2B02A

Crystal structure of arnt pas-b domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
111
structure length
111
Chain Sequence
MSNVSQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Crystal Structure and Binding Properties of ARNT PAS-B Heterodimerization Domain
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 34
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2b02A01
3VE4A 2HV1A 4GHIB 1DP9A 4I39A 2W0NA 1OT9A 3VE3A 1GSWA 1D7EA 2QJ5A 2QHKA 5F68A 3LIAA 4HH3A 4I5SA 1UWNX 3UB7A 2PR5A 1WA9A 1T19A 4EESA 4BBVA 4JGOA 2ZOIA 1LL8A 1G28A 2PHYA 4HNBA 4HP9A 1JNUA 3K3CA 4WL9A 4WLAA 1D06A 1XJ4A 3P7NA 3ZQ5A 2V9AA 2YKFA 3H82A 4XT2B 4JGRA 1V9YA 3BWLA 4HI4A 2GJ3A 3KX0X 2VLGA 3OLOA 4H6JB 5HWVA 1MZUA 1TS7A 2D01A 3F1OA 3VOLA 4JGPA 4HP4A 4R70A 2L4RA 2KX6A 4HOIA 4I3JA 5AVEA 4BBUA 1P0ZA 4F3LA 5TBMA 4GCZA 3IBRA 3UMDA 2PD7A 5AVFA 1S66L 2H28A 4EEPA 3LIEA 1N9OA 1OTDA 3C8CA 5J4EA 4NXFA 4M4XA 3A0SA 3H7WA 4LRZE 4WUJA 2JHEA 1DP8A 3T50A 3SW1A 4HJ4A 2KDKA 1XFQA 3NOUC 2PR6A 2PD8A 3LIDA 1NWZA 3H82B 2PDRA 5F5YA 3MR0A 4HJ3A 2V0WA 3A0VA 4HJ6A 2V1AA 1P97A 4EQ1A 5HDCA 4LRXC 2W27A 5G4YA 3F1NB 2PYPA 1OT6A 3GECA 3C2WA 3F1OB 1EW0A 3NOPC 3FC7A 3B33A 4EXOA 4R3AA 3CLOA 5KIZA 2WKPA 3UB9A 1GSXA 4F3LB 1ODVA 5DJUA 4LLOB 5TBMB 2A24A 4I3AA 2VV7A 2ZOHA 4PKYA 2J80A 1UWPX 2Z6DA 3MQOA 3D72A 1S1ZA 3F1PA 1KOUA 4HHDA 5G4ZA 1DP6A 3E4PA 3RH8B 4PKYG 4EERA 3H7WB 4KQDA 1GSVA 4R38A 5I5LA 1X0OA 3LI9A 1F9IA 5DKKA 2OOLA 1TS6A 4KUOA 3CAXA 5HWTA 3NJAA 3RTYA 3HJKA 3EWKA 1LSVA 1BYWA 1F98A 1OTBA 4NXBA 1S4RA 3A0RA 2WKQA 5IU1A 3LUQA 2VEAA 1XJ6A 2M1CA 1S1YA 2JN7A 5DJTA 4EEUA 3UMEA 3HJIA 4LRYC 1T1BA 3PYPA 3MFXA 3IS2A 2VV6A 4MN5A 3UB8A 3LIFA 2OWHA 3ULFA 5HD3A 2Z6CA 4KUKA 4BBTA 2BASA 2PYRA 3BY9A 5IS1A 3GDIA 4HIAA 2I9VA 4B9OA 2QWSA 2WKRA 5A8BA 5HDDA 1T18A 5J7EA 2A24B 3LICA 1V9ZA 1LSWA 3LI8A 1N9NA 3K3DA 1XFNA 2L1MA 4L9GA 4MN6A 4DJ3A 3F1PB 4GW9A 3H9WA 4L9EA 3LYXA 2INWA 5F69A 3NHQA 3EEHA 3FG8A 2D02A 1S4SA 3CWFA 2V1BA 2V0UA 1T1AA 1XJ2A 1UGUA 1N9LA 5J3WA 4RQ9A 2VV8A 2QKPA 1S67L 5HSQA 1VB6A 2B02A 2QJ7A 3IS2B 4GS9A 3E4QA 2EA9A 4HH2A 5DKLA 4I38A 2R78A 4EW7A 1DRMA 4GHIA 3MQQA 3UB6A 4WN5A 1T1CA 3ICYA 2K7SA 4JGQA 2L0WA 3NOTC 4I3IA 1Y28A 4LPZA 4YWZA 3LIBA 3E4OA 5EFWA 4DJ2A 3F1NA 1OJGA 2P7JA 2YKHA 2CMNA 5F6AA 3PHYA 4WF0A 5HWWA 3MJQA 4E04A 1TS8A 3MXQA 4XT2A 1LT0A 5HDSA 4HQAA 2OWJA 2ZBBA 1OTEA 1OTAA 4EETB 1OJ5A 1TS0A 5HZHA 4H6JA 3UE6A 4GS9B 3G6OA 4NXGA 1OTIA 4NXEA 4R6LA 4L9FA 5HD5A 1XJ3A 3BY8A 1LSXA 4K08A 4HY8A
chains in the Genus database with same CATH superfamily
2HV1A 5F83A 3WS5A 4GHIB 1E3UA 4KG2A 5MC7A 1HZOA 5HL6A 1D7EA 2QJ5A 1K56D 3IF6B 2QHKA 2Y55A 5F68A 1FCMA 1LL9A 3FYZA 1SZVA 3G35A 4EU0A 4EESA 5CGXA 1LHYA 2NUTC 4P6BA 1LL8A 3RXWA 2E8IA 2EFUA 3V3SA 4S2JA 4WLAA 3V39A 2NUPC 1CI9A 1KGGA 4CPKA 4E3IA 2WGWB 2YKFA 3H82A 3S22A 3EEAA 2XFTA 4HI4A 2HGVA 3HLWA 2GJ3A 3ZFZA 3IF5A 1NXYA 3SS3A 3MS6A 1LI9A 4DE1A 5HWVA 1LI0A 1MZUA 1CI8A 1YLPA 4Y3IA 1XP4A 5DF9A 3ZVTA 1BSGA 3BQ8A 2V1ZA 4UAAA 1K54C 4U3TA 5EVIA 3UMDA 5M1AA 4DE2A 2Y2GA 1S66L 4F94A 3UE0A 3ZGAB 3KSFA 4R4SA 4OQHA 4M4XA 4JBFA 3H7WA 4P6ZM 5AJGA 2M7VA 2EWWA 4FH2A 2V8CA 4JPMA 4LRZE 1YLYA 3V5MA 2QMIA 1ESUA 3DBAA 3T50A 2OLVA 1SKOA 3C4OA 1FR6A 3SW1A 1FSWA 4GN2A 3WRZA 4HJ4A 1U60A 5E2FA 5AQBA 1FCNA 4LCMA 4C3QA 3HUNA 4KZBA 2PDRA 1YSQA 2HP9A 1NYMA 1GHPA 1MC0A 3Q81A 3A0VA 1ERQA 3NI9A 5AQ9A 4OH0A 3VP1A 4MEZA 4IUHA 5FAOA 3UY6A 4EQ1A 2O0YA 4BJPA 5DTTA 2ZMVA 3B33A 4EXOA 3G34A 3IWQA 2XSSA 1PYYA 4Q0JA 3NY4A 3TW8A 4F3LB 5TBMB 4LLOB 3OPPA 2X02A 4O7DA 4I3AA 4CLCB 3OZHA 4UHUA 3PAEA 3BRMA 3O3VA 1PWGA 2Y59A 3MQOA 3D72A 1S1ZA 3TOIA 2O9CA 3BFFA 5EV0A 1IELA 4P85A 3DTKA 2WKEA 1K55A 5CTNA 4JKTA 1TS6A 2HP6A 5IHVA 3GRJA 4CLCD 4HBUA 4PAUA 1LSVA 3MZFA 1F98A 3S7PA 4GB7A 3IWOA 1S1YA 2RL3A 2Y8HA 4O8GA 4LCLA 5GLBA 3IX4A 1MKIA 1E4DA 2OAP1 3PYPA 3MFXA 3OBFA 3LIFA 5HD3A 1YM1A 1TDGA 4JXWA 4BBTA 2BASA 2PYRA 1Y54A 4FTXA 3GDIA 1SDEA 2G7UA 2QWSA 3IF6C 5A8BA 1I2SA 4BMWA 4P87A 5HPIA 2JKGA 3KYQA 1ZHHB 3M2JA 4Q0IA 4OQ0A 3HREA 2WGVA 3C7VA 1N9NA 2X01A 2XD5A 3MXSA 3SS5A 1LLBA 3H9WA 2GX5A 3M2KA 4Q8IA 4DDSA 4R0QA 3LYXA 5TGFA 4ESPA 1YPRA 3NHQA 2PAVP 2ZJ9A 2ACGA 1UGUA 1CK3A 2VGLM 3ZG9B 1J3WA 2ZQCA 5DF7A 2EX9A 4BD0A 1N9LA 3BECA 3LY3A 3HLDA 3IH8A 1Z6FA 4R3BA 4RQ9A 5L09A 2VV8A 2QPNA 5DFYA 3HLCA 2B02A 2QJ7A 3IS2B 3WRTA 3N7WA 4LENA 3T1RA 1P9RA 2Y2MA 3IXHA 2H10A 2Y2IA 4CLCE 4NETA 1W8YA 1DRMA 2B18A 3CUEA 1BLSA 1WYBA 1MBLA 3UB6A 4K91A 1NRFA 2ZMAA 2R9XA 1EI5A 3ICYA 2L0WA 4KG6A 1VQQA 3LIBA 5EFWA 4XUXA 4MN7A 3ZYTA 4DJ2A 5E2GA 4KZ4A 2PU4A 1OJGA 2P7JA 3MFDA 4PM5A 4S2MA 4R3JA 2CMNA 2UWXA 3IXDA 2PU2A 4H8RA 3ZNTA 3T1SA 5GHZA 4WM9A 2HDSA 3BFEA 2WZZA 1XKZA 5KSCA 4RX2A 1DJAA 2J9PA 2WAEA 3C30A 3MJQA 4E04A 1L2SA 1OTEA 1OTAA 4Q0HA 4UA7A 1BZAA 3FZCA 1OJ5A 2WKHA 3BFCA 2J3TD 2HP5A 2XGNA 4ZJ1A 4IHQA 5CHUA 3PBRA 3HUOA 3UPPA 3N6IA 5EECA 5DF8A 4BD1A 2ZM2A 5J8XA 4CLCC 1XJ3A 3BY8A 1LSXA 4X56A 3OPHA 4K0XA 3UPNA 1OT9A 3VE3A 1GSWA 4FSFA 3BLMA 1MPLA 3MF0A 2HF6A 4WYYA 3IX3A 4E3MA 4YOFA 4B4ZA 3QHYA 4FUWA 5FQ9A 1NY0A 4LV2A 