2K7SA

Human arnt c-terminal pas domain, 3 residue ib slip
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSQTAQNPYSDEIETIICTNTNVKNSSQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title ARNT PAS-B has a fragile native state structure with an alternative beta-sheet register nearby in sequence space
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2k7sA01
4GW9A 3UE6A 1T19A 4KUKA 5HD5A 2QHKA 3KX0X 3VE3A 3H7WA 2K7SA 2V0WA 1V9ZA 1S4RA 3IS2B 4LRYC 2EA9A 3FC7A 4WN5A 4GS9B 1OT9A 3MR0A 2PD8A 4NXFA 5G4ZA 5HDSA 5EFWA 4GHIA 3RH8B 5F69A 1TS7A 2PD7A 2VV6A 5AVEA 4R38A 1WA9A 3NJAA 1LSXA 3UMDA 3LUQA 4HHDA 4KQDA 2VV7A 5HD3A 3BY8A 1DP6A 3BWLA 2B02A 4NXGA 4GHIB 3A0SA 4LRXC 4EEUA 1UWNX 3F1PA 2Z6CA 1S1YA 3MXQA 4YWZA 2PR6A 5IS1A 1XJ4A 3OLOA 1DP8A 3F1OA 1TS8A 1ODVA 3UB6A 1BYWA 4HH2A 1LSVA 4HOIA 3LIFA 2PDRA 4F3LA 1GSWA 4JGQA 4WLAA 4I5SA 1T1BA 1N9OA 1G28A 2R78A 2KX6A 2JN7A 3C8CA 4WL9A 2PR5A 3H9WA 4EW7A 4H6JA 5TBMA 1UGUA 3NOTC 1OJGA 4GCZA 5KIZA 1TS0A 3UMEA 1KOUA 2J80A 3K3CA 5G4YA 3K3DA 2W27A 1XJ2A 4I39A 4DJ3A 5F68A 5TBMB 1OTAA 5DKKA 3UB9A 3LI8A 1F98A 2W0NA 4HP9A 4LRZE 3NOUC 4JGOA 3EWKA 1OT6A 3UB7A 3A0RA 3E4PA 4DJ2A 1S67L 4BBVA 3H7WB 3B33A 5HSQA 5IU1A 4HI4A 3IBRA 1DRMA 1XJ3A 1XFQA 4BBTA 4HJ6A 4HP4A 2V0UA 3VE4A 1OTEA 3ZQ5A 4PKYA 2YKHA 2OWJA 2I9VA 3F1NA 3P7NA 3PYPA 3T50A 2WKQA 4HIAA 2ZOIA 5DJTA 4HNBA 3MQOA 2Z6DA 2JHEA 3CWFA 2YKFA 2ZBBA 1D7EA 3G6OA 4WF0A 3F1NB 4EEPA 1OTBA 4HQAA 1VB6A 3F1PB 3LIDA 2VLGA 4BBUA 2OWHA 1P97A 4EESA 4EETB 2HV1A 2V9AA 3D72A 3F1OB 2M1CA 1DP9A 4R3AA 4L9FA 4KUOA 4MN6A 2BASA 3H82A 3E4OA 2WKRA 4F3LB 1N9LA 4LPZA 2ZOHA 4EQ1A 5I5LA 4L9GA 4MN5A 1XFNA 1XJ6A 5J4EA 3LI9A 2H28A 4H6JB 4XT2A 1LT0A 1EW0A 2OOLA 2GJ3A 5HWVA 4M4XA 1D06A 3E4QA 4PKYG 3IS2A 3H82B 2D02A 5A8BA 3EEHA 1Y28A 4K08A 1T18A 4GS9A 2WKPA 1OTDA 4I3IA 2PYPA 1NWZA 4R6LA 3ULFA 1LSWA 3A0VA 4EERA 1OJ5A 1GSVA 3MFXA 3CAXA 4XT2B 2QWSA 5HZHA 4L9EA 5HDDA 5HWTA 4HH3A 2INWA 1LL8A 1T1AA 2KDKA 3NHQA 3HJKA 2V1BA 4LLOB 3BY9A 5HWWA 4NXEA 4E04A 4R70A 1S66L 4B9OA 2QJ5A 3CLOA 2L0WA 3LIAA 5F5YA 2L1MA 3PHYA 1MZUA 3LICA 2A24A 4RQ9A 3MQQA 2V1AA 2QJ7A 4I3AA 5F6AA 1F9IA 4HJ4A 2PHYA 1TS6A 1UWPX 4EXOA 3HJIA 1X0OA 3UB8A 5HDCA 4HY8A 3MJQA 4I3JA 3C2WA 2VEAA 3ICYA 4NXBA 3VOLA 1T1CA 2A24B 3GDIA 1N9NA 2PYRA 3LYXA 1V9YA 5DKLA 2D01A 1S1ZA 1P0ZA 3GECA 5J3WA 5J7EA 3NOPC 4JGRA 1JNUA 3FG8A 2P7JA 2QKPA 5DJUA 3SW1A 4I38A 3RTYA 1S4SA 5AVFA 3LIBA 1OTIA 2VV8A 2L4RA 2CMNA 3LIEA 4WUJA 4HJ3A 1GSXA 4JGPA
chains in the Genus database with same CATH superfamily
1XGIA 4KUKA 2M7UA 1VETB 3UPNA 4WEJA 3T4KA 4XUZA 2WKHA 1QMFA 4XXRA 4KZ4A 4DE3A 1IELA 4X53A 3FYZA 3BRMA 3EGXC 4OOYA 3HLGA 4GD6A 3IS2B 4LRYC 1GHIA 4WMCD 4P6ZS 1ZG6A 5CTNA 1H8YA 1J9MA 1L0DA 4CPKA 3HLCA 4KZ6A 3AGFA 3SH7A 2AVXA 2VV6A 5AVEA 3VSKA 4R38A 3NJAA 2XFSA 1WE4A 4N1XA 1PZPA 3BQAA 3DTMA 2DCFA 1KE4A 5FEGA 2VV7A 4YFMA 3W2ZA 1YMSA 3OPHA 3QP5A 5F1FA 3FPVA 5IHVA 2Y2IA 3A0SA 4D60A 5M18A 4EEUA 3F1PA 4R4RA 2Z6CA 3UDIA 3MXQA 2ZQDA 5A91A 2JBFA 2XGNA 4S2NA 1BYWA 1G6OA 3UNWA 3VSLA 2DRWA 4HOIA 4BD0A 4X1LA 1PNEA 3QHYA 1CEFA 2ZQCA 4IUKA 1G28A 2R78A 3C4OA 3TSGA 2HDRA 4ESPA 3UN7A 1XKZA 3H9WA 5FA7A 2ZQ9A 4BJPA 4FCFA 5LBRA 2WADA 1CI8A 3PBQA 3VV4A 4O7DA 4IHQA 1KOUA 2EWVA 3D9YA 3KSHA 3BJNA 4Y5FA 3IF5A 3FWLA 5E2HA 4P87A 4DJ3A 5DTTA 4Q0JA 3ZHHA 3FZCA 2XA7S 5DKKA 4OP8A 4Y0OA 3ZG7B 4PM6A 3Q7VA 1FQGA 1K6RA 5JYOA 3U4LP 2Y2KA 2ZLYA 2HDUA 3NOUC 4JGOA 3EWKA 4NKPA 3KYQA 3A0RA 3SOIA 4ME4A 1S0WA 3IWOA 3KYZA 5HSQA 1YLWA 4A5RA 4II7A 5IU1A 3VOZA 5DF8A 1K56A 4UAAA 1IKGA 1ONHA 1XFQA 4BBTA 1KGEA 3CI6A 5DF9A 3HLDA 1PFLA 2Z2MB 3DWZA 4R0QA 4K0XA 4X68A 4QU3A 1PYYA 2Y79A 4JPMA 3LO7A 5GLBA 1DJAA 2JKRM 3NIAA 3UB5P 1SKOB 4KZ5A 4IVIA 1KGGA 1F5MA 4Y17A 2ZM2A 3EQVA 4BWIA 1PRQA 1Z09A 3LFVA 4ETXA 2J9OA 4LV0A 2YKFA 1Y54A 3G6OA 4N9KA 3F1NB 2B5RA 3UE1A 1OTBA 3M2JA 3CJMA 1CF0A 4OOLA 3F1PB 1ES5A 5FQ9A 1P97A 2JKTI 3GV9A 3UY6A 2V9AA 3D72A 2M1CA 3IXHA 4X6TA 5L07A 3NY4A 4F94A 3CMZA 3PBRA 3V5MA 3H82A 3E4OA 1P9RA 2BLSA 2WKRA 2IWCA 4LPZA 3V50A 4HBUA 1NXYA 2Y2GA 1CI9A 4EQ1A 4YNRA 4DXCA 3LI9A 2A3UA 1O7EA 4XT2A 4PM9A 2GJ3A 4M4XA 4PM7A 4P0MA 4PPRA 5EPHA 1YLTA 4K08A 4E3KA 3ZG9B 1FCOA 1OTDA 4I3IA 3N8SA 3OPLA 1YLPA 3T4JA 3PBNA 4KQQA 1LSWA 3ZG0A 4JKTA 2XD5A 1ONGA 3A0VA 1OJ5A 4EERA 3BM6A 1L0FA 2V20A 5DVAA 4ZJ3A 3T1SA 2PU4A 3HVFA 2INWA 4CLCA 3A3FA 1LL8A 3QP8A 3RJUA 1BULA 3KO6A 2XH9A 3IT9A 3G30A 5AQ7A 1YLJA 2H0YA 2ZQ7A 3IH8A 4S2JA 4OVDA 3T4LA 5FATA 1NY0A 3T1QB 3KSGA 4BD1A 1GCEA 2L1MA 2HPBA 5HAPA 4UA9A 3MQQA 2V1AA 2QJ7A 4I3AA 1CJFA 3ITBA 5KMWA 1ES3A 3A3IA 4EXOA 4OP5A 2EX8A 2DNSA 3C30A 1X0OA 3MJQA 2LB9A 3C2WA 5M1AA 3VOLA 3G34A 3FV7A 2VJWA 2WGWB 1E25A 4EUVA 5HAQA 2IA2A 4MCWA 1L3LA 3N6IA 2VZWA 2A24B 1N9BA 2PYRA 3MF0A 1K6SA 2E8IA 5A90A 2D01A 2W3GA 3Q82A 5J7EA 3Q81A 4OQGA 3IXDA 5GLCA 2W3DA 2QPNA 5FASA 4WELA 1ZKJA 2Y2JA 5HW3A 3N8LA 2EXAA 3Q07A 1S4SA 5CGWA 5AVFA 1BLHA 5CRFA 1ERMA 3RXXA 2K31A 1PIOA 5EVIC 4MN7A 4FD8A 2JC7A 4ZAMA 3S7NA 3BEBA 2HDSA 1VEUB 3CUEA 4HJ3A 2A49A 4QWOA 2Y8HA 5DFYA 3ZFZA 3DTKA 3OOVA 3EEAA 3E0YA 