CA 3PXPA 4I3JA 3LI8A 3H7WB 3FC7A 2ZOHA 3T4OA 1GSXA 2A2LA 4BBUA 4F3LB 5HWTA 3MR0A 4HI4A 3EEHA 3FPVA 3E98A 4IHQA 4I3IA 1MZUA 4L0LA 2W3HA 3G6OA 4DJ2A 1ZHHB 2JKTM 2W3FA 1EW0A 4WF0A 3PR6A 1LT0A 5F69A 4Y2FA 2V1AA 2PHYA 4KUKA 2L0WA 3S7OA 2VKSA 3C38A 3RH8B 5HSQA 4B9OA 5F68A 5DKLA 1UGUA 2JKTI 5TJJA 1DP8A 1P0ZA 4Z1WA 4GHIB 3P7NA 3TW8A 2V1BA 2O99A 3BQ8A 4EETB 2J80A 2W3GA 5HWVA 4L9FA 2VGLS 4IUHA 5HZHA 4I38A 3BJNA 1XFQA 4NXBA 1P9RA 1N9NA 3GDIA 2Z6DA 3MF0A 1TD5A 3S7QA 1XJ2A 4NXGA 3MFXA 5AVFA 3R7WB 4EEUA 4MN5A 3KO6A 2W1RA 1YSPA 3LR0A 5HDCA 1T1BA 2V0WA 3LIDA 4HJ3A 4PKYA 1IOUA 2WKPA 2QKPA 5IU1A 3RTYA 3LUQA 4XT2A 5L8MA 5KSHA 2HGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F1O A;  3D72 A;  4I5S A;  2A24 B;  3FG8 A;  5HD5 A;  1S1Z A;  3IBR A;  3F1P A;  2D01 A;  4GCZ A;  2INW A;  2OOL A;  4H6J B;  4HQA A;  2HV1 A;  4GHI A;  5J7E A;  1TS0 A;  4L9G A;  3BY8 A;  3K3C A;  4XT2 B;  2WKQ A;  3NJA A;  3NOP C;  1OTA A;  4L9E A;  5HDS A;  4YWZ A;  4WN5 A;  3UB9 A;  1OT6 A;  5HD3 A;  4HH3 A;  1OTD A;  4LPZ A;  2KDK A;  1T18 A;  1S1Y A;  1LL8 A;  2P7J A;  3H7W A;  1OTB A;  2YKF A;  4HOI A;  4HY8 A;  4I3A A;  4MN6 A;  4H6J A;  1JNU A;  3A0V A;  4WUJ A;  3UMD A;  1F9I A;  5HDD A;  1XJ3 A;  1OTI A;  3E4P A;  3UME A;  4E04 A;  3UE6 A;  4EEP A;  5I5L A;  2EA9 A;  1D7E A;  1ODV A;  2WKR A;  3LIA A;  4LRZ E;  4LRY C;  5TBM B;  4HH2 A;  3PHY A;  4HJ6 A;  4I3J A;  3NOT C;  3LI8 A;  3H7W B;  2VLG A;  3FC7 A;  3LI9 A;  2V0U A;  2ZOH A;  3F1O B;  3LIB A;  3NOU C;  1GSX A;  4JGR A;  4HIA A;  5EFW A;  4BBU A;  5HWT A;  3ICY A;  4F3L B;  3MR0 A;  1N9O A;  3KX0 X;  3K3D A;  3EEH A;  4HI4 A;  5DJT A;  3UB6 A;  3E4O A;  1VB6 A;  1XJ4 A;  1MZU A;  2PDR A;  4I3I A;  3VE4 A;  5A8B A;  4HHD A;  3G6O A;  5F6A A;  4GS9 A;  2OWH A;  4DJ2 A;  3BWL A;  4JGQ A;  3HJI A;  2BAS A;  5F5Y A;  2PYP A;  4F3L A;  4LLO B;  1EW0 A;  4WF0 A;  5DKK A;  3ULF A;  3ZQ5 A;  4EER A;  2PR6 A;  1KOU A;  1LT0 A;  1DRM A;  1NWZ A;  1P97 A;  4NXF A;  2V1A A;  4WLA A;  2PHY A;  5F69 A;  1Y28 A;  4KUK A;  1S67 L;  2L0W A;  2QJ5 A;  4M4X A;  4EXO A;  2W0N A;  2JN7 A;  3F1N B;  3RH8 B;  4DJ3 A;  4LRX C;  4JGO A;  2QJ7 A;  5HSQ A;  4B9O A;  2KX6 A;  3LIC A;  5DKL A;  1LSX A;  1XJ6 A;  2PYR A;  5F68 A;  1LSV A;  3LIF A;  1UGU A;  2A24 A;  1DP8 A;  1S4S A;  1OTE A;  2VEA A;  1P0Z A;  4NXE A;  3UB8 A;  1UWN X;  1TS7 A;  3EWK A;  3H9W A;  2Z6C A;  3PYP A;  4GHI B;  4WL9 A;  3P7N A;  3GEC A;  2B02 A;  3SW1 A;  3NHQ A;  2V9A A;  4PKY G;  2V1B A;  4HNB A;  1T1A A;  1TS6 A;  1LSW A;  4KUO A;  1DP6 A;  5HWW A;  4KQD A;  1OT9 A;  1X0O A;  2VV7 A;  4HJ4 A;  4EET B;  1G28 A;  3B33 A;  1T19 A;  2OWJ A;  2VV6 A;  1D06 A;  2J80 A;  1S66 L;  2ZOI A;  2JHE A;  2PR5 A;  4R38 A;  1OJ5 A;  2YKH A;  4R6L A;  3VE3 A;  5HWV A;  1XFN A;  2H28 A;  3LIE A;  3MQO A;  2ZBB A;  4L9F A;  3CWF A;  3UB7 A;  5HZH A;  4HP4 A;  1OJG A;  2L1M A;  1V9Y A;  3LYX A;  1XFQ A;  2D02 A;  1TS8 A;  4I38 A;  4JGP A;  3H82 B;  4NXB A;  3C2W A;  5TBM A;  5KIZ A;  4HP9 A;  3F1N A;  1N9N A;  3GDI