2PHYA 4OLGA 4DN0A 4Z1WA 1D06A 1XJ4A 4DRTA 5GLAA 3MZDA 3P7NA 4Z9QA 1W5DA 4UQIS 2C5WB 3UDXA 1ONGA 4IBRA 4Y15A 3NC8A 3ZQ5A 3QP6A 3DWZA 4UEYA 3R7WA 1EWZA 1NJ4A 4JGRA 1F5MA 1V9YA 3KSGA 3HVFA 2BTFP 2OLUA 1PI5A 3VP0A 5CHMA 1MWRA 3KX0X 1ZG6A 4WMCA 4WZ5C 3HLGA 4ETZA 4H6JB 4CJNA 2FH5A 1TS7A 3IHAA 2W3HA 2D01A 3F1OA 1H8MA 1FQGA 3SOIA 1NYYA 2IA2A 3QP1A 4I3JA 1KE4A 4BBUA 2IWCA 3IQAA 4GCZA 2PD7A 5AVFA 3AGEA 1IYOA 5EVEA 3C4PA 1ZC2A 2Z2LB 3EQVA 3LIEA 1Y4OA 3C8CA 3ISGA 2ZC6B 3UE1A 5IT5A 3C5AA 2P08A 2J8YA 1TEMA 2XEPA 5CEDA 2B5RA 2XA7M 3EQUA 1S6RA 5FQJA 2Y2PA 4QJGA 2O9BA 3A3IA 1NWZA 5TFQA 5F5YA 2V0WA 4PMAA 3WWXA 4HJ6A 3DTMA 5F1GA 2XLNA 2VZWA 2PYPA 1OT6A 3C2WA 2W1TB 2ZQDA 3W4QA 2ZQ7A 5KIZA 2WKPA 4WEJA 1MKMA 3GSGA 3UB9A 5KZHA 3HLFA 5DJUA 1PZOA 2A24A 2OSUA 3VP3A 3DAVA 2Z6DA 3N8SA 1AWIA 1K54A 3TJZC 4N1XA 3O87A 2CC1A 2J3TC 5FDHA 1KOUA 3VFFA 5EM0A 4PPRA 3RH8B 4KQDA 2BG1A 1VEUA 5AQAA 4R38A 1GCEA 5FQIA 3LI9A 4ID4A 1MWSA 4MBKA 3LEQA 2OOLA 2J9OA 1OPXA 4KUOA 2XRNA 3CAXA 3NJAA 1L0GA 5GLCA 1BTLA 3KSIA 1YT4A 4E3LA 4KZ6A 1IKIA 3ZVWA 1OTBA 1ESIA 3T1XA 2WKQA 4OKPA 5IU1A 1YKDA 4B4XA 2Q9MA 2JN7A 2ZQ9A 1K4FA 1XGJA 3UMEA 4QY6A 4OVDA 2W3GA 5E43A 3QNBA 3ZG7B 3OPRA 2DRWA 3UB5P 3WS2A 3FPVA 3VP4A 4OP8A 4MBFA 4DXCA 5GHXA 4GZBA 2DCFA 4HIAA 2I9VA 4FOFA 1K38A 4XUZA 4Y17A 3KSHA 2JKTI 2PBYA 1L0FA 1T18A 3KYEA 1V9ZA 2V8FA 1PIOA 4ARZA 2ZM8A 4MN6A 3VV4A 2ZC7A 3F1PB 5BOHA 3L9KA 4GW9A 3BM6A 5CEBA 4L9EA 4JF5A 3E98A 3KO6A 3HL9A 5A92A 1KGFA 4Y13A 1E25A 2RCXA 3C7UA 1K57C 1T1AA 1DJBA 1ZKJA 2H0YA 4GDBA 2VGKA 3FPWA 4R4RA 3E0YA 5CRFA 3CPTB 3G2ZA 4IVIA 2P04A 4MMNA 4E3KA 3W2ZA 1K56A 2QKPA 5A91A 5HSQA 3HUMA 1H0MA 3PBQA 4X53A 2XDMA 4EQIA 3B3XA 4X25A 3MZEA 5DKLA 3PBNA 2R78A 3ITAA 1XXMA 3V3RA 3S4XA 2ZL1B 1QMFA 4GHIA 1YQSA 3JVUA 4WN5A 2JE5A 4HBTA 1T1CA 3P01A 3OOVA 4JGQA 3IF6A 5L8MA 2B95A 3NOTC 4I3IA 4IBXA 4ME4A 2DMWA 3GV9A 3E4OA 1XGIA 2HDUA 2XQZA 1FOFA 2Y4AA 5DTSA 5GLDA 3MSHA 5HAQA 3M6HA 4D2OA 2ZMFA 2Q9NA 3G31A 1HLUP 2VGJA 4Y2FA 4WEKA 3R4KA 3OC2A 1IYQA 2JKFA 4DE0A 4RVAA 1SCWA 4KZ7A 5HWWA 3P09A 4R1GA 2WGWA 1H8ZA 3MXQA 2EX2A 2HJ9C 4Y0TA 2H5SA 4OOYA 2PT7A 1YAXA 5CGWA 5DVAA 2WZXA 2HZ5A 2G2WA 4GS9B 1TVFA 5K5BA 1ES5A 3T4JA 2Y91A 4E6XA 4L9FA 5FI6A 1STZA 2P9VB 5HD5A 4KQOA 4HY8A 1PNEA 1Q2QA 3CI6A 3PBTA 1DP9A 5EOOA 3ZG8B 4QWOA 3D3OA 3LGOA 2A49A 1G68A 4E3OA 3PTEA 1KE3A 4E6WA 1FCOA 5DFXA 4HH3A 4I5SA 3Q1FA 3BW6A 1WA9A 2VGLS 3GMWA 1T19A 3QP2A 1I5QA 4BBVA 4JGOA 2ZOIA 5FEGA 4IJGA 3W4OA 5HAPA 3KYZA 4HP9A 3VFHA 1ZTUA 1JTDA 1CEGA 2AVXA 3PR6A 1EROA 1BLPA 4E3JA 4R23A 3B42A 4N9LA 3LFVA 2Y2QA 4XT2B 4S2NC 3UN7A 3BWLA 3T4QA 1JTGA 2HDQA 3A3JA 5FAQA 1L0DA 2Q0OA 2VLGA 1BUEA 1KDWA 5KSHA 1S0WA 4KZ9A 3WS4A 3BFDA 3VOLA 4UA9A 4JGPA 4R70A 2WADA 2L4RA 2KX6A 4S2OA 4HOIA 3DWKA 4JLFA 1K25A 2V2FF 3VP2A 4NKPA 5AVEA 1FR1A 3RJUA 4C75A 4F3LA 5TBMA 4CLCA 4G3KA 2PBDP 3IBRA 1PWCA 1ES2A 4G3WA 3CMZA 2H28A 4P0MA 4EEPA 2ZLYA 1OTDA 1IKGA 4N92A 3BEBA 3CUEC 3WS0A 3ZG0A 1W63M 1J9MA 1K0KA 3FWLA 1RGZA 4X1LA 2H0TA 4WUJA 1WYCA 1K6RA 2JHEA 2O99A 1DP8A 3C38A 2WUQA 1E3UD 4Y7PA 4N9KA 3HCYA 4C6YA 1M40A 4IEDA 2KDKA 2Y2KA 1XFQA 3NOUC 5HFOA 1GA9A 3ZCZA 3H82B 4U0TA 4NK3A 1PFLA 3NECA 4HJ3A 4LV3A 1ACFA 2I72A 1ZG4A 3TE8A 5HDCA 1Z09A 3QP4A 2W27A 3TG9A 5G4YA 3F1NB 4XXRA 3QNCA 1YSPA 1IEMA 1EW0A 3NOPC 4JXGA 3GQZA 4WZ5A 3FC7A 4MBHA 1YMSA 2J3WA 3CLOA 1CF0A 4KG5A 5HAIA 3BFGA 1GSXA 1KGEA 3V67A 4OQIA 3UE3A 5HX9A 1ODVA 5TJJA 1KVLA 2VV7A 5EVIB 2W3DA 2ZOHA 1UWPX 3IX8A 2JC7A 2JCHA 4EV4A 1CQAA 4X69A 2PRFA 1DJCA 4KZAA 2C6WB 1LL5A 3E4PA 2G2UA 4PKYG 3H7WB 2FZ0A 3NBLA 3NDEA 2M7UA 1X0OA 5E2HA 5U47A 1F9IA 5DKKA 3W8KA 3Q7VB 4KZ3A 3S7OA 5HWTA 3PAGA 3RTYA 2XK1A 3NULA 1SKOB 4DF6A 3EWKA 3FV7A 2K31A 2Z2MB 3D4FA 1S4RA 3A0RA 2GNXA 4OLDA 1K4EA 1TF1A 2HJEA 2ZC5B 3B47A 2KOIA 4B93A 1N9BA 3VSKA 2OAQ1 3HJIA 4BLMA 5A90A 4O0PA 1H8YA 3IS2A 3Q7ZA 2VV6A 3N8LA 2Y2LA 4QB8A 1VM1A 5LBRA 3S7QA 4KQQA 4G3VA 3ULFA 2P74A 2MJ6A 5EPHA 1M6KA 4BL2A 5JYPA 5FA7A 3JPUA 2W3EA 3BY9A 3QP5A 2ZC4B 2HDRA 4B9OA 1BULA 5F1FA 4MLLA 1SKFA 3AGDA 1VHMA 4BENA 5J7EA 1N4OA 4S2LA 3LICA 2KLIA 3QP8A 1RGYA 4X68A 1A0KA 3LI8A 1YLJA 3K3DA 1D1JA 2L1MA 4DJ3A 4AFIA 1W79A 4FCFA 4IUKA 4ZJ3A 3RXXA 4L0LA 3Q82A 2WYXA 4IVKA 5F69A 5EUAA 3EEHA 3FG8A 2QYBA 4ZJ2A 3T4SA 1HD8A 1S4SA 2V1BA 2ZM0A 2V0UA 4ZRRA 3LR0A 3M6BA 1O07A 1XJ2A 4OONA 3TSGA 3G4PA 4JXVA 3OCNA 1YLWA 4UA6A 4X6TA 4O01A 4DDYA 1XX2A 4WBGA 1S67L 3GVBA 2XROA 2LB5A 3G2YA 3E4QA 3IBJA 5EE8A 2WAFA 4HH2A 1H5XA 2DNSA 2FFYA 2Y2JA 4DE3A 3A3DA 3EOIA 4NG2A 5FQKA 5EOEA 3U2AA 1ALQA 1ONHA 5CERA 3MQQA 2R9WA 4M3KA 3MXRA 3EGXC 4KENB 2XD1A 4KQRA 4K0WA 5CECA 4DMZA 5CTMA 1K6SA 4GDNA 4YWZA 3CITA 3MKEA 3F1NA 3CG5A 5M19A 5FASA 3LY4A 2ZQ8A 4YFMA 4GD6A 3IH9A 1KE0A 2YKHA 4YINA 3JVVA 2VJWA 3BQAA 5KMWA 3BYDA 1RCJA 4S2KA 5C5KA 1NZUA 3G30A 3N8RA 3GTCA 4WF0A 4EWFA 3T4TA 1G5UA 1XPBA 1K57A 1TS8A 2GZAA 1XA7A 4RYEA 1LT0A 4P6ZS 5FI7A 4HQAA 1FIKA 3N4IA 2XFSA 5HARA 3VSLA 3LEZA 1NZOA 4H6JA 3WS1A 3G6OA 4NXGA 3Q07A 3Q7VA 1PW1A 3O5YA 3P98A 4QPRA 3CJMA 3LR5A 4ZTKA 2XF3A 5EVIC 4JXSA 5FEFA 3VE4A 2W1RA 4PM7A 2GDNA 4I39A 