2QJ5A

Pyp ultra-high resolution of a bacterial photoreceptor
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
121
Chain Sequence
HVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Picometer-scale conformational heterogeneity separates functional from nonfunctional States of a photoreceptor protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 34
structure length 121
sequence length 123
ec nomenclature
pdb deposition date 2007-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2qj5A00
3EEHA 3UE6A 4HJ6A 3ULFA 2B02A 2OOLA 3A0RA 1XFNA 4GHIB 3G6OA 3LI9A 1XJ6A 3A0VA 5DJUA 1T1CA 3PHYA 3LIFA 3H82A 3FC7A 4R70A 1DP6A 4LRYC 4WL9A 3A0SA 1Y28A 3KX0X 5HWVA 1TS6A 3H7WA 1OTEA 4NXGA 1OJGA 1P97A 5HZHA 1NWZA 4DJ3A 3LICA 1ODVA 3OLOA 2V0WA 3MJQA 4XT2B 1LL8A 1LSXA 4HNBA 4WF0A 1OTAA 1XJ2A 4R3AA 2PYRA 3D72A 4EEUA 4EQ1A 4I5SA 3RH8B 4NXBA 5HDDA 1D7EA 4HI4A 4LRXC 4HQAA 4F3LA 1DP8A 4HP4A 3MQOA 2L1MA 4BBTA 4I39A 4E04A 3F1OB 1S4RA 3EWKA 1DRMA 1F98A 1XJ4A 1UWNX 2QJ7A 4JGQA 3FG8A 3CWFA 1TS8A 1OTBA 2V9AA 2GJ3A 5F68A 3UB8A 3VE3A 1WA9A 4JGPA 3IS2A 2PR6A 2KDKA 2L4RA 1P0ZA 4K08A 5HDSA 3P7NA 3LIBA 1LSWA 5AVEA 1DP9A 3UMDA 3CAXA 2M1CA 2W0NA 2Z6DA 1GSXA 3ICYA 5KIZA 1S66L 5I5LA 2VV6A 4HHDA 5G4ZA 2BASA 1T18A 1OTIA 3VE4A 2PD7A 3LYXA 3GECA 4L9FA 3F1NA 1OTDA 2YKHA 4HOIA 2YKFA 3H82B 4GS9A 4KUKA 3LUQA 2OWJA 1S1YA 3MQQA 4L9GA 2J80A 5F6AA 4LRZE 5F5YA 2HV1A 2QWSA 4R6LA 4EXOA 2VV8A 2INWA 3H7WB 1S4SA 2WKQA 2PHYA 3BY8A 1T1AA 2ZOHA 2I9VA 3MXQA 4BBVA 4XT2A 1KOUA 5HWTA 1JNUA 5J3WA 1N9NA 1GSVA 1V9ZA 4M4XA 3T50A 3UMEA 3LIAA 4NXFA 4R38A 2K7SA 2PD8A 5TBMA 5J4EA 5G4YA 4PKYG 2WKRA 5DKKA 2V0UA 1MZUA 1VB6A 4KQDA 1TS0A 3NOTC 4WUJA 5HD3A 1N9LA 1G28A 4H6JA 2P7JA 4F3LB 1V9YA 4EETB 2W27A 4RQ9A 4NXEA 1TS7A 3UB9A 2ZBBA 5J7EA 1XJ3A 4HY8A 3F1OA 3PYPA 2PR5A 2A24B 2V1AA 2JHEA 4JGRA 1F9IA 1LSVA 4EW7A 5HWWA 1GSWA 3B33A 4EERA 3E4OA 5HD5A 1S67L 1T19A 1OT6A 5IU1A 3IS2B 4KUOA 2ZOIA 3K3DA 2L0WA 4WLAA 4HIAA 2R78A 3F1PA 3VOLA 1UGUA 3NOPC 1N9OA 4L9EA 3LIEA 4GHIA 4I3AA 4HH3A 3LI8A 3C8CA 4BBUA 3NOUC 5HDCA 3HJIA 1OT9A 5EFWA 5AVFA 1BYWA 4LPZA 3K3CA 1LT0A 4MN6A 4EESA 2PDRA 3C2WA 2WKPA 4DJ2A 2VLGA 2H28A 3E4PA 2Z6CA 1XFQA 3F1NB 3ZQ5A 4LLOB 2KX6A 4B9OA 4GS9B 4MN5A 3HJKA 4PKYA 4WN5A 3H9WA 1EW0A 3MR0A 3E4QA 4GCZA 2CMNA 4I38A 5IS1A 2QJ5A 3UB6A 5DJTA 3IBRA 4EEPA 1OJ5A 2PYPA 5TBMB 3CLOA 2D01A 5A8BA 4H6JB 4GW9A 4JGOA 1T1BA 3BY9A 2V1BA 4YWZA 3MFXA 3RTYA 1D06A 2D02A 3BWLA 5F69A 2JN7A 4HH2A 4I3IA 2A24A 2QHKA 2EA9A 3UB7A 1UWPX 1X0OA 3SW1A 5HSQA 4HJ3A 5DKLA 3NHQA 4HJ4A 2VV7A 3LIDA 1S1ZA 3GDIA 2QKPA 4HP9A 3NJAA 4I3JA 2OWHA 2VEAA 3F1PB
chains in the Genus database with same CATH superfamily
1XPBA 3BEBA 3A0RA 4PM9A 1XFNA 4E3IA 1XJ6A 2XH9A 4OLDA 2Y2QA 2J9OA 5GHYA 4BL3A 1CI9A 1J9MA 3PHYA 3FC7A 2Y2PA 4YNRA 3UE0A 4F94A 4KZAA 4LCLA 1CEFA 1Y28A 3S1YA 2JKGA 3KX0X 5HWVA 3PR6A 3S7PA 1BLPA 4LGWA 2NUTC 2BG1A 5TGFA 3CUEA 4K0XA 4E3JA 4HBTA 4S2LA 1E4DA 1ONHA 3UDXA 4UA9A 4Y17A 3HLEA 3FKVA 4HNBA 1VETB 1YSQA 4WF0A 3ITAA 5FASA 1GHPA 4ARZA 5BOHA 2O9BA 2OLVA 2EX8A 4C6YA 2J3WA 1K56A 3RH8B 3QP6A 1VM1A 4DE0A 4E3OA 3G4PA 1CF0A 4DDSA 3P01A 4LRXC 5DFYA 3VP4A 1DP8A 5FSRA 1N4OA 4HP4A 4XXRA 3T1RA 1H8ZA 3PAGA 4E04A 1S4RA 3CZDA 3HLFA 1DRMA 2R9XA 1FSWA 1F98A 1XJ4A 2XLNA 2QJ7A 3IQAA 2G7UA 4LV0A 4P6ZS 1BTLA 1RP5A 2ZQ9A 3T12B 3IH8A 3QP4A 3LR5A 4DE3A 1OTBA 4UA7A 1NLZA 5F68A 5AQBA 1LL5A 1WA9A 3W8KA 4KZ8A 4WZ5C 4QWOA 4FCFA 4ZJ3A 2PR6A 2EFXA 2IWDA 3S7QA 4JF6A 2OV5A 4CLCA 2KDKA 4OLGA 3EOIA 4G3VA 1DY6A 5EV0A 1TDLA 3P7NA 3LIBA 3QHYA 3HVFA 1ZG4A 1CQAA 2Q0OA 1YLJA 3SH7A 3UMDA 1MXOA 2M1CA 3T4LA 2QPNA 5KIZA 3C38A 3QP2A 3MF0A 5G4ZA 2BASA 4EU0A 1OTIA 3VE4A 2PD7A 3LFVA 1YT4A 1OTDA 1NLYA 1IEMA 2W3HA 4HOIA 1FOFA 2HGVA 4FH2A 3M2KA 3MQQA 2LB5A 5F5YA 5GLAA 1NZUA 2P08A 1BLCA 1BULA 3UN7A 2WKHA 3HL9A 5F1GA 1S4SA 2WKQA 5HX9A 3NC8A 1W63Q 3MZFA 1ERMA 1G6AA 1JWZA 1NRJA 3QNCA 1IYQA 2HF6A 1PFLA 1KOUA 5FI7A 4GDBA 4OOYA 5HWTA 1N9NA 3IX8A 2Y4AA 3G2ZA 4ARZB 3PBQA 5L10A 3VP0A 3MXSA 4OQ0A 4HESA 5DKKA 4Y13A 2PU4A 4IEDA 1MZUA 1VB6A 2P9VA 5M1AA 2ZC5B 4EBLA 3PXPA 3BQAA 5GHZA 5A90A 3W4PA 5AQAA 1V9YA 4MEZA 2W27A 1K54C 1TS7A 1XKZA 2A24B 3Q7VA 4JGRA 5FL3A 4EW7A 4D2OA 3JVUA 1W5DA 3B33A 1FR6A 2PAVP 3KO6A 4Y15A 4KUOA 4CLCB 5G18A 1SCWA 1IFQA 2XR0A 3UY6A 3F1PA 3WS0A 1GCEA 3VOLA 1TF1A 2Y2IA 1PZOA 5CHMA 2R9WA 2RL3A 4S2KA 4MBKA 5AQ9A 4L9EA 3UDIA 5HAPA 2HJ9C 2P04A 1BYWA 2X02A 4MN6A 2PDRA 2ZM0A 4DXCA 3HLGA 2PT7A 5IHVA 2KX6A 4KZ5A 5TJJA 2XGNA 4MN5A 3SZTA 3T4JA 3JVVA 1FSYA 2J3TD 1EW0A 3W4QA 2KOIA 3E4QA 3HLCA 4YINA 1KVMA 3M6HA 4GCZA 4QU3A 2Y59A 3EEAA 1IYPA 1N9BA 2NUPC 4C3QA 2OLUA 5GLBA 1FIKA 3LY4A 5F82A 3FPVA 1Y4OA 3IXHA 3BLSA 4DE1A 2Z2LB 4PAUA 3LY3A 5EUAA 3ZNYA 2DNSA 3CPTA 3IHBA 3OCNA 2PYPA 1GHMA 2HZ5A 1DJAA 4OQHA 5E2FA 3IX4A 3WRZA 4WELA 3ZG9B 5FQKA 2DRWA 3V50A 1XXMA 2P9VB 3FKWA 1IYSA 2W1TB 5FAPA 4JGOA 1T1BA 1YLWA 4E3LA 1W8QA 4DXBA 2H0TA 5FQJA 1H3QA 2XF3A 1ALQA 4I3IA 4B4ZA 2QHKA 2XD5A 3WS1A 1PZPA 3Q7VB 5DF7A 5FEGA 3ZG8B 3SW1A 1ZHHB 3BW6A 3HUMA 3WRTA 4JPMA 1SDNA 4HJ3A 3V3RA 4JXVA 4OPZA 2JKTI 3GDIA 