3H7WA 2EX9A 2Y2QA 2XK1A 4KG6A 1IOUA 5M19A 2V0WA 4R4SA 4MDZA 3QP6A 4NG2A 2W1TA 3OCNA 3CHWP 4WN5A 3O3VA 4DE1A 2PD8A 4WZ4A 4NXFA 5AJGA 1E3UD 3WS0A 4QD4A 5TGFA 5E2GA 4UQIM 4JXSA 4FTXA 4JF6A 1TS7A 4MMNA 4LCMA 3P01A 2ZL1B 4LCLA 4CLCB 3MZDA 4OQIA 4HHDA 2OLVA 1H8MA 4B4XA 4UA6A 3BY8A 4GD8A 1DP6A 2HZ5A 3WWXA 4IJGA 2XA7M 4LV2A 4MNRA 3O5YA 3G35A 4GHIB 2BG1A 4S2OA 4WM9A 3O87A 2UV0E 1S1YA 1XA1A 5FL3A 4YINA 3IX8A 4K0WA 5HAIA 3ZG5A 3K2NA 1DP8A 1TS8A 2HJ9C 4DN0A 4BENA 1BTLA 3WS2A 2J3TC 4ZDXA 2PDRA 1GSWA 4WLAA 1EROA 2Y2LA 1ZHHB 3PBSA 3S7QA 1L0GA 4P85A 4FUWA 1PI5A 5EVEA 1NZOA 3HBRA 3UO9A 4GDNA 1UGUA 2QZ6A 3BFFA 5KIZA 5L2FA 2JKRI 2P08A 4PM5A 3UMEA 5KSCA 3K3CA 4MBFA 4ETZA 5G4YA 1HVBA 4Y0TA 1K54A 2PBDP 2EFXA 3FKWA 2FH5A 4LV1A 1LL5A 3A3EA 5TBMB 3O86A 4QHCA 3BQ8A 3UPOA 1MXOA 5F83A 2M7VA 3BFCA 4OPZA 4E3MA 3GMWA 4BMWA 5JYPA 2H10A 1OT6A 4BBVA 3H7WB 4KZ7A 5EVID 3B33A 2XEPA 3V3SA 5GL9A 5FEFA 4HI4A 4OLDA 4DMZA 2W1TB 4Y0UA 1DRMA 4G3WA 2K2NA 1SKOA 5FQJA 3C38A 5FAOA 3VE4A 5HL1A 1OTEA 5HPFA 2KLIA 3D3OA 2YKHA 3JVVA 4KZBA 4GLQA 3F1NA 4GJ4A 2WKQA 3GTCA 4JBFA 1JWPA 5TJJA 4MLLA 4HIAA 2ZC5B 5EUAA 3IWIA 4BQMA 5CEBA 1SKFA 3P09A 4HNBA 4OPRA 3AGEA 4WBGA 2Z6DA 4BLMA 2JHEA 5DF7A 1MBLA 1FSWA 4E3LA 5FQMA 4GDBA 1HZOA 2VGLS 2VK3A 3G31A 3VMAA 4U0TA 4BBUA 5EOEA 3U2AA 3M2KA 4EETB 3NULA 2HV1A 2ZMVA 4D2OA 1K57A 3PR6A 3JVUA 2Y2MA 1DP9A 4R3AA 4MN6A 2A2LA 1MKMA 3VFHA 3LR4A 2X02A 3T4SA 4RVAA 4KZ9A 3QP2A 2ZM8A 3M6BA 1K4EA 3DWKA 4L9GA 5I5LA 4KZ3A 3IX4A 2GZAA 2H28A 4HEFA 2HF6A 1FOFA 1LT0A 4E3JA 1EW0A 2ZQ8A 4EBLA 4WMCA 1D06A 3KSIA 2PT7A 4GB7A 3RFBA 5GHYA 1W63M 3MS6A 5DTSA 4GKUA 3QNCA 1IYPA 4GS9A 1KGFA 5F1GA 1FR1A 3G2ZA 3MQ0A 2PYPA 4JXVA 4DXBA 1GSVA 3CAXA 2VX8A 4H8RA 3HUNA 2XQZA 2LB5A 1BLSA 1DJCA 1YPRA 5HDDA 3IHAA 1P9WA 4HH3A 1T1AA 2KDKA 4MEZA 2G2WA 2QMIA 3HJKA 1XXMA 1YSPA 3BY9A 5HWWA 3DBAA 4MBHA 1H8ZA 4HESA 2IWBA 2EFUA 1ES2A 1YSQA 3C7VA 4N1HA 4DKIA 3PBTA 3B42A 3BECA 4UHUA 3BFDA 2E8JA 4O0PA 2WGWA 4OH0A 1CK3A 3PHYA 1MZUA 3C7UA 2A24A 4RQ9A 2JE5A 2DMWA 4KZ8A 4HJ4A 2PHYA 1TS6A 3HJIA 2JKFA 5EVLA 4EUZA 5HDCA 4P6BA 1JTDA 4I3JA 3T4TA 1EI5A 1FILA 2VEAA 4ZRRA 3PAEA 3HREA 4CLCE 3OPPA 2WUQA 1T1CA 1W79A 5FDSA 1P0ZA 3TOIA 3V67A 3SH8A 4XUXA 3GECA 3NI9A 4Q8IA 3DAVA 4X55A 4JGRA 5HARA 2HDQA 1VEUA 2FFYA 1Y4OA 2WK0A 5L8MA 3VP0A 1XA7A 3SW1A 1AWIA 3ZDJA 1K54C 1OTIA 3D4FA 3LIEA 3BFEA 4WUJA 3MZFA 3N4IA 5TFQA 1BT5A 2ZC3B 2XF3A 4Y15A 1JTGA 5E2FA 1V9ZA 1VM1A 3A3JA 3UE6A 1LL9A 1MWSA 1LLBA 1T19A 5HFOA 3BLSA 1NJ4A 4R3JA 4NEED 2XFTA 3KX0X 4JXGA 4QPRA 4G3KA 1TDLA 2Y59A 5L10A 1JWZA 4Z1WA 4QJGA 1WYBA 3NDGA 2Y91A 5DFXA 1S4RA 3NDEA 2H5SA 2EA9A 2ZL1A 5HL6A 1ALQA 4GS9B 2G2UA 4O01A 4Q0HA 1W8QA 3MKEA 4E6XA 5EFWA 4GHIA 1PI4A 5F69A 3RH8B 1YAXA 2PD7A 2HP6A 1WA9A 3UMDA 5DTKA 4OLGA 1VHMA 1Q2QA 3W8KA 2FFFB 4B93A 1Q2PA 3TG9A 3S7OA 1H0MA 3LCEA 3HLBA 4DE2A 1K4FA 1LI0A 2B02A 5CHUA 4S2NC 1TD5A 1Z6FA 2PU2A 3EQUA 1ESIA 1F2KA 3ZG8B 1K55A 1TVFA 1UWNX 2W3EA 4GNUA 1HTZA 4YWZA 2CC1A 2ZC6B 4P6ZM 2V8FA 1FIKA 1XJ4A 2V1ZA 4GOGA 3UE0A 1NRJA 1PWDA 3S22A 1BLPA 5CXWA 1K57C 2P04A 1TDGA 4B88A 1GHPA 3LIFA 4F3LA 5CGXA 4IBXA 2Q9MA 3SS5A 3KSFA 4R23A 2O9CA 1N9OA 1KDSA 2JN7A 2PR5A 3GVBA 4EW7A 4ZJ2A 5TBMA 3P98A 3C5AA 3ITAA 2O9AA 3NOTC 1WYCA 5D3OA 4LENA 2KOIA 5AQBA 1TS0A 2J80A 5GLDA 2P9VB 3K3DA 1A0KA 1TEMA 5K5BA 4I39A 3ZVTA 3PBOA 5CECA 5CX7A 3TE8A 1ZC2A 1OTAA 2VGLM 4FSFA 4E3IA 2J7VA 4WEKA 3UB9A 4Z9QA 3LEQA 1F98A 2W0NA 5CHMA 3W4OA 3IF6B 2XLNA 3PTEA 4DJ2A 4E6WA 4PM8A 2XD1A 2WKIA 3VOYA 3WRTA 2V2FF 4N9LA 1XP4A 4BL3A 5EV0A 4ARZB 2BTFP 1XJ3A 3FKVA 1W7FA 5EM1A 3MSHA 4QY6A 4DDSA 1PWCA 2G7UA 3ZQ5A 1KVMA 3LGOA 2JKTM 4PKYA 2WKEA 5GHXA 3L7HA 3VFFA 4R1GA 2OWJA 1JVJA 5F82A 1MKIA 3P7NA 3B3XA 3ZYTA 3B47A 3HLFA 2GNXA 3OC2A 2ZOIA 3GR2A 1S6RA 5DJTA 1KE3A 1KE0A 2B95A 3CWFA 3DTEA 5KZHA 3UDFA 2ZBBA 1D7EA 4WF0A 3N7WA 4EEPA 4LFUA 1VB6A 3TRCA 2VLGA 5C5KA 3SS3A 2Q0OA 1IFQA 2GX5A 2OWHA 4KG5A 3G2YA 4EBPA 5FQQA 4DRTA 1TF1A 1I2SA 3HUMA 4L9FA 4KG2A 4OONA 1O07A 4KENB 4F3LB 3ZNYA 1N9LA 4RX2A 2ZOHA 5EECA 3IWQA 3BW6A 4NETA 3MMHA 2JCHA 1XFNA 5J4EA 1NLZA 1U60A 1YMXA 1VQQA 2OOLA 1N4OA 3E98A 3OPRA 4PMAA 3FPWA 4EU0A 1T18A 4CLCC 4IEDA 1I2WA 1E3UA 3GRJA 2WKPA 4X69A 2ZMAA 4R6LA 2ZM0A 3ULFA 2Y2PA 1DY6A 3CG5A 2JKGA 2C5WB 2B18A 4OPYA 1EWZA 2QWSA 3T4OA 2P74A 1KVLA 3V3RA 3HL9A 3DW0A 1G68A 2ZC4B 4Y3IA 5EOOA 1XX2A 4YOFA 4NXEA 1MWUA 4R70A 5GHZA 3R4KA 1K55C 5GLAA 4B9OA 3S7PA 5CGSA 2I72A 1SCWA 5J8XA 1QMEA 2Z2LB 2HJEA 2WGIA 1PW1A 1BZAA 3LIAA 1BSGA 2H0TA 4CQHA 1K56D 1L0EA 4FOFA 1F9IA 1LHYA 1PW8A 1XGJA 1SZVA 2XDMA 4QB8A 3V39A 3NBLA 3UB8A 1ERQA 4HY8A 1STZA 4EBNA 1HD8A 2PAVP 2EWWA 2HGVA 3ICYA 4NXBA 4JLFA 1NYYA 5FDHA 3OCLA 4AFIA 3HLWA 3GDIA 4IBRA 5A92A 1V9YA 1PZOA 3W4PA 3E2LA 1S1ZA 4DF6A 1K0KA 1GA0A 3NCKA 4FH2A 3NOPC 3PAGA 1JNUA 3FG8A 4X1MA 3TJZC 3CUEC 2P7JA 3ISGA 3LY3A 3S4XA 5DJUA 3CPTB 3NECA 3RTYA 5FAQA 3LIBA 2VV8A 5IT5A 1D1JA 2L4RA 1RP5A 2CMNA 3Q1FA 2O9BA 4BL2A 1ESUA 4UQIS 3CITA 4JF4A 1GSXA 4JGPA 3IXBA 4GW9A 1NRFA 2J3TD 1OPXA 5HD5A 2QHKA 5EVIA 2WYXA 3VE3A 4C75A 3MKFA 2K7SA 3MFDA 1K25A 1LI9A 2RCXA 