3DBAA

Crystal structure of the cgmp-bound gaf a domain from the photoreceptor phosphodiesterase 6c
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
171
structure length
171
Chain Sequence
RLEECNILFELLTEIQDEAGSMEKIVHKTLQRLSQLLAADRCSMFICRSRNGIPEVATRLLNVTPTSKFEDNLVNPDKETVFPLDIGIAGWVAHTKKFFNIPDVKKNNHFSDYLDKKTGYTTVNMMAIPITQGKEVLAVVMALNKLNASEFSKEDEEVFKKYLNFISLVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit al
publication title The Structure of the GAF A Domain from Phosphodiesterase 6C Reveals Determinants of cGMP Binding, a Conserved Binding Surface, and a Large cGMP-dependent Conformational Change.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
total genus 49
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.4.35: 3',5'-cyclic-GMP phosphodiesterase.
pdb deposition date 2008-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3dbaA00
1F5MA 1YKDA 5L8MA 2HGVA 2XSSA 4R70A 3O5YA 2XROA 3MMHA 2B18A 4GLQA 2W1TA 3IBRA 3K2NA 3S7PA 5I5LA 4FOFA 3EEAA 3KSHA 2W3EA 2M7UA 4Q0HA 3VV4A 3S7NA 3MQ0A 2IA2A 3S7QA 3RFBA 4O8GA 3MF0A 3KSIA 5HPFA 3NOTC 4IUKA 4E04A 1TF1A 4EUVA 1MC0A 5C5KA 5LBRA 2GX5A 4GW9A 3D3OA 4Z1WA 3S7OA 4O0PA 2O9CA 2QYBA 3TRCA 3R4KA 3CITA 3KSGA 3W2ZA 3E0YA 1ZTUA 1TD5A 3LFVA 2VZWA 1YSPA 3CI6A 2XRNA 2VJWA 3NOPC 4O01A 5AJGA 3OOVA 4RQ9A 2VKSA 4ETZA 4Q0IA 5TJJA 2W1RA 1STZA 2VEAA 4CQHA 3KSFA 2LB5A 3DBAA 2KLIA 4BWIA 4ETXA 2ZMFA 3NHQA 2Y79A 4G3VA 5DFYA 2M7VA 4QPRA 4Q0JA 2W3FA 2W1TB 4YOFA 3C2WA 2O0YA 5DFXA 2KOIA 3ZQ5A 2LB9A 4LRXC 1MKMA 5K5BA 2O99A 2OOLA 2W3GA 3E98A 3OBFA 4PAUA 4Y2FA 4MCWA 3BJNA 5HPIA 2G7UA 2K31A 4MMNA 2Y8HA 4EU0A 1VHMA 4IUHA 2K2NA 4G3KA 1YSQA 4LRYC 5HL6A 2O9AA 4MDZA 4DMZA 3HCYA 4Y3IA 3NOUC 5HSQA 4LRZE 2W3HA 2W3DA 4ZRRA 4G3WA 3IBJA 4DN0A 2O9BA 4YNRA 4ME4A 4R6LA 3KO6A 4IJGA 4Y5FA 4MN7A 3G6OA
chains in the Genus database with same CATH superfamily
1GHIA 4JXWA 1PW1A 3LI8A 3S7PA 2BASA 4Q0HA 2W27A 2INWA 2HZ5A 3T4OA 4OONA 4R38A 4Z9QA 1K6SA 1VETB 2EFUA 1OT6A 1JTDA 4EUVA 5EVLA 1KGEA 4YINA 1ESIA 4BD0A 4GDNA 4GN2A 5HD5A 4M3KA 2HPBA 1BUEA 1G5UA 4K0XA 2EWVA 3F1OA 4PHTA 3TJZC 2QPNA 1OTDA 3PTEA 5TBMA 3FKVA 5HW3A 3B47A 3LGOA 1F9IA 2VEAA 3GMWA 4BENA 2EA9A 1P9RA 5HWWA 3VFHA 4KUOA 2JKRM 4Q0JA 3E4OA 3HLEA 2XK1A 4JF4A 1NRFA 2DRWA 3IWOA 3UY6A 5TR7A 3NULA 2Y2KA 1MKMA 2O99A 3LIFA 1EROA 3MXQA 4JF5A 3A0RA 1NJ4A 4OP8A 4BBVA 3LR4A 5E2GA 2ZC4B 5CGXA 4BJPA 4OVDA 5HDSA 3LIDA 2PD8A 4N92A 4GJ4A 1NRJA 5F82A 2A49A 5KZHA 2W3DA 1SKOA 1QMEA 3N8SA 3CPTA 1CJFA 3IS2A 4Y0TA 3G31A 5TGFA 1U60A 2XH9A 3F1PA 3KYQA 1MY8A 2XROA 4BMWA 3FV7A 2W1TA 4PKYG 4R0QA 3MZDA 3KSHA 2ZMVA 1O07A 2Y2IA 1IKIA 1AWIA 4BBTA 1MWUA 3C5AA 1W8QA 4LCLA 4QU3A 2Q0OA 5HWTA 3E4PA 2C5WB 1TF1A 1GA0A 2WK0A 4B4XA 3WS0A 2QZ6A 5FI2A 5I94A 1K54C 4S2JA 3TRCA 4NKPA 5CXWA 2FH5A 2VV6A 3PYPA 2P04A 5FI6A 4ZJ1A 2ZQ7A 3EQUA 1FCOA 2HF6A 5HX9A 1ZG6A 2ZQ9A 2Y2QA 3LY4A 2JKFA 4CQHA 4ARZB 3QP1A 2ZC3B 2JCHA 3EWKA 3M6BA 1BULA 4WMCD 3LCEA 4XUXA 3LR5A 1VETA 3VOZA 5EV0A 3OZHA 3WS2A 2EX2A 2ZM0A 3BY9A 5K5BA 4I3IA 2R78A 4ZDXA 4NEED 5DTTA 4BLMA 2K7SA 3CUEC 4ZBEA 2KX6A 3V67A 1HD8A 1XA1A 1ESUA 2ZBBA 1VB6A 1LI0A 4KG2A 1YLYA 3L7HA 2Z6CA 5F68A 3NY4A 5AVEA 3ZNTA 1YT4A 3B33A 3B3XA 2Y2HA 4C3QA 1DY6A 1WA9A 3A3DA 2UV0E 3NDEA 1MZUA 1PZPA 2HDQA 4FOFA 2H0YA 3EEAA 4OQGA 3IHAA 3PR6A 2EWWA 1XGIA 3VP1A 1FR6A 3R7WA 2B5RA 4HP9A 4X1MA 2OWJA 2Y2LA 3QP5A 1NLYA 3ZG5A 4NXBA 3ZYTA 4LLOB 4I5SA 1OT9A 3W2ZA 1S1ZA 2Y2OA 1CI8A 5MC7A 2VZWA 2WAFA 3CI6A 4KQRA 1I5QA 4DF6A 1ZG4A 4II7A 3FKWA 1PZOA 2D02A 3Q7ZA 2PAVP 2A24A 2ZLYA 2P9VB 1LL9A 2HJEA 5DVAA 1VEUB 1K25A 1L0DA 4JGRA 3ZFZA 2VGLS 2W3FA 3TOIA 2KOIA 3SS5A 4R3BA 1Q2QA 3JVUA 1DP8A 4MCWA 2VGKA 2G7UA 2Y8HA 2O9AA 1YLWA 3HCYA 1S0WA 3IF6B 4HJ4A 2O9BA 1T18A 4KZ5A 4ARZA 1L2SA 3PBOA 2V8CA 5IU1A 1T1BA 4IJGA 4KENB 3BWLA 3N8LA 2UWXA 1PNEA 4KZ7A 1NWZA 4PM9A 5CRFA 1T19A 2WZZA 1XGJA 4S2PA 4EUZA 2WZXA 1ERQA 2ZQCA 2NUPC 3S7QA 2Q9MA 5FEGA 2PYRA 1S67L 3ZG8B 4IUKA 1LT0A 3NCKA 3GVBA 2DNSA 2W0NA 3IX8A 4KG6A 3ZHHA 3ZVWA 3MXRA 3E2KA 4CLCB 4Q8IA 3V3RA 1IFQA 3EGXC 4RX2A 3S1YA 2H0TA 4O01A 5CGWA 2WUQA 2WKQA 3GECA 1SDEA 3HJIA 5HWVA 1OJ5A 4I38A 4ETZA 1ZC2A 4DJ2A 4OOYA 4PPRA 3I7JA 1IYOA 3WWXA 3EGDC 3ULFA 1L0FA 1TS7A 3EQVA 2Y2MA 3GQZA 5KSCA 4XXRA 5FAOA 3L9KA 3IT9A 3UB7A 3CMZA 3Q07A 1LHYA 1Y54A 1D06A 4L0LA 3MKFA 2OOLA 4GD6A 2J8YA 2ZC6B 4NK3A 4KZBA 1BZAA 4PAUA 3GR2A 5IHVA 2OWHA 1NY0A 1CF0A 4DMZA 4OQ0A 4O7DA 3PBTA 5KIZA 2HP9A 1EW0A 4HNBA 3EEHA 5EECA 4R6LA 4QD4A 2JKGA 2P9VA 4MN5A 3NJAA 3SOIA 4JGPA 1OTEA 1DJCA 2CC1A 1VEUA 4JKTA 5DTSA 2ZMAA 1FQGA 4DXBA 3QP4A 3ZG7B 2VGLM 1OPXA 1CK3A 4GD8A 2H28A 3B42A 1LLBA 3WS4A 2J3TD 2J80A 4R3JA 1S4RA 4HBTA 2VX8A 5CEBA 1SDNA 3BEBA 1PI4A 4PM5A 5J8XA 2HDSA 5L09A 4ESPA 3PBNA 5C5KA 1UWPX 2GZAA 