2QJ5A

Pyp ultra-high resolution of a bacterial photoreceptor
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
121
Chain Sequence
HVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
publication title Picometer-scale conformational heterogeneity separates functional from nonfunctional States of a photoreceptor protein.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 34
structure length 121
sequence length 123
ec nomenclature
pdb deposition date 2007-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2qj5A00
4JGOA 5TBMA 4HJ6A 3B33A 4R6LA 5HD3A 5F69A 2H28A 5AVEA 3MR0A 1V9ZA 3F1OA 3VE3A 5DJUA 4JGQA 4EQ1A 1N9NA 4XT2B 2KX6A 2HV1A 3T50A 5HDCA 5HWVA 2B02A 2PD7A 4EESA 2V1AA 4F3LA 4KUOA 2P7JA 2ZOHA 3UB6A 4RQ9A 1XJ6A 3E4PA 2YKFA 4NXFA 5F68A 1EW0A 5DKKA 5A8BA 2OWHA 1DP6A 2BASA 3LICA 4WUJA 5EFWA 3NJAA 1F9IA 4H6JA 5HDSA 2QJ5A 3A0VA 3K3DA 4LRXC 1TS0A 2VEAA 5HWWA 3D72A 2KDKA 1OT9A 1T1CA 2WKRA 1V9YA 3UB9A 5G4YA 2L1MA 3RH8B 3VOLA 1G28A 3LIFA 2V1BA 2A24B 3CWFA 2PDRA 1P97A 4YWZA 4WN5A 2OOLA 3H9WA 3UB7A 5IS1A 4HY8A 4E04A 1DRMA 3PYPA 4B9OA 4BBTA 2JN7A 2VLGA 3MQQA 3UE6A 4R3AA 4I39A 2QJ7A 4HQAA 3VE4A 4PKYA 4WLAA 2A24A 5IU1A 1GSWA 2WKQA 4HP4A 3LIBA 3UB8A 3F1PB 1N9OA 1D06A 3BY8A 1T1AA 4EETB 5J4EA 5I5LA 1BYWA 2QWSA 1DP9A 4LLOB 1OTEA 3ZQ5A 1LSXA 5J7EA 1S4RA 2V0UA 4HJ4A 4HH2A 1Y28A 4KQDA 4GHIB 4HNBA 1S1ZA 1XJ2A 3IS2A 2PR5A 2W0NA 2Z6CA 2PD8A 3F1PA 3P7NA 4EEUA 4LRYC 4L9GA 1DP8A 4GW9A 2V9AA 2L0WA 2K7SA 4BBUA 1P0ZA 4I3AA 1D7EA 2GJ3A 3KX0X 2INWA 3OLOA 1MZUA 2D01A 5AVFA 3ULFA 1S67L 3G6OA 4XT2A 1OJGA 3CAXA 2D02A 3MJQA 4HJ3A 3CLOA 4HH3A 4HOIA 4R70A 4WL9A 1UGUA 4I3IA 4NXEA 3E4OA 2VV6A 2YKHA 2V0WA 3SW1A 4PKYG 4HHDA 2Z6DA 1OTIA 4K08A 3A0SA 3NOPC 4DJ3A 4JGRA 1OTAA 4GS9B 3PHYA 3A0RA 3BWLA 2EA9A 1T1BA 4MN5A 3GDIA 1TS6A 5TBMB 3F1NB 1ODVA 3LI9A 3E4QA 2CMNA 3UMDA 3H82B 2VV7A 4JGPA 4I5SA 3FC7A 1KOUA 3C2WA 4M4XA 2VV8A 5J3WA 3LUQA 3HJKA 3MXQA 2ZOIA 1NWZA 3UMEA 1T19A 3BY9A 4DJ2A 4MN6A 4GS9A 2OWJA 3F1NA 4H6JB 3EWKA 3LI8A 3H82A 4I3JA 2JHEA 5G4ZA 4LRZE 1UWPX 5HD5A 1TS8A 5DKLA 5F5YA 3MFXA 1XFNA 3LIDA 5DJTA 3GECA 2I9VA 1S1YA 5KIZA 2WKPA 3LIAA 1S4SA 3EEHA 4L9FA 4NXGA 4I38A 1LSVA 4WF0A 4HI4A 2J80A 3IBRA 3FG8A 4KUKA 2ZBBA 4GHIA 5HWTA 1GSVA 1OT6A 5HSQA 1GSXA 2QHKA 3K3CA 4L9EA 3RTYA 2PR6A 2QKPA 3NOTC 1WA9A 1F98A 2R78A 4HIAA 4EW7A 4EEPA 5HDDA 2PYRA 4LPZA 3C8CA 3ICYA 3H7WB 4EXOA 1LT0A 5HZHA 2L4RA 4GCZA 3MQOA 2W27A 3NHQA 1VB6A 1OTBA 3LYXA 3HJIA 4EERA 3NOUC 3F1OB 2PYPA 1XJ4A 4R38A 4BBVA 2PHYA 1OJ5A 5F6AA 1UWNX 1LL8A 3IS2B 1T18A 4F3LB 1X0OA 1TS7A 3H7WA 2M1CA 4HP9A 1XFQA 1S66L 3LIEA 1OTDA 1LSWA 1N9LA 4NXBA 1JNUA 1XJ3A
chains in the Genus database with same CATH superfamily
1FOFA 1BULA 5TBMA 2WGWB 3B33A 4RYEA 5HD3A 5DTSA 4WZ4A 5AVEA 3W4OA 1LL9A 3VE3A 4DKIA 2HP9A 3N6IA 4XT2B 2KX6A 1K6RA 3T50A 3C5AA 5HWVA 2BTFP 2P7JA 3R7WB 4U3TA 1GHMA 2YKFA 4NXFA 3BEBA 4O7DA 2JKRM 5DKKA 3MFDA 3L7HA 5A8BA 2OWHA 3M6BA 3LICA 4WUJA 4Q0HA 3NJAA 4S2OA 3DW0A 3A0VA 1H8YA 3CPTA 5F83A 1SZVA 2VEAA 4UAAA 5HWWA 3D72A 2PT7A 1YLZA 2KDKA 1VEUB 3MSHA 2WKRA 1V9YA 1CI8A 4R4SA 4NK3A 2OV5A 3Q1FA 3ITBA 1YPRA 1NRFA 1MXOA 3DTKA 3RH8B 1K57C 4O8GA 4E3KA 1JTGA 4MBFA 2EFUA 2ZQ8A 3S7QA 3CMZA 3FZCA 4RVAA 3T4SA 2IWCA 4WN5A 4OOYA 3OPPA 1W8YA 5IS1A 1EWZA 1K38A 2XK1A 1Q2PA 1BLHA 3K2NA 4P6ZS 3RXXA 4JXSA 3UN7A 2EXBA 3FPVA 4Y5FA 1G6OA 4MBHA 3HREA 3RXWA 5FQ9A 3PBTA 1L0DA 5EM0A 1I2SA 2QJ7A 2QZ6A 1F5MA 2A24A 1MPLA 4DDSA 2WKQA 4KZ4A 4Z1WA 5FSRA 4WM9A 1N9OA 1CEGA 3CJMA 2DNSA 4YNRA 1PI4A 3LEZA 3AGDA 4WYYA 2Y4AA 5CECA 2JKGA 1WYCA 1ZG4A 2JC7A 2JBFA 3C7UA 1XA7A 3Q7VB 2H10A 2ZM0A 1YLPA 3VFFA 5CGSA 1PZPA 2ZC7A 4GHIB 3IH9A 3LR0A 4DMZA 1ZG6A 3VOYA 3FWLA 4X25A 1F2KA 1LI9A 2ZC5B 5HW3A 3UB5P 5CTMA 1DP8A 2ZJ9A 2A2LA 1G68A 2V9AA 5FI6A 5AQBA 3NCKA 1I2WA 2WAFA 4CLCC 2L0WA 2K7SA 1PI5A 4BBUA 1P0ZA 1KE0A 4I3AA 3FPWA 1NXYA 2GJ3A 1MZUA 1KVMA 4KZ9A 5HARA 1K4FA 2V2FF 2Q9NA 1RP5A 1OJGA 4BJPA 3CAXA 3VP1A 3IHBA 1AWIA 1O07A 3QP2A 1MC0A 3G30A 2UWXA 1NRJA 3E4OA 3IWOA 3SW1A 1BLSA 1SKOA 2WZZA 4IVKA 3A0SA 3N8SA 2J9OA 4B88A 2FFYA 3SH9A 4WEKA 2QMIA 4C6YA 4GS9B 3BWLA 1T1BA 1TD5A 3GDIA 3M2KA 3QHYA 3MBZA 3O3VA 2Y2NA 5TBMB 4OVDA 1HLUP 2W1TB 2XFTA 1ODVA 4MLLA 4OQHA 1SCWA 5HX9A 4EQIA 2PU2A 1ZTUA 3FC7A 1VM1A 1Z6FA 4KG6A 3T12B 2ZQ9A 3BYDA 2EWWA 4P85A 3IX3A 2Y2PA 5KZHA 2HP5A 3RFBA 2P74A 1O7EA 2G7UA 2B18A 2WAEA 4OONA 3M2JA 3JYIA 3SS5A 4KZAA 4XXRA 1MWRA 4I3JA 3JVUA 2GDNA 2JHEA 4P0MA 5G4ZA 1UWPX 4K91A 2NUTC 5DKLA 4E3JA 1XFNA 2VK3A 4EBLA 5DJTA 4RX3A 2WK0A 5KIZA 3LGOA 3LIAA 4UA7A 4NXGA 5CTNA 3Q82A 3IWQA 4GOGA 4UQIM 3S1YA 1L3LA 3HLCA 5LBRA 3IX4A 3IBRA 3GVBA 4KZ7A 4KQQA 1K57A 1GSXA 3IHAA 3PXPA 1XGIA 1F98A 3ZDJA 4Y0TA 1FIKA 4HIAA 5CHMA 3IF6C 2J9PA 1CQAA 2HGVA 3E2KA 3UPPA 2HDUA 5HAPA 3KSGA 4X1LA 2JKFA 3BRMA 2VGLS 5HDDA 2PYRA 1IYPA 1TEMA 4UEYA 3IXGA 4Y0UA 3EOIA 4U0XA 4EXOA 5DFXA 3ZNYA 1E4DA 2Q9MA 3IX8A 5FEFA 2L4RA 4N1HA 1ERMA 3ZG7B 3FKWA 5D3OA 4LFUA 3IT9A 4IUKA 1VB6A 1ACFA 4PHTA 3KSFA 1PFLA 4GD6A 2RL3A 4HBUA 2E8JA 3WS4A 4U0TA 3O88A 3F1OB 2PHYA 4DRTA 1PWGA 1T18A 4F3LB 3MF0A 3P01A 