4HP9A 3AGDA 3CI6A 2Y2KA 2C5WB 4I3JA 1VEUA 2OWHA 4JXWA 3TOIA 4CQHA 3F1PB 2W3GA 3EEHA 3UE6A 3ULFA 2B02A 2V2FF 3ZCZA 3WS4A 2G2UA 4BQMA 3G6OA 4A5RA 4MBFA 3LI9A 4X56A 3B47A 2Y2HA 1TEMA 3H82A 2E8IA 1M40A 1EI5A 3OBFA 4WL9A 5D3OA 1W7FA 3EQUA 5CX7A 1TS6A 1W79A 1K57C 4JF5A 4MDZA 4M3KA 2ZM2A 1NWZA 4DJ3A 1PWGA 5KMWA 3VP2A 2V0WA 3PBSA 1F5MA 3MJQA 4XT2B 2M7VA 1LL8A 1H8YA 4NEED 4S2NC 1LSXA 5HARA 3PBRA 4R3AA 3D72A 3DW0A 2X01A 5I94A 4E3NA 2Y55A 1K4EA 2WZXA 2WKIA 2ACGA 4E6WA 4DN0A 4HQAA 2RCXA 2VA0A 5HPIA 3PBTA 2WK0A 3MQOA 4WMCD 4I39A 1FR1A 1LHYA 2WGWA 4QHCA 1CK3A 1UWNX 3OZHA 4JGQA 4RX3A 1MBLA 3IXBA 1VHMA 3UB8A 2EWWA 5CGSA 2VGLM 3FYZA 4IBRA 1G68A 5CGWA 1TVFA 5E2EA 1P0ZA 5CEDA 5HDSA 3R7WA 3SH8A 3N8SA 2JKRM 4OP5A 1LSWA 4ID4A 2LB9A 3CAXA 5AJGA 3GQZA 2Y2OA 2Y2MA 3UO9A 4KZ9A 1PRQA 4S2JA 4HHDA 4X25A 1S0WA 2A49A 3IF5A 2Q9MA 3LYXA 1TDGA 4WZ5A 1K25A 3MS6A 4L9FA 3F1NA 3VOZA 4U3TA 4EUZA 3H82B 4GS9A 4DKIA 3S4XA 3ZNTA 3BFEA 5FQMA 2J80A 5CGXA 1BUEA 2ZQ7A 3N8RA 1Z09A 4GDNA 5FDSA 1NXYA 2VV8A 3MMHA 1BT5A 4C75A 3LO7A 5DF9A 3DBAA 3GR2A 3BLMA 1XA7A 1SKOA 2PHYA 3LR0A 1T1AA 4PPRA 5DFXA 4X53A 1IKGA 3MXQA 4P0MA 3GVBA 1QMEA 4WMCA 4KZ3A 3OPRA 5J3WA 3ZG7B 4Q8IA 1YQSA 4KZBA 1PNEA 2WUQA 2ZC4B 3T50A 1STZA 5EE8A 5MC7A 4R38A 1MWTA 4KENB 1E3UD 4KQDA 1MPLA 3MKFA 1L3LA 1GA9A 1ZTUA 4S2MA 3NY4A 2ZMVA 3D3OA 3P09A 2P7JA 2P74A 2XA7M 2VGLS 3SOIA 3U2AA 4X1LA 5A93A 1JTGA 4S2PA 1L0DA 3G35A 5GLCA 4HY8A 3F1OA 3PYPA 2PR5A 2EXAA 1L0GA 2JHEA 3MXRA 1HZOA 1F9IA 4IHQA 4JF4A 2WAFA 3OPLA 3MKEA 5HD5A 3SS5A 2IWBA 5LBRA 3QP8A 2WAEA 1JWVA 4II7A 5IU1A 1ESIA 3Q82A 4JKTA 3GTCA 1J3WA 1FCNA 2ZOIA 5TR7A 3K3DA 3HBRA 1O7EA 1K54A 2Y2GA 3R7WB 4HIAA 4GD8A 4LV1A 2VGKA 3BYDA 4AFIA 4U0XA 3IX3A 1N9OA 3CJMA 5FEFA 3LIEA 2ZMFA 3G31A 3C8CA 2J8YA 1K38A 3HJIA 5AVFA 3I7JA 4IUKA 3VSLA 3WWXA 1SKFA 3C2WA 2WKPA 4KZ4A 5F1FA 2QZ6A 3BM6A 4Y0OA 3E4PA 3F1NB 1XFQA 5CXWA 5EVIC 4LLOB 5GLDA 4GS9B 4KQQA 4PKYA 1NRFA 4WN5A 3VP3A 2EWVA 1E3UA 1KDWA 3GRJA 3RJUA 3M2JA 1YPRA 2VJWA 3DWZA 5K5BA 5FQIA 4XUZA 1SKOB 2VKSA 2XA7S 4N9KA 2IA2A 3R4KA 3WS5A 5L07A 4EEPA 2Y8HA 1XGJA 3KYZA 2JE5A 4P85A 4GN2A 2K31A 4JXSA 3C7UA 3CLOA 2QMIA 1Q2QA 3A3JA 2WZZA 5A8BA 2JBFA 4BENA 1JWPA 2HP6A 3W4OA 5GHXA 3BY9A 3BFGA 2GZAA 1LI9A 4YWZA 4PHTA 1ERQA 3RTYA 3MBZA 1D06A 3G34A 4KZ6A 2A3UA 2ZL1A 4RA7A 3S7OA 4K91A 3IF6C 1I2WA 1YLYA 3L7HA 1UWPX 1PI5A 1X0OA 4OPQA 1FQGA 4WZ4A 1DJBA 1K4FA 3HREA 1SDEA 1MY8A 4OOLA 2KLIA 3LR3A 1KGFA 4BWIA 1EROA 3D4FA 5CHUA 3UPPA 1XX2A 3FZCA 4PM5A 3V67A 2MJ6A 3IWIA 3TG9A 2JCHA 5L09A 4IVIA 1K6SA 3ZGAB 4X69A 2O9CA 3ZG0A 5J8XA 2VK3A 2ZJ9A 3LIFA 5CTNA 3OPHA 3Q1FA 4R70A 4IVKA 3A0SA 4BLMA 3T4QA 4ZJ2A 4BMWA 4RX2A 5EM1A 1NJ4A 2Y2JA 1NYYA 1OJGA 1P97A 2XQZA 4Q0JA 2HDSA 3C4PA 1LL9A 4Q0HA 5FDHA 3ZYTA 3VV4A 3G2YA 4ZAMA 1ZKJA 4DRTA 2GX5A 3VFHA 2JKFA 5EVEA 1XJ2A 4PM7A 2HP9A 3UDFA 2DMWA 4NXBA 1G6OA 1PIOA 3E0YA 2ZMAA 3IHAA 1D7EA 1KDSA 4HI4A 1K57A 1YAXA 4F3LA 4E6XA 4MN7A 2L1MA 1HLUP 3U4LP 1BSGA 1IOUA 3SH9A 2PBDP 2OAP1 1YM1A 3DAVA 5L8MA 4S2NA 4FH4A 4ETZA 2ZL1B 1TS8A 5U47A 2GJ3A 1JTDA 3S7NA 3N8LA 4E3KA 3NDEA 3VE3A 2AVXA 1ES5A 3IS2A 4MCWA 3T1XA 1K55C 4ZTKA 4FUWA 2Y79A 4D60A 5FI6A 3HLBA 4N1XA 1GSXA 3UE3A 2Y2NA 5I5LA 1NZOA 2H10A 4WEKA 3IWQA 4X6TA 2YKHA 1KGEA 3GMWA 4HEFA 4KUKA 2BLSA 4OVDA 2OWJA 1S1YA 5HPFA 4L9GA 4UEYA 5F6AA 4LRZE 4UAAA 4UA6A 4R6LA 4EXOA 3DTMA 3OPPA 5KSHA 5HL1A 3IXDA 5A91A 4ESPA 4DMZA 1ES3A 1PWDA 2XK1A 1YLPA 4PMAA 1H0MA 3NCKA 3QP1A 2ZLYA 5FAQA 1P9WA 4G3WA 3MSHA 1GSVA 2HDUA 2PBYA 3SS4A 4KG5A 4M4XA 4YFMA 1RGYA 2M7UA 4QJGA 3ISGA 1QMFA 3UMEA 3CPTB 3SS3A 1PWCA 3MZEA 1L0FA 2E8JA 2EX2A 3LIAA 4MMNA 4NXFA 4CJNA 4EWFA 2K7SA 1U60A 4WM9A 3TSGA 4NKPA 5G4YA 3BQ8A 3DTIA 2V0UA 5M19A 1FCOA 4WUJA 5F83A 4KQRA 1N9LA 4H6JA 4F3LB 4RQ9A 3UPNA 2ZBBA 3M6BA 4BD0A 1MWUA 5DTKA 2JKRI 4R0QA 2V8CA 3BFCA 1LSVA 5EVID 1GSWA 3Q07A 4EBPA 2ZD8A 3E4OA 5DTSA 2PRFA 4DE2A 5C5KA 3QNBA 1T19A 1WYBA 1HVBA 3IS2B 3O86A 5CEBA 2B18A 2L0WA 3FWLA 5E2HA 1VEUB 2Y2LA 3NBLA 1UGUA 2EX9A 3NOPC 4P87A 3TW8A 3G32A 4E3MA 4Z9QA 4GHIA 3ZDJA 4HH3A 4B93A 3LI8A 4BBUA 3HCYA 4Q0IA 4YOFA 5HDCA 4CPKA 1OMEA 1MWRA 1OT9A 3O87A 3MFDA 2J7VA 4LPZA 4BD1A 3K3CA 4UQIM 4JBFA 4U0TA 4EESA 4FD8A 2VLGA 1ZG6A 4CLCD 1OPXA 3DTEA 2H28A 2XROA 2Z6CA 5EVLA 2HDQA 3ZQ5A 4QB8A 4B9OA 1BLHA 2FH5A 4Y0TA 4O7DA 4O0PA 4QPRA 1ONGA 4H8RA 4QD4A 3CITA 4WYYA 5GL9A 3QP5A 3VOYA 4N9LA 2CMNA 4I38A 5IS1A 3T4KA 4MBHA 1KE3A 2BTFP 5JYOA 5CECA 4X55A 2XD1A 1XGIA 3IBRA 4LFUA 3BFDA 1OJ5A 2EFUA 2IWCA 4ZRRA 3ZG5A 5EVIA 2W3EA 2ZC6B 3T1QB 2HP5A 1BZAA 2V8FA 3C30A 2Z2MB 1L0EA 2D01A 4FOFA 5FQ9A 1O07A 4H6JB 5HL6A 2ZM8A 3KSHA 4KQOA 3MFXA 2WGWB 5HAQA 1H5XA 4EBNA 2D02A 4OPRA 5DF8A 2JN7A 4OP8A 4HH2A 2W3FA 2A24A 3IWOA 4BJPA 3L9KA 4XUXA 3UB7A 4OQGA 4ZDXA 3OC2A 3V39A 3K2NA 3NI9A 3N7WA 2ZQDA 5HSQA 4OQIA 4O01A 3NHQA 4HJ4A 3RXXA 2VV7A 1ES2A 3NIAA 2Y91A 4PM6A 4UQIS 1CI8A 2QKPA 2CC1A 2FFYA 5A92A 1MKIA 4HBUA 3LEQA 3T1SA 3CUEC 4P6BA 5E2GA 4HJ6A 2J9PA 2OOLA 2O99A 4GHIB 4WEJA 4Y0UA 4DF6A 3C4OA 3OOVA 3IF6A 1I2SA 2X71A 3A3DA 3BJNA 3Q7ZA 3A0VA 5DJUA 4OOMA 1T1CA 2VGJA 3IT9A 1YLTA 1CJFA 2B5RA 