2QJ5A

Pyp ultra-high resolution of a bacterial photoreceptor
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
121
Chain Sequence
b'HVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Picometer-scale conformational heterogeneity separates functional from nonfunctional States of a photoreceptor protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 34
structure length 121
sequence length 123
ec nomenclature
pdb deposition date 2007-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2qj5A00
2A24B 2Z6CA 2QJ7A 2V0WA 1GSWA 4EQ1A 2J80A 3PHYA 1OJGA 2M1CA 4R3AA 3NJAA 2PR6A 4JGOA 2P7JA 3C8CA 4I5SA 3IBRA 1DP8A 2BASA 1JNUA 3BY8A 1TS0A 3SW1A 1LSVA 2GJ3A 2QHKA 4MN5A 3PYPA 5HD3A 3VOLA 4H6JA 3LIDA 3LICA 3NOTC 4LRYC 4DJ3A 2WKRA 2Z6DA 4I3JA 2JN7A 3LYXA 3OLOA 3UMEA 5J7EA 1N9OA 5DJUA 5DKLA 2V1AA 1XFQA 2R78A 4HH3A 3F1PB 1GSVA 4JGQA 2VV8A 1TS6A 1T1BA 3G6OA 1OTBA 1UWNX 1V9ZA 1LL8A 1S4SA 3H7WB 2OWJA 5F5YA 3A0RA 4L9GA 2VV6A 4HJ3A 3BWLA 3MXQA 3C2WA 2ZOHA 1OTIA 3LI9A 1KOUA 3NOUC 1D06A 3MFXA 2KX6A 3IS2B 2YKHA 3H9WA 4NXBA 1N9LA 1XJ2A 4BBTA 3FC7A 5IS1A 2K7SA 3E4OA 1S66L 1V9YA 1T1CA 2V9AA 3F1OB 2PD7A 2VV7A 4KUKA 4LPZA 1P0ZA 3F1NB 2HV1A 2QWSA 2PD8A 3GECA 4GS9A 3VE4A 3KX0X 4GHIA 4KUOA 3UB9A 3K3DA 2A24A 2PDRA 3ZQ5A 3E4PA 5HSQA 4HOIA 4HP9A 4HQAA 3NOPC 4R38A 2I9VA 1GSXA 4I3AA 4I3IA 1LT0A 3GDIA 5F6AA 4HI4A 3FG8A 2PYRA 5AVFA 4LRXC 1F9IA 3H82B 3CLOA 1OJ5A 4WL9A 3UB8A 5F68A 3LI8A 2H28A 3NHQA 1S67L 4HY8A 5AVEA 3E4QA 5G4ZA 3K3CA 1WA9A 2OOLA 2EA9A 3A0VA 5J3WA 5HDCA 4HH2A 4L9FA 5I5LA 3MJQA 3F1PA 2WKQA 2W27A 1P97A 1OTEA 1XJ3A 4WN5A 4HJ6A 4F3LB 1XJ4A 2ZBBA 3H7WA 3D72A 1N9NA 1S1ZA 1Y28A 3T50A 3A0SA 2W0NA 3ICYA 4EXOA 2PYPA 5TBMB 2D01A 2PHYA 3IS2A 1F98A 1D7EA 4WLAA 4EESA 1MZUA 1EW0A 4M4XA 4B9OA 4JGRA 4XT2B 5DJTA 1X0OA 2QJ5A 4I39A 3UB6A 3F1OA 1VB6A 3LUQA 4PKYG 1TS7A 1BYWA 1DRMA 1T19A 4PKYA 3BY9A 3F1NA 1OT9A 2VEAA 1OT6A 1T18A 3CWFA 2PR5A 3VE3A 5HDSA 4YWZA 1T1AA 5J4EA 3LIEA 5HZHA 2VLGA 1UWPX 5EFWA 5DKKA 3LIAA 4HHDA 3LIBA 5KIZA 4HJ4A 4MN6A 4EETB 2L4RA 1S4RA 4EEUA 1NWZA 1XFNA 4JGPA 4NXEA 1LSXA 3MR0A 1ODVA 3MQQA 3UE6A 2L0WA 3H82A 4RQ9A 1UGUA 4WUJA 4H6JB 4BBVA 5F69A 3UMDA 3CAXA 1G28A 3EEHA 4DJ2A 4HP4A 2QKPA 3ULFA 4WF0A 3RH8B 3RTYA 2V1BA 4LLOB 4LRZE 5G4YA 5HWVA 2KDKA 5HD5A 5HDDA 1S1YA 5IU1A 4NXGA 4EEPA 4GW9A 1XJ6A 2V0UA 5HWWA 3P7NA 5A8BA 3HJIA 3LIFA 4F3LA 3MQOA 4EW7A 4GCZA 4EERA 2ZOIA 4KQDA 4L9EA 5TBMA 2WKPA 1OTAA 1DP6A 2L1MA 4R6LA 3B33A 2CMNA 4HNBA 1TS8A 4K08A 2JHEA 1LSWA 4BBUA 2B02A 4E04A 4XT2A 4R70A 3HJKA 5HWTA 1OTDA 2D02A 4HIAA 1DP9A 2YKFA 3UB7A 4I38A 2INWA 2OWHA 3EWKA 4GS9B 4NXFA 4GHIB
chains in the Genus database with same CATH superfamily
3VP4A 2V0WA 5EVEA 2G2UA 3HUMA 4PM7A 1OJGA 2M1CA 4ZJ1A 4O01A 3NJAA 2VJWA 2PR6A 4JGOA 4RYEA 1VETA 3IBRA 2WAFA 4MCWA 1JWVA 1SDEA 5L09A 4KG5A 3SW1A 1LSVA 3T1SA 3T1QB 4S2OA 1IYQA 3O86A 3PYPA 4ARZA 4BWIA 5HD3A 3VOLA 4H6JA 1FCOA 2DMWA 3E0YA 3LIDA 3LICA 3LFVA 3WRTA 3NOTC 3G2ZA 3LEZA 4LRYC 3GQZA 3S7NA 2WKRA 1VQQA 3PAGA 4I3JA 5GLAA 2JN7A 2Y59A 3OLOA 3IH9A 3TSGA 5DJUA 2EFUA 2ZQDA 1AXBA 4RVAA 1RGYA 4GN2A 1PIOA 4HH3A 3DTEA 4G3WA 2X71A 3Q7ZA 3VP1A 4JGQA 3D3OA 3BFEA 1TS6A 1TDGA 3IX8A 4WYYA 4A5RA 1OTBA 1V9ZA 1YLWA 1LL8A 2OWJA 1LI0A 5DVAA 3GRJA 3PTEA 3C2WA 2ZOHA 3OBFA 1PZOA 3C38A 5CXWA 1D06A 3GSGA 4HBTA 4WBGA 4P0MA 2C6WB 4GZBA 3G31A 1PYYA 1TEMA 3PBTA 5FDSA 1N9LA 3EQUA 1Q2PA 2K7SA 3E4OA 1V9YA 1T1CA 1BLPA 1G6AA 2M7UA 4EWFA 4U0XA 2W1TA 3PAEA 2B95A 2PD7A 1F5MA 3M2KA 5FI2A 1P0ZA 2W3DA 2EXBA 3F1NB 3LY3A 5EM1A 4Z1WA 5FI7A 2XFTA 4GJ4A 5E2HA 3UPOA 3VE4A 2J8YA 4KZ3A 4KUOA 3UB9A 5I94A 3OPLA 4LFUA 2VK3A 3T12B 3VFHA 4X55A 2HDQA 5CHUA 4FCFA 4HOIA 4JBFA 4P6ZS 5U47A 4EUZA 3MXSA 4OOLA 1JTGA 4I3AA 4ZAMA 4HI4A 2EXAA 2PYRA 4BD1A 1EROA 5L10A 4OPQA 1F9IA 3NDEA 2PU2A 5EM0A 3ZNYA 3RXXA 3KSGA 2ZJ9A 1NXYA 2JC7A 3DBAA 1HVBA 1MBLA 3HL9A 4MLLA 4UAAA 5AVEA 1FQGA 5A93A 3JPUA 3R7WB 4PMAA 1PI5A 2EA9A 5G18A 4IUHA 3A0VA 2GNXA 2V20A 3V5MA 4HH2A 5KSHA 3SS5A 1P9RA 3FV7A 1MC0A 1YLZA 1N9BA 2QZ6A 2P9VB 2W3FA 1XJ3A 1ES4A 3M6BA 1LHYA 2GDNA 4WZ5A 2C5WB 1H8MA 3FKWA 5MC7A 3D72A 1Y28A 4O0PA 3JVUA 3ZFZA 1L0GA 2W3HA 3IXHA 2XD5A 2XEPA 2PHYA 3W4PA 2J9OA 3DTIA 3SH8A 4IUKA 4MNRA 1MZUA 1GHPA 3BW6A 4X6TA 4M4XA 3BLMA 1Z09A 1PW1A 5FI6A 1Q2QA 3NC8A 3GV9A 4X25A 2WGWB 4I39A 2ZQ8A 4GKUA 2J3TD 2V8CA 2O9AA 4S2KA 1DRMA 1SZVA 3HREA 4ME4A 3F1NA 1OT9A 1OT6A 1KGEA 3V50A 2DNSA 3IBJA 4P87A 4GNUA 1EWZA 4BL2A 4D2OA 5HDSA 3KYZA 1T1AA 4NKPA 4LCLA 5HZHA 2Y2NA 4ESPA 1UWPX 1O07A 3BFDA 3KO6A 1QMFA 3HLDA 3C30A 4HJ4A 1FOFA 1S0WA 1YLTA 4JGPA 1NYYA 2ZQAA 4N9KA 4LV0A 4QWOA 3MQQA 1PFLA 3VSKA 3MSHA 2L0WA 3C7VA 5JYOA 5TGFA 3TE8A 1BLCA 4WUJA 4BBVA 4IBRA 2B18A 1VEUB 2FZ0A 1ZG4A 4GD8A 1K56D 4UQIS 3CAXA 4S2MA 1P9WA 4HP4A 3IT9A 3RH8B 2H0TA 4UA6A 3RTYA 1IYOA 4R3JA 3T4SA 1IKGA 2MJ6A 4HEFA 4LRZE 4U3TA 3R7WA 3ZCZA 2JKFA 1YM1A 4GD6A 5EPHA 1IKIA 5HDDA 4F94A 1WYBA 4WEJA 3GVBA 2NUPC 2P9VA 1FSYA 2DCFA 2XGNA 2HDUA 3HJIA 4EW7A 2ZM8A 3V3SA 3A3JA 4CQHA 4EERA 1G6OA 3RFBA 4KQDA 4E3LA 2PBDP 4R1GA 2WKPA 4DRTA 1OTAA 2FFFB 5IHVA 2KLIA 3HLFA 