2B02A

Crystal structure of arnt pas-b domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
111
structure length
111
Chain Sequence
MSNVSQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Crystal Structure and Binding Properties of ARNT PAS-B Heterodimerization Domain
rcsb
source organism Homo sapiens
total genus 34
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2b02A01
4KQDA 2QJ7A 4LLOB 5HWTA 2W27A 4GCZA 2VV7A 3RTYA 4HP9A 3UMDA 3BY8A 3G6OA 3IS2B 4RQ9A 1P0ZA 4E04A 4WF0A 1X0OA 4LRYC 2I9VA 1OTEA 2D01A 2V1AA 3NHQA 4H6JB 3VOLA 5F68A 3UB8A 4WL9A 3F1NA 2PYRA 2PR5A 4NXEA 4BBUA 3F1PA 1BYWA 3LIDA 5HDDA 4R38A 4M4XA 2R78A 4YWZA 3PYPA 3ULFA 3NOTC 2YKHA 5AVEA 4I5SA 5TBMB 1D06A 5HDSA 4XT2A 3CAXA 2WKQA 4I3AA 2VV8A 4LPZA 1N9LA 1S1YA 4JGOA 5A8BA 2PD7A 2GJ3A 4KUOA 4HJ3A 1GSVA 2QWSA 2YKFA 1T1AA 3HJKA 3A0RA 5DJTA 3PHYA 2PHYA 3E4QA 3A0VA 1UWNX 3MFXA 4GS9B 1S67L 3VE3A 3NOUC 3A0SA 4HY8A 3K3DA 1JNUA 3UB9A 2QKPA 1OJGA 1ODVA 4HOIA 5F5YA 4I3JA 4B9OA 4PKYG 4HHDA 4PKYA 4NXGA 4LRXC 2KDKA 1T18A 1XFQA 4EETB 3IS2A 3MJQA 4EEUA 3FC7A 5IS1A 1G28A 3H7WA 3H82B 4H6JA 2PDRA 2V9AA 3EEHA 3H9WA 3T50A 4HH2A 2OOLA 3BY9A 4HH3A 1TS6A 4EESA 3MXQA 3LUQA 3LIBA 1UWPX 2BASA 2KX6A 1OJ5A 2OWJA 3UB7A 1OTIA 2EA9A 3LYXA 2L0WA 4HIAA 3OLOA 2HV1A 2PR6A 4JGRA 4HNBA 1TS0A 4NXFA 1LL8A 4HQAA 3F1NB 1DRMA 4JGPA 3E4OA 3F1PB 4WLAA 1F98A 4R70A 4HP4A 5F6AA 4BBTA 3HJIA 3CLOA 2M1CA 3LIFA 4GS9A 5HSQA 3IBRA 4R3AA 3ICYA 1N9OA 3NOPC 3F1OB 1MZUA 4L9FA 1GSWA 4F3LA 2PYPA 5I5LA 5G4YA 2Z6DA 3GECA 1Y28A 1LSWA 2D02A 1V9ZA 4GHIA 3UMEA 3E4PA 2L4RA 4DJ3A 2H28A 2A24A 3CWFA 5HD3A 4EQ1A 1OT9A 1N9NA 1LSXA 4GW9A 1OTDA 4K08A 2K7SA 5F69A 4I38A 1S1ZA 3P7NA 1S4RA 4WN5A 1T1CA 3LIAA 3LIEA 2J80A 2QHKA 1P97A 4EXOA 3LI8A 1F9IA 1DP9A 5DKLA 1S66L 5HZHA 4JGQA 4DJ2A 2VEAA 4EEPA 5HDCA 1DP6A 1S4SA 5KIZA 3NJAA 3LICA 3GDIA 2JN7A 1UGUA 4NXBA 4L9EA 1OTAA 1VB6A 4WUJA 4BBVA 2L1MA 1T1BA 5TBMA 1EW0A 2ZOIA 3KX0X 3H7WB 3LI9A 1TS7A 1LSVA 1WA9A 2P7JA 2ZBBA 2W0NA 4HJ6A 1KOUA 2OWHA 1DP8A 1V9YA 2V1BA 4R6LA 4EERA 2QJ5A 5J3WA 2WKPA 5HWWA 1T19A 1LT0A 4I39A 3F1OA 2CMNA 5EFWA 3ZQ5A 2V0WA 3MQOA 3D72A 4HJ4A 4XT2B 2ZOHA 3MR0A 5IU1A 4MN6A 3VE4A 2V0UA 2PD8A 3BWLA 5HWVA 2WKRA 5DJUA 4KUKA 3C2WA 1XJ4A 2INWA 3RH8B 2B02A 3K3CA 5DKKA 1GSXA 5G4ZA 5AVFA 3SW1A 5J7EA 1XJ3A 1TS8A 4L9GA 3C8CA 1OTBA 5HD5A 4EW7A 1NWZA 1OT6A 2VLGA 1XFNA 2VV6A 4HI4A 4I3IA 3B33A 3MQQA 4F3LB 1XJ2A 3EWKA 2Z6CA 2JHEA 3UE6A 1D7EA 3FG8A 1XJ6A 3UB6A 3H82A 4GHIB 4MN5A 5J4EA 4LRZE 2A24B
chains in the Genus database with same CATH superfamily
3FKWA 4KENB 5G18A 2V8CA 2BG1A 1VEUB 2A49A 1BLPA 1P9RA 3RTYA 1SDNA 1FQGA 5GHXA 4S2PA 3BY8A 2K2NA 2D01A 1YLTA 4NETA 3NHQA 3LEZA 5F68A 1PNEA 3HUNA 1W8YA 4Y3IA 3V5MA 4KQOA 5HDDA 4M4XA 1NLZA 3CUEA 4YWZA 2HP9A 4OLDA 1JTGA 4E6XA 3GSGA 4YFMA 1D06A 3EOIA 5CHJA 3R7WB 3DW0A 3N7WA 2ZC6B 4I3AA 2VV8A 3SS5A 1CJFA 2A3UA 2PBDP 2ZM2A 2PT7A 3ZNYA 1S1YA 1CEGA 3SOIA 4ZJ1A 1ONHA 4KUOA 3NBLA 4KG6A 2QWSA 4IBXA 3DTKA 2WGWB 5FEGA 4MBHA 1YQSA 3CUEC 1K56A 4S2NA 1GA9A 2PHYA 2Y2JA 5HX9A 3MFXA 3CG5A 1W7FA 4QU3A 3QP8A 3UDFA 3A0SA 5IHVA 4WM9A 3PTEA 4AFIA 1I5QA 1ESIA 3K3DA 1JNUA 3BLSA 1K4EA 4WBGA 4OQIA 5FQJA 4QB8A 1JWPA 4ETZA 4P85A 3QHYA 1K56D 2G7UA 2JKRI 5CXWA 2J3WA 3MMHA 2WKIA 3LFVA 2IWBA 3V39A 3BFEA 3BFFA 4S2NC 1XKZA 2R9WA 1SKOA 1MWRA 4LRXC 2JC7A 4Y13A 4RA7A 3L7HA 4ME4A 3FYZA 1W5DA 4OPRA 2NUPC 2LB5A 3PAGA 3HLBA 4IHQA 3T1RA 2KLIA 3H82B 1K6SA 2EX6A 2J3TD 1FILA 3UNWA 5GHZA 2V9AA 4U3TA 4UEYA 1H0MA 4K0XA 4HH2A 1KE3A 3OBFA 2Y55A 3A3FA 4HH3A 2J3TC 2XSSA 4EESA 4OPZA 3MXQA 3MFDA 3ZG8B 2BASA 4KZ3A 3O87A 1TVFA 3DWKA 1OTIA 3WS0A 1ZHHB 3EQUA 5EVEA 2PBYA 5CHUA 5CECA 2PR6A 2W3HA 4JGRA 1TS0A 3PAEA 4E3LA 3BEBA 2ZQ7A 4R4SA 5EVIB 3VOZA 3SS3A 2UV0E 5L2FA 4MLLA 4GN2A 3Q7ZA 1YMSA 4GS9A 2XLNA 3IBRA 5DF8A 3C38A 5HARA 3ICYA 1N9OA 4NEED 4LV2A 4L9FA 3IH9A 1KGEA 5KSHA 3FKVA 5M19A 1L0EA 1LSWA 2XFSA 4KZ8A 2ZQ9A 4D60A 1PWCA 1K0KA 1V9ZA 1AXBA 1JTDA 2XFTA 5EV0A 1SHVA 2VK3A 3JVUA 3IX4A 4K0WA 3PR6A 3HREA 3CWFA 3B42A 2JE5A 4KZ4A 4BL2A 1YKDA 1LL5A 1VQQA 2W1TB 1PIOA 4K08A 3FV7A 1S1ZA 4P87A 1SZVA 4Y0UA 1PZPA 5M18A 4WN5A 4G3WA 4BWIA 4Y5FA 1P97A 1VHMA 5GLDA 5FDHA 3VP3A 4X1MA 2VEAA 2R9XA 3G4PA 1MBLA 5HDCA 1SKOB 5A91A 5AQBA 3MQ0A 3Q82A 2JN7A 4QJGA 1HVBA 1OTAA 1VB6A 1KDWA 2EWWA 5FEFA 1EW0A 3CPTA 4Z9QA 3IHAA 4KZAA 1PZOA 4EUVA 5KZHA 1YT4A 1WA9A 2P7JA 4L0LA 1FIKA 3RJUA 1CI8A 4GJ4A 4LV0A 2AVXA 2HDQA 1Y4OA 1KDSA 3FWLA 4EERA 2HJ9C 5FI7A 4JF5A 5L10A 4OKPA 2WKPA 1T19A 2CMNA 3UPNA 1DJBA 5CX7A 1E4DA 2HPBA 4XT2B 5CTNA 3BFGA 5AQ9A 4CLCB 1A0KA 2V0UA 3FZCA 3GMWA 3WRZA 3SZTA 4ID4A 3HBRA 1YSPA 1DJCA 2G2UA 2Y79A 1XJ4A 4Y17A 3ZFZA 4WMCD 3RH8B 5DKKA 3SW1A 1GHIA 5EE8A 1VM1A 3VP4A 3RXXA 3NCKA 2M7UA 3K2NA 2VLGA 4OQHA 5E2EA 1XFNA 3E0YA 3ITAA 1QMFA 4HI4A 3MQQA 4GDNA 1PWGA 3GRJA 4PM9A 1QMEA 2VX8A 1XX2A 3FG8A 1XJ6A 2JKFA 3WS4A 1MWUA 2WKHA 3SH9A 2P9VA 1Y54A 1IYSA 4FCFA 3A3DA 3SH8A 1K25A 2DMWA 5J4EA 4LRZE 5F83A 1K4FA 3NI9A 2XROA 1LHYA 3CHWP 3T4KA 3VFFA 1XGIA 4S2OA 5FSRA 3NC8A 5HWTA 4DE1A 3LR3A 3KYQA 2EXBA 4S2LA 1FSYA 5FDSA 