1L2SA 1ZC2A 2HDRA 1FCMA 3V3SA 2HPBA 1DP6A 1NY0A 4LRYC 1EWZA 4EQIA 1SHVA 3KYEA 2V20A 4R3JA 3A3IA 1XP4A 1YKDA 1MC0A 3H7WA 5AQ7A 4Z1WA 5EOEA 1OTEA 4NXGA 2PU2A 1KE4A 4B88A 4CLCE 5HZHA 3LICA 2JC7A 4KZ7A 3VSKA 3AGEA 4OKPA 1ODVA 2H5SA 1YSPA 3FV7A 3OLOA 3VP1A 3PBNA 4S2OA 3EGDC 2B95A 2H0YA 1I5QA 3B3XA 1OTAA 1ES4A 2PYRA 3MZDA 4EEUA 1DJCA 4PM8A 5CRFA 4GKUA 4NETA 4EQ1A 4I5SA 4JLFA 1W8YA 4O8GA 5EVIB 5HDDA 3ZVTA 3CG5A 5FQQA 1MWSA 4CLCC 3IXGA 1K6RA 1KVLA 3NULA 3C7VA 5EECA 2W1TA 4BBTA 4IUHA 1IYOA 3T4TA 2WADA 3HLWA 3F1OB 4N1HA 3EWKA 2FFFB 3N4IA 3WS2A 3FG8A 3CWFA 5CHJA 2V9AA 2ZQAA 3T4SA 5KZHA 4G3KA 3D9YA 1E25A 1WYCA 4JGPA 4MNRA 5KSCA 3DTKA 1YLZA 3E98A 2L4RA 1WE4A 5EM0A 3E2LA 4K08A 3VMAA 2XEPA 4QY6A 3ZFZA 3EQVA 1CEGA 3MQ0A 1ACFA 1JVJA 3P98A 4R23A 2WGVA 1S6RA 5AVEA 1DP9A 3JPUA 3DWKA 2W0NA 2Z6DA 2O9AA 1VQQA 5M18A 4DDYA 3ICYA 2QYBA 4R3BA 1S66L 5FA7A 1LLBA 2VV6A 3ITBA 3IF6B 1NYMA 1T18A 4GD6A 3GECA 1SZVA 1C3BA 1MKMA 3UE1A 4Y3IA 3KYQA 4FSFA 1K55A 2YKFA 2HJEA 4FTXA 3O3VA 3LUQA 2ZC7A 4LENA 2HV1A 2QWSA 4Y5FA 3NECA 2FZ0A 1YMSA 2INWA 3H7WB 3UNWA 1AXBA 3RXWA 3T4OA 2XFTA 4RYEA 5FAOA 2WYXA 4X68A 4JXGA 3BY8A 4RVAA 5EPHA 2ZOHA 5IT5A 2I9VA 1IELA 4BBVA 4XT2A 5CERA 3UPOA 3HUNA 1JNUA 3HLDA 3G30A 1V9ZA 1AWIA 1Y54A 5HW3A 4UHUA 5E43A 5JYPA 3ZHHA 1YMXA 4IBXA 3A3FA 5CTMA 2PD8A 5TBMA 5J4EA 2G2WA 4PKYG 2WKRA 1M6KA 4LCMA 1TS0A 1HTZA 3NOTC 5HD3A 1G28A 4WBGA 4ZBEA 4EETB 3JYIA 3TRCA 4BL2A 1BLSA 4NXEA 5EOOA 3UB9A 5J7EA 2I72A 2GDNA 3O5YA 1XJ3A 3TJZC 4OPYA 1D1JA 2V1AA 3AGFA 5HWWA 3BRMA 4EERA 5TFQA 3KSFA 4MLLA 2OSUA 3E2KA 4Y2FA 4NG2A 5DTTA 2A2LA 4GB7A 3GSGA 2ZC3B 1S67L 3LGOA 3V5MA 4LV3A 1OT6A 1PW8A 2C6WB 1Q2PA 1PW1A 1RCJA 4WLAA 3ZVWA 3HUOA 4B4XA 2R78A 2XFSA 4KG2A 5DVAA 2ZQ8A 1P9RA 2O0YA 3NDGA 4I3AA 4K0WA 4GNUA 3TE8A 3EGXC 3NOUC 1W63M 2OAQ1 3N6IA 3Q81A 5EFWA 1XA1A 5FATA 1GHIA 1LT0A 2JKTM 1GA0A 3PBOA 4ETXA 4DJ2A 5HFOA 1FILA 2WKEA 1PI4A 4OONA 3S22A 3BFFA 3IBJA 2W3DA 4S2IA 3W2ZA 2W1RA 3HJKA 3LEZA 3H9WA 3MR0A 4NK3A 4GJ4A 1F2KA 3PTEA 5HAIA 4ZJ1A 3CMZA 4R4SA 4X1MA 2XRNA 3B42A 4EV4A 3PAEA 2QJ5A 2EXBA 4R1GA 1VETA 3UB6A 1G5UA 2VZWA 4QY5A 1K0KA 5DJTA 1IKIA 3IH9A 1KGGA 2UV0E 3C5AA 4LV2A 5FI2A 3O88A 3KSGA 2DCFA 4GLQA 5TBMB 3GV9A 1H8MA 4OH0A 3KSIA 2Q9NA 4KG6A 1A0KA 3UB5P 1LI0A 3VFFA 4GW9A 2V1BA 2ZQCA 1TD5A 3A3EA 4N92A 3BWLA 5F69A 3OCLA 3BECA 2J3TC 1PYYA 1KE0A 4EUVA 2EA9A 3LR4A 1K56D 3CHWP 4GOGA 2GNXA 2K2NA 4ME4A 2V1ZA 5DKLA 1RGZA 2VX8A 4Y7PA 3LIDA 1S1ZA 4IJGA 4L0LA 2XSSA 1Z6FA 5L2FA 2XDMA 4R4RA 4GZBA 1ESUA 3NJAA 3FPWA 4P6ZM 2UWXA 1HD8A 2EX6A 2VEAA 2WGIA 3RFBA 3LCEA
chains in the Genus database with same CATH topology
3EEHA 3V67A 3UE6A 4HJ6A 3ULFA 2B02A 2MJ6A 2OOLA 2O99A 3A0RA 1XFNA 4GHIB 4WEJA 3G6OA 3OOVA 3LI9A 1XJ6A 3BJNA 3B47A 3A0VA 5DJUA 4OOMA 2O9CA 1T1CA 3PHYA 3LIFA 3H82A 3FC7A 4YNRA 3OBFA 4R70A 1DP6A 4LRYC 4WL9A 3A0SA 3T4QA 1Y28A 3EQUA 3KX0X 5HWVA 3PR6A 1TS6A 5CX7A 3S7PA 4BMWA 1YKDA 4MDZA 1MC0A 3H7WA 4Z1WA 2NUTC 1OTEA 4NXGA 1OJGA 1P97A 3CUEA 4CLCE 5HZHA 1NWZA 4DJ3A 3LICA 4Q0JA 1ODVA 1YSPA 3OLOA 4Q0HA 2V0WA 3PBSA 3ZYTA 3PBNA 1F5MA 3EGDC 3MJQA 4XT2B 3VV4A 2M7VA 1LL8A 4NEED 1LSXA 2GX5A 4HNBA 1YSQA 4WF0A 1OTAA 1XJ2A 3PBRA 4ARZA 4R3AA 2PYRA 3D72A 2O9BA 4EEUA 2J3WA 2DMWA 4EQ1A 4I5SA 3RH8B 4NXBA 1G6OA 3E0YA 4O8GA 5HDDA 1D7EA 4HI4A 3P01A 4CLCC 4DN0A 4LRXC 4HQAA 5DFYA 1YAXA 4F3LA 1DP8A 2VA0A 5HPIA 4MN7A 2W1TA 3PBTA 4HP4A 3MQOA 2L1MA 4BBTA 4I39A 4IUHA 3T4TA 4E04A 1IOUA 3F1OB 1S4RA 3EWKA 1DRMA 2OAP1 1F98A 5L8MA 1XJ4A 1UWNX 2QJ7A 2G7UA 4P6ZS 4JGQA 4ETZA 3FG8A 3CWFA 1TS8A 3LR5A 1OTBA 2V9AA 2GJ3A 3T4SA 3S7NA 4G3KA 1VHMA 1NLZA 5F68A 3UB8A 3VE3A 2EWWA 1WA9A 4JGPA 3IS2A 2VGLM 4MCWA 2PR6A 3S7QA 3E98A 4CLCA 2KDKA 2L4RA 1P0ZA 2Y79A 4K08A 5HDSA 3R7WA 3EOIA 4G3VA 3P7NA 2JKRM 3LIBA 3EQVA 1LSWA 3MQ0A 5AVEA 2LB9A 1DP9A 3UMDA 3CAXA 2M1CA 2W0NA 3T4LA 2Z6DA 2O9AA 5AJGA 1GSXA 3ICYA 2QYBA 3UE3A 5KIZA 1S66L 5I5LA 2VV6A 3C38A 4WEKA 4HHDA 3MF0A 5G4ZA 2BASA 4EU0A 1T18A 1OTIA 3VE4A 2PD7A 3LYXA 3GECA 3LFVA 1MKMA 4L9FA 3F1NA 4Y3IA 1OTDA 1NLYA 3KYQA 2YKHA 4FSFA 2W3HA 4HOIA 2YKFA 3H82B 2HJEA 2HGVA 4GS9A 4KUKA 3LUQA 2OWJA 1S1YA 5HPFA 3MQQA 4L9GA 2LB5A 2J80A 4UEYA 5F6AA 4LRZE 5F5YA 2HV1A 2QWSA 4Y5FA 4R6LA 4EXOA 2P08A 2FZ0A 2VV8A 3MMHA 2INWA 3H7WB 3T4OA 5KSHA 1S4SA 2WKQA 4DMZA 5DF9A 3DBAA 2PHYA 3BY8A 1T1AA 3LR0A 5DFXA 2ZOHA 1W63Q 5IT5A 2I9VA 3MXQA 4BBVA 1NRJA 4XT2A 1P9WA 2HF6A 1KOUA 4G3WA 5HWTA 1JNUA 5J3WA 1N9NA 1GSVA 1V9ZA 2M7UA 4M4XA 1STZA 3T50A 3UMEA 4ARZB 5MC7A 3PBQA 3LIAA 4MMNA 4NXFA 4R38A 2K7SA 2PD8A 5TBMA 5J4EA 4NKPA 5G4YA 3BQ8A 2WKRA 4PKYG 5DKKA 2V0UA 1MZUA 1VB6A 4KQDA 1TS0A 3NOTC 4WUJA 5HD3A 1N9LA 1G28A 3PXPA 3BQAA 4H6JA 1ZTUA 2ZMVA 3D3OA 2P7JA 4F3LB 1V9YA 2XA7M 2VGLS 3U2AA 4EETB 2W27A 4RQ9A 3TRCA 4NXEA 1TS7A 3UB9A 2ZBBA 5J7EA 3O5YA 1XJ3A 3TJZC 4HY8A 3F1OA 3PYPA 2PR5A 2A24B 2V1AA 2JHEA 2JKRI 4JGRA 1F9IA 1LSVA 5FL3A 4EW7A 4IHQA 5HWWA 1GSWA 3JVUA 3B33A 4EERA 3KSFA 3E4OA 5HD5A 4Y2FA 2A2LA 5C5KA 1S67L 1T19A 5LBRA 1OT6A 3KO6A 5IU1A 4II7A 3IS2B 4KUOA 2B18A 2ZOIA 3K3DA 2L0WA 4CLCB 4WLAA 2W3GA 1IFQA 3R7WB 4HIAA 2R78A 3F1PA 3VOLA 1UGUA 1TF1A 4AFIA 3NOPC 3TW8A 1N9OA 4L9EA 1P9RA 2O0YA 3LIEA 4GHIA 4I3AA 2ZMFA 4HH3A 4B93A 3LI8A 3C8CA 3TE8A 3EGXC 4BBUA 3HCYA 3NOUC 4Q0IA 1W63M 4YOFA 5HDCA 2OAQ1 3HJIA 1OT9A 2HJ9C 5EFWA 2P04A 5AVFA 4IUKA 1BYWA 4LPZA 3K3CA 1LT0A 2JKTM 4MN6A 4UQIM 4EESA 2PDRA 3C2WA 2WKPA 3PBOA 4ETXA 4DJ2A 2VLGA 4CLCD 1OPXA 2PT7A 3F1NB 2H28A 2Z6CA 1XFQA 3E4PA 2XROA 3ZQ5A 4LLOB 3IBJA 2KX6A 2W3DA 5TJJA 4B9OA 4GS9B 4MN5A 2FH5A 3W2ZA 2W1RA 3T4JA 3HJKA 4PKYA 3JVVA 4WN5A 4O0PA 3H9WA 2J3TD 4QPRA 2EWVA 1EW0A 2KOIA 3MR0A 3E4QA 3CITA 4GJ4A 4GCZA 2CMNA 3EEAA 4I38A 2NUPC 2XRNA 2VJWA 3B42A 5IS1A 5K5BA 3T4KA 3FPVA 2QJ5A 2VKSA 3UB6A 2XA7S 2VZWA 4PAUA 2IA2A 3R4KA 5DJTA 3IBRA 4EEPA 2Y8HA 3KYZA 1OJ5A 4ZRRA 2K31A 3OCNA 2W3EA 2PYPA 3KSGA 4GLQA 5TBMB 3CLOA 1H8MA 4WELA 3C30A 3KSIA 2D01A 4FOFA 5A8BA 2W1TB 4H6JB 4GW9A 4JGOA 5HL6A 1T1BA 3BY9A 2V1BA 2GZAA 1TD5A 3KSHA 4KQOA 4YWZA 4PHTA 3MFXA 3RTYA 1D06A 2D02A 3BWLA 5F69A 1H3QA 3OCLA 2JN7A 4HH2A 2J3TC 2W3FA 4I3IA 2A24A 3S7OA 4BJPA 4EUVA 2QHKA 2EA9A 3LR4A 3UB7A 1UWPX 1X0OA 3OC2A 3SW1A 1ZHHB 3K2NA 3BW6A 2GNXA 2K2NA 5HSQA 4ME4A 4HJ3A 4O01A 5DKLA 3NHQA 4HJ4A 2VV7A 2VX8A 4OOLA 3LIDA 1S1ZA 2KLIA 4IJGA 2JKTI 3GDIA 3LR3A 4L0LA 2XSSA 4UQIS 2QKPA 4HP9A 3NJAA 4BWIA 3FPWA 3CI6A 4P6ZM 4I3JA 2OWHA 2VEAA 3RFBA 4CQHA 3CUEC 3F1PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EEH A;  3UE6 A;  4HJ6 A;  3ULF A;  2B02 A;  2OOL A;  3A0R A;  1XFN A;  4GHI B;  3G6O A;  3LI9 A;  1XJ6 A;  3A0V A;  5DJU A;  1T1C A;  3PHY A;  3LIF A;  3H82 A;  3FC7 A;  4R70 A;  1DP6 A;  4LRY C;  4WL9 A;  3A0S A;  1Y28 A;  3KX0 X;  5HWV A;  1TS6 A;  3H7W A;  1OTE A;  4NXG A;  1OJG A;  1P97 A;  5HZH A;  1NWZ A;  4DJ3 A;  3LIC A;  1ODV A;  3OLO A;  2V0W A;  3MJQ A;  4XT2 B;  1LL8 A;  1LSX A;  4HNB A;  4WF0 A;  1OTA A;  1XJ2 A;  4R3A A;  2PYR A;  3D72 A;  4EEU A;  4EQ1 A;  4I5S A;  3RH8 B;  4NXB A;  5HDD A;  1D7E A;  4HI4 A;  4LRX C;  4HQA A;  4F3L A;  1DP8 A;  4HP4 A;  3MQO A;  2L1M A;  4BBT A;  4I39 A;  4E04 A;  3F1O B;  1S4R A;  3EWK A;  1DRM A;  1F98 A;  1XJ4 A;  1UWN X;  2QJ7 A;  4JGQ A;  3FG8 A;  3CWF A;  1TS8 A;  1OTB A;  2V9A A;  2GJ3 A;  5F68 A;  3UB8 A;  3VE3 A;  1WA9 A;  4JGP A;  3IS2 A;  2PR6 A;  2KDK A;  2L4R A;  1P0Z A;  4K08 A;  5HDS A;  3P7N A;  3LIB A;  1LSW A;  5AVE A;  1DP9 A;  3UMD A;  3CAX A;  2M1C A;  2W0N A;  2Z6D A;  1GSX A;  3ICY A;  5KIZ A;  1S66 L;  5I5L A;  2VV6 A;  4HHD A;  5G4Z A;  2BAS A;  1T18 A;  1OTI A;  3VE4 A;  2PD7 A;  3LYX A;  3GEC A;  4L9F A;  3F1N A;  1OTD A;  2YKH A;  4HOI A;  2YKF A;  3H82 B;  4GS9 A;  4KUK A;  3LUQ A;  2OWJ A;  1S1Y A;  3MQQ A;  4L9G A;  2J80 A;  5F6A A;  4LRZ E;  5F5Y A;  2HV1 A;  2QWS A;  4R6L A;  4EXO A;  2VV8 A;  2INW A;  3H7W B;  1S4S A;  2WKQ A;  2PHY A;  3BY8 A;  1T1A A;  2ZOH A;  2I9V A;  3MXQ A;  4BBV A;  4XT2 A;  1KOU A;  5HWT A;  1JNU A;  5J3W A;  1N9N A;  1GSV A;  1V9Z A;  4M4X A;  3T50 A;  3UME A;  3LIA A;  4NXF A;  4R38 A;  2K7S A;  2PD8 A;  5TBM A;  5J4E A;  5G4Y A;  4PKY G;  2WKR A;  5DKK A;  2V0U A;  1MZU A;  1VB6 A;  4KQD A;  1TS0 A;  3NOT C;  4WUJ A;  5HD3 A;  1N9L A;  1G28 A;  4H6J A;  2P7J A;  4F3L B;  1V9Y A;  4EET B;  2W27 A;  4RQ9 A;  4NXE A;  1TS7 A;  3UB9 A;  2ZBB A;  5J7E A;  1XJ3 A;  4HY8 A;  3F1O A;  3PYP A;  2PR5 A;  2A24 B;  2V1A A;  2JHE A;  4JGR A;  1F9I A;  1LSV A;  4EW7 A;  5HWW A;  1GSW A;  3B33 A;  4EER A;  3E4O A;  5HD5 A;  1S67 L;  1T19 A;  1OT6 A;  5IU1 A;  3IS2 B;  4KUO A;  2ZOI A;  3K3D A;  2L0W A;  4WLA A;  4HIA A;  2R78 A;  3F1P A;  3VOL A;  1UGU A;  3NOP C;  1N9O A;  4L9E A;  3LIE A;  4GHI A;  4I3A A;  4HH3 A;  3LI8 A;  3C8C A;  4BBU A;  3NOU C;  5HDC A;  3HJI A;  1OT9 A;  5EFW A;  5AVF A;  1BYW A;  4LPZ A;  3K3C A;  1LT0 A;  4MN6 A;  4EES A;  2PDR A;  3C2W A;  2WKP A;  4DJ2 A;  2VLG A;  2H28 A;  3E4P A;  2Z6C A;  1XFQ A;  3F1N B;  3ZQ5 A;  4LLO B;  2KX6 A;  4B9O A;  4GS9 B;  4MN5 A;  3HJK A;  4PKY A;  4WN5 A;  3H9W A;  1EW0 A;  3MR0 A;  3E4Q A;  4GCZ A;  2CMN A;  4I38 A;  5IS1 A;  2QJ5 A;  3UB6 A;  5DJT A;  3IBR A;  4EEP A;  1OJ5 A;  2PYP A;  5TBM B;  3CLO A;  2D01 A;  5A8B A;  4H6J B;  4GW9 A;  4JGO A;  1T1B A;  3BY9 A;  2V1B A;  4YWZ A;  3MFX A;  3RTY A;  1D06 A;  2D02 A;  3BWL A;  5F69 A;  2JN7 A;  4HH2 A;  4I3I A;  2A24 A;  2QHK A;  2EA9 A;  3UB7 A;  1UWP X;  1X0O A;  3SW1 A;  5HSQ A;  4HJ3 A;  5DKL A;  3NHQ A;  4HJ4 A;  2VV7 A;  3LID A;  1S1Z A;  3GDI A;  2QKP A;  4HP9 A;  3NJA A;  4I3J A;  2OWH A;  2VEA A;  3F1P B; 
#chains in the Genus database with same CATH topology
