2QJ5A

Pyp ultra-high resolution of a bacterial photoreceptor
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
121
Chain Sequence
HVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Picometer-scale conformational heterogeneity separates functional from nonfunctional States of a photoreceptor protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
total genus 34
structure length 121
sequence length 123
ec nomenclature
pdb deposition date 2007-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2qj5A00
2Z6CA 4EXOA 2Z6DA 4I38A 3CLOA 4PKYA 5DKLA 1T1BA 2I9VA 4HJ6A 4F3LB 3UE6A 1OT9A 4BBTA 3BY9A 3H82B 1OTDA 3NHQA 2V1BA 4HP4A 4R6LA 4K08A 3LI8A 2QJ7A 4YWZA 2PD8A 4HJ4A 3D72A 1N9OA 4MN5A 5HD3A 3F1PB 3GDIA 4KUOA 1F98A 2J80A 3C8CA 3IBRA 5DJTA 3CAXA 1P0ZA 1LSXA 4JGRA 5AVFA 4EESA 5F6AA 3H7WB 2PR6A 4NXEA 4EW7A 4HP9A 1WA9A 1XJ2A 1NWZA 1ODVA 3E4QA 2OWHA 2PD7A 2QKPA 4GHIA 4HQAA 4RQ9A 4XT2A 4EETB 4LRZE 2JN7A 3FC7A 2V1AA 4JGPA 1N9NA 3A0VA 3ULFA 5J4EA 2WKRA 2K7SA 3RH8B 1LSVA 1T1AA 4LLOB 1TS8A 1DP6A 1V9ZA 4EEUA 4XT2B 1OT6A 2M1CA 2R78A 3F1OA 2VV6A 2KDKA 5F5YA 4DJ2A 2VLGA 4I3IA 4R70A 5J7EA 4WN5A 5EFWA 4F3LA 5F69A 2PDRA 1S1YA 2D01A 3E4PA 1MZUA 3K3DA 3CWFA 3NOTC 1JNUA 2PYRA 2WKQA 3LUQA 3NOUC 3UB9A 1UGUA 4DJ3A 1BYWA 1TS0A 2BASA 3ZQ5A 1KOUA 3G6OA 4PKYG 2D02A 1OTBA 2VEAA 1GSWA 3A0SA 3A0RA 3B33A 4KQDA 1OJ5A 2YKFA 3BY8A 4L9EA 4GHIB 4LPZA 1T19A 2OOLA 4WUJA 3F1NA 3PHYA 4WF0A 1XFQA 3H7WA 1DP9A 2OWJA 2PHYA 2A24B 2L4RA 3BWLA 3F1NB 3ICYA 4HH2A 4L9GA 4NXBA 3SW1A 1S67L 3IS2A 3P7NA 2W0NA 3T50A 2V9AA 4R38A 4B9OA 2B02A 2WKPA 3LIAA 4HJ3A 2H28A 4WL9A 5AVEA 3GECA 1D06A 3VOLA 1S1ZA 2VV7A 1DRMA 1OTAA 2HV1A 2VV8A 1S4SA 4GS9B 4HHDA 4HOIA 3K3CA 1GSXA 3RTYA 3UMDA 2GJ3A 4NXFA 1N9LA 4BBVA 1XJ4A 1UWPX 3OLOA 4HI4A 5A8BA 3EWKA 2QHKA 3NOPC 1X0OA 4I3AA 4EQ1A 1V9YA 1DP8A 2QWSA 3MJQA 4GS9A 5DKKA 1UWNX 5HDSA 2W27A 3MQQA 5TBMA 4EEPA 3F1PA 3HJIA 3UB8A 1LL8A 1VB6A 4HY8A 3UB6A 1P97A 3MXQA 3LIDA 2V0WA 1LT0A 4M4XA 5TBMB 3UB7A 5HD5A 3EEHA 5HZHA 5IS1A 1TS6A 3H82A 3MFXA 2L0WA 4GCZA 3VE4A 3KX0X 4I3JA 1F9IA 1TS7A 3H9WA 5G4ZA 1S4RA 1XFNA 4L9FA 5I5LA 4EERA 1D7EA 5HDCA 3LIBA 4E04A 2JHEA 2V0UA 4HH3A 3NJAA 4MN6A 1LSWA 1OTEA 2KX6A 2YKHA 5J3WA 1G28A 5HSQA 4HIAA 3C2WA 4JGQA 4LRXC 2ZBBA 1OJGA 1Y28A 2L1MA 4H6JA 4R3AA 3MQOA 2QJ5A 1OTIA 2ZOIA 3LICA 3FG8A 3MR0A 5F68A 1S66L 3LIFA 3UMEA 2CMNA 1XJ6A 3LI9A 3PYPA 2P7JA 5HWVA 4NXGA 1EW0A 4I39A 4I5SA 4BBUA 5HWWA 3IS2B 3LYXA 4LRYC 1GSVA 2A24A 2INWA 4WLAA 3VE3A 4KUKA 4H6JB 1XJ3A 4JGOA 2PYPA 3HJKA 1T18A 4HNBA 1T1CA 5HDDA 2PR5A 3F1OB 3LIEA 2ZOHA 5KIZA 5IU1A 5DJUA 5G4YA 3E4OA 2EA9A 5HWTA 4GW9A
chains in the Genus database with same CATH superfamily
1K4EA 1MBLA 2EWWA 4EQIA 2XQZA 3MQ0A 4K08A 2ACGA 5GLCA 1H3QA 3IXDA 4YFMA 1K4FA 2ZC4B 4NXEA 2PR6A 4EETB 2V20A 2JN7A 4JPMA 4OQIA 5D3OA 4S2LA 2ZL1B 4EEUA 1OT6A 3F1OA 4N9LA 2M7UA 4ETXA 3ITBA 5L2FA 4NK3A 3EQVA 4Q0HA 4HH2A 2B95A 1BT5A 3P7NA 2Y91A 3T1QB 3GECA 1Q2QA 1S4SA 3MS6A 3S1YA 1BZAA 3NOPC 1W79A 1X0OA 2NUPC 4KZ7A 4HY8A 1PI5A 3N6IA 2V0WA 4K0XA 5CHJA 3GRJA 3T4KA 1BLPA 3IWOA 4K91A 1FCMA 2GZAA 5AQBA 4MLLA 1W63M 3GR2A 1OJGA 2WKHA 4C3QA 1EI5A 4GD8A 2HPBA 2XDMA 5HWVA 1BSGA 3DWKA 3IS2B 2R9WA 3MKEA 1W5DA 1JVJA 1ES3A 3SZTA 4Q0IA 3E4OA 3CUEA 3CLOA 2PT7A 3G31A 1YSPA 3UB5P 1TEMA 3TE8A 5EM1A 2WGVA 4UEYA 2ZQAA 2PD8A 2OLUA 1KDSA 3A3DA 2KLIA 3OPRA 3CAXA 1FQGA 3OCNA 2K7SA 2DCFA 1T1AA 3RH8B 3S4XA 4BLMA 5FEFA 2XF3A 2X71A 3ZFZA 4KZ8A 2P08A 3HLFA 1PWDA 4BL2A 1HTZA 2JBFA 4PM8A 4WBGA 3EOIA 4WYYA 4HOIA 3K3CA 2GJ3A 4O01A 5FQMA 1HVBA 5FATA 3KSGA 3TOIA 1MKIA 3P01A 4P87A 4X1LA 4BWIA 1VB6A 3HLBA 5FQ9A 1K25A 2ZMFA 1ZTUA 3IXBA 1YAXA 3FV7A 3KX0X 3N8RA 4I3JA 3BJNA 4Q0JA 1S4RA 1LSWA 3PBTA 2W1TB 4BD1A 1W63Q 4Y7PA 3MZEA 1Y28A 4KZAA 2L1MA 1PNEA 3LICA 3V67A 3VSKA 3UMEA 3LR3A 3TW8A 2XROA 3LGOA 3B3XA 3LYXA 3MMHA 4KUKA 3U2AA 4JGOA 4BQMA 3UPOA 3HLCA 1NXYA 4Q8IA 4IVKA 2Y2MA 1CF0A 5EM0A 5AQ7A 1RGZA 4UHUA 3D3OA 1N9BA 4XUZA 3HLGA 4OQHA 4CLCC 4LV2A 1YM1A 1L0FA 5EVIC 1L0DA 1WYBA 1NWZA 2G7UA 2W3GA 4RQ9A 4QY6A 4YOFA 4DDSA 2J8YA 3LUQA 5FAOA 3E2KA 3KSFA 4QJGA 5MC7A 4GHIB 4OONA 1T19A 1XKZA 4LV3A 5G4ZA 2A49A 2OWJA 3M6BA 2W1TA 4HBTA 4EWFA 5TR7A 1OTAA 1TVFA 3EEAA 3JVVA 2FFFB 4S2PA 3VOYA 3W8KA 3OLOA 4JXWA 2QWSA 1GA9A 3HJIA 4BENA 4OP5A 1NLZA 4NKPA 2M7VA 3WS0A 5HD5A 4OQGA 2JC7A 3WRTA 4II7A 5EVIB 1M40A 1CEGA 4DDYA 4R3BA 1YQSA 4JF4A 4QPRA 5FAPA 2X02A 5F68A 1G6OA 1YMSA 1YLPA 5GHXA 1T18A 2IWDA 3R7WB 4LGWA 3CUEC 1VETA 2W3FA 3Q1FA 1T1BA 3BY9A 4YWZA 2HP5A 3RFBA 1MPLA 1O07A 3C8CA 4CLCA 1XJ2A 3OPPA 3JVUA 3ISGA 4GN2A 1MWSA 3BFCA 3MXSA 4P6BA 4XT2B 4R70A 3E4PA 1JNUA 3UB9A 1UGUA 3VP1A 3MXRA 3DTMA 1OJ5A 4QD4A 3UPNA 3QP6A 3BFDA 4NXBA 5KSHA 3BYDA 3ZYTA 4M3KA 4FOFA 5FAQA 3RXXA 4ETZA 4Y0TA 2HDUA 1DJCA 2HV1A 5HL6A 3U4LP 2WGWA 4Z1WA 1H0MA 3ZG0A 4EEPA 4U0XA 1BTLA 1XPBA 2GX5A 5GLBA 3UDIA 4Y3IA 1NRFA 2V0UA 2ZMAA 3DBAA 1KDWA 4WZ5A 1IYPA 2ZBBA 1IYOA 3IX4A 3WWXA 4OPZA 4BL3A 3T4SA 3ZVWA 4B88A 4ARZA 4ZBEA 1KVLA 3V39A 2WZZA 3NY4A 4GB7A 3I7JA 2ZC3B 5A91A 1OPXA 4OLGA 4Y0UA 4DE2A 5E2EA 1FSYA 3KYZA 3CPTA 