4ZBEA 4LV3A 4L0LA 3LR0A 4ID4A 2HP5A 2NUTC 3FC7A 3SZTA 1FCNA 1OT9A 1K38A 3MR0A 3IHBA 1GHMA 5BOHA 5G4ZA 2FZ0A 2GDNA 5HDSA 3CZDA 4DE0A 3SS4A 3S1YA 5TR7A 2ZC7A 3BYDA 1H3QA 3LR5A 3UE3A 1OMEA 4MBKA 4DDYA 1LSXA 3LUQA 3AGDA 4KQDA 4PAUA 4GZBA 2Q9NA 3VP1A 5HD3A 4CLCD 3T12B 2RL3A 1IKIA 3EGDC 3W4QA 3BWLA 2ACGA 4NXGA 4LRXC 3QP4A 3ZCZA 4UA7A 5CTMA 4CJNA 2MJ6A 1NYMA 2PR6A 4WZ5A 5IS1A 1RCJA 3OLOA 4FH4A 3F1OA 2OAP1 1ODVA 3UB6A 1G6AA 4HH2A 1LSVA 2Y2HA 3ZGAB 2Y4AA 3MZEA 4WYYA 4JGQA 4I5SA 1ZG4A 1T1BA 2EX6A 2P9VA 2Y55A 2KX6A 2WAFA 3JYIA 4NK3A 3C8CA 4WL9A 3QNBA 4RA7A 3ZNTA 2OAQ1 3HUOA 4RX3A 1W8YA 4LGWA 4H6JA 3IH9A 3IBJA 2Y2OA 1ACFA 4JXWA 1NLYA 1OJGA 4GCZA 2VA0A 3HCYA 3HLEA 1SDNA 3OBFA 4E3NA 2PBYA 4B4ZA 4Y13A 2QYBA 3WS1A 2W27A 3IF6A 1XJ2A 4OOMA 4ZTKA 4G3VA 5F68A 1YLYA 3LEZA 1ES4A 3TW8A 5HX9A 2R9WA 4S2IA 4ARZA 3LI8A 4X25A 1CEGA 3NC8A 1BLCA 1IYQA 1MWRA 1FSYA 1I5QA 3UPPA 4JF5A 1FCMA 4C6YA 4HP9A 4LRZE 5CEDA 2W1RA 5EVIB 4EWFA 3UB7A 3T1XA 2J3WA 3E4PA 5FI2A 1S67L 1SHVA 5FSRA 4RYEA 1MC0A 3LR3A 1YKDA 1IYSA 4Y7PA 4R3BA 4PHTA 2W3HA 3Q7VB 3IBRA 4HJ6A 4HP4A 2V0UA 2UWXA 4S2LA 5FI6A 2WGVA 3WS5A 2IWDA 1NZUA 4S2KA 1XPBA 2J8YA 2EX2A 1C3BA 2WZZA 1IYOA 4OKPA 2I9VA 3BFGA 3OZHA 3PYPA 3T50A 3R7WA 1YQSA 4K91A 4IVKA 2O0YA 5EE8A 1W63Q 4S2MA 5FQKA 2XSSA 4EQIA 4HBTA 1IEMA 4OPQA 3MQOA 2HP9A 2X01A 3IX3A 3G32A 4KQOA 3WS4A 1AXBA 1L2SA 1MWTA 5KSHA 5G18A 1M6KA 4HQAA 3VP2A 4EV4A 3LIDA 1G5UA 5FAPA 2Y2NA 2OSUA 4EESA 3LY4A 3BLMA 4S2PA 1SDEA 4OQHA 2R9XA 4IUHA 1MPLA 3F1OB 1M40A 5EM0A 4KUOA 3VP4A 5CERA 2VKSA 2BASA 1CQAA 1HLUP 4KQRA 2ZMFA 4M3KA 3GSGA 2W3FA 3DTIA 4ZJ1A 1VETA 3IXGA 5E43A 4MN5A 1XJ6A 4N92A 4H6JB 5HWVA 3E4QA 4PKYG 1RGYA 3IS2A 3H82B 2XROA 2D02A 5A8BA 3EEHA 1Y28A 3QP1A 1YLZA 1FR6A 1NWZA 2VGKA 2O99A 3MFXA 4XT2B 3RXWA 4C3QA 3T4QA 2XR0A 5HZHA 2WAEA 4L9EA 4E3OA 5L09A 5HWTA 5HPIA 3I7JA 3NHQA 2EXBA 3EOIA 3C4PA 3MBZA 1W5DA 5AQ9A 2V1BA 4LLOB 3T1RA 2V8CA 3KYEA 1YM1A 3GQZA 4E04A 1PWGA 1S66L 4O8GA 3WRZA 2QJ5A 3IQAA 3CLOA 4Q0IA 2L0WA 5CHJA 1E4DA 3MXSA 1J3WA 5F5YA 3L9KA 4WZ5C 3LICA 5I94A 4GN2A 2OV5A 3G4PA 5F6AA 3ZVWA 1BUEA 5A93A 4QY5A 1UWPX 3MXRA 3Q7ZA 5FQIA 3A3DA 4OQ0A 4KZAA 4X56A 2OLUA 2PRFA 3R7WB 2J9PA 3PXPA 3CPTA 2X71A 2C6WB 3SH9A 2NUPC 1N9NA 3LYXA 1ZTUA 2WZXA 5DKLA 1RGZA 5J3WA 1DJBA 3N8RA 5FI7A 1YT4A 1JWVA 5AQAA 2XRNA 2ZQAA 3E2KA 4U0XA 2QKPA 1MY8A 3VP3A 4UEYA 1KDWA 3JPUA 2ZJ9A 4I38A 3O88A 3IF6C 4U3TA 1H5XA 2ZD8A 1GA9A 4Y2FA 2VGJA 3UDXA 5U47A 5E2EA 3M6HA 5MC7A
chains in the Genus database with same CATH topology
4GW9A 2Y8HA 3UE6A 2J3TD 5DFYA 1T19A 1OPXA 4KUKA 2M7UA 5HD5A 2QHKA 3OOVA 3EEAA 4WEJA 3T4KA 4NEED 3E0YA 3KX0X 3VE3A 3H7WA 2K7SA 4QPRA 4G3KA 1IOUA 4Z1WA 2V0WA 3EGXC 4L0LA 5DFXA 4MDZA 1S4RA 3IS2B 2W1TA 3LR0A 4LRYC 2EA9A 2NUTC 3OCNA 5HL6A 3FC7A 4WN5A 4P6ZS 4GS9B 1OT9A 3MR0A 2PD8A 4NXFA 4Q0HA 4O01A 5AJGA 5G4ZA 2FZ0A 5HDSA 4UQIM 5EFWA 4GHIA 3RH8B 5F69A 1TS7A 1YAXA 2PD7A 2VV6A 4MMNA 5AVEA 4R38A 1H3QA 3LR5A 3UE3A 1WA9A 3NJAA 3P01A 1LSXA 4CLCB 3BQAA 3UMDA 3LUQA 4HHDA 1H8MA 4KQDA 4PAUA 1VHMA 2VV7A 5HD3A 4B93A 4CLCD 3BY8A 3S7OA 3W2ZA 1DP6A 3EGDC 3BWLA 4IJGA 2XA7M 2B02A 1TD5A 3FPVA 3O5YA 4NXGA 3EQUA 4GHIB 3A0SA 4LRXC 4EEUA 1UWNX 3F1PA 2Z6CA 2W3EA 1S1YA 3MXQA 4YWZA 4P6ZM 2MJ6A 5FL3A 2PR6A 5IS1A 4JGPA 1XJ4A 3OLOA 1NRJA 3K2NA 1DP8A 3F1OA 1TS8A 2OAP1 1ODVA 2P04A 3UB6A 2HJ9C 1BYWA 4DN0A 1G6OA 4HH2A 1LSVA 2J3TC 4HOIA 3LIFA 2PDRA 4F3LA 1GSWA 4JGQA 4WLAA 3KSFA 4I5SA 1T1BA 1ZHHB 4IUKA 2O9CA 1N9OA 3PBSA 1G28A 2R78A 3S7QA 2KX6A 2JN7A 3C8CA 4WL9A 2PR5A 3H9WA 4BJPA 2OAQ1 5LBRA 4EW7A 4H6JA 3IBJA 5TBMA 1UGUA 2O9AA 3NOTC 3PBQA 1NLYA 1OJGA 4GCZA 3VV4A 5KIZA 2JKRI 2P08A 2KOIA 2VA0A 3HCYA 1TS0A 3UMEA 4IHQA 1KOUA 2J80A 2EWVA 3OBFA 3KSHA 3K3CA 4ETZA 3BJNA 5G4YA 4Y5FA 2QYBA 3K3DA 2W27A 2FH5A 1XJ2A 4OOMA 5K5BA 4I39A 4DJ3A 3PBOA 4Q0JA 4G3VA 5CX7A 3TE8A 5F68A 5TBMB 1OTAA 2VGLM 2XA7S 3BQ8A 4FSFA 5DKKA 4WEKA 3TW8A 3UB9A 4ARZA 3LI8A 1F98A 2M7VA 4BMWA 2W0NA 4HP9A 4LRZE 3NOUC 4JGOA 2W1RA 3EWKA 4NKPA 1OT6A 3KYQA 3UB7A 3A0RA 2J3WA 3E4PA 4ME4A 4DJ2A 1S67L 3KYZA 4BBVA 3H7WB 3B33A 1MC0A 3LR3A 5HSQA 1YKDA 4II7A 5IU1A 4HI4A 4DMZA 4PHTA 2W3HA 2W1TB 4ARZB 3IBRA 1DRMA 1XJ3A 1XFQA 4BBTA 4HJ6A 4HP4A 2V0UA 4G3WA 2K2NA 3CI6A 5DF9A 3C38A 3VE4A 2G7UA 1OTEA 3ZQ5A 5HPFA 2KLIA 2JKTM 3D3OA 4PKYA 2YKHA 3JVVA 2OWJA 2I9VA 4GLQA 3F1NA 3P7NA 3PYPA 3T50A 4GJ4A 3ZYTA 2WKQA 3B47A 3R7WA 5TJJA 2Y79A 4HIAA 2O0YA 1W63Q 2GNXA 3OC2A 2JKRM 2ZOIA 2XSSA 5DJTA 1F5MA 4HNBA 3EQVA 4BWIA 3LFVA 3MQOA 4ETXA 2Z6DA 2JHEA 3CWFA 2YKFA 2ZBBA 1D7EA 4KQOA 3G6OA 4WF0A 3F1NB 5KSHA 4EEPA 1OTBA 2VGLS 4HQAA 4OOLA 1VB6A 3F1PB 3LIDA 3TRCA 2VLGA 5C5KA 4BBUA 1IFQA 2GX5A 2OWHA 1P97A 3U2AA 2JKTI 4EESA 4EETB 1TF1A 2HV1A 2ZMVA 2V9AA 3D72A 4IUHA 3F1OB 2M1CA 3PR6A 3JVUA 1DP9A 4R3AA 4L9FA 4KUOA 2VKSA 4MN6A 2BASA 2A2LA 3PBRA 3H82A 3E4OA 1P9RA 2WKRA 4F3LB 1MKMA 3LR4A 3T4SA 2ZMFA 1N9LA 2W3FA 4LPZA 2ZOHA 4EQ1A 4L9GA 4YNRA 3BW6A 5I5LA 3MMHA 4MN5A 1XFNA 1XJ6A 5J4EA 1NLZA 2GZAA 3LI9A 2H28A 2HF6A 4H6JB 4XT2A 1LT0A 1EW0A 2OOLA 2GJ3A 5HWVA 4M4XA 3E98A 1D06A 3KSIA 2PT7A 