4K08A 4KZ9A 4OLGA 5EECA 4WM9A 4BBUA 4R70A 3M2JA 3V39A 2XRNA 1JWPA 3MS6A 2WGWA 5CEDA 4OLDA 3VV4A 3HJKA 2D02A 3VOZA 3NULA 2YKFA 4C75A 1K54C 3MZDA 3N6IA 3VSLA 4DMZA 3QP5A 2QMIA 3EWKA 4GS9B 5M18A 4ZTKA 3DTKA 5AQAA 2OV5A 1ALQA 1NLYA 5CHJA 3S22A 3EGDC 3WWXA 3S4XA 1XKZA 5FQ9A 2A2LA 4DXBA 2BLSA 2IWDA 3C8CA 5DF9A 4WMCA 1CQAA 4BD0A 1PW8A 4KZ8A 2BASA 1IOUA 3JYIA 3BY8A 4X1MA 1CK3A 2VA0A 4PPRA 3HLBA 2BTFP 2QHKA 4BENA 1PWGA 4ZDXA 3Q81A 5AJGA 1YKDA 5TR7A 4OQHA 3WS2A 1VEUA 4R4SA 1I2SA 2H5SA 2Z6DA 3KSHA 4ETZA 1YMXA 5CGXA 3E2KA 4UHUA 4EUVA 2HJEA 1ZKJA 1BLSA 3UMEA 1HD8A 3KSIA 1ONHA 1IELA 1W7FA 1KGGA 3QP1A 2VV8A 3N7WA 4YINA 2OLVA 5TFQA 2A49A 3BQAA 5A90A 4N1XA 4DE1A 1S4SA 5F5YA 4Y3IA 3A0RA 1NRJA 3CMZA 4FOFA 2J3TC 2VV6A 4HJ3A 4G3VA 1MXOA 3RXWA 1ESIA 4R0QA 5EV0A 3LI9A 1K0KA 5A91A 4II7A 2VKSA 1K6RA 2KX6A 5HAPA 1J9MA 3IS2B 1FIKA 5EVLA 4JF4A 3M6HA 4NXBA 4B4XA 4JXGA 5GLBA 1XJ2A 2GZAA 5IS1A 5FAQA 1NZOA 3VP0A 1G5UA 2V9AA 2VV7A 4KUKA 5CGWA 4LPZA 2O99A 3AGEA 4LCMA 1VHMA 1K54A 3GTCA 3TG9A 2HV1A 5K5BA 3SOIA 2QWSA 4GS9A 3KX0X 3K3DA 1YPRA 2PDRA 3ZQ5A 1ES3A 5HSQA 5DFXA 3MFDA 3B42A 4R38A 2WZXA 4E3OA 1NLZA 2JKTM 4X53A 3UDFA 1LT0A 5F6AA 3NECA 3H82B 1DJAA 2WK0A 1W79A 5DTKA 3ZHHA 4LV2A 4NG2A 5EUAA 1KE3A 3Q1FA 2Y2KA 3IX4A 3NHQA 1YT4A 4HY8A 1CI9A 5HPFA 4BLMA 3CPTB 3WS1A 4WMCD 1FCMA 3K3CA 3T4LA 3SS4A 3FWLA 2HDRA 3T4KA 1H3QA 2ZC3B 4UEYA 4OP5A 4ID4A 3MJQA 3S1YA 2WKQA 2W27A 2HP9A 1L3LA 5L07A 1BULA 1KE4A 5E2GA 2Y79A 3RJUA 1BSGA 3HVFA 4WZ5C 5F1GA 1XJ4A 2ZBBA 3EEAA 4OQGA 4FH4A 2ZD8A 4MBHA 1QMEA 4WEKA 3L7HA 2VGLS 5TBMB 3OPHA 3IX3A 2VZWA 2UV0E 3IS2A 1KDWA 3IWOA 2EX9A 3CHWP 3TRCA 4EESA 5J8XA 1EW0A 4ZJ2A 3VP2A 4PHTA 1IEMA 1JTDA 1PI4A 3IXDA 4QU3A 2WKIA 2XSSA 3DAVA 4MMNA 1VB6A 1TS7A 1GA0A 4LGWA 5CGSA 2XFSA 4Y7PA 5FASA 3BY9A 1I2WA 1DJCA 4E6XA 5HX9A 3IXBA 3VE3A 2VGJA 1K56A 2R9XA 5J4EA 3LIEA 3IQAA 1SKOB 1D1JA 1L0FA 1XP4A 3O5YA 4Y0UA 3KYQA 3LIBA 5D3OA 5KIZA 4KQOA 2Y55A 1YAXA 2LB9A 4KZ5A 1NWZA 2W1RA 3CG5A 4EEUA 3UE3A 3EQVA 3T1XA 1LSXA 3UE6A 1ODVA 3MZFA 2W3GA 3Q82A 3E98A 4BJPA 1ZC2A 4NETA 2O9CA 3H82A 1JVJA 4RQ9A 4DXCA 2W3EA 1UGUA 3ZG0A 1ZTUA 4KG6A 3UMDA 3OCNA 4DJ2A 4WF0A 2PAVP 3MBZA 5BOHA 1BLHA 1ZHHB 1NRFA 3O88A 3CPTA 4LLOB 4ZBEA 1IFQA 4PM5A 2Q9NA 5DF8A 4CLCD 2IA2A 2HP5A 1XX2A 3VP3A 3UE0A 1S1YA 3LEQA 5IU1A 2G2WA 5GLCA 4NXGA 4EEPA 1L2SA 1VM1A 3HBRA 3P7NA 4X68A 1IYPA 4OVDA 3LIFA 5EVID 4X69A 5E2EA 2Y2IA 4ETXA 1A0KA 3JVVA 5TBMA 4P6ZM 2ZM2A 1DP6A 1KDSA 4R6LA 1SHVA 2Y2JA 1BTLA 4UA7A 4OONA 2GX5A 4XUXA 1W8QA 3OCLA 1FR1A 4E04A 4MBFA 3HUNA 4C3QA 2Y2OA 4RX3A 1PNEA 3QP2A 2J9PA 1OTDA 4HIAA 2E8JA 3ZYTA 4PM9A 3B3XA 5CECA 1RGZA 3LR3A 3T4OA 2INWA 3LR0A 3HLGA 1YQSA 4NXFA 3WS4A 4NK3A 5AQ7A 2XH9A 5KMWA 4GHIB 3LCEA 1PWCA 2Z6CA 1MKMA 4KZBA 2QJ7A 5GLDA 5GHZA 4X1LA 2X02A 4HBUA 1GSWA 1SKOA 2J80A 3PHYA 3FPWA 2ZQ9A 1ONGA 5GHXA 2ZQCA 3KYEA 5TJJA 1H8YA 4BL3A 2XD1A 2JKGA 3ZG7B 4MBKA 1DP8A 3ISGA 2RL3A 2XQZA 4EBLA 3ZGAB 2ACGA 2XROA 1TS0A 3SH7A 2GJ3A 1WYCA 2XA7S 4MN5A 3D4FA 1NY0A 4ZRRA 1K25A 3MKFA 3PBRA 4JKTA 5L8MA 4Q0IA 2QYBA 4WZ4A 4JF5A 3LYXA 5J7EA 1N9OA 1XGJA 1XA1A 4KG2A 2LB5A 2V1AA 3WRZA 2Y2GA 3EOIA 5CRFA 1GSVA 4DE0A 1OMEA 4DE2A 1GA9A 1GHMA 2JCHA 3G6OA 4E3IA 2PRFA 3OZHA 1OPXA 2X01A 4JPMA 1MWSA 4L9GA 3TW8A 3BWLA 3MXQA 4BQMA 3HLCA 4DF6A 1HTZA 4OPYA 3Q7VB 1KOUA 3IXGA 3MFXA 5EE8A 4CLCE 3QNCA 3BQ8A 1PWDA 2YKHA 3H9WA 4OP8A 4N92A 1MPLA 1S6RA 4Q0JA 4BBTA 3FC7A 3CITA 3V3RA 5FAOA 1XGIA 4IVIA 1S66L 1XXMA 1W63Q 4NEED 1DJBA 2Z2LB 4Q8IA 5A92A 4M3KA 4IVKA 4S2NC 4OH0A 3MMHA 4UQIM 4QY6A 2PD8A 4OPRA 3GECA 4B4ZA 5FEGA 2ZMFA 3BRMA 2B5RA 4GHIA 4YNRA 4Q0HA 1ESUA 2PU4A 3E4PA 1TVFA 2PT7A 3NY4A 4E6WA 4HQAA 3NOPC 1K4EA 2HPBA 1GSXA 1YSQA 3IF5A 4CLCB 5DTSA 1AWIA 2NUTC 4CLCC 3LR4A 4P6BA 5AVFA 4IEDA 4LRXC 3WS5A 1FCNA 1G68A 1XA7A 2V8FA 3CLOA 1OJ5A 4DE3A 3UB8A 5F68A 3LI8A 5EVIB 2E8IA 2H28A 3IF6B 3ZVWA 2OLUA 3FKVA 1RCJA 3UB5P 3AGFA 4K0XA 1CJFA 2UWXA 3PXPA 1S67L 5EVIC 1ES2A 1U60A 2FH5A 1GCEA 3P09A 3E4QA 4OOMA 4JLFA 3A3DA 1KVLA 1LLBA 2ZMAA 4E3NA 4FH2A 3BJNA 4JXSA 5J3WA 1MWUA 1P97A 3G32A 1I5QA 3UY6A 1ES5A 4F3LB 1K57C 1N9NA 3UNWA 3T50A 3VMAA 3A3EA 4IBXA 4DKIA 3MF0A 4FUWA 2JKRM 3QP6A 3BLSA 4G3KA 3Q7VA 3P98A 2Y2MA 3LY4A 2PYPA 4GDBA 4XXRA 3U2AA 4KZ6A 3UDXA 3DTMA 3PBNA 5LBRA 5EOOA 3QHYA 3G30A 3DWKA 2H0YA 3NIAA 5CTMA 1CF0A 2JE5A 4GOGA 1CEFA 3N4IA 4EBPA 3ZNTA 4L0LA 1C3BA 1X0OA 2QJ5A 4PAUA 2G7UA 4P85A 3U4LP 3UPNA 4OPZA 3T4JA 2WYXA 1KE0A 3LUQA 4R23A 4S2NA 5HAQA 3OPRA 1HZOA 1T19A 3N8RA 2ZLYA 3BYDA 1K6SA 5FQJA 4EV4A 4O8GA 1O7EA 1T18A 4Y2FA 2PR5A 1YMSA 3C4OA 1CI8A 1W5DA 2R9WA 3GMWA 1KGFA 4YWZA 3T1RA 1YLPA 3NCKA 2RCXA 2VLGA 2Y2LA 4C6YA 3IWIA 5FQIA 5DKKA 3HLEA 4X56A 1Y4OA 4MN6A 5FA7A 1S4RA 1YLYA 3W8KA 4CLCA 3PBSA 1XFNA 3MR0A 1SDNA 1MY8A 4LV1A 4GLQA 3I7JA 2Y91A 3HUOA 5M19A 2Y8HA 5EVIA 3IF6A 5F69A 5HARA 3BEBA 3C4PA 2Y2QA 1G28A 3EEHA 4JF6A 2PBYA 4FSFA 1BT5A 1SCWA 2V1BA 2ZMVA 2EX2A 4DN0A 4Y0TA 5HWVA 5AQBA 2KDKA 3C5AA 2M7VA 2ZC5B 5HD5A 3ITBA 1LI9A 2Y4AA 2XLNA 4MN7A 3EGXC 4GW9A 1XJ6A 4S2IA 5KZHA 2V0UA 3AGDA 1ERQA 3G35A 1K57A 1E3UA 4F3LA 1BZAA 1BUEA 1PZPA 3BECA 4N1HA 