1XFQA 2WGIA 1W63M 1OTDA 4R3BA 2GNXA 3VSLA 1N9LA 1JNUA 2XROA 2JE5A 1NJ4A 1BUEA 2ZLYA 3T1XA 4G3VA 3QNBA 1FR1A 4R6LA 3S7NA 4OP5A 4M3KA 2ZD8A 1U60A 3BLMA 2WGVA 1MWTA 1W79A 1XA1A 3AGFA 4MNRA 2W3EA 5EM1A 5DJUA 5FAPA 4S2NC 1HD8A 4OKPA 1ES4A 4EQ1A 3A3FA 1N9NA 4R1GA 4ZJ1A 1IOUA 1YT4A 1ALQA 1S6RA 2PD7A 1K55C 4EESA 1STZA 3HBRA 4Q8IA 3UDXA 2ZOHA 5FQQA 3V39A 4EBNA 2WKEA 4QD4A 1H8ZA 2V20A 1SKOB 2BASA 5EFWA 1F9IA 1BZAA 4B4XA 2QJ5A 2ZMAA 3K3DA 2Y79A 3PBOA 1TS0A 3G34A 2O99A 1J9MA 1JTDA 1L0EA 3WS0A 4P87A 2P04A 1T1CA 3DTIA 3TJZC 2P08A 5F82A 1NY0A 5MC7A 1YMSA 3VOLA 2ZM2A 1EI5A 3CWFA 5DFYA 1IELA 1P9WA 3EGDC 2Y59A 3W8KA 1CEFA 3B42A 5IHVA 4IUHA 3H9WA 4OLGA 3A3JA 4E04A 3NY4A 3WS1A 3PYPA 1ZC2A 2EWVA 1NZUA 3BFDA 1JWVA 3HL9A 4WZ5C 3UE6A 1YSPA 4R3AA 3FKVA 4QHCA 4YFMA 4WLAA 1GSWA 4HP4A 3UB8A 3HUMA 5CRFA 1Q2QA 3EEAA 5K5BA 3UE0A 1W63Q 4ID4A 5CGWA 3T4JA 3BQAA 4N1XA 4JPMA 4Q0JA 3BY8A 4MBKA 4HBTA 4EETB 3BECA 4LLOB 1OTEA 3ZQ5A 3OOVA 4R4RA 5EVID 1S4RA 2XD5A 5L8MA 2DCFA 2V0UA 4HH2A 4BMWA 4PAUA 3VP0A 3LR3A 4X69A 4G3KA 4FH2A 1XJ2A 5M18A 2PD8A 3QP4A 3UPOA 3F1PA 5AQAA 3P7NA 4LRYC 2Q0OA 4L9GA 2Y2GA 2H0YA 1NYMA 4GDBA 3E98A 2BG1A 1VHMA 3CUEC 1OPXA 2XA7S 1KGGA 4DE0A 3IF6A 3TE8A 2INWA 4HESA 4BLMA 5AVFA 3G6OA 1BTLA 4DXCA 5FQMA 3CLOA 2HDRA 3MXRA 5E2GA 5KMWA 4JF5A 4I3IA 3HLEA 1YQSA 2QPNA 3O86A 5GL9A 4PKYG 4PM9A 3PAEA 4MEZA 5L07A 4L0LA 4O0PA 2Z2LB 2V8CA 3IXHA 4CLCE 1RGZA 4KZ5A 4DJ3A 4HEFA 3LY4A 5CGXA 3A0RA 4OPRA 3ZYTA 2AVXA 1TS6A 3F1NB 1LI0A 3B47A 4UA6A 4X53A 4ETZA 3E4QA 2CMNA 1FCOA 2VZWA 4ZJ3A 3H82B 4JGPA 3HLFA 4IBXA 3ZG9B 3T4OA 3G32A 4A5RA 2BLSA 1W8QA 3OZHA 3HJKA 3NECA 4QB8A 4ZJ2A 2ZOIA 1W5DA 1MY8A 3V50A 1YLJA 4BL2A 3GRJA 1DJCA 2WKIA 4S2NA 3UMEA 3GSGA 3BY9A 4MN6A 2LB5A 3ISGA 4ZDXA 2ZC3B 4IJGA 1K55A 4JBFA 5JYOA 4OQIA 1JWPA 1Z09A 3LI8A 4DE2A 3G31A 5FI7A 4LRZE 4S2MA 3NC8A 4WEJA 4C3QA 1YLYA 1PWDA 3TOIA 3GECA 3UY6A 3C7VA 5EVIB 1PW8A 1K0KA 1S4SA 4JXVA 4L9FA 4GDNA 5TR7A 2K31A 3FYZA 5EVLA 3IBJA 3MMHA 4Y3IA 4CJNA 3FG8A 5HWTA 1GSVA 3HUNA 5HSQA 5DVAA 4G3WA 3K3CA 4L9EA 4QY5A 1GHIA 2HZ5A 4FOFA 4QWOA 2OSUA 3NOTC 1GCEA 5FATA 1YKDA 3S4XA 4E3LA 4EW7A 3RJUA 5FI2A 3MZDA 1VETA 4OH0A 2IA2A 4Z9QA 3ICYA 4O01A 3BFCA 3PBSA 1K54C 2JKRI 1ESIA 3BLSA 4DE3A 2W3HA 5HPFA 3OPHA 4ZTKA 3NHQA 4Y13A 4S2LA 1NZOA 2Y2IA 2X01A 4NEED 3LYXA 3NIAA 4Y15A 3E2LA 1H8MA 4BENA 2PYPA 3V3RA 3SS4A 3LR4A 2J3TD 1H5XA 3ZVWA 1YLTA 3C4PA 2A3UA 2EXAA 1BLPA 5FQIA 1IEMA 4IHQA 4NG2A 3VFHA 2ZC4B 1SKFA 1LL8A 2ZMVA 3H7WA 2M1CA 3MKFA 1FCMA 3LIEA 3TSGA 2XLNA 1LSWA 4KENB 2ZL1A 4NXBA 5FQJA 1L0GA 3ZNTA 1XJ3A 1PIOA 2WKHA 3Q07A 2QYBA 5E2EA 1H0MA 2Y2MA 4HJ6A 2R9XA 5CX7A 3LCEA 5FQKA 2HPBA 2KLIA 2Y2JA 2H28A 2OAQ1 3CPTB 3BJNA 1BT5A 5CEBA 4H8RA 2ZQ7A 4JGQA 3W4PA 4OPYA 5FEGA 3KSHA 3NULA 2B02A 4ARZA 3ZG8B 4DXBA 2V1AA 1HTZA 4KUOA 2B5RA 4QJGA 4D2OA 3UB6A 3PBNA 3E4PA 5HPIA 2JCHA 1BLCA 3EQUA 3IF5A 1EW0A 3O5YA 1BSGA 1J3WA 3IQAA 4S2KA 1DP6A 2WGWA 3DTMA 5HDSA 3WS2A 3CITA 5GLCA 4LENA 3UPNA 3DWZA 3EGXC 2B95A 2JKTM 2XFSA 3MKEA 2EX2A 3OPRA 3UB9A 3JVVA 1G5UA 3R7WA 3A3DA 3LEQA 1G28A 3ZGAB 5A90A 1IFQA 4WMCA 2A24B 1E3UA 3T1QB 5GHYA 4Q0IA 4BL3A 3D9YA 4YWZA 2H0TA 1SDNA 4HY8A 1DRMA 3KSIA 2XDMA 1HVBA 5L10A 4B9OA 3S7OA 1VEUA 3D3OA 2JN7A 2VLGA 3MQQA 5DF8A 1FILA 2OLUA 3GR2A 3N4IA 4YINA 3T4LA 2Y91A 4HQAA 2VA0A 4F94A 2WUQA 4NKPA 2GZAA 4R23A 5IU1A 4KZ3A 2XEPA 2XF3A 3LIBA 3QP8A 3Q7ZA 1ES3A 2RCXA 2W3DA 3PBQA 3ITAA 1PWCA 1D06A 1ZHHB 1PRQA 3P98A 4OP8A 3LFVA 1KGFA 1FSWA 5FAQA 4OLDA 1ES5A 5J4EA 3R4KA 1DJAA 3PBRA 1BYWA 2ZQDA 1DP9A 3HLWA 2HJ9C 1PNEA 5EPHA 4GKUA 3KYZA 4HJ4A 4CLCA 1Y28A 4UQIS 1NLZA 4HNBA 4FSFA 1NLYA 4WMCD 3IS2A 1PYYA 2PR5A 2W0NA 2Z6CA 3PR6A 5GHZA 2M7VA 5GLBA 1DY6A 4NETA 4EEUA 2Y8HA 3IXBA 2ZM8A 4E3OA 2FZ0A 2ZMFA 3S22A 3U4LP 2W3GA 4KG5A 4ME4A 2HDSA 4OQ0A 1WYBA 5GLDA 2W1RA 1D7EA 4WBGA 1TDGA 3OLOA 4GNUA 5J8XA 5L09A 3OBFA 3ULFA 1FR6A 2D02A 3MJQA 4MDZA 1QMEA 1MWSA 4R70A 3C4OA 1K54A 3MQ0A 3HVFA 1ONHA 1Y54A 1RCJA 2VV6A 3W2ZA 5M19A 2Z6DA 4K08A 4WELA 2ZQAA 4PMAA 1ONGA 3NOPC 2A49A 4JGRA 1YLWA 1YAXA 1OTAA 2NUPC 5C5KA 4CLCD 3U2AA 1CF0A 2E8IA 1GA9A 1KDSA 4JXGA 2X02A 3AGEA 2HP6A 1M40A 2O0YA 5DTKA 4IBRA 2O9AA 2P9VA 1FSYA 2HDQA 2Y2QA 4I5SA 2XR0A 4JLFA 3C2WA 1MKIA 1TF1A 3MZEA 2XH9A 4P6ZM 5FASA 4LGWA 2VV8A 1K6SA 5J3WA 1XPBA 1RGYA 3LUQA 1G6AA 1GA0A 1C3BA 3MXQA 4OOMA 4GJ4A 1NWZA 4FD8A 3HUOA 1T19A 2XRNA 4GS9A 3VMAA 2K2NA 2IWBA 4RX2A 1IKIA 3S7PA 3OC2A 4FH4A 4GB7A 2W1TA 4JKTA 3TRCA 3SZTA 2PAVP 2Y2LA 1GHPA 2WADA 3DWKA 3MS6A 4DN0A 3VSKA 3MFXA 4OPQA 2H5SA 3LIDA 5I94A 4E6XA 4KZBA 4E3MA 5EE8A 1S1YA 5GLAA 2VJWA 3ZG5A 3EEHA 5KSCA 2WZXA 3MXSA 4MN7A 1XXMA 2VGKA 5EOEA 1LSVA 4WF0A 4JF6A 5M1AA 3SH7A 3QP5A 2J80A 3FV7A 1ERQA 2C6WB 4KUKA 2PU4A 1OT6A 2QHKA 3T4TA 3CI6A 3RTYA 5IT5A 2PR6A 5DTTA 3GMWA 3LR5A 1WA9A 2EX8A 2IWDA 4CPKA 4Y7PA 4Y17A 2XD1A 5HFOA 1M6KA 3ZCZA 1QMFA 3KYEA 3WRTA 4LPZA 3MZFA 5CHJA 4LV0A 1SDEA 3C8CA 5FL3A 2J7VA 5TFQA 4FTXA 4LV2A 1LT0A 5HL6A 3MQOA 2OLVA 2FFFB 2W27A 3T1RA 3SH8A 1IYOA 1MKMA 4Y0OA 3NBLA 4CQHA 4EERA 4EV4A 5TGFA 1N9BA 4R38A 4BBVA 3N8RA 2G2WA 4B93A 3VP4A 4CLCB 4DDYA 3GQZA 4GLQA 