A;  2Z6D A;  5G4Y A;  4BBT A;  2GJ3 A;  3CAX A;  1XJ2 A;  1WA9 A;  3IS2 A;  4EQ1 A;  4NXG A;  2R78 A;  4GW9 A;  3BY9 A;  2QWS A;  5IS1 A;  3MFX A;  1DP9 A;  4R70 A;  5AVF A;  3MQQ A;  4K08 A;  5J3W A;  4EEU A;  4MN5 A;  4BBV A;  1F98 A;  2I9V A;  2QHK A;  5G4Z A;  3OLO A;  1GSW A;  4GS9 B;  1T1C A;  5HDC A;  1UWP X;  1T1B A;  2V0W A;  2M1C A;  3E4Q A;  3LID A;  2PD8 A;  2L4R A;  5DJU A;  4I39 A;  3MJQ A;  3IS2 B;  2VV8 A;  4HJ3 A;  4PKY A;  4R3A A;  4EW7 A;  1V9Z A;  5AVE A;  2WKP A;  1S4R A;  2QKP A;  3F1P B;  5IU1 A;  3RTY A;  3A0S A;  3VOL A;  1N9L A;  1GSV A;  2CMN A;  5J4E A;  4RQ9 A;  2K7S A;  3LUQ A;  4XT2 A;  3MXQ A;  2PD7 A;  3CLO A;  4EES A;  3T50 A;  1BYW A;  3HJK A;  3C8C A;  3A0R A;  3H82 A;  2W27 A; 
#chains in the Genus database with same CATH topology
 3D72 A;  3B3X A;  4H6J B;  4GHI A;  1M40 A;  2ZMF A;  1IYO A;  4KG6 A;  4BD0 A;  3ITA A;  1W5D A;  4ZTK A;  3UMD A;  1K54 C;  3SS4 A;  1FSY A;  2WKR A;  3PHY A;  5M19 A;  3JVU A;  4OQ0 A;  3UB6 A;  3SOI A;  2GNX A;  1PI4 A;  1L0F A;  4B88 A;  1BUL A;  1FR6 A;  1A0K A;  4BD1 A;  2Y2O A;  1Y28 A;  2V20 A;  2Y2P A;  4DJ3 A;  2JN7 A;  1W8Q A;  3BFF A;  1YLP A;  4Y7P A;  1KE0 A;  4NXE A;  3CPT B;  2KLI A;  4K91 A;  2HDS A;  3OOV A;  2V9A A;  3IWO A;  2W3E A;  2WAD A;  5FDS A;  4R38 A;  3FZC A;  4E3M A;  4JGP A;  2M7V A;  3T4L A;  4HP9 A;  3UDF A;  2QWS A;  4CQH A;  4KZ6 A;  5F83 A;  1F98 A;  2ZC4 B;  5FQ9 A;  4WMC A;  1JTG A;  5DJU A;  4KZ5 A;  5DVA A;  3GSG A;  5CGW A;  1HVB A;  5FAT A;  3T50 A;  1C3B A;  4CLC B;  2LB5 A;  5HD5 A;  1GHM A;  4L9G A;  2Y2M A;  1K38 A;  4L9E A;  3UO9 A;  1PZO A;  1LL8 A;  3EGD C;  2FZ0 A;  1F9I A;  1DJA A;  2LB9 A;  1OTI A;  2AVX A;  2XFT A;  3VSK A;  1G5U A;  3A3I A;  1KVL A;  1I2W A;  4JXV A;  1VEU B;  1K54 A;  1K55 A;  1XKZ A;  4Q0I A;  3LO7 A;  3LIB A;  4C6Y A;  5LBR A;  1NLY A;  2E8I A;  2ZL1 A;  5KZH A;  4KG2 A;  2PDR A;  3IT9 A;  2EFU A;  3SH9 A;  3ULF A;  1BT5 A;  1ZTU A;  3ZQ5 A;  4FSF A;  3JPU A;  4M3K A;  2K31 A;  2XD1 A;  3SS3 A;  3T4Q A;  5A91 A;  3S22 A;  4JGO A;  4K0W A;  1JVJ A;  3KSI A;  2WZX A;  1NRJ A;  5FAQ A;  1F5M A;  2C6W B;  1NJ4 A;  2HP9 A;  3GEC A;  5FQK A;  3NHQ A;  3NEC A;  4FD8 A;  3ZCZ A;  2B5R A;  1DP6 A;  4Y0T A;  3S7N A;  3QNC A;  3NDE A;  3LYX A;  1TS8 A;  1YQS A;  4BBT A;  2GJ3 A;  3CAX A;  3NI9 A;  5GLB A;  5L09 A;  3NBL A;  5EVE A;  3GV9 A;  2QHK A;  4KZ9 A;  3MXR A;  1UWP X;  5EM1 A;  4UEY A;  4PMA A;  2A3U A;  4U0X A;  1V9Z A;  4RQ9 A;  4S2J A;  3OZH A;  1P9W A;  4QHC A;  4KZ8 A;  2G2U A;  2D01 A;  4GCZ A;  3K3C A;  3HCY A;  1FIL A;  2WKQ A;  3NOP C;  4DE3 A;  3MMH A;  3IXH A;  5HD3 A;  2G7U A;  5GHY A;  1OTD A;  1EI5 A;  5D3O A;  1ES4 A;  3Q7V A;  5I5L A;  5KMW A;  4HBT A;  2V0U A;  3KSF A;  5EFW A;  3CG5 A;  5C5K A;  3OC2 A;  3T12 B;  3E4O A;  4LCL A;  1GA0 A;  3BWL A;  5F5Y A;  1SKF A;  4G3K A;  2G2W A;  3VP1 A;  1P97 A;  4NK3 A;  1YLY A;  4GJ4 A;  3ZYT A;  1HD8 A;  2P04 A;  1PWG A;  4B4X A;  4XUX A;  5I94 A;  5EEC A;  3DBA A;  1OT9 A;  2EX6 