2V8CA 3GMWA 4JXSA 5DKLA 5EE8A 4BJPA 4HJ6A 3UE6A 1K57C 1S0WA 4ZTKA 1LLBA 3W4QA 1Y4OA 3V3SA 3F1PB 2ZC7A 3LEQA 4JKTA 3IBRA 3IX8A 3ZGAB 1EWZA 3OZHA 4E3NA 2OWHA 2IWCA 3C4OA 2C6WB 4GDBA 1N9NA 5HAIA 4LCMA 3PBQA 4LCLA 3BLMA 5BOHA 3QP2A 2JKRM 1CJFA 5CTNA 2C5WB 2PYRA 3T4OA 1IOUA 1ZKJA 3A0SA 3BY8A 1K38A 1PRQA 2PHYA 3C5AA 5FSRA 3KO6A 5EVLA 5EVIA 2O99A 5CTMA 2JKRI 4ZJ1A 2VGJA 2QHKA 1F5MA 1BLCA 1KGFA 3PBSA 3O87A 1PWGA 4X56A 2EX2A 3UB6A 4PM7A 3UB7A 3BQ8A 3ZG8B 3BFFA 1NLYA 1TS6A 3H82A 2V1ZA 1YPRA 1KGGA 1CI8A 5FI6A 1JWVA 4HH3A 4WEJA 1FCNA 3SS3A 1E25A 1SKFA 4IUKA 3IF6B 4N1XA 1OTIA 5FQKA 1L2SA 1YLZA 1GHIA 3T1RA 2EFXA 2HF6A 3E0YA 4R4SA 2OAQ1 3FWLA 1IEMA 2EA9A 4I38A 4OVDA 5HX9A 1O7EA 3PXPA 5KZHA 2V1BA 3A3EA 5M1AA 4JXGA 3CPTB 4CQHA 2Z2MB 1HZOA 4H8RA 2FFYA 3T12B 5DF9A 4E6XA 2QKPA 3VP4A 4E3MA 4HEFA 4U0TA 5CGSA 1L0EA 1QMEA 2VGLM 3SH7A 2V2FF 1ES2A 4ZDXA 3G6OA 1TDGA 2D02A 1OTBA 2Y79A 1MC0A 3ICYA 4HJ3A 4WL9A 4B4ZA 3VOLA 1Z09A 1YLJA 4IBXA 1YSQA 2QYBA 3DTEA 4GLQA 5IS1A 3FKVA 2Y59A 1F9IA 1NJ4A 3C38A 5M19A 1XFNA 2OSUA 4EERA 1PYYA 5DFXA 3G2YA 4JGQA 3SH8A 1SDNA 3IH8A 3DTIA 5M18A 3MR0A 1K54C 4IHQA 4I39A 2H10A 1GSVA 1P9RA 4ZJ3A 4GW9A 3UE3A 4HBUA 4R6LA 1W8QA 3LI8A 4WZ5C 2O9BA 3KSIA 1FR1A 5AVFA 1E4DA 1JWPA 2WAEA 1WA9A 4S2OA 3HLEA 1YKDA 3FC7A 2WGIA 2P04A 5FQJA 4MCWA 5E2GA 3RXWA 1V9ZA 1VQQA 2QPNA 2M1CA 2H5SA 5F69A 3K3DA 1WYCA 1TS0A 4KZ9A 4GZBA 3MZFA 1VEUA 3B33A 3ZNYA 5HFOA 2EFUA 5EUAA 2JKFA 4MN7A 2H28A 5AVEA 4S2JA 4PM9A 3C4PA 3VP2A 4UQIM 1L3LA 3R7WA 3WS2A 4NXFA 4MBKA 3TJZC 3EWKA 1V9YA 5TBMA 3MQQA 4Y17A 2ZL1A 1SZVA 5FL3A 1M6KA 3QP8A 1N4OA 2RCXA 2XGNA 5EVID 5GHZA 4B93A 5DVAA 1EROA 2Y2OA 4UA6A 2XRNA 3D9YA 3IXGA 3HUNA 3HREA 1KE0A 4AFIA 1ESIA 2PBDP 5L09A 4I5SA 2FH5A 3FPWA 2IWBA 1K54A 4EUZA 1XJ3A 2PYPA 1T1CA 2PR5A 2ZOHA 1MWRA 4MDZA 2PBYA 4PKYA 2ZQ7A 4CLCB 2ZJ9A 3B47A 4WMCD 3IQAA 3LFVA 1F98A 3P09A 1MY8A 4JGRA 1SKOB 2DMWA 5LBRA 4E6WA 5JYPA 1KE3A 1AWIA 4ME4A 2KDKA 1BLHA 5F83A 4KQDA 2D01A 1ACFA 1MZUA 3BFEA 3NOUC 3SOIA 4DF6A 3IHAA 3HLWA 1F2KA 1LI0A 4GJ4A 2YKFA 5G18A 2J9OA 2EXAA 1DP9A 3F1NB 4NEED 2A24B 2WGWB 1LHYA 4P6ZM 4P85A 4QHCA 2WKPA 2VKSA 2VV7A 3S7OA 3HCYA 3JPUA 3ZNTA 5HPIA 1ERQA 1GCEA 1DP8A 5J8XA 3MJQA 5HDSA 2RL3A 3JYIA 5AJGA 3IWQA 2EX6A 5HZHA 3MFXA 1ZHHB 3IH9A 4FH4A 2Y2QA 3KYEA 3HL9A 5I5LA 3NC8A 5HDCA 2VK3A 1KE4A 2QMIA 2MJ6A 1IKIA 3IBJA 2BTFP 1SCWA 4LRXC 4R0QA 4H6JA 2P9VA 3NDEA 3PAEA 1RP5A 1XA1A 1AXBA 3CI6A 3FPVA 3W4PA 3NBLA 1NZOA 1PW1A 1G6AA 4RVAA 3LIEA 1BUEA 4ARZB 2Z6CA 2ZM2A 3CMZA 3LEZA 4R1GA 5DF8A 4PMAA 1YLWA 2HDRA 1IKGA 1DY6A 1GHPA 4N92A 2Y2HA 3M6HA 1LSXA 1TF1A 1SKOA 4HP9A 4HQAA 3TSGA 2Y2IA 3ULFA 5FDSA 3A0VA 5J4EA 5A93A 4G3WA 1XGIA 1TS8A 3S7PA 3LR4A 5E2FA 2VLGA 4X69A 2LB9A 4L0LA 2WK0A 1BYWA 4QY5A 1KOUA 2P74A 3BFGA 2VEAA 3NCKA 1I2WA 3VFHA 4L9GA 2W3HA 5E43A 3OOVA 4FH2A 2B5RA 3C30A 3QP4A 3UE1A 3UO9A 2VJWA 5CX7A 1CEFA 5CRFA 4EU0A 5FQQA 5EECA 5GHYA 1LL8A 5A90A 1BLSA 3LIDA 3MF0A 3AGDA 1YMXA 4DXCA 4WZ4A 2ZC6B 3NULA 4GCZA 1TS7A 1D7EA 2J9PA 3Q7VA 3ZG9B 1TDLA 4KQOA 1OTEA 3IXHA 5GL9A 5DTTA 2ZOIA 2G2WA 5F1GA 3FG8A 5DTSA 3IF5A 4GOGA 2V8FA 1Q2PA 4PM5A 2INWA 4H6JB 3TRCA 2NUTC 1MKMA 1ZC2A 3MBZA 4S2MA 3HUMA 5AQ9A 4BBTA 3FYZA 1LL5A 2QJ7A 4MBFA 3GDIA 1ES4A 1LI9A 1ONHA 4QB8A 5HW3A 3ZG5A 2PD7A 3G30A 5TGFA 2WKRA 4DE0A 3UY6A 1LSVA 3G2ZA 1A0KA 2R78A 2XLNA 5HL1A 4I3IA 1H8MA 2ZC5B 1E3UD 1D1JA 1FILA 3OPLA 3QP5A 1GSWA 2XA7M 4X53A 2OOLA 2HP6A 3UN7A 3PHYA 4KZ3A 2V9AA 4RYEA 2AVXA 1K57A 1S1ZA 4K0WA 3IWIA 4GS9B 3PAGA 2WYXA 1JTGA 1UWPX 1MWTA 1RCJA 4Y5FA 5EVEA 3EEHA 2DRWA 5GLAA 4D2OA 3PBRA 2KOIA 4ZJ2A 5CGWA 4L9FA 4XUXA 4KZ6A 3DTKA 2KX6A 4DRTA 4KG2A 3N8SA 3PBNA 3NIAA 4QU3A 4XXRA 2UV0E 2J3WA 5C5KA 4JLFA 5IHVA 4E3OA 1OMEA 3N8LA 2R9XA 3HJKA 2ZMVA 4G3VA 3SH9A 2Y55A 1BULA 1GA0A 2OAP1 2Z6DA 2ZM8A 5I94A 1I5QA 1OT9A 3NHQA 3ZG7B 4R3JA 3QHYA 1N9OA 5HD3A 3OC2A 4LV1A 4EESA 4EW7A 4Y0OA 5FQIA 2FZ0A 1L0GA 1RGYA 3K2NA 3GQZA 2I72A 4IBRA 4RX2A 4WN5A 3KSHA 3P98A 3NOTC 1KGEA 5DF7A 4Z9QA 3A0RA 4OOMA 4DXBA 4A5RA 3F1NA 2P9VB 2L4RA 3BWLA 3NI9A 3Q81A 2XEPA 3R4KA 2W0NA 3T50A 2JE5A 3GV9A 2VV8A 3UMDA 2ZD8A 3RTYA 3PTEA 2W3DA 3O3VA 1J3WA 5A92A 4I3AA 4E3LA 3L7HA 4X6TA 2BLSA 4M4XA 1QMFA 2O0YA 2H0YA 3M2JA 2A3UA 2HJ9C 3PR6A 1G68A 2Y4AA 2W3EA 3VOZA 1K55A 2Q9MA 2PRFA 3T1SA 1U60A 4N1HA 4KZ5A 4OPQA 3O88A 4JBFA 2VGKA 3LIFA 3VFFA 3LI9A 2P7JA 4WMCA 2K31A 3LO7A 5GLDA 5FASA 5CEDA 2ZQCA 1ES5A 4BD0A 3T4JA 2ZM0A 4EXOA 2HGVA 2I9VA 2CC1A 3FKWA 4Y15A 1VHMA 1YLYA 3LR5A 4KENB 1PI4A 4D60A 1I2SA 4X55A 1CK3A 1P0ZA 3CHWP 3W2ZA 1K6SA 3BM6A 3T1XA 2O9AA 4E3IA 2WAFA 3MFDA 4QWOA 4EUVA 2HZ5A 4UAAA 3BRMA 1IYQA 2WKQA 3VMAA 3ZQ5A 3T4QA 3CG5A 2JKGA 1NYMA 1ESUA 4LPZA 4MNRA 1JWZA 4DE3A 3DW0A 3H7WA 4E3JA 3V3RA 2XFSA 3HUOA 3WRZA 4OP8A 4BBVA 5CERA 2E8JA 4HI4A 4E3KA 1UWNX 5L07A 2ZQ8A 3CITA 3O5YA 3BECA 1FCOA 1PZPA 5AQAA 5FA7A 1LT0A 5TBMB 4KZBA 5FI7A 5HARA 4KZ4A 3VE4A 5CXWA 3MSHA 5HPFA 1STZA 3A3JA 1ALQA 4CLCD 2EX9A 1NYYA 5L10A 2YKHA 5EV0A 3ZCZA 4MEZA 4N9KA 1K55C 4X1MA 4R3AA 3MQOA 1VETB 1HD8A 5FEGA 1S66L 2CMNA 1FOFA 3IF6C 3VP0A 3PYPA 5HWWA 3KYQA 1YLTA 4KG5A 2VX8A 