5F6AA 1UWNX 2FH5A 3IS2B 3UE3A 5F1FA 1X0OA 4HP9A 4ZBEA 2HJEA 1S66L 4R3JA 5EECA 1LL5A 2DRWA 3PAGA 2ACGA 1FCNA 4JGOA 2PRFA 4X68A 2V1ZA 4S2PA 4BD0A 3I7JA 5F69A 3MR0A 1V9ZA 3F1OA 4EU0A 3UNWA 4KQRA 2LB9A 5A92A 2ZC6B 1YM1A 3NDEA 5CEDA 2X71A 3T4KA 2HV1A 1LHYA 5HDCA 3VP2A 3V67A 3N8LA 4F3LA 4FCFA 3BFGA 3QP6A 3UDIA 5FDSA 1KDWA 4RQ9A 1XJ6A 5F68A 4D60A 5TJJA 2ZQCA 3O87A 4GN2A 4KG2A 1I5QA 1N4OA 4OOLA 4R0QA 4Y2FA 4H6JA 2W3FA 2XQZA 5CERA 4LRXC 4MMNA 2MJ6A 1YSQA 3BFFA 3W4QA 4S2IA 4XUXA 5G18A 4PM5A 1OT9A 2Y2OA 2VX8A 3G4PA 3IH8A 3P09A 5G4YA 2VKSA 2L1MA 5HL1A 2P9VB 1XP4A 1MBLA 3LIFA 2EX9A 2V1BA 4WZ5A 3OCLA 5E43A 2PDRA 1P97A 4DF6A 1ESUA 2OOLA 3OPLA 3UB7A 1ES2A 3NI9A 1YMXA 4QU3A 4FUWA 5A91A 5EVIC 3G2ZA 5E2FA 1H3QA 3EQVA 4LCMA 4BBTA 1W7FA 4BWIA 2VGLM 4E3IA 3UDFA 3M6HA 4I39A 3VE4A 4PKYA 4OPZA 3HLBA 3BW6A 4UA9A 3A3EA 1P9RA 3F1PB 3L9KA 3Q81A 3ZVTA 4ETXA 4PPRA 1CK3A 1SHVA 3T4QA 1L0FA 1IYSA 3A3IA 1Y4OA 1T1AA 5I5LA 2QWSA 3BFEA 3B3XA 3IF6B 1LSXA 4EWFA 5J7EA 4UHUA 1WE4A 1TVFA 3OCNA 3KO6A 1IKGA 4KQDA 2O9CA 4N9LA 1XX2A 3TG9A 4PM7A 1S1ZA 3CUEA 3C38A 4N92A 1XGJA 1ZKJA 2EX6A 4N9KA 4E3NA 2R9WA 1D1JA 4X55A 3BQ8A 2J3WA 5U47A 4GW9A 5EVEA 2CC1A 5JYPA 2Y2KA 4BQMA 1XKZA 2C5WB 2WYXA 3KX0X 4K0XA 3VP3A 3WS5A 2D01A 4B4ZA 1S67L 2PBYA 3V5MA 5HAIA 4XT2A 3UO9A 3QNCA 1CI9A 1LLBA 4HJ3A 4HH3A 4HOIA 3TW8A 3HCYA 4WL9A 3N7WA 4EBPA 4P6BA 1UGUA 5L2FA 4NXEA 3PTEA 3V3SA 2YKHA 2EFXA 4KZ6A 3G2YA 2V0WA 1JVJA 3UE1A 1VQQA 1FQGA 2Y2HA 3CG5A 4HHDA 2OAP1 4X56A 1OTIA 1DJBA 1EROA 4MCWA 5DF9A 2GX5A 4S2JA 5BOHA 3DAVA 4IEDA 3PHYA 4II7A 4E6WA 2EA9A 4ZRRA 4MN5A 5HAQA 1L2SA 1AXBA 1E25A 3LI9A 3LY3A 2PBDP 4KZ8A 5GHXA 3UMDA 2VV7A 2I72A 2G2UA 4GD8A 1KOUA 4M4XA 3SS3A 3IXDA 4JF4A 3GTCA 5EUAA 1K4EA 3WWXA 4ESPA 5EV0A 3VV4A 4QY6A 1HZOA 5EOOA 5FDHA 4DJ2A 2OWJA 4PM6A 5A93A 3CHWP 3F1NA 1PW1A 4H6JB 5CXWA 1E3UD 3EWKA 3H82A 4BD1A 1KE3A 5HD5A 4IVIA 5AQ7A 1TS8A 4EUVA 5F1GA 5F5YA 2V8FA 3DTEA 4JXWA 1CJFA 3NDGA 1K56A 3D4FA 4C75A 5AQ9A 2I9VA 4EUZA 2WKPA 4I38A 1VETB 2DMWA 4QPRA 1MWUA 4LCLA 4X1MA 3Q7VA 4HI4A 5AJGA 5KSHA 5FAOA 1K25A 4RA7A 4AFIA 3JPUA 2ZBBA 4GHIA 4GZBA 2J3TC 1JWZA 2O9BA 2QKPA 1A0KA 3GV9A 4K0WA 4YOFA 2VGJA 2R78A 2Z2MB 5EVIA 3C30A 4EEPA 3G35A 2XA7M 2HF6A 3KYQA 2Y55A 4KQOA 3BM6A 1NYYA 5DF7A 4LV3A 3H7WB 4DE1A 2KOIA 5E2HA 5HZHA 3T1SA 2UV0E 2J8YA 4GCZA 4PM8A 3QP1A 2ZL1B 3ZFZA 3E0YA 3SOIA 1KGEA 3IWIA 2XSSA 1S0WA 3DBAA 1OTBA 3HLGA 3HLDA 3WRZA 4XUZA 3HJIA 3ZHHA 2JKTI 4LV1A 1K56D 3NOUC 4ZAMA 2XGNA 4X6TA 3LO7A 1XJ4A 1PZOA 1KVLA 4OQGA 5FA7A 5CHUA 1OJ5A 4ARZB 1TDLA 1OMEA 1TS7A 2M7UA 3CZDA 1IYQA 1KE4A 3VOZA 3ZG0A
chains in the Genus database with same CATH topology
4JGOA 5TBMA 2QYBA 4G3VA 4HJ6A 3B33A 4R6LA 5CX7A 3S7NA 5HD3A 5F69A 2KLIA 2H28A 2OAQ1 5AVEA 3MR0A 3BJNA 1V9ZA 3F1OA 3VE3A 2W3EA 4EU0A 5DJUA 2LB9A 4JGQA 4EQ1A 1N9NA 4XT2B 2KX6A 3T4KA 2HV1A 3KSHA 3T50A 5HDCA 5HWVA 2B02A 4ARZA 3V67A 1IOUA 2PD7A 4EESA 2V1AA 4F3LA 1STZA 4KUOA 2P7JA 3R7WB 2ZOHA 3UB6A 3PBNA 1XJ6A 3E4PA 4RQ9A 5HPIA 2YKFA 3EQUA 4NXFA 5F68A 1EW0A 5TJJA 3O5YA 2JKRM 5DKKA 5A8BA 2OWHA 1DP6A 4OOLA 2BASA 3LICA 4WUJA 4Q0HA 3NJAA 5EFWA 1F9IA 4Y2FA 4H6JA 2W3FA 5HDSA 2QJ5A 3CITA 3A0VA 3K3DA 2Y79A 3PBOA 4LRXC 4MMNA 1TS0A 2O99A 2MJ6A 2VEAA 1YSQA 3EGXC 5HWWA 3D72A 2JKTM 2PT7A 2KDKA 1OT9A 2P04A 1T1CA 3TJZC 2WKRA 2P08A 1V9YA 2VX8A 3UB9A 5MC7A 3JVVA 5G4YA 2VKSA 3R7WA 2L1MA 3RH8B 3VOLA 4O8GA 1G28A 1IFQA 3LIFA 2V1BA 2A24B 3CWFA 5DFYA 1P9WA 3S7QA 3EGDC 3OCLA 2PDRA 4Q0IA 1P97A 3T4SA 3B42A 4YWZA 4WN5A 4IUHA 2OOLA 3H9WA 3UB7A 5IS1A 3K2NA 4P6ZS 4HY8A 4E04A 1DRMA 3KSIA 1H3QA 3FPVA 4Y5FA 3EQVA 3PYPA 4B9OA 3S7OA 2EWVA 4BBTA 3D3OA 1G6OA 2JN7A 4BWIA 2VGLM 2VLGA 3MQQA 3UE6A 3PBTA 1YSPA 4R3AA 3T4LA 4I39A 2QJ7A 4HQAA 2VA0A 3VE4A 1F5MA 4PKYA 4NKPA 2GZAA 4WLAA 2A24A 5IU1A 3BW6A 1GSWA 1P9RA 2WKQA 4HP4A 3LIBA 3UB8A 4Z1WA 3F1PB 1N9OA 2W3DA 3PBQA 4ETXA 1D06A 4YNRA 3EEAA 3T4QA 1ZHHB 5K5BA 1W63Q 3LFVA 3T4JA 3BQAA 4Q0JA 3BY8A 1T1AA 4EETB 5J4EA 3R4KA 3PBRA 5I5LA 1BYWA 2QWSA 1DP9A 4LLOB 1OTEA 3ZQ5A 3OOVA 1LSXA 2HJ9C 5J7EA 1S4RA 5L8MA 2V0UA 3KYZA 3OCNA 4HJ4A 4CLCA 3KO6A 1Y28A 4HH2A 4UQIS 4BMWA 4KQDA 4PAUA 2O9CA 4GHIB 3LR0A 4DMZA 3LR3A 1NLZA 4HNBA 1S1ZA 3CUEA 4FSFA 4G3KA 1NLYA 1XJ2A 3IS2A 3C38A 2PR5A 2W0NA 2Z6CA 2PD8A 3PR6A 3F1PA 2M7VA 3P7NA 4EEUA 2Y8HA 4LRYC 4L9GA 1DP8A 2A2LA 3BQ8A 2J3WA 4GW9A 2V9AA 2FZ0A 2ZMFA 2W3GA 4CLCC 2L0WA 4ME4A 2K7SA 4BBUA 1P0ZA 3E98A 4I3AA 1VHMA 3CUEC 1OPXA 2XA7S 3FPWA 2W1RA 1D7EA 2GJ3A 3KX0X 2INWA 3OLOA 3TE8A 1MZUA 2D01A 3OBFA 5AVFA 1S67L 3G6OA 3ULFA 4XT2A 4BJPA 1OJGA 3CAXA 2D02A 3MJQA 4MDZA 4HJ3A 3CLOA 4HH3A 4HOIA 4R70A 3TW8A 3HCYA 3MQ0A 4WL9A 1UGUA 1MC0A 4I3IA 4NXEA 1NRJA 3E4OA 2VV6A 2YKHA 2V0WA 3SW1A 3W2ZA 4PKYG 4HHDA 2OAP1 4L0LA 4O0PA 2Z6DA 1OTIA 4K08A 4CLCE 4WELA 3A0SA 3NOPC 4DJ3A 4JGRA 4MCWA 5DF9A 2GX5A 1YAXA 1OTAA 4WEKA 2NUPC 5C5KA 4GS9B 4CLCD 3PHYA 3A0RA 3BWLA 3U2AA 4II7A 2EA9A 1T1BA 4ZRRA 1TD5A 4MN5A 3GDIA 3ZYTA 1TS6A 5TBMB 3F1NB 2W1TB 2O0YA 1ODVA 3B47A 3LI9A 4ETZA 2O9AA 3E4QA 2CMNA 2VZWA 3UMDA 3H82B 2VV7A 4JGPA 4I5SA 1ZTUA 3FC7A 1KOUA 3C2WA 4M4XA 1TF1A 4P6ZM 