5KSCA 2QPNA 2EWVA 4L9EA 3W4QA 2WUQA 5FATA 2CMNA 1TS8A 5FL3A 4IHQA 4K0WA 2JHEA 3ZG9B 4AFIA 3PBQA 2BG1A 2H10A 2IWBA 5GL9A 1K4FA 3C7UA 3PR6A 4R4RA 4QB8A 5HWTA 4MEZA 5DF7A 5C5KA 4RX2A 4CJNA 2VX8A 3UDIA 1MWRA 4I38A 2XR0A 3B47A 2OWHA 5HL6A 1TDLA 4N9LA 3G4PA 3K2NA 1PRQA 4PM8A 1E25A 5E2FA 2A24B 3N8SA 4PM6A 3LR5A 3A3IA 4EQ1A 2I72A 3LO7A 4Y15A 3PBOA 2WZZA 5FQMA 1KVMA 4R3AA 4JXVA 2WGIA 2P7JA 2WGVA 3MKEA 4I5SA 3IWQA 3NDGA 5CEBA 5HFOA 2HGVA 4XUZA 2JKRI 1JNUA 4R3BA 3IHBA 3S7QA 3D9YA 2EFXA 3DWZA 1IYSA 4GB7A 4OOYA 3QP8A 2Q9MA 2P04A 2WADA 5M1AA 3IHAA 3BFFA 5CERA 4O7DA 1N4OA 3OOVA 2VGLM 3WS0A 4DJ3A 4YOFA 1LL5A 1ERMA 2XF3A 4Y0OA 3R4KA 1H0MA 1Z6FA 2HF6A 5DKLA 1XFQA 3TOIA 4DDYA 2R78A 3SZTA 4S2LA 5F82A 3F1PB 1ZG6A 1T1BA 3ZG8B 5HL1A 2P08A 1UWNX 1FSWA 1L0EA 3H7WB 2JKTI 5HPIA 4QHCA 2ZC4B 4K91A 1OTIA 1MWTA 3NOUC 3IH8A 1K55C 2WAEA 1LL9A 3W2ZA 5F1FA 2OAP1 4UA9A 2P74A 3G2YA 4KQQA 1E3UD 1L0DA 3F1OB 5AQ9A 3DW0A 5FAPA 4OQ0A 3FPVA 5CHMA 4OQIA 5F83A 3LGOA 3ZG5A 4GDNA 5JYPA 4Z9QA 5FDHA 4LENA 2A24A 1RP5A 1SKFA 1NZUA 3NBLA 4HP9A 1K38A 1E4DA 3FZCA 3S7PA 3CUEC 1STZA 2I9VA 4YFMA 4I3IA 2ZQ7A 3GDIA 1NJ4A 1H8ZA 1Y54A 3FG8A 2Y2PA 3UN7A 1TD5A 3Q07A 4KENB 1HLUP 1ACFA 4Y13A 2XDMA 4WL9A 4E3MA 2Y2HA 2A3UA 1XPBA 3QP4A 3MXRA 4U0TA 1MKIA 1F2KA 2ZC6B 4CPKA 1H5XA 4QY5A 5G4ZA 5CX7A 1WA9A 2OOLA 1TF1A 3A3FA 5FQQA 5HDCA 4KZ4A 4L9FA 4H8RA 5I5LA 2AVXA 3F1PA 1OTEA 1EI5A 4QJGA 4WN5A 3HLWA 4HJ6A 2EX8A 3H7WA 3T4QA 1S1ZA 1K55A 1DY6A 3A0SA 1FILA 2W0NA 3ICYA 3UO9A 4EXOA 5FSRA 2D01A 3ITAA 2ZC7A 1YSPA 1F98A 3SS3A 5DTTA 1D7EA 4WLAA 4E3KA 1YLJA 3VFFA 3NI9A 4B9OA 4JGRA 4XT2B 4EU0A 4JXWA 2HP6A 2Z2MB 4WELA 4RA7A 5DJTA 5EOEA 2K2NA 2WKHA 3G34A 4KZAA 3SH9A 5CTNA 3O87A 2ZL1B 2ZM0A 3F1OA 4QD4A 3UB6A 2XA7M 2EWWA 3FYZA 4PKYG 3V67A 1M40A 3T4TA 1BYWA 4LV3A 3W4OA 4PKYA 4MDZA 2VEAA 3CWFA 1JWZA 4EQIA 4BMWA 2OSUA 4B88A 2K31A 2JBFA 2V2FF 3HCYA 5EFWA 4OKPA 3CUEA 3LIAA 4HHDA 3OPPA 1VETB 4EETB 2L4RA 1W8YA 3QNBA 3TJZC 2DRWA 4NXEA 1WE4A 4B93A 4ZJ3A 4FTXA 5FEFA 3UE1A 5L2FA 2J7VA 3L9KA 2J3WA 3CI6A 4ARZB 5FQKA 4H6JB 2HDSA 3IF6C 1CEGA 3S7OA 4S2PA 2QKPA 3ULFA 1J3WA 4E3JA 5DFYA 3KSFA 5G4YA 3MQ0A 2O0YA 2HJ9C 3BM6A 3BFGA 2O9BA 5HWWA 3E2LA 5GHYA 5A8BA 2EX6A 4S2JA 2XK1A 3CJMA 2CC1A 4Y5FA 3MQOA 4FD8A 4DDSA 4GCZA 3CZDA 2ZOIA 3GR2A 4Y17A 3P01A 3ZDJA 1FR6A 4QPRA 2L1MA 2VGKA 3B33A 4HNBA 5IT5A 4IJGA 5HW3A 3N8LA 2FFYA 1LSWA 3UPPA 2B02A 2HZ5A 1M6KA 1NYMA 3OC2A 4XT2A 3VOYA 2IWCA 4HESA 5E43A 2W1TB 1W63M 2ZL1A 4KQRA 3BFCA 3MZEA 1DP9A 2OAQ1 1GHIA 2Q0OA 3UB7A 4KZ7A 2WKEA 2V1ZA 2KOIA 3O3VA 5HAIA 4D60A 4EBNA 3ZVTA
chains in the Genus database with same CATH topology
2A24B 1MKMA 2Z6CA 1NLYA 2QJ7A 2V0WA 1GSWA 3LR5A 4EQ1A 2J80A 3PHYA 3EGDC 1OJGA 3FPWA 2M1CA 3PBOA 4O01A 5TJJA 4R3AA 2A2LA 3NJAA 2VJWA 2PR6A 4JGOA 2P7JA 3C8CA 5DF9A 4I5SA 3IBRA 1DP8A 2HGVA 2BASA 2JKRI 4MCWA 1JNUA 1IOUA 3S7QA 3BY8A 2VA0A 2XROA 1TS0A 3SW1A 1LSVA 2GJ3A 2QHKA 2XA7S 2P04A 4MN5A 4ZRRA 5AJGA 3PYPA 1YKDA 4ARZA 4BWIA 5HD3A 3VOLA 4H6JA 2DMWA 3E0YA 3LIDA 3LICA 3OOVA 3LFVA 3PBRA 2VGLM 3NOTC 4LRYC 3S7NA 5L8MA 4DJ3A 2WKRA 2Z6DA 3KSHA 4YOFA 4ETZA 4Q0IA 2QYBA 4I3JA 2JN7A 4EUVA 2HJEA 3LYXA 3OLOA 3UMEA 5J7EA 3R4KA 1N9OA 5DJUA 2HF6A 3KSIA 5DKLA 2LB5A 2V1AA 1XFQA 2R78A 4HH3A 4G3WA 3F1PB 3EOIA 1GSVA 4JGQA 2VV8A 3D3OA 1TS6A 1T1BA 3G6OA 1OTBA 3BQAA 2P08A 1UWNX 1V9ZA 1LL8A 1S4SA 3H7WB 2OWJA 2JKTI 1OPXA 5F5YA 4Y3IA 5HPIA 3A0RA 1NRJA 4L9GA 3TW8A 4FOFA 2J3TC 2VV6A 3BWLA 3MXQA 4G3VA 4HJ3A 3C2WA 2ZOHA 1OTIA 3OBFA 3LI9A 1KOUA 3C38A 3NOUC 4II7A 1D06A 3MFXA 2VKSA 2KX6A 4CLCE 3IS2B 3BQ8A 2YKHA 3H9WA 3W2ZA 4NXBA 2OAP1 3PBTA 1N9LA 1XJ2A 2GZAA 3EQUA 4Q0JA 4BBTA 3FC7A 3CITA 5IS1A 2K7SA 3E4OA 1S66L 1V9YA 1T1CA 2V9AA 1W63Q 3F1OB 4NEED 2M7UA 2W1TA 3FPVA 2PD7A 2VV7A 1F5MA 4KUKA 4LPZA 2O99A 1P0ZA 1VHMA 2W3DA 3F1NB 4Z1WA 2HV1A 3MMHA 4UQIM 5K5BA 2QWSA 2PD8A 4GJ4A 3GECA 2ZMFA 4GS9A 3VE4A 3KX0X 4GHIA 4KUOA 3UB9A 4YNRA 4Q0HA 3K3DA 2A24A 2PDRA 3ZQ5A 3E4PA 5HSQA 2PT7A 4HOIA 5DFXA 4P6ZS 4HP9A 4HQAA 3B42A 3NOPC 4R38A 3S7PA 3CUEC 1NLZA 1STZA 2JKTM 2I9VA 4OOLA 1GSXA 4I3AA 4I3IA 1YSQA 1LT0A 4CLCB 3GDIA 5F6AA 2NUTC 4HI4A 3FG8A 2PYRA 1TD5A 3LR4A 4CLCC 5AVFA 4LRXC 1F9IA 3H82B 3CLOA 1OJ5A 4WL9A 3KSGA 3UB8A 5F68A 3LI8A 2H28A 3DBAA 3NHQA 3PXPA 1S67L 4HY8A 5AVEA 2FH5A 5HPFA 3E4QA 5G4ZA 4OOMA 3K3CA 3R7WB 3T4LA 5CX7A 1WA9A 2OOLA 1TF1A 2EA9A 3T4KA 1H3QA 4IUHA 3A0VA 3BJNA 2GNXA 4UEYA 5J3WA 5HDCA 4HH2A 4L9FA 5KSHA 5I5LA 3MJQA 3F1PA 1P9RA 2WKQA 2W27A 1MC0A 1P97A 1OTEA 2Y79A 2W3FA 1XJ3A 4WN5A 4HJ6A 4F3LB 1XJ4A 2ZBBA 3H7WA 3T4QA 1H8MA 3EEAA 5MC7A 3D72A 1N9NA 1S1ZA 1Y28A 3T50A 4O0PA 3JVUA 3MF0A 4WEKA 2JKRM 3A0SA 2W0NA 4G3KA 3ICYA 2W3HA 2VGLS 4EXOA 2PYPA 5TBMB 2D01A 2PHYA 3U2AA 2VZWA 3IS2A 3PBNA 5LBRA 1YSPA 4IUKA 1F98A 1D7EA 4WLAA 3TRCA 4EESA 1MZUA 3BW6A 1EW0A 4M4XA 4PHTA 4B9OA 4JGRA 4XT2B 4EU0A 4L0LA 4WELA 5DJTA 1X0OA 2QJ5A 4PAUA 2G7UA 2K2NA 4I39A 2XSSA 3UB6A 3T4JA 3F1OA 4MMNA 1VB6A 3LUQA 2XA7M 2EWWA 3V67A 2J3TD 1TS7A 2O9AA 4PKYG 3T4TA 1BYWA 1DRMA 1T19A 4PKYA 3BY9A 4ME4A 3F1NA 4MDZA 1OT9A 2VEAA 4O8GA 1OT6A 1T18A 3CWFA 4Y2FA 2PR5A 3IBJA 3VE3A 5HDSA 4YWZA 3KYZA 1T1AA 4NKPA 4BMWA 5J4EA 3LIEA 5HZHA 2VLGA 1UWPX 2K31A 3HCYA 5EFWA 3CUEA 3O5YA 3KO6A 5DKKA 3KYQA 3LIAA 4HHDA 3LIBA 5KIZA 4KQOA 3C30A 4HJ4A 4MN6A 4EETB 1YAXA 2L4RA 1S4RA 2LB9A 4EEUA 1NWZA 2W1RA 3UE3A 4CLCA 3TJZC 3PBSA 1XFNA 4JGPA 3EQVA 4NXEA 1LSXA 3MR0A 1ODVA 3MQQA 3UE6A 4B93A 2L0WA 2W3GA 3E98A 3TE8A 4BJPA 4GLQA 2O9CA 3H82A 2J3WA 3CI6A 4ARZB 4RQ9A 2W3EA 1UGUA 2Y8HA 4WUJA 4H6JB 4BBVA 1ZTUA 2B18A 2FZ0A 5F69A 3S7OA 3UMDA 4UQIS 3CAXA 1G28A 3OCNA 3EEHA 4DJ2A 1P9WA 4HP4A 2QKPA 4WF0A 3ULFA 3RH8B 1ZHHB 4FSFA 3RTYA 2V1BA 2ZMVA 5DFYA 4LLOB 4DN0A 3T4SA 3KSFA 1IFQA 2MJ6A 4LRZE 3R7WA 5G4YA 5HWVA 3MQ0A 2O0YA 2KDKA 2M7VA 4CLCD 5HD5A 2IA2A 5HDDA 2HJ9C 1S1YA 5IU1A 4WEJA 4MN7A 3EGXC 4NXGA 4EEPA 4GW9A 1XJ6A 2V0UA 2O9BA 2NUPC 5HWWA 3P7NA 5A8BA 3HJIA 3LIFA 4Y5FA 4F3LA 3MQOA 4EW7A 4CQHA 4GCZA 4EERA 1G6OA 3RFBA 2ZOIA 4KQDA 4ETXA 3P01A 2EWVA 4L9EA 3JVVA 5TBMA 2WKPA 4P6ZM 1OTAA 1DP6A 4QPRA 2L1MA 4R6LA 3B33A 2CMNA 4HNBA 2KLIA 4IJGA 1TS8A 5IT5A 5FL3A 4K08A 4IHQA 2JHEA 4AFIA 1LSWA 4BBUA 2GX5A 2B02A 3PBQA 3OCLA 4E04A 3OC2A 4XT2A 4R70A 2XRNA 2W1TB 1W63M 3PR6A 3VV4A 3HJKA 5HWTA 1OTDA 2D02A 4HIAA 1DP9A 5C5KA 2VX8A 2OAQ1 2YKFA 3ZYTA 3UB7A 4I38A 3B47A 3LR3A 3T4OA 2INWA 2OWHA 3LR0A 4DMZA 3EWKA 4GS9B 4NXFA 5HL6A 2KOIA 3K2NA 4GHIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A24 B;  2Z6C A;  2QJ7 A;  2V0W A;  1GSW A;  4EQ1 A;  2J80 A;  3PHY A;  1OJG A;  2M1C A;  4R3A A;  3NJA A;  2PR6 A;  4JGO A;  2P7J A;  3C8C A;  4I5S A;  3IBR A;  1DP8 A;  2BAS A;  1JNU A;  3BY8 A;  1TS0 A;  3SW1 A;  1LSV A;  2GJ3 A;  2QHK A;  4MN5 A;  3PYP A;  5HD3 A;  3VOL A;  4H6J A;  3LID A;  3LIC A;  3NOT C;  4LRY C;  4DJ3 A;  2WKR A;  2Z6D A;  4I3J A;  2JN7 A;  3LYX A;  3OLO A;  3UME A;  5J7E A;  1N9O A;  5DJU A;  5DKL A;  2V1A A;  1XFQ A;  2R78 A;  4HH3 A;  3F1P B;  1GSV A;  4JGQ A;  2VV8 A;  1TS6 A;  1T1B A;  3G6O A;  1OTB A;  1UWN X;  1V9Z A;  1LL8 A;  1S4S A;  3H7W B;  2OWJ A;  5F5Y A;  3A0R A;  4L9G A;  2VV6 A;  4HJ3 A;  3BWL A;  3MXQ A;  3C2W A;  2ZOH A;  1OTI A;  3LI9 A;  1KOU A;  3NOU C;  1D06 A;  3MFX A;  2KX6 A;  3IS2 B;  2YKH A;  3H9W A;  4NXB A;  1N9L A;  1XJ2 A;  4BBT A;  3FC7 A;  5IS1 A;  2K7S A;  3E4O A;  1S66 L;  1V9Y A;  1T1C A;  2V9A A;  3F1O B;  2PD7 A;  2VV7 A;  4KUK A;  4LPZ A;  1P0Z A;  3F1N B;  2HV1 A;  2QWS A;  2PD8 A;  3GEC A;  4GS9 A;  3VE4 A;  3KX0 X;  4GHI A;  4KUO A;  3UB9 A;  3K3D A;  2A24 A;  2PDR A;  3ZQ5 A;  3E4P A;  5HSQ A;  4HOI A;  4HP9 A;  4HQA A;  3NOP C;  4R38 A;  2I9V A;  1GSX A;  4I3A A;  4I3I A;  1LT0 A;  3GDI A;  5F6A A;  4HI4 A;  3FG8 A;  2PYR A;  5AVF A;  4LRX C;  1F9I A;  3H82 B;  3CLO A;  1OJ5 A;  4WL9 A;  3UB8 A;  5F68 A;  3LI8 A;  2H28 A;  3NHQ A;  1S67 L;  4HY8 A;  5AVE A;  3E4Q A;  5G4Z A;  3K3C A;  1WA9 A;  2OOL A;  2EA9 A;  3A0V A;  5J3W A;  5HDC A;  4HH2 A;  4L9F A;  5I5L A;  3MJQ A;  3F1P A;  2WKQ A;  2W27 A;  1P97 A;  1OTE A;  1XJ3 A;  4WN5 A;  4HJ6 A;  4F3L B;  1XJ4 A;  2ZBB A;  3H7W A;  3D72 A;  1N9N A;  1S1Z A;  1Y28 A;  3T50 A;  3A0S A;  2W0N A;  3ICY A;  4EXO A;  2PYP A;  5TBM B;  2D01 A;  2PHY A;  3IS2 A;  1F98 A;  1D7E A;  4WLA A;  4EES A;  1MZU A;  1EW0 A;  4M4X A;  4B9O A;  4JGR A;  4XT2 B;  5DJT A;  1X0O A;  2QJ5 A;  4I39 A;  3UB6 A;  3F1O A;  1VB6 A;  3LUQ A;  4PKY G;  1TS7 A;  1BYW A;  1DRM A;  1T19 A;  4PKY A;  3BY9 A;  3F1N A;  1OT9 A;  2VEA A;  1OT6 A;  1T18 A;  3CWF A;  2PR5 A;  3VE3 A;  5HDS A;  4YWZ A;  1T1A A;  5J4E A;  3LIE A;  5HZH A;  2VLG A;  1UWP X;  5EFW A;  5DKK A;  3LIA A;  4HHD A;  3LIB A;  5KIZ A;  4HJ4 A;  4MN6 A;  4EET B;  2L4R A;  1S4R A;  4EEU A;  1NWZ A;  1XFN A;  4JGP A;  4NXE A;  1LSX A;  3MR0 A;  1ODV A;  3MQQ A;  3UE6 A;  2L0W A;  3H82 A;  4RQ9 A;  1UGU A;  4WUJ A;  4H6J B;  4BBV A;  5F69 A;  3UMD A;  3CAX A;  1G28 A;  3EEH A;  4DJ2 A;  4HP4 A;  2QKP A;  3ULF A;  4WF0 A;  3RH8 B;  3RTY A;  2V1B A;  4LLO B;  4LRZ E;  5G4Y A;  5HWV A;  2KDK A;  5HD5 A;  5HDD A;  1S1Y A;  5IU1 A;  4NXG A;  4EEP A;  4GW9 A;  1XJ6 A;  2V0U A;  5HWW A;  3P7N A;  5A8B A;  3HJI A;  3LIF A;  4F3L A;  3MQO A;  4EW7 A;  4GCZ A;  4EER A;  2ZOI A;  4KQD A;  4L9E A;  5TBM A;  2WKP A;  1OTA A;  1DP6 A;  2L1M A;  4R6L A;  3B33 A;  2CMN A;  4HNB A;  1TS8 A;  4K08 A;  2JHE A;  1LSW A;  4BBU A;  2B02 A;  4E04 A;  4XT2 A;  4R70 A;  3HJK A;  5HWT A;  1OTD A;  2D02 A;  4HIA A;  1DP9 A;  2YKF A;  3UB7 A;  4I38 A;  2INW A;  2OWH A;  3EWK A;  4GS9 B;  4NXF A;  4GHI B; 
#chains in the Genus database with same CATH topology