A;  2VX8 A;  1OJ5 A;  4ETX A;  3TG9 A;  1IFQ A;  3WS4 A;  5TBM A;  3H82 B;  2O9A A;  4FTX A;  3BFD A;  4CJN A;  4QD4 A;  3LCE A;  3HLW A;  5IS1 A;  4N9K A;  3EOI A;  2JE5 A;  2M1C A;  2VGJ A;  1S4R A;  3MBZ A;  3T1S A;  3EQU A;  1K6R A;  3MXQ A;  1BYW A;  3C30 A;  3FWL A;  1BZA A;  3MS6 A;  1J3W A;  2OOL A;  3UPO A;  2HDR A;  4R70 A;  4AFI A;  4LCM A;  2JCH A;  2NUP C;  2VA0 A;  1HTZ A;  2DMW A;  5A93 A;  2O9C A;  3QHY A;  4GD6 A;  2ZOH A;  5FA7 A;  2IWD A;  3IX4 A;  2A2L A;  5HWT A;  3MR0 A;  3E98 A;  2P74 A;  3ZDJ A;  3W4O A;  4DJ2 A;  1ZHH B;  3L9K A;  2JKT M;  5GLA A;  4X6T A;  5IHV A;  4FH4 A;  5FI6 A;  5GLD A;  1LI0 A;  2ZM2 A;  2H0T A;  4KUK A;  2VKS A;  1QMF A;  3C38 A;  4OVD A;  4HES A;  1JWV A;  1UGU A;  3A3F A;  4WZ4 A;  4BL3 A;  3WS1 A;  1P0Z A;  4MLL A;  4ESP A;  1FIK A;  2ZQA A;  3TW8 A;  3W4P A;  3BQ8 A;  2XH9 A;  5EVI B;  3V3S A;  5HWV A;  3O86 A;  1O7E A;  4L9F A;  4O7D A;  5EVI D;  4I38 A;  4KEN B;  1XFQ A;  2ZC6 B;  1P9R A;  3ZVT A;  3MF0 A;  3T1R A;  4WYY A;  4PM9 A;  2P9V B;  1BLC A;  1K55 C;  5EUA A;  4EEU A;  3IF5 A;  4LFU A;  3RXX A;  3UN7 A;  2WGW A;  5L10 A;  2EX2 A;  2P9V A;  3MZF A;  2EX8 A;  1PW8 A;  3GR2 A;  5EV0 A;  4CPK A;  1H8Z A;  3CZD A;  2R9W A;  3PAE A;  3CJM A;  2WGI A;  3F1O A;  4JF5 A;  2BLS A;  2XSS A;  2Z2L B;  2Z2M B;  4EBP A;  3R4K A;  5CHU A;  3ZVW A;  4MBK A;  1NZO A;  5DTK A;  4MBF A;  4HOI A;  3LR3 A;  4KQQ A;  3JVV A;  1E4D A;  3E4P A;  2XFS A;  1D7E A;  2HJ9 C;  3LIA A;  4LRY C;  3RJU A;  1L0E A;  3MQ0 A;  4PM8 A;  3BFC A;  3QP4 A;  1ACF A;  1KVM A;  3ICY A;  4B93 A;  2ACG A;  2B95 A;  1RCJ A;  4CLC C;  3Q7Z A;  5A8B A;  4GS9 A;  1IKI A;  2OWH A;  3PBR A;  1SKO B;  1XGJ A;  4P87 A;  4ETZ A;  4GLQ A;  2WKH A;  1TF1 A;  4EU0 A;  1RGY A;  1DRM A;  3MKF A;  4JXW A;  3D4F A;  2ZJ9 A;  3FV7 A;  2QJ7 A;  5E43 A;  1SCW A;  2KX6 A;  4Y0U A;  4BWI A;  4R1G A;  3M6B A;  4X1L A;  2OV5 A;  2W3D A;  1BLS A;  5HAI A;  1T1A A;  4DDS A;  5HWW A;  4NEE D;  3VE3 A;  2ZC3 B;  1K4E A;  1V9Y A;  3IQA A;  1W63 M;  4P6Z M;  4UAA A;  3HLF A;  2Q0O A;  2XD5 A;  5EOE A;  5HPI A;  1DY6 A;  2RL3 A;  2R78 A;  2XDM A;  3ZHH A;  3BW6 A;  4IED A;  2OAP 1;  4LV1 A;  3UE0 A;  1GSW A;  2EWW A;  5HW3 A;  4EQI A;  3N8S A;  1Q2Q A;  5AQA A;  2VV8 A;  3WWX A;  3VSL A;  4N92 A;  2CMN A;  4C75 A;  3C4O A;  5HFO A;  1KE4 A;  1YAX A;  4YFM A;  5GLC A;  4BL2 A;  3O5Y A;  3H82 A;  1H8M A;  1ERQ A;  5E2E A;  4UHU A;  1S1Z A;  3IBR A;  4JBF A;  5CTN A;  4BEN A;  1MWR A;  1G6A A;  1OTA A;  3ISG A;  3IF6 B;  3M6H A;  1PW1 A;  1YPR A;  4IUK A;  4HY8 A;  1JNU A;  4WEL A;  5HDD A;  3EEA A;  1XJ3 A;  4PM7 A;  1JWZ A;  3EQV A;  3IF6 A;  2Y2G A;  2W1T B;  3BFG A;  2K2N A;  1L0D A;  3GTC A;  4HIA A;  3VFH A;  3ZG9 B;  1D1J A;  4PM5 A;  4U0T A;  2O0Y A;  4X1M A;  3HJI A;  4Q0J A;  2PYP A;  2VGK A;  4X55 A;  2Y2Q A;  5A90 A;  1NZU A;  2XRN A;  1KOU A;  3E2K A;  4OP8 A;  3C7U A;  3CI6 A;  3SH8 A;  4OLD A;  1UWN X;  1MXO A;  4WEK A;  1FCO A;  4HNB A;  4KUO A;  1TS6 A;  3NIA A;  1PNE A;  