3K2NA 2W0NA 1NLZA 2V20A 4QY5A 4RX3A 4MDZA 2JKRI 1F2KA 3IHBA 3LIAA 1MY8A 3LCEA 2UV0E 3NCKA 3PXPA 1UWNX 5FQMA 3UB7A 2PR5A 4II7A 1C3BA 4MCWA 4ZAMA 4Y0OA 5CGSA 1Q2PA 1MWTA 1G28A 2VA0A 4HNBA 1JNUA 3K3CA 2EX8A 4WL9A 2XR0A 3PBOA 3D9YA 3NDGA 3VOYA 5L2FA 2V9AA 5TR7A 3ZG5A 4FD8A 2XH9A 4N1HA 4EUZA 4BQMA 5L07A 3A3EA 1ES3A 3VMAA 3HBRA 4QHCA 4DKIA 3OLOA 2IWBA 5E2EA 2A2LA 3RFBA 4YNRA 2W1TA 4HP4A 4OP5A 4OPYA 3E2KA 3GR2A 2WGIA 2QZ6A 1P0ZA 3CZDA 4OPZA 1G6OA 3SZTA 5HPFA 3DTEA 3PBSA 3UPOA 1AXBA 1SDNA 4MNRA 3O88A 4JF6A 1N9OA 1MWUA 3DW0A 3LR4A 5DTKA 1YLTA 3TRCA 5J4EA 1K55C 5A93A 1CEFA 3BLSA 1GHIA 4NXFA 4WZ4A 3LR3A 4ZBEA 1IYPA 4ETXA 3A0SA 4LGWA 2EXAA 4KZ8A 3I7JA 4KZ5A 3O86A 4PM8A 4OPQA 3EGDC 5I94A 1PWDA 3UDIA 1W7FA 2PD8A 2PR6A 3ZHHA 5CHJA 5L10A 1PRQA 3R7WB 3LIDA 3MR0A 4EBNA 3MBZA 1HVBA 1FSYA 5M18A 4Y5FA 2K2NA 4JF4A 1RP5A 1JVJA 1P9WA 4OOLA 2V1AA 1QMEA 4S2NA 1P97A 4LRXC 3GECA 3F1OB 2WKIA 1VETB 3CHWP 4R3AA 4Y0UA 1DY6A 1SHVA 3OPLA 3T4LA 1PI4A 4GJ4A 1BLCA 2OV5A 2JBFA 5FAPA 5FATA 3FKWA 1TD5A 4PM6A 4PKYA 2J80A 5JYOA 1JWVA 2JKTM 3L7HA 4HEFA 3F1PA 3ZNYA 4WMCD 4HHDA 1I2WA 1KVMA 5G4ZA 1DP6A 3UDFA 3G32A 4QU3A 4EERA 1GSVA 5I5LA 5AQ7A 1W8QA 2ZD8A 4X55A 1H3QA 3T1QB 1FILA 2X71A 3SS4A 3HJKA 1BYWA 2E8JA 4EBPA 4NXBA 4GOGA 1ES4A 2O9AA 3CPTA 3LUQA 2VEAA 1XJ6A 2M1CA 4BL3A 5DJTA 1ERMA 4U0XA 3IWIA 4EEUA 4LRYC 1T1BA 2JKRM 3T4KA 2Y2OA 4QD4A 4ZDXA 4MN5A 1GHMA 3V50A 3UB8A 2OWHA 4DXBA 1JWZA 2Z6CA 4KUKA 1NRJA 4RA7A 3MMHA 1YMXA 5IS1A 3IXBA 2ZL1A 4EUVA 4LV0A 2WKRA 5FL3A 1GA0A 1W63Q 3S1YA 2ZC3B 5HDDA 3VOZA 2A24B 5G18A 2EXBA 5CXWA 2EWVA 3SH9A 4A5RA 1LSWA 5EM1A 1XFNA 4L9GA 2IWDA 3IT9A 2ZQAA 2INWA 5FDSA 1VEUB 5EVLA 2D02A 3SH7A 3MQ0A 3JYIA 3CWFA 1TDLA 2BLSA 3SH8A 4BWIA 2VK3A 1G6AA 1NLYA 4CQHA 5FI2A 3T4OA 3UO9A 3DTIA 5D3OA 2WK0A 4LFUA 5J3WA 1OMEA 4GNUA 1BLHA 5HW3A 3U4LP 1VB6A 4UQIM 5GHYA 4GS9A 3AGFA 4E3NA 2EA9A 2Y2HA 4S2PA 4WELA 4I38A 5FSRA 2Y2NA 2P9VA 1CJFA 5HL1A 2A3UA 3IXGA 4EW7A 1O7EA 3LO7A 2EFXA 4LV1A 4X1MA 4B88A 4GKUA 3HLBA 4FH4A 1YLZA 5EVID 3T12B 3E2LA 2K7SA 3UNWA 4D60A 2VKSA 4EBLA 4GLQA 1Y28A 4LPZA 4ARZB 4PM9A 4OOMA 4NEED 2HPBA 1VETA 3BJNA 2J7VA 2W3FA 1L0EA 5GL9A 3ITBA 1KDSA 3ZDJA 1BT5A 1MXOA 5F6AA 3PHYA 1PW8A 3NIAA 2EX6A 1IFQA 5F82A 4HESA 4GD8A 1HTZA 1JWPA 4XT2A 3W4PA 5HDSA 2OWJA 2ZBBA 3OCLA 4OQGA 4EETB 3A3FA 1IYSA 1TS0A 5HZHA 2VX8A 3UE6A 2FFFB 2LB9A 1PZPA 1OTIA 4OPRA 2XA7S 1XA1A 4NXEA 3HLEA 5FQQA 4PHTA 1L3LA 4R6LA 5CX7A 2Y79A 3FKVA 1WE4A 1IOUA 3MKFA 3S7NA 4S2IA 4K08A
chains in the Genus database with same CATH topology
3VE4A 2HV1A 3CI6A 2W1RA 3PBTA 4GHIB 1DP9A 5MC7A 4I39A 3K2NA 2W0NA 1NLZA 1OT9A 3VE3A 1GSWA 3D3OA 5HL6A 1D7EA 2QJ5A 4FSFA 4MDZA 2JKRI 2QHKA 5F68A 3LIAA 3PXPA 3MF0A 4HH3A 4I5SA 5DFXA 2HF6A 1UWNX 3BW6A 3UB7A 2PR5A 4II7A 1WA9A 2VGLS 4EU0A 4MCWA 1T19A 4YOFA 4EESA 4BBVA 4JGOA 2ZOIA 2NUTC 1LL8A 1G28A 2VA0A 2PHYA 4IJGA 3KYZA 4HNBA 4HP9A 1JNUA 1ZTUA 3K3CA 4WL9A 4DN0A 4Z1WA 4WLAA 3PBOA 1D06A 1XJ4A 3PR6A 3P7NA 4UQIS 2NUPC 3B42A 3LFVA 3ZQ5A 2V9AA 4UEYA 3R7WA 2YKFA 3H82A 4XT2B 4JGRA 3EEAA 1F5MA 1V9YA 3KSGA 3BWLA 3T4QA 4HI4A 2HGVA 2GJ3A 3KX0X 2VLGA 4ETZA 3OLOA 5KSHA 4H6JB 5HWVA 1MZUA 2FH5A 1TS7A 2A2LA 3RFBA 4YNRA 2W3HA 2D01A 3F1OA 1H8MA 2W1TA 3VOLA 4Y3IA 4JGPA 4HP4A 4R70A 5DF9A 2L4RA 2KX6A 2IA2A 4HOIA 3BQ8A 4I3JA 4NKPA 5AVEA 4BBUA 1P0ZA 4F3LA 1G6OA 5TBMA 4GCZA 4CLCA 4G3KA 3IBRA 5HPFA 3UMDA 2PD7A 5AVFA 3PBSA 1S66L 4G3WA 3EQVA 2H28A 4EEPA 3LIEA 3KSFA 1N9OA 3LR4A 1OTDA 3C8CA 3TRCA 5J4EA 4NXFA 4M4XA 3CUEC 3LR3A 1W63M 4ETXA 3A0SA 3H7WA 4P6ZM 5AJGA 5IT5A 2M7VA 2EWWA 2P08A 4LRZE 4WUJA 2JHEA 2O99A 1DP8A 3C38A 3EGDC 3DBAA 3T50A 3SW1A 2XA7M 3EQUA 3HCYA 4HJ4A 2KDKA 1XFQA 3NOUC 2PR6A 2PD8A 2O9BA 3R7WB 3LIDA 1NWZA 3H82B 2PDRA 1YSQA 5F5YA 3MR0A 4HJ3A 1MC0A 2V0WA 3A0VA 4Y5FA 2K2NA 4HJ6A 1P9WA 4IUHA 4OOLA 2V1AA 1P97A 2VZWA 3TE8A 4EQ1A 5HDCA 4LRXC 2W27A 5G4YA 3F1NB 2PYPA 1OT6A 3GECA 3C2WA 3F1OB 2W1TB 2O0YA 1YSPA 4BJPA 1EW0A 3NOPC 2ZMVA 3FC7A 3B33A 4EXOA 4R3AA 2J3WA 3CLOA 3T4LA 2XSSA 4GJ4A 5KIZA 2WKPA 4WEJA 1MKMA 3UB9A 1GSXA 4Q0JA 3V67A 3TW8A 3UE3A 4F3LB 1ODVA 5DJUA 4LLOB 5TBMB 1TD5A 2A24A 5TJJA 4I3AA 4CLCB 2VV7A 2W3DA 2ZOHA 4PKYA 2J80A 1UWPX 2Z6DA 3TJZC 2JKTM 3MQOA 2J3TC 3D72A 1S1ZA 3F1PA 1KOUA 4HHDA 5G4ZA 1DP6A 2O9CA 3E4PA 3RH8B 4PKYG 4EERA 3H7WB 4KQDA 2FZ0A 1GSVA 4R38A 5I5LA 2M7UA 1X0OA 3LI9A 1H3QA 1F9IA 5DKKA 2OOLA 1OPXA 1TS6A 4KUOA 2XRNA 3CAXA 3S7OA 5HWTA 3NJAA 3RTYA 4CLCD 3HJKA 3KSIA 3EWKA 4PAUA 1LSVA 1BYWA 1F98A 1OTBA 2K31A 4NXBA 1S4RA 2O9AA 3A0RA 2WKQA 5IU1A 2GNXA 3S7PA 3LUQA 1YKDA 2VEAA 1XJ6A 2M1CA 1S1YA 2Y8HA 2JN7A 4O8GA 5DJTA 1TF1A 2HJEA 3B47A 2KOIA 4B93A 4EEUA 2OAQ1 3UMEA 2OAP1 3HJIA 4LRYC 1T1BA 2JKRM 3PYPA 3T4KA 3MFXA 3OBFA 4O0PA 2W3GA 3IS2A 2VV6A 4MN5A 5LBRA 3S7QA 3UB8A 3LIFA 2OWHA 4G3VA 3ULFA 5HD3A 3FPVA 2MJ6A 2Z6CA 4KUKA 4BBTA 1NRJA 2BASA 2PYRA 2W3EA 3BY9A 3MMHA 5IS1A 3GDIA 4EUVA 4HIAA 2I9VA 4FOFA 4B9OA 2G7UA 2QWSA 2WKRA 5FL3A 3KSHA 1VHMA 2JKTI 5A8BA 1W63Q 4BMWA 5HPIA 5HDDA 1T18A 5J7EA 2A24B 3LICA 1V9ZA 2KLIA 3KYQA 2EWVA 1ZHHB 1LSWA 4Q0IA 3LI8A 4ARZA 1N9NA 