2VV8A 3T4OA 5J3WA 3LUQA 3HJKA 2EWWA 3MXQA 4OOMA 2ZOIA 4GJ4A 1NWZA 3VV4A 3UMEA 1T19A 2XRNA 3BY9A 4DJ2A 4MN6A 3RFBA 4GS9A 2OWJA 2G7UA 2B18A 2LB5A 2K2NA 3S7PA 3OC2A 4IJGA 3F1NA 2W1TA 3TRCA 4H6JB 3EWKA 3LI8A 3H82A 4I3JA 3JVUA 2JHEA 4DN0A 5G4ZA 4LRZE 1UWPX 5HD5A 1TS8A 4EUVA 2NUTC 4WEJA 5DKLA 3MFXA 5F5YA 1XFNA 3LIDA 5DJTA 3GECA 2I9VA 1S1YA 5KIZA 2VJWA 2WKPA 3LIAA 1S4SA 3EEHA 4L9FA 4NXGA 4I38A 2DMWA 4MN7A 4QPRA 2K31A 1LSVA 4UQIM 4WF0A 4HI4A 5AJGA 3IBJA 2J80A 5LBRA 5KSHA 3MMHA 3IBRA 4Y3IA 3FG8A 4AFIA 4KUKA 2ZBBA 4GHIA 5HWTA 1GSVA 1OT6A 5HSQA 1GSXA 4G3WA 2QHKA 3T4TA 3CI6A 3K3CA 4L9EA 3RTYA 5IT5A 2J3TC 2PR6A 2O9BA 3PXPA 2QKPA 4FOFA 3NOTC 3LR5A 1WA9A 4YOFA 1F98A 1YKDA 2R78A 4HIAA 2HGVA 4EW7A 3KSGA 3C30A 4EEPA 2VGLS 2XA7M 2HF6A 3KYQA 5HDDA 2PYRA 4LPZA 2IA2A 3C8CA 3ICYA 4KQOA 4O01A 4UEYA 5FL3A 3H7WB 3EOIA 2JKRI 3PBSA 2KOIA 4EXOA 5DFXA 1LT0A 5HZHA 2L4RA 5HL6A 4GCZA 3MQOA 2W3HA 5HPFA 3E0YA 2W27A 3NHQA 4IUKA 1VB6A 2XSSA 4PHTA 4NEED 1MKMA 3DBAA 1OTBA 3KSFA 3LYXA 3HJIA 2JKTI 1H8MA 4CQHA 4EERA 3NOUC 3F1OB 2PYPA 3LR4A 2J3TD 1XJ4A 4R38A 4BBVA 4B93A 4CLCB 2PHYA 1OJ5A 4IHQA 4ARZB 4GLQA 5F6AA 1UWNX 1LL8A 2FH5A 3IS2B 2ZMVA 3UE3A 1T18A 4F3LB 1X0OA 3MF0A 1TS7A 3H7WA 2M1CA 4HP9A 3P01A 1XFQA 2HJEA 1S66L 2M7UA 1W63M 1OTDA 3LIEA 2GNXA 1LSWA 1N9LA 4NXBA 1JNUA 2XROA 1XJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JGO A;  5TBM A;  4HJ6 A;  3B33 A;  4R6L A;  5HD3 A;  5F69 A;  2H28 A;  5AVE A;  3MR0 A;  1V9Z A;  3F1O A;  3VE3 A;  5DJU A;  4JGQ A;  4EQ1 A;  1N9N A;  4XT2 B;  2KX6 A;  2HV1 A;  3T50 A;  5HDC A;  5HWV A;  2B02 A;  2PD7 A;  4EES A;  2V1A A;  4F3L A;  4KUO A;  2P7J A;  2ZOH A;  3UB6 A;  4RQ9 A;  1XJ6 A;  3E4P A;  2YKF A;  4NXF A;  5F68 A;  1EW0 A;  5DKK A;  5A8B A;  2OWH A;  1DP6 A;  2BAS A;  3LIC A;  4WUJ A;  5EFW A;  3NJA A;  1F9I A;  4H6J A;  5HDS A;  2QJ5 A;  3A0V A;  3K3D A;  4LRX C;  1TS0 A;  2VEA A;  5HWW A;  3D72 A;  2KDK A;  1OT9 A;  1T1C A;  2WKR A;  1V9Y A;  3UB9 A;  5G4Y A;  2L1M A;  3RH8 B;  3VOL A;  1G28 A;  3LIF A;  2V1B A;  2A24 B;  3CWF A;  2PDR A;  1P97 A;  4YWZ A;  4WN5 A;  2OOL A;  3H9W A;  3UB7 A;  5IS1 A;  4HY8 A;  4E04 A;  1DRM A;  3PYP A;  4B9O A;  4BBT A;  2JN7 A;  2VLG A;  3MQQ A;  3UE6 A;  4R3A A;  4I39 A;  2QJ7 A;  4HQA A;  3VE4 A;  4PKY A;  4WLA A;  2A24 A;  5IU1 A;  1GSW A;  2WKQ A;  4HP4 A;  3LIB A;  3UB8 A;  3F1P B;  1N9O A;  1D06 A;  3BY8 A;  1T1A A;  4EET B;  5J4E A;  5I5L A;  1BYW A;  2QWS A;  1DP9 A;  4LLO B;  1OTE A;  3ZQ5 A;  1LSX A;  5J7E A;  1S4R A;  2V0U A;  4HJ4 A;  4HH2 A;  1Y28 A;  4KQD A;  4GHI B;  4HNB A;  1S1Z A;  1XJ2 A;  3IS2 A;  2PR5 A;  2W0N A;  2Z6C A;  2PD8 A;  3F1P A;  3P7N A;  4EEU A;  4LRY C;  4L9G A;  1DP8 A;  4GW9 A;  2V9A A;  2L0W A;  2K7S A;  4BBU A;  1P0Z A;  4I3A A;  1D7E A;  2GJ3 A;  3KX0 X;  2INW A;  3OLO A;  1MZU A;  2D01 A;  5AVF A;  3ULF A;  1S67 L;  3G6O A;  4XT2 A;  1OJG A;  3CAX A;  2D02 A;  3MJQ A;  4HJ3 A;  3CLO A;  4HH3 A;  4HOI A;  4R70 A;  4WL9 A;  1UGU A;  4I3I A;  4NXE A;  3E4O A;  2VV6 A;  2YKH A;  2V0W A;  3SW1 A;  4PKY G;  4HHD A;  2Z6D A;  1OTI A;  4K08 A;  3A0S A;  3NOP C;  4DJ3 A;  4JGR A;  1OTA A;  4GS9 B;  3PHY A;  3A0R A;  3BWL A;  2EA9 A;  1T1B A;  4MN5 A;  3GDI A;  1TS6 A;  5TBM B;  3F1N B;  1ODV A;  3LI9 A;  3E4Q A;  2CMN A;  3UMD A;  3H82 B;  2VV7 A;  4JGP A;  4I5S A;  3FC7 A;  1KOU A;  3C2W A;  4M4X A;  2VV8 A;  5J3W A;  3LUQ A;  3HJK A;  3MXQ A;  2ZOI A;  1NWZ A;  3UME A;  1T19 A;  3BY9 A;  4DJ2 A;  4MN6 A;  4GS9 A;  2OWJ A;  3F1N A;  4H6J B;  3EWK A;  3LI8 A;  3H82 A;  4I3J A;  2JHE A;  5G4Z A;  4LRZ E;  1UWP X;  5HD5 A;  1TS8 A;  5DKL A;  5F5Y A;  3MFX A;  1XFN A;  3LID A;  5DJT A;  3GEC A;  2I9V A;  1S1Y A;  5KIZ A;  2WKP A;  3LIA A;  1S4S A;  3EEH A;  4L9F A;  4NXG A;  4I38 A;  1LSV A;  4WF0 A;  4HI4 A;  2J80 A;  3IBR A;  3FG8 A;  4KUK A;  2ZBB A;  4GHI A;  5HWT A;  1GSV A;  1OT6 A;  5HSQ A;  1GSX A;  2QHK A;  3K3C A;  4L9E A;  3RTY A;  2PR6 A;  2QKP A;  3NOT C;  1WA9 A;  1F98 A;  2R78 A;  4HIA A;  4EW7 A;  4EEP A;  5HDD A;  2PYR A;  4LPZ A;  3C8C A;  3ICY A;  3H7W B;  4EXO A;  1LT0 A;  5HZH A;  2L4R A;  4GCZ A;  3MQO A;  2W27 A;  3NHQ A;  1VB6 A;  1OTB A;  3LYX A;  3HJI A;  4EER A;  3NOU C;  3F1O B;  2PYP A;  1XJ4 A;  4R38 A;  4BBV A;  2PHY A;  1OJ5 A;  5F6A A;  1UWN X;  1LL8 A;  3IS2 B;  1T18 A;  4F3L B;  1X0O A;  1TS7 A;  3H7W A;  2M1C A;  4HP9 A;  1XFQ A;  1S66 L;  3LIE A;  1OTD A;  1LSW A;  1N9L A;  4NXB A;  1JNU A;  1XJ3 A; 
#chains in the Genus database with same CATH topology