3IHB A;  5M18 A;  5EE8 A;  1ONG A;  1S66 L;  4JXG A;  1XFN A;  4R23 A;  3R7W A;  2H0Y A;  3G30 A;  3HRE A;  1Q2P A;  2OLV A;  1CI8 A;  4UA7 A;  3SZT A;  4FOF A;  4NG2 A;  3HL9 A;  4QY5 A;  2J3T D;  4PM6 A;  3S1Y A;  2ZC7 A;  2ZQ9 A;  1KDW A;  2ZQD A;  4DE2 A;  1J9M A;  4MDZ A;  3NUL A;  5HAR A;  3G31 A;  4Y3I A;  3HLE A;  2EFX A;  3FYZ A;  4S2O A;  4XUZ A;  2EXB A;  2EWV A;  4LGW A;  1KGG A;  3MSH A;  1YLZ A;  1G6O A;  4HH3 A;  4P85 A;  2J9O A;  1YMX A;  2EX9 A;  3AGD A;  5GHX A;  2WAF A;  4WUJ A;  2Q9N A;  1ODV A;  4LRZ E;  1ALQ A;  3F1O B;  3IF6 C;  4WZ5 C;  1LL5 A;  2VZW A;  3Q82 A;  4LV2 A;  4MMN A;  3KYE A;  5F6A A;  1YLJ A;  3DTK A;  2ZLY A;  5M1A A;  2BAS A;  2PT7 A;  5E2F A;  4KZ4 A;  3VFF A;  1NWZ A;  4QPR A;  3SH7 A;  2QJ5 A;  2FFY A;  3NDG A;  3W8K A;  4ZRR A;  1XJ6 A;  1CQA A;  5HX9 A;  3TRC A;  3JYI A;  2Y59 A;  3EWK A;  2Z6C A;  3SW1 A;  5HL1 A;  4KQD A;  3B33 A;  3PBS A;  2VV6 A;  1D06 A;  2ZOI A;  4E3J A;  1BLP A;  3G32 A;  1KGF A;  2RCX A;  5KIZ A;  1RGZ A;  3ZG5 A;  1VEU A;  3UDX A;  1Z6F A;  4NET A;  3TE8 A;  2HF6 A;  1PWD A;  2VJW A;  3O3V A;  5G4Z A;  3HLC A;  1ZG6 A;  4CLC A;  2E8J A;  3MJQ A;  3IS2 B;  1ESU A;  3PBT A;  4MEZ A;  2GDN A;  3SS5 A;  4Y5F A;  1H3Q A;  3A0R A;  1ES2 A;  1OPX A;  3ZGA B;  5E2H A;  3FG8 A;  2XA7 S;  4GKU A;  2GZA A;  5EVI C;  1PZP A;  1OT6 A;  3H7W A;  1S1Y A;  4MN6 A;  4JKT A;  3NY4 A;  2XA7 M;  5CTM A;  4S2P A;  3UE6 A;  1YSQ A;  5DF8 A;  1KE3 A;  4GDB A;  1NYY A;  3H7W B;  4XXR A;  5CGX A;  3T4O A;  4QB8 A;  4HI4 A;  1FR1 A;  3EEH A;  4ZBE A;  5FI7 A;  4I3I A;  4OP5 A;  4L0L A;  1YLT A;  1ERM A;  2W3H A;  1W8Y A;  3HBR A;  3IHA A;  1XP4 A;  5AQ9 A;  4WF0 A;  2PBD P;  3S7O A;  5HSQ A;  5DKL A;  2JKF A;  5AQB A;  2JKT I;  5TJJ A;  5BOH A;  4Z1W A;  3LEQ A;  2V1B A;  5EVL A;  1AWI A;  1IYQ A;  5F82 A;  5JYP A;  3DTI A;  3MZD A;  2J80 A;  1FCM A;  1AXB A;  4Z9Q A;  5HZH A;  2JKG A;  1N9N A;  2Z6D A;  4NXG A;  3VOY A;  3MFX A;  5AVF A;  1K4F A;  3BEC A;  4OH0 A;  2W1R A;  3AGF A;  3LR0 A;  3BRM A;  5HDC A;  3HLD A;  3LID A;  1N9B A;  3IXG A;  4HJ3 A;  1IOU A;  5IU1 A;  3LUQ A;  3IX3 A;  2HGV A;  2FFF B;  3D9Y A;  5HL6 A;  2A24 B;  3G4P A;  3N8L A;  4ZJ1 A;  1G68 A;  2INW A;  1H5X A;  5J7E A;  2HV1 A;  5MC7 A;  1JWP A;  3G35 A;  4GZB A;  4S2M A;  2JKR I;  3P09 A;  2KDK A;  4EXO A;  2Y2I A;  3V3R A;  4I3A A;  4S2N C;  4D60 A;  5EVI A;  2KOI A;  3A0V A;  1L3L A;  3IWQ A;  3T4S A;  4NKP A;  3OCN A;  2PU4 A;  3LY4 A;  4EBL A;  4O0P A;  4YIN A;  3UE1 A;  4BJP A;  1VB6 A;  4E3O A;  5DTT A;  1PYY A;  1ZKJ A;  1OME A;  4OOL A;  4D2O A;  1K6S A;  1HLU P;  4BLM A;  3E0Y A;  1SHV A;  3B47 A;  2XRO A;  3BQA A;  4KZ7 A;  3D3O A;  3CUE C;  3QP8 A;  2X01 A;  3VP3 A;  4Q0H A;  4IBR A;  2PYR A;  4IVK A;  1OTE A;  4HEF A;  4WL9 A;  3WRT A;  4PKY G;  3GQZ A;  4II7 A;  3V5M A;  2XGN A;  1YM1 A;  4B4Z A;  4R6L A;  3AGE A;  4GB7 A;  4KQO A;  1OJG A;  1KGE A;  2OLU A;  4Y17 A;  1MKI A;  3CIT A;  3C2W A;  1L2S A;  1NXY A;  3F1N A;  2J3T C;  4IVI A;  