3K3DA 1XFNA 2L1MA 4L9GA 4MN6A 3VV4A 4DJ3A 3F1PB 4AFIA 4GW9A 4IUKA 3H9WA 2GX5A 4L0LA 4L9EA 3E98A 3LYXA 3KO6A 2INWA 5F69A 3NHQA 3EEHA 3FG8A 2QYBA 2D02A 3T4SA 3MQ0A 1S4SA 3CWFA 2V1BA 2V0UA 4ZRRA 1T1AA 4BWIA 3LR0A 1XJ2A 1NLYA 3FPWA 1UGUA 3E0YA 4CQHA 2VGLM 3T4OA 1N9LA 5J3WA 3OCNA 2P04A 4MMNA 4O01A 3W2ZA 4RQ9A 2VV8A 2QKPA 1S67L 2XROA 5HSQA 2LB5A 5DFYA 1VB6A 2B02A 2QJ7A 3IS2B 4UQIM 4GS9A 3E4QA 3PBQA 3IBJA 1P9RA 2EA9A 4HH2A 4WELA 3PBNA 4I38A 5DKLA 2R78A 4CLCE 4EW7A 1DRMA 3EOIA 2B18A 3CUEA 4GHIA 3U2AA 3MQQA 3UB6A 3JVUA 4WN5A 1T1CA 3P01A 3EGXC 3ICYA 3OOVA 2K7SA 4DMZA 4JGQA 2L0WA 2VKSA 5L8MA 3NOTC 4I3IA 4GLQA 1Y28A 4LPZA 4ME4A 2DMWA 4YWZA 3LIBA 4ARZB 3E4OA 5EFWA 3CITA 4OOMA 4MN7A 3ZYTA 4NEED 4DJ2A 3F1NA 1OJGA 3BJNA 2W3FA 2ZMFA 2P7JA 2YKHA 2CMNA 4Y2FA 3JVVA 4WEKA 2VJWA 3R4KA 3OC2A 3BQAA 5F6AA 3PHYA 5C5KA 4WF0A 1IFQA 5HWWA 3C30A 3T4TA 3MJQA 4E04A 1TS8A 2GZAA 3MXQA 4XT2A 2HJ9C 1LT0A 4P6ZS 5HDSA 4HQAA 2OWJA 2ZBBA 1OTEA 1OTAA 2PT7A 3OCLA 4Q0HA 4EETB 1YAXA 1OJ5A 1TS0A 5HZHA 2VX8A 2J3TD 4H6JA 3UE6A 4IHQA 4GS9B 3G6OA 2LB9A 5K5BA 3PBRA 4NXGA 1OTIA 2XA7S 4NXEA 3T4JA 4PHTA 4R6LA 3O5YA 4L9FA 5CX7A 2Y79A 1STZA 4QPRA 5HD5A 3LR5A 4KQOA 4CLCC 1IOUA 3S7NA 1XJ3A 3BY8A 1LSXA 4K08A 4HY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VE4 A;  2HV1 A;  4GHI B;  1DP9 A;  4I39 A;  2W0N A;  1OT9 A;  3VE3 A;  1GSW A;  1D7E A;  2QJ5 A;  2QHK A;  5F68 A;  3LIA A;  4HH3 A;  4I5S A;  1UWN X;  3UB7 A;  2PR5 A;  1WA9 A;  1T19 A;  4EES A;  4BBV A;  4JGO A;  2ZOI A;  1LL8 A;  1G28 A;  2PHY A;  4HNB A;  4HP9 A;  1JNU A;  3K3C A;  4WL9 A;  4WLA A;  1D06 A;  1XJ4 A;  3P7N A;  3ZQ5 A;  2V9A A;  2YKF A;  3H82 A;  4XT2 B;  4JGR A;  1V9Y A;  3BWL A;  4HI4 A;  2GJ3 A;  3KX0 X;  2VLG A;  3OLO A;  4H6J B;  5HWV A;  1MZU A;  1TS7 A;  2D01 A;  3F1O A;  3VOL A;  4JGP A;  4HP4 A;  4R70 A;  2L4R A;  2KX6 A;  4HOI A;  4I3J A;  5AVE A;  4BBU A;  1P0Z A;  4F3L A;  5TBM A;  4GCZ A;  3IBR A;  3UMD A;  2PD7 A;  5AVF A;  1S66 L;  2H28 A;  4EEP A;  3LIE A;  1N9O A;  1OTD A;  3C8C A;  5J4E A;  4NXF A;  4M4X A;  3A0S A;  3H7W A;  4LRZ E;  4WUJ A;  2JHE A;  1DP8 A;  3T50 A;  3SW1 A;  4HJ4 A;  2KDK A;  1XFQ A;  3NOU C;  2PR6 A;  2PD8 A;  3LID A;  1NWZ A;  3H82 B;  2PDR A;  5F5Y A;  3MR0 A;  4HJ3 A;  2V0W A;  3A0V A;  4HJ6 A;  2V1A A;  1P97 A;  4EQ1 A;  5HDC A;  4LRX C;  2W27 A;  5G4Y A;  3F1N B;  2PYP A;  1OT6 A;  3GEC A;  3C2W A;  3F1O B;  1EW0 A;  3NOP C;  3FC7 A;  3B33 A;  4EXO A;  4R3A A;  3CLO A;  5KIZ A;  2WKP A;  3UB9 A;  1GSX A;  4F3L B;  1ODV A;  5DJU A;  4LLO B;  5TBM B;  2A24 A;  4I3A A;  2VV7 A;  2ZOH A;  4PKY A;  2J80 A;  1UWP X;  2Z6D A;  3MQO A;  3D72 A;  1S1Z A;  3F1P A;  1KOU A;  4HHD A;  5G4Z A;  1DP6 A;  3E4P A;  3RH8 B;  4PKY G;  4EER A;  3H7W B;  4KQD A;  1GSV A;  4R38 A;  5I5L A;  1X0O A;  3LI9 A;  1F9I A;  5DKK A;  2OOL A;  1TS6 A;  4KUO A;  3CAX A;  5HWT A;  3NJA A;  3RTY A;  3HJK A;  3EWK A;  1LSV A;  1BYW A;  1F98 A;  1OTB A;  4NXB A;  1S4R A;  3A0R A;  2WKQ A;  5IU1 A;  3LUQ A;  2VEA A;  1XJ6 A;  2M1C A;  1S1Y A;  2JN7 A;  5DJT A;  4EEU A;  3UME A;  3HJI A;  4LRY C;  1T1B A;  3PYP A;  3MFX A;  3IS2 A;  2VV6 A;  4MN5 A;  3UB8 A;  3LIF A;  2OWH A;  3ULF A;  5HD3 A;  2Z6C A;  4KUK A;  4BBT A;  2BAS A;  2PYR A;  3BY9 A;  5IS1 A;  3GDI A;  4HIA A;  2I9V A;  4B9O A;  2QWS A;  2WKR A;  5A8B A;  5HDD A;  1T18 A;  5J7E A;  2A24 B;  3LIC A;  1V9Z A;  1LSW A;  3LI8 A;  1N9N A;  3K3D A;  1XFN A;  2L1M A;  4L9G A;  4MN6 A;  4DJ3 A;  3F1P B;  4GW9 A;  3H9W A;  4L9E A;  3LYX A;  2INW A;  5F69 A;  3NHQ A;  3EEH A;  3FG8 A;  2D02 A;  1S4S A;  3CWF A;  2V1B A;  2V0U A;  1T1A A;  1XJ2 A;  1UGU A;  1N9L A;  5J3W A;  4RQ9 A;  2VV8 A;  2QKP A;  1S67 L;  5HSQ A;  1VB6 A;  2B02 A;  2QJ7 A;  3IS2 B;  4GS9 A;  3E4Q A;  2EA9 A;  4HH2 A;  5DKL A;  4I38 A;  2R78 A;  4EW7 A;  1DRM A;  4GHI A;  3MQQ A;  3UB6 A;  4WN5 A;  1T1C A;  3ICY A;  2K7S A;  4JGQ A;  2L0W A;  3NOT C;  4I3I A;  1Y28 A;  4LPZ A;  4YWZ A;  3LIB A;  3E4O A;  5EFW A;  4DJ2 A;  3F1N A;  1OJG A;  2P7J A;  2YKH A;  2CMN A;  5F6A A;  3PHY A;  4WF0 A;  5HWW A;  3MJQ A;  4E04 A;  1TS8 A;  3MXQ A;  4XT2 A;  1LT0 A;  5HDS A;  4HQA A;  2OWJ A;  2ZBB A;  1OTE A;  1OTA A;  4EET B;  1OJ5 A;  1TS0 A;  5HZH A;  4H6J A;  3UE6 A;  4GS9 B;  3G6O A;  4NXG A;  1OTI A;  4NXE A;  4R6L A;  4L9F A;  5HD5 A;  1XJ3 A;  3BY8 A;  1LSX A;  4K08 A;  4HY8 A; 
#chains in the Genus database with same CATH topology