3E4QA 4PKYG 3IS2A 3H82B 2XROA 2D02A 5A8BA 3EEHA 1Y28A 3RFBA 3FPWA 4EU0A 1W63M 4K08A 1T18A 4CLCC 4GS9A 2WKPA 1OTDA 4I3IA 3MQ0A 2PYPA 1NWZA 4R6LA 3T4JA 3PBNA 3ULFA 1LSWA 3A0VA 2O99A 1OJ5A 1GSVA 3MFXA 4EERA 3CAXA 4XT2B 2VX8A 2B18A 3T4QA 2QWSA 3T4OA 5HZHA 2LB5A 4L9EA 5HDDA 5HWTA 1P9WA 4HH3A 2INWA 4CLCA 5HPIA 1LL8A 1T1AA 2KDKA 3NHQA 3EOIA 3HJKA 1YSPA 4Y3IA 2V1BA 4LLOB 3BY9A 5HWWA 4YOFA 3DBAA 4NXEA 3KO6A 4E04A 1YSQA 4R70A 1S66L 4O8GA 3PBTA 3R4KA 4B9OA 3B42A 2QJ5A 3S7PA 3T4LA 3CLOA 4Q0IA 2L0WA 2HJEA 4O0PA 3KSGA 3LIAA 5F5YA 2L1MA 3PHYA 1MZUA 3LICA 4CQHA 2A24A 4RQ9A 3MQQA 2V1AA 2DMWA 2QJ7A 4I3AA 5F6AA 4FOFA 1F9IA 4HJ4A 2PHYA 1TS6A 1UWPX 4EXOA 3HJIA 3C30A 1X0OA 3UB8A 5HDCA 4HY8A 1STZA 3MJQA 4I3JA 3T4TA 2LB9A 3C2WA 3R7WB 3PXPA 2EWWA 2VEAA 2HGVA 3ICYA 4NXBA 4ZRRA 3VOLA 2VJWA 4AFIA 3OCLA 4EUVA 2IA2A 4MCWA 4CLCE 2VZWA 1T1CA 2A24B 3GDIA 1N9NA 2PYRA 3LYXA 2NUPC 1ZTUA 1V9YA 5DKLA 3MF0A 2D01A 1S1ZA 2W3GA 1P0ZA 3V67A 3GECA 5J3WA 5J7EA 3NOPC 4JGRA 2W3DA 1JNUA 2XRNA 3FG8A 3TJZC 3CUEC 4WELA 2P7JA 2QKPA 5L8MA 5DJUA 3SW1A 4UEYA 4I38A 3RTYA 1S4SA 5AVFA 3LIBA 1OTIA 2K31A 2VV8A 5IT5A 2L4RA 2CMNA 3LIEA 4WUJA 4MN7A 4Y2FA 2O9BA 3S7NA 3CUEA 4HJ3A 4UQIS 3CITA 5MC7A 1GSXA 1V9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GW9 A;  3UE6 A;  1T19 A;  4KUK A;  5HD5 A;  2QHK A;  3KX0 X;  3VE3 A;  3H7W A;  2K7S A;  2V0W A;  1V9Z A;  1S4R A;  3IS2 B;  4LRY C;  2EA9 A;  3FC7 A;  4WN5 A;  4GS9 B;  1OT9 A;  3MR0 A;  2PD8 A;  4NXF A;  5G4Z A;  5HDS A;  5EFW A;  4GHI A;  3RH8 B;  5F69 A;  1TS7 A;  2PD7 A;  2VV6 A;  5AVE A;  4R38 A;  1WA9 A;  3NJA A;  1LSX A;  3UMD A;  3LUQ A;  4HHD A;  4KQD A;  2VV7 A;  5HD3 A;  3BY8 A;  1DP6 A;  3BWL A;  2B02 A;  4NXG A;  4GHI B;  3A0S A;  4LRX C;  4EEU A;  1UWN X;  3F1P A;  2Z6C A;  1S1Y A;  3MXQ A;  4YWZ A;  2PR6 A;  5IS1 A;  1XJ4 A;  3OLO A;  1DP8 A;  3F1O A;  1TS8 A;  1ODV A;  3UB6 A;  1BYW A;  4HH2 A;  1LSV A;  4HOI A;  3LIF A;  2PDR A;  4F3L A;  1GSW A;  4JGQ A;  4WLA A;  4I5S A;  1T1B A;  1N9O A;  1G28 A;  2R78 A;  2KX6 A;  2JN7 A;  3C8C A;  4WL9 A;  2PR5 A;  3H9W A;  4EW7 A;  4H6J A;  5TBM A;  1UGU A;  3NOT C;  1OJG A;  4GCZ A;  5KIZ A;  1TS0 A;  3UME A;  1KOU A;  2J80 A;  3K3C A;  5G4Y A;  3K3D A;  2W27 A;  1XJ2 A;  4I39 A;  4DJ3 A;  5F68 A;  5TBM B;  1OTA A;  5DKK A;  3UB9 A;  3LI8 A;  1F98 A;  2W0N A;  4HP9 A;  4LRZ E;  3NOU C;  4JGO A;  3EWK A;  1OT6 A;  3UB7 A;  3A0R A;  3E4P A;  4DJ2 A;  1S67 L;  4BBV A;  3H7W B;  3B33 A;  5HSQ A;  5IU1 A;  4HI4 A;  3IBR A;  1DRM A;  1XJ3 A;  1XFQ A;  4BBT A;  4HJ6 A;  4HP4 A;  2V0U A;  3VE4 A;  1OTE A;  3ZQ5 A;  4PKY A;  2YKH A;  2OWJ A;  2I9V A;  3F1N A;  3P7N A;  3PYP A;  3T50 A;  2WKQ A;  4HIA A;  2ZOI A;  5DJT A;  4HNB A;  3MQO A;  2Z6D A;  2JHE A;  3CWF A;  2YKF A;  2ZBB A;  1D7E A;  3G6O A;  4WF0 A;  3F1N B;  4EEP A;  1OTB A;  4HQA A;  1VB6 A;  3F1P B;  3LID A;  2VLG A;  4BBU A;  2OWH A;  1P97 A;  4EES A;  4EET B;  2HV1 A;  2V9A A;  3D72 A;  3F1O B;  2M1C A;  1DP9 A;  4R3A A;  4L9F A;  4KUO A;  4MN6 A;  2BAS A;  3H82 A;  3E4O A;  2WKR A;  4F3L B;  1N9L A;  4LPZ A;  2ZOH A;  4EQ1 A;  5I5L A;  4L9G A;  4MN5 A;  1XFN A;  1XJ6 A;  5J4E A;  3LI9 A;  2H28 A;  4H6J B;  4XT2 A;  1LT0 A;  1EW0 A;  2OOL A;  2GJ3 A;  5HWV A;  4M4X A;  1D06 A;  3E4Q A;  4PKY G;  3IS2 A;  3H82 B;  2D02 A;  5A8B A;  3EEH A;  1Y28 A;  4K08 A;  1T18 A;  4GS9 A;  2WKP A;  1OTD A;  4I3I A;  2PYP A;  1NWZ A;  4R6L A;  3ULF A;  1LSW A;  3A0V A;  4EER A;  1OJ5 A;  1GSV A;  3MFX A;  3CAX A;  4XT2 B;  2QWS A;  5HZH A;  4L9E A;  5HDD A;  5HWT A;  4HH3 A;  2INW A;  1LL8 A;  1T1A A;  2KDK A;  3NHQ A;  3HJK A;  2V1B A;  4LLO B;  3BY9 A;  5HWW A;  4NXE A;  4E04 A;  4R70 A;  1S66 L;  4B9O A;  2QJ5 A;  3CLO A;  2L0W A;  3LIA A;  5F5Y A;  2L1M A;  3PHY A;  1MZU A;  3LIC A;  2A24 A;  4RQ9 A;  3MQQ A;  2V1A A;  2QJ7 A;  4I3A A;  5F6A A;  1F9I A;  4HJ4 A;  2PHY A;  1TS6 A;  1UWP X;  4EXO A;  3HJI A;  1X0O A;  3UB8 A;  5HDC A;  4HY8 A;  3MJQ A;  4I3J A;  3C2W A;  2VEA A;  3ICY A;  4NXB A;  3VOL A;  1T1C A;  2A24 B;  3GDI A;  1N9N A;  2PYR A;  3LYX A;  1V9Y A;  5DKL A;  2D01 A;  1S1Z A;  1P0Z A;  3GEC A;  5J3W A;  5J7E A;  3NOP C;  4JGR A;  1JNU A;  3FG8 A;  2P7J A;  2QKP A;  5DJU A;  3SW1 A;  4I38 A;  3RTY A;  1S4S A;  5AVF A;  3LIB A;  1OTI A;  2VV8 A;  2L4R A;  2CMN A;  3LIE A;  4WUJ A;  4HJ3 A;  1GSX A;  4JGP A; 
#chains in the Genus database with same CATH topology