2XLN A;  1K56 D;  1ESI A;  4KZA A;  1L0G A;  2Y8H A;  1WA9 A;  4BQM A;  4GW9 A;  2J3W A;  2OSU A;  3UPN A;  5FEF A;  3KSG A;  4GS9 B;  4WZ5 A;  2L4R A;  5FL3 A;  3HVF A;  5AQ7 A;  4OQI A;  1SDN A;  5FQM A;  1N9L A;  3CLO A;  3VP2 A;  3MFD A;  4GNU A;  5F1F A;  4IJG A;  2GX5 A;  3M2J A;  4RYE A;  4MCW A;  4G3W A;  4WN5 A;  4JF4 A;  5CHM A;  2QMI A;  5CER A;  3RXW A;  2P7J A;  4LRX C;  1OTB A;  2YKF A;  3ITB A;  2B18 A;  5FDH A;  2H5S A;  3C5A A;  1K25 A;  4S2N A;  4P6Z S;  3CMZ A;  3PTE A;  5K5B A;  1PWC A;  3NOU C;  4JGR A;  3UNW A;  4OQH A;  1I5Q A;  4OKP A;  3W2Z A;  4F3L A;  4WBG A;  4EER A;  4OPZ A;  4U3T A;  3OPR A;  5DTS A;  1ES5 A;  3ZG7 B;  2WAE A;  3LIC A;  1LSX A;  2V8C A;  2Y2H A;  4ID4 A;  1S4S A;  2VEA A;  1TS7 A;  3H9W A;  1IKG A;  3PBN A;  2Y2N A;  3NC8 A;  2Y91 A;  1ZG4 A;  3HLG A;  4DKI A;  5DF9 A;  4ME4 A;  4OPY A;  4P0M A;  2V2F F;  3UB5 P;  4H8R A;  1S6R A;  3KSH A;  5HPF A;  5G4Y A;  1DJB A;  4QWO A;  4EQ1 A;  1BSG A;  4DRT A;  2JKR M;  4BBV A;  1SZV A;  2QZ6 A;  4E3K A;  2ZC5 B;  4DMZ A;  5AVE A;  3ZG8 B;  4DN0 A;  1IYP A;  1TEM A;  2W27 A;  4WM9 A;  1CJF A;  2HJE A;  1K0K A;  5TFQ A;  2ZM0 A;  5HDS A;  4WEJ A;  5A92 A;  1LI9 A;  3UDI A;  1N4O A;  4H6J A;  4E3I A;  4MBH A;  1CF0 A;  4OLG A;  3WRZ A;  2JBF A;  4S2I A;  4KZ3 A;  4HJ6 A;  4BMW A;  4MN7 A;  2UWX A;  5FQJ A;  5DJT A;  3KX0 X;  3K3D A;  3PAG A;  2HP6 A;  3NCK A;  1YT4 A;  2Y2L A;  4LLO B;  4WLA A;  4EWF A;  2WYX A;  1XA7 A;  1U60 A;  2XK1 A;  1LL9 A;  5CXW A;  1K56 A;  4OPR A;  1KDS A;  5GHZ A;  2VK3 A;  4OOM A;  2VGL M;  2ZMV A;  1NY0 A;  4X56 A;  4EUV A;  3GMW A;  3PYP A;  4N1H A;  4CLC E;  2CC1 A;  2NUT C;  4HJ4 A;  1T19 A;  2OWJ A;  1VHM A;  2JHE A;  2PR5 A;  3CPT A;  3CWF A;  4HP4 A;  2L1M A;  2V1Z A;  2HZ5 A;  2W1T A;  3EGX C;  3QNB A;  3P01 A;  1QME A;  4X25 A;  2ZD8 A;  3BY9 A;  4IBX A;  3MQQ A;  3N8R A;  4GOG A;  4PPR A;  5J3W A;  3E4Q A;  3L7H A;  1DJC A;  3LGO A;  5KSC A;  4C3Q A;  5EM0 A;  2EXA A;  2PD7 A;  4QU3 A;  3C8C A;  5CHJ A;  3CUE A;  4I5S A;  4ARZ B;  3CHW P;  1PIO A;  4KG5 A;  4EUZ A;  2WGV A;  1IEM A;  4HQA A;  1Z09 A;  4XT2 B;  2I72 A;  2WK0 A;  3DAV A;  4YWZ A;  4ARZ A;  1PI5 A;  2BG1 A;  2XQZ A;  3DTM A;  3UME A;  5CED A;  4EEP A;  2EA9 A;  5E2G A;  3V39 A;  3PXP A;  4I3J A;  1F2K A;  3LI8 A;  3UPP A;  1Y54 A;  3FC7 A;  4N1X A;  3S4X A;  1GSX A;  4BBU A;  1MZU A;  3G6O A;  2IWC A;  5TGF A;  4P6B A;  1EW0 A;  4R3J A;  3PR6 A;  1JTD A;  2J9P A;  4E3L A;  5F69 A;  4Y2F A;  2V1A A;  2PHY A;  3RH8 B;  5EOO A;  5F68 A;  4K0X A;  3BLS A;  1DP8 A;  2X02 A;  4GHI B;  3P7N A;  2XR0 A;  3FKV A;  4EET B;  3E2L A;  5HAQ A;  4GD8 A;  4R0Q A;  4IUH A;  5FI2 A;  4UA9 A;  2Y55 A;  2XF3 A;  4NXB A;  1O07 A;  5DF7 A;  4R3B A;  2A49 A;  3GDI A;  1WYC A;  1XJ2 A;  1HZO A;  4ZJ2 A;  3A3J A;  3TSG A;  1YSP A;  5GL9 A;  1S0W A;  1T1B A;  4E6W A;  1ZC2 A;  3HLB A;  2IWB A;  3RTY A;  4JPM A;  1RP5 A;  4XT2 A;  2ZMA A;  3OPL A;  2PAV P;  4DE1 A;  4OPQ A;  1FOF A;  3VMA A;  1TS0 A;  1MPL A;  