3VP3A 5TJJA 5KIZA 3BQAA 4S2NC 3ITAA 1ONGA 2XK1A 4U3TA 3Q82A 3QNBA 2OV5A 1FIKA 4UQIS 4CLCE 1P9WA 2J80A 5DJTA 4MBHA 2ZLYA 3H7WB 3LCEA 4PAUA 1ODVA 1YT4A 1VM1A 1C3BA 2WKEA 3E98A 5F5YA 4CPKA 5J7EA 3Q07A 2Q0OA 4R4RA 1S1YA 3VSLA 3Q7ZA 4RA7A 2VZWA 3EQUA 4PPRA 4NG2A 4WUJA 2XA7S 4F3LB 3C7VA 5KMWA 3NECA 3S22A 2WADA 2WKIA 4R38A 3D4FA 2XSSA 4YINA 2PU4A 4HHDA 3BLSA 5U47A 4FCFA 5CECA 3F1PA 3Q7VB 2PU2A 5HAPA 1DJBA 2E8IA 2VA0A 2JKTI 4E04A 4MN6A 4KQQA 2OLVA 1G28A 4HIAA 1SDEA 2QJ5A 3G34A 2B18A 3SS5A 2J7VA 3CJMA 2IA2A 4CJNA 1EW0A 4BBUA 5JYOA 3DWZA 1XGJA 5G4YA 4UA9A 2Y2GA 3BEBA 1H8YA 5HWTA 4LV0A 4WELA 4MMNA 1KVMA 3E2LA 3CZDA 4S2NA 2Y8HA 3V50A 1E3UA 4HESA 1PFLA 3VV4A 4OLDA 3C7UA 3V5MA 4OPRA 4RX3A 3L9KA 1XX2A 5F6AA 3E4QA 3LY4A 2V1AA 4P0MA 4GDNA 2HDSA 2O9CA 3W4OA 1NZUA 3IHBA 5EFWA 2PDRA 4X68A 3UDXA 2QZ6A 1XXMA 4IVIA 3GSGA 4C75A 4WF0A 1XA7A 1XFQA 4JF6A 1S67L 3G35A 4FSFA 3N4IA 4S2IA 4DN0A 3HBRA 4B4XA 1JTDA 2LB5A 4ESPA 1GSXA 4R23A 2XD1A 1Z6FA 1XJ4A 4EQ1A 5DKKA 1K56A 3UB8A 1H5XA 1HLUP 5K5BA 2VGLS 4OQ0A 2WZXA 3ZHHA 3EGXC 3M2KA 4UA7A 3LR0A 4ZAMA 4YNRA 1PWCA 3PBOA 4FUWA 2JCHA 3QP1A 1TD5A 1NRJA 2BG1A 1PIOA 3IX3A 3T4TA 5CHMA 3GTCA 1XP4A 2HP9A 5EOOA 4DKIA 2G2UA 4HNBA 5HDDA 3WS4A 4X25A 4Y2FA 2XR0A 4FD8A 3H82B 3OCLA 1ZG4A 4HP4A 1J9MA 4OOYA 4HJ4A 3D72A 3A3IA 3IF6A 2XH9A 1S6RA 4XT2A 2Z2LB 3G4PA 4LENA 4KG6A 1G5UA 1K6RA 4DJ2A 3HLDA 2VV6A 5EOEA 5E2HA 2J3TC 5IT5A 4KQRA 2Y2KA 3OPHA 3B42A 3FZCA 2W1RA 4L9EA 3S7QA 4S2KA 4O0PA 3NDGA 3SW1A 5TFQA 4DE1A 1SHVA 2Y2NA 4B9OA 4BMWA 3GVBA 1H8ZA 1D06A 1GHMA 2PAVP 3DAVA 5DTKA 1DRMA 3MKFA 4GNUA 4Y13A 5A8BA 1LL9A 4GS9A 3AGFA 4WEKA 4DMZA 2X01A 2H0TA 1P97A 3MXQA 3WS5A 2WUQA 2L0WA 4JF5A 5HAQA 3H9WA 1Y54A 3LY3A 1W8YA 4GD6A 1NY0A 3OBFA 3ZDJA 5HSQA 4JXVA 4PHTA 2UWXA 2EXBA 4IUHA 4ZRRA 1XJ6A 1VEUB 4GKUA 2ZQ9A 3S7NA 4NXGA 3G32A 4LRYC 4NETA 2K2NA 3VE3A 2JKTM 3F1OB 1WE4A 4C6YA 5IU1A 1FR6A 4O7DA 1PW8A 2Y2LA 3SS4A 1K56D 3BW6A 1OTDA 4P6ZS 4FTXA 4IEDA 5F1FA 3QNCA 4MN5A 4OH0A 4OKPA 4KUOA 2HJEA 3AGEA 4GHIA 3T4LA 4LRZE 4JGPA 5FDHA 3TG9A 3UE0A 4LLOB 1DP6A 1ZG6A 3O86A 2GDNA 4F3LA 3HVFA 1DJAA 3MZDA 5CEBA 3CWFA 4DJ3A 2BASA 4PKYG 2Y2JA 4OPYA 3RJUA 1CI9A 1W7FA 4O8GA 3IS2A 1ERMA 2GNXA 2B02A 3LIAA 4ID4A 4EBNA 4EBLA 3A3FA 3UPPA 2DNSA 2EWVA 1N9LA 2A2LA 4EBPA 4IJGA 5CHUA 1CQAA 3UDFA 5L8MA 1MXOA 3IT9A 2W27A 5FI2A 5EPHA 2ZQDA 2Y2PA 3ZVTA 5F82A 4LFUA 1K0KA 3WS1A 3LIBA 2JHEA 1PZOA 3NJAA 2Q9NA 1IFQA 2J3TD 5J3WA 4WM9A 3C2WA 4EV4A 1MWUA 5CGXA 1FSWA 4OOLA 2XD5A 1IELA 5KSCA 1IYSA 2HDQA 3EGDC 2A24A 5DFYA 4WLAA 3UNWA 2EX8A 2XFTA 4F94A 4G3KA 5DJUA 3N7WA 4PM6A
chains in the Genus database with same CATH topology
4ARZB 2Z6CA 2EWWA 5DKLA 4BJPA 4HJ6A 3UE6A 3MQ0A 4K08A 3F1PB 1H3QA 4UQIS 4CLCE 1P9WA 2J80A 3IBRA 5DJTA 1LSXA 1TF1A 3H7WB 2PR6A 4NXEA 4PAUA 4HP9A 1ODVA 4HQAA 2OWHA 4EETB 3ULFA 2JN7A 1N9NA 3A0VA 5J4EA 3PBQA 4G3WA 1TS8A 3S7PA 3LR4A 4EEUA 1OT6A 3F1OA 3E98A 5F5YA 2VLGA 2JKRM 2M7UA 5J7EA 2LB9A 4ETXA 1S1YA 2PYRA 4L0LA 3T4OA 1IOUA 1BYWA 3EQVA 1KOUA 2VEAA 3A0SA 2VZWA 3EQUA 3BY8A 4Q0HA 4WUJA 2XA7S 4HH2A 4F3LB 2PHYA 3KO6A 4L9GA 2W3HA 3P7NA 4R38A 2O99A 3GECA 3OOVA 3C30A 2XSSA 1S4SA 4HHDA 2JKRI 2VJWA 5CX7A 3NOPC 2QHKA 1X0OA 1F5MA 3PBSA 2NUPC 4EU0A 3F1PA 1LL8A 4HY8A 3UB6A 3LIDA 3MF0A 2V0WA 3UB7A 3BQ8A 1NLYA 1TS6A 3H82A 3T4KA 2VA0A 4GCZA 1TS7A 1D7EA 2JKTI 4E04A 4HH3A 4MN6A 4KQOA 4WEJA 1OTEA 2GZAA 1G28A 4HIAA 4IUKA 1W63M 1OJGA 2QJ5A 1OTIA 2ZOIA 2B18A 3FG8A 2IA2A 5HWVA 1EW0A 4BBUA 3IS2B 2INWA 2HF6A 3E0YA 4H6JB 3TRCA 2OAQ1 2NUTC 1MKMA 4Q0IA 5G4YA 3E4OA 3CUEA 2EA9A 5HWTA 4WELA 4MMNA 4I38A 3CLOA 2PT7A 1YSPA 4BBTA 3PXPA 3TE8A 2Y8HA 2V1BA 2QJ7A 4UEYA 2PD8A 3VV4A 4CQHA 3GDIA 2KLIA 3CAXA 5DF9A 5F6AA 3E4QA 3OCNA 2PD7A 2QKPA 2V1AA 2WKRA 2K7SA 3RH8B 1LSVA 1T1AA 2VGLM 2R78A 2O9CA 4I3IA 1H8MA 5EFWA 2PDRA 3G6OA 2D02A 1OTBA 1GSWA 2P08A 2Y79A 2XA7M 2OOLA 1MC0A 3PHYA 4WF0A 1XFQA 3ICYA 1S67L 4FSFA 2V9AA 4HJ3A 4WL9A 4DN0A 3VOLA 2LB5A 1S1ZA 3EOIA 4GS9B 4HOIA 3K3CA 1GSXA 2GJ3A 1XJ4A 1UWPX 4O01A 4EQ1A 3KSGA 5DKKA 4Y5FA 1YSQA 3P01A 3UB8A 4BWIA 1VB6A 2QYBA 5K5BA 2VGLS 4GLQA 3EEHA 5IS1A 2ZMFA 1ZTUA 3PBRA 2KOIA 3EGXC 1YAXA 3KX0X 4I3JA 1F9IA 3C38A 3LR0A 3BJNA 4Q0JA 1S4RA 1XFNA 4L9FA 4YNRA 4EERA 3PBOA 5DFXA 1LSWA 3PBTA 2W1TB 1W63Q 2KX6A 1TD5A 1NRJA 4JGQA 1Y28A 2L1MA 3LICA 3PBNA 3MR0A 3V67A 3UMEA 3T4TA 3LR3A 3TW8A 4IHQA 2XROA 2J3WA 4I39A 5C5KA 3LYXA 1GSVA 1P9RA 3MMHA 4KUKA 3U2AA 4JGOA 3HJKA 4HNBA 5HDDA 2ZMVA 4G3VA 4Y2FA 4GW9A 2OAP1 2Z6DA 1OT9A 3UE3A 3H82B 3OCLA 3NHQA 3D3OA 4HP4A 4R6LA 3LI8A 2O9BA 3KSIA 4HJ4A 3D72A 4CLCC 1N9OA 5HD3A 3OC2A 5AVFA 4EESA 4EW7A 1WA9A 1NWZA 2G7UA 2W3GA 2FZ0A 4RQ9A 1YKDA 4XT2A 3FC7A 2P04A 4YOFA 4MCWA 3K2NA 1V9ZA 2M1CA 4DJ2A 2VV6A 2J3TC 4WN5A 3KSHA 5F69A 3K3DA 5IT5A 3NOTC 3LUQA 1TS0A 3KSFA 3B42A 3A0RA 2W1RA 4OOMA 3B33A 4L9EA 5MC7A 4GHIB 3S7QA 1T19A 4O0PA 3F1NA 5G4ZA 2OWJA 3SW1A 2L4RA 3BWLA 3R4KA 4MN7A 2W0NA 3T50A 4B9OA 2H28A 5AVEA 4BMWA 2W1TA 1D06A 2VV8A 1DRMA 1OTAA 4UQIM 3UMDA 3EEAA 3JVVA 3R7WA 3RTYA 4NXFA 2W3DA 3OLOA 5A8BA 3TJZC 3EWKA 4I3AA 1V9YA 2QWSA 4GS9A 5TBMA 3MQQA 3HJIA 4WEKA 