 1XGI A;  4KUK A;  2M7U A;  1VET B;  3UPN A;  4WEJ A;  3T4K A;  4XUZ A;  2WKH A;  1QMF A;  4XXR A;  4KZ4 A;  4DE3 A;  1IEL A;  4X53 A;  3FYZ A;  3BRM A;  3EGX C;  4OOY A;  3HLG A;  4GD6 A;  3IS2 B;  4LRY C;  1GHI A;  4WMC D;  4P6Z S;  1ZG6 A;  5CTN A;  1H8Y A;  1J9M A;  1L0D A;  4CPK A;  3HLC A;  4KZ6 A;  3AGF A;  3SH7 A;  2AVX A;  2VV6 A;  5AVE A;  3VSK A;  4R38 A;  3NJA A;  2XFS A;  1WE4 A;  4N1X A;  1PZP A;  3BQA A;  3DTM A;  2DCF A;  1KE4 A;  5FEG A;  2VV7 A;  4YFM A;  3W2Z A;  1YMS A;  3OPH A;  3QP5 A;  5F1F A;  3FPV A;  5IHV A;  2Y2I A;  3A0S A;  4D60 A;  5M18 A;  4EEU A;  3F1P A;  4R4R A;  2Z6C A;  3UDI A;  3MXQ A;  2ZQD A;  5A91 A;  2JBF A;  2XGN A;  4S2N A;  1BYW A;  1G6O A;  3UNW A;  3VSL A;  2DRW A;  4HOI A;  4BD0 A;  4X1L A;  1PNE A;  3QHY A;  1CEF A;  2ZQC A;  4IUK A;  1G28 A;  2R78 A;  3C4O A;  3TSG A;  2HDR A;  4ESP A;  3UN7 A;  1XKZ A;  3H9W A;  5FA7 A;  2ZQ9 A;  4BJP A;  4FCF A;  5LBR A;  2WAD A;  1CI8 A;  3PBQ A;  3VV4 A;  4O7D A;  4IHQ A;  1KOU A;  2EWV A;  3D9Y A;  3KSH A;  3BJN A;  4Y5F A;  3IF5 A;  3FWL A;  5E2H A;  4P87 A;  4DJ3 A;  5DTT A;  4Q0J A;  3ZHH A;  3FZC A;  2XA7 S;  5DKK A;  4OP8 A;  4Y0O A;  3ZG7 B;  4PM6 A;  3Q7V A;  1FQG A;  1K6R A;  5JYO A;  3U4L P;  2Y2K A;  2ZLY A;  2HDU A;  3NOU C;  4JGO A;  3EWK A;  4NKP A;  3KYQ A;  3A0R A;  3SOI A;  4ME4 A;  1S0W A;  3IWO A;  3KYZ A;  5HSQ A;  1YLW A;  4A5R A;  4II7 A;  5IU1 A;  3VOZ A;  5DF8 A;  1K56 A;  4UAA A;  1IKG A;  1ONH A;  1XFQ A;  4BBT A;  1KGE A;  3CI6 A;  5DF9 A;  3HLD A;  1PFL A;  2Z2M B;  3DWZ A;  4R0Q A;  4K0X A;  4X68 A;  4QU3 A;  1PYY A;  2Y79 A;  4JPM A;  3LO7 A;  5GLB A;  1DJA A;  2JKR M;  3NIA A;  3UB5 P;  1SKO B;  4KZ5 A;  4IVI A;  1KGG A;  1F5M A;  4Y17 A;  2ZM2 A;  3EQV A;  4BWI A;  1PRQ A;  1Z09 A;  3LFV A;  4ETX A;  2J9O A;  4LV0 A;  2YKF A;  1Y54 A;  3G6O A;  4N9K A;  3F1N B;  2B5R A;  3UE1 A;  1OTB A;  3M2J A;  3CJM A;  1CF0 A;  4OOL A;  3F1P B;  1ES5 A;  5FQ9 A;  1P97 A;  2JKT I;  3GV9 A;  3UY6 A;  2V9A A;  3D72 A;  2M1C A;  3IXH A;  4X6T A;  5L07 A;  3NY4 A;  4F94 A;  3CMZ A;  3PBR A;  3V5M A;  3H82 A;  3E4O A;  1P9R A;  2BLS A;  2WKR A;  2IWC A;  4LPZ A;  3V50 A;  4HBU A;  1NXY A;  2Y2G A;  1CI9 A;  4EQ1 A;  4YNR A;  4DXC A;  3LI9 A;  2A3U A;  1O7E A;  4XT2 A;  4PM9 A;  2GJ3 A;  4M4X A;  4PM7 A;  4P0M A;  4PPR A;  5EPH A;  1YLT A;  4K08 A;  4E3K A;  3ZG9 B;  1FCO A;  1OTD A;  4I3I A;  3N8S A;  3OPL A;  1YLP A;  3T4J A;  3PBN A;  4KQQ A;  1LSW A;  3ZG0 A;  4JKT A;  2XD5 A;  1ONG A;  3A0V A;  1OJ5 A;  4EER A;  3BM6 A;  1L0F A;  2V20 A;  5DVA A;  4ZJ3 A;  3T1S A;  2PU4 A;  3HVF A;  2INW A;  4CLC A;  3A3F A;  1LL8 A;  3QP8 A;  3RJU A;  1BUL A;  3KO6 A;  2XH9 A;  3IT9 A;  3G30 A;  5AQ7 A;  1YLJ A;  2H0Y A;  2ZQ7 A;  3IH8 A;  4S2J A;  4OVD A;  3T4L A;  5FAT A;  1NY0 A;  3T1Q B;  3KSG A;  4BD1 A;  1GCE A;  2L1M A;  2HPB A;  5HAP A;  4UA9 A;  3MQQ A;  2V1A A;  2QJ7 A;  4I3A A;  1CJF A;  3ITB A;  5KMW A;  1ES3 A;  3A3I A;  4EXO A;  4OP5 A;  2EX8 A;  2DNS A;  3C30 A;  1X0O A;  3MJQ A;  2LB9 A;  3C2W A;  5M1A A;  3VOL A;  3G34 A;  3FV7 A;  2VJW A;  2WGW B;  1E25 A;  4EUV A;  5HAQ A;  2IA2 A;  4MCW A;  1L3L A;  3N6I A;  2VZW A;  2A24 B;  1N9B A;  2PYR A;  3MF0 A;  1K6S A;  2E8I A;  5A90 A;  2D01 A;  2W3G A;  3Q82 A;  5J7E A;  3Q81 A;  4OQG A;  3IXD A;  5GLC A;  2W3D A;  2QPN A;  5FAS A;  4WEL A;  1ZKJ A;  2Y2J A;  5HW3 A;  3N8L A;  2EXA A;  3Q07 A;  1S4S A;  5CGW A;  5AVF A;  1BLH A;  5CRF A;  1ERM A;  3RXX A;  2K31 A;  1PIO A;  5EVI C;  4MN7 A;  4FD8 A;  2JC7 A;  4ZAM A;  3S7N A;  3BEB A;  2HDS A;  1VEU B;  3CUE A;  4HJ3 A;  2A49 A;  4QWO A;  2Y8H A;  5DFY A;  3ZFZ A;  3DTK A;  3OOV A;  3EEA A;  3E0Y A;  3H7W A;  2EX9 A;  2Y2Q A;  2XK1 A;  4KG6 A;  1IOU A;  5M19 A;  2V0W A;  4R4S A;  4MDZ A;  3QP6 A;  4NG2 A;  2W1T A;  3OCN A;  3CHW P;  4WN5 A;  3O3V A;  4DE1 A;  2PD8 A;  4WZ4 A;  4NXF A;  5AJG A;  1E3U D;  3WS0 A;  4QD4 A;  5TGF A;  5E2G A;  4UQI M;  4JXS A;  4FTX A;  4JF6 A;  1TS7 A;  4MMN A;  4LCM A;  3P01 A;  2ZL1 B;  4LCL A;  4CLC B;  3MZD A;  4OQI A;  4HHD A;  2OLV A;  1H8M A;  4B4X A;  4UA6 A;  3BY8 A;  4GD8 A;  1DP6 A;  2HZ5 A;  3WWX A;  4IJG A;  2XA7 M;  4LV2 A;  4MNR A;  3O5Y A;  3G35 A;  4GHI B;  2BG1 A;  4S2O A;  4WM9 A;  3O87 A;  2UV0 E;  1S1Y A;  1XA1 A;  5FL3 A;  4YIN A;  3IX8 A;  4K0W A;  5HAI A;  3ZG5 A;  3K2N A;  1DP8 A;  1TS8 A;  2HJ9 C;  4DN0 A;  4BEN A;  1BTL A;  3WS2 A;  2J3T C;  4ZDX A;  2PDR A;  1GSW A;  4WLA A;  1ERO A;  2Y2L A;  1ZHH B;  3PBS A;  3S7Q A;  1L0G A;  4P85 A;  4FUW A;  1PI5 A;  5EVE A;  1NZO A;  3HBR A;  3UO9 A;  4GDN A;  1UGU A;  2QZ6 A;  3BFF A;  5KIZ A;  5L2F A;  2JKR I;  2P08 A;  4PM5 A;  3UME A;  5KSC A;  3K3C A;  4MBF A;  4ETZ A;  5G4Y A;  1HVB A;  4Y0T A;  1K54 A;  2PBD P;  2EFX A;  3FKW A;  2FH5 A;  4LV1 A;  1LL5 A;  3A3E A;  5TBM B;  3O86 A;  4QHC A;  3BQ8 A;  3UPO A;  1MXO A;  5F83 A;  2M7V A;  3BFC A;  4OPZ A;  4E3M A;  3GMW A;  4BMW A;  5JYP A;  2H10 A;  1OT6 A;  4BBV A;  3H7W B;  4KZ7 A;  5EVI D;  3B33 A;  2XEP A;  3V3S A;  5GL9 A;  5FEF A;  4HI4 A;  4OLD A;  4DMZ A;  2W1T B;  4Y0U A;  1DRM A;  4G3W A;  2K2N A;  1SKO A;  5FQJ A;  3C38 A;  5FAO A;  3VE4 A;  5HL1 A;  1OTE A;  5HPF A;  2KLI A;  3D3O A;  2YKH A;  3JVV A;  4KZB A;  4GLQ A;  3F1N A;  4GJ4 A;  2WKQ A;  3GTC A;  4JBF A;  1JWP A;  5TJJ A;  4MLL A;  4HIA A;  2ZC5 B;  5EUA A;  3IWI A;  4BQM A;  5CEB A;  1SKF A;  3P09 A;  4HNB A;  4OPR A;  3AGE A;  4WBG A;  2Z6D A;  4BLM A;  2JHE A;  5DF7 A;  1MBL A;  1FSW A;  4E3L A;  5FQM A;  4GDB A;  