2E8JA 3UE0A 5J8XA 3OCNA 3UMDA 4R4RA 3IS2B 4E04A 4O8GA 1OTEA 1JVJA 1BLSA 2B95A 2V1AA 4H6JB 2VGKA 4Y7PA 3VOLA 3F1NA 1IYQA 4QHCA 2PYRA 4OPQA 2PR5A 5HAPA 3F1PA 4R38A 3UDXA 4OLGA 4QY5A 2R78A 4OQ0A 5FA7A 1TDGA 4KG2A 3CI6A 1RP5A 4I5SA 2H0YA 4N92A 1Z09A 3NULA 3CPTB 2ZC4B 1G68A 3WS1A 4KZ6A 5HDSA 1RGZA 3CAXA 2WKQA 1ES2A 2HDSA 3W4QA 3VV4A 2BTFP 3VSLA 3ZG9B 4LPZA 1LI9A 1ZTUA 2GJ3A 4XUZA 2IWCA 4F94A 5FATA 1IELA 5DJTA 3PHYA 1YLYA 3E4QA 2OV5A 4DE3A 3A0VA 1E3UD 1IKIA 3G31A 2FFYA 4K91A 4O01A 3M6HA 4HY8A 3IF5A 1P9WA 3CZDA 2ZC7A 2P74A 4UQIS 3G30A 5KSCA 2C6WB 1ODVA 4EBLA 3MBZA 2LB9A 1K54A 1PI4A 4Q0IA 3V67A 3OCLA 4PKYG 4HHDA 3S7OA 4NXGA 4ARZA 4XUXA 1T18A 1XFQA 3G2ZA 1BTLA 4EBPA 1L0FA 4FH4A 5A90A 4KZBA 2ZM0A 4LV1A 3UPOA 1CK3A 3FC7A 2RCXA 3OPPA 5U47A 5IS1A 5HPFA 1L0DA 2H0TA 3RXWA 1F5MA 2PDRA 3DTMA 1FOFA 3H9WA 3IT9A 3PBNA 3IXGA 5E43A 3OPLA 1K54C 3S7NA 4X53A 2OOLA 1I2SA 3BY9A 1TS6A 3KO6A 4S2IA 3VP1A 1MY8A 1BZAA 1ZKJA 3LIBA 4QWOA 4DDYA 4LENA 2Y59A 4PHTA 2C5WB 1MWSA 4B4XA 2OSUA 2J9PA 4GOGA 4GNUA 2J8YA 1XXMA 3MZDA 2ACGA 3G34A 2HV1A 4KQQA 3MZEA 3WS5A 1NJ4A 5FAOA 5IT5A 2ZL1A 1YLPA 2X01A 1FR1A 3F1NB 2PU2A 4JGPA 3F1PB 1ZG6A 4WLAA 1F98A 3ISGA 5FASA 2B5RA 2W3EA 3HJIA 4MBFA 1YLZA 3MZFA 4X56A 2M1CA 5EVID 4A5RA 4E6WA 5HSQA 3GV9A 3NOPC 3HLWA 3F1OB 4ZBEA 4B88A 1TD5A 2VGLS 3T1SA 3LR5A 4E3IA 1W8QA 5I5LA 2MJ6A 4EWFA 3KSGA 4DF6A 2D02A 4GLQA 3UMEA 4X55A 4EUZA 3MF0A 1DJAA 1ES5A 4DJ3A 5AQAA 2ZM8A 1L0GA 2H28A 2WK0A 2Y8HA 3Q7VA 4EQ1A 1OT9A 4DDSA 4DN0A 1LSXA 5I94A 4GW9A 1OTDA 3TOIA 2E8IA 4FOFA 5EM0A 2WGIA 3VP0A 3LIAA 3BECA 2Q9NA 2QHKA 1MC0A 2G2WA 3G2YA 1XGJA 2VA0A 1DP9A 5CRFA 5HZHA 4OVDA 4JGQA 4YOFA 5EOOA 4G3KA 1DP6A 1S4SA 4R1GA 1IOUA 5KIZA 3NJAA 1UGUA 4NXBA 4R23A 4L9EA 3HVFA 4S2KA 1BULA 4O0PA 4Y15A 2XD5A 5TBMA 5FAQA 1U60A 1H8YA 2ZBBA 4OOLA 2W0NA 1CI9A 1RGYA 4PMAA 2OWHA 3D3OA 3BFCA 1VETA 2PU4A 5FI6A 4CPKA 2QJ5A 3NY4A 3HLFA 1YSQA 4FTXA 4GD6A 5FQMA 5J3WA 3S7QA 3T4QA 1H5XA 5EFWA 2OLUA 2Q0OA 5EVLA 3E2KA 4IVKA 3ZQ5A 4U0TA 1EI5A 4MN6A 2VJWA 2ZL1B 5AQ7A 4XXRA 2OAP1 1K38A 3T1XA 3C2WA 4MEZA 2B02A 2ZQDA 3K3CA 1GSXA 2ZMVA 3ZVWA 5CGSA 1ONGA 1XJ3A 2HDRA 3NDEA 1TS8A 4CLCD 5A92A 3ZDJA 4DXCA 4BD1A 1OTBA 3OZHA 1NWZA 1ZC2A 2X02A 4X25A 5FI2A 3B33A 2CC1A 1XJ2A 3EWKA 5DF9A 1I2WA 3HLCA 1JWZA 2GZAA 2DNSA 3UB6A 2HP5A 3M2JA 4LV3A 4JBFA 3C7UA 5F1FA 4N1XA 3QNCA 2KOIA 1O07A 2W3GA 2W3DA 4MN5A 4MN7A 1KVMA 2H10A 2IA2A 3Q7VB 3UY6A 4C6YA 4Y0TA 2Y2QA 4RYEA 3ZG0A 4BMWA 4E3OA 3T4LA 3G32A 5A93A 3G6OA 4RQ9A 1LI0A 1TEMA 3HCYA 1X0OA 1BLHA 4BQMA 1PW8A 2ZQ8A 2JKGA 4WL9A 3KSIA 3GVBA 3T4TA 1HTZA 2IWDA 4GKUA 5LBRA 4BBUA 1BYWA 3LIDA 4X6TA 3EGXC 4H8RA 2WAEA 4IEDA 4MBKA 4Q8IA 3LY3A 3ULFA 1YM1A 1MXOA 4UQIM 3E98A 3LCEA 2YKHA 4DKIA 4Q0JA 5TBMB 4N9KA 3ZYTA 4WMCA 5CTMA 1NYYA 5CGWA 4PM6A 1E25A 4R3JA 4Y0OA 3KSHA 2EWVA 3T12B 1J9MA 1WYBA 3PXPA 3LY4A 1KE4A 5GLCA 2Q9MA 1N9LA 5KMWA 1VETB 3ZVTA 5A8BA 2PD7A 4WZ4A 4X1LA 2O9BA 1GSVA 1H8ZA 1ALQA 2JCHA 3BJNA 2W1RA 3N4IA 5HL6A 2ZMAA 1TDLA 4D2OA 2FFFB 4UAAA 4GS9B 3TJZC 5M1AA 4P6BA 3WRTA 4G3VA 3IWIA 3UO9A 2WZXA 4PM5A 1MWTA 4ZJ3A 3UB9A 3UE3A 4B93A 3HUOA 3AGFA 3O86A 1YAXA 2XQZA 1BUEA 5F5YA 3GTCA 4IUHA 4OQGA 2PAVP 1C3BA 5MC7A 3QP4A 4QD4A 2ZD8A 4B9OA 5F1GA 4DXBA 4PKYA 2VGJA 3C4OA 2QPNA 1VEUA 2KDKA 4KG5A 4Z1WA 3W4OA 2EFXA 1Z6FA 3N6IA 3UPPA 4KQRA 1PRQA 3JPUA 1G28A 3H7WA 3HL9A 4JXVA 2EX2A 2JKTM 1FR6A 3CJMA 2XGNA 4QPRA 3U4LP 2UWXA 4WEJA 1NRJA 2ZC5B 1N4OA 1FSWA 2NUTC 3IX3A 2VGLM 2EXAA 1GA0A 3LUQA 1UWPX 3DWZA 4ZAMA 2KX6A 3G35A 4YNRA 3V3RA 1OJ5A 3QP6A 4M3KA 2OWJA 3R7WA 3IWQA 3T4OA 2EA9A 3N8RA 2L0WA 3V3SA 4UA9A 4DMZA 3OLOA 2HDUA 1PYYA 3DTEA 3O5YA 2ZC3B 4P6ZS 3S4XA 1E3UA 4NXFA 1IYPA 4HQAA 3DAVA 3IXHA 4R3BA 1DRMA 4Y2FA 5FQQA 4MNRA 3E4OA 3IWOA 5F82A 3VMAA 2WGWA 4LCLA 3TW8A 4R70A 5HPIA 5F6AA 3I7JA 4JF4A 3S7PA 3QP5A 3CLOA 3LIFA 5DVAA 3L9KA 3VP2A 4R3AA 1TF1A 1O7EA 3HLDA 2Y2KA 1MZUA 1NYMA 3IX8A 3LGOA 1GSWA 2PYPA 5G4YA 1FCMA 5E2FA 4PAUA 4HEFA 3ZG5A 4NK3A 1KE0A 4N9LA 3BM6A 1PI5A 5K5BA 3C5AA 2XH9A 3IXDA 4UHUA 4OP8A 2VKSA 2A24A 4JLFA 1MPLA 1YLJA 5TFQA 3BQ8A 5F69A 2K31A 4I38A 4E3MA 3P7NA 3V50A 1S4RA 2JKRM 4IUKA 2A2LA 2GX5A 4QY6A 4FH2A 2J7VA 2P9VB 3LI8A 1F9IA 2I72A 4ZDXA 4DJ2A 3S22A 4NG2A 3ZHHA 3GDIA 4WUJA 4OOYA 2L1MA 1T1BA 4JXGA 5AJGA 3T4JA 3VSKA 3FPWA 3KX0X 3GR2A 1IFQA 3H7WB 1SKFA 5CHMA 4DE2A 5GLAA 5L09A 5EVIA 4KZ5A 5BOHA 1TS7A 4UA7A 3MKEA 3E2LA 2Y2HA 4CJNA 1L3LA 2V1ZA 5TJJA 3PBSA 1GHMA 2P08A 1DP8A 1V9YA 4R6LA 1YMXA 2PRFA 5C5KA 2H5SA 5HWWA 3KYZA 4BENA 3D9YA 1J3WA 4LGWA 4I39A 5HFOA 5FL3A 3MQOA 1EROA 3D72A 1G5UA 4HJ4A 5TR7A 2ZOHA 3JVVA 1YLWA 1CQAA 1KGFA 5EVIC 4WZ5A 5CEBA 1NLYA 2PD8A 1G6OA 2WZZA 5HWVA 3B3XA 5GHYA 2WKRA 2XA7S 4KUKA 5EECA 3T1QB 5FAPA 2OLVA 2INWA 3ZGAB 3SH7A 3TG9A 2Y2IA 5HD5A 4EW7A 2W1TA 1OT6A 2ZMFA 2Z2LB 3IF6A 2WGVA 1FCOA 4WEKA 1WYCA 1S6RA 3DTIA 4DRTA 2JHEA 5DTTA 3OC2A 3KYEA 2V8FA 4WZ5C 2XR0A 1Q2PA 1NY0A 3UE1A 2VZWA 4N1HA 4BD0A 4HESA 4EQIA 3PBQA 3ZG7B 4OH0A 1AWIA 2A24B 3FPVA 4KQDA 2QJ7A 4LLOB 4LFUA 1PW1A 4X69A 4OPYA 4R0QA 4CLCE 2W27A 3P09A 3Q07A 5DFXA 2WYXA 4ARZB 4E3KA 4GCZA 4JPMA 