5FL3A 4DMZA 1NLZA 1P97A 3MXQA 4NKPA 2M7VA 4M4XA 2O0YA 5HD5A 2HJ9C 3PR6A 2L0WA 3H9WA 2W3EA 4B93A 4II7A 3OBFA 5HSQA 2XRNA 4PHTA 4QPRA 4IUHA 4ZRRA 5F68A 3LIFA 4AFIA 1G6OA 1XJ6A 3LI9A 2P7JA 3S7NA 4NXGA 4I5SA 2FH5A 2K31A 3FPWA 4LRYC 2K2NA 3VE3A 1XJ3A 2PYPA 1T18A 1T1CA 2JKTM 2PR5A 3F1OB 3R7WB 2ZOHA 5IU1A 4MDZA 3T4JA 4EXOA 3CUEC 2W3FA 4PKYA 2HGVA 1T1BA 2I9VA 3BW6A 3BY9A 4CLCB 1OTDA 4P6ZS 1VHMA 3B47A 3LR5A 4YWZA 3RFBA 4MN5A 3LFVA 1F98A 4KUOA 2HJEA 3C8CA 1P0ZA 4JGRA 4CLCA 3W2ZA 1XJ2A 4GHIA 3JVUA 2DMWA 4LRZE 3T4LA 4JGPA 5LBRA 2O9AA 4LLOB 1DP6A 4EUVA 4ME4A 4XT2B 2KDKA 4R70A 4F3LA 2D01A 3E4PA 4KQDA 1MZUA 3CWFA 3NOUC 1JNUA 2WKQA 3UB9A 1UGUA 4DJ3A 2BASA 3ZQ5A 4PKYG 4GJ4A 3T4QA 1OJ5A 2YKFA 4LPZA 4O8GA 3H7WA 1DP9A 3F1NB 4NEED 2A24B 4NXBA 3ZYTA 5KSHA 4P6ZM 3IS2A 2GNXA 4FOFA 2B02A 2WKPA 3LIAA 4ETZA 2VKSA 2EWVA 2VV7A 3S7OA 2HV1A 3HCYA 5HL6A 4BBVA 5HPIA 1N9LA 2A2LA 4IJGA 4Z1WA 4HI4A 5L8MA 1DP8A 3MJQA 5HDSA 1UWNX 2W27A 4EEPA 3CITA 3O5YA 1LT0A 5AJGA 5TBMB 2GX5A 5HZHA 3MFXA 1ZHHB 3VE4A 4Y3IA 5I5LA 5HDCA 3LIBA 5HPFA 2JHEA 2V0UA 1STZA 3NJAA 3DBAA 1IFQA 2J3TD 4CLCD 2MJ6A 2YKHA 5J3WA 3C2WA 3IBJA 4LRXC 2ZBBA 4H6JA 4R3AA 3MQOA 3T4SA 4OOLA 1S66L 4ARZA 2CMNA 3PYPA 5HWWA 3KYQA 3CI6A 3EGDC 2A24A 3FPVA 5DFYA 4WLAA 2VX8A 1OPXA 5TJJA 3LIEA 5KIZA 4G3KA 3BQAA 5DJUA 3KYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z6C A;  4EXO A;  2Z6D A;  4I38 A;  3CLO A;  4PKY A;  5DKL A;  1T1B A;  2I9V A;  4HJ6 A;  4F3L B;  3UE6 A;  1OT9 A;  4BBT A;  3BY9 A;  3H82 B;  1OTD A;  3NHQ A;  2V1B A;  4HP4 A;  4R6L A;  4K08 A;  3LI8 A;  2QJ7 A;  4YWZ A;  2PD8 A;  4HJ4 A;  3D72 A;  1N9O A;  4MN5 A;  5HD3 A;  3F1P B;  3GDI A;  4KUO A;  1F98 A;  2J80 A;  3C8C A;  3IBR A;  5DJT A;  3CAX A;  1P0Z A;  1LSX A;  4JGR A;  5AVF A;  4EES A;  5F6A A;  3H7W B;  2PR6 A;  4NXE A;  4EW7 A;  4HP9 A;  1WA9 A;  1XJ2 A;  1NWZ A;  1ODV A;  3E4Q A;  2OWH A;  2PD7 A;  2QKP A;  4GHI A;  4HQA A;  4RQ9 A;  4XT2 A;  4EET B;  4LRZ E;  2JN7 A;  3FC7 A;  2V1A A;  4JGP A;  1N9N A;  3A0V A;  3ULF A;  5J4E A;  2WKR A;  2K7S A;  3RH8 B;  1LSV A;  1T1A A;  4LLO B;  1TS8 A;  1DP6 A;  1V9Z A;  4EEU A;  4XT2 B;  1OT6 A;  2M1C A;  2R78 A;  3F1O A;  2VV6 A;  2KDK A;  5F5Y A;  4DJ2 A;  2VLG A;  4I3I A;  4R70 A;  5J7E A;  4WN5 A;  5EFW A;  4F3L A;  5F69 A;  2PDR A;  1S1Y A;  2D01 A;  3E4P A;  1MZU A;  3K3D A;  3CWF A;  3NOT C;  1JNU A;  2PYR A;  2WKQ A;  3LUQ A;  3NOU C;  3UB9 A;  1UGU A;  4DJ3 A;  1BYW A;  1TS0 A;  2BAS A;  3ZQ5 A;  1KOU A;  3G6O A;  4PKY G;  2D02 A;  1OTB A;  2VEA A;  1GSW A;  3A0S A;  3A0R A;  3B33 A;  4KQD A;  1OJ5 A;  2YKF A;  3BY8 A;  4L9E A;  4GHI B;  4LPZ A;  1T19 A;  2OOL A;  4WUJ A;  3F1N A;  3PHY A;  4WF0 A;  1XFQ A;  3H7W A;  1DP9 A;  2OWJ A;  2PHY A;  2A24 B;  2L4R A;  3BWL A;  3F1N B;  3ICY A;  4HH2 A;  4L9G A;  4NXB A;  3SW1 A;  1S67 L;  3IS2 A;  3P7N A;  2W0N A;  3T50 A;  2V9A A;  4R38 A;  4B9O A;  2B02 A;  2WKP A;  3LIA A;  4HJ3 A;  2H28 A;  4WL9 A;  5AVE A;  3GEC A;  1D06 A;  3VOL A;  1S1Z A;  2VV7 A;  1DRM A;  1OTA A;  2HV1 A;  2VV8 A;  1S4S A;  4GS9 B;  4HHD A;  4HOI A;  3K3C A;  1GSX A;  3RTY A;  3UMD A;  2GJ3 A;  4NXF A;  1N9L A;  4BBV A;  1XJ4 A;  1UWP X;  3OLO A;  4HI4 A;  5A8B A;  3EWK A;  2QHK A;  3NOP C;  1X0O A;  4I3A A;  4EQ1 A;  1V9Y A;  1DP8 A;  2QWS A;  3MJQ A;  4GS9 A;  5DKK A;  1UWN X;  5HDS A;  2W27 A;  3MQQ A;  5TBM A;  4EEP A;  3F1P A;  3HJI A;  3UB8 A;  1LL8 A;  1VB6 A;  4HY8 A;  3UB6 A;  1P97 A;  3MXQ A;  3LID A;  2V0W A;  1LT0 A;  4M4X A;  5TBM B;  3UB7 A;  5HD5 A;  3EEH A;  5HZH A;  5IS1 A;  1TS6 A;  3H82 A;  3MFX A;  2L0W A;  4GCZ A;  3VE4 A;  3KX0 X;  4I3J A;  1F9I A;  1TS7 A;  3H9W A;  5G4Z A;  1S4R A;  1XFN A;  4L9F A;  5I5L A;  4EER A;  1D7E A;  5HDC A;  3LIB A;  4E04 A;  2JHE A;  2V0U A;  4HH3 A;  3NJA A;  4MN6 A;  1LSW A;  1OTE A;  2KX6 A;  2YKH A;  5J3W A;  1G28 A;  5HSQ A;  4HIA A;  3C2W A;  4JGQ A;  4LRX C;  2ZBB A;  1OJG A;  1Y28 A;  2L1M A;  4H6J A;  4R3A A;  3MQO A;  2QJ5 A;  1OTI A;  2ZOI A;  3LIC A;  3FG8 A;  3MR0 A;  5F68 A;  1S66 L;  3LIF A;  3UME A;  2CMN A;  1XJ6 A;  3LI9 A;  3PYP A;  2P7J A;  5HWV A;  4NXG A;  1EW0 A;  4I39 A;  4I5S A;  4BBU A;  5HWW A;  3IS2 B;  3LYX A;  4LRY C;  1GSV A;  2A24 A;  2INW A;  4WLA A;  3VE3 A;  4KUK A;  4H6J B;  1XJ3 A;  4JGO A;  2PYP A;  3HJK A;  1T18 A;  4HNB A;  1T1C A;  5HDD A;  2PR5 A;  3F1O B;  3LIE A;  2ZOH A;  5KIZ A;  5IU1 A;  5DJU A;  5G4Y A;  3E4O A;  2EA9 A;  5HWT A;  4GW9 A; 
#chains in the Genus database with same CATH topology