 1FOF A;  1BUL A;  5TBM A;  2WGW B;  3B33 A;  4RYE A;  5HD3 A;  5DTS A;  4WZ4 A;  5AVE A;  3W4O A;  1LL9 A;  3VE3 A;  4DKI A;  2HP9 A;  3N6I A;  4XT2 B;  2KX6 A;  1K6R A;  3T50 A;  3C5A A;  5HWV A;  2BTF P;  2P7J A;  3R7W B;  4U3T A;  1GHM A;  2YKF A;  4NXF A;  3BEB A;  4O7D A;  2JKR M;  5DKK A;  3MFD A;  3L7H A;  5A8B A;  2OWH A;  3M6B A;  3LIC A;  4WUJ A;  4Q0H A;  3NJA A;  4S2O A;  3DW0 A;  3A0V A;  1H8Y A;  3CPT A;  5F83 A;  1SZV A;  2VEA A;  4UAA A;  5HWW A;  3D72 A;  2PT7 A;  1YLZ A;  2KDK A;  1VEU B;  3MSH A;  2WKR A;  1V9Y A;  1CI8 A;  4R4S A;  4NK3 A;  2OV5 A;  3Q1F A;  3ITB A;  1YPR A;  1NRF A;  1MXO A;  3DTK A;  3RH8 B;  1K57 C;  4O8G A;  4E3K A;  1JTG A;  4MBF A;  2EFU A;  2ZQ8 A;  3S7Q A;  3CMZ A;  3FZC A;  4RVA A;  3T4S A;  2IWC A;  4WN5 A;  4OOY A;  3OPP A;  1W8Y A;  5IS1 A;  1EWZ A;  1K38 A;  2XK1 A;  1Q2P A;  1BLH A;  3K2N A;  4P6Z S;  3RXX A;  4JXS A;  3UN7 A;  2EXB A;  3FPV A;  4Y5F A;  1G6O A;  4MBH A;  3HRE A;  3RXW A;  5FQ9 A;  3PBT A;  1L0D A;  5EM0 A;  1I2S A;  2QJ7 A;  2QZ6 A;  1F5M A;  2A24 A;  1MPL A;  4DDS A;  2WKQ A;  4KZ4 A;  4Z1W A;  5FSR A;  4WM9 A;  1N9O A;  1CEG A;  3CJM A;  2DNS A;  4YNR A;  1PI4 A;  3LEZ A;  3AGD A;  4WYY A;  2Y4A A;  5CEC A;  2JKG A;  1WYC A;  1ZG4 A;  2JC7 A;  2JBF A;  3C7U A;  1XA7 A;  3Q7V B;  2H10 A;  2ZM0 A;  1YLP A;  3VFF A;  5CGS A;  1PZP A;  2ZC7 A;  4GHI B;  3IH9 A;  3LR0 A;  4DMZ A;  1ZG6 A;  3VOY A;  3FWL A;  4X25 A;  1F2K A;  1LI9 A;  2ZC5 B;  5HW3 A;  3UB5 P;  5CTM A;  1DP8 A;  2ZJ9 A;  2A2L A;  1G68 A;  2V9A A;  5FI6 A;  5AQB A;  3NCK A;  1I2W A;  2WAF A;  4CLC C;  2L0W A;  2K7S A;  1PI5 A;  4BBU A;  1P0Z A;  1KE0 A;  4I3A A;  3FPW A;  1NXY A;  2GJ3 A;  1MZU A;  1KVM A;  4KZ9 A;  5HAR A;  1K4F A;  2V2F F;  2Q9N A;  1RP5 A;  1OJG A;  4BJP A;  3CAX A;  3VP1 A;  3IHB A;  1AWI A;  1O07 A;  3QP2 A;  1MC0 A;  3G30 A;  2UWX A;  1NRJ A;  3E4O A;  3IWO A;  3SW1 A;  1BLS A;  1SKO A;  2WZZ A;  4IVK A;  3A0S A;  3N8S A;  2J9O A;  4B88 A;  2FFY A;  3SH9 A;  4WEK A;  2QMI A;  4C6Y A;  4GS9 B;  3BWL A;  1T1B A;  1TD5 A;  3GDI A;  3M2K A;  3QHY A;  3MBZ A;  3O3V A;  2Y2N A;  5TBM B;  4OVD A;  1HLU P;  2W1T B;  2XFT A;  1ODV A;  4MLL A;  4OQH A;  1SCW A;  5HX9 A;  4EQI A;  2PU2 A;  1ZTU A;  3FC7 A;  1VM1 A;  1Z6F A;  4KG6 A;  3T12 B;  2ZQ9 A;  3BYD A;  2EWW A;  4P85 A;  3IX3 A;  2Y2P A;  5KZH A;  2HP5 A;  3RFB A;  2P74 A;  1O7E A;  2G7U A;  2B18 A;  2WAE A;  4OON A;  3M2J A;  3JYI A;  3SS5 A;  4KZA A;  4XXR A;  1MWR A;  4I3J A;  3JVU A;  2GDN A;  2JHE A;  4P0M A;  5G4Z A;  1UWP X;  4K91 A;  2NUT C;  5DKL A;  4E3J A;  1XFN A;  2VK3 A;  4EBL A;  5DJT A;  4RX3 A;  2WK0 A;  5KIZ A;  3LGO A;  3LIA A;  4UA7 A;  4NXG A;  5CTN A;  3Q82 A;  3IWQ A;  4GOG A;  4UQI M;  3S1Y A;  1L3L A;  3HLC A;  5LBR A;  3IX4 A;  3IBR A;  3GVB A;  4KZ7 A;  4KQQ A;  1K57 A;  1GSX A;  3IHA A;  3PXP A;  1XGI A;  1F98 A;  3ZDJ A;  4Y0T A;  1FIK A;  4HIA A;  5CHM A;  3IF6 C;  2J9P A;  1CQA A;  2HGV A;  3E2K A;  3UPP A;  2HDU A;  5HAP A;  3KSG A;  4X1L A;  2JKF A;  3BRM A;  2VGL S;  5HDD A;  2PYR A;  1IYP A;  1TEM A;  4UEY A;  3IXG A;  4Y0U A;  3EOI A;  4U0X A;  4EXO A;  5DFX A;  3ZNY A;  1E4D A;  2Q9M A;  3IX8 A;  5FEF A;  2L4R A;  4N1H A;  1ERM A;  3ZG7 B;  3FKW A;  5D3O A;  4LFU A;  3IT9 A;  4IUK A;  1VB6 A;  1ACF A;  4PHT A;  3KSF A;  1PFL A;  4GD6 A;  2RL3 A;  4HBU A;  2E8J A;  3WS4 A;  4U0T A;  3O88 A;  3F1O B;  2PHY A;  4DRT A;  1PWG A;  1T18 A;  4F3L B;  3MF0 A;  3P01 A;  1XFQ A;  2WGI A;  1W63 M;  1OTD A;  4R3B A;  2GNX A;  3VSL A;  1N9L A;  1JNU A;  2XRO A;  2JE5 A;  1NJ4 A;  1BUE A;  2ZLY A;  3T1X A;  4G3V A;  3QNB A;  1FR1 A;  4R6L A;  3S7N A;  4OP5 A;  4M3K A;  2ZD8 A;  1U60 A;  3BLM A;  2WGV A;  1MWT A;  1W79 A;  1XA1 A;  3AGF A;  4MNR A;  2W3E A;  5EM1 A;  5DJU A;  5FAP A;  4S2N C;  1HD8 A;  4OKP A;  1ES4 A;  4EQ1 A;  3A3F A;  1N9N A;  4R1G A;  4ZJ1 A;  1IOU A;  1YT4 A;  1ALQ A;  1S6R A;  2PD7 A;  1K55 C;  4EES A;  1STZ A;  3HBR A;  4Q8I A;  3UDX A;  2ZOH A;  5FQQ A;  3V39 A;  4EBN A;  2WKE A;  4QD4 A;  1H8Z A;  2V20 A;  1SKO B;  2BAS A;  5EFW A;  1F9I A;  1BZA A;  4B4X A;  2QJ5 A;  2ZMA A;  3K3D A;  2Y79 A;  3PBO A;  1TS0 A;  3G34 A;  2O99 A;  1J9M A;  1JTD A;  1L0E A;  3WS0 A;  4P87 A;  2P04 A;  1T1C A;  3DTI A;  3TJZ C;  2P08 A;  5F82 A;  1NY0 A;  5MC7 A;  1YMS A;  3VOL A;  2ZM2 A;  1EI5 A;  3CWF A;  5DFY A;  1IEL A;  1P9W A;  3EGD C;  2Y59 A;  3W8K A;  1CEF A;  3B42 A;  5IHV A;  4IUH A;  3H9W A;  4OLG A;  3A3J A;  4E04 A;  3NY4 A;  3WS1 A;  3PYP A;  1ZC2 A;  2EWV A;  1NZU A;  3BFD A;  1JWV A;  3HL9 A;  4WZ5 C;  3UE6 A;  1YSP A;  4R3A A;  3FKV A;  4QHC A;  4YFM A;  4WLA A;  1GSW A;  4HP4 A;  3UB8 A;  3HUM A;  5CRF A;  1Q2Q A;  3EEA A;  5K5B A;  3UE0 A;  1W63 Q;  4ID4 A;  5CGW A;  3T4J A;  3BQA A;  4N1X A;  4JPM A;  4Q0J A;  3BY8 A;  4MBK A;  4HBT A;  4EET B;  3BEC A;  4LLO B;  1OTE A;  3ZQ5 A;  3OOV A;  4R4R A;  5EVI D;  1S4R A;  2XD5 A;  5L8M A;  2DCF A;  2V0U A;  4HH2 A;  4BMW A;  4PAU A;  3VP0 A;  3LR3 A;  4X69 A;  4G3K A;  4FH2 A;  1XJ2 A;  5M18 A;  2PD8 A;  3QP4 A;  3UPO A;  3F1P A;  5AQA A;  3P7N A;  4LRY C;  2Q0O A;  4L9G A;  2Y2G A;  2H0Y A;  1NYM A;  4GDB A;  3E98 A;  2BG1 A;  1VHM A;  3CUE C;  1OPX A;  2XA7 S;  1KGG A;  4DE0 A;  3IF6 A;  3TE8 A;  2INW A;  4HES A;  4BLM A;  5AVF A;  3G6O A;  1BTL A;  4DXC A;  5FQM A;  3CLO A;  2HDR A;  3MXR A;  5E2G A;  5KMW A;  4JF5 A;  4I3I A;  3HLE A;  1YQS A;  2QPN A;  3O86 A;  5GL9 A;  4PKY G;  4PM9 