1HZO A;  2VGL S;  2VK3 A;  3G31 A;  3VMA A;  4U0T A;  4BBU A;  5EOE A;  3U2A A;  3M2K A;  4EET B;  3NUL A;  2HV1 A;  2ZMV A;  4D2O A;  1K57 A;  3PR6 A;  3JVU A;  2Y2M A;  1DP9 A;  4R3A A;  4MN6 A;  2A2L A;  1MKM A;  3VFH A;  3LR4 A;  2X02 A;  3T4S A;  4RVA A;  4KZ9 A;  3QP2 A;  2ZM8 A;  3M6B A;  1K4E A;  3DWK A;  4L9G A;  5I5L A;  4KZ3 A;  3IX4 A;  2GZA A;  2H28 A;  4HEF A;  2HF6 A;  1FOF A;  1LT0 A;  4E3J A;  1EW0 A;  2ZQ8 A;  4EBL A;  4WMC A;  1D06 A;  3KSI A;  2PT7 A;  4GB7 A;  3RFB A;  5GHY A;  1W63 M;  3MS6 A;  5DTS A;  4GKU A;  3QNC A;  1IYP A;  4GS9 A;  1KGF A;  5F1G A;  1FR1 A;  3G2Z A;  3MQ0 A;  2PYP A;  4JXV A;  4DXB A;  1GSV A;  3CAX A;  2VX8 A;  4H8R A;  3HUN A;  2XQZ A;  2LB5 A;  1BLS A;  1DJC A;  1YPR A;  5HDD A;  3IHA A;  1P9W A;  4HH3 A;  1T1A A;  2KDK A;  4MEZ A;  2G2W A;  2QMI A;  3HJK A;  1XXM A;  1YSP A;  3BY9 A;  5HWW A;  3DBA A;  4MBH A;  1H8Z A;  4HES A;  2IWB A;  2EFU A;  1ES2 A;  1YSQ A;  3C7V A;  4N1H A;  4DKI A;  3PBT A;  3B42 A;  3BEC A;  4UHU A;  3BFD A;  2E8J A;  4O0P A;  2WGW A;  4OH0 A;  1CK3 A;  3PHY A;  1MZU A;  3C7U A;  2A24 A;  4RQ9 A;  2JE5 A;  2DMW A;  4KZ8 A;  4HJ4 A;  2PHY A;  1TS6 A;  3HJI A;  2JKF A;  5EVL A;  4EUZ A;  5HDC A;  4P6B A;  1JTD A;  4I3J A;  3T4T A;  1EI5 A;  1FIL A;  2VEA A;  4ZRR A;  3PAE A;  3HRE A;  4CLC E;  3OPP A;  2WUQ A;  1T1C A;  1W79 A;  5FDS A;  1P0Z A;  3TOI A;  3V67 A;  3SH8 A;  4XUX A;  3GEC A;  3NI9 A;  4Q8I A;  3DAV A;  4X55 A;  4JGR A;  5HAR A;  2HDQ A;  1VEU A;  2FFY A;  1Y4O A;  2WK0 A;  5L8M A;  3VP0 A;  1XA7 A;  3SW1 A;  1AWI A;  3ZDJ A;  1K54 C;  1OTI A;  3D4F A;  3LIE A;  3BFE A;  4WUJ A;  3MZF A;  3N4I A;  5TFQ A;  1BT5 A;  2ZC3 B;  2XF3 A;  4Y15 A;  1JTG A;  5E2F A;  1V9Z A;  1VM1 A;  3A3J A;  3UE6 A;  1LL9 A;  1MWS A;  1LLB A;  1T19 A;  5HFO A;  3BLS A;  1NJ4 A;  4R3J A;  4NEE D;  2XFT A;  3KX0 X;  4JXG A;  4QPR A;  4G3K A;  1TDL A;  2Y59 A;  5L10 A;  1JWZ A;  4Z1W A;  4QJG A;  1WYB A;  3NDG A;  2Y91 A;  5DFX A;  1S4R A;  3NDE A;  2H5S A;  2EA9 A;  2ZL1 A;  5HL6 A;  1ALQ A;  4GS9 B;  2G2U A;  4O01 A;  4Q0H A;  1W8Q A;  3MKE A;  4E6X A;  5EFW A;  4GHI A;  1PI4 A;  5F69 A;  3RH8 B;  1YAX A;  2PD7 A;  2HP6 A;  1WA9 A;  3UMD A;  5DTK A;  4OLG A;  1VHM A;  1Q2Q A;  3W8K A;  2FFF B;  4B93 A;  1Q2P A;  3TG9 A;  3S7O A;  1H0M A;  3LCE A;  3HLB A;  4DE2 A;  1K4F A;  1LI0 A;  2B02 A;  5CHU A;  4S2N C;  1TD5 A;  1Z6F A;  2PU2 A;  3EQU A;  1ESI A;  1F2K A;  3ZG8 B;  1K55 A;  1TVF A;  1UWN X;  2W3E A;  4GNU A;  1HTZ A;  4YWZ A;  2CC1 A;  2ZC6 B;  4P6Z M;  2V8F A;  1FIK A;  1XJ4 A;  2V1Z A;  4GOG A;  3UE0 A;  1NRJ A;  1PWD A;  3S22 A;  1BLP A;  5CXW A;  1K57 C;  2P04 A;  1TDG A;  4B88 A;  1GHP A;  3LIF A;  4F3L A;  5CGX A;  4IBX A;  2Q9M A;  3SS5 A;  3KSF A;  4R23 A;  2O9C A;  1N9O A;  1KDS A;  2JN7 A;  2PR5 A;  3GVB A;  4EW7 A;  4ZJ2 A;  5TBM A;  3P98 A;  3C5A A;  3ITA A;  2O9A A;  3NOT C;  1WYC A;  5D3O A;  4LEN A;  2KOI A;  5AQB A;  1TS0 A;  2J80 A;  5GLD A;  2P9V B;  3K3D A;  1A0K A;  1TEM A;  5K5B A;  4I39 A;  3ZVT A;  3PBO A;  5CEC A;  5CX7 A;  3TE8 A;  1ZC2 A;  1OTA A;  2VGL M;  4FSF A;  4E3I A;  2J7V A;  4WEK A;  3UB9 A;  4Z9Q A;  3LEQ A;  1F98 A;  2W0N A;  5CHM A;  3W4O A;  3IF6 B;  2XLN A;  3PTE A;  4DJ2 A;  4E6W A;  4PM8 A;  2XD1 A;  2WKI A;  3VOY A;  3WRT A;  2V2F F;  4N9L A;  1XP4 A;  4BL3 A;  5EV0 A;  4ARZ B;  2BTF P;  1XJ3 A;  3FKV A;  1W7F A;  5EM1 A;  3MSH A;  4QY6 A;  4DDS A;  1PWC A;  2G7U A;  3ZQ5 A;  1KVM A;  3LGO A;  2JKT M;  4PKY A;  2WKE A;  5GHX A;  3L7H A;  3VFF A;  4R1G A;  2OWJ A;  1JVJ A;  5F82 A;  1MKI A;  3P7N A;  3B3X A;  3ZYT A;  3B47 A;  3HLF A;  2GNX A;  3OC2 A;  2ZOI A;  3GR2 A;  1S6R A;  5DJT A;  1KE3 A;  1KE0 A;  2B95 A;  3CWF A;  3DTE A;  5KZH A;  3UDF A;  2ZBB A;  1D7E A;  4WF0 A;  3N7W A;  4EEP A;  4LFU A;  1VB6 A;  3TRC A;  2VLG A;  5C5K A;  3SS3 A;  2Q0O A;  1IFQ A;  2GX5 A;  2OWH A;  4KG5 A;  3G2Y A;  4EBP A;  5FQQ A;  4DRT A;  1TF1 A;  1I2S A;  3HUM A;  4L9F A;  4KG2 A;  4OON A;  1O07 A;  4KEN B;  4F3L B;  3ZNY A;  1N9L A;  4RX2 A;  2ZOH A;  5EEC A;  3IWQ A;  3BW6 A;  4NET A;  3MMH A;  2JCH A;  1XFN A;  5J4E A;  1NLZ A;  1U60 A;  1YMX A;  1VQQ A;  2OOL A;  1N4O A;  3E98 A;  3OPR A;  4PMA A;  3FPW A;  4EU0 A;  1T18 A;  4CLC C;  4IED A;  1I2W A;  1E3U A;  3GRJ A;  2WKP A;  4X69 A;  2ZMA A;  4R6L A;  2ZM0 A;  3ULF A;  2Y2P A;  1DY6 A;  3CG5 A;  2JKG A;  2C5W B;  2B18 A;  4OPY A;  1EWZ A;  2QWS A;  3T4O A;  2P74 A;  1KVL A;  3V3R A;  3HL9 A;  3DW0 A;  1G68 A;  2ZC4 B;  4Y3I A;  5EOO A;  1XX2 A;  4YOF A;  4NXE A;  1MWU A;  4R70 A;  5GHZ A;  3R4K A;  1K55 C;  5GLA A;  4B9O A;  3S7P A;  5CGS A;  2I72 A;  1SCW A;  5J8X A;  1QME A;  2Z2L B;  2HJE A;  2WGI A;  1PW1 A;  1BZA A;  3LIA A;  1BSG A;  2H0T A;  4CQH A;  1K56 D;  1L0E A;  4FOF A;  1F9I A;  1LHY A;  1PW8 A;  1XGJ A;  1SZV A;  2XDM A;  4QB8 A;  3V39 A;  3NBL A;  3UB8 A;  1ERQ A;  4HY8 A;  1STZ A;  4EBN A;  1HD8 A;  2PAV P;  2EWW A;  2HGV A;  