 1K4E A;  1MBL A;  2EWW A;  4EQI A;  2XQZ A;  3MQ0 A;  4K08 A;  2ACG A;  5GLC A;  1H3Q A;  3IXD A;  4YFM A;  1K4F A;  2ZC4 B;  4NXE A;  2PR6 A;  4EET B;  2V20 A;  2JN7 A;  4JPM A;  4OQI A;  5D3O A;  4S2L A;  2ZL1 B;  4EEU A;  1OT6 A;  3F1O A;  4N9L A;  2M7U A;  4ETX A;  3ITB A;  5L2F A;  4NK3 A;  3EQV A;  4Q0H A;  4HH2 A;  2B95 A;  1BT5 A;  3P7N A;  2Y91 A;  3T1Q B;  3GEC A;  1Q2Q A;  1S4S A;  3MS6 A;  3S1Y A;  1BZA A;  3NOP C;  1W79 A;  1X0O A;  2NUP C;  4KZ7 A;  4HY8 A;  1PI5 A;  3N6I A;  2V0W A;  4K0X A;  5CHJ A;  3GRJ A;  3T4K A;  1BLP A;  3IWO A;  4K91 A;  1FCM A;  2GZA A;  5AQB A;  4MLL A;  1W63 M;  3GR2 A;  1OJG A;  2WKH A;  4C3Q A;  1EI5 A;  4GD8 A;  2HPB A;  2XDM A;  5HWV A;  1BSG A;  3DWK A;  3IS2 B;  2R9W A;  3MKE A;  1W5D A;  1JVJ A;  1ES3 A;  3SZT A;  4Q0I A;  3E4O A;  3CUE A;  3CLO A;  2PT7 A;  3G31 A;  1YSP A;  3UB5 P;  1TEM A;  3TE8 A;  5EM1 A;  2WGV A;  4UEY A;  2ZQA A;  2PD8 A;  2OLU A;  1KDS A;  3A3D A;  2KLI A;  3OPR A;  3CAX A;  1FQG A;  3OCN A;  2K7S A;  2DCF A;  1T1A A;  3RH8 B;  3S4X A;  4BLM A;  5FEF A;  2XF3 A;  2X71 A;  3ZFZ A;  4KZ8 A;  2P08 A;  3HLF A;  1PWD A;  4BL2 A;  1HTZ A;  2JBF A;  4PM8 A;  4WBG A;  3EOI A;  4WYY A;  4HOI A;  3K3C A;  2GJ3 A;  4O01 A;  5FQM A;  1HVB A;  5FAT A;  3KSG A;  3TOI A;  1MKI A;  3P01 A;  4P87 A;  4X1L A;  4BWI A;  1VB6 A;  3HLB A;  5FQ9 A;  1K25 A;  2ZMF A;  1ZTU A;  3IXB A;  1YAX A;  3FV7 A;  3KX0 X;  3N8R A;  4I3J A;  3BJN A;  4Q0J A;  1S4R A;  1LSW A;  3PBT A;  2W1T B;  4BD1 A;  1W63 Q;  4Y7P A;  3MZE A;  1Y28 A;  4KZA A;  2L1M A;  1PNE A;  3LIC A;  3V67 A;  3VSK A;  3UME A;  3LR3 A;  3TW8 A;  2XRO A;  3LGO A;  3B3X A;  3LYX A;  3MMH A;  4KUK A;  3U2A A;  4JGO A;  4BQM A;  3UPO A;  3HLC A;  1NXY A;  4Q8I A;  4IVK A;  2Y2M A;  1CF0 A;  5EM0 A;  5AQ7 A;  1RGZ A;  4UHU A;  3D3O A;  1N9B A;  4XUZ A;  3HLG A;  4OQH A;  4CLC C;  4LV2 A;  1YM1 A;  1L0F A;  5EVI C;  1L0D A;  1WYB A;  1NWZ A;  2G7U A;  2W3G A;  4RQ9 A;  4QY6 A;  4YOF A;  4DDS A;  2J8Y A;  3LUQ A;  5FAO A;  3E2K A;  3KSF A;  4QJG A;  5MC7 A;  4GHI B;  4OON A;  1T19 A;  1XKZ A;  4LV3 A;  5G4Z A;  2A49 A;  2OWJ A;  3M6B A;  2W1T A;  4HBT A;  4EWF A;  5TR7 A;  1OTA A;  1TVF A;  3EEA A;  3JVV A;  2FFF B;  4S2P A;  3VOY A;  3W8K A;  3OLO A;  4JXW A;  2QWS A;  1GA9 A;  3HJI A;  4BEN A;  4OP5 A;  1NLZ A;  4NKP A;  2M7V A;  3WS0 A;  5HD5 A;  4OQG A;  2JC7 A;  3WRT A;  4II7 A;  5EVI B;  1M40 A;  1CEG A;  4DDY A;  4R3B A;  1YQS A;  4JF4 A;  4QPR A;  5FAP A;  2X02 A;  5F68 A;  1G6O A;  1YMS A;  1YLP A;  5GHX A;  1T18 A;  2IWD A;  3R7W B;  4LGW A;  3CUE C;  1VET A;  2W3F A;  3Q1F A;  1T1B A;  3BY9 A;  4YWZ A;  2HP5 A;  3RFB A;  1MPL A;  1O07 A;  3C8C A;  4CLC A;  1XJ2 A;  3OPP A;  3JVU A;  3ISG A;  4GN2 A;  1MWS A;  3BFC A;  3MXS A;  4P6B A;  4XT2 B;  4R70 A;  3E4P A;  1JNU A;  3UB9 A;  1UGU A;  3VP1 A;  3MXR A;  3DTM A;  1OJ5 A;  4QD4 A;  3UPN A;  3QP6 A;  3BFD A;  4NXB A;  5KSH A;  3BYD A;  3ZYT A;  4M3K A;  4FOF A;  5FAQ A;  3RXX A;  4ETZ A;  4Y0T A;  2HDU A;  1DJC A;  2HV1 A;  5HL6 A;  3U4L P;  2WGW A;  4Z1W A;  1H0M A;  3ZG0 A;  4EEP A;  4U0X A;  1BTL A;  1XPB A;  2GX5 A;  5GLB A;  3UDI A;  4Y3I A;  1NRF A;  2V0U A;  2ZMA A;  3DBA A;  1KDW A;  4WZ5 A;  1IYP A;  2ZBB A;  1IYO A;  3IX4 A;  3WWX A;  4OPZ A;  4BL3 A;  3T4S A;  3ZVW A;  4B88 A;  4ARZ A;  4ZBE A;  1KVL A;  3V39 A;  2WZZ A;  3NY4 A;  4GB7 A;  3I7J A;  2ZC3 B;  5A91 A;  1OPX A;  4OLG A;  4Y0U A;  4DE2 A;  5E2E A;  1FSY A;  3KYZ A;  3CPT A;  2V8C A;  3GMW A;  4JXS A;  5DKL A;  5EE8 A;  4BJP A;  4HJ6 A;  3UE6 A;  1K57 C;  1S0W A;  4ZTK A;  1LLB A;  3W4Q A;  1Y4O A;  3V3S A;  3F1P B;  2ZC7 A;  3LEQ A;  4JKT A;  3IBR A;  3IX8 A;  3ZGA B;  1EWZ A;  3OZH A;  4E3N A;  2OWH A;  2IWC A;  3C4O A;  2C6W B;  4GDB A;  1N9N A;  5HAI A;  4LCM A;  3PBQ A;  4LCL A;  3BLM A;  5BOH A;  3QP2 A;  2JKR M;  1CJF A;  5CTN A;  2C5W B;  2PYR A;  3T4O A;  1IOU A;  1ZKJ A;  3A0S A;  3BY8 A;  1K38 A;  1PRQ A;  2PHY A;  3C5A A;  5FSR A;  3KO6 A;  5EVL A;  5EVI A;  2O99 A;  5CTM A;  2JKR I;  4ZJ1 A;  2VGJ A;  2QHK A;  1F5M A;  1BLC A;  1KGF A;  3PBS A;  3O87 A;  1PWG A;  4X56 A;  2EX2 A;  3UB6 A;  4PM7 A;  3UB7 A;  3BQ8 A;  3ZG8 B;  3BFF A;  1NLY A;  1TS6 A;  3H82 A;  2V1Z A;  1YPR A;  1KGG A;  1CI8 A;  5FI6 A;  1JWV A;  4HH3 A;  4WEJ A;  1FCN A;  3SS3 A;  1E25 A;  1SKF A;  4IUK A;  3IF6 B;  4N1X A;  1OTI A;  5FQK A;  1L2S A;  1YLZ A;  1GHI A;  3T1R A;  2EFX A;  2HF6 A;  3E0Y A;  4R4S A;  2OAQ 1;  3FWL A;  1IEM A;  2EA9 A;  4I38 A;  4OVD A;  5HX9 A;  1O7E A;  3PXP A;  5KZH A;  2V1B A;  3A3E A;  5M1A A;  4JXG A;  3CPT B;  4CQH A;  2Z2M B;  1HZO A;  4H8R A;  2FFY A;  3T12 B;  5DF9 A;  4E6X A;  2QKP A;  3VP4 A;  4E3M A;  4HEF A;  4U0T A;  5CGS A;  1L0E A;  1QME A;  2VGL M;  3SH7 A;  2V2F F;  1ES2 A;  4ZDX A;  3G6O A;  1TDG A;  2D02 A;  1OTB A;  2Y79 A;  1MC0 A;  3ICY A;  4HJ3 A;  4WL9 A;  4B4Z A;  3VOL A;  1Z09 A;  1YLJ A;  4IBX A;  1YSQ A;  2QYB A;  3DTE A;  4GLQ A;  5IS1 A;  3FKV A;  2Y59 A;  1F9I A;  1NJ4 A;  3C38 A;  5M19 A;  1XFN A;  2OSU A;  4EER A;  1PYY A;  5DFX A;  3G2Y A;  4JGQ A;  3SH8 A;  1SDN A;  3IH8 A;  3DTI A;  5M18 A;  3MR0 A;  1K54 C;  4IHQ A;  4I39 A;  2H10 A;  1GSV A;  1P9R A;  4ZJ3 A;  4GW9 A;  3UE3 A;  4HBU A;  4R6L A;  1W8Q A;  3LI8 A;  4WZ5 C;  2O9B A;  3KSI A;  1FR1 A;  5AVF A;  1E4D A;  1JWP A;  2WAE A;  1WA9 A;  4S2O A;  3HLE A;  1YKD A;  3FC7 A;  2WGI A;  2P04 A;  5FQJ A;  4MCW A;  5E2G A;  3RXW A;  1V9Z A;  1VQQ A;  2QPN A;  2M1C A;  2H5S A;  5F69 A;  3K3D A;  1WYC A;  1TS0 A;  4KZ9 A;  4GZB A;  3MZF A;  1VEU A;  3B33 A;  3ZNY A;  5HFO A;  2EFU A;  5EUA A;  2JKF A;  4MN7 A;  2H28 A;  5AVE A;  4S2J A;  4PM9 A;  3C4P A;  3VP2 A;  4UQI M;  1L3L A;  3R7W A;  3WS2 A;  4NXF A;  4MBK A;  3TJZ C;  3EWK A;  1V9Y A;  5TBM A;  3MQQ A;  4Y17 A;  2ZL1 A;  1SZV A;  5FL3 A;  1M6K A;  3QP8 A;  1N4O A;  2RCX A;  2XGN A;  5EVI D;  5GHZ A;  4B93 A;  5DVA A;  1ERO A;  2Y2O A;  4UA6 A;  2XRN A;  3D9Y A;  3IXG A;  3HUN A;  3HRE A;  1KE0 A;  4AFI A;  1ESI A;  2PBD P;  5L09 A;  4I5S A;  2FH5 A;  3FPW A;  2IWB A;  1K54 A;  4EUZ A;  1XJ3 A;  2PYP A;  1T1C A;  2PR5 A;  2ZOH A;  1MWR A;  4MDZ A;  2PBY A;  4PKY A;  2ZQ7 A;  4CLC B;  2ZJ9 A;  3B47 A;  4WMC D;  3IQA A;  3LFV A;  1F98 A;  3P09 A;  1MY8 A;  4JGR A;  1SKO B;  2DMW A;  5LBR A;  4E6W A;  5JYP A;  1KE3 A;  1AWI A;  4ME4 A;  2KDK A;  1BLH A;  5F83 A;  4KQD A;  2D01 A;  1ACF A;  1MZU A;  3BFE A;  3NOU C;  3SOI A;  4DF6 A;  3IHA A;  3HLW A;  1F2K A;  1LI0 A;  4GJ4 A;  2YKF A;  5G18 A;  2J9O A;  2EXA A;  1DP9 A;  3F1N B;  4NEE D;  2A24 B;  2WGW B;  1LHY A;  4P6Z M;  4P85 A;  4QHC A;  2WKP A;  2VKS A;  2VV7 A;  3S7O A;  3HCY A;  3JPU A;  3ZNT A;  5HPI A;  1ERQ A;  1GCE A;  1DP8 A;  5J8X A;  3MJQ A;  5HDS A;  2RL3 A;  3JYI A;  5AJG A;  3IWQ A;  2EX6 A;  5HZH A;  3MFX A;  1ZHH B;  3IH9 A;  4FH4 A;  2Y2Q A;  3KYE A;  3HL9 A;  5I5L A;  3NC8 A;  5HDC A;  2VK3 A;  1KE4 A;  2QMI A;  2MJ6 A;  1IKI A;  3IBJ A;  2BTF P;  1SCW A;  4LRX C;  4R0Q A;  4H6J A;  2P9V A;  3NDE A;  3PAE A;  1RP5 A;  1XA1 A;  1AXB A;  3CI6 A;  3FPV A;  3W4P A;  3NBL A;  1NZO A;  1PW1 A;  1G6A A;  4RVA A;  3LIE A;  1BUE A;  4ARZ B;  2Z6C A;  2ZM2 A;  3CMZ A;  3LEZ A;  4R1G A;  5DF8 A;  4PMA A;  1YLW A;  2HDR A;  1IKG A;  1DY6 A;  1GHP A;  4N92 A;  2Y2H A;  3M6H A;  1LSX A;  1TF1 A;  1SKO A;  4HP9 A;  4HQA A;  3TSG A;  2Y2I A;  3ULF A;  5FDS A;  3A0V A;  5J4E A;  5A93 A;  4G3W A;  1XGI A;  1TS8 A;  3S7P A;  3LR4 A;  5E2F A;  2VLG A;  4X69 A;  2LB9 A;  4L0L A;  2WK0 A;  1BYW A;  4QY5 A;  1KOU A;  2P74 A;  3BFG A;  2VEA A;  3NCK A;  1I2W A;  3VFH A;  4L9G A;  2W3H A;  5E43 A;  3OOV A;  4FH2 A;  2B5R A;  3C30 A;  3QP4 A;  3UE1 A;  3UO9 A;  2VJW A;  5CX7 A;  1CEF A;  5CRF A;  4EU0 A;  5FQQ A;  5EEC A;  5GHY A;  1LL8 A;  5A90 A;  1BLS A;  3LID A;  3MF0 A;  3AGD A;  1YMX A;  4DXC A;  4WZ4 A;  2ZC6 B;  3NUL A;  4GCZ A;  1TS7 A;  1D7E A;  2J9P A;  3Q7V A;  3ZG9 B;  1TDL A;  4KQO A;  1OTE A;  3IXH A;  5GL9 A;  5DTT A;  2ZOI A;  2G2W A;  5F1G A;  3FG8 A;  5DTS A;  3IF5 A;  4GOG A;  2V8F A;  1Q2P A;  4PM5 A;  2INW A;  4H6J B;  3TRC A;  2NUT C;  1MKM A;  1ZC2 A;  3MBZ A;  4S2M A;  3HUM A;  5AQ9 A;  4BBT A;  3FYZ A;  1LL5 A;  2QJ7 A;  4MBF A;  3GDI A;  1ES4 A;  1LI9 A;  1ONH A;  4QB8 A;  5HW3 A;  3ZG5 A;  2PD7 A;  3G30 A;  5TGF A;  2WKR A;  4DE0 A;  3UY6 A;  1LSV A;  3G2Z A;  1A0K A;  2R78 A;  2XLN A;  5HL1 A;  4I3I A;  1H8M A;  2ZC5 B;  1E3U D;  1D1J A;  1FIL A;  3OPL A;  3QP5 A;  1GSW A;  2XA7 M;  4X53 A;  2OOL A;  2HP6 A;  3UN7 A;  3PHY A;  4KZ3 A;  2V9A A;  4RYE A;  2AVX A;  1K57 A;  1S1Z A;  4K0W A;  3IWI A;  4GS9 B;  3PAG A;  2WYX A;  1JTG A;  1UWP X;  1MWT A;  1RCJ A;  4Y5F A;  5EVE A;  3EEH A;  2DRW A;  5GLA A;  4D2O A;  3PBR A;  2KOI A;  4ZJ2 A;  5CGW A;  4L9F A;  4XUX A;  4KZ6 A;  3DTK A;  2KX6 A;  4DRT A;  4KG2 A;  3N8S A;  3PBN A;  3NIA A;  4QU3 A;  4XXR A;  2UV0 E;  2J3W A;  5C5K A;  4JLF A;  5IHV A;  4E3O A;  1OME A;  3N8L A;  2R9X A;  3HJK A;  2ZMV A;  4G3V A;  3SH9 A;  2Y55 A;  1BUL A;  1GA0 A;  2OAP 1;  2Z6D A;  2ZM8 A;  5I94 A;  1I5Q A;  1OT9 A;  3NHQ A;  3ZG7 B;  4R3J A;  3QHY A;  1N9O A;  5HD3 A;  3OC2 A;  4LV1 A;  4EES A;  4EW7 A;  4Y0O A;  5FQI A;  2FZ0 A;  1L0G A;  1RGY A;  3K2N A;  3GQZ A;  2I72 A;  4IBR A;  4RX2 A;  4WN5 A;  3KSH A;  3P98 A;  3NOT C;  1KGE A;  5DF7 A;  4Z9Q A;  3A0R A;  4OOM A;  4DXB A;  4A5R A;  3F1N A;  2P9V B;  2L4R A;  3BWL A;  3NI9 A;  3Q81 A;  2XEP A;  3R4K A;  2W0N A;  3T50 A;  2JE5 A;  3GV9 A;  2VV8 A;  3UMD A;  2ZD8 A;  3RTY A;  3PTE A;  2W3D A;  3O3V A;  1J3W A;  5A92 A;  4I3A A;  4E3L A;  3L7H A;  4X6T A;  2BLS A;  4M4X A;  1QMF A;  2O0Y A;  2H0Y A;  3M2J A;  2A3U A;  2HJ9 C;  3PR6 A;  1G68 A;  2Y4A A;  2W3E A;  3VOZ A;  1K55 A;  2Q9M A;  2PRF A;  3T1S A;  1U60 A;  4N1H A;  4KZ5 A;  4OPQ A;  3O88 A;  4JBF A;  2VGK A;  3LIF A;  3VFF A;  3LI9 A;  2P7J A;  4WMC A;  2K31 A;  3LO7 A;  5GLD A;  5FAS A;  5CED A;  2ZQC A;  1ES5 A;  4BD0 A;  3T4J A;  2ZM0 A;  4EXO A;  2HGV A;  2I9V A;  2CC1 A;  3FKW A;  4Y15 A;  1VHM A;  1YLY A;  3LR5 A;  4KEN B;  1PI4 A;  4D60 A;  1I2S A;  4X55 A;  1CK3 A;  1P0Z A;  3CHW P;  3W2Z A;  1K6S A;  3BM6 A;  3T1X A;  2O9A A;  4E3I A;  2WAF A;  3MFD A;  4QWO A;  4EUV A;  2HZ5 A;  4UAA A;  3BRM A;  1IYQ A;  2WKQ A;  3VMA A;  3ZQ5 A;  3T4Q A;  3CG5 A;  2JKG A;  1NYM A;  1ESU A;  4LPZ A;  4MNR A;  1JWZ A;  4DE3 A;  3DW0 A;  3H7W A;  4E3J A;  3V3R A;  2XFS A;  3HUO A;  3WRZ A;  4OP8 A;  