3LR0A 3IF6A 3SS4A 5GHXA 4ID4A 3IXBA 1ZTUA 4X56A 4S2NA 3H9WA 4HIAA 3A3JA 5EFWA 4L9GA 2OV5A 2E8IA 5EVIB 4WN5A 4ETXA 2ZC7A 4G3VA 4KZ3A 2V8FA 4UA7A 4FH4A 3BY8A 1H8MA 3HL9A 2L1MA 3FPWA 3W4OA 3SS3A 4CLCA 4Y2FA 3HUOA 2ZL1B 1XXMA 3UE3A 3C7UA 1H5XA 1HTZA 3UE6A 4RVAA 3M6HA 3P09A 2R9WA 2L4RA 2GNXA 3OPRA 1H0MA 1RCJA 1FSWA 1ES5A 3T1XA 4KZ9A 4FH2A 3A3FA 4XUZA 1TEMA 3BLMA 3SZTA 1PI5A 5DKKA 3BYDA 1PWGA 1PWCA 3QP2A 1W5DA 3UNWA 3CAXA 2Y2PA 4C6YA 1KGFA 2IA2A 2JKTI 1GSVA 3BM6A 3T12B 5A93A 3CG5A 1YLPA 2RCXA 2XFSA 2QJ5A 3PAEA 4HEFA 3ZGAB 5HAIA 5EVEA 5HFOA 4KQOA 3M2JA 1NLZA 1MC0A 4FD8A 1IEMA 4LV3A 2JKTM 4DDSA 3HREA 3CITA 4EXOA 3O87A 4R4RA 4ZJ2A 1DP6A 5GLDA 2Y4AA 2HV1A 2ZOIA 3OOVA 4E3NA 3D72A 2VKSA 4HESA 3MQQA 3WS1A 1STZA 2NUTC 4N1HA 4KQDA 1FCMA 4C75A 4OPRA 3VSKA 3ZG0A 1DJBA 2Y55A 3F1NA 3O88A 1YMXA 1K56D 1DRMA 2EX9A 2J9OA 3ZCZA 4ZTKA 4LRXC 3VOLA 4OLGA 4DE0A 4HOIA 2PR6A 4FSFA 5FQJA 3TW8A 3T1SA 1SHVA 1I2WA 3HVFA 2H10A 1MWSA 4S2MA 4QHCA 2XF3A 3FYZA 3Q1FA 1ZHHB 4UEYA 2Z6DA 1BLPA 1GCEA 5FATA 3IX3A 3LICA 5EVIA 3HLDA 4LPZA 4N1XA 3R7WB 2WGIA 3AGEA 3IBRA 4HHDA 5CGSA 2A2LA 3FPVA 3IXHA 2W3EA 4LCMA 3OCNA 3MQ0A 4WBGA 2ZL1A 3PAGA 3JPUA 5HAQA 3KSIA 4U3TA 4H6JB 3OPLA 5GL9A 4WELA 1JWPA 3LIAA 4BBUA 2P7JA 3LY3A 5EM1A 3CJMA 4IEDA 3D4FA 4Y17A 2QYBA 3FWLA 4WZ4A 3W4QA 1SCWA 2A24B 4E6XA 1N9OA 1N9BA 5IS1A 1W8YA 4IBRA 2I9VA 3T50A 4P0MA 4HJ6A 2LB5A 4X1LA 5EUAA 3P7NA 5CTMA 5IT5A 1G6AA 5HZHA 3TSGA 1PRQA 2WKPA 3PHYA 2WKRA 5A91A 4JLFA 3BJNA 4JXSA 4MMNA 5GLCA 3AGFA 1LL8A 3K3DA 1D1JA 4N9LA 1YSQA 2PRFA 4GS9A 4UHUA 3NOUC 1L3LA 3IQAA 4OQIA 4S2KA 3G6OA 2XDMA 1TDGA 2EXAA 2XSSA 3VSLA 4H8RA 1MPLA 4IBXA 3S22A 1LSVA 5FASA 3MZEA 1YAXA 2PU4A 4FCFA 1XJ4A 5F1GA 5F69A 4E6WA 3MFXA 4P6ZS 4DRTA 4R3AA 2OAP1 2VV7A 5LBRA 3D3OA 4Y15A 4O0PA 3TG9A 3DTKA 4HI4A 3C4PA 3LUQA 2P74A 1BYWA 4NG2A 4ZAMA 3OCLA 3HLCA 1ERMA 1XJ2A 3KSFA 3T4TA 4HP4A 1TDLA 4UQIS 2Y79A 2M7VA 3N7WA 4H6JA 3KYEA 1E3UD 5DKLA 3ZQ5A 3QNCA 3OBFA 2G2UA 3N8RA 4KZ4A 3KX0X 3PBSA 3UMEA 4LRYC 5M19A 5EVIC 1H3QA 5HSQA 2V1AA 3G32A 2ZQAA 2W3HA 3HLBA 2R9XA 2HP5A 3DTEA 1S4SA 4U0XA 5DF9A 2WGWA 5BOHA 4P87A 4MN7A 3C7VA 1FILA 2HGVA 3A0VA 5EPHA 4EQIA 3O5YA 4OP5A 1RP5A 1K57A 5CECA 3HBRA 4RX3A 5I5LA 3GRJA 2ZM2A 4MEZA 3S7NA 2PBDP 1I2SA 4MBKA 2QJ7A 1PFLA 1MKIA 4KG5A 5KSHA 3OC2A 3MFDA 3LIEA 4E04A 1ACFA 2DMWA 3H82B 3E4QA 4YFMA 3LI9A 4D60A 4EEUA 1Z6FA 4OPQA 3VP3A 1OTIA 2V1ZA 2G2WA 1P97A 2XRNA 2VJWA 1RGZA 1G6OA 5AJGA 3V50A 1FCNA 4WZ5A 1CEGA 4JPMA 3QNBA 5TJJA 5EM0A 1YMSA 3ITBA 2J7VA 5F1FA 3LEQA 1TVFA 1YLZA 2JN7A 3A3IA 3NHQA 5DFYA 1RGYA 2Y2NA 4P6ZM 4LV1A 4OOLA 3PXPA 4JBFA 2D01A 1G68A 2LB9A 4I3JA 2JHEA 4M4XA 4IHQA 4GB7A 2KDKA 1NZOA 3HJKA 3M2KA 4JXVA 3VP2A 4ZJ3A 4E3IA 5DJUA 4WMCA 4ZRRA 4ME4A 3MR0A 3ISGA 1L0EA 4DE1A 4GOGA 4UQIM 5CHJA 3ZNYA 1LSXA 5FDSA 3JVVA 5HD3A 2M7UA 1D7EA 5HDDA 5AQ9A 4WLAA 4B88A 2OLVA 3IXGA 5L2FA 1O7EA 3VP4A 3U4LP 5DTKA 2VV8A 1K0KA 4F94A 3OPHA 3VE3A 2GX5A 4GW9A 4OH0A 1ALQA 1ES4A 3GV9A 1L0GA 3N6IA 3TE8A 4QWOA 4HQAA 4Y13A 1S1YA 3IF5A 4LENA 4EBLA 3Q82A 2DCFA 1ODVA 5EE8A 3F1NB 2FFYA 3ITAA 1KVMA 2WYXA 2PYPA 4EESA 4F3LB 4EWFA 2ZMFA 1Y4OA 2OAQ1 3G4PA 4MNRA 1JWZA 3WRZA 3VMAA 4MN6A 3T4QA 3IXDA 5DFXA 3H82A 3BFGA 1T1AA 1XPBA 5GHZA 1XKZA 5G4ZA 4CPKA 3G35A 5DF8A 1XJ6A 3WRTA 3P98A 3EOIA 4IUHA 2Y91A 1NZUA 5A8BA 5GLBA 2FZ0A 4Y3IA 3LO7A 3WS5A 2PD7A 1J9MA 2HDUA 4G3WA 2X02A 3UN7A 3MSHA 2V9AA 1YKDA 5AQBA 4S2OA 5HAPA 3UMDA 4X69A 1UGUA 4OPYA 1IYQA 1WYBA 4HY8A 1K54A 4HH2A 5FL3A 4JGOA 1YQSA 1MWTA 1FOFA 1W63M 3DW0A 4BD1A 1ZKJA 5G18A 1DP9A 2OSUA 4LV0A 5TFQA 4JXGA 5A92A 2BLSA 3UDXA 4EV4A 3UPNA 4HJ3A 2IWDA 3ZG9B 4QY6A 3QP8A 1PYYA 3IWIA 4A5RA 4Q0IA 2W1RA 4B4ZA 1F98A 3ZDJA 1QMFA 4E3MA 2Z2LB 5E2HA 2JE5A 1W79A 2V20A 3NC8A 3NI9A 3H7WB 5CTNA 1TS8A 3A0SA 3CUEA 5J7EA 1KOUA 4PMAA 1ONGA 3N4IA 3C2WA 4WEJA 1A0KA 4GS9B 4DE3A 3JYIA 1BLHA 2XGNA 3G30A 4K0WA 5EOOA 2K31A 4U0TA 2K2NA 4WF0A 3UB5P 2IWCA 2QHKA 4MDZA 2HDRA 4GDBA 1ES2A 1CEFA 3NBLA 4F3LA 1IKGA 3KO6A 1DJAA 3UB8A 5L8MA 1KDSA 4LGWA 3O3VA 1M6KA 3UB9A 4Y0OA 1MWRA 2EXBA 5FAQA 1N4OA 3IH9A 1OTAA 1K6RA 2JKRI 3NOTC 1ONHA 5F5YA 4BQMA 4CJNA 4X6TA 2JC7A 1V9YA 2O9CA 1KE4A 4RYEA 1K55A 3NDGA 3KSGA 4X53A 5A90A 2Q9NA 4IVKA 4X25A 1YSPA 1IELA 3NOPC 3IF6C 3UE1A 3U2AA 4LV2A 4WYYA 4CLCE 1LI9A 4OOMA 2I72A 4R23A 3T4SA 3VOYA 4HBUA 1JTGA 3BLSA 3DWZA 5F83A 4S2NC 2XA7S 1NYYA 2EX6A 1FR1A 3D9YA 3GTCA 1OMEA 2V2FF 3MKEA 2PDRA 3OLOA 3C38A 2QKPA 5FDHA 3DTIA 2P08A 3UDFA 3MS6A 2Y2JA 1BTLA 1LL5A 5M18A 4NXFA 2WGWB 2V0WA 5JYOA 4QJGA 2A3UA 4G3KA 3IX4A 2EX8A 1GSWA 4CLCC 4LRZE 3G2ZA 4GZBA 5L10A 3W8KA 4OQHA 1YPRA 3BECA 4RA7A 2V0UA 3SH9A 2ZM8A 3CHWP 1Q2PA 3GSGA 3MMHA 2B18A 3H7WA 1E25A 5J4EA 5E2FA 4K08A 1KVLA 2ZD8A 2J9PA 4KZ6A 2FFFB 4GHIB 3VV4A 2PR5A 3W4PA 4DJ3A 4AFIA 3MXSA 4FTXA 