 2HV1 A;  5F83 A;  3WS5 A;  4GHI B;  1E3U A;  4KG2 A;  5MC7 A;  1HZO A;  5HL6 A;  1D7E A;  2QJ5 A;  1K56 D;  3IF6 B;  2QHK A;  2Y55 A;  5F68 A;  1FCM A;  1LL9 A;  3FYZ A;  1SZV A;  3G35 A;  4EU0 A;  4EES A;  5CGX A;  1LHY A;  2NUT C;  4P6B A;  1LL8 A;  3RXW A;  2E8I A;  2EFU A;  3V3S A;  4S2J A;  4WLA A;  3V39 A;  2NUP C;  1CI9 A;  1KGG A;  4CPK A;  4E3I A;  2WGW B;  2YKF A;  3H82 A;  3S22 A;  3EEA A;  2XFT A;  4HI4 A;  2HGV A;  3HLW A;  2GJ3 A;  3ZFZ A;  3IF5 A;  1NXY A;  3SS3 A;  3MS6 A;  1LI9 A;  4DE1 A;  5HWV A;  1LI0 A;  1MZU A;  1CI8 A;  1YLP A;  4Y3I A;  1XP4 A;  5DF9 A;  3ZVT A;  1BSG A;  3BQ8 A;  2V1Z A;  4UAA A;  1K54 C;  4U3T A;  5EVI A;  3UMD A;  5M1A A;  4DE2 A;  2Y2G A;  1S66 L;  4F94 A;  3UE0 A;  3ZGA B;  3KSF A;  4R4S A;  4OQH A;  4M4X A;  4JBF A;  3H7W A;  4P6Z M;  5AJG A;  2M7V A;  2EWW A;  4FH2 A;  2V8C A;  4JPM A;  4LRZ E;  1YLY A;  3V5M A;  2QMI A;  1ESU A;  3DBA A;  3T50 A;  2OLV A;  1SKO A;  3C4O A;  1FR6 A;  3SW1 A;  1FSW A;  4GN2 A;  3WRZ A;  4HJ4 A;  1U60 A;  5E2F A;  5AQB A;  1FCN A;  4LCM A;  4C3Q A;  3HUN A;  4KZB A;  2PDR A;  1YSQ A;  2HP9 A;  1NYM A;  1GHP A;  1MC0 A;  3Q81 A;  3A0V A;  1ERQ A;  3NI9 A;  5AQ9 A;  4OH0 A;  3VP1 A;  4MEZ A;  4IUH A;  5FAO A;  3UY6 A;  4EQ1 A;  2O0Y A;  4BJP A;  5DTT A;  2ZMV A;  3B33 A;  4EXO A;  3G34 A;  3IWQ A;  2XSS A;  1PYY A;  4Q0J A;  3NY4 A;  3TW8 A;  4F3L B;  5TBM B;  4LLO B;  3OPP A;  2X02 A;  4O7D A;  4I3A A;  4CLC B;  3OZH A;  4UHU A;  3PAE A;  3BRM A;  3O3V A;  1PWG A;  2Y59 A;  3MQO A;  3D72 A;  1S1Z A;  3TOI A;  2O9C A;  3BFF A;  5EV0 A;  1IEL A;  4P85 A;  3DTK A;  2WKE A;  1K55 A;  5CTN A;  4JKT A;  1TS6 A;  2HP6 A;  5IHV A;  3GRJ A;  4CLC D;  4HBU A;  4PAU A;  1LSV A;  3MZF A;  1F98 A;  3S7P A;  4GB7 A;  3IWO A;  1S1Y A;  2RL3 A;  2Y8H A;  4O8G A;  4LCL A;  5GLB A;  3IX4 A;  1MKI A;  1E4D A;  2OAP 1;  3PYP A;  3MFX A;  3OBF A;  3LIF A;  5HD3 A;  1YM1 A;  1TDG A;  4JXW A;  4BBT A;  2BAS A;  2PYR A;  1Y54 A;  4FTX A;  3GDI A;  1SDE A;  2G7U A;  2QWS A;  3IF6 C;  5A8B A;  1I2S A;  4BMW A;  4P87 A;  5HPI A;  2JKG A;  3KYQ A;  1ZHH B;  3M2J A;  4Q0I A;  4OQ0 A;  3HRE A;  2WGV A;  3C7V A;  1N9N A;  2X01 A;  2XD5 A;  3MXS A;  3SS5 A;  1LLB A;  3H9W A;  2GX5 A;  3M2K A;  4Q8I A;  4DDS A;  4R0Q A;  3LYX A;  5TGF A;  4ESP A;  1YPR A;  3NHQ A;  2PAV P;  2ZJ9 A;  2ACG A;  1UGU A;  1CK3 A;  2VGL M;  3ZG9 B;  1J3W A;  2ZQC A;  5DF7 A;  2EX9 A;  4BD0 A;  1N9L A;  3BEC A;  3LY3 A;  3HLD A;  3IH8 A;  1Z6F A;  4R3B A;  4RQ9 A;  5L09 A;  2VV8 A;  2QPN A;  5DFY A;  3HLC A;  2B02 A;  2QJ7 A;  3IS2 B;  3WRT A;  3N7W A;  4LEN A;  3T1R A;  1P9R A;  2Y2M A;  3IXH A;  2H10 A;  2Y2I A;  4CLC E;  4NET A;  1W8Y A;  1DRM A;  2B18 A;  3CUE A;  1BLS A;  1WYB A;  1MBL A;  3UB6 A;  4K91 A;  1NRF A;  2ZMA A;  2R9X A;  1EI5 A;  3ICY A;  2L0W A;  4KG6 A;  1VQQ A;  3LIB A;  5EFW A;  4XUX A;  4MN7 A;  3ZYT A;  4DJ2 A;  5E2G A;  4KZ4 A;  2PU4 A;  1OJG A;  2P7J A;  3MFD A;  4PM5 A;  4S2M A;  4R3J A;  2CMN A;  2UWX A;  3IXD A;  2PU2 A;  4H8R A;  3ZNT A;  3T1S A;  5GHZ A;  4WM9 A;  2HDS A;  3BFE A;  2WZZ A;  1XKZ A;  5KSC A;  4RX2 A;  1DJA A;  2J9P A;  2WAE A;  3C30 A;  3MJQ A;  4E04 A;  1L2S A;  1OTE A;  1OTA A;  4Q0H A;  4UA7 A;  1BZA A;  3FZC A;  1OJ5 A;  2WKH A;  3BFC A;  2J3T D;  2HP5 A;  2XGN A;  4ZJ1 A;  4IHQ A;  5CHU A;  3PBR A;  3HUO A;  3UPP A;  3N6I A;  5EEC A;  5DF8 A;  4BD1 A;  2ZM2 A;  5J8X A;  4CLC C;  1XJ3 A;  3BY8 A;  1LSX A;  4X56 A;  3OPH A;  4K0X A;  3UPN A;  1OT9 A;  3VE3 A;  1GSW A;  4FSF A;  3BLM A;  1MPL A;  3MF0 A;  2HF6 A;  4WYY A;  3IX3 A;  4E3M A;  4YOF A;  4B4Z A;  3QHY A;  4FUW A;  5FQ9 A;  1NY0 A;  4LV2 A;  2PHY A;  4OLG A;  4DN0 A;  4Z1W A;  1D06 A;  1XJ4 A;  4DRT A;  5GLA A;  3MZD A;  3P7N A;  4Z9Q A;  1W5D A;  4UQI S;  2C5W B;  3UDX A;  1ONG A;  4IBR A;  4Y15 A;  3NC8 A;  3ZQ5 A;  3QP6 A;  3DWZ A;  4UEY A;  3R7W A;  1EWZ A;  1NJ4 A;  4JGR A;  1F5M A;  1V9Y A;  3KSG A;  3HVF A;  2BTF P;  2OLU A;  1PI5 A;  3VP0 A;  5CHM A;  1MWR A;  3KX0 X;  1ZG6 A;  4WMC A;  4WZ5 C;  3HLG A;  4ETZ A;  4H6J B;  4CJN A;  2FH5 A;  1TS7 A;  3IHA A;  2W3H A;  2D01 A;  3F1O A;  1H8M A;  1FQG A;  3SOI A;  1NYY A;  2IA2 A;  3QP1 A;  4I3J A;  1KE4 A;  4BBU A;  2IWC A;  3IQA A;  4GCZ A;  2PD7 A;  5AVF A;  3AGE A;  1IYO A;  5EVE A;  3C4P A;  1ZC2 A;  2Z2L B;  3EQV A;  3LIE A;  1Y4O A;  3C8C A;  3ISG A;  2ZC6 B;  3UE1 A;  5IT5 A;  3C5A A;  2P08 A;  2J8Y A;  1TEM A;  2XEP A;  5CED A;  2B5R A;  2XA7 M;  3EQU A;  1S6R A;  5FQJ A;  2Y2P A;  4QJG A;  2O9B A;  3A3I A;  1NWZ A;  5TFQ A;  5F5Y A;  2V0W A;  4PMA A;  3WWX A;  4HJ6 A;  3DTM A;  5F1G A;  2XLN A;  2VZW A;  2PYP A;  1OT6 A;  3C2W A;  2W1T B;  2ZQD A;  3W4Q A;  2ZQ7 A;  5KIZ A;  2WKP A;  4WEJ A;  1MKM A;  3GSG A;  3UB9 A;  5KZH A;  3HLF A;  5DJU A;  1PZO A;  2A24 A;  2OSU A;  3VP3 A;  3DAV A;  2Z6D A;  3N8S A;  1AWI A;  1K54 A;  3TJZ C;  4N1X A;  3O87 A;  2CC1 A;  2J3T C;  5FDH A;  1KOU A;  3VFF A;  5EM0 A;  4PPR A;  3RH8 B;  4KQD A;  2BG1 A;  1VEU A;  5AQA A;  4R38 A;  1GCE A;  5FQI A;  3LI9 A;  4ID4 A;  1MWS A;  4MBK A;  3LEQ A;  2OOL A;  2J9O A;  1OPX A;  4KUO A;  2XRN A;  3CAX A;  3NJA A;  1L0G A;  5GLC A;  1BTL A;  3KSI A;  1YT4 A;  4E3L A;  4KZ6 A;  1IKI A;  3ZVW A;  1OTB A;  1ESI A;  3T1X A;  2WKQ A;  4OKP A;  5IU1 A;  1YKD A;  4B4X A;  2Q9M A;  2JN7 A;  2ZQ9 A;  1K4F A;  1XGJ A;  3UME A;  4QY6 A;  4OVD A;  2W3G A;  5E43 A;  3QNB A;  3ZG7 B;  3OPR A;  2DRW A;  3UB5 P;  3WS2 A;  3FPV A;  3VP4 A;  4OP8 A;  4MBF A;  4DXC A;  5GHX A;  