 1XPB A;  3BEB A;  3A0R A;  4PM9 A;  1XFN A;  4E3I A;  1XJ6 A;  2XH9 A;  4OLD A;  2Y2Q A;  2J9O A;  5GHY A;  4BL3 A;  1CI9 A;  1J9M A;  3PHY A;  3FC7 A;  2Y2P A;  4YNR A;  3UE0 A;  4F94 A;  4KZA A;  4LCL A;  1CEF A;  1Y28 A;  3S1Y A;  2JKG A;  3KX0 X;  5HWV A;  3PR6 A;  3S7P A;  1BLP A;  4LGW A;  2NUT C;  2BG1 A;  5TGF A;  3CUE A;  4K0X A;  4E3J A;  4HBT A;  4S2L A;  1E4D A;  1ONH A;  3UDX A;  4UA9 A;  4Y17 A;  3HLE A;  3FKV A;  4HNB A;  1VET B;  1YSQ A;  4WF0 A;  3ITA A;  5FAS A;  1GHP A;  4ARZ A;  5BOH A;  2O9B A;  2OLV A;  2EX8 A;  4C6Y A;  2J3W A;  1K56 A;  3RH8 B;  3QP6 A;  1VM1 A;  4DE0 A;  4E3O A;  3G4P A;  1CF0 A;  4DDS A;  3P01 A;  4LRX C;  5DFY A;  3VP4 A;  1DP8 A;  5FSR A;  1N4O A;  4HP4 A;  4XXR A;  3T1R A;  1H8Z A;  3PAG A;  4E04 A;  1S4R A;  3CZD A;  3HLF A;  1DRM A;  2R9X A;  1FSW A;  1F98 A;  1XJ4 A;  2XLN A;  2QJ7 A;  3IQA A;  2G7U A;  4LV0 A;  4P6Z S;  1BTL A;  1RP5 A;  2ZQ9 A;  3T12 B;  3IH8 A;  3QP4 A;  3LR5 A;  4DE3 A;  1OTB A;  4UA7 A;  1NLZ A;  5F68 A;  5AQB A;  1LL5 A;  1WA9 A;  3W8K A;  4KZ8 A;  4WZ5 C;  4QWO A;  4FCF A;  4ZJ3 A;  2PR6 A;  2EFX A;  2IWD A;  3S7Q A;  4JF6 A;  2OV5 A;  4CLC A;  2KDK A;  4OLG A;  3EOI A;  4G3V A;  1DY6 A;  5EV0 A;  1TDL A;  3P7N A;  3LIB A;  3QHY A;  3HVF A;  1ZG4 A;  1CQA A;  2Q0O A;  1YLJ A;  3SH7 A;  3UMD A;  1MXO A;  2M1C A;  3T4L A;  2QPN A;  5KIZ A;  3C38 A;  3QP2 A;  3MF0 A;  5G4Z A;  2BAS A;  4EU0 A;  1OTI A;  3VE4 A;  2PD7 A;  3LFV A;  1YT4 A;  1OTD A;  1NLY A;  1IEM A;  2W3H A;  4HOI A;  1FOF A;  2HGV A;  4FH2 A;  3M2K A;  3MQQ A;  2LB5 A;  5F5Y A;  5GLA A;  1NZU A;  2P08 A;  1BLC A;  1BUL A;  3UN7 A;  2WKH A;  3HL9 A;  5F1G A;  1S4S A;  2WKQ A;  5HX9 A;  3NC8 A;  1W63 Q;  3MZF A;  1ERM A;  1G6A A;  1JWZ A;  1NRJ A;  3QNC A;  1IYQ A;  2HF6 A;  1PFL A;  1KOU A;  5FI7 A;  4GDB A;  4OOY A;  5HWT A;  1N9N A;  3IX8 A;  2Y4A A;  3G2Z A;  4ARZ B;  3PBQ A;  5L10 A;  3VP0 A;  3MXS A;  4OQ0 A;  4HES A;  5DKK A;  4Y13 A;  2PU4 A;  4IED A;  1MZU A;  1VB6 A;  2P9V A;  5M1A A;  2ZC5 B;  4EBL A;  3PXP A;  3BQA A;  5GHZ A;  5A90 A;  3W4P A;  5AQA A;  1V9Y A;  4MEZ A;  2W27 A;  1K54 C;  1TS7 A;  1XKZ A;  2A24 B;  3Q7V A;  4JGR A;  5FL3 A;  4EW7 A;  4D2O A;  3JVU A;  1W5D A;  3B33 A;  1FR6 A;  2PAV P;  3KO6 A;  4Y15 A;  4KUO A;  4CLC B;  5G18 A;  1SCW A;  1IFQ A;  2XR0 A;  3UY6 A;  3F1P A;  3WS0 A;  1GCE A;  3VOL A;  1TF1 A;  2Y2I A;  1PZO A;  5CHM A;  2R9W A;  2RL3 A;  4S2K A;  4MBK A;  5AQ9 A;  4L9E A;  3UDI A;  5HAP A;  2HJ9 C;  2P04 A;  1BYW A;  2X02 A;  4MN6 A;  2PDR A;  2ZM0 A;  4DXC A;  3HLG A;  2PT7 A;  5IHV A;  2KX6 A;  4KZ5 A;  5TJJ A;  2XGN A;  4MN5 A;  3SZT A;  3T4J A;  3JVV A;  1FSY A;  2J3T D;  1EW0 A;  3W4Q A;  2KOI A;  3E4Q A;  3HLC A;  4YIN A;  1KVM A;  3M6H A;  4GCZ A;  4QU3 A;  2Y59 A;  3EEA A;  1IYP A;  1N9B A;  2NUP C;  4C3Q A;  2OLU A;  5GLB A;  1FIK A;  3LY4 A;  5F82 A;  3FPV A;  1Y4O A;  3IXH A;  3BLS A;  4DE1 A;  2Z2L B;  4PAU A;  3LY3 A;  5EUA A;  3ZNY A;  2DNS A;  3CPT A;  3IHB A;  3OCN A;  2PYP A;  1GHM A;  2HZ5 A;  1DJA A;  4OQH A;  5E2F A;  3IX4 A;  3WRZ A;  4WEL A;  3ZG9 B;  5FQK A;  2DRW A;  3V50 A;  1XXM A;  2P9V B;  3FKW A;  1IYS A;  2W1T B;  5FAP A;  4JGO A;  1T1B A;  1YLW A;  4E3L A;  1W8Q A;  4DXB A;  2H0T A;  5FQJ A;  1H3Q A;  2XF3 A;  1ALQ A;  4I3I A;  4B4Z A;  2QHK A;  2XD5 A;  3WS1 A;  1PZP A;  3Q7V B;  5DF7 A;  5FEG A;  3ZG8 B;  3SW1 A;  1ZHH B;  3BW6 A;  3HUM A;  3WRT A;  4JPM A;  1SDN A;  4HJ3 A;  3V3R A;  4JXV A;  4OPZ A;  2JKT I;  3GDI A;  4HP9 A;  3AGD A;  3CI6 A;  2Y2K A;  2C5W B;  4I3J A;  1VEU A;  2OWH A;  4JXW A;  3TOI A;  4CQH A;  3F1P B;  2W3G A;  3EEH A;  3UE6 A;  3ULF A;  2B02 A;  2V2F F;  3ZCZ A;  3WS4 A;  2G2U A;  4BQM A;  3G6O A;  4A5R A;  4MBF A;  3LI9 A;  4X56 A;  3B47 A;  2Y2H A;  1TEM A;  3H82 A;  2E8I A;  1M40 A;  1EI5 A;  3OBF A;  4WL9 A;  5D3O A;  1W7F A;  3EQU A;  5CX7 A;  1TS6 A;  1W79 A;  1K57 C;  4JF5 A;  4MDZ A;  4M3K A;  2ZM2 A;  1NWZ A;  4DJ3 A;  1PWG A;  5KMW A;  3VP2 A;  2V0W A;  3PBS A;  1F5M A;  3MJQ A;  4XT2 B;  2M7V A;  1LL8 A;  1H8Y A;  4NEE D;  4S2N C;  1LSX A;  5HAR A;  3PBR A;  4R3A A;  3D72 A;  3DW0 A;  2X01 A;  5I94 A;  4E3N A;  2Y55 A;  1K4E A;  2WZX A;  2WKI A;  2ACG A;  4E6W A;  4DN0 A;  4HQA A;  2RCX A;  2VA0 A;  5HPI A;  3PBT A;  2WK0 A;  3MQO A;  4WMC D;  4I39 A;  1FR1 A;  1LHY A;  2WGW A;  4QHC A;  1CK3 A;  1UWN X;  3OZH A;  4JGQ A;  4RX3 A;  1MBL A;  3IXB A;  1VHM A;  3UB8 A;  2EWW A;  5CGS A;  2VGL M;  3FYZ A;  4IBR A;  1G68 A;  5CGW A;  1TVF A;  5E2E A;  1P0Z A;  5CED A;  5HDS A;  3R7W A;  3SH8 A;  3N8S A;  2JKR M;  4OP5 A;  1LSW A;  4ID4 A;  2LB9 A;  3CAX A;  5AJG A;  3GQZ A;  2Y2O A;  2Y2M A;  3UO9 A;  4KZ9 A;  1PRQ A;  4S2J A;  4HHD A;  4X25 A;  1S0W A;  2A49 A;  3IF5 A;  2Q9M A;  3LYX A;  1TDG A;  4WZ5 A;  1K25 A;  3MS6 A;  4L9F A;  3F1N A;  3VOZ A;  4U3T A;  4EUZ A;  3H82 B;  4GS9 A;  4DKI A;  3S4X A;  3ZNT A;  3BFE A;  5FQM A;  2J80 A;  5CGX A;  1BUE A;  2ZQ7 A;  3N8R A;  1Z09 A;  4GDN A;  5FDS A;  1NXY A;  2VV8 A;  3MMH A;  1BT5 A;  4C75 A;  3LO7 A;  5DF9 A;  3DBA A;  3GR2 A;  3BLM A;  1XA7 A;  1SKO A;  2PHY A;  3LR0 A;  1T1A A;  4PPR A;  5DFX A;  4X53 A;  1IKG A;  3MXQ A;  4P0M A;  3GVB A;  1QME A;  4WMC A;  4KZ3 A;  3OPR A;  5J3W A;  3ZG7 B;  4Q8I A;  1YQS A;  4KZB A;  1PNE A;  2WUQ A;  2ZC4 B;  3T50 A;  1STZ A;  5EE8 A;  5MC7 A;  4R38 A;  1MWT A;  4KEN B;  1E3U D;  4KQD A;  1MPL A;  3MKF A;  1L3L A;  1GA9 A;  1ZTU A;  4S2M A;  3NY4 A;  