2VV7A 4OONA 3IF6C 3MXRA 4JKTA 3W4PA 4HP9A 3D4FA 1P0ZA 5DTSA 3P01A 4WF0A 1PFLA 4LRYC 2I9VA 3MSHA 1RCJA 2XRNA 1NZUA 3A3EA 2Y2GA 3HLEA 3UB8A 3BQAA 5JYPA 1OPXA 4BLMA 3M6BA 4NXEA 2ZLYA 1YPRA 5FQ9A 5HL1A 4IVIA 4OOMA 4ESPA 3NIAA 3PYPA 2XEPA 3NOTC 2JBFA 5AVEA 3BLMA 1L2SA 2XF3A 3C4PA 4KZ7A 4XT2A 3IH8A 3SS4A 4CLCA 3M2KA 5EOEA 5CGXA 4ZJ2A 2HF6A 2Y2NA 1IKGA 3QP1A 1Q2QA 4GD8A 4JGOA 2FH5A 3TSGA 2W3FA 1M6KA 4HJ3A 3AGEA 2YKFA 1GCEA 1T1AA 3HJKA 3A0RA 2EX8A 4IJGA 2OAQ1 5E2GA 1LLBA 1UWNX 1JWVA 1BT5A 4FUWA 4OP5A 1S67L 2Y91A 3NOUC 3VE3A 4WELA 3ZCZA 4MDZA 3T4SA 4CLCC 1XP4A 1ES3A 2Y2PA 2FZ0A 5EM1A 1PWDA 2QKPA 1OJGA 1KVLA 3Q1FA 1N9BA 2O99A 4HOIA 1FCNA 4C3QA 1ESUA 4U0XA 4I3JA 3PBOA 4P6ZM 4JF6A 5E2HA 1XPBA 4EETB 4ZRRA 4LCMA 3TE8A 3IF6B 3NECA 4PM8A 3IS2A 3MJQA 4EEUA 2XD1A 1ZG4A 3IQAA 4JXWA 4X68A 2WUQA 2DRWA 1GHPA 1HZOA 5CERA 4C75A 3VOYA 1EWZA 1W63M 4H6JA 2Y2LA 1ACFA 1SDEA 3IBJA 3EEHA 2J9OA 1HD8A 3T50A 4ETXA 3OPRA 4KZ9A 4YINA 1K55A 3OPHA 1ES4A 1NZOA 5EUAA 3TRCA 1IYOA 3C30A 3UB7A 2RL3A 1BSGA 3LYXA 1H8MA 4E3NA 4HIAA 3OOVA 4S2MA 3W2ZA 4GB7A 3LR0A 1SCWA 3UDIA 3UN7A 1CF0A 4HNBA 1IEMA 2WAFA 4B4ZA 3BYDA 1LL8A 1F2KA 4Q0HA 1W79A 2GNXA 5FQIA 3B47A 4MCWA 3AGDA 3NDGA 5GL9A 3U2AA 5L8MA 3A3IA 1K55C 4MMNA 4HP4A 1OMEA 4BBTA 1K57A 2DCFA 5HW3A 1MKMA 2WKEA 3C7VA 4IBRA 3RFBA 2Z2MB 1W63Q 1K6RA 4F3LA 3IHBA 4GZBA 1LL9A 3S1YA 2Z6DA 3GECA 5JYOA 1Y28A 1M40A 3HLGA 2QMIA 5FQKA 4GHIA 4EBNA 3E4PA 3EEAA 1MKIA 3CITA 2EFUA 1ERQA 2ZQCA 2L4RA 3ITBA 1WE4A 2HZ5A 1K57C 3CMZA 4CQHA 2QYBA 5HD3A 5CEDA 1ERMA 2GDNA 1N9NA 2O9AA 3W8KA 4RVAA 2K7SA 2HP6A 4PPRA 5DTKA 1T1CA 3BRMA 2O9CA 3LIEA 5EPHA 2J80A 3HUMA 5L07A 4EXOA 3BFDA 1D1JA 2Y4AA 5DKLA 1S66L 3A3JA 4EEPA 3BW6A 3PBTA 1XA7A 4EV4A 2QZ6A 3PBRA 3UB5P 3QP2A 3LICA 4DE0A 1NXYA 3EGDC 5DFYA 2XA7M 4BBVA 2B18A 3N8SA 2BLSA 3Q81A 2ZOIA 2ZJ9A 2Y2MA 4P0MA 4EU0A 4HBTA 3LI9A 2EX9A 1NRFA 1LSVA 2HJEA 3LR4A 4HBUA 3O88A 3VFHA 3P98A 3WS2A 4HJ6A 1KOUA 3LEQA 4RX3A 4E3JA 1CEFA 3MXSA 4UA6A 4PM7A 2V1BA 3JYIA 3QNBA 4BL3A 2P04A 2X71A 1BLCA 3EQVA 2HGVA 2M7VA 2V20A 1STZA 1LT0A 5GLBA 3F1OA 4GDBA 2V0WA 1S0WA 3MR0A 5IU1A 3MKFA 3VE4A 3ZNTA 2ZQAA 3KSFA 3WWXA 3MS6A 2WADA 4S2JA 4RX2A 3BWLA 3IXBA 5DJUA 5TGFA 2V2FF 1DY6A 5HAQA 2Y2OA 5G4ZA 5AVFA 4BJPA 4FD8A 5J7EA 2O0YA 4II7A 2XDMA 4ZTKA 4L9GA 1G6AA 3LO7A 3C8CA 1KGGA 2XK1A 4NKPA 4O7DA 2VV6A 4F3LB 4I3IA 4WYYA 3N8LA 2Z6CA 4JXSA 5HAIA 1D7EA 3UE6A 1XA1A 3O3VA 3GQZA 3R4KA 3H82A 5D3OA 4GHIB 1H3QA 5DF7A 4FSFA 1HLUP 2JKTI 3DBAA
chains in the Genus database with same CATH topology
3FPVA 2IA2A 4KQDA 2QJ7A 4LLOB 5HWTA 3LR3A 4CLCE 2W27A 5DFXA 4ARZB 4BMWA 3KYQA 4GCZA 3T4LA 2VV7A 1P9RA 3RTYA 3OCNA 4HP9A 3UMDA 3BY8A 3G6OA 3IS2B 4RQ9A 1P0ZA 3HCYA 3P01A 4E04A 4WF0A 1X0OA 2K2NA 4LRYC 4O8GA 2I9VA 1OTEA 2D01A 2V1AA 2XRNA 3NHQA 4H6JB 3VOLA 5F68A 3UB8A 4WL9A 3F1NA 3KSIA 3BQAA 2PYRA 4Y3IA 3T4TA 1OPXA 2PR5A 5LBRA 4NXEA 4KQOA 4BBUA 3F1PA 1BYWA 3LIDA 5HDDA 3EGXC 4R38A 4M4XA 4OOMA 1NLZA 2R78A 3CUEA 4YWZA 3PYPA 3ULFA 3NOTC 4UQIM 3E98A 2YKHA 5AVEA 3CI6A 4I5SA 4Q0JA 5TBMB 1D06A 3ZYTA 3EOIA 3R7WB 4XT2A 5HDSA 3CAXA 2WKQA 4I3AA 3KSHA 4CLCA 2EWVA 2VV8A 3VV4A 3PXPA 4LPZA 2HF6A 2PT7A 1N9LA 1S1YA 4JGOA 2FH5A 1ZTUA 5A8BA 2PD7A 2GJ3A 2W3FA 4KUOA 2O9BA 4HJ3A 1GSVA 2QWSA 2YKFA 3BJNA 1T1AA 2W1RA 3HJKA 3A0RA 3CUEC 5HL6A 4IJGA 5DJTA 3PHYA 2PHYA 3E4QA 3A0VA 2OAQ1 1UWNX 3MFXA 4GS9B 3TJZC 4G3VA 1S67L 3VE3A 3NOUC 4O01A 3A0SA 4WELA 4HY8A 4AFIA 4MDZA 3T4SA 4CLCC 1P9WA 3K3DA 1JNUA 3UB9A 3UE3A 2FZ0A 2QKPA 4UQIS 1OJGA 4B93A 4ETZA 1ODVA 2O99A 4HOIA 2G7UA 1YAXA 2LB9A 2JKRI 2J3WA 3MMHA 5F5YA 4IUHA 4Q0IA 3V67A 4I3JA 3LFVA 5MC7A 3OCLA 3PBOA 4B9OA 4P6ZM 4PKYG 4HHDA 4PKYA 3S7OA 4NXGA 4ARZA 4LRXC 2KDKA 1T18A 1XFQA 4EETB 4Z1WA 4ZRRA 3TE8A 4ME4A 2A24B 3IS2A 3MJQA 4EEUA 2NUPC 2LB5A 3FC7A 4IHQA 5IS1A 2KLIA 1G28A 3H7WA 5HPFA 2JKTM 3H82B 1W63M 4H6JA 1F5MA 2J3TD 2PDRA 4QPRA 3IBJA 2V9AA 3EEHA 3H9WA 4UEYA 3T50A 3PBNA 4ETXA 4WEJA 3S7NA 1NRJA 4HH2A 2OOLA 3OBFA 3BY9A 2NUTC 1TS6A 2J3TC 2VGLM 3KO6A 4HH3A 2XSSA 4EESA 3MXQA 3LUQA 3LIBA 1UWPX 2BASA 2KX6A 4YNRA 1OJ5A 4PHTA 3TRCA 2OWJA 3C30A 3UB7A 1OTIA 3R7WA 3T4OA 2EA9A 3LYXA 1H8MA 2L0WA 1ZHHB 3EQUA 4HIAA 4DMZA 3OLOA 3OOVA 3W2ZA 3LR0A 2HV1A 3O5YA 4P6ZS 2PR6A 2W3HA 4HNBA 1TS0A 4JGRA 5IT5A 4NXFA 1LL8A 4HQAA 4Q0HA 3F1NB 2GNXA 1DRMA 4Y2FA 3B47A 4MCWA 4JGPA 3E4OA 3F1PB 4WLAA 3U2AA 1F98A 3TW8A 5L8MA 4R70A 4MMNA 5HPIA 4HP4A 5F6AA 4BBTA 2W3EA 3HJIA 3S7PA 3CLOA 1MKMA 2M1CA 3LIFA 4GS9A 5HSQA 3IBRA 4R3AA 3C38A 1TF1A 1N9OA 3ICYA 3NOPC 4NEED 3RFBA 3F1OB 1MZUA 4L9FA 1W63Q 1TD5A 1GSWA 2VGLS 4F3LA 3LR5A 5KSHA 2PYPA 5I5LA 2MJ6A 5G4YA 2Z6DA 3GECA 1Y28A 1LSWA 3KSGA 4PAUA 2D02A 1V9ZA 4GLQA 4GHIA 3UMEA 3E4PA 3EEAA 3MF0A 3CITA 5K5BA 3JVUA 2L4RA 4DJ3A 2VKSA 2H28A 2A24A 3PR6A 3CWFA 4CQHA 3B42A 2Y8HA 2QYBA 5HD3A 4EQ1A 1OT9A 1YKDA 4DN0A 1N9NA 1LSXA 2O9AA 2W1TB 3BQ8A 4GW9A 1OTDA 4K08A 2K7SA 5F69A 2K31A 4I38A 1S1ZA 3P7NA 1S4RA 4FOFA 2JKRM 4WN5A 4G3WA 1T1CA 4BWIA 4IUKA 4Y5FA 2A2LA 3LIAA 2GX5A 2O9CA 3LIEA 2J80A 2QHKA 1MC0A 1P97A 1VHMA 4EXOA 2VA0A 3LI8A 1F9IA 1DP9A 5DKLA 