 3VP4 A;  2V0W A;  5EVE A;  2G2U A;  3HUM A;  4PM7 A;  1OJG A;  2M1C A;  4ZJ1 A;  4O01 A;  3NJA A;  2VJW A;  2PR6 A;  4JGO A;  4RYE A;  1VET A;  3IBR A;  2WAF A;  4MCW A;  1JWV A;  1SDE A;  5L09 A;  4KG5 A;  3SW1 A;  1LSV A;  3T1S A;  3T1Q B;  4S2O A;  1IYQ A;  3O86 A;  3PYP A;  4ARZ A;  4BWI A;  5HD3 A;  3VOL A;  4H6J A;  1FCO A;  2DMW A;  3E0Y A;  3LID A;  3LIC A;  3LFV A;  3WRT A;  3NOT C;  3G2Z A;  3LEZ A;  4LRY C;  3GQZ A;  3S7N A;  2WKR A;  1VQQ A;  3PAG A;  4I3J A;  5GLA A;  2JN7 A;  2Y59 A;  3OLO A;  3IH9 A;  3TSG A;  5DJU A;  2EFU A;  2ZQD A;  1AXB A;  4RVA A;  1RGY A;  4GN2 A;  1PIO A;  4HH3 A;  3DTE A;  4G3W A;  2X71 A;  3Q7Z A;  3VP1 A;  4JGQ A;  3D3O A;  3BFE A;  1TS6 A;  1TDG A;  3IX8 A;  4WYY A;  4A5R A;  1OTB A;  1V9Z A;  1YLW A;  1LL8 A;  2OWJ A;  1LI0 A;  5DVA A;  3GRJ A;  3PTE A;  3C2W A;  2ZOH A;  3OBF A;  1PZO A;  3C38 A;  5CXW A;  1D06 A;  3GSG A;  4HBT A;  4WBG A;  4P0M A;  2C6W B;  4GZB A;  3G31 A;  1PYY A;  1TEM A;  3PBT A;  5FDS A;  1N9L A;  3EQU A;  1Q2P A;  2K7S A;  3E4O A;  1V9Y A;  1T1C A;  1BLP A;  1G6A A;  2M7U A;  4EWF A;  4U0X A;  2W1T A;  3PAE A;  2B95 A;  2PD7 A;  1F5M A;  3M2K A;  5FI2 A;  1P0Z A;  2W3D A;  2EXB A;  3F1N B;  3LY3 A;  5EM1 A;  4Z1W A;  5FI7 A;  2XFT A;  4GJ4 A;  5E2H A;  3UPO A;  3VE4 A;  2J8Y A;  4KZ3 A;  4KUO A;  3UB9 A;  5I94 A;  3OPL A;  4LFU A;  2VK3 A;  3T12 B;  3VFH A;  4X55 A;  2HDQ A;  5CHU A;  4FCF A;  4HOI A;  4JBF A;  4P6Z S;  5U47 A;  4EUZ A;  3MXS A;  4OOL A;  1JTG A;  4I3A A;  4ZAM A;  4HI4 A;  2EXA A;  2PYR A;  4BD1 A;  1ERO A;  5L10 A;  4OPQ A;  1F9I A;  3NDE A;  2PU2 A;  5EM0 A;  3ZNY A;  3RXX A;  3KSG A;  2ZJ9 A;  1NXY A;  2JC7 A;  3DBA A;  1HVB A;  1MBL A;  3HL9 A;  4MLL A;  4UAA A;  5AVE A;  1FQG A;  5A93 A;  3JPU A;  3R7W B;  4PMA A;  1PI5 A;  2EA9 A;  5G18 A;  4IUH A;  3A0V A;  2GNX A;  2V20 A;  3V5M A;  4HH2 A;  5KSH A;  3SS5 A;  1P9R A;  3FV7 A;  1MC0 A;  1YLZ A;  1N9B A;  2QZ6 A;  2P9V B;  2W3F A;  1XJ3 A;  1ES4 A;  3M6B A;  1LHY A;  2GDN A;  4WZ5 A;  2C5W B;  1H8M A;  3FKW A;  5MC7 A;  3D72 A;  1Y28 A;  4O0P A;  3JVU A;  3ZFZ A;  1L0G A;  2W3H A;  3IXH A;  2XD5 A;  2XEP A;  2PHY A;  3W4P A;  2J9O A;  3DTI A;  3SH8 A;  4IUK A;  4MNR A;  1MZU A;  1GHP A;  3BW6 A;  4X6T A;  4M4X A;  3BLM A;  1Z09 A;  1PW1 A;  5FI6 A;  1Q2Q A;  3NC8 A;  3GV9 A;  4X25 A;  2WGW B;  4I39 A;  2ZQ8 A;  4GKU A;  2J3T D;  2V8C A;  2O9A A;  4S2K A;  1DRM A;  1SZV A;  3HRE A;  4ME4 A;  3F1N A;  1OT9 A;  1OT6 A;  1KGE A;  3V50 A;  2DNS A;  3IBJ A;  4P87 A;  4GNU A;  1EWZ A;  4BL2 A;  4D2O A;  5HDS A;  3KYZ A;  1T1A A;  4NKP A;  4LCL A;  5HZH A;  2Y2N A;  4ESP A;  1UWP X;  1O07 A;  3BFD A;  3KO6 A;  1QMF A;  3HLD A;  3C30 A;  4HJ4 A;  1FOF A;  1S0W A;  1YLT A;  4JGP A;  1NYY A;  2ZQA A;  4N9K A;  4LV0 A;  4QWO A;  3MQQ A;  1PFL A;  3VSK A;  3MSH A;  2L0W A;  3C7V A;  5JYO A;  5TGF A;  3TE8 A;  1BLC A;  4WUJ A;  4BBV A;  4IBR A;  2B18 A;  1VEU B;  2FZ0 A;  1ZG4 A;  4GD8 A;  1K56 D;  4UQI S;  3CAX A;  4S2M A;  1P9W A;  4HP4 A;  3IT9 A;  3RH8 B;  2H0T A;  4UA6 A;  3RTY A;  1IYO A;  4R3J A;  3T4S A;  1IKG A;  2MJ6 A;  4HEF A;  4LRZ E;  4U3T A;  3R7W A;  3ZCZ A;  2JKF A;  1YM1 A;  4GD6 A;  5EPH A;  1IKI A;  5HDD A;  4F94 A;  1WYB A;  4WEJ A;  3GVB A;  2NUP C;  2P9V A;  1FSY A;  2DCF A;  2XGN A;  2HDU A;  3HJI A;  4EW7 A;  2ZM8 A;  3V3S A;  3A3J A;  4CQH A;  4EER A;  1G6O A;  3RFB A;  4KQD A;  4E3L A;  2PBD P;  4R1G A;  2WKP A;  4DRT A;  1OTA A;  2FFF B;  5IHV A;  2KLI A;  3HLF A;  4K08 A;  4KZ9 A;  4OLG A;  5EEC A;  4WM9 A;  4BBU A;  4R70 A;  3M2J A;  3V39 A;  2XRN A;  1JWP A;  3MS6 A;  2WGW A;  5CED A;  4OLD A;  3VV4 A;  3HJK A;  2D02 A;  3VOZ A;  3NUL A;  2YKF A;  4C75 A;  1K54 C;  3MZD A;  3N6I A;  3VSL A;  4DMZ A;  3QP5 A;  2QMI A;  3EWK A;  4GS9 B;  5M18 A;  4ZTK A;  3DTK A;  5AQA A;  2OV5 A;  1ALQ A;  1NLY A;  5CHJ A;  3S22 A;  3EGD C;  3WWX A;  3S4X A;  1XKZ A;  5FQ9 A;  2A2L A;  4DXB A;  2BLS A;  2IWD A;  3C8C A;  5DF9 A;  4WMC A;  1CQA A;  4BD0 A;  1PW8 A;  4KZ8 A;  2BAS A;  1IOU A;  3JYI A;  3BY8 A;  4X1M A;  1CK3 A;  2VA0 A;  4PPR A;  3HLB A;  2BTF P;  2QHK A;  4BEN A;  1PWG A;  4ZDX A;  3Q81 A;  5AJG A;  1YKD A;  5TR7 A;  4OQH A;  3WS2 A;  1VEU A;  4R4S A;  1I2S A;  2H5S A;  2Z6D A;  3KSH A;  4ETZ A;  1YMX A;  5CGX A;  3E2K A;  4UHU A;  4EUV A;  2HJE A;  1ZKJ A;  1BLS A;  3UME A;  1HD8 A;  3KSI A;  1ONH A;  1IEL A;  1W7F A;  1KGG A;  3QP1 A;  2VV8 A;  3N7W A;  4YIN A;  2OLV A;  5TFQ A;  2A49 A;  3BQA A;  5A90 A;  4N1X A;  4DE1 A;  1S4S A;  5F5Y A;  4Y3I A;  3A0R A;  1NRJ A;  3CMZ A;  4FOF A;  2J3T C;  2VV6 A;  4HJ3 A;  4G3V A;  1MXO A;  3RXW A;  1ESI A;  4R0Q A;  5EV0 A;  3LI9 A;  1K0K A;  5A91 A;  4II7 A;  2VKS A;  1K6R A;  2KX6 A;  5HAP A;  1J9M A;  3IS2 B;  1FIK A;  5EVL A;  4JF4 A;  3M6H A;  4NXB A;  4B4X A;  4JXG A;  5GLB A;  1XJ2 A;  2GZA A;  5IS1 A;  5FAQ A;  1NZO A;  3VP0 A;  1G5U A;  2V9A A;  2VV7 A;  4KUK A;  5CGW A;  4LPZ A;  2O99 A;  3AGE A;  4LCM A;  1VHM A;  1K54 A;  3GTC A;  3TG9 A;  2HV1 A;  5K5B A;  3SOI A;  2QWS A;  4GS9 A;  3KX0 X;  3K3D A;  1YPR A;  2PDR A;  3ZQ5 A;  1ES3 A;  5HSQ A;  5DFX A;  3MFD A;  3B42 A;  4R38 A;  2WZX A;  4E3O A;  1NLZ A;  2JKT M;  4X53 A;  3UDF A;  1LT0 A;  5F6A A;  3NEC A;  3H82 B;  1DJA A;  2WK0 A;  1W79 A;  5DTK A;  3ZHH A;  4LV2 A;  4NG2 A;  5EUA A;  1KE3 A;  3Q1F A;  2Y2K A;  3IX4 A;  3NHQ A;  1YT4 A;  4HY8 A;  1CI9 A;  5HPF A;  4BLM A;  3CPT B;  3WS1 A;  4WMC D;  1FCM A;  3K3C A;  