4E3KA 5HPFA 2OLUA 2YKHA 4EETB 2VLGA 3RJUA 3CLOA 1K4FA 4Z1WA 3S7OA 4E3LA 1P0ZA 1CI9A 4R1GA 4EBPA 3LFVA 3ICYA 1JNUA 4WEKA 1S6RA 2WKHA 1PW8A 1OJGA 4YWZA 5DF7A 1E4DA 3E2LA 1W7FA 3BRMA 5HARA 4QPRA 4MBFA 3HLGA 4R4SA 2PU2A 1KGGA 3V3SA 1IOUA 2O0YA 3UB6A 3OPPA 1EI5A 2VA0A 5JYPA 2WKEA 3T4KA 5AQAA 1J3WA 1VM1A 1YLTA 2PBYA 4NETA 1XFQA 5E43A 3NECA 3BQAA 4XT2B 4EERA 1N9NA 2Z2MB 4WL9A 4K91A 1K56A 4X68A 2QWSA 2XQZA 3S4XA 1ES3A 4X55A 5E2EA 2ZC5B 2XA7M 5HL1A 4R70A 3G34A 2XD1A 1Y28A 1GA9A 4WM9A 4EQ1A 4EEPA 2WADA 3C4OA 3RXWA 1W63Q 5GHYA 4D2OA 3UDIA 3VP0A 3RFBA 1Z09A 3BW6A 5FI7A 1KDWA 2PHYA 1K55C 5G4YA 3VE4A 3DWKA 2XR0A 2J3TC 1XA7A 3SH7A 2BG1A 1JWVA 1VQQA 1PIOA 3T1QB 1H8YA 5L07A 4UA6A 3E0YA 2B95A 1TD5A 1EWZA 1CQAA 3G2YA 3BQ8A 5FSRA 2L0WA 4PM8A 1FIKA 4CLCD 2AVXA 1FSYA 4I39A 5GLAA 4GHIA 3DBAA 4PKYA 2XFTA 4BWIA 3UPPA 2ZOHA 3BFEA 3UE0A 3A3EA 3AGDA 3ZVTA 5HDCA 1HVBA 2JBFA 2XLNA 3GDIA 1P9WA 3V5MA 3QP6A 3MJQA 2W3GA 4DXCA 3HUMA 1XX2A 3PBQA 4HH3A 1UWNX 4PM6A 2GDNA 5FA7A 2ZQ8A 4KUKA 1XFNA 1HLUP 2E8JA 2MJ6A 1S66L 3VFFA 3SW1A 3MZFA 4IVIA 1T1CA 1X0OA 3Q7VB 1F5MA 2IWBA 5CERA 1IYSA 1M40A 4EW7A 3BFFA 4BL2A 4GLQA 1N9LA 3KYZA 5FQ9A 4JF6A 3Q81A 3T4JA 5M1AA 4OPZA 5CEDA 3DAVA 4P85A 5AQ7A 2EFXA 3BFDA 2YKFA 3MF0A 4MBHA 5D3OA 3T4LA 1F2KA 4XT2A 3RH8B 3LR3A 4QY5A 4L9FA 3R4KA 1NYMA 5F6AA 4NXEA 2B02A 3DTMA 3RTYA 5FQKA 3UPOA 1BLCA 1MBLA 1OTBA 3BFCA 5FAPA 3RXXA 4OLDA 4I3AA 2J3WA 4QB8A 3SH8A 5CX7A 4JGQA 3LEZA 2VGJA 1IYPA 2XD5A 1BLSA 2X71A 4WUJA 5EVID 4B9OA 4BL3A 3UO9A 2WGVA 2WAEA 3CWFA 1XJ3A 2ACGA 4DE2A 3LIBA 3T1RA 4FUWA 2Y59A 5HPIA 3MQOA 2QMIA 2Y2GA 2PT7A 1VHMA 3HLFA 4L9EA 5FQIA 1BSGA 3FG8A 3NIAA 1SKFA 2XEPA 2H5SA 4N9KA 2BTFP 3IBJA 1YM1A 4YNRA 4GNUA 3QHYA 1E3UA 2CMNA 3HUNA 1KE0A 3F1OB 4DDYA 5TBMB 2WKIA 2X01A 3K2NA 2V1BA 4KQQA 2RL3A 3IH8A 1JVJA 3IWQA 4O8GA 4S2IA 4Y0UA 1K57C 5DJTA 1TS0A 1HZOA 5AVFA 2HP6A 1AXBA 4Y7PA 4OKPA 2GJ3A 4LFUA 1GHPA 5FEFA 4GCZA 1BT5A 1PWDA 3IHBA 3Q7VA 3PBRA 3C8CA 1XP4A 4P6BA 4MLLA 1GHMA 1MXOA 4RQ9A 5CHUA 1SKOB 3CZDA 1V9ZA 4UA9A 5FQQA 4E3JA 3O86A 2KLIA 3CPTB 3MBZA 3IS2B 4KZAA 5J3WA 4E3OA 1NXYA 4WZ5C 3F1PB 3FC7A 1K4EA 4GKUA 2W1TB 5KMWA 4YOFA 2HJ9C 3C30A 3LYXA 4UAAA 1WYCA 2M1CA 1YLJA 3P01A 5U47A 4B93A 4S2LA 1WE4A 3E98A 3K3CA 4EBNA 1LSWA 4EU0A 1C3BA 1K38A 5FQMA 1TS6A 4KZ8A 5HL6A 3FZCA 4NXGA 1GSXA 1SZVA 2ZQDA 2C6WB 1G28A 3V39A 1H8ZA 2ZJ9A 5CHMA 1KE3A 4DKIA 3HLWA 4PM7A 2VK3A 4Y5FA 4DN0A 5EOEA
chains in the Genus database with same CATH topology
2HGVA 3A0VA 2VGLM 3O5YA 3MMHA 2B18A 3H7WA 1OPXA 5J4EA 4K08A 3LI8A 3S7PA 2BASA 2H28A 3B42A 5I5LA 4GHIB 2J3TD 4Q0HA 2J80A 3VV4A 3S7NA 1S4RA 2VX8A 2W27A 2INWA 2PR5A 2QJ7A 3T4OA 4R38A 4DJ3A 4AFIA 5KSHA 3OC2A 5HPFA 2YKHA 4EETB 3LIEA 4E04A 1OT6A 2DMWA 2VLGA 4EUVA 3CLOA 3H82B 3PBNA 5C5KA 3E4QA 1UWPX 2GZAA 3LR0A 3LI9A 4Z1WA 3S7OA 4EEUA 5HD5A 1P0ZA 1OTIA 1ZTUA 2EWVA 3LFVA 3ICYA 3F1OA 1JNUA 1P97A 4PHTA 2XRNA 4WEKA 3TJZC 2VJWA 1OTDA 1G6OA 3H9WA 5AJGA 4HIAA 5TBMA 5EFWA 4L9GA 3B47A 1F9IA 1OJGA 5TJJA 4YWZA 2VEAA 2EA9A 1P9RA 5HWWA 4WN5A 2JN7A 4ETXA 3NHQA 4G3VA 5DFYA 4QPRA 4KUOA 2JKRM 4Q0JA 3E4OA 4P6ZM 4OOLA 3PXPA 1IOUA 2O0YA 3UB6A 3BY8A 1H8MA 2L1MA 2VA0A 3FPWA 2D01A 2LB9A 1MKMA 2O99A 3T4KA 4I3JA 2JHEA 4M4XA 4Y2FA 3LIFA 4IHQA 4CLCA 3MXQA 3A0RA 2KDKA 4BBVA 3LR4A 3UE3A 4BJPA 3HJKA 5HDSA 1XFQA 3LIDA 2PD8A 3UE6A 4GJ4A 3BQAA 1NRJA 4XT2B 5DJUA 4EERA 1N9NA 2L4RA 2GNXA 4ZRRA 2W3DA 4WL9A 2QWSA 4ME4A 3MR0A 3IS2A 4UQIM 3F1PA 1LSXA 2XA7M 3KYQA 5DKKA 4R70A 2XROA 4BMWA 1Y28A 4EQ1A 2W1TA 4PKYG 4EEPA 3JVVA 3KSHA 3CAXA 5HD3A 2M7UA 1D7EA 2ZMVA 1W63Q 5HDDA 2IA2A 2JKTI 1GSVA 4BBTA 4WLAA 3RFBA 3BW6A 5HWTA 2PHYA 2QJ5A 2VV8A 3E4PA 5G4YA 1TF1A 4KQOA 3VE4A 1NLZA 1MC0A 2J3TC 3VE3A 2GX5A 4GW9A 2JKTM 3TRCA 3CITA 3TE8A 4EXOA 3E0YA 1TD5A 4HQAA 4NKPA 1DP6A 2FH5A 3BQ8A 2VV6A 3PYPA 2P04A 1S1YA 3EQUA 2HV1A 2ZOIA 2HF6A 3OOVA 1ODVA 2L0WA 3F1NB 4CLCD 3D72A 2VKSA 4I39A 3MQQA 1STZA 2NUTC 2PYPA 4GHIA 4EESA 4CQHA 4KQDA 4F3LB 4ARZB 3DBAA 3EWKA 4PKYA 4BWIA 2ZMFA 2ZOHA 3F1NA 2OAQ1 3LR5A 5HDCA 1DRMA 4MN6A 3T4QA 5DFXA 3H82A 3GDIA 1P9WA 1T1AA 3BY9A 5K5BA 4LRXC 3VOLA 3MJQA 5G4ZA 4I3IA 2W3GA 2R78A 4HOIA 3PBQA 4NEED 2PR6A 4HH3A 1UWNX 2K7SA 1XJ6A 3CUEC 4FSFA 2KX6A 3V67A 3TW8A 3EOIA 4IUHA 4KUKA 5A8BA 1XFNA 2FZ0A 2ZBBA 2MJ6A 1S66L 1VB6A 4Y3IA 2PD7A 3SW1A 2Z6CA 1ZHHB 5F68A 4G3WA 5AVEA 4UEYA 2Z6DA 1T1CA 1X0OA 3LICA 3B33A 2V9AA 1WA9A 1F5MA 1YKDA 4LPZA 1MZUA 3R7WB 4EW7A 4GLQA 1N9LA 3KYZA 3IBRA 4HHDA 2A2LA 3FPVA 4FOFA 3EEAA 3UMDA 2W3EA 3T4JA 3PR6A 1UGUA 3OCNA 2EWWA 3MQ0A 4HY8A 4HH2A 5FL3A 2YKFA 4JGOA 3R7WA 1W63M 3MF0A 4HP9A 3KSIA 4H6JB 2OWJA 4WELA 1DP9A 3LIAA 4BBUA 3T4LA 2P7JA 4XT2A 3RH8B 3LR3A 1NLYA 4NXBA 3ZYTA 4L9FA 2QYBA 4LLOB 3R4KA 4I5SA 1OT9A 3W2ZA 1S1ZA 5F6AA 4NXEA 2A24B 2B02A 5MC7A 