A;  3PAE A;  4MEZ A;  5L07 A;  4L0L A;  4O0P A;  2Z2L B;  2V8C A;  3IXH A;  4CLC E;  1RGZ A;  4KZ5 A;  4DJ3 A;  4HEF A;  3LY4 A;  5CGX A;  3A0R A;  4OPR A;  3ZYT A;  2AVX A;  1TS6 A;  3F1N B;  1LI0 A;  3B47 A;  4UA6 A;  4X53 A;  4ETZ A;  3E4Q A;  2CMN A;  1FCO A;  2VZW A;  4ZJ3 A;  3H82 B;  4JGP A;  3HLF A;  4IBX A;  3ZG9 B;  3T4O A;  3G32 A;  4A5R A;  2BLS A;  1W8Q A;  3OZH A;  3HJK A;  3NEC A;  4QB8 A;  4ZJ2 A;  2ZOI A;  1W5D A;  1MY8 A;  3V50 A;  1YLJ A;  4BL2 A;  3GRJ A;  1DJC A;  2WKI A;  4S2N A;  3UME A;  3GSG A;  3BY9 A;  4MN6 A;  2LB5 A;  3ISG A;  4ZDX A;  2ZC3 B;  4IJG A;  1K55 A;  4JBF A;  5JYO A;  4OQI A;  1JWP A;  1Z09 A;  3LI8 A;  4DE2 A;  3G31 A;  5FI7 A;  4LRZ E;  4S2M A;  3NC8 A;  4WEJ A;  4C3Q A;  1YLY A;  1PWD A;  3TOI A;  3GEC A;  3UY6 A;  3C7V A;  5EVI B;  1PW8 A;  1K0K A;  1S4S A;  4JXV A;  4L9F A;  4GDN A;  5TR7 A;  2K31 A;  3FYZ A;  5EVL A;  3IBJ A;  3MMH A;  4Y3I A;  4CJN A;  3FG8 A;  5HWT A;  1GSV A;  3HUN A;  5HSQ A;  5DVA A;  4G3W A;  3K3C A;  4L9E A;  4QY5 A;  1GHI A;  2HZ5 A;  4FOF A;  4QWO A;  2OSU A;  3NOT C;  1GCE A;  5FAT A;  1YKD A;  3S4X A;  4E3L A;  4EW7 A;  3RJU A;  5FI2 A;  3MZD A;  1VET A;  4OH0 A;  2IA2 A;  4Z9Q A;  3ICY A;  4O01 A;  3BFC A;  3PBS A;  1K54 C;  2JKR I;  1ESI A;  3BLS A;  4DE3 A;  2W3H A;  5HPF A;  3OPH A;  4ZTK A;  3NHQ A;  4Y13 A;  4S2L A;  1NZO A;  2Y2I A;  2X01 A;  4NEE D;  3LYX A;  3NIA A;  4Y15 A;  3E2L A;  1H8M A;  4BEN A;  2PYP A;  3V3R A;  3SS4 A;  3LR4 A;  2J3T D;  1H5X A;  3ZVW A;  1YLT A;  3C4P A;  2A3U A;  2EXA A;  1BLP A;  5FQI A;  1IEM A;  4IHQ A;  4NG2 A;  3VFH A;  2ZC4 B;  1SKF A;  1LL8 A;  2ZMV A;  3H7W A;  2M1C A;  3MKF A;  1FCM A;  3LIE A;  3TSG A;  2XLN A;  1LSW A;  4KEN B;  2ZL1 A;  4NXB A;  5FQJ A;  1L0G A;  3ZNT A;  1XJ3 A;  1PIO A;  2WKH A;  3Q07 A;  2QYB A;  5E2E A;  1H0M A;  2Y2M A;  4HJ6 A;  2R9X A;  5CX7 A;  3LCE A;  5FQK A;  2HPB A;  2KLI A;  2Y2J A;  2H28 A;  2OAQ 1;  3CPT B;  3BJN A;  1BT5 A;  5CEB A;  4H8R A;  2ZQ7 A;  4JGQ A;  3W4P A;  4OPY A;  5FEG A;  3KSH A;  3NUL A;  2B02 A;  4ARZ A;  3ZG8 B;  4DXB A;  2V1A A;  1HTZ A;  4KUO A;  2B5R A;  4QJG A;  4D2O A;  3UB6 A;  3PBN A;  3E4P A;  5HPI A;  2JCH A;  1BLC A;  3EQU A;  3IF5 A;  1EW0 A;  3O5Y A;  1BSG A;  1J3W A;  3IQA A;  4S2K A;  1DP6 A;  2WGW A;  3DTM A;  5HDS A;  3WS2 A;  3CIT A;  5GLC A;  4LEN A;  3UPN A;  3DWZ A;  3EGX C;  2B95 A;  2JKT M;  2XFS A;  3MKE A;  2EX2 A;  3OPR A;  3UB9 A;  3JVV A;  1G5U A;  3R7W A;  3A3D A;  3LEQ A;  1G28 A;  3ZGA B;  5A90 A;  1IFQ A;  4WMC A;  2A24 B;  1E3U A;  3T1Q B;  5GHY A;  4Q0I A;  4BL3 A;  3D9Y A;  4YWZ A;  2H0T A;  1SDN A;  4HY8 A;  1DRM A;  3KSI A;  2XDM A;  1HVB A;  5L10 A;  4B9O A;  3S7O A;  1VEU A;  3D3O A;  2JN7 A;  2VLG A;  3MQQ A;  5DF8 A;  1FIL A;  2OLU A;  3GR2 A;  3N4I A;  4YIN A;  3T4L A;  2Y91 A;  4HQA A;  2VA0 A;  4F94 A;  2WUQ A;  4NKP A;  2GZA A;  4R23 A;  5IU1 A;  4KZ3 A;  2XEP A;  2XF3 A;  3LIB A;  3QP8 A;  3Q7Z A;  1ES3 A;  2RCX A;  2W3D A;  3PBQ A;  3ITA A;  1PWC A;  1D06 A;  1ZHH B;  1PRQ A;  3P98 A;  4OP8 A;  3LFV A;  1KGF A;  1FSW A;  5FAQ A;  4OLD A;  1ES5 A;  5J4E A;  3R4K A;  1DJA A;  3PBR A;  1BYW A;  2ZQD A;  1DP9 A;  3HLW A;  2HJ9 C;  1PNE A;  5EPH A;  4GKU A;  3KYZ A;  4HJ4 A;  4CLC A;  1Y28 A;  4UQI S;  1NLZ A;  4HNB A;  4FSF A;  1NLY A;  4WMC D;  3IS2 A;  1PYY A;  2PR5 A;  2W0N A;  2Z6C A;  3PR6 A;  5GHZ A;  2M7V A;  5GLB A;  1DY6 A;  4NET A;  4EEU A;  2Y8H A;  3IXB A;  2ZM8 A;  4E3O A;  2FZ0 A;  2ZMF A;  3S22 A;  3U4L P;  2W3G A;  4KG5 A;  4ME4 A;  2HDS A;  4OQ0 A;  1WYB A;  5GLD A;  2W1R A;  1D7E A;  4WBG A;  1TDG A;  3OLO A;  4GNU A;  5J8X A;  5L09 A;  3OBF A;  3ULF A;  1FR6 A;  2D02 A;  3MJQ A;  4MDZ A;  1QME A;  1MWS A;  4R70 A;  3C4O A;  1K54 A;  3MQ0 A;  3HVF A;  1ONH A;  1Y54 A;  1RCJ A;  2VV6 A;  3W2Z A;  5M19 A;  2Z6D A;  4K08 A;  4WEL A;  2ZQA A;  4PMA A;  1ONG A;  3NOP C;  2A49 A;  4JGR A;  1YLW A;  1YAX A;  1OTA A;  2NUP C;  5C5K A;  4CLC D;  3U2A A;  1CF0 A;  2E8I A;  1GA9 A;  1KDS A;  4JXG A;  2X02 A;  3AGE A;  2HP6 A;  1M40 A;  2O0Y A;  5DTK A;  4IBR A;  2O9A A;  2P9V A;  1FSY A;  2HDQ A;  2Y2Q A;  4I5S A;  2XR0 A;  4JLF A;  3C2W A;  1MKI A;  1TF1 A;  3MZE A;  2XH9 A;  4P6Z M;  5FAS A;  4LGW A;  2VV8 A;  1K6S A;  5J3W A;  1XPB A;  1RGY A;  3LUQ A;  1G6A A;  1GA0 A;  1C3B A;  3MXQ A;  4OOM A;  4GJ4 A;  1NWZ A;  4FD8 A;  3HUO A;  1T19 A;  2XRN A;  4GS9 A;  3VMA A;  2K2N A;  2IWB A;  4RX2 A;  1IKI A;  3S7P A;  3OC2 A;  4FH4 A;  4GB7 A;  2W1T A;  4JKT A;  3TRC A;  3SZT A;  2PAV P;  2Y2L A;  1GHP A;  2WAD A;  3DWK A;  3MS6 A;  4DN0 A;  3VSK A;  3MFX A;  4OPQ A;  2H5S A;  3LID A;  5I94 A;  4E6X A;  4KZB A;  4E3M A;  5EE8 A;  1S1Y A;  5GLA A;  2VJW A;  3ZG5 A;  3EEH A;  5KSC A;  2WZX A;  3MXS A;  4MN7 A;  1XXM A;  2VGK A;  5EOE A;  1LSV A;  4WF0 A;  4JF6 A;  5M1A A;  3SH7 A;  3QP5 A;  2J80 A;  3FV7 A;  1ERQ A;  2C6W B;  4KUK A;  2PU4 A;  1OT6 A;  2QHK A;  3T4T A;  3CI6 A;  3RTY A;  5IT5 A;  2PR6 