3ICY A;  4NXB A;  4JLF A;  1NYY A;  5FDH A;  3OCL A;  4AFI A;  3HLW A;  3GDI A;  4IBR A;  5A92 A;  1V9Y A;  1PZO A;  3W4P A;  3E2L A;  1S1Z A;  4DF6 A;  1K0K A;  1GA0 A;  3NCK A;  4FH2 A;  3NOP C;  3PAG A;  1JNU A;  3FG8 A;  4X1M A;  3TJZ C;  3CUE C;  2P7J A;  3ISG A;  3LY3 A;  3S4X A;  5DJU A;  3CPT B;  3NEC A;  3RTY A;  5FAQ A;  3LIB A;  2VV8 A;  5IT5 A;  1D1J A;  2L4R A;  1RP5 A;  2CMN A;  3Q1F A;  2O9B A;  4BL2 A;  1ESU A;  4UQI S;  3CIT A;  4JF4 A;  1GSX A;  4JGP A;  3IXB A;  4GW9 A;  1NRF A;  2J3T D;  1OPX A;  5HD5 A;  2QHK A;  5EVI A;  2WYX A;  3VE3 A;  4C75 A;  3MKF A;  2K7S A;  3MFD A;  1K25 A;  1LI9 A;  2RCX A;  4ZBE A;  4LV3 A;  4L0L A;  3LR0 A;  4ID4 A;  2HP5 A;  2NUT C;  3FC7 A;  3SZT A;  1FCN A;  1OT9 A;  1K38 A;  3MR0 A;  3IHB A;  1GHM A;  5BOH A;  5G4Z A;  2FZ0 A;  2GDN A;  5HDS A;  3CZD A;  4DE0 A;  3SS4 A;  3S1Y A;  5TR7 A;  2ZC7 A;  3BYD A;  1H3Q A;  3LR5 A;  3UE3 A;  1OME A;  4MBK A;  4DDY A;  1LSX A;  3LUQ A;  3AGD A;  4KQD A;  4PAU A;  4GZB A;  2Q9N A;  3VP1 A;  5HD3 A;  4CLC D;  3T12 B;  2RL3 A;  1IKI A;  3EGD C;  3W4Q A;  3BWL A;  2ACG A;  4NXG A;  4LRX C;  3QP4 A;  3ZCZ A;  4UA7 A;  5CTM A;  4CJN A;  2MJ6 A;  1NYM A;  2PR6 A;  4WZ5 A;  5IS1 A;  1RCJ A;  3OLO A;  4FH4 A;  3F1O A;  2OAP 1;  1ODV A;  3UB6 A;  1G6A A;  4HH2 A;  1LSV A;  2Y2H A;  3ZGA B;  2Y4A A;  3MZE A;  4WYY A;  4JGQ A;  4I5S A;  1ZG4 A;  1T1B A;  2EX6 A;  2P9V A;  2Y55 A;  2KX6 A;  2WAF A;  3JYI A;  4NK3 A;  3C8C A;  4WL9 A;  3QNB A;  4RA7 A;  3ZNT A;  2OAQ 1;  3HUO A;  4RX3 A;  1W8Y A;  4LGW A;  4H6J A;  3IH9 A;  3IBJ A;  2Y2O A;  1ACF A;  4JXW A;  1NLY A;  1OJG A;  4GCZ A;  2VA0 A;  3HCY A;  3HLE A;  1SDN A;  3OBF A;  4E3N A;  2PBY A;  4B4Z A;  4Y13 A;  2QYB A;  3WS1 A;  2W27 A;  3IF6 A;  1XJ2 A;  4OOM A;  4ZTK A;  4G3V A;  5F68 A;  1YLY A;  3LEZ A;  1ES4 A;  3TW8 A;  5HX9 A;  2R9W A;  4S2I A;  4ARZ A;  3LI8 A;  4X25 A;  1CEG A;  3NC8 A;  1BLC A;  1IYQ A;  1MWR A;  1FSY A;  1I5Q A;  3UPP A;  4JF5 A;  1FCM A;  4C6Y A;  4HP9 A;  4LRZ E;  5CED A;  2W1R A;  5EVI B;  4EWF A;  3UB7 A;  3T1X A;  2J3W A;  3E4P A;  5FI2 A;  1S67 L;  1SHV A;  5FSR A;  4RYE A;  1MC0 A;  3LR3 A;  1YKD A;  1IYS A;  4Y7P A;  4R3B A;  4PHT A;  2W3H A;  3Q7V B;  3IBR A;  4HJ6 A;  4HP4 A;  2V0U A;  2UWX A;  4S2L A;  5FI6 A;  2WGV A;  3WS5 A;  2IWD A;  1NZU A;  4S2K A;  1XPB A;  2J8Y A;  2EX2 A;  1C3B A;  2WZZ A;  1IYO A;  4OKP A;  2I9V A;  3BFG A;  3OZH A;  3PYP A;  3T50 A;  3R7W A;  1YQS A;  4K91 A;  4IVK A;  2O0Y A;  5EE8 A;  1W63 Q;  4S2M A;  5FQK A;  2XSS A;  4EQI A;  4HBT A;  1IEM A;  4OPQ A;  3MQO A;  2HP9 A;  2X01 A;  3IX3 A;  3G32 A;  4KQO A;  3WS4 A;  1AXB A;  1L2S A;  1MWT A;  5KSH A;  5G18 A;  1M6K A;  4HQA A;  3VP2 A;  4EV4 A;  3LID A;  1G5U A;  5FAP A;  2Y2N A;  2OSU A;  4EES A;  3LY4 A;  3BLM A;  4S2P A;  1SDE A;  4OQH A;  2R9X A;  4IUH A;  1MPL A;  3F1O B;  1M40 A;  5EM0 A;  4KUO A;  3VP4 A;  5CER A;  2VKS A;  2BAS A;  1CQA A;  1HLU P;  4KQR A;  2ZMF A;  4M3K A;  3GSG A;  2W3F A;  3DTI A;  4ZJ1 A;  1VET A;  3IXG A;  5E43 A;  4MN5 A;  1XJ6 A;  4N92 A;  4H6J B;  5HWV A;  3E4Q A;  4PKY G;  1RGY A;  3IS2 A;  3H82 B;  2XRO A;  2D02 A;  5A8B A;  3EEH A;  1Y28 A;  3QP1 A;  1YLZ A;  1FR6 A;  1NWZ A;  2VGK A;  2O99 A;  3MFX A;  4XT2 B;  3RXW A;  4C3Q A;  3T4Q A;  2XR0 A;  5HZH A;  2WAE A;  4L9E A;  4E3O A;  5L09 A;  5HWT A;  5HPI A;  3I7J A;  3NHQ A;  2EXB A;  3EOI A;  3C4P A;  3MBZ A;  1W5D A;  5AQ9 A;  2V1B A;  4LLO B;  3T1R A;  2V8C A;  3KYE A;  1YM1 A;  3GQZ A;  4E04 A;  1PWG A;  1S66 L;  4O8G A;  3WRZ A;  2QJ5 A;  3IQA A;  3CLO A;  4Q0I A;  2L0W A;  5CHJ A;  1E4D A;  3MXS A;  1J3W A;  5F5Y A;  3L9K A;  4WZ5 C;  3LIC A;  5I94 A;  4GN2 A;  2OV5 A;  3G4P A;  5F6A A;  3ZVW A;  1BUE A;  5A93 A;  4QY5 A;  1UWP X;  3MXR A;  3Q7Z A;  5FQI A;  3A3D A;  4OQ0 A;  4KZA A;  4X56 A;  2OLU A;  2PRF A;  3R7W B;  2J9P A;  3PXP A;  3CPT A;  2X71 A;  2C6W B;  3SH9 A;  2NUP C;  1N9N A;  3LYX A;  1ZTU A;  2WZX A;  5DKL A;  1RGZ A;  5J3W A;  1DJB A;  3N8R A;  5FI7 A;  1YT4 A;  1JWV A;  5AQA A;  2XRN A;  2ZQA A;  3E2K A;  4U0X A;  2QKP A;  1MY8 A;  3VP3 A;  4UEY A;  1KDW A;  3JPU A;  2ZJ9 A;  4I38 A;  3O88 A;  3IF6 C;  4U3T A;  1H5X A;  2ZD8 A;  1GA9 A;  4Y2F A;  2VGJ A;  3UDX A;  5U47 A;  5E2E A;  3M6H A;  5MC7 A; 
#chains in the Genus database with same CATH homology