4GZB A;  2DCF A;  4HIA A;  2I9V A;  4FOF A;  1K38 A;  4XUZ A;  4Y17 A;  3KSH A;  2JKT I;  2PBY A;  1L0F A;  1T18 A;  3KYE A;  1V9Z A;  2V8F A;  1PIO A;  4ARZ A;  2ZM8 A;  4MN6 A;  3VV4 A;  2ZC7 A;  3F1P B;  5BOH A;  3L9K A;  4GW9 A;  3BM6 A;  5CEB A;  4L9E A;  4JF5 A;  3E98 A;  3KO6 A;  3HL9 A;  5A92 A;  1KGF A;  4Y13 A;  1E25 A;  2RCX A;  3C7U A;  1K57 C;  1T1A A;  1DJB A;  1ZKJ A;  2H0Y A;  4GDB A;  2VGK A;  3FPW A;  4R4R A;  3E0Y A;  5CRF A;  3CPT B;  3G2Z A;  4IVI A;  2P04 A;  4MMN A;  4E3K A;  3W2Z A;  1K56 A;  2QKP A;  5A91 A;  5HSQ A;  3HUM A;  1H0M A;  3PBQ A;  4X53 A;  2XDM A;  4EQI A;  3B3X A;  4X25 A;  3MZE A;  5DKL A;  3PBN A;  2R78 A;  3ITA A;  1XXM A;  3V3R A;  3S4X A;  2ZL1 B;  1QMF A;  4GHI A;  1YQS A;  3JVU A;  4WN5 A;  2JE5 A;  4HBT A;  1T1C A;  3P01 A;  3OOV A;  4JGQ A;  3IF6 A;  5L8M A;  2B95 A;  3NOT C;  4I3I A;  4IBX A;  4ME4 A;  2DMW A;  3GV9 A;  3E4O A;  1XGI A;  2HDU A;  2XQZ A;  1FOF A;  2Y4A A;  5DTS A;  5GLD A;  3MSH A;  5HAQ A;  3M6H A;  4D2O A;  2ZMF A;  2Q9N A;  3G31 A;  1HLU P;  2VGJ A;  4Y2F A;  4WEK A;  3R4K A;  3OC2 A;  1IYQ A;  2JKF A;  4DE0 A;  4RVA A;  1SCW A;  4KZ7 A;  5HWW A;  3P09 A;  4R1G A;  2WGW A;  1H8Z A;  3MXQ A;  2EX2 A;  2HJ9 C;  4Y0T A;  2H5S A;  4OOY A;  2PT7 A;  1YAX A;  5CGW A;  5DVA A;  2WZX A;  2HZ5 A;  2G2W A;  4GS9 B;  1TVF A;  5K5B A;  1ES5 A;  3T4J A;  2Y91 A;  4E6X A;  4L9F A;  5FI6 A;  1STZ A;  2P9V B;  5HD5 A;  4KQO A;  4HY8 A;  1PNE A;  1Q2Q A;  3CI6 A;  3PBT A;  1DP9 A;  5EOO A;  3ZG8 B;  4QWO A;  3D3O A;  3LGO A;  2A49 A;  1G68 A;  4E3O A;  3PTE A;  1KE3 A;  4E6W A;  1FCO A;  5DFX A;  4HH3 A;  4I5S A;  3Q1F A;  3BW6 A;  1WA9 A;  2VGL S;  3GMW A;  1T19 A;  3QP2 A;  1I5Q A;  4BBV A;  4JGO A;  2ZOI A;  5FEG A;  4IJG A;  3W4O A;  5HAP A;  3KYZ A;  4HP9 A;  3VFH A;  1ZTU A;  1JTD A;  1CEG A;  2AVX A;  3PR6 A;  1ERO A;  1BLP A;  4E3J A;  4R23 A;  3B42 A;  4N9L A;  3LFV A;  2Y2Q A;  4XT2 B;  4S2N C;  3UN7 A;  3BWL A;  3T4Q A;  1JTG A;  2HDQ A;  3A3J A;  5FAQ A;  1L0D A;  2Q0O A;  2VLG A;  1BUE A;  1KDW A;  5KSH A;  1S0W A;  4KZ9 A;  3WS4 A;  3BFD A;  3VOL A;  4UA9 A;  4JGP A;  4R70 A;  2WAD A;  2L4R A;  2KX6 A;  4S2O A;  4HOI A;  3DWK A;  4JLF A;  1K25 A;  2V2F F;  3VP2 A;  4NKP A;  5AVE A;  1FR1 A;  3RJU A;  4C75 A;  4F3L A;  5TBM A;  4CLC A;  4G3K A;  2PBD P;  3IBR A;  1PWC A;  1ES2 A;  4G3W A;  3CMZ A;  2H28 A;  4P0M A;  4EEP A;  2ZLY A;  1OTD A;  1IKG A;  4N92 A;  3BEB A;  3CUE C;  3WS0 A;  3ZG0 A;  1W63 M;  1J9M A;  1K0K A;  3FWL A;  1RGZ A;  4X1L A;  2H0T A;  4WUJ A;  1WYC A;  1K6R A;  2JHE A;  2O99 A;  1DP8 A;  3C38 A;  2WUQ A;  1E3U D;  4Y7P A;  4N9K A;  3HCY A;  4C6Y A;  1M40 A;  4IED A;  2KDK A;  2Y2K A;  1XFQ A;  3NOU C;  5HFO A;  1GA9 A;  3ZCZ A;  3H82 B;  4U0T A;  4NK3 A;  1PFL A;  3NEC A;  4HJ3 A;  4LV3 A;  1ACF A;  2I72 A;  1ZG4 A;  3TE8 A;  5HDC A;  1Z09 A;  3QP4 A;  2W27 A;  3TG9 A;  5G4Y A;  3F1N B;  4XXR A;  3QNC A;  1YSP A;  1IEM A;  1EW0 A;  3NOP C;  4JXG A;  3GQZ A;  4WZ5 A;  3FC7 A;  4MBH A;  1YMS A;  2J3W A;  3CLO A;  1CF0 A;  4KG5 A;  5HAI A;  3BFG A;  1GSX A;  1KGE A;  3V67 A;  4OQI A;  3UE3 A;  5HX9 A;  1ODV A;  5TJJ A;  1KVL A;  2VV7 A;  5EVI B;  2W3D A;  2ZOH A;  1UWP X;  3IX8 A;  2JC7 A;  2JCH A;  4EV4 A;  1CQA A;  4X69 A;  2PRF A;  1DJC A;  4KZA A;  2C6W B;  1LL5 A;  3E4P A;  2G2U A;  4PKY G;  3H7W B;  2FZ0 A;  3NBL A;  3NDE A;  2M7U A;  1X0O A;  5E2H A;  5U47 A;  1F9I A;  5DKK A;  3W8K A;  3Q7V B;  4KZ3 A;  3S7O A;  5HWT A;  3PAG A;  3RTY A;  2XK1 A;  3NUL A;  1SKO B;  4DF6 A;  3EWK A;  3FV7 A;  2K31 A;  2Z2M B;  3D4F A;  1S4R A;  3A0R A;  2GNX A;  4OLD A;  1K4E A;  1TF1 A;  2HJE A;  2ZC5 B;  3B47 A;  2KOI A;  4B93 A;  1N9B A;  3VSK A;  2OAQ 1;  3HJI A;  4BLM A;  5A90 A;  4O0P A;  1H8Y A;  3IS2 A;  3Q7Z A;  2VV6 A;  3N8L A;  2Y2L A;  4QB8 A;  1VM1 A;  5LBR A;  3S7Q A;  4KQQ A;  4G3V A;  3ULF A;  2P74 A;  2MJ6 A;  5EPH A;  1M6K A;  4BL2 A;  5JYP A;  5FA7 A;  3JPU A;  2W3E A;  3BY9 A;  3QP5 A;  2ZC4 B;  2HDR A;  4B9O A;  1BUL A;  5F1F A;  4MLL A;  1SKF A;  3AGD A;  1VHM A;  4BEN A;  5J7E A;  1N4O A;  4S2L A;  3LIC A;  2KLI A;  3QP8 A;  1RGY A;  4X68 A;  1A0K A;  3LI8 A;  1YLJ A;  3K3D A;  1D1J A;  2L1M A;  4DJ3 A;  4AFI A;  1W79 A;  4FCF A;  4IUK A;  4ZJ3 A;  3RXX A;  4L0L A;  3Q82 A;  2WYX A;  4IVK A;  5F69 A;  5EUA A;  3EEH A;  3FG8 A;  2QYB A;  4ZJ2 A;  3T4S A;  1HD8 A;  1S4S A;  2V1B A;  2ZM0 A;  2V0U A;  4ZRR A;  3LR0 A;  3M6B A;  1O07 A;  1XJ2 A;  4OON A;  3TSG A;  3G4P A;  4JXV A;  3OCN A;  1YLW A;  4UA6 A;  4X6T A;  4O01 A;  4DDY A;  1XX2 A;  4WBG A;  1S67 L;  3GVB A;  2XRO A;  2LB5 A;  3G2Y A;  3E4Q A;  3IBJ A;  5EE8 A;  2WAF A;  4HH2 A;  1H5X A;  2DNS A;  2FFY A;  2Y2J A;  4DE3 A;  3A3D A;  3EOI A;  4NG2 A;  5FQK A;  5EOE A;  3U2A A;  1ALQ A;  1ONH A;  5CER A;  3MQQ A;  2R9W A;  4M3K A;  3MXR A;  3EGX C;  4KEN B;  2XD1 A;  4KQR A;  4K0W A;  5CEC A;  4DMZ A;  5CTM A;  1K6S A;  4GDN A;  4YWZ A;  3CIT A;  3MKE