A;  5DTT A;  3GMW A;  3LR5 A;  1WA9 A;  2EX8 A;  2IWD A;  4CPK A;  4Y7P A;  4Y17 A;  2XD1 A;  5HFO A;  1M6K A;  3ZCZ A;  1QMF A;  3KYE A;  3WRT A;  4LPZ A;  3MZF A;  5CHJ A;  4LV0 A;  1SDE A;  3C8C A;  5FL3 A;  2J7V A;  5TFQ A;  4FTX A;  4LV2 A;  1LT0 A;  5HL6 A;  3MQO A;  2OLV A;  2FFF B;  2W27 A;  3T1R A;  3SH8 A;  1IYO A;  1MKM A;  4Y0O A;  3NBL A;  4CQH A;  4EER A;  4EV4 A;  5TGF A;  1N9B A;  4R38 A;  4BBV A;  3N8R A;  2G2W A;  4B93 A;  3VP4 A;  4CLC B;  4DDY A;  3GQZ A;  4GLQ A;  5F6A A;  1UWN X;  2FH5 A;  3IS2 B;  3UE3 A;  5F1F A;  1X0O A;  4HP9 A;  4ZBE A;  2HJE A;  1S66 L;  4R3J A;  5EEC A;  1LL5 A;  2DRW A;  3PAG A;  2ACG A;  1FCN A;  4JGO A;  2PRF A;  4X68 A;  2V1Z A;  4S2P A;  4BD0 A;  3I7J A;  5F69 A;  3MR0 A;  1V9Z A;  3F1O A;  4EU0 A;  3UNW A;  4KQR A;  2LB9 A;  5A92 A;  2ZC6 B;  1YM1 A;  3NDE A;  5CED A;  2X71 A;  3T4K A;  2HV1 A;  1LHY A;  5HDC A;  3VP2 A;  3V67 A;  3N8L A;  4F3L A;  4FCF A;  3BFG A;  3QP6 A;  3UDI A;  5FDS A;  1KDW A;  4RQ9 A;  1XJ6 A;  5F68 A;  4D60 A;  5TJJ A;  2ZQC A;  3O87 A;  4GN2 A;  4KG2 A;  1I5Q A;  1N4O A;  4OOL A;  4R0Q A;  4Y2F A;  4H6J A;  2W3F A;  2XQZ A;  5CER A;  4LRX C;  4MMN A;  2MJ6 A;  1YSQ A;  3BFF A;  3W4Q A;  4S2I A;  4XUX A;  5G18 A;  4PM5 A;  1OT9 A;  2Y2O A;  2VX8 A;  3G4P A;  3IH8 A;  3P09 A;  5G4Y A;  2VKS A;  2L1M A;  5HL1 A;  2P9V B;  1XP4 A;  1MBL A;  3LIF A;  2EX9 A;  2V1B A;  4WZ5 A;  3OCL A;  5E43 A;  2PDR A;  1P97 A;  4DF6 A;  1ESU A;  2OOL A;  3OPL A;  3UB7 A;  1ES2 A;  3NI9 A;  1YMX A;  4QU3 A;  4FUW A;  5A91 A;  5EVI C;  3G2Z A;  5E2F A;  1H3Q A;  3EQV A;  4LCM A;  4BBT A;  1W7F A;  4BWI A;  2VGL M;  4E3I A;  3UDF A;  3M6H A;  4I39 A;  3VE4 A;  4PKY A;  4OPZ A;  3HLB A;  3BW6 A;  4UA9 A;  3A3E A;  1P9R A;  3F1P B;  3L9K A;  3Q81 A;  3ZVT A;  4ETX A;  4PPR A;  1CK3 A;  1SHV A;  3T4Q A;  1L0F A;  1IYS A;  3A3I A;  1Y4O A;  1T1A A;  5I5L A;  2QWS A;  3BFE A;  3B3X A;  3IF6 B;  1LSX A;  4EWF A;  5J7E A;  4UHU A;  1WE4 A;  1TVF A;  3OCN A;  3KO6 A;  1IKG A;  4KQD A;  2O9C A;  4N9L A;  1XX2 A;  3TG9 A;  4PM7 A;  1S1Z A;  3CUE A;  3C38 A;  4N92 A;  1XGJ A;  1ZKJ A;  2EX6 A;  4N9K A;  4E3N A;  2R9W A;  1D1J A;  4X55 A;  3BQ8 A;  2J3W A;  5U47 A;  4GW9 A;  5EVE A;  2CC1 A;  5JYP A;  2Y2K A;  4BQM A;  1XKZ A;  2C5W B;  2WYX A;  3KX0 X;  4K0X A;  3VP3 A;  3WS5 A;  2D01 A;  4B4Z A;  1S67 L;  2PBY A;  3V5M A;  5HAI A;  4XT2 A;  3UO9 A;  3QNC A;  1CI9 A;  1LLB A;  4HJ3 A;  4HH3 A;  4HOI A;  3TW8 A;  3HCY A;  4WL9 A;  3N7W A;  4EBP A;  4P6B A;  1UGU A;  5L2F A;  4NXE A;  3PTE A;  3V3S A;  2YKH A;  2EFX A;  4KZ6 A;  3G2Y A;  2V0W A;  1JVJ A;  3UE1 A;  1VQQ A;  1FQG A;  2Y2H A;  3CG5 A;  4HHD A;  2OAP 1;  4X56 A;  1OTI A;  1DJB A;  1ERO A;  4MCW A;  5DF9 A;  2GX5 A;  4S2J A;  5BOH A;  3DAV A;  4IED A;  3PHY A;  4II7 A;  4E6W A;  2EA9 A;  4ZRR A;  4MN5 A;  5HAQ A;  1L2S A;  1AXB A;  1E25 A;  3LI9 A;  3LY3 A;  2PBD P;  4KZ8 A;  5GHX A;  3UMD A;  2VV7 A;  2I72 A;  2G2U A;  4GD8 A;  1KOU A;  4M4X A;  3SS3 A;  3IXD A;  4JF4 A;  3GTC A;  5EUA A;  1K4E A;  3WWX A;  4ESP A;  5EV0 A;  3VV4 A;  4QY6 A;  1HZO A;  5EOO A;  5FDH A;  4DJ2 A;  2OWJ A;  4PM6 A;  5A93 A;  3CHW P;  3F1N A;  1PW1 A;  4H6J B;  5CXW A;  1E3U D;  3EWK A;  3H82 A;  4BD1 A;  1KE3 A;  5HD5 A;  4IVI A;  5AQ7 A;  1TS8 A;  4EUV A;  5F1G A;  5F5Y A;  2V8F A;  3DTE A;  4JXW A;  1CJF A;  3NDG A;  1K56 A;  3D4F A;  4C75 A;  5AQ9 A;  2I9V A;  4EUZ A;  2WKP A;  4I38 A;  1VET B;  2DMW A;  4QPR A;  1MWU A;  4LCL A;  4X1M A;  3Q7V A;  4HI4 A;  5AJG A;  5KSH A;  5FAO A;  1K25 A;  4RA7 A;  4AFI A;  3JPU A;  2ZBB A;  4GHI A;  4GZB A;  2J3T C;  1JWZ A;  2O9B A;  2QKP A;  1A0K A;  3GV9 A;  4K0W A;  4YOF A;  2VGJ A;  2R78 A;  2Z2M B;  5EVI A;  3C30 A;  4EEP A;  3G35 A;  2XA7 M;  2HF6 A;  3KYQ A;  2Y55 A;  4KQO A;  3BM6 A;  1NYY A;  5DF7 A;  4LV3 A;  3H7W B;  4DE1 A;  2KOI A;  5E2H A;  5HZH A;  3T1S A;  2UV0 E;  2J8Y A;  4GCZ A;  4PM8 A;  3QP1 A;  2ZL1 B;  3ZFZ A;  3E0Y A;  3SOI A;  1KGE A;  3IWI A;  2XSS A;  1S0W A;  3DBA A;  1OTB A;  3HLG A;  3HLD A;  3WRZ A;  4XUZ A;  3HJI A;  3ZHH A;  2JKT I;  4LV1 A;  1K56 D;  3NOU C;  4ZAM A;  2XGN A;  4X6T A;  3LO7 A;  1XJ4 A;  1PZO A;  1KVL A;  4OQG A;  5FA7 A;  5CHU A;  1OJ5 A;  4ARZ B;  1TDL A;  1OME A;  1TS7 A;  2M7U A;  3CZD A;  1IYQ A;  1KE4 A;  3VOZ A;  3ZG0 A; 
#chains in the Genus database with same CATH homology