3T4L A;  3SS4 A;  3FWL A;  2HDR A;  3T4K A;  1H3Q A;  2ZC3 B;  4UEY A;  4OP5 A;  4ID4 A;  3MJQ A;  3S1Y A;  2WKQ A;  2W27 A;  2HP9 A;  1L3L A;  5L07 A;  1BUL A;  1KE4 A;  5E2G A;  2Y79 A;  3RJU A;  1BSG A;  3HVF A;  4WZ5 C;  5F1G A;  1XJ4 A;  2ZBB A;  3EEA A;  4OQG A;  4FH4 A;  2ZD8 A;  4MBH A;  1QME A;  4WEK A;  3L7H A;  2VGL S;  5TBM B;  3OPH A;  3IX3 A;  2VZW A;  2UV0 E;  3IS2 A;  1KDW A;  3IWO A;  2EX9 A;  3CHW P;  3TRC A;  4EES A;  5J8X A;  1EW0 A;  4ZJ2 A;  3VP2 A;  4PHT A;  1IEM A;  1JTD A;  1PI4 A;  3IXD A;  4QU3 A;  2WKI A;  2XSS A;  3DAV A;  4MMN A;  1VB6 A;  1TS7 A;  1GA0 A;  4LGW A;  5CGS A;  2XFS A;  4Y7P A;  5FAS A;  3BY9 A;  1I2W A;  1DJC A;  4E6X A;  5HX9 A;  3IXB A;  3VE3 A;  2VGJ A;  1K56 A;  2R9X A;  5J4E A;  3LIE A;  3IQA A;  1SKO B;  1D1J A;  1L0F A;  1XP4 A;  3O5Y A;  4Y0U A;  3KYQ A;  3LIB A;  5D3O A;  5KIZ A;  4KQO A;  2Y55 A;  1YAX A;  2LB9 A;  4KZ5 A;  1NWZ A;  2W1R A;  3CG5 A;  4EEU A;  3UE3 A;  3EQV A;  3T1X A;  1LSX A;  3UE6 A;  1ODV A;  3MZF A;  2W3G A;  3Q82 A;  3E98 A;  4BJP A;  1ZC2 A;  4NET A;  2O9C A;  3H82 A;  1JVJ A;  4RQ9 A;  4DXC A;  2W3E A;  1UGU A;  3ZG0 A;  1ZTU A;  4KG6 A;  3UMD A;  3OCN A;  4DJ2 A;  4WF0 A;  2PAV P;  3MBZ A;  5BOH A;  1BLH A;  1ZHH B;  1NRF A;  3O88 A;  3CPT A;  4LLO B;  4ZBE A;  1IFQ A;  4PM5 A;  2Q9N A;  5DF8 A;  4CLC D;  2IA2 A;  2HP5 A;  1XX2 A;  3VP3 A;  3UE0 A;  1S1Y A;  3LEQ A;  5IU1 A;  2G2W A;  5GLC A;  4NXG A;  4EEP A;  1L2S A;  1VM1 A;  3HBR A;  3P7N A;  4X68 A;  1IYP A;  4OVD A;  3LIF A;  5EVI D;  4X69 A;  5E2E A;  2Y2I A;  4ETX A;  1A0K A;  3JVV A;  5TBM A;  4P6Z M;  2ZM2 A;  1DP6 A;  1KDS A;  4R6L A;  1SHV A;  2Y2J A;  1BTL A;  4UA7 A;  4OON A;  2GX5 A;  4XUX A;  1W8Q A;  3OCL A;  1FR1 A;  4E04 A;  4MBF A;  3HUN A;  4C3Q A;  2Y2O A;  4RX3 A;  1PNE A;  3QP2 A;  2J9P A;  1OTD A;  4HIA A;  2E8J A;  3ZYT A;  4PM9 A;  3B3X A;  5CEC A;  1RGZ A;  3LR3 A;  3T4O A;  2INW A;  3LR0 A;  3HLG A;  1YQS A;  4NXF A;  3WS4 A;  4NK3 A;  5AQ7 A;  2XH9 A;  5KMW A;  4GHI B;  3LCE A;  1PWC A;  2Z6C A;  1MKM A;  4KZB A;  2QJ7 A;  5GLD A;  5GHZ A;  4X1L A;  2X02 A;  4HBU A;  1GSW A;  1SKO A;  2J80 A;  3PHY A;  3FPW A;  2ZQ9 A;  1ONG A;  5GHX A;  2ZQC A;  3KYE A;  5TJJ A;  1H8Y A;  4BL3 A;  2XD1 A;  2JKG A;  3ZG7 B;  4MBK A;  1DP8 A;  3ISG A;  2RL3 A;  2XQZ A;  4EBL A;  3ZGA B;  2ACG A;  2XRO A;  1TS0 A;  3SH7 A;  2GJ3 A;  1WYC A;  2XA7 S;  4MN5 A;  3D4F A;  1NY0 A;  4ZRR A;  1K25 A;  3MKF A;  3PBR A;  4JKT A;  5L8M A;  4Q0I A;  2QYB A;  4WZ4 A;  4JF5 A;  3LYX A;  5J7E A;  1N9O A;  1XGJ A;  1XA1 A;  4KG2 A;  2LB5 A;  2V1A A;  3WRZ A;  2Y2G A;  3EOI A;  5CRF A;  1GSV A;  4DE0 A;  1OME A;  4DE2 A;  1GA9 A;  1GHM A;  2JCH A;  3G6O A;  4E3I A;  2PRF A;  3OZH A;  1OPX A;  2X01 A;  4JPM A;  1MWS A;  4L9G A;  3TW8 A;  3BWL A;  3MXQ A;  4BQM A;  3HLC A;  4DF6 A;  1HTZ A;  4OPY A;  3Q7V B;  1KOU A;  3IXG A;  3MFX A;  5EE8 A;  4CLC E;  3QNC A;  3BQ8 A;  1PWD A;  2YKH A;  3H9W A;  4OP8 A;  4N92 A;  1MPL A;  1S6R A;  4Q0J A;  4BBT A;  3FC7 A;  3CIT A;  3V3R A;  5FAO A;  1XGI A;  4IVI A;  1S66 L;  1XXM A;  1W63 Q;  4NEE D;  1DJB A;  2Z2L B;  4Q8I A;  5A92 A;  4M3K A;  4IVK A;  4S2N C;  4OH0 A;  3MMH A;  4UQI M;  4QY6 A;  2PD8 A;  4OPR A;  3GEC A;  4B4Z A;  5FEG A;  2ZMF A;  3BRM A;  2B5R A;  4GHI A;  4YNR A;  4Q0H A;  1ESU A;  2PU4 A;  3E4P A;  1TVF A;  2PT7 A;  3NY4 A;  4E6W A;  4HQA A;  3NOP C;  1K4E A;  2HPB A;  1GSX A;  1YSQ A;  3IF5 A;  4CLC B;  5DTS A;  1AWI A;  2NUT C;  4CLC C;  3LR4 A;  4P6B A;  5AVF A;  4IED A;  4LRX C;  3WS5 A;  1FCN A;  1G68 A;  1XA7 A;  2V8F A;  3CLO A;  1OJ5 A;  4DE3 A;  3UB8 A;  5F68 A;  3LI8 A;  5EVI B;  2E8I A;  2H28 A;  3IF6 B;  3ZVW A;  2OLU A;  3FKV A;  1RCJ A;  3UB5 P;  3AGF A;  4K0X A;  1CJF A;  2UWX A;  3PXP A;  1S67 L;  5EVI C;  1ES2 A;  1U60 A;  2FH5 A;  1GCE A;  3P09 A;  3E4Q A;  4OOM A;  4JLF A;  3A3D A;  1KVL A;  1LLB A;  2ZMA A;  4E3N A;  4FH2 A;  3BJN A;  4JXS A;  5J3W A;  1MWU A;  1P97 A;  3G32 A;  1I5Q A;  3UY6 A;  1ES5 A;  4F3L B;  1K57 C;  1N9N A;  3UNW A;  3T50 A;  3VMA A;  3A3E A;  4IBX A;  4DKI A;  3MF0 A;  4FUW A;  2JKR M;  3QP6 A;  3BLS A;  4G3K A;  3Q7V A;  3P98 A;  2Y2M A;  3LY4 A;  2PYP A;  4GDB A;  4XXR A;  3U2A A;  4KZ6 A;  3UDX A;  3DTM A;  3PBN A;  5LBR A;  5EOO A;  3QHY A;  3G30 A;  3DWK A;  2H0Y A;  3NIA A;  5CTM A;  1CF0 A;  2JE5 A;  4GOG A;  1CEF A;  3N4I A;  4EBP A;  3ZNT A;  4L0L A;  1C3B A;  1X0O A;  2QJ5 A;  4PAU A;  2G7U A;  4P85 A;  3U4L P;  3UPN A;  4OPZ A;  3T4J A;  2WYX A;  1KE0 A;  3LUQ A;  4R23 A;  4S2N A;  5HAQ A;  3OPR A;  1HZO A;  1T19 A;  3N8R A;  2ZLY A;  3BYD A;  1K6S A;  5FQJ A;  4EV4 A;  4O8G A;  1O7E A;  1T18 A;  4Y2F A;  2PR5 A;  1YMS A;  3C4O A;  1CI8 A;  1W5D A;  2R9W A;  3GMW A;  1KGF A;  4YWZ A;  3T1R A;  1YLP A;  3NCK A;  2RCX A;  2VLG A;  2Y2L A;  4C6Y A;  3IWI A;  5FQI A;  5DKK A;  3HLE A;  4X56 A;  1Y4O A;  4MN6 A;  5FA7 A;  1S4R A;  1YLY A;  3W8K A;  4CLC A;  3PBS A;  1XFN A;  3MR0 A;  1SDN