A;  3F1N A;  3CG5 A;  5M19 A;  5FAS A;  3LY4 A;  2ZQ8 A;  4YFM A;  4GD6 A;  3IH9 A;  1KE0 A;  2YKH A;  4YIN A;  3JVV A;  2VJW A;  3BQA A;  5KMW A;  3BYD A;  1RCJ A;  4S2K A;  5C5K A;  1NZU A;  3G30 A;  3N8R A;  3GTC A;  4WF0 A;  4EWF A;  3T4T A;  1G5U A;  1XPB A;  1K57 A;  1TS8 A;  2GZA A;  1XA7 A;  4RYE A;  1LT0 A;  4P6Z S;  5FI7 A;  4HQA A;  1FIK A;  3N4I A;  2XFS A;  5HAR A;  3VSL A;  3LEZ A;  1NZO A;  4H6J A;  3WS1 A;  3G6O A;  4NXG A;  3Q07 A;  3Q7V A;  1PW1 A;  3O5Y A;  3P98 A;  4QPR A;  3CJM A;  3LR5 A;  4ZTK A;  2XF3 A;  5EVI C;  4JXS A;  5FEF A;  3VE4 A;  2W1R A;  4PM7 A;  2GDN A;  4I39 A;  3K2N A;  2W0N A;  1NLZ A;  2V20 A;  4QY5 A;  4RX3 A;  4MDZ A;  2JKR I;  1F2K A;  3IHB A;  3LIA A;  1MY8 A;  3LCE A;  2UV0 E;  3NCK A;  3PXP A;  1UWN X;  5FQM A;  3UB7 A;  2PR5 A;  4II7 A;  1C3B A;  4MCW A;  4ZAM A;  4Y0O A;  5CGS A;  1Q2P A;  1MWT A;  1G28 A;  2VA0 A;  4HNB A;  1JNU A;  3K3C A;  2EX8 A;  4WL9 A;  2XR0 A;  3PBO A;  3D9Y A;  3NDG A;  3VOY A;  5L2F A;  2V9A A;  5TR7 A;  3ZG5 A;  4FD8 A;  2XH9 A;  4N1H A;  4EUZ A;  4BQM A;  5L07 A;  3A3E A;  1ES3 A;  3VMA A;  3HBR A;  4QHC A;  4DKI A;  3OLO A;  2IWB A;  5E2E A;  2A2L A;  3RFB A;  4YNR A;  2W1T A;  4HP4 A;  4OP5 A;  4OPY A;  3E2K A;  3GR2 A;  2WGI A;  2QZ6 A;  1P0Z A;  3CZD A;  4OPZ A;  1G6O A;  3SZT A;  5HPF A;  3DTE A;  3PBS A;  3UPO A;  1AXB A;  1SDN A;  4MNR A;  3O88 A;  4JF6 A;  1N9O A;  1MWU A;  3DW0 A;  3LR4 A;  5DTK A;  1YLT A;  3TRC A;  5J4E A;  1K55 C;  5A93 A;  1CEF A;  3BLS A;  1GHI A;  4NXF A;  4WZ4 A;  3LR3 A;  4ZBE A;  1IYP A;  4ETX A;  3A0S A;  4LGW A;  2EXA A;  4KZ8 A;  3I7J A;  4KZ5 A;  3O86 A;  4PM8 A;  4OPQ A;  3EGD C;  5I94 A;  1PWD A;  3UDI A;  1W7F A;  2PD8 A;  2PR6 A;  3ZHH A;  5CHJ A;  5L10 A;  1PRQ A;  3R7W B;  3LID A;  3MR0 A;  4EBN A;  3MBZ A;  1HVB A;  1FSY A;  5M18 A;  4Y5F A;  2K2N A;  4JF4 A;  1RP5 A;  1JVJ A;  1P9W A;  4OOL A;  2V1A A;  1QME A;  4S2N A;  1P97 A;  4LRX C;  3GEC A;  3F1O B;  2WKI A;  1VET B;  3CHW P;  4R3A A;  4Y0U A;  1DY6 A;  1SHV A;  3OPL A;  3T4L A;  1PI4 A;  4GJ4 A;  1BLC A;  2OV5 A;  2JBF A;  5FAP A;  5FAT A;  3FKW A;  1TD5 A;  4PM6 A;  4PKY A;  2J80 A;  5JYO A;  1JWV A;  2JKT M;  3L7H A;  4HEF A;  3F1P A;  3ZNY A;  4WMC D;  4HHD A;  1I2W A;  1KVM A;  5G4Z A;  1DP6 A;  3UDF A;  3G32 A;  4QU3 A;  4EER A;  1GSV A;  5I5L A;  5AQ7 A;  1W8Q A;  2ZD8 A;  4X55 A;  1H3Q A;  3T1Q B;  1FIL A;  2X71 A;  3SS4 A;  3HJK A;  1BYW A;  2E8J A;  4EBP A;  4NXB A;  4GOG A;  1ES4 A;  2O9A A;  3CPT A;  3LUQ A;  2VEA A;  1XJ6 A;  2M1C A;  4BL3 A;  5DJT A;  1ERM A;  4U0X A;  3IWI A;  4EEU A;  4LRY C;  1T1B A;  2JKR M;  3T4K A;  2Y2O A;  4QD4 A;  4ZDX A;  4MN5 A;  1GHM A;  3V50 A;  3UB8 A;  2OWH A;  4DXB A;  1JWZ A;  2Z6C A;  4KUK A;  1NRJ A;  4RA7 A;  3MMH A;  1YMX A;  5IS1 A;  3IXB A;  2ZL1 A;  4EUV A;  4LV0 A;  2WKR A;  5FL3 A;  1GA0 A;  1W63 Q;  3S1Y A;  2ZC3 B;  5HDD A;  3VOZ A;  2A24 B;  5G18 A;  2EXB A;  5CXW A;  2EWV A;  3SH9 A;  4A5R A;  1LSW A;  5EM1 A;  1XFN A;  4L9G A;  2IWD A;  3IT9 A;  2ZQA A;  2INW A;  5FDS A;  1VEU B;  5EVL A;  2D02 A;  3SH7 A;  3MQ0 A;  3JYI A;  3CWF A;  1TDL A;  2BLS A;  3SH8 A;  4BWI A;  2VK3 A;  1G6A A;  1NLY A;  4CQH A;  5FI2 A;  3T4O A;  3UO9 A;  3DTI A;  5D3O A;  2WK0 A;  4LFU A;  5J3W A;  1OME A;  4GNU A;  1BLH A;  5HW3 A;  3U4L P;  1VB6 A;  4UQI M;  5GHY A;  4GS9 A;  3AGF A;  4E3N A;  2EA9 A;  2Y2H A;  4S2P A;  4WEL A;  4I38 A;  5FSR A;  2Y2N A;  2P9V A;  1CJF A;  5HL1 A;  2A3U A;  3IXG A;  4EW7 A;  1O7E A;  3LO7 A;  2EFX A;  4LV1 A;  4X1M A;  4B88 A;  4GKU A;  3HLB A;  4FH4 A;  1YLZ A;  5EVI D;  3T12 B;  3E2L A;  2K7S A;  3UNW A;  4D60 A;  2VKS A;  4EBL A;  4GLQ A;  1Y28 A;  4LPZ A;  4ARZ B;  4PM9 A;  4OOM A;  4NEE D;  2HPB A;  1VET A;  3BJN A;  2J7V A;  2W3F A;  1L0E A;  5GL9 A;  3ITB A;  1KDS A;  3ZDJ A;  1BT5 A;  1MXO A;  5F6A A;  3PHY A;  1PW8 A;  3NIA A;  2EX6 A;  1IFQ A;  5F82 A;  4HES A;  4GD8 A;  1HTZ A;  1JWP A;  4XT2 A;  3W4P A;  5HDS A;  2OWJ A;  2ZBB A;  3OCL A;  4OQG A;  4EET B;  3A3F A;  1IYS A;  1TS0 A;  5HZH A;  2VX8 A;  3UE6 A;  2FFF B;  2LB9 A;  1PZP A;  1OTI A;  4OPR A;  2XA7 S;  1XA1 A;  4NXE A;  3HLE A;  5FQQ A;  4PHT A;  1L3L A;  4R6L A;  5CX7 A;  2Y79 A;  3FKV A;  1WE4 A;  1IOU A;  3MKF A;  3S7N A;  4S2I A;  4K08 A; 
#chains in the Genus database with same CATH homology