1S66L 5HZHA 4JGQA 4YOFA 4DJ2A 2VEAA 4EEPA 3BW6A 3PBTA 5HDCA 4G3KA 1DP6A 1S4SA 1IOUA 5KIZA 3NJAA 3PBRA 3MQ0A 3LICA 3GDIA 2JN7A 3EGDC 1UGUA 4NXBA 5DFYA 4L9EA 1OTAA 1VB6A 4WUJA 2XA7M 4BBVA 4O0PA 2B18A 2L1MA 1T1BA 5TBMA 2EWWA 5AJGA 3T4JA 1EW0A 2ZOIA 3FPWA 3KX0X 3H7WB 1IFQA 4EU0A 4EUVA 3LI9A 1TS7A 1LSVA 2HJEA 3LR4A 1WA9A 2P7JA 2ZBBA 4OOLA 2W0NA 4L0LA 4HJ6A 1KOUA 2OWHA 3D3OA 5TJJA 3PBSA 4GJ4A 2P08A 1DP8A 1V9YA 2V1BA 4R6LA 4EERA 2HJ9C 2QJ5A 1YSQA 5J3WA 2P04A 5C5KA 2WKPA 3S7QA 3EQVA 2HGVA 2M7VA 5HWWA 3KYZA 1T19A 3T4QA 1STZA 1LT0A 4I39A 3F1OA 2CMNA 5EFWA 5FL3A 3ZQ5A 2V0WA 3MQOA 3D72A 4HJ4A 5CX7A 4XT2B 2ZOHA 3MR0A 5IU1A 4MN6A 2VJWA 3VE4A 3JVVA 3KSFA 4CLCB 1NLYA 2OAP1 2PD8A 2V0UA 1G6OA 3BWLA 5HWVA 1YSPA 2WKRA 5DJUA 2XA7S 4KUKA 2Y79A 3C2WA 1XJ4A 2INWA 3RH8B 2B02A 3K3CA 5DKKA 1GSXA 2ZMVA 5G4ZA 5AVFA 4BJPA 3SW1A 5J7EA 2O0YA 4II7A 1XJ3A 4CLCD 1TS8A 4L9GA 3C8CA 1OTBA 5HD5A 4EW7A 4NKPA 1NWZA 2M7UA 2W1TA 3K2NA 1OT6A 2VLGA 2ZMFA 1XFNA 3E0YA 2VV6A 4WEKA 4HI4A 4I3IA 3B33A 3MQQA 4F3LB 1XJ2A 3EWKA 2Z6CA 2JHEA 3OC2A 5DF9A 2VX8A 1D7EA 3UE6A 3FG8A 1XJ6A 2GZAA 3UB6A 3R4KA 3H82A 2VZWA 4GHIB 3PBQA 1H3QA 2KOIA 2W3GA 2W3DA 4MN5A 4FSFA 4MN7A 2DMWA 5J4EA 4LRZE 2XROA 2JKTI 3DBAA 3T4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KQD A;  2QJ7 A;  4LLO B;  5HWT A;  2W27 A;  4GCZ A;  2VV7 A;  3RTY A;  4HP9 A;  3UMD A;  3BY8 A;  3G6O A;  3IS2 B;  4RQ9 A;  1P0Z A;  4E04 A;  4WF0 A;  1X0O A;  4LRY C;  2I9V A;  1OTE A;  2D01 A;  2V1A A;  3NHQ A;  4H6J B;  3VOL A;  5F68 A;  3UB8 A;  4WL9 A;  3F1N A;  2PYR A;  2PR5 A;  4NXE A;  4BBU A;  3F1P A;  1BYW A;  3LID A;  5HDD A;  4R38 A;  4M4X A;  2R78 A;  4YWZ A;  3PYP A;  3ULF A;  3NOT C;  2YKH A;  5AVE A;  4I5S A;  5TBM B;  1D06 A;  5HDS A;  4XT2 A;  3CAX A;  2WKQ A;  4I3A A;  2VV8 A;  4LPZ A;  1N9L A;  1S1Y A;  4JGO A;  5A8B A;  2PD7 A;  2GJ3 A;  4KUO A;  4HJ3 A;  1GSV A;  2QWS A;  2YKF A;  1T1A A;  3HJK A;  3A0R A;  5DJT A;  3PHY A;  2PHY A;  3E4Q A;  3A0V A;  1UWN X;  3MFX A;  4GS9 B;  1S67 L;  3VE3 A;  3NOU C;  3A0S A;  4HY8 A;  3K3D A;  1JNU A;  3UB9 A;  2QKP A;  1OJG A;  1ODV A;  4HOI A;  5F5Y A;  4I3J A;  4B9O A;  4PKY G;  4HHD A;  4PKY A;  4NXG A;  4LRX C;  2KDK A;  1T18 A;  1XFQ A;  4EET B;  3IS2 A;  3MJQ A;  4EEU A;  3FC7 A;  5IS1 A;  1G28 A;  3H7W A;  3H82 B;  4H6J A;  2PDR A;  2V9A A;  3EEH A;  3H9W A;  3T50 A;  4HH2 A;  2OOL A;  3BY9 A;  4HH3 A;  1TS6 A;  4EES A;  3MXQ A;  3LUQ A;  3LIB A;  1UWP X;  2BAS A;  2KX6 A;  1OJ5 A;  2OWJ A;  3UB7 A;  1OTI A;  2EA9 A;  3LYX A;  2L0W A;  4HIA A;  3OLO A;  2HV1 A;  2PR6 A;  4JGR A;  4HNB A;  1TS0 A;  4NXF A;  1LL8 A;  4HQA A;  3F1N B;  1DRM A;  4JGP A;  3E4O A;  3F1P B;  4WLA A;  1F98 A;  4R70 A;  4HP4 A;  5F6A A;  4BBT A;  3HJI A;  3CLO A;  2M1C A;  3LIF A;  4GS9 A;  5HSQ A;  3IBR A;  4R3A A;  3ICY A;  1N9O A;  3NOP C;  3F1O B;  1MZU A;  4L9F A;  1GSW A;  4F3L A;  2PYP A;  5I5L A;  5G4Y A;  2Z6D A;  3GEC A;  1Y28 A;  1LSW A;  2D02 A;  1V9Z A;  4GHI A;  3UME A;  3E4P A;  2L4R A;  4DJ3 A;  2H28 A;  2A24 A;  3CWF A;  5HD3 A;  4EQ1 A;  1OT9 A;  1N9N A;  1LSX A;  4GW9 A;  1OTD A;  4K08 A;  2K7S A;  5F69 A;  4I38 A;  1S1Z A;  3P7N A;  1S4R A;  4WN5 A;  1T1C A;  3LIA A;  3LIE A;  2J80 A;  2QHK A;  1P97 A;  4EXO A;  3LI8 A;  1F9I A;  1DP9 A;  5DKL A;  1S66 L;  5HZH A;  4JGQ A;  4DJ2 A;  2VEA A;  4EEP A;  5HDC A;  1DP6 A;  1S4S A;  5KIZ A;  3NJA A;  3LIC A;  3GDI A;  2JN7 A;  1UGU A;  4NXB A;  4L9E A;  1OTA A;  1VB6 A;  4WUJ A;  4BBV A;  2L1M A;  1T1B A;  5TBM A;  1EW0 A;  2ZOI A;  3KX0 X;  3H7W B;  3LI9 A;  1TS7 A;  1LSV A;  1WA9 A;  2P7J A;  2ZBB A;  2W0N A;  4HJ6 A;  1KOU A;  2OWH A;  1DP8 A;  1V9Y A;  2V1B A;  4R6L A;  4EER A;  2QJ5 A;  5J3W A;  2WKP A;  5HWW A;  1T19 A;  1LT0 A;  4I39 A;  3F1O A;  2CMN A;  5EFW A;  3ZQ5 A;  2V0W A;  3MQO A;  3D72 A;  4HJ4 A;  4XT2 B;  2ZOH A;  3MR0 A;  5IU1 A;  4MN6 A;  3VE4 A;  2V0U A;  2PD8 A;  3BWL A;  5HWV A;  2WKR A;  5DJU A;  4KUK A;  3C2W A;  1XJ4 A;  2INW A;  3RH8 B;  2B02 A;  3K3C A;  5DKK A;  1GSX A;  5G4Z A;  5AVF A;  3SW1 A;  5J7E A;  1XJ3 A;  1TS8 A;  4L9G A;  3C8C A;  1OTB A;  5HD5 A;  4EW7 A;  1NWZ A;  1OT6 A;  2VLG A;  1XFN A;  2VV6 A;  4HI4 A;  4I3I A;  3B33 A;  3MQQ A;  4F3L B;  1XJ2 A;  3EWK A;  2Z6C A;  2JHE A;  3UE6 A;  1D7E A;  3FG8 A;  1XJ6 A;  3UB6 A;  3H82 A;  4GHI B;  4MN5 A;  5J4E A;  4LRZ E;  2A24 B; 
#chains in the Genus database with same CATH topology