2QYB A;  3HUO A;  2J7V A;  4OQG A;  3DTE A;  4LPZ A;  3VP4 A;  4UA6 A;  3ZNY A;  3G2Z A;  1ERO A;  4E6X A;  3BYD A;  3LFV A;  5J8X A;  2Y4A A;  1GHP A;  3VV4 A;  3LI9 A;  3ZFZ A;  3QP1 A;  1M6K A;  3IXD A;  4MNR A;  1VQQ A;  1XJ4 A;  4HHD A;  2ZM8 A;  3LR5 A;  3V67 A;  2PR6 A;  1PRQ A;  4OOY A;  4NXF A;  4PAU A;  3V50 A;  1FQG A;  1CK3 A;  3F1N B;  1E3U A;  5DFX A;  3O88 A;  2A24 A;  3IH8 A;  3TJZ C;  1GHI A;  3M2K A;  1CI9 A;  2B02 A;  3KYQ A;  4RA7 A;  3PBQ A;  5FEG A;  2JC7 A;  2BTF P;  4A5R A;  3DWZ A;  4GDN A;  5F1G A;  3WS2 A;  1WYB A;  1YKD A;  4FUW A;  2UV0 E;  3FKW A;  1TDL A;  2PRF A;  3BEB A;  2ZL1 B;  4UQI S;  1XXM A;  1DP9 A;  3IH9 A;  4O01 A;  5CEC A;  1T1C A;  3HUM A;  2FH5 A;  2WKI A;  1XA1 A;  1ES3 A;  4O8G A;  3IBJ A;  2WGW B;  1XPB A;  4LV3 A;  5TR7 A;  3BY8 A;  3I7J A;  4QJG A;  3LY3 A;  2Q9M A;  1SDE A;  3MZE A;  1XGI A;  3C4P A;  3OPP A;  1BLH A;  5TBM B;  3IX8 A;  4HH2 A;  1VET B;  3A3D A;  3QP5 A;  2VLG A;  1Y4O A;  4JLF A;  4QY6 A;  2HPB A;  4JXS A;  4DE0 A;  1K57 A;  3T4K A;  4JGQ A;  5FAS A;  3LEZ A;  5DKK A;  3T1X A;  1NRF A;  2W0N A;  4E3N A;  1BTL A;  1NYM A;  3BM6 A;  4S2K A;  1LSV A;  3LIF A;  4LEN A;  1E25 A;  2HDQ A;  4X69 A;  5CRF A;  2Y79 A;  1LSW A;  1W79 A;  1X0O A;  2VV7 A;  1GCE A;  1G28 A;  1PFL A;  2YKH A;  4UQI M;  3MQO A;  3LIE A;  2ZBB A;  4OON A;  3Q7V B;  4Y13 A;  4RX2 A;  2Y2J A;  3MXS A;  4RVA A;  4ZDX A;  1MY8 A;  3Q81 A;  2IA2 A;  3IS2 A;  4DDY A;  2H10 A;  2X71 A;  3WS5 A;  1W7F A;  4K08 A;  4G3V A;  4Y15 A;  1H0M A;  2DCF A;  2WZZ A;  3N7W A;  1LLB A;  4I39 A;  1IYS A;  4R3A A;  4CLC D;  3A0S A;  1TDG A;  1GSV A;  2HDU A;  3W4Q A;  5J4E A;  3N4I A;  5CEB A;  3DW0 A;  3HJK A;  3K2N A;  4YOF A;  5CGS A;  2QPN A;  2ZQ7 A;  5IT5 A;  4R4S A;  4X68 A;  3OCL A;  5L07 A;  1TVF A;  3LR4 A;  1CEG A;  4Y0O A;  1STZ A;  2MJ6 A;  5AJG A;  3OPH A;  3NOT C;  3VP0 A;  4S2L A;  5DFY A;  1I2S A;  2DNS A;  1N9O A;  3UY6 A;  2OAQ 1;  3VE4 A;  3IWI A;  2WKE A;  3OBF A;  1MC0 A;  1K57 C;  4JF6 A;  3Q1F A;  3B42 A;  2M7U A;  1S67 L;  4M4X A;  3BFE A;  3UE3 A;  3C7V A;  4YNR A;  1W63 Q;  5FAP A;  2PU2 A;  3UB8 A;  5CX7 A;  3UB7 A;  3U4L P;  4X53 A;  4DF6 A;  1GA9 A;  1MKM A;  3FPW A;  5FAO A;  2H28 A;  3G2Y A;  3KYZ A;  5FQQ A;  3T4T A;  2D02 A;  3P98 A;  2O9B A;  3O87 A;  1BUE A;  2R9X A;  2V8F A;  3T4J A;  2I9V A;  3OLO A;  5L2F A;  3DWK A;  1SKO A;  2PD8 A;  4EW7 A;  4PHT A;  3S7P A;  3F1P B;  4R4R A;  3VOL A;  2K7S A;  2DRW A;  2P08 A;  3QP6 A;  4EES A;  2WUQ A;  3PBO A;  3RFB A;  3F1P A;  1NLZ A;  4HBU A;  4ZJ3 A;  5HAP A;  3NJA A;  3A3E A;  4ZAM A;  3UB9 A;  1MWT A;  5FSR A;  3TOI A;  1T18 A;  4Q8I A;  3U2A A;  3N6I A;  1CEF A;  2XEP A;  4EV4 A;  1MWS A;  3ZG0 A;  4E04 A;  2HP5 A;  3BLM A;  3QP2 A;  4F3L B;  2ZQC A;  3ZNT A;  3HUN A;  2ZQ8 A;  4KQR A;  4IHQ A;  3FPV A;  5FQI A;  4LV0 A;  4DXB A;  1WE4 A;  3WS0 A;  1YMS A;  2W3F A;  1LHY A;  3GRJ A;  5JYO A;  1LT0 A;  1EWZ A;  2L0W A;  4B9O A;  1VET A;  2Y2K A;  4FH2 A;  4GN2 A;  5U47 A;  4WMC D;  2O99 A;  4FCF A;  3MKE A;  4DXC A;  1XX2 A;  2J8Y A;  2W3G A;  1VM1 A;  2VGL S;  3IXB A;  3GVB A;  1E3U D;  4RX3 A;  3BJN A;  1IEL A;  2C5W B;  3VOZ A;  4EBN A;  1TD5 A;  3S7Q A;  4N9L A;  1FCN A;  5EPH A;  4KZB A;  3R7W B;  1MWU A;  2PBY A;  4MN5 A;  3T1Q B;  3KO6 A;  3Q07 A;  2V0W A;  1FSW A;  3G34 A;  5G18 A;  4PKY A;  4F94 A;  2WKP A;  2QKP A;  1H8Y A;  1YLW A;  5L8M A;  1MBL A;  5KSH A;  1ONH A; 