 4GW9 A;  2Y8H A;  3UE6 A;  2J3T D;  5DFY A;  1T19 A;  1OPX A;  4KUK A;  2M7U A;  5HD5 A;  2QHK A;  3OOV A;  3EEA A;  4WEJ A;  3T4K A;  4NEE D;  3E0Y A;  3KX0 X;  3VE3 A;  3H7W A;  2K7S A;  4QPR A;  4G3K A;  1IOU A;  4Z1W A;  2V0W A;  3EGX C;  4L0L A;  5DFX A;  4MDZ A;  1S4R A;  3IS2 B;  2W1T A;  3LR0 A;  4LRY C;  2EA9 A;  2NUT C;  3OCN A;  5HL6 A;  3FC7 A;  4WN5 A;  4P6Z S;  4GS9 B;  1OT9 A;  3MR0 A;  2PD8 A;  4NXF A;  4Q0H A;  4O01 A;  5AJG A;  5G4Z A;  2FZ0 A;  5HDS A;  4UQI M;  5EFW A;  4GHI A;  3RH8 B;  5F69 A;  1TS7 A;  1YAX A;  2PD7 A;  2VV6 A;  4MMN A;  5AVE A;  4R38 A;  1H3Q A;  3LR5 A;  3UE3 A;  1WA9 A;  3NJA A;  3P01 A;  1LSX A;  4CLC B;  3BQA A;  3UMD A;  3LUQ A;  4HHD A;  1H8M A;  4KQD A;  4PAU A;  1VHM A;  2VV7 A;  5HD3 A;  4B93 A;  4CLC D;  3BY8 A;  3S7O A;  3W2Z A;  1DP6 A;  3EGD C;  3BWL A;  4IJG A;  2XA7 M;  2B02 A;  1TD5 A;  3FPV A;  3O5Y A;  4NXG A;  3EQU A;  4GHI B;  3A0S A;  4LRX C;  4EEU A;  1UWN X;  3F1P A;  2Z6C A;  2W3E A;  1S1Y A;  3MXQ A;  4YWZ A;  4P6Z M;  2MJ6 A;  5FL3 A;  2PR6 A;  5IS1 A;  4JGP A;  1XJ4 A;  3OLO A;  1NRJ A;  3K2N A;  1DP8 A;  3F1O A;  1TS8 A;  2OAP 1;  1ODV A;  2P04 A;  3UB6 A;  2HJ9 C;  1BYW A;  4DN0 A;  1G6O A;  4HH2 A;  1LSV A;  2J3T C;  4HOI A;  3LIF A;  2PDR A;  4F3L A;  1GSW A;  4JGQ A;  4WLA A;  3KSF A;  4I5S A;  1T1B A;  1ZHH B;  4IUK A;  2O9C A;  1N9O A;  3PBS A;  1G28 A;  2R78 A;  3S7Q A;  2KX6 A;  2JN7 A;  3C8C A;  4WL9 A;  2PR5 A;  3H9W A;  4BJP A;  2OAQ 1;  5LBR A;  4EW7 A;  4H6J A;  3IBJ A;  5TBM A;  1UGU A;  2O9A A;  3NOT C;  3PBQ A;  1NLY A;  1OJG A;  4GCZ A;  3VV4 A;  5KIZ A;  2JKR I;  2P08 A;  2KOI A;  2VA0 A;  3HCY A;  1TS0 A;  3UME A;  4IHQ A;  1KOU A;  2J80 A;  2EWV A;  3OBF A;  3KSH A;  3K3C A;  4ETZ A;  3BJN A;  5G4Y A;  4Y5F A;  2QYB A;  3K3D A;  2W27 A;  2FH5 A;  1XJ2 A;  4OOM A;  5K5B A;  4I39 A;  4DJ3 A;  3PBO A;  4Q0J A;  4G3V A;  5CX7 A;  3TE8 A;  5F68 A;  5TBM B;  1OTA A;  2VGL M;  2XA7 S;  3BQ8 A;  4FSF A;  5DKK A;  4WEK A;  3TW8 A;  3UB9 A;  4ARZ A;  3LI8 A;  1F98 A;  2M7V A;  4BMW A;  2W0N A;  4HP9 A;  4LRZ E;  3NOU C;  4JGO A;  2W1R A;  3EWK A;  4NKP A;  1OT6 A;  3KYQ A;  3UB7 A;  3A0R A;  2J3W A;  3E4P A;  4ME4 A;  4DJ2 A;  1S67 L;  3KYZ A;  4BBV A;  3H7W B;  3B33 A;  1MC0 A;  3LR3 A;  5HSQ A;  1YKD A;  4II7 A;  5IU1 A;  4HI4 A;  4DMZ A;  4PHT A;  2W3H A;  2W1T B;  4ARZ B;  3IBR A;  1DRM A;  1XJ3 A;  1XFQ A;  4BBT A;  4HJ6 A;  4HP4 A;  2V0U A;  4G3W A;  2K2N A;  3CI6 A;  5DF9 A;  3C38 A;  3VE4 A;  2G7U A;  1OTE A;  3ZQ5 A;  5HPF A;  2KLI A;  2JKT M;  3D3O A;  4PKY A;  2YKH A;  3JVV A;  2OWJ A;  2I9V A;  4GLQ A;  3F1N A;  3P7N A;  3PYP A;  3T50 A;  4GJ4 A;  3ZYT A;  2WKQ A;  3B47 A;  3R7W A;  5TJJ A;  2Y79 A;  4HIA A;  2O0Y A;  1W63 Q;  2GNX A;  3OC2 A;  2JKR M;  2ZOI A;  2XSS A;  5DJT A;  1F5M A;  4HNB A;  3EQV A;  4BWI A;  3LFV A;  3MQO A;  4ETX A;  2Z6D A;  2JHE A;  3CWF A;  2YKF A;  2ZBB A;  1D7E A;  4KQO A;  3G6O A;  4WF0 A;  3F1N B;  5KSH A;  4EEP A;  1OTB A;  2VGL S;  4HQA A;  4OOL A;  1VB6 A;  3F1P B;  3LID A;  3TRC A;  2VLG A;  5C5K A;  4BBU A;  1IFQ A;  2GX5 A;  2OWH A;  1P97 A;  3U2A A;  2JKT I;  4EES A;  4EET B;  1TF1 A;  2HV1 A;  2ZMV A;  2V9A A;  3D72 A;  4IUH A;  3F1O B;  2M1C A;  3PR6 A;  3JVU A;  1DP9 A;  4R3A A;  4L9F A;  4KUO A;  2VKS A;  4MN6 A;  2BAS A;  2A2L A;  3PBR A;  3H82 A;  3E4O A;  1P9R A;  2WKR A;  4F3L B;  1MKM A;  3LR4 A;  3T4S A;  2ZMF A;  1N9L A;  2W3F A;  4LPZ A;  2ZOH A;  4EQ1 A;  4L9G A;  4YNR A;  3BW6 A;  5I5L A;  3MMH A;  4MN5 A;  1XFN A;  1XJ6 A;  5J4E A;  1NLZ A;  2GZA A;  3LI9 A;  2H28 A;  2HF6 A;  4H6J B;  4XT2 A;  1LT0 A;  1EW0 A;  2OOL A;  2GJ3 A;  5HWV A;  4M4X A;  3E98 A;  1D06 A;  3KSI A;  2PT7 A;  3E4Q A;  4PKY G;  3IS2 A;  3H82 B;  2XRO A;  2D02 A;  5A8B A;  3EEH A;  1Y28 A;  3RFB A;  3FPW A;  4EU0 A;  1W63 M;  4K08 A;  1T18 A;  4CLC C;  4GS9 A;  2WKP A;  1OTD A;  4I3I A;  3MQ0 A;  2PYP A;  1NWZ A;  4R6L A;  3T4J A;  3PBN A;  3ULF A;  1LSW A;  3A0V A;  2O99 A;  1OJ5 A;  1GSV A;  3MFX A;  4EER A;  3CAX A;  4XT2 B;  2VX8 A;  2B18 A;  3T4Q A;  2QWS A;  3T4O A;  5HZH A;  2LB5 A;  4L9E A;  5HDD A;  5HWT A;  1P9W A;  4HH3 A;  2INW A;  4CLC A;  5HPI A;  1LL8 A;  1T1A A;  2KDK A;  3NHQ A;  3EOI A;  3HJK A;  1YSP A;  4Y3I A;  2V1B A;  4LLO B;  3BY9 A;  5HWW A;  4YOF A;  3DBA A;  4NXE A;  3KO6 A;  4E04 A;  1YSQ A;  4R70 A;  1S66 L;  4O8G A;  3PBT A;  3R4K A;  4B9O A;  3B42 A;  2QJ5 A;  3S7P A;  3T4L A;  3CLO A;  4Q0I A;  2L0W A;  2HJE A;  4O0P A;  3KSG A;  3LIA A;  5F5Y A;  2L1M A;  3PHY A;  1MZU A;  3LIC A;  4CQH A;  2A24 A;  4RQ9 A;  3MQQ A;  2V1A A;  2DMW A;  2QJ7 A;  4I3A A;  5F6A A;  4FOF A;  1F9I A;  4HJ4 A;  2PHY A;  1TS6 A;  1UWP X;  4EXO A;  3HJI A;  3C30 A;  1X0O A;  3UB8 A;  5HDC A;  4HY8 A;  1STZ A;  3MJQ A;  4I3J A;  3T4T A;  2LB9 A;  3C2W A;  3R7W B;  3PXP A;  2EWW A;  2VEA A;  2HGV A;  3ICY A;  4NXB A;  4ZRR A;  3VOL A;  2VJW A;  4AFI A;  3OCL A;  4EUV A;  2IA2 A;  4MCW A;  4CLC E;  2VZW A;  1T1C A;  2A24 B;  3GDI A;  1N9N A;  2PYR A;  3LYX A;  2NUP C;  1ZTU A;  1V9Y A;  5DKL A;  3MF0 A;  2D01 A;  1S1Z A;  2W3G A;  1P0Z A;  3V67 A;  3GEC A;  5J3W A;  5J7E A;  3NOP C;  4JGR A;  2W3D A;  1JNU A;  2XRN A;  3FG8 A;  3TJZ C;  3CUE C;  4WEL A;  2P7J A;  2QKP A;  5L8M A;  5DJU A;  3SW1 A;  4UEY A;  4I38 A;  3RTY A;  1S4S A;  5AVF A;  3LIB A;  1OTI A;  2K31 A;  2VV8 A;  5IT5 A;  2L4R A;  2CMN A;  3LIE A;  4WUJ A;  4MN7 A;  4Y2F A;  2O9B A;  3S7N A;  3CUE A;  4HJ3 A;  4UQI S;  3CIT A;  5MC7 A;  1GSX A;  1V9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...