A;  1MY8 A;  4LV1 A;  4GLQ A;  3I7J A;  2Y91 A;  3HUO A;  5M19 A;  2Y8H A;  5EVI A;  3IF6 A;  5F69 A;  5HAR A;  3BEB A;  3C4P A;  2Y2Q A;  1G28 A;  3EEH A;  4JF6 A;  2PBY A;  4FSF A;  1BT5 A;  1SCW A;  2V1B A;  2ZMV A;  2EX2 A;  4DN0 A;  4Y0T A;  5HWV A;  5AQB A;  2KDK A;  3C5A A;  2M7V A;  2ZC5 B;  5HD5 A;  3ITB A;  1LI9 A;  2Y4A A;  2XLN A;  4MN7 A;  3EGX C;  4GW9 A;  1XJ6 A;  4S2I A;  5KZH A;  2V0U A;  3AGD A;  1ERQ A;  3G35 A;  1K57 A;  1E3U A;  4F3L A;  1BZA A;  1BUE A;  1PZP A;  3BEC A;  4N1H A;  5KSC A;  2QPN A;  2EWV A;  4L9E A;  3W4Q A;  2WUQ A;  5FAT A;  2CMN A;  1TS8 A;  5FL3 A;  4IHQ A;  4K0W A;  2JHE A;  3ZG9 B;  4AFI A;  3PBQ A;  2BG1 A;  2H10 A;  2IWB A;  5GL9 A;  1K4F A;  3C7U A;  3PR6 A;  4R4R A;  4QB8 A;  5HWT A;  4MEZ A;  5DF7 A;  5C5K A;  4RX2 A;  4CJN A;  2VX8 A;  3UDI A;  1MWR A;  4I38 A;  2XR0 A;  3B47 A;  2OWH A;  5HL6 A;  1TDL A;  4N9L A;  3G4P A;  3K2N A;  1PRQ A;  4PM8 A;  1E25 A;  5E2F A;  2A24 B;  3N8S A;  4PM6 A;  3LR5 A;  3A3I A;  4EQ1 A;  2I72 A;  3LO7 A;  4Y15 A;  3PBO A;  2WZZ A;  5FQM A;  1KVM A;  4R3A A;  4JXV A;  2WGI A;  2P7J A;  2WGV A;  3MKE A;  4I5S A;  3IWQ A;  3NDG A;  5CEB A;  5HFO A;  2HGV A;  4XUZ A;  2JKR I;  1JNU A;  4R3B A;  3IHB A;  3S7Q A;  3D9Y A;  2EFX A;  3DWZ A;  1IYS A;  4GB7 A;  4OOY A;  3QP8 A;  2Q9M A;  2P04 A;  2WAD A;  5M1A A;  3IHA A;  3BFF A;  5CER A;  4O7D A;  1N4O A;  3OOV A;  2VGL M;  3WS0 A;  4DJ3 A;  4YOF A;  1LL5 A;  1ERM A;  2XF3 A;  4Y0O A;  3R4K A;  1H0M A;  1Z6F A;  2HF6 A;  5DKL A;  1XFQ A;  3TOI A;  4DDY A;  2R78 A;  3SZT A;  4S2L A;  5F82 A;  3F1P B;  1ZG6 A;  1T1B A;  3ZG8 B;  5HL1 A;  2P08 A;  1UWN X;  1FSW A;  1L0E A;  3H7W B;  2JKT I;  5HPI A;  4QHC A;  2ZC4 B;  4K91 A;  1OTI A;  1MWT A;  3NOU C;  3IH8 A;  1K55 C;  2WAE A;  1LL9 A;  3W2Z A;  5F1F A;  2OAP 1;  4UA9 A;  2P74 A;  3G2Y A;  4KQQ A;  1E3U D;  1L0D A;  3F1O B;  5AQ9 A;  3DW0 A;  5FAP A;  4OQ0 A;  3FPV A;  5CHM A;  4OQI A;  5F83 A;  3LGO A;  3ZG5 A;  4GDN A;  5JYP A;  4Z9Q A;  5FDH A;  4LEN A;  2A24 A;  1RP5 A;  1SKF A;  1NZU A;  3NBL A;  4HP9 A;  1K38 A;  1E4D A;  3FZC A;  3S7P A;  3CUE C;  1STZ A;  2I9V A;  4YFM A;  4I3I A;  2ZQ7 A;  3GDI A;  1NJ4 A;  1H8Z A;  1Y54 A;  3FG8 A;  2Y2P A;  3UN7 A;  1TD5 A;  3Q07 A;  4KEN B;  1HLU P;  1ACF A;  4Y13 A;  2XDM A;  4WL9 A;  4E3M A;  2Y2H A;  2A3U A;  1XPB A;  3QP4 A;  3MXR A;  4U0T A;  1MKI A;  1F2K A;  2ZC6 B;  4CPK A;  1H5X A;  4QY5 A;  5G4Z A;  5CX7 A;  1WA9 A;  2OOL A;  1TF1 A;  3A3F A;  5FQQ A;  5HDC A;  4KZ4 A;  4L9F A;  4H8R A;  5I5L A;  2AVX A;  3F1P A;  1OTE A;  1EI5 A;  4QJG A;  4WN5 A;  3HLW A;  4HJ6 A;  2EX8 A;  3H7W A;  3T4Q A;  1S1Z A;  1K55 A;  1DY6 A;  3A0S A;  1FIL A;  2W0N A;  3ICY A;  3UO9 A;  4EXO A;  5FSR A;  2D01 A;  3ITA A;  2ZC7 A;  1YSP A;  1F98 A;  3SS3 A;  5DTT A;  1D7E A;  4WLA A;  4E3K A;  1YLJ A;  3VFF A;  3NI9 A;  4B9O A;  4JGR A;  4XT2 B;  4EU0 A;  4JXW A;  2HP6 A;  2Z2M B;  4WEL A;  4RA7 A;  5DJT A;  5EOE A;  2K2N A;  2WKH A;  3G34 A;  4KZA A;  3SH9 A;  5CTN A;  3O87 A;  2ZL1 B;  2ZM0 A;  3F1O A;  4QD4 A;  3UB6 A;  2XA7 M;  2EWW A;  3FYZ A;  4PKY G;  3V67 A;  1M40 A;  3T4T A;  1BYW A;  4LV3 A;  3W4O A;  4PKY A;  4MDZ A;  2VEA A;  3CWF A;  1JWZ A;  4EQI A;  4BMW A;  2OSU A;  4B88 A;  2K31 A;  2JBF A;  2V2F F;  3HCY A;  5EFW A;  4OKP A;  3CUE A;  3LIA A;  4HHD A;  3OPP A;  1VET B;  4EET B;  2L4R A;  1W8Y A;  3QNB A;  3TJZ C;  2DRW A;  4NXE A;  1WE4 A;  4B93 A;  4ZJ3 A;  4FTX A;  5FEF A;  3UE1 A;  5L2F A;  2J7V A;  3L9K A;  2J3W A;  3CI6 A;  4ARZ B;  5FQK A;  4H6J B;  2HDS A;  3IF6 C;  1CEG A;  3S7O A;  4S2P A;  2QKP A;  3ULF A;  1J3W A;  4E3J A;  5DFY A;  3KSF A;  5G4Y A;  3MQ0 A;  2O0Y A;  2HJ9 C;  3BM6 A;  3BFG A;  2O9B A;  5HWW A;  3E2L A;  5GHY A;  5A8B A;  2EX6 A;  4S2J A;  2XK1 A;  3CJM A;  2CC1 A;  4Y5F A;  3MQO A;  4FD8 A;  4DDS A;  4GCZ A;  3CZD A;  2ZOI A;  3GR2 A;  4Y17 A;  3P01 A;  3ZDJ A;  1FR6 A;  4QPR A;  2L1M A;  2VGK A;  3B33 A;  4HNB A;  5IT5 A;  4IJG A;  5HW3 A;  3N8L A;  2FFY A;  1LSW A;  3UPP A;  2B02 A;  2HZ5 A;  1M6K A;  1NYM A;  3OC2 A;  4XT2 A;  3VOY A;  2IWC A;  4HES A;  5E43 A;  2W1T B;  1W63 M;  2ZL1 A;  4KQR A;  3BFC A;  3MZE A;  1DP9 A;  2OAQ 1;  1GHI A;  2Q0O A;  3UB7 A;  4KZ7 A;  2WKE A;  2V1Z A;  2KOI A;  3O3V A;  5HAI A;  4D60 A;  4EBN A;  3ZVT A; 
#chains in the Genus database with same CATH homology