#chains in the Genus database with same CATH homology
 5HL6 A;  3F1O A;  3D72 A;  2A24 B;  2XSS A;  2INW A;  4H6J B;  5J7E A;  2HV1 A;  4GHI A;  1TS0 A;  3R4K A;  2QYB A;  5MC7 A;  2ZMF A;  2JKR I;  4LPZ A;  2KDK A;  4HOI A;  4EXO A;  3LR3 A;  4I3A A;  2KOI A;  3A0V A;  3UMD A;  3JVV A;  3LFV A;  3E4P A;  3T4S A;  4NKP A;  3OCN A;  1D7E A;  2HJ9 C;  2WKR A;  3LIA A;  4LRY C;  3PHY A;  3VV4 A;  3JVU A;  3LI9 A;  3MQ0 A;  3ICY A;  4O0P A;  4B93 A;  3UB6 A;  4BJP A;  1VB6 A;  1XJ4 A;  2GNX A;  4CLC C;  5A8B A;  4HHD A;  4GS9 A;  2OWH A;  3PBR A;  4OOL A;  3LR5 A;  3V67 A;  4ETZ A;  2XRO A;  3E0Y A;  3B47 A;  3BQA A;  4GLQ A;  1TF1 A;  2PR6 A;  4EU0 A;  3D3O A;  4NXF A;  1DRM A;  3CUE C;  4PAU A;  1Y28 A;  4Q0H A;  4DJ3 A;  2JN7 A;  3F1N B;  2QJ7 A;  2KX6 A;  4BWI A;  2PYR A;  5DFX A;  2A24 A;  3TJZ C;  1OTE A;  4NXE A;  4WL9 A;  2W3D A;  2KLI A;  2B02 A;  3OOV A;  2V9A A;  3KYQ A;  4PKY G;  1T1A A;  2W3E A;  4II7 A;  3PBQ A;  5HWW A;  4NEE D;  4R6L A;  4R38 A;  3VE3 A;  1YKD A;  4KQO A;  1OJG A;  1V9Y A;  4JGP A;  3CIT A;  3C2W A;  2M7V A;  3T4L A;  4HP9 A;  1W63 M;  3F1N A;  4P6Z M;  2J3T C;  5HPI A;  2Y8H A;  1WA9 A;  2R78 A;  2J3W A;  4GW9 A;  2QWS A;  4CQH A;  4UQI S;  1DP9 A;  4O01 A;  3BW6 A;  2OAP 1;  1F98 A;  3KSG A;  1GSW A;  2EWW A;  1T1C A;  4GS9 B;  2L4R A;  5DJU A;  5FL3 A;  2VV8 A;  2FH5 A;  1N9L A;  2CMN A;  3CLO A;  4O8G A;  3T50 A;  1YAX A;  3O5Y A;  4CLC B;  3H82 A;  3IBJ A;  4IJG A;  2LB5 A;  1H8M A;  2GX5 A;  5HD5 A;  1S1Z A;  3IBR A;  4MCW A;  4G3W A;  3BY8 A;  4L9G A;  4L9E A;  1OTA A;  4WN5 A;  4IUK A;  2P7J A;  4LRX C;  1LL8 A;  3EGD C;  1OTB A;  2YKF A;  4HY8 A;  2FZ0 A;  1JNU A;  4WEL A;  2B18 A;  1F9I A;  3EEA A;  1XJ3 A;  1OTI A;  2LB9 A;  5HDD A;  3EQV A;  5TBM B;  4P6Z S;  4HH2 A;  2W1T B;  5K5B A;  2VLG A;  4Q0I A;  3LIB A;  3NOU C;  2K2N A;  4HIA A;  4JGR A;  5LBR A;  1NLY A;  3T4K A;  2PDR A;  2O0Y A;  4JGQ A;  3HJI A;  4Q0J A;  2PYP A;  3W2Z A;  4F3L A;  5DKK A;  3ULF A;  1ZTU A;  3ZQ5 A;  4FSF A;  4EER A;  2XRN A;  2K31 A;  1KOU A;  3T4Q A;  2W0N A;  4JGO A;  3CI6 A;  3LIC A;  3KSI A;  1LSX A;  1NRJ A;  1LSV A;  3LIF A;  1F5M A;  1S4S A;  2VEA A;  1UWN X;  1TS7 A;  3H9W A;  4WEK A;  3GEC A;  2Y79 A;  3NHQ A;  3PBN A;  4HNB A;  4KUO A;  1TS6 A;  1LSW A;  1DP6 A;  3S7N A;  1X0O A;  2VV7 A;  1G28 A;  1S66 L;  2YKH A;  4UQI M;  1XFN A;  3LIE A;  3MQO A;  2ZBB A;  5DF9 A;  4ME4 A;  3LYX A;  3R7W A;  1TS8 A;  3KSH A;  4FOF A;  5HPF A;  5G4Y A;  4BBT A;  2GJ3 A;  3CAX A;  2J3T D;  2IA2 A;  3IS2 A;  4EQ1 A;  4K08 A;  2JKR M;  4G3V A;  4BBV A;  2QHK