4BBV A;  5CER A;  2E8J A;  4HI4 A;  4E3K A;  1UWN X;  5L07 A;  2ZQ8 A;  3CIT A;  3O5Y A;  3BEC A;  1FCO A;  1PZP A;  5AQA A;  5FA7 A;  1LT0 A;  5TBM B;  4KZB A;  5FI7 A;  5HAR A;  4KZ4 A;  3VE4 A;  5CXW A;  3MSH A;  5HPF A;  1STZ A;  3A3J A;  1ALQ A;  4CLC D;  2EX9 A;  1NYY A;  5L10 A;  2YKH A;  5EV0 A;  3ZCZ A;  4MEZ A;  4N9K A;  1K55 C;  4X1M A;  4R3A A;  3MQO A;  1VET B;  1HD8 A;  5FEG A;  1S66 L;  2CMN A;  1FOF A;  3IF6 C;  3VP0 A;  3PYP A;  5HWW A;  3KYQ A;  1YLT A;  4KG5 A;  2VX8 A;  3VP3 A;  5TJJ A;  5KIZ A;  3BQA A;  4S2N C;  3ITA A;  1ONG A;  2XK1 A;  4U3T A;  3Q82 A;  3QNB A;  2OV5 A;  1FIK A;  4UQI S;  4CLC E;  1P9W A;  2J80 A;  5DJT A;  4MBH A;  2ZLY A;  3H7W B;  3LCE A;  4PAU A;  1ODV A;  1YT4 A;  1VM1 A;  1C3B A;  2WKE A;  3E98 A;  5F5Y A;  4CPK A;  5J7E A;  3Q07 A;  2Q0O A;  4R4R A;  1S1Y A;  3VSL A;  3Q7Z A;  4RA7 A;  2VZW A;  3EQU A;  4PPR A;  4NG2 A;  4WUJ A;  2XA7 S;  4F3L B;  3C7V A;  5KMW A;  3NEC A;  3S22 A;  2WAD A;  2WKI A;  4R38 A;  3D4F A;  2XSS A;  4YIN A;  2PU4 A;  4HHD A;  3BLS A;  5U47 A;  4FCF A;  5CEC A;  3F1P A;  3Q7V B;  2PU2 A;  5HAP A;  1DJB A;  2E8I A;  2VA0 A;  2JKT I;  4E04 A;  4MN6 A;  4KQQ A;  2OLV A;  1G28 A;  4HIA A;  1SDE A;  2QJ5 A;  3G34 A;  2B18 A;  3SS5 A;  2J7V A;  3CJM A;  2IA2 A;  4CJN A;  1EW0 A;  4BBU A;  5JYO A;  3DWZ A;  1XGJ A;  5G4Y A;  4UA9 A;  2Y2G A;  3BEB A;  1H8Y A;  5HWT A;  4LV0 A;  4WEL A;  4MMN A;  1KVM A;  3E2L A;  3CZD A;  4S2N A;  2Y8H A;  3V50 A;  1E3U A;  4HES A;  1PFL A;  3VV4 A;  4OLD A;  3C7U A;  3V5M A;  4OPR A;  4RX3 A;  3L9K A;  1XX2 A;  5F6A A;  3E4Q A;  3LY4 A;  2V1A A;  4P0M A;  4GDN A;  2HDS A;  2O9C A;  3W4O A;  1NZU A;  3IHB A;  5EFW A;  2PDR A;  4X68 A;  3UDX A;  2QZ6 A;  1XXM A;  4IVI A;  3GSG A;  4C75 A;  4WF0 A;  1XA7 A;  1XFQ A;  4JF6 A;  1S67 L;  3G35 A;  4FSF A;  3N4I A;  4S2I A;  4DN0 A;  3HBR A;  4B4X A;  1JTD A;  2LB5 A;  4ESP A;  1GSX A;  4R23 A;  2XD1 A;  1Z6F A;  1XJ4 A;  4EQ1 A;  5DKK A;  1K56 A;  3UB8 A;  1H5X A;  1HLU P;  5K5B A;  2VGL S;  4OQ0 A;  2WZX A;  3ZHH A;  3EGX C;  3M2K A;  4UA7 A;  3LR0 A;  4ZAM A;  4YNR A;  1PWC A;  3PBO A;  4FUW A;  2JCH A;  3QP1 A;  1TD5 A;  1NRJ A;  2BG1 A;  1PIO A;  3IX3 A;  3T4T A;  5CHM A;  3GTC A;  1XP4 A;  2HP9 A;  5EOO A;  4DKI A;  2G2U A;  4HNB A;  5HDD A;  3WS4 A;  4X25 A;  4Y2F A;  2XR0 A;  4FD8 A;  3H82 B;  3OCL A;  1ZG4 A;  4HP4 A;  1J9M A;  4OOY A;  4HJ4 A;  3D72 A;  3A3I A;  3IF6 A;  2XH9 A;  1S6R A;  4XT2 A;  2Z2L B;  3G4P A;  4LEN A;  4KG6 A;  1G5U A;  1K6R A;  4DJ2 A;  3HLD A;  2VV6 A;  5EOE A;  5E2H A;  2J3T C;  5IT5 A;  4KQR A;  2Y2K A;  3OPH A;  3B42 A;  3FZC A;  2W1R A;  4L9E A;  3S7Q A;  4S2K A;  4O0P A;  3NDG A;  3SW1 A;  5TFQ A;  4DE1 A;  1SHV A;  2Y2N A;  4B9O A;  4BMW A;  3GVB A;  1H8Z A;  1D06 A;  1GHM A;  2PAV P;  3DAV A;  5DTK A;  1DRM A;  3MKF A;  4GNU A;  4Y13 A;  5A8B A;  1LL9 A;  4GS9 A;  3AGF A;  4WEK A;  4DMZ A;  2X01 A;  2H0T A;  1P97 A;  3MXQ A;  3WS5 A;  2WUQ A;  2L0W A;  4JF5 A;  5HAQ A;  3H9W A;  1Y54 A;  3LY3 A;  1W8Y A;  4GD6 A;  1NY0 A;  3OBF A;  3ZDJ A;  5HSQ A;  4JXV A;  4PHT A;  2UWX A;  2EXB A;  4IUH A;  4ZRR A;  1XJ6 A;  1VEU B;  4GKU A;  2ZQ9 A;  3S7N A;  4NXG A;  3G32 A;  4LRY C;  4NET A;  2K2N A;  3VE3 A;  2JKT M;  3F1O B;  1WE4 A;  4C6Y A;  5IU1 A;  1FR6 A;  4O7D A;  1PW8 A;  2Y2L A;  3SS4 A;  1K56 D;  3BW6 A;  1OTD A;  4P6Z S;  4FTX A;  4IED A;  5F1F A;  3QNC A;  4MN5 A;  4OH0 A;  4OKP A;  4KUO A;  2HJE A;  3AGE A;  4GHI A;  3T4L A;  4LRZ E;  4JGP A;  5FDH A;  3TG9 A;  3UE0 A;  4LLO B;  1DP6 A;  1ZG6 A;  3O86 A;  2GDN A;  4F3L A;  3HVF A;  1DJA A;  3MZD A;  5CEB A;  3CWF A;  4DJ3 A;  2BAS A;  4PKY G;  2Y2J A;  4OPY A;  3RJU A;  1CI9 A;  1W7F A;  4O8G A;  3IS2 A;  1ERM A;  2GNX A;  2B02 A;  3LIA A;  4ID4 A;  4EBN A;  4EBL A;  3A3F A;  3UPP A;  2DNS A;  2EWV A;  1N9L A;  2A2L A;  4EBP A;  4IJG A;  5CHU A;  1CQA A;  3UDF A;  5L8M A;  1MXO A;  3IT9 A;  2W27 A;  5FI2 A;  5EPH A;  2ZQD A;  2Y2P A;  3ZVT A;  5F82 A;  4LFU A;  1K0K A;  3WS1 A;  3LIB A;  2JHE A;  1PZO A;  3NJA A;  2Q9N A;  1IFQ A;  2J3T D;  5J3W A;  4WM9 A;  3C2W A;  4EV4 A;  1MWU A;  5CGX A;  1FSW A;  4OOL A;  2XD5 A;  1IEL A;  5KSC A;  1IYS A;  2HDQ A;  3EGD C;  2A24 A;  5DFY A;  4WLA A;  3UNW A;  2EX8 A;  2XFT A;  4F94 A;  4G3K A;  5DJU A;  3N7W A;  4PM6 A; 
#chains in the Genus database with same CATH homology