1N9OA 2VZWA 3RTYA 3CI6A 4HJ3A 4II7A 5IS1A 1OTBA 2D02A 2I9VA 3T50A 4Q0IA 2W1RA 1F98A 4I3AA 4HJ6A 2A24A 2LB5A 2J3WA 2HJEA 5CX7A 4JGQA 4JGRA 3P7NA 2VGLS 3H7WB 1TS8A 3A0SA 3CUEA 5IT5A 5J7EA 1KOUA 2W3FA 3C2WA 4WEJA 2KOIA 4WUJA 5HZHA 2WKPA 3PHYA 4B9OA 2WKRA 4GS9B 3CWFA 1XJ3A 3LIBA 3JVUA 1DP8A 4MCWA 3BJNA 5HPIA 3MQOA 2G7UA 2K31A 4MMNA 2Y8HA 2PT7A 1LL8A 1VHMA 2K2NA 4WF0A 3K3DA 4L9EA 1YSQA 2QHKA 2O9AA 4MDZA 3HCYA 3FG8A 4GS9A 3NOUC 3IBJA 4HJ4A 2O9BA 1T18A 4YNRA 4F3LA 4ARZA 3PBOA 2CMNA 5IU1A 1T1BA 3KO6A 4IJGA 3F1OB 3G6OA 3BWLA 3UB8A 5TBMB 5L8MA 2XSSA 1LSVA 1YAXA 2V1BA 3K2NA 1NWZA 3UB9A 1T19A 1XJ4A 2NUPC 5F69A 3S7QA 1OTAA 2PYRA 4O8GA 2JKRI 1S67L 3MFXA 4P6ZS 5DJTA 1TS0A 3NOTC 4IUKA 4R3AA 1LT0A 5F5YA 2OAP1 5AVFA 2W0NA 2VV7A 5LBRA 3D3OA 4O0PA 4CLCB 2GJ3A 1V9YA 2O9CA 1IFQA 4GCZA 3KSGA 3EGXC 4HI4A 3PBRA 3C8CA 1YSPA 3LUQA 3NOPC 4O01A 2WKQA 3GECA 1BYWA 4RQ9A 3U2AA 3OCLA 3HJIA 4CLCE 5HWVA 1OJ5A 4I38A 4OOMA 4ETZA 4DJ2A 1XJ2A 1V9ZA 3T4SA 3KSFA 3T4TA 4HP4A 2KLIA 3IS2B 3EGDC 5J3WA 3ULFA 4UQIS 3F1PB 1TS7A 2XA7S 2Y79A 3EQVA 2M7VA 3FC7A 2PDRA 4H6JA 3OLOA 3UB7A 3C38A 2QKPA 2W1TB 4YOFA 2HJ9C 3C30A 2P08A 3LYXA 2M1CA 4L0LA 1D06A 5DKLA 3P01A 3ZQ5A 2OOLA 4B93A 3OBFA 3E98A 4PAUA 3K3CA 1LSWA 4NXFA 2OWHA 4EU0A 2V0WA 3KX0X 3PBSA 3UMEA 1TS6A 4G3KA 5HL6A 4LRYC 4DMZA 1H3QA 4NXGA 3PBTA 5KIZA 1GSXA 4CLCC 1GSWA 5HSQA 2V1AA 4LRZE 1EW0A 4HNBA 2W3HA 1G28A 3EEHA 1S4SA 4R6LA 2V0UA 5DF9A 4MN5A 3NJAA 4JGPA 1OTEA 4Y5FA 4MN7A 4DN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F5M A;  1YKD A;  5L8M A;  2HGV A;  2XSS A;  4R70 A;  3O5Y A;  2XRO A;  3MMH A;  2B18 A;  4GLQ A;  2W1T A;  3IBR A;  3K2N A;  3S7P A;  5I5L A;  4FOF A;  3EEA A;  3KSH A;  2W3E A;  2M7U A;  4Q0H A;  3VV4 A;  3S7N A;  3MQ0 A;  2IA2 A;  3S7Q A;  3RFB A;  4O8G A;  3MF0 A;  3KSI A;  5HPF A;  3NOT C;  4IUK A;  4E04 A;  1TF1 A;  4EUV A;  1MC0 A;  5C5K A;  5LBR A;  2GX5 A;  4GW9 A;  3D3O A;  4Z1W A;  3S7O A;  4O0P A;  2O9C A;  2QYB A;  3TRC A;  3R4K A;  3CIT A;  3KSG A;  3W2Z A;  3E0Y A;  1ZTU A;  1TD5 A;  3LFV A;  2VZW A;  1YSP A;  3CI6 A;  2XRN A;  2VJW A;  3NOP C;  4O01 A;  5AJG A;  3OOV A;  4RQ9 A;  2VKS A;  4ETZ A;  4Q0I A;  5TJJ A;  2W1R A;  1STZ A;  2VEA A;  4CQH A;  3KSF A;  2LB5 A;  3DBA A;  2KLI A;  4BWI A;  4ETX A;  2ZMF A;  3NHQ A;  2Y79 A;  4G3V A;  5DFY A;  2M7V A;  4QPR A;  4Q0J A;  2W3F A;  2W1T B;  4YOF A;  3C2W A;  2O0Y A;  5DFX A;  2KOI A;  3ZQ5 A;  2LB9 A;  4LRX C;  1MKM A;  5K5B A;  2O99 A;  2OOL A;  2W3G A;  3E98 A;  3OBF A;  4PAU A;  4Y2F A;  4MCW A;  3BJN A;  5HPI A;  2G7U A;  2K31 A;  4MMN A;  2Y8H A;  4EU0 A;  1VHM A;  4IUH A;  2K2N A;  4G3K A;  1YSQ A;  4LRY C;  5HL6 A;  2O9A A;  4MDZ A;  4DMZ A;  3HCY A;  4Y3I A;  3NOU C;  5HSQ A;  4LRZ E;  2W3H A;  2W3D A;  4ZRR A;  4G3W A;  3IBJ A;  4DN0 A;  2O9B A;  4YNR A;  4ME4 A;  4R6L A;  3KO6 A;  4IJG A;  4Y5F A;  4MN7 A;  3G6O A; 
#chains in the Genus database with same CATH topology
 1GHI A;  4JXW A;  1PW1 A;  3LI8 A;  3S7P A;  2BAS A;  4Q0H A;  2W27 A;  2INW A;  2HZ5 A;  3T4O A;  4OON A;  4R38 A;  4Z9Q A;  1K6S A;  1VET B;  2EFU A;  1OT6 A;  1JTD A;  4EUV A;  5EVL A;  1KGE A;  4YIN A;  1ESI A;  4BD0 A;  4GDN A;  4GN2 A;  5HD5 A;  4M3K A;  2HPB A;  1BUE A;  1G5U A;  4K0X A;  2EWV A;  3F1O A;  4PHT A;  3TJZ C;  2QPN A;  1OTD A;  3PTE A;  5TBM A;  3FKV A;  5HW3 A;  3B47 A;  3LGO A;  1F9I A;  2VEA A;  3GMW A;  4BEN A;  2EA9 A;  1P9R A;  5HWW A;  3VFH A;  4KUO A;  2JKR M;  4Q0J A;  3E4O A;  3HLE A;  2XK1 A;  4JF4 A;  1NRF A;  2DRW A;  3IWO A;  3UY6 A;  5TR7 A;  3NUL A;  2Y2K A;  1MKM A;  2O99 A;  3LIF A;  1ERO A;  3MXQ A;  4JF5 A;  3A0R A;  1NJ4 A;  4OP8 A;  4BBV A;  3LR4 A;  5E2G A;  2ZC4 B;  5CGX A;  4BJP A;  4OVD A;  5HDS A;  3LID A;  2PD8 A;  4N92 A;  4GJ4 A;  1NRJ A;  5F82 A;  2A49 A;  5KZH A;  2W3D A;  1SKO A;  1QME A;  3N8S A;  3CPT A;  1CJF A;  3IS2 A;  4Y0T A;  3G31 A;  5TGF A;  1U60 A;  2XH9 A;  3F1P A;  3KYQ A;  1MY8 A;  2XRO A;  4BMW A;  3FV7 A;  2W1T A;  4PKY G;  4R0Q A;  3MZD A;  3KSH A;  2ZMV A;  1O07 A;  2Y2I A;  1IKI A;  1AWI A;  4BBT A;  1MWU A;  3C5A A;  1W8Q A;  4LCL A;  4QU3 A;  2Q0O A;  5HWT A;  3E4P A;  2C5W B;  1TF1 A;  1GA0 A;  2WK0 A;  4B4X A;  3WS0 A;  2QZ6 A;  5FI2 A;  5I94 A;  1K54 C;  4S2J A;  3TRC A;  4NKP A;  5CXW A;  2FH5 A;  2VV6 A;  3PYP A;  2P04 A;  5FI6 A;  4ZJ1 A;  2ZQ7 A;  3EQU A;  1FCO A;  2HF6 A;  5HX9 A;  1ZG6 A;  2ZQ9 A;  2Y2Q A;  3LY4 A;  2JKF A;  4CQH A;  4ARZ B;  3QP1 A;  2ZC3 B;  2JCH A;  3EWK A;  3M6B A;  1BUL A;  4WMC D;  3LCE A;  4XUX A;  3LR5 A;  1VET A;  3VOZ A;  5EV0 A;  3OZH A;  3WS2 A;  2EX2 A;  2ZM0 A;  3BY9 A;  5K5B A;  4I3I A;  2R78 A;  4ZDX A;  4NEE D;  5DTT A;  4BLM A;  2K7S A;  