A;  4MDZ A;  1UWP X;  4UEY A;  4I39 A;  4R3A A;  4DMZ A;  4CLC D;  4Y3I A;  1V9Z A;  5AVE A;  3A0S A;  1GSV A;  5J4E A;  4RQ9 A;  4DN0 A;  3HJK A;  1P9W A;  2W27 A;  3K2N A;  4YOF A;  2HJE A;  2D01 A;  4GCZ A;  2EWV A;  3K3C A;  3HCY A;  2WKQ A;  3NOP C;  5HDS A;  5IT5 A;  3MMH A;  4WEJ A;  1G6O A;  5HD3 A;  4HH3 A;  2G7U A;  1OTD A;  3OCL A;  4H6J A;  4WUJ A;  3LR4 A;  1STZ A;  5I5L A;  1ODV A;  2MJ6 A;  4LRZ E;  5AJG A;  4HJ6 A;  3NOT C;  4BMW A;  2V0U A;  3KSF A;  5DFY A;  3F1O B;  5EFW A;  4MN7 A;  5C5K A;  5DJT A;  1N9O A;  3KX0 X;  3K3D A;  3OC2 A;  3E4O A;  2OAQ 1;  3VE4 A;  2VZW A;  4MMN A;  3OBF A;  5F6A A;  3BWL A;  1MC0 A;  2BAS A;  5F5Y A;  4G3K A;  2PT7 A;  4LLO B;  3B42 A;  1NWZ A;  4QPR A;  4WLA A;  1P97 A;  2M7U A;  1S67 L;  4M4X A;  2QJ5 A;  4GJ4 A;  3UE3 A;  3ZYT A;  4ZRR A;  4YNR A;  1XJ6 A;  2P04 A;  4OOM A;  1W63 Q;  2VGL M;  3TRC A;  2ZMV A;  5CX7 A;  3EWK A;  3UB8 A;  3UB7 A;  2Z6C A;  3PYP A;  4EUV A;  3SW1 A;  3DBA A;  1MKM A;  4CLC E;  4KQD A;  1OT9 A;  2NUT C;  4HJ4 A;  3B33 A;  3PBS A;  1T19 A;  2OWJ A;  2VV6 A;  1D06 A;  1VHM A;  2ZOI A;  2JHE A;  2VX8 A;  3FPW A;  2PR5 A;  1OJ5 A;  4ETX A;  2H28 A;  3CWF A;  1IFQ A;  3KYZ A;  4HP4 A;  5KIZ A;  2L1M A;  3T4T A;  2D02 A;  5TBM A;  2O9B A;  3H82 B;  2O9A A;  2W1T A;  3EGX C;  3P01 A;  3BY9 A;  3TE8 A;  5IS1 A;  2HF6 A;  3MQQ A;  5J3W A;  3T4J A;  2VJW A;  2I9V A;  5G4Z A;  3OLO A;  3EOI A;  3E4Q A;  2M1C A;  4CLC A;  2PD8 A;  3MJQ A;  3IS2 B;  4EW7 A;  4PHT A;  3S7P A;  1S4R A;  3F1P B;  3PBT A;  3VOL A;  3EQU A;  2K7S A;  3MXQ A;  2PD7 A;  4Y5F A;  1BYW A;  1H3Q A;  3C30 A;  2P08 A;  3C8C A;  3A0R A;  1OPX A;  4EES A;  3CUE A;  4I5S A;  4ARZ B;  3FG8 A;  3PBO A;  3RFB A;  3F1P A;  2XA7 S;  1NLZ A;  2OOL A;  4HQA A;  4XT2 B;  2GZA A;  3NJA A;  4YWZ A;  3UB9 A;  1OT6 A;  4ARZ A;  1T18 A;  1S1Y A;  3H7W A;  4MN6 A;  4R70 A;  4AFI A;  2NUP C;  2VA0 A;  3U2A A;  2XA7 M;  2DMW A;  4E04 A;  3UME A;  3UE6 A;  4EEP A;  1YSQ A;  2EA9 A;  2O9C A;  3PXP A;  4I3J A;  3LI8 A;  3H7W B;  3FC7 A;  2ZOH A;  3T4O A;  1GSX A;  2A2L A;  4BBU A;  4F3L B;  5HWT A;  3MR0 A;  4HI4 A;  3EEH A;  3FPV A;  3E98 A;  4IHQ A;  4I3I A;  1MZU A;  4L0L A;  2W3H A;  3G6O A;  4DJ2 A;  1ZHH B;  2JKT M;  2W3F A;  1EW0 A;  4WF0 A;  3PR6 A;  1LT0 A;  5F69 A;  4Y2F A;  2V1A A;  2PHY A;  4KUK A;  2L0W A;  3S7O A;  2VKS A;  3C38 A;  3RH8 B;  5HSQ A;  4B9O A;  5F68 A;  5DKL A;  1UGU A;  2JKT I;  5TJJ A;  1DP8 A;  1P0Z A;  4Z1W A;  4GHI B;  3P7N A;  3TW8 A;  2V1B A;  2O99 A;  3BQ8 A;  4EET B;  2J80 A;  2W3G A;  5HWV A;  4L9F A;  2VGL S;  4IUH A;  5HZH A;  4I38 A;  3BJN A;  1XFQ A;  4NXB A;  1P9R A;  1N9N A;  3GDI A;  2Z6D A;  3MF0 A;  1TD5 A;  3S7Q A;  1XJ2 A;  4NXG A;  3MFX A;  5AVF A;  3R7W B;  4EEU A;  4MN5 A;  3KO6 A;  2W1R A;  1YSP A;  3LR0 A;  5HDC A;  1T1B A;  2V0W A;  3LID A;  4HJ3 A;  4PKY A;  1IOU A;  2WKP A;  2QKP A;  5IU1 A;  3RTY A;  3LUQ A;  4XT2 A;  5L8M A;  5KSH A;  2HGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...