 3FKW A;  4KEN B;  5G18 A;  2V8C A;  2BG1 A;  1VEU B;  2A49 A;  1BLP A;  1P9R A;  3RTY A;  1SDN A;  1FQG A;  5GHX A;  4S2P A;  3BY8 A;  2K2N A;  2D01 A;  1YLT A;  4NET A;  3NHQ A;  3LEZ A;  5F68 A;  1PNE A;  3HUN A;  1W8Y A;  4Y3I A;  3V5M A;  4KQO A;  5HDD A;  4M4X A;  1NLZ A;  3CUE A;  4YWZ A;  2HP9 A;  4OLD A;  1JTG A;  4E6X A;  3GSG A;  4YFM A;  1D06 A;  3EOI A;  5CHJ A;  3R7W B;  3DW0 A;  3N7W A;  2ZC6 B;  4I3A A;  2VV8 A;  3SS5 A;  1CJF A;  2A3U A;  2PBD P;  2ZM2 A;  2PT7 A;  3ZNY A;  1S1Y A;  1CEG A;  3SOI A;  4ZJ1 A;  1ONH A;  4KUO A;  3NBL A;  4KG6 A;  2QWS A;  4IBX A;  3DTK A;  2WGW B;  5FEG A;  4MBH A;  1YQS A;  3CUE C;  1K56 A;  4S2N A;  1GA9 A;  2PHY A;  2Y2J A;  5HX9 A;  3MFX A;  3CG5 A;  1W7F A;  4QU3 A;  3QP8 A;  3UDF A;  3A0S A;  5IHV A;  4WM9 A;  3PTE A;  4AFI A;  1I5Q A;  1ESI A;  3K3D A;  1JNU A;  3BLS A;  1K4E A;  4WBG A;  4OQI A;  5FQJ A;  4QB8 A;  1JWP A;  4ETZ A;  4P85 A;  3QHY A;  1K56 D;  2G7U A;  2JKR I;  5CXW A;  2J3W A;  3MMH A;  2WKI A;  3LFV A;  2IWB A;  3V39 A;  3BFE A;  3BFF A;  4S2N C;  1XKZ A;  2R9W A;  1SKO A;  1MWR A;  4LRX C;  2JC7 A;  4Y13 A;  4RA7 A;  3L7H A;  4ME4 A;  3FYZ A;  1W5D A;  4OPR A;  2NUP C;  2LB5 A;  3PAG A;  3HLB A;  4IHQ A;  3T1R A;  2KLI A;  3H82 B;  1K6S A;  2EX6 A;  2J3T D;  1FIL A;  3UNW A;  5GHZ A;  2V9A A;  4U3T A;  4UEY A;  1H0M A;  4K0X A;  4HH2 A;  1KE3 A;  3OBF A;  2Y55 A;  3A3F A;  4HH3 A;  2J3T C;  2XSS A;  4EES A;  4OPZ A;  3MXQ A;  3MFD A;  3ZG8 B;  2BAS A;  4KZ3 A;  3O87 A;  1TVF A;  3DWK A;  1OTI A;  3WS0 A;  1ZHH B;  3EQU A;  5EVE A;  2PBY A;  5CHU A;  5CEC A;  2PR6 A;  2W3H A;  4JGR A;  1TS0 A;  3PAE A;  4E3L A;  3BEB A;  2ZQ7 A;  4R4S A;  5EVI B;  3VOZ A;  3SS3 A;  2UV0 E;  5L2F A;  4MLL A;  4GN2 A;  3Q7Z A;  1YMS A;  4GS9 A;  2XLN A;  3IBR A;  5DF8 A;  3C38 A;  5HAR A;  3ICY A;  1N9O A;  4NEE D;  4LV2 A;  4L9F A;  3IH9 A;  1KGE A;  5KSH A;  3FKV A;  5M19 A;  1L0E A;  1LSW A;  2XFS A;  4KZ8 A;  2ZQ9 A;  4D60 A;  1PWC A;  1K0K A;  1V9Z A;  1AXB A;  1JTD A;  2XFT A;  5EV0 A;  1SHV A;  2VK3 A;  3JVU A;  3IX4 A;  4K0W A;  3PR6 A;  3HRE A;  3CWF A;  3B42 A;  2JE5 A;  4KZ4 A;  4BL2 A;  1YKD A;  1LL5 A;  1VQQ A;  2W1T B;  1PIO A;  4K08 A;  3FV7 A;  1S1Z A;  4P87 A;  1SZV A;  4Y0U A;  1PZP A;  5M18 A;  4WN5 A;  4G3W A;  4BWI A;  4Y5F A;  1P97 A;  1VHM A;  5GLD A;  5FDH A;  3VP3 A;  4X1M A;  2VEA A;  2R9X A;  3G4P A;  1MBL A;  5HDC A;  1SKO B;  5A91 A;  5AQB A;  3MQ0 A;  3Q82 A;  2JN7 A;  4QJG A;  1HVB A;  1OTA A;  1VB6 A;  1KDW A;  2EWW A;  5FEF A;  1EW0 A;  3CPT A;  4Z9Q A;  3IHA A;  4KZA A;  1PZO A;  4EUV A;  5KZH A;  1YT4 A;  1WA9 A;  2P7J A;  4L0L A;  1FIK A;  3RJU A;  1CI8 A;  4GJ4 A;  4LV0 A;  2AVX A;  2HDQ A;  1Y4O A;  1KDS A;  3FWL A;  4EER A;  2HJ9 C;  5FI7 A;  4JF5 A;  5L10 A;  4OKP A;  2WKP A;  1T19 A;  2CMN A;  3UPN A;  1DJB A;  5CX7 A;  1E4D A;  2HPB A;  4XT2 B;  5CTN A;  3BFG A;  5AQ9 A;  4CLC B;  1A0K A;  2V0U A;  3FZC A;  3GMW A;  3WRZ A;  3SZT A;  4ID4 A;  3HBR A;  1YSP A;  1DJC A;  2G2U A;  2Y79 A;  1XJ4 A;  4Y17 A;  3ZFZ A;  4WMC D;  3RH8 B;  5DKK A;  3SW1 A;  1GHI A;  5EE8 A;  1VM1 A;  3VP4 A;  3RXX A;  3NCK A;  2M7U A;  3K2N A;  2VLG A;  4OQH A;  5E2E A;  1XFN A;  3E0Y A;  3ITA A;  1QMF A;  4HI4 A;  3MQQ A;  4GDN A;  1PWG A;  3GRJ A;  4PM9 A;  1QME A;  2VX8 A;  1XX2 A;  3FG8 A;  1XJ6 A;  2JKF A;  3WS4 A;  1MWU A;  2WKH A;  3SH9 A;  2P9V A;  1Y54 A;  1IYS A;  4FCF A;  3A3D A;  3SH8 A;  1K25 A;  2DMW A;  5J4E A;  4LRZ E;  5F83 A;  1K4F A;  3NI9 A;  2XRO A;  1LHY A;  3CHW P;  3T4K A;  3VFF A;  1XGI A;  4S2O A;  5FSR A;  3NC8 A;  5HWT A;  4DE1 A;  3LR3 A;  3KYQ A;  2EXB A;  4S2L A;  1FSY A;  5FDS A;  2E8J A;  3UE0 A;  5J8X A;  3OCN A;  3UMD A;  4R4R A;  3IS2 B;  4E04 A;  4O8G A;  1OTE A;  1JVJ A;  1BLS A;  2B95 A;  2V1A A;  4H6J B;  2VGK A;  4Y7P A;  3VOL A;  3F1N A;  1IYQ A;  4QHC A;  2PYR A;  4OPQ A;  2PR5 A;  5HAP A;  3F1P A;  4R38 A;  3UDX A;  4OLG A;  4QY5 A;  2R78 A;  4OQ0 A;  5FA7 A;  1TDG A;  4KG2 A;  3CI6 A;  1RP5 A;  4I5S A;  2H0Y A;  4N92 A;  1Z09 A;  3NUL A;  3CPT B;  2ZC4 B;  1G68 A;  3WS1 A;  4KZ6 A;  5HDS A;  1RGZ A;  3CAX A;  2WKQ A;  1ES2 A;  2HDS A;  3W4Q A;  3VV4 A;  2BTF P;  3VSL A;  3ZG9 B;  4LPZ A;  1LI9 A;  1ZTU A;  2GJ3 A;  4XUZ A;  2IWC A;  4F94 A;  5FAT A;  1IEL A;  5DJT A;  3PHY A;  1YLY A;  3E4Q A;  2OV5 A;  4DE3 A;  3A0V A;  1E3U D;  1IKI A;  3G31 A;  2FFY A;  4K91 A;  4O01 A;  3M6H A;  4HY8 A;  3IF5 A;  1P9W A;  3CZD A;  2ZC7 A;  2P74 A;  4UQI S;  3G30 A;  5KSC A;  2C6W B;  1ODV A;  4EBL A;  3MBZ A;  2LB9 A;  1K54 A;  1PI4 A;  4Q0I A;  3V67 A;  3OCL A;  4PKY G;  4HHD A;  3S7O A;  4NXG A;  4ARZ A;  4XUX A;  1T18 A;  1XFQ A;  3G2Z A;  1BTL A;  4EBP A;  1L0F A;  4FH4 A;  5A90 A;  4KZB A;  2ZM0 A;  4LV1 A;  3UPO A;  1CK3 A;  3FC7 A;  2RCX A;  3OPP A;  5U47 A;  5IS1 A;  5HPF A;  1L0D A;  2H0T A;  3RXW A;  1F5M A;  2PDR A;  3DTM A;  1FOF A;  3H9W A;  3IT9 A;  3PBN A;  3IXG A;  5E43 A;  3OPL A;  1K54 C;  3S7N A;  4X53 A;  2OOL A;  1I2S A;  3BY9 A;  1TS6 A;  3KO6 A;  4S2I A;  3VP1 A;  1MY8 A;  1BZA A;  1ZKJ A;  3LIB A;  4QWO A;  4DDY A;  4LEN A;  2Y59 A;  4PHT A;  2C5W B;  1MWS A;  4B4X A;  2OSU A;  2J9P A;  4GOG A;  4GNU A;  2J8Y A;  1XXM A;  3MZD A;  2ACG A;  3G34 A;  2HV1 A;  4KQQ A;  3MZE A;  3WS5 A;  1NJ4 A;  5FAO A;  5IT5 A;  2ZL1 A;  1YLP A;  2X01 A;  1FR1 A;  3F1N B;  2PU2 A;  4JGP A;  3F1P B;  1ZG6 A;  4WLA A;  1F98 A;  3ISG A;  5FAS A;  2B5R A;  2W3E A;  3HJI A;  4MBF A;  1YLZ A;  3MZF A;  4X56 A;  2M1C A;  5EVI D;  