3CUE C;  4ZBE A;  2KX6 A;  3V67 A;  1HD8 A;  1XA1 A;  1ESU A;  2ZBB A;  1VB6 A;  1LI0 A;  4KG2 A;  1YLY A;  3L7H A;  2Z6C A;  5F68 A;  3NY4 A;  5AVE A;  3ZNT A;  1YT4 A;  3B33 A;  3B3X A;  2Y2H A;  4C3Q A;  1DY6 A;  1WA9 A;  3A3D A;  2UV0 E;  3NDE A;  1MZU A;  1PZP A;  2HDQ A;  4FOF A;  2H0Y A;  3EEA A;  4OQG A;  3IHA A;  3PR6 A;  2EWW A;  1XGI A;  3VP1 A;  1FR6 A;  3R7W A;  2B5R A;  4HP9 A;  4X1M A;  2OWJ A;  2Y2L A;  3QP5 A;  1NLY A;  3ZG5 A;  4NXB A;  3ZYT A;  4LLO B;  4I5S A;  1OT9 A;  3W2Z A;  1S1Z A;  2Y2O A;  1CI8 A;  5MC7 A;  2VZW A;  2WAF A;  3CI6 A;  4KQR A;  1I5Q A;  4DF6 A;  1ZG4 A;  4II7 A;  3FKW A;  1PZO A;  2D02 A;  3Q7Z A;  2PAV P;  2A24 A;  2ZLY A;  2P9V B;  1LL9 A;  2HJE A;  5DVA A;  1VEU B;  1K25 A;  1L0D A;  4JGR A;  3ZFZ A;  2VGL S;  2W3F A;  3TOI A;  2KOI A;  3SS5 A;  4R3B A;  1Q2Q A;  3JVU A;  1DP8 A;  4MCW A;  2VGK A;  2G7U A;  2Y8H A;  2O9A A;  1YLW A;  3HCY A;  1S0W A;  3IF6 B;  4HJ4 A;  2O9B A;  1T18 A;  4KZ5 A;  4ARZ A;  1L2S A;  3PBO A;  2V8C A;  5IU1 A;  1T1B A;  4IJG A;  4KEN B;  3BWL A;  3N8L A;  2UWX A;  1PNE A;  4KZ7 A;  1NWZ A;  4PM9 A;  5CRF A;  1T19 A;  2WZZ A;  1XGJ A;  4S2P A;  4EUZ A;  2WZX A;  1ERQ A;  2ZQC A;  2NUP C;  3S7Q A;  2Q9M A;  5FEG A;  2PYR A;  1S67 L;  3ZG8 B;  4IUK A;  1LT0 A;  3NCK A;  3GVB A;  2DNS A;  2W0N A;  3IX8 A;  4KG6 A;  3ZHH A;  3ZVW A;  3MXR A;  3E2K A;  4CLC B;  4Q8I A;  3V3R A;  1IFQ A;  3EGX C;  4RX2 A;  3S1Y A;  2H0T A;  4O01 A;  5CGW A;  2WUQ A;  2WKQ A;  3GEC A;  1SDE A;  3HJI A;  5HWV A;  1OJ5 A;  4I38 A;  4ETZ A;  1ZC2 A;  4DJ2 A;  4OOY A;  4PPR A;  3I7J A;  1IYO A;  3WWX A;  3EGD C;  3ULF A;  1L0F A;  1TS7 A;  3EQV A;  2Y2M A;  3GQZ A;  5KSC A;  4XXR A;  5FAO A;  3L9K A;  3IT9 A;  3UB7 A;  3CMZ A;  3Q07 A;  1LHY A;  1Y54 A;  1D06 A;  4L0L A;  3MKF A;  2OOL A;  4GD6 A;  2J8Y A;  2ZC6 B;  4NK3 A;  4KZB A;  1BZA A;  4PAU A;  3GR2 A;  5IHV A;  2OWH A;  1NY0 A;  1CF0 A;  4DMZ A;  4OQ0 A;  4O7D A;  3PBT A;  5KIZ A;  2HP9 A;  1EW0 A;  4HNB A;  3EEH A;  5EEC A;  4R6L A;  4QD4 A;  2JKG A;  2P9V A;  4MN5 A;  3NJA A;  3SOI A;  4JGP A;  1OTE A;  1DJC A;  2CC1 A;  1VEU A;  4JKT A;  5DTS A;  2ZMA A;  1FQG A;  4DXB A;  3QP4 A;  3ZG7 B;  2VGL M;  1OPX A;  1CK3 A;  4GD8 A;  2H28 A;  3B42 A;  1LLB A;  3WS4 A;  2J3T D;  2J80 A;  4R3J A;  1S4R A;  4HBT A;  2VX8 A;  5CEB A;  1SDN A;  3BEB A;  1PI4 A;  4PM5 A;  5J8X A;  2HDS A;  5L09 A;  4ESP A;  3PBN A;  5C5K A;  1UWP X;  2GZA A;  3LR0 A;  3IF6 A;  3SS4 A;  5GHX A;  4ID4 A;  3IXB A;  1ZTU A;  4X56 A;  4S2N A;  3H9W A;  4HIA A;  3A3J A;  5EFW A;  4L9G A;  2OV5 A;  2E8I A;  5EVI B;  4WN5 A;  4ETX A;  2ZC7 A;  4G3V A;  4KZ3 A;  2V8F A;  4UA7 A;  4FH4 A;  3BY8 A;  1H8M A;  3HL9 A;  2L1M A;  3FPW A;  3W4O A;  3SS3 A;  4CLC A;  4Y2F A;  3HUO A;  2ZL1 B;  1XXM A;  3UE3 A;  3C7U A;  1H5X A;  1HTZ A;  3UE6 A;  4RVA A;  3M6H A;  3P09 A;  2R9W A;  2L4R A;  2GNX A;  3OPR A;  1H0M A;  1RCJ A;  1FSW A;  1ES5 A;  3T1X A;  4KZ9 A;  4FH2 A;  3A3F A;  4XUZ A;  1TEM A;  3BLM A;  3SZT A;  1PI5 A;  5DKK A;  3BYD A;  1PWG A;  1PWC A;  3QP2 A;  1W5D A;  3UNW A;  3CAX A;  2Y2P A;  4C6Y A;  1KGF A;  2IA2 A;  2JKT I;  1GSV A;  3BM6 A;  3T12 B;  5A93 A;  3CG5 A;  1YLP A;  2RCX A;  2XFS A;  2QJ5 A;  3PAE A;  4HEF A;  3ZGA B;  5HAI A;  5EVE A;  5HFO A;  4KQO A;  3M2J A;  1NLZ A;  1MC0 A;  4FD8 A;  1IEM A;  4LV3 A;  2JKT M;  4DDS A;  3HRE A;  3CIT A;  4EXO A;  3O87 A;  4R4R A;  4ZJ2 A;  1DP6 A;  5GLD A;  2Y4A A;  2HV1 A;  2ZOI A;  3OOV A;  4E3N A;  3D72 A;  2VKS A;  4HES A;  3MQQ A;  3WS1 A;  1STZ A;  2NUT C;  4N1H A;  4KQD A;  1FCM A;  4C75 A;  4OPR A;  3VSK A;  3ZG0 A;  1DJB A;  2Y55 A;  3F1N A;  3O88 A;  1YMX A;  1K56 D;  1DRM A;  2EX9 A;  2J9O A;  3ZCZ A;  4ZTK A;  4LRX C;  3VOL A;  4OLG A;  4DE0 A;  4HOI A;  2PR6 A;  4FSF A;  5FQJ A;  3TW8 A;  3T1S A;  1SHV A;  1I2W A;  3HVF A;  2H10 A;  1MWS A;  4S2M A;  4QHC A;  2XF3 A;  3FYZ A;  3Q1F A;  1ZHH B;  4UEY A;  2Z6D A;  1BLP A;  1GCE A;  5FAT A;  3IX3 A;  3LIC A;  5EVI A;  3HLD A;  4LPZ A;  4N1X A;  3R7W B;  2WGI A;  3AGE A;  3IBR A;  4HHD A;  5CGS A;  2A2L A;  3FPV A;  3IXH A;  2W3E A;  4LCM A;  3OCN A;  3MQ0 A;  4WBG A;  2ZL1 A;  3PAG A;  3JPU A;  5HAQ A;  3KSI A;  4U3T A;  4H6J B;  3OPL A;  5GL9 A;  4WEL A;  1JWP A;  3LIA A;  4BBU A;  2P7J A;  3LY3 A;  5EM1 A;  3CJM A;  4IED A;  3D4F A;  4Y17 A;  2QYB A;  3FWL A;  4WZ4 A;  3W4Q A;  1SCW A;  2A24 B;  4E6X A;  1N9O A;  1N9B A;  5IS1 A;  1W8Y A;  4IBR A;  2I9V A;  3T50 A;  4P0M A;  4HJ6 A;  2LB5 A;  4X1L A;  5EUA A;  3P7N A;  5CTM A;  5IT5 A;  1G6A A;  5HZH A;  3TSG A;  1PRQ A;  2WKP A;  3PHY A;  2WKR A;  5A91 A;  4JLF A;  3BJN A;  4JXS A;  4MMN A;  