2ZMV A;  3D3O A;  3P09 A;  2P7J A;  2P74 A;  2XA7 M;  2VGL S;  3SOI A;  3U2A A;  4X1L A;  5A93 A;  1JTG A;  4S2P A;  1L0D A;  3G35 A;  5GLC A;  4HY8 A;  3F1O A;  3PYP A;  2PR5 A;  2EXA A;  1L0G A;  2JHE A;  3MXR A;  1HZO A;  1F9I A;  4IHQ A;  4JF4 A;  2WAF A;  3OPL A;  3MKE A;  5HD5 A;  3SS5 A;  2IWB A;  5LBR A;  3QP8 A;  2WAE A;  1JWV A;  4II7 A;  5IU1 A;  1ESI A;  3Q82 A;  4JKT A;  3GTC A;  1J3W A;  1FCN A;  2ZOI A;  5TR7 A;  3K3D A;  3HBR A;  1O7E A;  1K54 A;  2Y2G A;  3R7W B;  4HIA A;  4GD8 A;  4LV1 A;  2VGK A;  3BYD A;  4AFI A;  4U0X A;  3IX3 A;  1N9O A;  3CJM A;  5FEF A;  3LIE A;  2ZMF A;  3G31 A;  3C8C A;  2J8Y A;  1K38 A;  3HJI A;  5AVF A;  3I7J A;  4IUK A;  3VSL A;  3WWX A;  1SKF A;  3C2W A;  2WKP A;  4KZ4 A;  5F1F A;  2QZ6 A;  3BM6 A;  4Y0O A;  3E4P A;  3F1N B;  1XFQ A;  5CXW A;  5EVI C;  4LLO B;  5GLD A;  4GS9 B;  4KQQ A;  4PKY A;  1NRF A;  4WN5 A;  3VP3 A;  2EWV A;  1E3U A;  1KDW A;  3GRJ A;  3RJU A;  3M2J A;  1YPR A;  2VJW A;  3DWZ A;  5K5B A;  5FQI A;  4XUZ A;  1SKO B;  2VKS A;  2XA7 S;  4N9K A;  2IA2 A;  3R4K A;  3WS5 A;  5L07 A;  4EEP A;  2Y8H A;  1XGJ A;  3KYZ A;  2JE5 A;  4P85 A;  4GN2 A;  2K31 A;  4JXS A;  3C7U A;  3CLO A;  2QMI A;  1Q2Q A;  3A3J A;  2WZZ A;  5A8B A;  2JBF A;  4BEN A;  1JWP A;  2HP6 A;  3W4O A;  5GHX A;  3BY9 A;  3BFG A;  2GZA A;  1LI9 A;  4YWZ A;  4PHT A;  1ERQ A;  3RTY A;  3MBZ A;  1D06 A;  3G34 A;  4KZ6 A;  2A3U A;  2ZL1 A;  4RA7 A;  3S7O A;  4K91 A;  3IF6 C;  1I2W A;  1YLY A;  3L7H A;  1UWP X;  1PI5 A;  1X0O A;  4OPQ A;  1FQG A;  4WZ4 A;  1DJB A;  1K4F A;  3HRE A;  1SDE A;  1MY8 A;  4OOL A;  2KLI A;  3LR3 A;  1KGF A;  4BWI A;  1ERO A;  3D4F A;  5CHU A;  3UPP A;  1XX2 A;  3FZC A;  4PM5 A;  3V67 A;  2MJ6 A;  3IWI A;  3TG9 A;  2JCH A;  5L09 A;  4IVI A;  1K6S A;  3ZGA B;  4X69 A;  2O9C A;  3ZG0 A;  5J8X A;  2VK3 A;  2ZJ9 A;  3LIF A;  5CTN A;  3OPH A;  3Q1F A;  4R70 A;  4IVK A;  3A0S A;  4BLM A;  3T4Q A;  4ZJ2 A;  4BMW A;  4RX2 A;  5EM1 A;  1NJ4 A;  2Y2J A;  1NYY A;  1OJG A;  1P97 A;  2XQZ A;  4Q0J A;  2HDS A;  3C4P A;  1LL9 A;  4Q0H A;  5FDH A;  3ZYT A;  3VV4 A;  3G2Y A;  4ZAM A;  1ZKJ A;  4DRT A;  2GX5 A;  3VFH A;  2JKF A;  5EVE A;  1XJ2 A;  4PM7 A;  2HP9 A;  3UDF A;  2DMW A;  4NXB A;  1G6O A;  1PIO A;  3E0Y A;  2ZMA A;  3IHA A;  1D7E A;  1KDS A;  4HI4 A;  1K57 A;  1YAX A;  4F3L A;  4E6X A;  4MN7 A;  2L1M A;  1HLU P;  3U4L P;  1BSG A;  1IOU A;  3SH9 A;  2PBD P;  2OAP 1;  1YM1 A;  3DAV A;  5L8M A;  4S2N A;  4FH4 A;  4ETZ A;  2ZL1 B;  1TS8 A;  5U47 A;  2GJ3 A;  1JTD A;  3S7N A;  3N8L A;  4E3K A;  3NDE A;  3VE3 A;  2AVX A;  1ES5 A;  3IS2 A;  4MCW A;  3T1X A;  1K55 C;  4ZTK A;  4FUW A;  2Y79 A;  4D60 A;  5FI6 A;  3HLB A;  4N1X A;  1GSX A;  3UE3 A;  2Y2N A;  5I5L A;  1NZO A;  2H10 A;  4WEK A;  3IWQ A;  4X6T A;  2YKH A;  1KGE A;  3GMW A;  4HEF A;  4KUK A;  2BLS A;  4OVD A;  2OWJ A;  1S1Y A;  5HPF A;  4L9G A;  4UEY A;  5F6A A;  4LRZ E;  4UAA A;  4UA6 A;  4R6L A;  4EXO A;  3DTM A;  3OPP A;  5KSH A;  5HL1 A;  3IXD A;  5A91 A;  4ESP A;  4DMZ A;  1ES3 A;  1PWD A;  2XK1 A;  1YLP A;  4PMA A;  1H0M A;  3NCK A;  3QP1 A;  2ZLY A;  5FAQ A;  1P9W A;  4G3W A;  3MSH A;  1GSV A;  2HDU A;  2PBY A;  3SS4 A;  4KG5 A;  4M4X A;  4YFM A;  1RGY A;  2M7U A;  4QJG A;  3ISG A;  1QMF A;  3UME A;  3CPT B;  3SS3 A;  1PWC A;  3MZE A;  1L0F A;  2E8J A;  2EX2 A;  3LIA A;  4MMN A;  4NXF A;  4CJN A;  4EWF A;  2K7S A;  1U60 A;  4WM9 A;  3TSG A;  4NKP A;  5G4Y A;  3BQ8 A;  3DTI A;  2V0U A;  5M19 A;  1FCO A;  4WUJ A;  5F83 A;  4KQR A;  1N9L A;  4H6J A;  4F3L B;  4RQ9 A;  3UPN A;  2ZBB A;  3M6B A;  4BD0 A;  1MWU A;  5DTK A;  2JKR I;  4R0Q A;  2V8C A;  3BFC A;  1LSV A;  5EVI D;  1GSW A;  3Q07 A;  4EBP A;  2ZD8 A;  3E4O A;  5DTS A;  2PRF A;  4DE2 A;  5C5K A;  3QNB A;  1T19 A;  1WYB A;  1HVB A;  3IS2 B;  3O86 A;  5CEB A;  2B18 A;  2L0W A;  3FWL A;  5E2H A;  1VEU B;  2Y2L A;  3NBL A;  1UGU A;  2EX9 A;  3NOP C;  4P87 A;  3TW8 A;  3G32 A;  4E3M A;  4Z9Q A;  4GHI A;  3ZDJ A;  4HH3 A;  4B93 A;  3LI8 A;  4BBU A;  3HCY A;  4Q0I A;  4YOF A;  5HDC A;  4CPK A;  1OME A;  1MWR A;  1OT9 A;  3O87 A;  3MFD A;  2J7V A;  4LPZ A;  4BD1 A;  3K3C A;  4UQI M;  4JBF A;  4U0T A;  4EES A;  4FD8 A;  2VLG A;  1ZG6 A;  4CLC D;  1OPX A;  3DTE A;  2H28 A;  2XRO A;  2Z6C A;  5EVL A;  2HDQ A;  3ZQ5 A;  4QB8 A;  4B9O A;  1BLH A;  2FH5 A;  4Y0T A;  4O7D A;  4O0P A;  4QPR A;  1ONG A;  4H8R A;  4QD4 A;  3CIT A;  4WYY A;  5GL9 A;  3QP5 A;  3VOY A;  4N9L A;  2CMN A;  4I38 A;  5IS1 A;  3T4K A;  4MBH A;  1KE3 A;  2BTF P;  5JYO A;  5CEC A;  4X55 A;  2XD1 A;  1XGI A;  3IBR A;  4LFU A;  3BFD A;  1OJ5 A;  2EFU A;  2IWC A;  4ZRR A;  3ZG5 A;  5EVI A;  2W3E A;  2ZC6 B;  3T1Q B;  2HP5 A;  1BZA A;  2V8F A;  3C30 A;  2Z2M B;  1L0E A;  2D01 A;  4FOF A;  5FQ9 A;  1O07 A;  4H6J B;  5HL6 A;  2ZM8 A;  3KSH A;  4KQO A;  3MFX A;  2WGW B;  5HAQ A;  1H5X A;  4EBN A;  2D02 A;  4OPR A;  5DF8 A;  2JN7 A;  4OP8 A;  4HH2 A;  2W3F A;  2A24 A;  3IWO A;  4BJP A;  3L9K A;  4XUX A;  3UB7 A;  4OQG