4A5R A;  4E6W A;  5HSQ A;  3GV9 A;  3NOP C;  3HLW A;  3F1O B;  4ZBE A;  4B88 A;  1TD5 A;  2VGL S;  3T1S A;  3LR5 A;  4E3I A;  1W8Q A;  5I5L A;  2MJ6 A;  4EWF A;  3KSG A;  4DF6 A;  2D02 A;  4GLQ A;  3UME A;  4X55 A;  4EUZ A;  3MF0 A;  1DJA A;  1ES5 A;  4DJ3 A;  5AQA A;  2ZM8 A;  1L0G A;  2H28 A;  2WK0 A;  2Y8H A;  3Q7V A;  4EQ1 A;  1OT9 A;  4DDS A;  4DN0 A;  1LSX A;  5I94 A;  4GW9 A;  1OTD A;  3TOI A;  2E8I A;  4FOF A;  5EM0 A;  2WGI A;  3VP0 A;  3LIA A;  3BEC A;  2Q9N A;  2QHK A;  1MC0 A;  2G2W A;  3G2Y A;  1XGJ A;  2VA0 A;  1DP9 A;  5CRF A;  5HZH A;  4OVD A;  4JGQ A;  4YOF A;  5EOO A;  4G3K A;  1DP6 A;  1S4S A;  4R1G A;  1IOU A;  5KIZ A;  3NJA A;  1UGU A;  4NXB A;  4R23 A;  4L9E A;  3HVF A;  4S2K A;  1BUL A;  4O0P A;  4Y15 A;  2XD5 A;  5TBM A;  5FAQ A;  1U60 A;  1H8Y A;  2ZBB A;  4OOL A;  2W0N A;  1CI9 A;  1RGY A;  4PMA A;  2OWH A;  3D3O A;  3BFC A;  1VET A;  2PU4 A;  5FI6 A;  4CPK A;  2QJ5 A;  3NY4 A;  3HLF A;  1YSQ A;  4FTX A;  4GD6 A;  5FQM A;  5J3W A;  3S7Q A;  3T4Q A;  1H5X A;  5EFW A;  2OLU A;  2Q0O A;  5EVL A;  3E2K A;  4IVK A;  3ZQ5 A;  4U0T A;  1EI5 A;  4MN6 A;  2VJW A;  2ZL1 B;  5AQ7 A;  4XXR A;  2OAP 1;  1K38 A;  3T1X A;  3C2W A;  4MEZ A;  2B02 A;  2ZQD A;  3K3C A;  1GSX A;  2ZMV A;  3ZVW A;  5CGS A;  1ONG A;  1XJ3 A;  2HDR A;  3NDE A;  1TS8 A;  4CLC D;  5A92 A;  3ZDJ A;  4DXC A;  4BD1 A;  1OTB A;  3OZH A;  1NWZ A;  1ZC2 A;  2X02 A;  4X25 A;  5FI2 A;  3B33 A;  2CC1 A;  1XJ2 A;  3EWK A;  5DF9 A;  1I2W A;  3HLC A;  1JWZ A;  2GZA A;  2DNS A;  3UB6 A;  2HP5 A;  3M2J A;  4LV3 A;  4JBF A;  3C7U A;  5F1F A;  4N1X A;  3QNC A;  2KOI A;  1O07 A;  2W3G A;  2W3D A;  4MN5 A;  4MN7 A;  1KVM A;  2H10 A;  2IA2 A;  3Q7V B;  3UY6 A;  4C6Y A;  4Y0T A;  2Y2Q A;  4RYE A;  3ZG0 A;  4BMW A;  4E3O A;  3T4L A;  3G32 A;  5A93 A;  3G6O A;  4RQ9 A;  1LI0 A;  1TEM A;  3HCY A;  1X0O A;  1BLH A;  4BQM A;  1PW8 A;  2ZQ8 A;  2JKG A;  4WL9 A;  3KSI A;  3GVB A;  3T4T A;  1HTZ A;  2IWD A;  4GKU A;  5LBR A;  4BBU A;  1BYW A;  3LID A;  4X6T A;  3EGX C;  4H8R A;  2WAE A;  4IED A;  4MBK A;  4Q8I A;  3LY3 A;  3ULF A;  1YM1 A;  1MXO A;  4UQI M;  3E98 A;  3LCE A;  2YKH A;  4DKI A;  4Q0J A;  5TBM B;  4N9K A;  3ZYT A;  4WMC A;  5CTM A;  1NYY A;  5CGW A;  4PM6 A;  1E25 A;  4R3J A;  4Y0O A;  3KSH A;  2EWV A;  3T12 B;  1J9M A;  1WYB A;  3PXP A;  3LY4 A;  1KE4 A;  5GLC A;  2Q9M A;  1N9L A;  5KMW A;  1VET B;  3ZVT A;  5A8B A;  2PD7 A;  4WZ4 A;  4X1L A;  2O9B A;  1GSV A;  1H8Z A;  1ALQ A;  2JCH A;  3BJN A;  2W1R A;  3N4I A;  5HL6 A;  2ZMA A;  1TDL A;  4D2O A;  2FFF B;  4UAA A;  4GS9 B;  3TJZ C;  5M1A A;  4P6B A;  3WRT A;  4G3V A;  3IWI A;  3UO9 A;  2WZX A;  4PM5 A;  1MWT A;  4ZJ3 A;  3UB9 A;  3UE3 A;  4B93 A;  3HUO A;  3AGF A;  3O86 A;  1YAX A;  2XQZ A;  1BUE A;  5F5Y A;  3GTC A;  4IUH A;  4OQG A;  2PAV P;  1C3B A;  5MC7 A;  3QP4 A;  4QD4 A;  2ZD8 A;  4B9O A;  5F1G A;  4DXB A;  4PKY A;  2VGJ A;  3C4O A;  2QPN A;  1VEU A;  2KDK A;  4KG5 A;  4Z1W A;  3W4O A;  2EFX A;  1Z6F A;  3N6I A;  3UPP A;  4KQR A;  1PRQ A;  3JPU A;  1G28 A;  3H7W A;  3HL9 A;  4JXV A;  2EX2 A;  2JKT M;  1FR6 A;  3CJM A;  2XGN A;  4QPR A;  3U4L P;  2UWX A;  4WEJ A;  1NRJ A;  2ZC5 B;  1N4O A;  1FSW A;  2NUT C;  3IX3 A;  2VGL M;  2EXA A;  1GA0 A;  3LUQ A;  1UWP X;  3DWZ A;  4ZAM A;  2KX6 A;  3G35 A;  4YNR A;  3V3R A;  1OJ5 A;  3QP6 A;  4M3K A;  2OWJ A;  3R7W A;  3IWQ A;  3T4O A;  2EA9 A;  3N8R A;  2L0W A;  3V3S A;  4UA9 A;  4DMZ A;  3OLO A;  2HDU A;  1PYY A;  3DTE A;  3O5Y A;  2ZC3 B;  4P6Z S;  3S4X A;  1E3U A;  4NXF A;  1IYP A;  4HQA A;  3DAV A;  3IXH A;  4R3B A;  1DRM A;  4Y2F A;  5FQQ A;  4MNR A;  3E4O A;  3IWO A;  5F82 A;  3VMA A;  2WGW A;  4LCL A;  3TW8 A;  4R70 A;  5HPI A;  5F6A A;  3I7J A;  4JF4 A;  3S7P A;  3QP5 A;  3CLO A;  3LIF A;  5DVA A;  3L9K A;  3VP2 A;  4R3A A;  1TF1 A;  1O7E A;  3HLD A;  2Y2K A;  1MZU A;  1NYM A;  3IX8 A;  3LGO A;  1GSW A;  2PYP A;  5G4Y A;  1FCM A;  5E2F A;  4PAU A;  4HEF A;  3ZG5 A;  4NK3 A;  1KE0 A;  4N9L A;  3BM6 A;  1PI5 A;  5K5B A;  3C5A A;  2XH9 A;  3IXD A;  4UHU A;  4OP8 A;  2VKS A;  2A24 A;  4JLF A;  1MPL A;  1YLJ A;  5TFQ A;  3BQ8 A;  5F69 A;  2K31 A;  4I38 A;  4E3M A;  3P7N A;  3V50 A;  1S4R A;  2JKR M;  4IUK A;  2A2L A;  2GX5 A;  4QY6 A;  4FH2 A;  2J7V A;  2P9V B;  3LI8 A;  1F9I A;  2I72 A;  4ZDX A;  4DJ2 A;  3S22 A;  4NG2 A;  3ZHH A;  3GDI A;  4WUJ A;  4OOY A;  2L1M A;  1T1B A;  4JXG A;  5AJG A;  3T4J A;  3VSK A;  3FPW A;  3KX0 X;  3GR2 A;  1IFQ A;  3H7W B;  1SKF A;  5CHM A;  4DE2 A;  5GLA A;  5L09 A;  5EVI A;  4KZ5 A;  5BOH A;  1TS7 A;  4UA7 A;  3MKE A;  3E2L A;  2Y2H A;  4CJN A;  1L3L A;  2V1Z A;  5TJJ A;  3PBS A;  1GHM A;  2P08 A;  1DP8 A;  1V9Y A;  4R6L A;  1YMX A;  2PRF A;  5C5K A;  2H5S A;  5HWW A;  3KYZ A;  4BEN A;  3D9Y A;  1J3W A;  4LGW A;  4I39 A;  5HFO A;  5FL3 A;  3MQO A;  1ERO A;  3D72 A;  1G5U A;  4HJ4 A;  5TR7 A;  2ZOH A;  3JVV A;  1YLW A;  1CQA A;  1KGF A;  5EVI C;  4WZ5 A;  5CEB A;  1NLY A;  2PD8 A;  1G6O A;  2WZZ A;  5HWV A;  3B3X A;  5GHY A;  2WKR A;  2XA7 S;  4KUK A;  5EEC A;  3T1Q B;  5FAP A;  2OLV A;  2INW A;  3ZGA B;  3SH7 A;  3TG9 A;  2Y2I A;  5HD5 A;  4EW7 A;  2W1T A;  1OT6 A;  2ZMF A;  2Z2L B;  3IF6 A;  2WGV A;  1FCO A;  4WEK A;  1WYC A;  1S6R A;  3DTI A;  4DRT A;  2JHE A;  5DTT A;  3OC2 A;  3KYE A;  2V8F A;  4WZ5 C;  2XR0 A;  1Q2P A;  1NY0 A;  3UE1 A;  2VZW A;  4N1H A;  4BD0 A;  4HES A;  4EQI A;  3PBQ A;  3ZG7 B;  4OH0 A;  1AWI A;  2A24 B;  3FPV A;  4KQD A;  2QJ7 A;  4LLO B;  4LFU A;  1PW1 A;  4X69 A;  4OPY A;  4R0Q A;  4CLC E;  2W27 A;  3P09 A;  3Q07 A;  5DFX A;  2WYX A;  4ARZ B;  4E3K A;  4GCZ A;  4JPM A;  2VV7 A;  4OON A;  3IF6 C;  3MXR A;  4JKT A;  3W4P A;  4HP9 A;  3D4F A;  1P0Z A;  5DTS A;  3P01 A;  4WF0 A;  1PFL A;  4LRY C;  2I9V A;  3MSH A;  1RCJ A;  2XRN A;  1NZU A;  3A3E A;  2Y2G A;  3HLE A;  3UB8 A;  3BQA A;  5JYP A;  1OPX A;  4BLM A;  3M6B A;  4NXE A;  2ZLY A;  1YPR A;  5FQ9 A;  5HL1 A;  4IVI A;  4OOM A;  4ESP A;  3NIA A;  3PYP A;  2XEP A;  3NOT C;  2JBF A;  5AVE A;  3BLM A;  1L2S A;  2XF3 A;  3C4P A;  4KZ7 A;  4XT2 A;  3IH8 A;  3SS4 A;  4CLC A;  3M2K A;  5EOE A;  5CGX A;  4ZJ2 A;  2HF6 A;  2Y2N A;  1IKG A;  3QP1 A;  1Q2Q A;  4GD8 A;  4JGO A;  2FH5 A;  3TSG A;  2W3F A;  1M6K A;  4HJ3 A;  3AGE A;  2YKF A;  1GCE A;  1T1A A;  3HJK A;  3A0R A;  2EX8 A;  4IJG A;  2OAQ 1;  5E2G A;  1LLB A;  1UWN X;  1JWV A;  1BT5 A;  4FUW A;  4OP5 A;  1S67 L;  2Y91 A;  3NOU C;  3VE3 A;  4WEL A;  3ZCZ A;  4MDZ A;  3T4S A;  4CLC C;  1XP4 A;  1ES3 A;  2Y2P A;  2FZ0 A;  5EM1 A;  1PWD A;  2QKP A;  1OJG A;  1KVL A;  3Q1F A;  1N9B A;  2O99 A;  4HOI A;  1FCN A;  4C3Q A;  1ESU A;  4U0X A;  4I3J A;  3PBO A;  4P6Z M;  4JF6 A;  5E2H A;  1XPB A;  4EET B;  4ZRR A;  4LCM A;  3TE8 A;  3IF6 B;  3NEC A;  4PM8 A;  3IS2 A;  3MJQ A;  4EEU A;  2XD1 A;  1ZG4 A;  3IQA A;  4JXW A;  4X68 A;  2WUQ A;  2DRW A;  1GHP A;  1HZO A;  5CER A;  4C75 A;  3VOY A;  1EWZ A;  1W63 M;  4H6J A;  2Y2L A;  1ACF A;  1SDE A;  3IBJ A;  3EEH A;  2J9O A;  1HD8 A;  3T50 A;  4ETX A;  3OPR A;  4KZ9 A;  4YIN A;  1K55 A;  3OPH A;  1ES4 A;  1NZO A;  5EUA A;  3TRC A;  1IYO A;  3C30 A;  3UB7 A;  2RL3 A;  1BSG A;  3LYX A;  1H8M A;  4E3N A;  4HIA A;  3OOV A;  4S2M A;  3W2Z A;  4GB7 A;  3LR0 A;  1SCW A;  3UDI A;  3UN7 A;  1CF0 A;  4HNB A;  1IEM A;  2WAF A;  4B4Z A;  3BYD A;  1LL8 A;  1F2K A;  4Q0H A;  1W79 A;  2GNX A;  5FQI A;  3B47 A;  4MCW A;  3AGD A;  3NDG A;  5GL9 A;  3U2A A;  5L8M A;  3A3I A;  1K55 C;  4MMN A;  4HP4 A;  1OME A;  4BBT A;  1K57 A;  2DCF A;  5HW3 A;  1MKM A;  2WKE A;  3C7V A;  4IBR A;  3RFB A;  2Z2M B;  1W63 Q;  1K6R A;  4F3L A;  3IHB A;  4GZB A;  1LL9 A;  3S1Y A;  2Z6D A;  3GEC A;  5JYO A;  1Y28 A;  1M40 A;  3HLG A;  2QMI A;  5FQK A;  4GHI A;  4EBN A;  3E4P A;  3EEA A;  1MKI A;  3CIT A;  2EFU A;  1ERQ A;  2ZQC A;  2L4R A;  3ITB A;  1WE4 A;  2HZ5 A;  1K57 C;  3CMZ A;  4CQH A;  2QYB A;  5HD3 A;  5CED A;  1ERM A;  2GDN A;  1N9N A;  2O9A A;  3W8K A;  4RVA A;  2K7S A;  2HP6 A;  4PPR A;  5DTK A;  1T1C A;  3BRM A;  2O9C A;  3LIE A;  5EPH A;  2J80 A;  3HUM A;  5L07 A;  4EXO A;  3BFD A;  1D1J A;  2Y4A A;  5DKL A;  1S66 L;  3A3J A;  4EEP A;  3BW6 A;  3PBT A;  1XA7 A;  4EV4 A;  2QZ6 A;  3PBR A;  3UB5 P;  3QP2 A;  3LIC A;  4DE0 A;  1NXY A;  3EGD C;  5DFY A;  2XA7 M;  4BBV A;  2B18 A;  3N8S A;  2BLS A;  3Q81 A;  2ZOI A;  2ZJ9 A;  2Y2M A;  4P0M A;  4EU0 A;  4HBT A;  3LI9 A;  2EX9 A;  1NRF A;  1LSV A;  2HJE A;  3LR4 A;  4HBU A;  3O88 A;  3VFH A;  3P98 A;  3WS2 A;  4HJ6 A;  1KOU A;  3LEQ A;  4RX3 A;  4E3J A;  1CEF A;  3MXS A;  4UA6 A;  4PM7 A;  2V1B A;  3JYI A;  3QNB A;  4BL3 A;  2P04 A;  2X71 A;  1BLC A;  3EQV A;  2HGV A;  2M7V A;  2V20 A;  1STZ A;  1LT0 A;  5GLB A;  3F1O A;  4GDB A;  2V0W A;  1S0W A;  3MR0 A;  5IU1 A;  3MKF A;  3VE4 A;  3ZNT A;  2ZQA A;  3KSF A;  3WWX A;  3MS6 A;  2WAD A;  4S2J A;  4RX2 A;  3BWL A;  3IXB A;  5DJU A;  5TGF A;  2V2F F;  1DY6 A;  5HAQ A;  2Y2O A;  5G4Z A;  5AVF A;  4BJP A;  4FD8 A;  5J7E A;  2O0Y A;  4II7 A;  2XDM A;  4ZTK A;  4L9G A;  1G6A A;  3LO7 A;  3C8C A;  1KGG A;  2XK1 A;  4NKP A;  4O7D A;  2VV6 A;  4F3L B;  4I3I A;  4WYY A;  3N8L A;  2Z6C A;  4JXS A;  5HAI A;  1D7E A;  3UE6 A;  1XA1 A;  3O3V A;  3GQZ A;  3R4K A;  3H82 A;  5D3O A;  4GHI B;  1H3Q A;  5DF7 A;  4FSF A;  1HLU P;  2JKT I;  3DBA A; 
#chains in the Genus database with same CATH homology