5GLC A;  3AGF A;  1LL8 A;  3K3D A;  1D1J A;  4N9L A;  1YSQ A;  2PRF A;  4GS9 A;  4UHU A;  3NOU C;  1L3L A;  3IQA A;  4OQI A;  4S2K A;  3G6O A;  2XDM A;  1TDG A;  2EXA A;  2XSS A;  3VSL A;  4H8R A;  1MPL A;  4IBX A;  3S22 A;  1LSV A;  5FAS A;  3MZE A;  1YAX A;  2PU4 A;  4FCF A;  1XJ4 A;  5F1G A;  5F69 A;  4E6W A;  3MFX A;  4P6Z S;  4DRT A;  4R3A A;  2OAP 1;  2VV7 A;  5LBR A;  3D3O A;  4Y15 A;  4O0P A;  3TG9 A;  3DTK A;  4HI4 A;  3C4P A;  3LUQ A;  2P74 A;  1BYW A;  4NG2 A;  4ZAM A;  3OCL A;  3HLC A;  1ERM A;  1XJ2 A;  3KSF A;  3T4T A;  4HP4 A;  1TDL A;  4UQI S;  2Y79 A;  2M7V A;  3N7W A;  4H6J A;  3KYE A;  1E3U D;  5DKL A;  3ZQ5 A;  3QNC A;  3OBF A;  2G2U A;  3N8R A;  4KZ4 A;  3KX0 X;  3PBS A;  3UME A;  4LRY C;  5M19 A;  5EVI C;  1H3Q A;  5HSQ A;  2V1A A;  3G32 A;  2ZQA A;  2W3H A;  3HLB A;  2R9X A;  2HP5 A;  3DTE A;  1S4S A;  4U0X A;  5DF9 A;  2WGW A;  5BOH A;  4P87 A;  4MN7 A;  3C7V A;  1FIL A;  2HGV A;  3A0V A;  5EPH A;  4EQI A;  3O5Y A;  4OP5 A;  1RP5 A;  1K57 A;  5CEC A;  3HBR A;  4RX3 A;  5I5L A;  3GRJ A;  2ZM2 A;  4MEZ A;  3S7N A;  2PBD P;  1I2S A;  4MBK A;  2QJ7 A;  1PFL A;  1MKI A;  4KG5 A;  5KSH A;  3OC2 A;  3MFD A;  3LIE A;  4E04 A;  1ACF A;  2DMW A;  3H82 B;  3E4Q A;  4YFM A;  3LI9 A;  4D60 A;  4EEU A;  1Z6F A;  4OPQ A;  3VP3 A;  1OTI A;  2V1Z A;  2G2W A;  1P97 A;  2XRN A;  2VJW A;  1RGZ A;  1G6O A;  5AJG A;  3V50 A;  1FCN A;  4WZ5 A;  1CEG A;  4JPM A;  3QNB A;  5TJJ A;  5EM0 A;  1YMS A;  3ITB A;  2J7V A;  5F1F A;  3LEQ A;  1TVF A;  1YLZ A;  2JN7 A;  3A3I A;  3NHQ A;  5DFY A;  1RGY A;  2Y2N A;  4P6Z M;  4LV1 A;  4OOL A;  3PXP A;  4JBF A;  2D01 A;  1G68 A;  2LB9 A;  4I3J A;  2JHE A;  4M4X A;  4IHQ A;  4GB7 A;  2KDK A;  1NZO A;  3HJK A;  3M2K A;  4JXV A;  3VP2 A;  4ZJ3 A;  4E3I A;  5DJU A;  4WMC A;  4ZRR A;  4ME4 A;  3MR0 A;  3ISG A;  1L0E A;  4DE1 A;  4GOG A;  4UQI M;  5CHJ A;  3ZNY A;  1LSX A;  5FDS A;  3JVV A;  5HD3 A;  2M7U A;  1D7E A;  5HDD A;  5AQ9 A;  4WLA A;  4B88 A;  2OLV A;  3IXG A;  5L2F A;  1O7E A;  3VP4 A;  3U4L P;  5DTK A;  2VV8 A;  1K0K A;  4F94 A;  3OPH A;  3VE3 A;  2GX5 A;  4GW9 A;  4OH0 A;  1ALQ A;  1ES4 A;  3GV9 A;  1L0G A;  3N6I A;  3TE8 A;  4QWO A;  4HQA A;  4Y13 A;  1S1Y A;  3IF5 A;  4LEN A;  4EBL A;  3Q82 A;  2DCF A;  1ODV A;  5EE8 A;  3F1N B;  2FFY A;  3ITA A;  1KVM A;  2WYX A;  2PYP A;  4EES A;  4F3L B;  4EWF A;  2ZMF A;  1Y4O A;  2OAQ 1;  3G4P A;  4MNR A;  1JWZ A;  3WRZ A;  3VMA A;  4MN6 A;  3T4Q A;  3IXD A;  5DFX A;  3H82 A;  3BFG A;  1T1A A;  1XPB A;  5GHZ A;  1XKZ A;  5G4Z A;  4CPK A;  3G35 A;  5DF8 A;  1XJ6 A;  3WRT A;  3P98 A;  3EOI A;  4IUH A;  2Y91 A;  1NZU A;  5A8B A;  5GLB A;  2FZ0 A;  4Y3I A;  3LO7 A;  3WS5 A;  2PD7 A;  1J9M A;  2HDU A;  4G3W A;  2X02 A;  3UN7 A;  3MSH A;  2V9A A;  1YKD A;  5AQB A;  4S2O A;  5HAP A;  3UMD A;  4X69 A;  1UGU A;  4OPY A;  1IYQ A;  1WYB A;  4HY8 A;  1K54 A;  4HH2 A;  5FL3 A;  4JGO A;  1YQS A;  1MWT A;  1FOF A;  1W63 M;  3DW0 A;  4BD1 A;  1ZKJ A;  5G18 A;  1DP9 A;  2OSU A;  4LV0 A;  5TFQ A;  4JXG A;  5A92 A;  2BLS A;  3UDX A;  4EV4 A;  3UPN A;  4HJ3 A;  2IWD A;  3ZG9 B;  4QY6 A;  3QP8 A;  1PYY A;  3IWI A;  4A5R A;  4Q0I A;  2W1R A;  4B4Z A;  1F98 A;  3ZDJ A;  1QMF A;  4E3M A;  2Z2L B;  5E2H A;  2JE5 A;  1W79 A;  2V20 A;  3NC8 A;  3NI9 A;  3H7W B;  5CTN A;  1TS8 A;  3A0S A;  3CUE A;  5J7E A;  1KOU A;  4PMA A;  1ONG A;  3N4I A;  3C2W A;  4WEJ A;  1A0K A;  4GS9 B;  4DE3 A;  3JYI A;  1BLH A;  2XGN A;  3G30 A;  4K0W A;  5EOO A;  2K31 A;  4U0T A;  2K2N A;  4WF0 A;  3UB5 P;  2IWC A;  2QHK A;  4MDZ A;  2HDR A;  4GDB A;  1ES2 A;  1CEF A;  3NBL A;  4F3L A;  1IKG A;  3KO6 A;  1DJA A;  3UB8 A;  5L8M A;  1KDS A;  4LGW A;  3O3V A;  1M6K A;  3UB9 A;  4Y0O A;  1MWR A;  2EXB A;  5FAQ A;  1N4O A;  3IH9 A;  1OTA A;  1K6R A;  2JKR I;  3NOT C;  1ONH A;  5F5Y A;  4BQM A;  4CJN A;  4X6T A;  2JC7 A;  1V9Y A;  2O9C A;  1KE4 A;  4RYE A;  1K55 A;  3NDG A;  3KSG A;  4X53 A;  5A90 A;  2Q9N A;  4IVK A;  4X25 A;  1YSP A;  1IEL A;  3NOP C;  3IF6 C;  3UE1 A;  3U2A A;  4LV2 A;  4WYY A;  4CLC E;  1LI9 A;  4OOM A;  2I72 A;  4R23 A;  3T4S A;  3VOY A;  4HBU A;  1JTG A;  3BLS A;  3DWZ A;  5F83 A;  4S2N C;  2XA7 S;  1NYY A;  2EX6 A;  1FR1 A;  3D9Y A;  3GTC A;  1OME A;  2V2F F;  3MKE A;  2PDR A;  3OLO A;  3C38 A;  2QKP A;  5FDH A;  3DTI A;  2P08 A;  3UDF A;  3MS6 A;  2Y2J A;  1BTL A;  1LL5 A;  5M18 A;  4NXF A;  2WGW B;  2V0W A;  5JYO A;  4QJG A;  2A3U A;  4G3K A;  3IX4 A;  2EX8 A;  1GSW A;  4CLC C;  4LRZ E;  3G2Z A;  4GZB A;  5L10 A;  3W8K A;  4OQH A;  1YPR A;  3BEC A;  4RA7 A;  2V0U A;  3SH9 A;  2ZM8 A;  3CHW P;  1Q2P A;  3GSG A;  3MMH A;  2B18 A;  3H7W A;  1E25 A;  5J4E A;  5E2F A;  4K08 