 4JGO A;  5TBM A;  2QYB A;  4G3V A;  4HJ6 A;  3B33 A;  4R6L A;  5CX7 A;  3S7N A;  5HD3 A;  5F69 A;  2KLI A;  2H28 A;  2OAQ 1;  5AVE A;  3MR0 A;  3BJN A;  1V9Z A;  3F1O A;  3VE3 A;  2W3E A;  4EU0 A;  5DJU A;  2LB9 A;  4JGQ A;  4EQ1 A;  1N9N A;  4XT2 B;  2KX6 A;  3T4K A;  2HV1 A;  3KSH A;  3T50 A;  5HDC A;  5HWV A;  2B02 A;  4ARZ A;  3V67 A;  1IOU A;  2PD7 A;  4EES A;  2V1A A;  4F3L A;  1STZ A;  4KUO A;  2P7J A;  3R7W B;  2ZOH A;  3UB6 A;  3PBN A;  1XJ6 A;  3E4P A;  4RQ9 A;  5HPI A;  2YKF A;  3EQU A;  4NXF A;  5F68 A;  1EW0 A;  5TJJ A;  3O5Y A;  2JKR M;  5DKK A;  5A8B A;  2OWH A;  1DP6 A;  4OOL A;  2BAS A;  3LIC A;  4WUJ A;  4Q0H A;  3NJA A;  5EFW A;  1F9I A;  4Y2F A;  4H6J A;  2W3F A;  5HDS A;  2QJ5 A;  3CIT A;  3A0V A;  3K3D A;  2Y79 A;  3PBO A;  4LRX C;  4MMN A;  1TS0 A;  2O99 A;  2MJ6 A;  2VEA A;  1YSQ A;  3EGX C;  5HWW A;  3D72 A;  2JKT M;  2PT7 A;  2KDK A;  1OT9 A;  2P04 A;  1T1C A;  3TJZ C;  2WKR A;  2P08 A;  1V9Y A;  2VX8 A;  3UB9 A;  5MC7 A;  3JVV A;  5G4Y A;  2VKS A;  3R7W A;  2L1M A;  3RH8 B;  3VOL A;  4O8G A;  1G28 A;  1IFQ A;  3LIF A;  2V1B A;  2A24 B;  3CWF A;  5DFY A;  1P9W A;  3S7Q A;  3EGD C;  3OCL A;  2PDR A;  4Q0I A;  1P97 A;  3T4S A;  3B42 A;  4YWZ A;  4WN5 A;  4IUH A;  2OOL A;  3H9W A;  3UB7 A;  5IS1 A;  3K2N A;  4P6Z S;  4HY8 A;  4E04 A;  1DRM A;  3KSI A;  1H3Q A;  3FPV A;  4Y5F A;  3EQV A;  3PYP A;  4B9O A;  3S7O A;  2EWV A;  4BBT A;  3D3O A;  1G6O A;  2JN7 A;  4BWI A;  2VGL M;  2VLG A;  3MQQ A;  3UE6 A;  3PBT A;  1YSP A;  4R3A A;  3T4L A;  4I39 A;  2QJ7 A;  4HQA A;  2VA0 A;  3VE4 A;  1F5M A;  4PKY A;  4NKP A;  2GZA A;  4WLA A;  2A24 A;  5IU1 A;  3BW6 A;  1GSW A;  1P9R A;  2WKQ A;  4HP4 A;  3LIB A;  3UB8 A;  4Z1W A;  3F1P B;  1N9O A;  2W3D A;  3PBQ A;  4ETX A;  1D06 A;  4YNR A;  3EEA A;  3T4Q A;  1ZHH B;  5K5B A;  1W63 Q;  3LFV A;  3T4J A;  3BQA A;  4Q0J A;  3BY8 A;  1T1A A;  4EET B;  5J4E A;  3R4K A;  3PBR A;  5I5L A;  1BYW A;  2QWS A;  1DP9 A;  4LLO B;  1OTE A;  3ZQ5 A;  3OOV A;  1LSX A;  2HJ9 C;  5J7E A;  1S4R A;  5L8M A;  2V0U A;  3KYZ A;  3OCN A;  4HJ4 A;  4CLC A;  3KO6 A;  1Y28 A;  4HH2 A;  4UQI S;  4BMW A;  4KQD A;  4PAU A;  2O9C A;  4GHI B;  3LR0 A;  4DMZ A;  3LR3 A;  1NLZ A;  4HNB A;  1S1Z A;  3CUE A;  4FSF A;  4G3K A;  1NLY A;  1XJ2 A;  3IS2 A;  3C38 A;  2PR5 A;  2W0N A;  2Z6C A;  2PD8 A;  3PR6 A;  3F1P A;  2M7V A;  3P7N A;  4EEU A;  2Y8H A;  4LRY C;  4L9G A;  1DP8 A;  2A2L A;  3BQ8 A;  2J3W A;  4GW9 A;  2V9A A;  2FZ0 A;  2ZMF A;  2W3G A;  4CLC C;  2L0W A;  4ME4 A;  2K7S A;  4BBU A;  1P0Z A;  3E98 A;  4I3A A;  1VHM A;  3CUE C;  1OPX A;  2XA7 S;  3FPW A;  2W1R A;  1D7E A;  2GJ3 A;  3KX0 X;  2INW A;  3OLO A;  3TE8 A;  1MZU A;  2D01 A;  3OBF A;  5AVF A;  1S67 L;  3G6O A;  3ULF A;  4XT2 A;  4BJP A;  1OJG A;  3CAX A;  2D02 A;  3MJQ A;  4MDZ A;  4HJ3 A;  3CLO A;  4HH3 A;  4HOI A;  4R70 A;  3TW8 A;  3HCY A;  3MQ0 A;  4WL9 A;  1UGU A;  1MC0 A;  4I3I A;  4NXE A;  1NRJ A;  3E4O A;  2VV6 A;  2YKH A;  2V0W A;  3SW1 A;  3W2Z A;  4PKY G;  4HHD A;  2OAP 1;  4L0L A;  4O0P A;  2Z6D A;  1OTI A;  4K08 A;  4CLC E;  4WEL A;  3A0S A;  3NOP C;  4DJ3 A;  4JGR A;  4MCW A;  5DF9 A;  2GX5 A;  1YAX A;  1OTA A;  4WEK A;  2NUP C;  5C5K A;  4GS9 B;  4CLC D;  3PHY A;  3A0R A;  3BWL A;  3U2A A;  4II7 A;  2EA9 A;  1T1B A;  4ZRR A;  1TD5 A;  4MN5 A;  3GDI A;  3ZYT A;  1TS6 A;  5TBM B;  3F1N B;  2W1T B;  2O0Y A;  1ODV A;  3B47 A;  3LI9 A;  4ETZ A;  2O9A A;  3E4Q A;  2CMN A;  2VZW A;  3UMD A;  3H82 B;  2VV7 A;  4JGP A;  4I5S A;  1ZTU A;  3FC7 A;  1KOU A;  3C2W A;  4M4X A;  1TF1 A;  4P6Z M;  2VV8 A;  3T4O A;  5J3W A;  3LUQ A;  3HJK A;  2EWW A;  3MXQ A;  4OOM A;  2ZOI A;  4GJ4 A;  1NWZ A;  3VV4 A;  3UME A;  1T19 A;  2XRN A;  3BY9 A;  4DJ2 A;  4MN6 A;  3RFB A;  4GS9 A;  2OWJ A;  2G7U A;  2B18 A;  2LB5 A;  2K2N A;  3S7P A;  3OC2 A;  4IJG A;  3F1N A;  2W1T A;  3TRC A;  4H6J B;  3EWK A;  3LI8 A;  3H82 A;  4I3J A;  3JVU A;  2JHE A;  4DN0 A;  5G4Z A;  4LRZ E;  1UWP X;  5HD5 A;  1TS8 A;  4EUV A;  2NUT C;  4WEJ A;  5DKL A;  3MFX A;  5F5Y A;  1XFN A;  3LID A;  5DJT A;  3GEC A;  2I9V A;  1S1Y A;  5KIZ A;  2VJW A;  2WKP A;  3LIA A;  1S4S A;  3EEH A;  4L9F A;  4NXG A;  4I38 A;  2DMW A;  4MN7 A;  4QPR A;  2K31 A;  1LSV A;  4UQI M;  4WF0 A;  4HI4 A;  5AJG A;  3IBJ A;  2J80 A;  5LBR A;  5KSH A;  3MMH A;  3IBR A;  4Y3I A;  3FG8 A;  4AFI A;  4KUK A;  2ZBB A;  4GHI A;  5HWT A;  1GSV A;  1OT6 A;  5HSQ A;  1GSX A;  4G3W A;  2QHK A;  3T4T A;  3CI6 A;  3K3C A;  4L9E A;  3RTY A;  5IT5 A;  2J3T C;  2PR6 A;  2O9B A;  3PXP A;  2QKP A;  4FOF A;  3NOT C;  3LR5 A;  1WA9 A;  4YOF A;  1F98 A;  1YKD A;  2R78 A;  4HIA A;  2HGV A;  4EW7 A;  3KSG A;  3C30 A;  4EEP A;  2VGL S;  2XA7 M;  2HF6 A;  3KYQ A;  5HDD A;  2PYR A;  4LPZ A;  2IA2 A;  3C8C A;  3ICY A;  4KQO A;  4O01 A;  4UEY A;  5FL3 A;  3H7W B;  3EOI A;  2JKR I;  3PBS A;  2KOI A;  4EXO A;  5DFX A;  1LT0 A;  5HZH A;  2L4R A;  5HL6 A;  4GCZ A;  3MQO A;  2W3H A;  5HPF A;  3E0Y A;  2W27 A;  3NHQ A;  4IUK A;  1VB6 A;  2XSS A;  4PHT A;  4NEE D;  1MKM A;  3DBA A;  1OTB A;  3KSF A;  3LYX A;  3HJI A;  2JKT I;  1H8M A;  4CQH A;  4EER A;  3NOU C;  3F1O B;  2PYP A;  3LR4 A;  2J3T D;  1XJ4 A;  4R38 A;  4BBV A;  4B93 A;  4CLC B;  2PHY A;  1OJ5 A;  4IHQ A;  4ARZ B;  4GLQ A;  5F6A A;  1UWN X;  1LL8 A;  2FH5 A;  3IS2 B;  2ZMV A;  3UE3 A;  1T18 A;  4F3L B;  1X0O A;  3MF0 A;  1TS7 A;  3H7W A;  2M1C A;  4HP9 A;  3P01 A;  1XFQ A;  2HJE A;  1S66 L;  2M7U A;  1W63 M;  1OTD A;  3LIE A;  2GNX A;  1LSW A;  1N9L A;  4NXB A;  1JNU A;  2XRO A;  1XJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...