 3FPV A;  2IA2 A;  4KQD A;  2QJ7 A;  4LLO B;  5HWT A;  3LR3 A;  4CLC E;  2W27 A;  5DFX A;  4ARZ B;  4BMW A;  3KYQ A;  4GCZ A;  3T4L A;  2VV7 A;  1P9R A;  3RTY A;  3OCN A;  4HP9 A;  3UMD A;  3BY8 A;  3G6O A;  3IS2 B;  4RQ9 A;  1P0Z A;  3HCY A;  3P01 A;  4E04 A;  4WF0 A;  1X0O A;  2K2N A;  4LRY C;  4O8G A;  2I9V A;  1OTE A;  2D01 A;  2V1A A;  2XRN A;  3NHQ A;  4H6J B;  3VOL A;  5F68 A;  3UB8 A;  4WL9 A;  3F1N A;  3KSI A;  3BQA A;  2PYR A;  4Y3I A;  3T4T A;  1OPX A;  2PR5 A;  5LBR A;  4NXE A;  4KQO A;  4BBU A;  3F1P A;  1BYW A;  3LID A;  5HDD A;  3EGX C;  4R38 A;  4M4X A;  4OOM A;  1NLZ A;  2R78 A;  3CUE A;  4YWZ A;  3PYP A;  3ULF A;  3NOT C;  4UQI M;  3E98 A;  2YKH A;  5AVE A;  3CI6 A;  4I5S A;  4Q0J A;  5TBM B;  1D06 A;  3ZYT A;  3EOI A;  3R7W B;  4XT2 A;  5HDS A;  3CAX A;  2WKQ A;  4I3A A;  3KSH A;  4CLC A;  2EWV A;  2VV8 A;  3VV4 A;  3PXP A;  4LPZ A;  2HF6 A;  2PT7 A;  1N9L A;  1S1Y A;  4JGO A;  2FH5 A;  1ZTU A;  5A8B A;  2PD7 A;  2GJ3 A;  2W3F A;  4KUO A;  2O9B A;  4HJ3 A;  1GSV A;  2QWS A;  2YKF A;  3BJN A;  1T1A A;  2W1R A;  3HJK A;  3A0R A;  3CUE C;  5HL6 A;  4IJG A;  5DJT A;  3PHY A;  2PHY A;  3E4Q A;  3A0V A;  2OAQ 1;  1UWN X;  3MFX A;  4GS9 B;  3TJZ C;  4G3V A;  1S67 L;  3VE3 A;  3NOU C;  4O01 A;  3A0S A;  4WEL A;  4HY8 A;  4AFI A;  4MDZ A;  3T4S A;  4CLC C;  1P9W A;  3K3D A;  1JNU A;  3UB9 A;  3UE3 A;  2FZ0 A;  2QKP A;  4UQI S;  1OJG A;  4B93 A;  4ETZ A;  1ODV A;  2O99 A;  4HOI A;  2G7U A;  1YAX A;  2LB9 A;  2JKR I;  2J3W A;  3MMH A;  5F5Y A;  4IUH A;  4Q0I A;  3V67 A;  4I3J A;  3LFV A;  5MC7 A;  3OCL A;  3PBO A;  4B9O A;  4P6Z M;  4PKY G;  4HHD A;  4PKY A;  3S7O A;  4NXG A;  4ARZ A;  4LRX C;  2KDK A;  1T18 A;  1XFQ A;  4EET B;  4Z1W A;  4ZRR A;  3TE8 A;  4ME4 A;  2A24 B;  3IS2 A;  3MJQ A;  4EEU A;  2NUP C;  2LB5 A;  3FC7 A;  4IHQ A;  5IS1 A;  2KLI A;  1G28 A;  3H7W A;  5HPF A;  2JKT M;  3H82 B;  1W63 M;  4H6J A;  1F5M A;  2J3T D;  2PDR A;  4QPR A;  3IBJ A;  2V9A A;  3EEH A;  3H9W A;  4UEY A;  3T50 A;  3PBN A;  4ETX A;  4WEJ A;  3S7N A;  1NRJ A;  4HH2 A;  2OOL A;  3OBF A;  3BY9 A;  2NUT C;  1TS6 A;  2J3T C;  2VGL M;  3KO6 A;  4HH3 A;  2XSS A;  4EES A;  3MXQ A;  3LUQ A;  3LIB A;  1UWP X;  2BAS A;  2KX6 A;  4YNR A;  1OJ5 A;  4PHT A;  3TRC A;  2OWJ A;  3C30 A;  3UB7 A;  1OTI A;  3R7W A;  3T4O A;  2EA9 A;  3LYX A;  1H8M A;  2L0W A;  1ZHH B;  3EQU A;  4HIA A;  4DMZ A;  3OLO A;  3OOV A;  3W2Z A;  3LR0 A;  2HV1 A;  3O5Y A;  4P6Z S;  2PR6 A;  2W3H A;  4HNB A;  1TS0 A;  4JGR A;  5IT5 A;  4NXF A;  1LL8 A;  4HQA A;  4Q0H A;  3F1N B;  2GNX A;  1DRM A;  4Y2F A;  3B47 A;  4MCW A;  4JGP A;  3E4O A;  3F1P B;  4WLA A;  3U2A A;  1F98 A;  3TW8 A;  5L8M A;  4R70 A;  4MMN A;  5HPI A;  4HP4 A;  5F6A A;  4BBT A;  2W3E A;  3HJI A;  3S7P A;  3CLO A;  1MKM A;  2M1C A;  3LIF A;  4GS9 A;  5HSQ A;  3IBR A;  4R3A A;  3C38 A;  1TF1 A;  1N9O A;  3ICY A;  3NOP C;  4NEE D;  3RFB A;  3F1O B;  1MZU A;  4L9F A;  1W63 Q;  1TD5 A;  1GSW A;  2VGL S;  4F3L A;  3LR5 A;  5KSH A;  2PYP A;  5I5L A;  2MJ6 A;  5G4Y A;  2Z6D A;  3GEC A;  1Y28 A;  1LSW A;  3KSG A;  4PAU A;  2D02 A;  1V9Z A;  4GLQ A;  4GHI A;  3UME A;  3E4P A;  3EEA A;  3MF0 A;  3CIT A;  5K5B A;  3JVU A;  2L4R A;  4DJ3 A;  2VKS A;  2H28 A;  2A24 A;  3PR6 A;  3CWF A;  4CQH A;  3B42 A;  2Y8H A;  2QYB A;  5HD3 A;  4EQ1 A;  1OT9 A;  1YKD A;  4DN0 A;  1N9N A;  1LSX A;  2O9A A;  2W1T B;  3BQ8 A;  4GW9 A;  1OTD A;  4K08 A;  2K7S A;  5F69 A;  2K31 A;  4I38 A;  1S1Z A;  3P7N A;  1S4R A;  4FOF A;  2JKR M;  4WN5 A;  4G3W A;  1T1C A;  4BWI A;  4IUK A;  4Y5F A;  2A2L A;  3LIA A;  2GX5 A;  2O9C A;  3LIE A;  2J80 A;  2QHK A;  1MC0 A;  1P97 A;  1VHM A;  4EXO A;  2VA0 A;  3LI8 A;  1F9I A;  1DP9 A;  5DKL A;  1S66 L;  5HZH A;  4JGQ A;  4YOF A;  4DJ2 A;  2VEA A;  4EEP A;  3BW6 A;  3PBT A;  5HDC A;  4G3K A;  1DP6 A;  1S4S A;  1IOU A;  5KIZ A;  3NJA A;  3PBR A;  3MQ0 A;  3LIC A;  3GDI A;  2JN7 A;  3EGD C;  1UGU A;  4NXB A;  5DFY A;  4L9E A;  1OTA A;  1VB6 A;  4WUJ A;  2XA7 M;  4BBV A;  4O0P A;  2B18 A;  2L1M A;  1T1B A;  5TBM A;  2EWW A;  5AJG A;  3T4J A;  1EW0 A;  2ZOI A;  3FPW A;  3KX0 X;  3H7W B;  1IFQ A;  4EU0 A;  4EUV A;  3LI9 A;  1TS7 A;  1LSV A;  2HJE A;  3LR4 A;  1WA9 A;  2P7J A;  2ZBB A;  4OOL A;  2W0N A;  4L0L A;  4HJ6 A;  1KOU A;  2OWH A;  3D3O A;  5TJJ A;  3PBS A;  4GJ4 A;  2P08 A;  1DP8 A;  1V9Y A;  2V1B A;  4R6L A;  4EER A;  2HJ9 C;  2QJ5 A;  1YSQ A;  5J3W A;  2P04 A;  5C5K A;  2WKP A;  3S7Q A;  3EQV A;  2HGV A;  2M7V A;  5HWW A;  3KYZ A;  1T19 A;  3T4Q A;  1STZ A;  1LT0 A;  4I39 A;  3F1O A;  2CMN A;  5EFW A;  5FL3 A;  3ZQ5 A;  2V0W A;  3MQO A;  3D72 A;  4HJ4 A;  5CX7 A;  4XT2 B;  2ZOH A;  3MR0 A;  5IU1 A;  4MN6 A;  2VJW A;  3VE4 A;  3JVV A;  3KSF A;  4CLC B;  1NLY A;  2OAP 1;  2PD8 A;  2V0U A;  1G6O A;  3BWL A;  5HWV A;  1YSP A;  2WKR A;  5DJU A;  2XA7 S;  4KUK A;  2Y79 A;  3C2W A;  1XJ4 A;  2INW A;  3RH8 B;  2B02 A;  3K3C A;  5DKK A;  1GSX A;  2ZMV A;  5G4Z A;  5AVF A;  4BJP A;  3SW1 A;  5J7E A;  2O0Y A;  4II7 A;  1XJ3 A;  4CLC D;  1TS8 A;  4L9G A;  3C8C A;  1OTB A;  5HD5 A;  4EW7 A;  4NKP A;  1NWZ A;  2M7U A;  2W1T A;  3K2N A;  1OT6 A;  2VLG A;  2ZMF A;  1XFN A;  3E0Y A;  2VV6 A;  4WEK A;  4HI4 A;  4I3I A;  3B33 A;  3MQQ A;  4F3L B;  1XJ2 A;  3EWK A;  2Z6C A;  2JHE A;  3OC2 A;  5DF9 A;  2VX8 A;  1D7E A;  3UE6 A;  3FG8 A;  1XJ6 A;  2GZA A;  3UB6 A;  3R4K A;  3H82 A;  2VZW A;  4GHI B;  3PBQ A;  1H3Q A;  2KOI A;  2W3G A;  2W3D A;  4MN5 A;  4FSF A;  4MN7 A;  2DMW A;  5J4E A;  4LRZ E;  2XRO A;  2JKT I;  3DBA A;  3T4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...