 2A24 B;  1MKM A;  2Z6C A;  1NLY A;  2QJ7 A;  2V0W A;  1GSW A;  3LR5 A;  4EQ1 A;  2J80 A;  3PHY A;  3EGD C;  1OJG A;  3FPW A;  2M1C A;  3PBO A;  4O01 A;  5TJJ A;  4R3A A;  2A2L A;  3NJA A;  2VJW A;  2PR6 A;  4JGO A;  2P7J A;  3C8C A;  5DF9 A;  4I5S A;  3IBR A;  1DP8 A;  2HGV A;  2BAS A;  2JKR I;  4MCW A;  1JNU A;  1IOU A;  3S7Q A;  3BY8 A;  2VA0 A;  2XRO A;  1TS0 A;  3SW1 A;  1LSV A;  2GJ3 A;  2QHK A;  2XA7 S;  2P04 A;  4MN5 A;  4ZRR A;  5AJG A;  3PYP A;  1YKD A;  4ARZ A;  4BWI A;  5HD3 A;  3VOL A;  4H6J A;  2DMW A;  3E0Y A;  3LID A;  3LIC A;  3OOV A;  3LFV A;  3PBR A;  2VGL M;  3NOT C;  4LRY C;  3S7N A;  5L8M A;  4DJ3 A;  2WKR A;  2Z6D A;  3KSH A;  4YOF A;  4ETZ A;  4Q0I A;  2QYB A;  4I3J A;  2JN7 A;  4EUV A;  2HJE A;  3LYX A;  3OLO A;  3UME A;  5J7E A;  3R4K A;  1N9O A;  5DJU A;  2HF6 A;  3KSI A;  5DKL A;  2LB5 A;  2V1A A;  1XFQ A;  2R78 A;  4HH3 A;  4G3W A;  3F1P B;  3EOI A;  1GSV A;  4JGQ A;  2VV8 A;  3D3O A;  1TS6 A;  1T1B A;  3G6O A;  1OTB A;  3BQA A;  2P08 A;  1UWN X;  1V9Z A;  1LL8 A;  1S4S A;  3H7W B;  2OWJ A;  2JKT I;  1OPX A;  5F5Y A;  4Y3I A;  5HPI A;  3A0R A;  1NRJ A;  4L9G A;  3TW8 A;  4FOF A;  2J3T C;  2VV6 A;  3BWL A;  3MXQ A;  4G3V A;  4HJ3 A;  3C2W A;  2ZOH A;  1OTI A;  3OBF A;  3LI9 A;  1KOU A;  3C38 A;  3NOU C;  4II7 A;  1D06 A;  3MFX A;  2VKS A;  2KX6 A;  4CLC E;  3IS2 B;  3BQ8 A;  2YKH A;  3H9W A;  3W2Z A;  4NXB A;  2OAP 1;  3PBT A;  1N9L A;  1XJ2 A;  2GZA A;  3EQU A;  4Q0J A;  4BBT A;  3FC7 A;  3CIT A;  5IS1 A;  2K7S A;  3E4O A;  1S66 L;  1V9Y A;  1T1C A;  2V9A A;  1W63 Q;  3F1O B;  4NEE D;  2M7U A;  2W1T A;  3FPV A;  2PD7 A;  2VV7 A;  1F5M A;  4KUK A;  4LPZ A;  2O99 A;  1P0Z A;  1VHM A;  2W3D A;  3F1N B;  4Z1W A;  2HV1 A;  3MMH A;  4UQI M;  5K5B A;  2QWS A;  2PD8 A;  4GJ4 A;  3GEC A;  2ZMF A;  4GS9 A;  3VE4 A;  3KX0 X;  4GHI A;  4KUO A;  3UB9 A;  4YNR A;  4Q0H A;  3K3D A;  2A24 A;  2PDR A;  3ZQ5 A;  3E4P A;  5HSQ A;  2PT7 A;  4HOI A;  5DFX A;  4P6Z S;  4HP9 A;  4HQA A;  3B42 A;  3NOP C;  4R38 A;  3S7P A;  3CUE C;  1NLZ A;  1STZ A;  2JKT M;  2I9V A;  4OOL A;  1GSX A;  4I3A A;  4I3I A;  1YSQ A;  1LT0 A;  4CLC B;  3GDI A;  5F6A A;  2NUT C;  4HI4 A;  3FG8 A;  2PYR A;  1TD5 A;  3LR4 A;  4CLC C;  5AVF A;  4LRX C;  1F9I A;  3H82 B;  3CLO A;  1OJ5 A;  4WL9 A;  3KSG A;  3UB8 A;  5F68 A;  3LI8 A;  2H28 A;  3DBA A;  3NHQ A;  3PXP A;  1S67 L;  4HY8 A;  5AVE A;  2FH5 A;  5HPF A;  3E4Q A;  5G4Z A;  4OOM A;  3K3C A;  3R7W B;  3T4L A;  5CX7 A;  1WA9 A;  2OOL A;  1TF1 A;  2EA9 A;  3T4K A;  1H3Q A;  4IUH A;  3A0V A;  3BJN A;  2GNX A;  4UEY A;  5J3W A;  5HDC A;  4HH2 A;  4L9F A;  5KSH A;  5I5L A;  3MJQ A;  3F1P A;  1P9R A;  2WKQ A;  2W27 A;  1MC0 A;  1P97 A;  1OTE A;  2Y79 A;  2W3F A;  1XJ3 A;  4WN5 A;  4HJ6 A;  4F3L B;  1XJ4 A;  2ZBB A;  3H7W A;  3T4Q A;  1H8M A;  3EEA A;  5MC7 A;  3D72 A;  1N9N A;  1S1Z A;  1Y28 A;  3T50 A;  4O0P A;  3JVU A;  3MF0 A;  4WEK A;  2JKR M;  3A0S A;  2W0N A;  4G3K A;  3ICY A;  2W3H A;  2VGL S;  4EXO A;  2PYP A;  5TBM B;  2D01 A;  2PHY A;  3U2A A;  2VZW A;  3IS2 A;  3PBN A;  5LBR A;  1YSP A;  4IUK A;  1F98 A;  1D7E A;  4WLA A;  3TRC A;  4EES A;  1MZU A;  3BW6 A;  1EW0 A;  4M4X A;  4PHT A;  4B9O A;  4JGR A;  4XT2 B;  4EU0 A;  4L0L A;  4WEL A;  5DJT A;  1X0O A;  2QJ5 A;  4PAU A;  2G7U A;  2K2N A;  4I39 A;  2XSS A;  3UB6 A;  3T4J A;  3F1O A;  4MMN A;  1VB6 A;  3LUQ A;  2XA7 M;  2EWW A;  3V67 A;  2J3T D;  1TS7 A;  2O9A A;  4PKY G;  3T4T A;  1BYW A;  1DRM A;  1T19 A;  4PKY A;  3BY9 A;  4ME4 A;  3F1N A;  4MDZ A;  1OT9 A;  2VEA A;  4O8G A;  1OT6 A;  1T18 A;  3CWF A;  4Y2F A;  2PR5 A;  3IBJ A;  3VE3 A;  5HDS A;  4YWZ A;  3KYZ A;  1T1A A;  4NKP A;  4BMW A;  5J4E A;  3LIE A;  5HZH A;  2VLG A;  1UWP X;  2K31 A;  3HCY A;  5EFW A;  3CUE A;  3O5Y A;  3KO6 A;  5DKK A;  3KYQ A;  3LIA A;  4HHD A;  3LIB A;  5KIZ A;  4KQO A;  3C30 A;  4HJ4 A;  4MN6 A;  4EET B;  1YAX A;  2L4R A;  1S4R A;  2LB9 A;  4EEU A;  1NWZ A;  2W1R A;  3UE3 A;  4CLC A;  3TJZ C;  3PBS A;  1XFN A;  4JGP A;  3EQV A;  4NXE A;  1LSX A;  3MR0 A;  1ODV A;  3MQQ A;  3UE6 A;  4B93 A;  2L0W A;  2W3G A;  3E98 A;  3TE8 A;  4BJP A;  4GLQ A;  2O9C A;  3H82 A;  2J3W A;  3CI6 A;  4ARZ B;  4RQ9 A;  2W3E A;  1UGU A;  2Y8H A;  4WUJ A;  4H6J B;  4BBV A;  1ZTU A;  2B18 A;  2FZ0 A;  5F69 A;  3S7O A;  3UMD A;  4UQI S;  3CAX A;  1G28 A;  3OCN A;  3EEH A;  4DJ2 A;  1P9W A;  4HP4 A;  2QKP A;  4WF0 A;  3ULF A;  3RH8 B;  1ZHH B;  4FSF A;  3RTY A;  2V1B A;  2ZMV A;  5DFY A;  4LLO B;  4DN0 A;  3T4S A;  3KSF A;  1IFQ A;  2MJ6 A;  4LRZ E;  3R7W A;  5G4Y A;  5HWV A;  3MQ0 A;  2O0Y A;  2KDK A;  2M7V A;  4CLC D;  5HD5 A;  2IA2 A;  5HDD A;  2HJ9 C;  1S1Y A;  5IU1 A;  4WEJ A;  4MN7 A;  3EGX C;  4NXG A;  4EEP A;  4GW9 A;  1XJ6 A;  2V0U A;  2O9B A;  2NUP C;  5HWW A;  3P7N A;  5A8B A;  3HJI A;  3LIF A;  4Y5F A;  4F3L A;  3MQO A;  4EW7 A;  4CQH A;  4GCZ A;  4EER A;  1G6O A;  3RFB A;  2ZOI A;  4KQD A;  4ETX A;  3P01 A;  2EWV A;  4L9E A;  3JVV A;  5TBM A;  2WKP A;  4P6Z M;  1OTA A;  1DP6 A;  4QPR A;  2L1M A;  4R6L A;  3B33 A;  2CMN A;  4HNB A;  2KLI A;  4IJG A;  1TS8 A;  5IT5 A;  5FL3 A;  4K08 A;  4IHQ A;  2JHE A;  4AFI A;  1LSW A;  4BBU A;  2GX5 A;  2B02 A;  3PBQ A;  3OCL A;  4E04 A;  3OC2 A;  4XT2 A;  4R70 A;  2XRN A;  2W1T B;  1W63 M;  3PR6 A;  3VV4 A;  3HJK A;  5HWT A;  1OTD A;  2D02 A;  4HIA A;  1DP9 A;  5C5K A;  2VX8 A;  2OAQ 1;  2YKF A;  3ZYT A;  3UB7 A;  4I38 A;  3B47 A;  3LR3 A;  3T4O A;  2INW A;  2OWH A;  3LR0 A;  4DMZ A;  3EWK A;  4GS9 B;  4NXF A;  5HL6 A;  2KOI A;  3K2N A;  4GHI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...