A;  1KVL A;  2ZD8 A;  2J9P A;  4KZ6 A;  2FFF B;  4GHI B;  3VV4 A;  2PR5 A;  3W4P A;  4DJ3 A;  4AFI A;  3MXS A;  4FTX A;  4E3K A;  5HPF A;  2OLU A;  2YKH A;  4EET B;  2VLG A;  3RJU A;  3CLO A;  1K4F A;  4Z1W A;  3S7O A;  4E3L A;  1P0Z A;  1CI9 A;  4R1G A;  4EBP A;  3LFV A;  3ICY A;  1JNU A;  4WEK A;  1S6R A;  2WKH A;  1PW8 A;  1OJG A;  4YWZ A;  5DF7 A;  1E4D A;  3E2L A;  1W7F A;  3BRM A;  5HAR A;  4QPR A;  4MBF A;  3HLG A;  4R4S A;  2PU2 A;  1KGG A;  3V3S A;  1IOU A;  2O0Y A;  3UB6 A;  3OPP A;  1EI5 A;  2VA0 A;  5JYP A;  2WKE A;  3T4K A;  5AQA A;  1J3W A;  1VM1 A;  1YLT A;  2PBY A;  4NET A;  1XFQ A;  5E43 A;  3NEC A;  3BQA A;  4XT2 B;  4EER A;  1N9N A;  2Z2M B;  4WL9 A;  4K91 A;  1K56 A;  4X68 A;  2QWS A;  2XQZ A;  3S4X A;  1ES3 A;  4X55 A;  5E2E A;  2ZC5 B;  2XA7 M;  5HL1 A;  4R70 A;  3G34 A;  2XD1 A;  1Y28 A;  1GA9 A;  4WM9 A;  4EQ1 A;  4EEP A;  2WAD A;  3C4O A;  3RXW A;  1W63 Q;  5GHY A;  4D2O A;  3UDI A;  3VP0 A;  3RFB A;  1Z09 A;  3BW6 A;  5FI7 A;  1KDW A;  2PHY A;  1K55 C;  5G4Y A;  3VE4 A;  3DWK A;  2XR0 A;  2J3T C;  1XA7 A;  3SH7 A;  2BG1 A;  1JWV A;  1VQQ A;  1PIO A;  3T1Q B;  1H8Y A;  5L07 A;  4UA6 A;  3E0Y A;  2B95 A;  1TD5 A;  1EWZ A;  1CQA A;  3G2Y A;  3BQ8 A;  5FSR A;  2L0W A;  4PM8 A;  1FIK A;  4CLC D;  2AVX A;  1FSY A;  4I39 A;  5GLA A;  4GHI A;  3DBA A;  4PKY A;  2XFT A;  4BWI A;  3UPP A;  2ZOH A;  3BFE A;  3UE0 A;  3A3E A;  3AGD A;  3ZVT A;  5HDC A;  1HVB A;  2JBF A;  2XLN A;  3GDI A;  1P9W A;  3V5M A;  3QP6 A;  3MJQ A;  2W3G A;  4DXC A;  3HUM A;  1XX2 A;  3PBQ A;  4HH3 A;  1UWN X;  4PM6 A;  2GDN A;  5FA7 A;  2ZQ8 A;  4KUK A;  1XFN A;  1HLU P;  2E8J A;  2MJ6 A;  1S66 L;  3VFF A;  3SW1 A;  3MZF A;  4IVI A;  1T1C A;  1X0O A;  3Q7V B;  1F5M A;  2IWB A;  5CER A;  1IYS A;  1M40 A;  4EW7 A;  3BFF A;  4BL2 A;  4GLQ A;  1N9L A;  3KYZ A;  5FQ9 A;  4JF6 A;  3Q81 A;  3T4J A;  5M1A A;  4OPZ A;  5CED A;  3DAV A;  4P85 A;  5AQ7 A;  2EFX A;  3BFD A;  2YKF A;  3MF0 A;  4MBH A;  5D3O A;  3T4L A;  1F2K A;  4XT2 A;  3RH8 B;  3LR3 A;  4QY5 A;  4L9F A;  3R4K A;  1NYM A;  5F6A A;  4NXE A;  2B02 A;  3DTM A;  3RTY A;  5FQK A;  3UPO A;  1BLC A;  1MBL A;  1OTB A;  3BFC A;  5FAP A;  3RXX A;  4OLD A;  4I3A A;  2J3W A;  4QB8 A;  3SH8 A;  5CX7 A;  4JGQ A;  3LEZ A;  2VGJ A;  1IYP A;  2XD5 A;  1BLS A;  2X71 A;  4WUJ A;  5EVI D;  4B9O A;  4BL3 A;  3UO9 A;  2WGV A;  2WAE A;  3CWF A;  1XJ3 A;  2ACG A;  4DE2 A;  3LIB A;  3T1R A;  4FUW A;  2Y59 A;  5HPI A;  3MQO A;  2QMI A;  2Y2G A;  2PT7 A;  1VHM A;  3HLF A;  4L9E A;  5FQI A;  1BSG A;  3FG8 A;  3NIA A;  1SKF A;  2XEP A;  2H5S A;  4N9K A;  2BTF P;  3IBJ A;  1YM1 A;  4YNR A;  4GNU A;  3QHY A;  1E3U A;  2CMN A;  3HUN A;  1KE0 A;  3F1O B;  4DDY A;  5TBM B;  2WKI A;  2X01 A;  3K2N A;  2V1B A;  4KQQ A;  2RL3 A;  3IH8 A;  1JVJ A;  3IWQ A;  4O8G A;  4S2I A;  4Y0U A;  1K57 C;  5DJT A;  1TS0 A;  1HZO A;  5AVF A;  2HP6 A;  1AXB A;  4Y7P A;  4OKP A;  2GJ3 A;  4LFU A;  1GHP A;  5FEF A;  4GCZ A;  1BT5 A;  1PWD A;  3IHB A;  3Q7V A;  3PBR A;  3C8C A;  1XP4 A;  4P6B A;  4MLL A;  1GHM A;  1MXO A;  4RQ9 A;  5CHU A;  1SKO B;  3CZD A;  1V9Z A;  4UA9 A;  5FQQ A;  4E3J A;  3O86 A;  2KLI A;  3CPT B;  3MBZ A;  3IS2 B;  4KZA A;  5J3W A;  4E3O A;  1NXY A;  4WZ5 C;  3F1P B;  3FC7 A;  1K4E A;  4GKU A;  2W1T B;  5KMW A;  4YOF A;  2HJ9 C;  3C30 A;  3LYX A;  4UAA A;  1WYC A;  2M1C A;  1YLJ A;  3P01 A;  5U47 A;  4B93 A;  4S2L A;  1WE4 A;  3E98 A;  3K3C A;  4EBN A;  1LSW A;  4EU0 A;  1C3B A;  1K38 A;  5FQM A;  1TS6 A;  4KZ8 A;  5HL6 A;  3FZC A;  4NXG A;  1GSX A;  1SZV A;  2ZQD A;  2C6W B;  1G28 A;  3V39 A;  1H8Z A;  2ZJ9 A;  5CHM A;  1KE3 A;  4DKI A;  3HLW A;  4PM7 A;  2VK3 A;  4Y5F A;  4DN0 A;  5EOE A; 
#chains in the Genus database with same CATH homology
 2HGV A;  3A0V A;  2VGL M;  3O5Y A;  3MMH A;  2B18 A;  3H7W A;  1OPX A;  5J4E A;  4K08 A;  3LI8 A;  3S7P A;  2BAS A;  2H28 A;  3B42 A;  5I5L A;  4GHI B;  2J3T D;  4Q0H A;  2J80 A;  3VV4 A;  3S7N A;  1S4R A;  2VX8 A;  2W27 A;  2INW A;  2PR5 A;  2QJ7 A;  3T4O A;  4R38 A;  4DJ3 A;  4AFI A;  5KSH A;  3OC2 A;  5HPF A;  2YKH A;  4EET B;  3LIE A;  4E04 A;  1OT6 A;  2DMW A;  2VLG A;  4EUV A;  3CLO A;  3H82 B;  3PBN A;  5C5K A;  3E4Q A;  1UWP X;  2GZA A;  3LR0 A;  3LI9 A;  4Z1W A;  3S7O A;  4EEU A;  5HD5 A;  1P0Z A;  1OTI A;  1ZTU A;  2EWV A;  3LFV A;  3ICY A;  3F1O A;  1JNU A;  1P97 A;  4PHT A;  2XRN A;  4WEK A;  3TJZ C;  2VJW A;  1OTD A;  1G6O A;  3H9W A;  5AJG A;  4HIA A;  5TBM A;  5EFW A;  4L9G A;  3B47 A;  1F9I A;  1OJG A;  5TJJ A;  4YWZ A;  2VEA A;  2EA9 A;  1P9R A;  5HWW A;  4WN5 A;  2JN7 A;  4ETX A;  3NHQ A;  4G3V A;  5DFY A;  4QPR A;  4KUO A;  2JKR M;  4Q0J A;  3E4O A;  