 3VE4 A;  2HV1 A;  3CI6 A;  2W1R A;  3PBT A;  4GHI B;  1DP9 A;  5MC7 A;  4I39 A;  3K2N A;  2W0N A;  1NLZ A;  1OT9 A;  3VE3 A;  1GSW A;  3D3O A;  5HL6 A;  1D7E A;  2QJ5 A;  4FSF A;  4MDZ A;  2JKR I;  2QHK A;  5F68 A;  3LIA A;  3PXP A;  3MF0 A;  4HH3 A;  4I5S A;  5DFX A;  2HF6 A;  1UWN X;  3BW6 A;  3UB7 A;  2PR5 A;  4II7 A;  1WA9 A;  2VGL S;  4EU0 A;  4MCW A;  1T19 A;  4YOF A;  4EES A;  4BBV A;  4JGO A;  2ZOI A;  2NUT C;  1LL8 A;  1G28 A;  2VA0 A;  2PHY A;  4IJG A;  3KYZ A;  4HNB A;  4HP9 A;  1JNU A;  1ZTU A;  3K3C A;  4WL9 A;  4DN0 A;  4Z1W A;  4WLA A;  3PBO A;  1D06 A;  1XJ4 A;  3PR6 A;  3P7N A;  4UQI S;  2NUP C;  3B42 A;  3LFV A;  3ZQ5 A;  2V9A A;  4UEY A;  3R7W A;  2YKF A;  3H82 A;  4XT2 B;  4JGR A;  3EEA A;  1F5M A;  1V9Y A;  3KSG A;  3BWL A;  3T4Q A;  4HI4 A;  2HGV A;  2GJ3 A;  3KX0 X;  2VLG A;  4ETZ A;  3OLO A;  5KSH A;  4H6J B;  5HWV A;  1MZU A;  2FH5 A;  1TS7 A;  2A2L A;  3RFB A;  4YNR A;  2W3H A;  2D01 A;  3F1O A;  1H8M A;  2W1T A;  3VOL A;  4Y3I A;  4JGP A;  4HP4 A;  4R70 A;  5DF9 A;  2L4R A;  2KX6 A;  2IA2 A;  4HOI A;  3BQ8 A;  4I3J A;  4NKP A;  5AVE A;  4BBU A;  1P0Z A;  4F3L A;  1G6O A;  5TBM A;  4GCZ A;  4CLC A;  4G3K A;  3IBR A;  5HPF A;  3UMD A;  2PD7 A;  5AVF A;  3PBS A;  1S66 L;  4G3W A;  3EQV A;  2H28 A;  4EEP A;  3LIE A;  3KSF A;  1N9O A;  3LR4 A;  1OTD A;  3C8C A;  3TRC A;  5J4E A;  4NXF A;  4M4X A;  3CUE C;  3LR3 A;  1W63 M;  4ETX A;  3A0S A;  3H7W A;  4P6Z M;  5AJG A;  5IT5 A;  2M7V A;  2EWW A;  2P08 A;  4LRZ E;  4WUJ A;  2JHE A;  2O99 A;  1DP8 A;  3C38 A;  3EGD C;  3DBA A;  3T50 A;  3SW1 A;  2XA7 M;  3EQU A;  3HCY A;  4HJ4 A;  2KDK A;  1XFQ A;  3NOU C;  2PR6 A;  2PD8 A;  2O9B A;  3R7W B;  3LID A;  1NWZ A;  3H82 B;  2PDR A;  1YSQ A;  5F5Y A;  3MR0 A;  4HJ3 A;  1MC0 A;  2V0W A;  3A0V A;  4Y5F A;  2K2N A;  4HJ6 A;  1P9W A;  4IUH A;  4OOL A;  2V1A A;  1P97 A;  2VZW A;  3TE8 A;  4EQ1 A;  5HDC A;  4LRX C;  2W27 A;  5G4Y A;  3F1N B;  2PYP A;  1OT6 A;  3GEC A;  3C2W A;  3F1O B;  2W1T B;  2O0Y A;  1YSP A;  4BJP A;  1EW0 A;  3NOP C;  2ZMV A;  3FC7 A;  3B33 A;  4EXO A;  4R3A A;  2J3W A;  3CLO A;  3T4L A;  2XSS A;  4GJ4 A;  5KIZ A;  2WKP A;  4WEJ A;  1MKM A;  3UB9 A;  1GSX A;  4Q0J A;  3V67 A;  3TW8 A;  3UE3 A;  4F3L B;  1ODV A;  5DJU A;  4LLO B;  5TBM B;  1TD5 A;  2A24 A;  5TJJ A;  4I3A A;  4CLC B;  2VV7 A;  2W3D A;  2ZOH A;  4PKY A;  2J80 A;  1UWP X;  2Z6D A;  3TJZ C;  2JKT M;  3MQO A;  2J3T C;  3D72 A;  1S1Z A;  3F1P A;  1KOU A;  4HHD A;  5G4Z A;  1DP6 A;  2O9C A;  3E4P A;  3RH8 B;  4PKY G;  4EER A;  3H7W B;  4KQD A;  2FZ0 A;  1GSV A;  4R38 A;  5I5L A;  2M7U A;  1X0O A;  3LI9 A;  1H3Q A;  1F9I A;  5DKK A;  2OOL A;  1OPX A;  1TS6 A;  4KUO A;  2XRN A;  3CAX A;  3S7O A;  5HWT A;  3NJA A;  3RTY A;  4CLC D;  3HJK A;  3KSI A;  3EWK A;  4PAU A;  1LSV A;  1BYW A;  1F98 A;  1OTB A;  2K31 A;  4NXB A;  1S4R A;  2O9A A;  3A0R A;  2WKQ A;  5IU1 A;  2GNX A;  3S7P A;  3LUQ A;  1YKD A;  2VEA A;  1XJ6 A;  2M1C A;  1S1Y A;  2Y8H A;  2JN7 A;  4O8G A;  5DJT A;  1TF1 A;  2HJE A;  3B47 A;  2KOI A;  4B93 A;  4EEU A;  2OAQ 1;  3UME A;  2OAP 1;  3HJI A;  4LRY C;  1T1B A;  2JKR M;  3PYP A;  3T4K A;  3MFX A;  3OBF A;  4O0P A;  2W3G A;  3IS2 A;  2VV6 A;  4MN5 A;  5LBR A;  3S7Q A;  3UB8 A;  3LIF A;  2OWH A;  4G3V A;  3ULF A;  5HD3 A;  3FPV A;  2MJ6 A;  2Z6C A;  4KUK A;  4BBT A;  1NRJ A;  2BAS A;  2PYR A;  2W3E A;  3BY9 A;  3MMH A;  5IS1 A;  3GDI A;  4EUV A;  4HIA A;  2I9V A;  4FOF A;  4B9O A;  2G7U A;  2QWS A;  2WKR A;  5FL3 A;  3KSH A;  1VHM A;  2JKT I;  5A8B A;  1W63 Q;  4BMW A;  5HPI A;  5HDD A;  1T18 A;  5J7E A;  2A24 B;  3LIC A;  1V9Z A;  2KLI A;  3KYQ A;  2EWV A;  1ZHH B;  1LSW A;  4Q0I A;  3LI8 A;  4ARZ A;  1N9N A;  3K3D A;  1XFN A;  2L1M A;  4L9G A;  4MN6 A;  3VV4 A;  4DJ3 A;  3F1P B;  4AFI A;  4GW9 A;  4IUK A;  3H9W A;  2GX5 A;  4L0L A;  4L9E A;  3E98 A;  3LYX A;  3KO6 A;  2INW A;  5F69 A;  3NHQ A;  3EEH A;  3FG8 A;  2QYB A;  2D02 A;  3T4S A;  3MQ0 A;  1S4S A;  3CWF A;  2V1B A;  2V0U A;  4ZRR A;  1T1A A;  4BWI A;  3LR0 A;  1XJ2 A;  1NLY A;  3FPW A;  1UGU A;  3E0Y A;  4CQH A;  2VGL M;  3T4O A;  1N9L A;  5J3W A;  3OCN A;  2P04 A;  4MMN A;  4O01 A;  3W2Z A;  4RQ9 A;  2VV8 A;  2QKP A;  1S67 L;  2XRO A;  5HSQ A;  2LB5 A;  5DFY A;  1VB6 A;  2B02 A;  2QJ7 A;  3IS2 B;  4UQI M;  4GS9 A;  3E4Q A;  3PBQ A;  3IBJ A;  1P9R A;  2EA9 A;  4HH2 A;  4WEL A;  3PBN A;  4I38 A;  5DKL A;  2R78 A;  4CLC E;  4EW7 A;  1DRM A;  3EOI A;  2B18 A;  3CUE A;  4GHI A;  3U2A A;  3MQQ A;  3UB6 A;  3JVU A;  4WN5 A;  1T1C A;  3P01 A;  3EGX C;  3ICY A;  3OOV A;  2K7S A;  4DMZ A;  4JGQ A;  2L0W A;  2VKS A;  5L8M A;  3NOT C;  4I3I A;  4GLQ A;  1Y28 A;  4LPZ A;  4ME4 A;  2DMW A;  4YWZ A;  3LIB A;  4ARZ B;  3E4O A;  5EFW A;  3CIT A;  4OOM A;  4MN7 A;  3ZYT A;  4NEE D;  4DJ2 A;  3F1N A;  1OJG A;  3BJN A;  2W3F A;  2ZMF A;  2P7J A;  2YKH A;  2CMN A;  4Y2F A;  3JVV A;  4WEK A;  2VJW A;  3R4K A;  3OC2 A;  3BQA A;  5F6A A;  3PHY A;  5C5K A;  4WF0 A;  1IFQ A;  5HWW A;  3C30 A;  3T4T A;  3MJQ A;  4E04 A;  1TS8 A;  2GZA A;  3MXQ A;  4XT2 A;  2HJ9 C;  1LT0 A;  4P6Z S;  5HDS A;  4HQA A;  2OWJ A;  2ZBB A;  1OTE A;  1OTA A;  2PT7 A;  3OCL A;  4Q0H A;  4EET B;  1YAX A;  1OJ5 A;  1TS0 A;  5HZH A;  2VX8 A;  2J3T D;  4H6J A;  3UE6 A;  4IHQ A;  4GS9 B;  3G6O A;  2LB9 A;  5K5B A;  3PBR A;  4NXG A;  1OTI A;  2XA7 S;  4NXE A;  3T4J A;  4PHT A;  4R6L A;  3O5Y A;  4L9F A;  5CX7 A;  2Y79 A;  1STZ A;  4QPR A;  5HD5 A;  3LR5 A;  4KQO A;  4CLC C;  1IOU A;  3S7N A;  1XJ3 A;  3BY8 A;  1LSX A;  4K08 A;  4HY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...