 4ARZ B;  2Z6C A;  2EWW A;  5DKL A;  4BJP A;  4HJ6 A;  3UE6 A;  3MQ0 A;  4K08 A;  3F1P B;  1H3Q A;  4UQI S;  4CLC E;  1P9W A;  2J80 A;  3IBR A;  5DJT A;  1LSX A;  1TF1 A;  3H7W B;  2PR6 A;  4NXE A;  4PAU A;  4HP9 A;  1ODV A;  4HQA A;  2OWH A;  4EET B;  3ULF A;  2JN7 A;  1N9N A;  3A0V A;  5J4E A;  3PBQ A;  4G3W A;  1TS8 A;  3S7P A;  3LR4 A;  4EEU A;  1OT6 A;  3F1O A;  3E98 A;  5F5Y A;  2VLG A;  2JKR M;  2M7U A;  5J7E A;  2LB9 A;  4ETX A;  1S1Y A;  2PYR A;  4L0L A;  3T4O A;  1IOU A;  1BYW A;  3EQV A;  1KOU A;  2VEA A;  3A0S A;  2VZW A;  3EQU A;  3BY8 A;  4Q0H A;  4WUJ A;  2XA7 S;  4HH2 A;  4F3L B;  2PHY A;  3KO6 A;  4L9G A;  2W3H A;  3P7N A;  4R38 A;  2O99 A;  3GEC A;  3OOV A;  3C30 A;  2XSS A;  1S4S A;  4HHD A;  2JKR I;  2VJW A;  5CX7 A;  3NOP C;  2QHK A;  1X0O A;  1F5M A;  3PBS A;  2NUP C;  4EU0 A;  3F1P A;  1LL8 A;  4HY8 A;  3UB6 A;  3LID A;  3MF0 A;  2V0W A;  3UB7 A;  3BQ8 A;  1NLY A;  1TS6 A;  3H82 A;  3T4K A;  2VA0 A;  4GCZ A;  1TS7 A;  1D7E A;  2JKT I;  4E04 A;  4HH3 A;  4MN6 A;  4KQO A;  4WEJ A;  1OTE A;  2GZA A;  1G28 A;  4HIA A;  4IUK A;  1W63 M;  1OJG A;  2QJ5 A;  1OTI A;  2ZOI A;  2B18 A;  3FG8 A;  2IA2 A;  5HWV A;  1EW0 A;  4BBU A;  3IS2 B;  2INW A;  2HF6 A;  3E0Y A;  4H6J B;  3TRC A;  2OAQ 1;  2NUT C;  1MKM A;  4Q0I A;  5G4Y A;  3E4O A;  3CUE A;  2EA9 A;  5HWT A;  4WEL A;  4MMN A;  4I38 A;  3CLO A;  2PT7 A;  1YSP A;  4BBT A;  3PXP A;  3TE8 A;  2Y8H A;  2V1B A;  2QJ7 A;  4UEY A;  2PD8 A;  3VV4 A;  4CQH A;  3GDI A;  2KLI A;  3CAX A;  5DF9 A;  5F6A A;  3E4Q A;  3OCN A;  2PD7 A;  2QKP A;  2V1A A;  2WKR A;  2K7S A;  3RH8 B;  1LSV A;  1T1A A;  2VGL M;  2R78 A;  2O9C A;  4I3I A;  1H8M A;  5EFW A;  2PDR A;  3G6O A;  2D02 A;  1OTB A;  1GSW A;  2P08 A;  2Y79 A;  2XA7 M;  2OOL A;  1MC0 A;  3PHY A;  4WF0 A;  1XFQ A;  3ICY A;  1S67 L;  4FSF A;  2V9A A;  4HJ3 A;  4WL9 A;  4DN0 A;  3VOL A;  2LB5 A;  1S1Z A;  3EOI A;  4GS9 B;  4HOI A;  3K3C A;  1GSX A;  2GJ3 A;  1XJ4 A;  1UWP X;  4O01 A;  4EQ1 A;  3KSG A;  5DKK A;  4Y5F A;  1YSQ A;  3P01 A;  3UB8 A;  4BWI A;  1VB6 A;  2QYB A;  5K5B A;  2VGL S;  4GLQ A;  3EEH A;  5IS1 A;  2ZMF A;  1ZTU A;  3PBR A;  2KOI A;  3EGX C;  1YAX A;  3KX0 X;  4I3J A;  1F9I A;  3C38 A;  3LR0 A;  3BJN A;  4Q0J A;  1S4R A;  1XFN A;  4L9F A;  4YNR A;  4EER A;  3PBO A;  5DFX A;  1LSW A;  3PBT A;  2W1T B;  1W63 Q;  2KX6 A;  1TD5 A;  1NRJ A;  4JGQ A;  1Y28 A;  2L1M A;  3LIC A;  3PBN A;  3MR0 A;  3V67 A;  3UME A;  3T4T A;  3LR3 A;  3TW8 A;  4IHQ A;  2XRO A;  2J3W A;  4I39 A;  5C5K A;  3LYX A;  1GSV A;  1P9R A;  3MMH A;  4KUK A;  3U2A A;  4JGO A;  3HJK A;  4HNB A;  5HDD A;  2ZMV A;  4G3V A;  4Y2F A;  4GW9 A;  2OAP 1;  2Z6D A;  1OT9 A;  3UE3 A;  3H82 B;  3OCL A;  3NHQ A;  3D3O A;  4HP4 A;  4R6L A;  3LI8 A;  2O9B A;  3KSI A;  4HJ4 A;  3D72 A;  4CLC C;  1N9O A;  5HD3 A;  3OC2 A;  5AVF A;  4EES A;  4EW7 A;  1WA9 A;  1NWZ A;  2G7U A;  2W3G A;  2FZ0 A;  4RQ9 A;  1YKD A;  4XT2 A;  3FC7 A;  2P04 A;  4YOF A;  4MCW A;  3K2N A;  1V9Z A;  2M1C A;  4DJ2 A;  2VV6 A;  2J3T C;  4WN5 A;  3KSH A;  5F69 A;  3K3D A;  5IT5 A;  3NOT C;  3LUQ A;  1TS0 A;  3KSF A;  3B42 A;  3A0R A;  2W1R A;  4OOM A;  3B33 A;  4L9E A;  5MC7 A;  4GHI B;  3S7Q A;  1T19 A;  4O0P A;  3F1N A;  5G4Z A;  2OWJ A;  3SW1 A;  2L4R A;  3BWL A;  3R4K A;  4MN7 A;  2W0N A;  3T50 A;  4B9O A;  2H28 A;  5AVE A;  4BMW A;  2W1T A;  1D06 A;  2VV8 A;  1DRM A;  1OTA A;  4UQI M;  3UMD A;  3EEA A;  3JVV A;  3R7W A;  3RTY A;  4NXF A;  2W3D A;  3OLO A;  5A8B A;  3TJZ C;  3EWK A;  4I3A A;  1V9Y A;  2QWS A;  4GS9 A;  5TBM A;  3MQQ A;  3HJI A;  4WEK A;  5FL3 A;  4DMZ A;  1NLZ A;  1P97 A;  3MXQ A;  4NKP A;  2M7V A;  4M4X A;  2O0Y A;  5HD5 A;  2HJ9 C;  3PR6 A;  2L0W A;  3H9W A;  2W3E A;  4B93 A;  4II7 A;  3OBF A;  5HSQ A;  2XRN A;  4PHT A;  4QPR A;  4IUH A;  4ZRR A;  5F68 A;  3LIF A;  4AFI A;  1G6O A;  1XJ6 A;  3LI9 A;  2P7J A;  3S7N A;  4NXG A;  4I5S A;  2FH5 A;  2K31 A;  3FPW A;  4LRY C;  2K2N A;  3VE3 A;  1XJ3 A;  2PYP A;  1T18 A;  1T1C A;  2JKT M;  2PR5 A;  3F1O B;  3R7W B;  2ZOH A;  5IU1 A;  4MDZ A;  3T4J A;  4EXO A;  3CUE C;  2W3F A;  4PKY A;  2HGV A;  1T1B A;  2I9V A;  3BW6 A;  3BY9 A;  4CLC B;  1OTD A;  4P6Z S;  1VHM A;  3B47 A;  3LR5 A;  4YWZ A;  3RFB A;  4MN5 A;  3LFV A;  1F98 A;  4KUO A;  2HJE A;  3C8C A;  1P0Z A;  4JGR A;  4CLC A;  3W2Z A;  1XJ2 A;  4GHI A;  3JVU A;  2DMW A;  4LRZ E;  3T4L A;  4JGP A;  5LBR A;  2O9A A;  4LLO B;  1DP6 A;  4EUV A;  4ME4 A;  4XT2 B;  2KDK A;  4R70 A;  4F3L A;  2D01 A;  3E4P A;  4KQD A;  1MZU A;  3CWF A;  3NOU C;  1JNU A;  2WKQ A;  3UB9 A;  1UGU A;  4DJ3 A;  2BAS A;  3ZQ5 A;  4PKY G;  4GJ4 A;  3T4Q A;  1OJ5 A;  2YKF A;  4LPZ A;  4O8G A;  3H7W A;  1DP9 A;  3F1N B;  4NEE D;  2A24 B;  4NXB A;  3ZYT A;  5KSH A;  4P6Z M;  3IS2 A;  2GNX A;  4FOF A;  2B02 A;  2WKP A;  3LIA A;  4ETZ A;  2VKS A;  2EWV A;  2VV7 A;  3S7O A;  2HV1 A;  3HCY A;  5HL6 A;  4BBV A;  5HPI A;  1N9L A;  2A2L A;  4IJG A;  4Z1W A;  4HI4 A;  5L8M A;  1DP8 A;  3MJQ A;  5HDS A;  1UWN X;  2W27 A;  4EEP A;  3CIT A;  3O5Y A;  1LT0 A;  5AJG A;  5TBM B;  2GX5 A;  5HZH A;  3MFX A;  1ZHH B;  3VE4 A;  4Y3I A;  5I5L A;  5HDC A;  3LIB A;  5HPF A;  2JHE A;  2V0U A;  1STZ A;  3NJA A;  3DBA A;  1IFQ A;  2J3T D;  4CLC D;  2MJ6 A;  2YKH A;  5J3W A;  3C2W A;  3IBJ A;  4LRX C;  2ZBB A;  4H6J A;  4R3A A;  3MQO A;  3T4S A;  4OOL A;  1S66 L;  4ARZ A;  2CMN A;  3PYP A;  5HWW A;  3KYQ A;  3CI6 A;  3EGD C;  2A24 A;  3FPV A;  5DFY A;  4WLA A;  2VX8 A;  1OPX A;  5TJJ A;  3LIE A;  5KIZ A;  4G3K A;  3BQA A;  5DJU A;  3KYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...