4P6Z M;  4OOL A;  3PXP A;  1IOU A;  2O0Y A;  3UB6 A;  3BY8 A;  1H8M A;  2L1M A;  2VA0 A;  3FPW A;  2D01 A;  2LB9 A;  1MKM A;  2O99 A;  3T4K A;  4I3J A;  2JHE A;  4M4X A;  4Y2F A;  3LIF A;  4IHQ A;  4CLC A;  3MXQ A;  3A0R A;  2KDK A;  4BBV A;  3LR4 A;  3UE3 A;  4BJP A;  3HJK A;  5HDS A;  1XFQ A;  3LID A;  2PD8 A;  3UE6 A;  4GJ4 A;  3BQA A;  1NRJ A;  4XT2 B;  5DJU A;  4EER A;  1N9N A;  2L4R A;  2GNX A;  4ZRR A;  2W3D A;  4WL9 A;  2QWS A;  4ME4 A;  3MR0 A;  3IS2 A;  4UQI M;  3F1P A;  1LSX A;  2XA7 M;  3KYQ A;  5DKK A;  4R70 A;  2XRO A;  4BMW A;  1Y28 A;  4EQ1 A;  2W1T A;  4PKY G;  4EEP A;  3JVV A;  3KSH A;  3CAX A;  5HD3 A;  2M7U A;  1D7E A;  2ZMV A;  1W63 Q;  5HDD A;  2IA2 A;  2JKT I;  1GSV A;  4BBT A;  4WLA A;  3RFB A;  3BW6 A;  5HWT A;  2PHY A;  2QJ5 A;  2VV8 A;  3E4P A;  5G4Y A;  1TF1 A;  4KQO A;  3VE4 A;  1NLZ A;  1MC0 A;  2J3T C;  3VE3 A;  2GX5 A;  4GW9 A;  2JKT M;  3TRC A;  3CIT A;  3TE8 A;  4EXO A;  3E0Y A;  1TD5 A;  4HQA A;  4NKP A;  1DP6 A;  2FH5 A;  3BQ8 A;  2VV6 A;  3PYP A;  2P04 A;  1S1Y A;  3EQU A;  2HV1 A;  2ZOI A;  2HF6 A;  3OOV A;  1ODV A;  2L0W A;  3F1N B;  4CLC D;  3D72 A;  2VKS A;  4I39 A;  3MQQ A;  1STZ A;  2NUT C;  2PYP A;  4GHI A;  4EES A;  4CQH A;  4KQD A;  4F3L B;  4ARZ B;  3DBA A;  3EWK A;  4PKY A;  4BWI A;  2ZMF A;  2ZOH A;  3F1N A;  2OAQ 1;  3LR5 A;  5HDC A;  1DRM A;  4MN6 A;  3T4Q A;  5DFX A;  3H82 A;  3GDI A;  1P9W A;  1T1A A;  3BY9 A;  5K5B A;  4LRX C;  3VOL A;  3MJQ A;  5G4Z A;  4I3I A;  2W3G A;  2R78 A;  4HOI A;  3PBQ A;  4NEE D;  2PR6 A;  4HH3 A;  1UWN X;  2K7S A;  1XJ6 A;  3CUE C;  4FSF A;  2KX6 A;  3V67 A;  3TW8 A;  3EOI A;  4IUH A;  4KUK A;  5A8B A;  1XFN A;  2FZ0 A;  2ZBB A;  2MJ6 A;  1S66 L;  1VB6 A;  4Y3I A;  2PD7 A;  3SW1 A;  2Z6C A;  1ZHH B;  5F68 A;  4G3W A;  5AVE A;  4UEY A;  2Z6D A;  1T1C A;  1X0O A;  3LIC A;  3B33 A;  2V9A A;  1WA9 A;  1F5M A;  1YKD A;  4LPZ A;  1MZU A;  3R7W B;  4EW7 A;  4GLQ A;  1N9L A;  3KYZ A;  3IBR A;  4HHD A;  2A2L A;  3FPV A;  4FOF A;  3EEA A;  3UMD A;  2W3E A;  3T4J A;  3PR6 A;  1UGU A;  3OCN A;  2EWW A;  3MQ0 A;  4HY8 A;  4HH2 A;  5FL3 A;  2YKF A;  4JGO A;  3R7W A;  1W63 M;  3MF0 A;  4HP9 A;  3KSI A;  4H6J B;  2OWJ A;  4WEL A;  1DP9 A;  3LIA A;  4BBU A;  3T4L A;  2P7J A;  4XT2 A;  3RH8 B;  3LR3 A;  1NLY A;  4NXB A;  3ZYT A;  4L9F A;  2QYB A;  4LLO B;  3R4K A;  4I5S A;  1OT9 A;  3W2Z A;  1S1Z A;  5F6A A;  4NXE A;  2A24 B;  2B02 A;  5MC7 A;  1N9O A;  2VZW A;  3RTY A;  3CI6 A;  4HJ3 A;  4II7 A;  5IS1 A;  1OTB A;  2D02 A;  2I9V A;  3T50 A;  4Q0I A;  2W1R A;  1F98 A;  4I3A A;  4HJ6 A;  2A24 A;  2LB5 A;  2J3W A;  2HJE A;  5CX7 A;  4JGQ A;  4JGR A;  3P7N A;  2VGL S;  3H7W B;  1TS8 A;  3A0S A;  3CUE A;  5IT5 A;  5J7E A;  1KOU A;  2W3F A;  3C2W A;  4WEJ A;  2KOI A;  4WUJ A;  5HZH A;  2WKP A;  3PHY A;  4B9O A;  2WKR A;  4GS9 B;  3CWF A;  1XJ3 A;  3LIB A;  3JVU A;  1DP8 A;  4MCW A;  3BJN A;  5HPI A;  3MQO A;  2G7U A;  2K31 A;  4MMN A;  2Y8H A;  2PT7 A;  1LL8 A;  1VHM A;  2K2N A;  4WF0 A;  3K3D A;  4L9E A;  1YSQ A;  2QHK A;  2O9A A;  4MDZ A;  3HCY A;  3FG8 A;  4GS9 A;  3NOU C;  3IBJ A;  4HJ4 A;  2O9B A;  1T18 A;  4YNR A;  4F3L A;  4ARZ A;  3PBO A;  2CMN A;  5IU1 A;  1T1B A;  3KO6 A;  4IJG A;  3F1O B;  3G6O A;  3BWL A;  3UB8 A;  5TBM B;  5L8M A;  2XSS A;  1LSV A;  1YAX A;  2V1B A;  3K2N A;  1NWZ A;  3UB9 A;  1T19 A;  1XJ4 A;  2NUP C;  5F69 A;  3S7Q A;  1OTA A;  2PYR A;  4O8G A;  2JKR I;  1S67 L;  3MFX A;  4P6Z S;  5DJT A;  1TS0 A;  3NOT C;  4IUK A;  4R3A A;  1LT0 A;  5F5Y A;  2OAP 1;  5AVF A;  2W0N A;  2VV7 A;  5LBR A;  3D3O A;  4O0P A;  4CLC B;  2GJ3 A;  1V9Y A;  2O9C A;  1IFQ A;  4GCZ A;  3KSG A;  3EGX C;  4HI4 A;  3PBR A;  3C8C A;  1YSP A;  3LUQ A;  3NOP C;  4O01 A;  2WKQ A;  3GEC A;  1BYW A;  4RQ9 A;  3U2A A;  3OCL A;  3HJI A;  4CLC E;  5HWV A;  1OJ5 A;  4I38 A;  4OOM A;  4ETZ A;  4DJ2 A;  1XJ2 A;  1V9Z A;  3T4S A;  3KSF A;  3T4T A;  4HP4 A;  2KLI A;  3IS2 B;  3EGD C;  5J3W A;  3ULF A;  4UQI S;  3F1P B;  1TS7 A;  2XA7 S;  2Y79 A;  3EQV A;  2M7V A;  3FC7 A;  2PDR A;  4H6J A;  3OLO A;  3UB7 A;  3C38 A;  2QKP A;  2W1T B;  4YOF A;  2HJ9 C;  3C30 A;  2P08 A;  3LYX A;  2M1C A;  4L0L A;  1D06 A;  5DKL A;  3P01 A;  3ZQ5 A;  2OOL A;  4B93 A;  3OBF A;  3E98 A;  4PAU A;  3K3C A;  1LSW A;  4NXF A;  2OWH A;  4EU0 A;  2V0W A;  3KX0 X;  3PBS A;  3UME A;  1TS6 A;  4G3K A;  5HL6 A;  4LRY C;  4DMZ A;  1H3Q A;  4NXG A;  3PBT A;  5KIZ A;  1GSX A;  4CLC C;  1GSW A;  5HSQ A;  2V1A A;  4LRZ E;  1EW0 A;  4HNB A;  2W3H A;  1G28 A;  3EEH A;  1S4S A;  4R6L A;  2V0U A;  5DF9 A;  4MN5 A;  3NJA A;  4JGP A;  1OTE A;  4Y5F A;  4MN7 A;  4DN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...