A;  4ZDX A;  3OC2 A;  3V39 A;  3K2N A;  3NI9 A;  3N7W A;  2ZQD A;  5HSQ A;  4OQI A;  4O01 A;  3NHQ A;  4HJ4 A;  3RXX A;  2VV7 A;  1ES2 A;  3NIA A;  2Y91 A;  4PM6 A;  4UQI S;  1CI8 A;  2QKP A;  2CC1 A;  2FFY A;  5A92 A;  1MKI A;  4HBU A;  3LEQ A;  3T1S A;  3CUE C;  4P6B A;  5E2G A;  4HJ6 A;  2J9P A;  2OOL A;  2O99 A;  4GHI B;  4WEJ A;  4Y0U A;  4DF6 A;  3C4O A;  3OOV A;  3IF6 A;  1I2S A;  2X71 A;  3A3D A;  3BJN A;  3Q7Z A;  3A0V A;  5DJU A;  4OOM A;  1T1C A;  2VGJ A;  3IT9 A;  1YLT A;  1CJF A;  2B5R A;  1L2S A;  1ZC2 A;  2HDR A;  1FCM A;  3V3S A;  2HPB A;  1DP6 A;  1NY0 A;  4LRY C;  1EWZ A;  4EQI A;  1SHV A;  3KYE A;  2V20 A;  4R3J A;  3A3I A;  1XP4 A;  1YKD A;  1MC0 A;  3H7W A;  5AQ7 A;  4Z1W A;  5EOE A;  1OTE A;  4NXG A;  2PU2 A;  1KE4 A;  4B88 A;  4CLC E;  5HZH A;  3LIC A;  2JC7 A;  4KZ7 A;  3VSK A;  3AGE A;  4OKP A;  1ODV A;  2H5S A;  1YSP A;  3FV7 A;  3OLO A;  3VP1 A;  3PBN A;  4S2O A;  3EGD C;  2B95 A;  2H0Y A;  1I5Q A;  3B3X A;  1OTA A;  1ES4 A;  2PYR A;  3MZD A;  4EEU A;  1DJC A;  4PM8 A;  5CRF A;  4GKU A;  4NET A;  4EQ1 A;  4I5S A;  4JLF A;  1W8Y A;  4O8G A;  5EVI B;  5HDD A;  3ZVT A;  3CG5 A;  5FQQ A;  1MWS A;  4CLC C;  3IXG A;  1K6R A;  1KVL A;  3NUL A;  3C7V A;  5EEC A;  2W1T A;  4BBT A;  4IUH A;  1IYO A;  3T4T A;  2WAD A;  3HLW A;  3F1O B;  4N1H A;  3EWK A;  2FFF B;  3N4I A;  3WS2 A;  3FG8 A;  3CWF A;  5CHJ A;  2V9A A;  2ZQA A;  3T4S A;  5KZH A;  4G3K A;  3D9Y A;  1E25 A;  1WYC A;  4JGP A;  4MNR A;  5KSC A;  3DTK A;  1YLZ A;  3E98 A;  2L4R A;  1WE4 A;  5EM0 A;  3E2L A;  4K08 A;  3VMA A;  2XEP A;  4QY6 A;  3ZFZ A;  3EQV A;  1CEG A;  3MQ0 A;  1ACF A;  1JVJ A;  3P98 A;  4R23 A;  2WGV A;  1S6R A;  5AVE A;  1DP9 A;  3JPU A;  3DWK A;  2W0N A;  2Z6D A;  2O9A A;  1VQQ A;  5M18 A;  4DDY A;  3ICY A;  2QYB A;  4R3B A;  1S66 L;  5FA7 A;  1LLB A;  2VV6 A;  3ITB A;  3IF6 B;  1NYM A;  1T18 A;  4GD6 A;  3GEC A;  1SZV A;  1C3B A;  1MKM A;  3UE1 A;  4Y3I A;  3KYQ A;  4FSF A;  1K55 A;  2YKF A;  2HJE A;  4FTX A;  3O3V A;  3LUQ A;  2ZC7 A;  4LEN A;  2HV1 A;  2QWS A;  4Y5F A;  3NEC A;  2FZ0 A;  1YMS A;  2INW A;  3H7W B;  3UNW A;  1AXB A;  3RXW A;  3T4O A;  2XFT A;  4RYE A;  5FAO A;  2WYX A;  4X68 A;  4JXG A;  3BY8 A;  4RVA A;  5EPH A;  2ZOH A;  5IT5 A;  2I9V A;  1IEL A;  4BBV A;  4XT2 A;  5CER A;  3UPO A;  3HUN A;  1JNU A;  3HLD A;  3G30 A;  1V9Z A;  1AWI A;  1Y54 A;  5HW3 A;  4UHU A;  5E43 A;  5JYP A;  3ZHH A;  1YMX A;  4IBX A;  3A3F A;  5CTM A;  2PD8 A;  5TBM A;  5J4E A;  2G2W A;  4PKY G;  2WKR A;  1M6K A;  4LCM A;  1TS0 A;  1HTZ A;  3NOT C;  5HD3 A;  1G28 A;  4WBG A;  4ZBE A;  4EET B;  3JYI A;  3TRC A;  4BL2 A;  1BLS A;  4NXE A;  5EOO A;  3UB9 A;  5J7E A;  2I72 A;  2GDN A;  3O5Y A;  1XJ3 A;  3TJZ C;  4OPY A;  1D1J A;  2V1A A;  3AGF A;  5HWW A;  3BRM A;  4EER A;  5TFQ A;  3KSF A;  4MLL A;  2OSU A;  3E2K A;  4Y2F A;  4NG2 A;  5DTT A;  2A2L A;  4GB7 A;  3GSG A;  2ZC3 B;  1S67 L;  3LGO A;  3V5M A;  4LV3 A;  1OT6 A;  1PW8 A;  2C6W B;  1Q2P A;  1PW1 A;  1RCJ A;  4WLA A;  3ZVW A;  3HUO A;  4B4X A;  2R78 A;  2XFS A;  4KG2 A;  5DVA A;  2ZQ8 A;  1P9R A;  2O0Y A;  3NDG A;  4I3A A;  4K0W A;  4GNU A;  3TE8 A;  3EGX C;  3NOU C;  1W63 M;  2OAQ 1;  3N6I A;  3Q81 A;  5EFW A;  1XA1 A;  5FAT A;  1GHI A;  1LT0 A;  2JKT M;  1GA0 A;  3PBO A;  4ETX A;  4DJ2 A;  5HFO A;  1FIL A;  2WKE A;  1PI4 A;  4OON A;  3S22 A;  3BFF A;  3IBJ A;  2W3D A;  4S2I A;  3W2Z A;  2W1R A;  3HJK A;  3LEZ A;  3H9W A;  3MR0 A;  4NK3 A;  4GJ4 A;  1F2K A;  3PTE A;  5HAI A;  4ZJ1 A;  3CMZ A;  4R4S A;  4X1M A;  2XRN A;  3B42 A;  4EV4 A;  3PAE A;  2QJ5 A;  2EXB A;  4R1G A;  1VET A;  3UB6 A;  1G5U A;  2VZW A;  4QY5 A;  1K0K A;  5DJT A;  1IKI A;  3IH9 A;  1KGG A;  2UV0 E;  3C5A A;  4LV2 A;  5FI2 A;  3O88 A;  3KSG A;  2DCF A;  4GLQ A;  5TBM B;  3GV9 A;  1H8M A;  4OH0 A;  3KSI A;  2Q9N A;  4KG6 A;  1A0K A;  3UB5 P;  1LI0 A;  3VFF A;  4GW9 A;  2V1B A;  2ZQC A;  1TD5 A;  3A3E A;  4N92 A;  3BWL A;  5F69 A;  3OCL A;  3BEC A;  2J3T C;  1PYY A;  1KE0 A;  4EUV A;  2EA9 A;  3LR4 A;  1K56 D;  3CHW P;  4GOG A;  2GNX A;  2K2N A;  4ME4 A;  2V1Z A;  5DKL A;  1RGZ A;  2VX8 A;  4Y7P A;  3LID A;  1S1Z A;  4IJG A;  4L0L A;  2XSS A;  1Z6F A;  5L2F A;  2XDM A;  4R4R A;  4GZB A;  1ESU A;  3NJA A;  3FPW A;  4P6Z M;  2UWX A;  1HD8 A;  2EX6 A;  2VEA A;  2WGI A;  3RFB A;  3LCE A; 
#chains in the Genus database with same CATH homology
 3EEH A;  3V67 A;  3UE6 A;  4HJ6 A;  3ULF A;  2B02 A;  2MJ6 A;  2OOL A;  2O99 A;  3A0R A;  1XFN A;  4GHI B;  4WEJ A;  3G6O A;  3OOV A;  3LI9 A;  1XJ6 A;  3BJN A;  3B47 A;  3A0V A;  5DJU A;  4OOM A;  2O9C A;  1T1C A;  3PHY A;  3LIF A;  3H82 A;  3FC7 A;  4YNR A;  3OBF A;  4R70 A;  1DP6 A;  4LRY C;  4WL9 A;  3A0S A;  3T4Q A;  1Y28 A;  3EQU A;  3KX0 X;  5HWV A;  3PR6 A;  1TS6 A;  5CX7 A;  3S7P A;  4BMW A;  1YKD A;  4MDZ A;  1MC0 A;  3H7W A;  4Z1W A;  2NUT C;  1OTE A;  4NXG A;  1OJG A;  1P97 A;  3CUE A;  4CLC E;  5HZH A;  1NWZ A;  4DJ3 A;  3LIC A;  4Q0J A;  1ODV A;  1YSP A;  3OLO A;  4Q0H A;  2V0W A;  3PBS A;  3ZYT A;  3PBN A;  1F5M A;  3EGD C;  3MJQ A;  4XT2 B;  3VV4 A;  2M7V A;  1LL8 A;  4NEE D;  1LSX A;  2GX5 A;  4HNB A;  1YSQ A;  4WF0 A;  1OTA A;  1XJ2 A;  3PBR A;  4ARZ A;  4R3A A;  2PYR A;  3D72 A;  2O9B A;  4EEU A;  2J3W A;  2DMW A;  4EQ1 A;  4I5S A;  3RH8 B;  4NXB A;  1G6O A;  3E0Y A;  4O8G A;  5HDD A;  1D7E A;  4HI4 A;  3P01 A;  4CLC C;  4DN0 A;  4LRX C;  4HQA A;  5DFY A;  1YAX A;  4F3L A;  1DP8 A;  2VA0 A;  5HPI A;  4MN7 A;  2W1T A;  3PBT A;  4HP4 A;  3MQO A;  2L1M A;  4BBT A;  4I39 A;  4IUH A;  3T4T A;  4E04 A;  1IOU A;  3F1O B;  1S4R A;  3EWK A;  1DRM A;  2OAP 1;  1F98 A;  5L8M A;  1XJ4 A;  1UWN X;  2QJ7 A;  2G7U A;  4P6Z S;  4JGQ A;  4ETZ A;  3FG8 A;  3CWF A;  1TS8 A;  3LR5 A;  1OTB A;  2V9A A;  2GJ3 A;  3T4S A;  3S7N A;  4G3K A;  1VHM A;  1NLZ A;  5F68 A;  3UB8 A;  3VE3 A;  2EWW A;  1WA9 A;  4JGP A;  3IS2 A;  2VGL M;  4MCW A;  2PR6 A;  3S7Q A;  3E98 A;  4CLC A;  2KDK A;  2L4R A;  1P0Z A;  2Y79 A;  4K08 A;  5HDS A;  3R7W A;  3EOI A;  4G3V A;  3P7N A;  2JKR M;  3LIB A;  3EQV A;  1LSW A;  3MQ0 A;  5AVE A;  2LB9 A;  1DP9 A;  3UMD A;  3CAX A;  2M1C A;  2W0N A;  3T4L A;  2Z6D A;  2O9A A;  5AJG A;  1GSX A;  3ICY A;  2QYB A;  3UE3 A;  5KIZ A;  1S66 L;  5I5L A;  2VV6 A;  3C38 A;  4WEK A;  4HHD A;  3MF0 A;  5G4Z A;  2BAS A;  4EU0 A;  1T18 A;  1OTI A;  3VE4 A;  2PD7 A;  3LYX A;  3GEC A;  3LFV A;  1MKM A;  4L9F A;  3F1N A;  4Y3I A;  1OTD A;  1NLY A;  3KYQ A;  2YKH A;  4FSF A;  2W3H A;  4HOI A;  2YKF A;  3H82 B;  2HJE A;  2HGV A;  4GS9 A;  4KUK A;  3LUQ A;  2OWJ A;  1S1Y A;  5HPF A;  3MQQ A;  4L9G A;  2LB5 A;  2J80 A;  4UEY A;  5F6A A;  4LRZ E;  5F5Y A;  2HV1 A;  2QWS A;  4Y5F A;  4R6L A;  4EXO A;  2P08 A;  2FZ0 A;  2VV8 A;  3MMH A;  2INW A;  3H7W B;  3T4O A;  5KSH A;  1S4S A;  2WKQ A;  4DMZ A;  5DF9 A;  3DBA A;  2PHY A;  3BY8 A;  1T1A A;  3LR0 A;  5DFX A;  2ZOH A;  1W63 Q;  5IT5 A;  2I9V A;  3MXQ A;  4BBV A;  1NRJ A;  4XT2 A;  1P9W A;  2HF6 A;  1KOU A;  4G3W A;  5HWT A;  1JNU A;  5J3W A;  1N9N A;  1GSV A;  1V9Z A;  2M7U A;  4M4X A;  1STZ A;  3T50 A;  3UME A;  4ARZ B;  5MC7 A;  3PBQ A;  3LIA A;  4MMN A;  4NXF A;  4R38 A;  2K7S A;  2PD8 A;  5TBM A;  5J4E A;  4NKP A;  5G4Y A;  3BQ8 A;  2WKR A;  4PKY G;  5DKK A;  2V0U A;  1MZU A;  1VB6 A;  4KQD A;  1TS0 A;  3NOT C;  4WUJ A;  5HD3 A;  1N9L A;  1G28 A;  3PXP A;  3BQA A;  4H6J A;  1ZTU A;  2ZMV A;  3D3O A;  2P7J A;  4F3L B;  1V9Y A;  2XA7 M;  2VGL S;  3U2A A;  4EET B;  2W27 A;  4RQ9 A;  3TRC A;  4NXE A;  1TS7 A;  3UB9 A;  2ZBB A;  5J7E A;  3O5Y A;  1XJ3 A;  3TJZ C;  4HY8 A;  3F1O A;  3PYP A;  2PR5 A;  2A24 B;  2V1A A;  2JHE A;  2JKR I;  4JGR A;  1F9I A;  1LSV A;  5FL3 A;  4EW7 A;  4IHQ A;  5HWW A;  1GSW A;  3JVU A;  3B33 A;  4EER A;  3KSF A;  3E4O A;  5HD5 A;  4Y2F A;  2A2L A;  5C5K A;  1S67 L;  1T19 A;  5LBR A;  1OT6 A;  3KO6 A;  5IU1 A;  4II7 A;  3IS2 B;  4KUO A;  2B18 A;  2ZOI A;  3K3D A;  2L0W A;  4CLC B;  4WLA A;  2W3G A;  1IFQ A;  3R7W B;  4HIA A;  2R78 A;  3F1P A;  3VOL A;  1UGU A;  1TF1 A;  4AFI A;  3NOP C;  3TW8 A;  1N9O A;  4L9E A;  1P9R A;  2O0Y A;  3LIE A;  4GHI A;  4I3A A;  2ZMF A;  4HH3 A;  4B93 A;  3LI8 A;  3C8C A;  3TE8 A;  3EGX C;  4BBU A;  3HCY A;  3NOU C;  4Q0I A;  1W63 M;  4YOF A;  5HDC A;  2OAQ 1;  3HJI A;  1OT9 A;  2HJ9 C;  5EFW A;  2P04 A;  5AVF A;  4IUK A;  1BYW A;  4LPZ A;  3K3C A;  1LT0 A;  2JKT M;  4MN6 A;  4UQI M;  4EES A;  2PDR A;  3C2W A;  2WKP A;  3PBO A;  4ETX A;  4DJ2 A;  2VLG A;  4CLC D;  1OPX A;  2PT7 A;  3F1N B;  2H28 A;  2Z6C A;  1XFQ A;  3E4P A;  2XRO A;  3ZQ5 A;  4LLO B;  3IBJ A;  2KX6 A;  2W3D A;  5TJJ A;  4B9O A;  4GS9 B;  4MN5 A;  2FH5 A;  3W2Z A;  2W1R A;  3T4J A;  3HJK A;  4PKY A;  3JVV A;  4WN5 A;  4O0P A;  3H9W A;  2J3T D;  4QPR A;  2EWV A;  1EW0 A;  2KOI A;  3MR0 A;  3E4Q A;  3CIT A;  4GJ4 A;  4GCZ A;  2CMN A;  3EEA A;  4I38 A;  2NUP C;  2XRN A;  2VJW A;  3B42 A;  5IS1 A;  5K5B A;  3T4K A;  3FPV A;  2QJ5 A;  2VKS A;  3UB6 A;  2XA7 S;  2VZW A;  4PAU A;  2IA2 A;  3R4K A;  5DJT A;  3IBR A;  4EEP A;  2Y8H A;  3KYZ A;  1OJ5 A;  4ZRR A;  2K31 A;  3OCN A;  2W3E A;  2PYP A;  3KSG A;  4GLQ A;  5TBM B;  3CLO A;  1H8M A;  4WEL A;  3C30 A;  3KSI A;  2D01 A;  4FOF A;  5A8B A;  2W1T B;  4H6J B;  4GW9 A;  4JGO A;  5HL6 A;  1T1B A;  3BY9 A;  2V1B A;  2GZA A;  1TD5 A;  3KSH A;  4KQO A;  4YWZ A;  4PHT A;  3MFX A;  3RTY A;  1D06 A;  2D02 A;  3BWL A;  5F69 A;  1H3Q A;  3OCL A;  2JN7 A;  4HH2 A;  2J3T C;  2W3F A;  4I3I A;  2A24 A;  3S7O A;  4BJP A;  4EUV A;  2QHK A;  2EA9 A;  3LR4 A;  3UB7 A;  1UWP X;  1X0O A;  3OC2 A;  3SW1 A;  1ZHH B;  3K2N A;  3BW6 A;  2GNX A;  2K2N A;  5HSQ A;  4ME4 A;  4HJ3 A;  4O01 A;  5DKL A;  3NHQ A;  4HJ4 A;  2VV7 A;  2VX8 A;  4OOL A;  3LID A;  1S1Z A;  2KLI A;  4IJG A;  2JKT I;  3GDI A;  3LR3 A;  4L0L A;  2XSS A;  4UQI S;  2QKP A;  4HP9 A;  3NJA A;  4BWI A;  3FPW A;  3CI6 A;  4P6Z M;  4I3J A;  2OWH A;  2VEA A;  3RFB A;  4CQH A;  3CUE C;  3F1P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...