3DBAA

Crystal structure of the cgmp-bound gaf a domain from the photoreceptor phosphodiesterase 6c
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
171
structure length
171
Chain Sequence
RLEECNILFELLTEIQDEAGSMEKIVHKTLQRLSQLLAADRCSMFICRSRNGIPEVATRLLNVTPTSKFEDNLVNPDKETVFPLDIGIAGWVAHTKKFFNIPDVKKNNHFSDYLDKKTGYTTVNMMAIPITQGKEVLAVVMALNKLNASEFSKEDEEVFKKYLNFISLVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit al
publication title The Structure of the GAF A Domain from Phosphodiesterase 6C Reveals Determinants of cGMP Binding, a Conserved Binding Surface, and a Large cGMP-dependent Conformational Change.
pubmed doi rcsb
source organism Gallus gallus
total genus 49
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.4.35: 3',5'-cyclic-GMP phosphodiesterase.
pdb deposition date 2008-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3dbaA00
2VEAA 3BJNA 1YSQA 3DBAA 4ME4A 2LB5A 1ZTUA 3IBRA 4ZRRA 2XRNA 2B18A 3LFVA 4G3KA 2W1TA 2XROA 4MN7A 2LB9A 3W2ZA 2O9BA 5AJGA 4GLQA 3OOVA 4RQ9A 4G3WA 4Q0IA 2W3HA 3E0YA 4Y2FA 2W1RA 4IUKA 4QPRA 5L8MA 2G7UA 3RFBA 5K5BA 2Y79A 4MCWA 3NOTC 2HGVA 4MMNA 4G3VA 3K2NA 3S7QA 3TRCA 1YKDA 2O99A 3ZQ5A 3G6OA 2W3DA 3S7PA 3KO6A 3CITA 3KSFA 1MKMA 3NHQA 4LRXC 4ETZA 2VJWA 4Z1WA 2O9AA 3E98A 1STZA 1TD5A 2XSSA 3CI6A 4FOFA 4LRZE 5DFYA 4LRYC 2M7UA 4PAUA 2O9CA 3C2WA 4CQHA 4EUVA 3D3OA 3S7NA 1F5MA 3S7OA 5HSQA 4E04A 5HPFA 3EEAA 3OBFA 3MQ0A 2OOLA 4ETXA 3MF0A 5I5LA 2W3FA 4Q0JA 5HL6A 3NOPC 4IUHA 3O5YA 4Q0HA 1MC0A 2GX5A 2K2NA 4YNRA 3KSIA 2KOIA 3MMHA 4IJGA 4O01A 5LBRA 4DMZA 2W3GA 2K31A 4R70A 3VV4A 3KSGA 3IBJA 2W3EA 2KLIA 2O0YA 4YOFA 4GW9A 2ZMFA 1VHMA 4EU0A 3KSHA 4O8GA 1YSPA 3HCYA 3NOUC 2M7VA 4MDZA 4BWIA 2IA2A 5TJJA 2W1TB 4O0PA 2Y8HA 2QYBA 5C5KA 3R4KA 4R6LA 4DN0A 2VZWA 4Y3IA 5HPIA 1TF1A 4Y5FA 2VKSA 5DFXA
chains in the Genus database with same CATH superfamily
4I38A 2V8FA 4YWZA 1IKGA 2P7JA 3JVUA 3FZCA 5EECA 3NY4A 1TDGA 3QP4A 2ZOHA 1FQGA 4MBHA 1NXYA 3RH8B 3NI9A 3WWXA 3CMZA 1EWZA 1CK3A 1YLWA 2GJ3A 3E4PA 3OOVA 1PI5A 2W3HA 2ZM0A 5GHYA 1K56A 1MWUA 2G2UA 3P7NA 3E4QA 1S66L 4GB7A 2ZM8A 1OTBA 1IYSA 3VP3A 2VGLM 1PFLA 1NWZA 5F6AA 2PD8A 3FG8A 5GHXA 2ZLYA 3HL9A 3UY6A 3VSLA 3BRMA 3EWKA 3UB5P 3GVBA 5KMWA 3UPPA 4WL9A 1L3LA 4JGPA 1ESIA 3NCKA 5DF9A 1Y28A 1JWPA 3BFEA 5FQMA 4E6WA 1GCEA 5GL9A 3A3DA 1V9YA 1MC0A 5FI7A 4GN2A 1NLYA 4WZ5A 4X6TA 4P87A 1Y54A 1OTAA 5TR7A 4LLOB 3DWKA 1ERQA 3Q7ZA 3KSHA 3LY4A 3C8CA 2W0NA 4EBPA 5AQAA 1IYOA 3P01A 2V1AA 4R6LA 4KZ9A 2PT7A 1TF1A 4UA6A 3EOIA 3SH8A 4EWFA 3KYQA 4HI4A 4E3KA 1OJGA 5AJGA 2XEPA 2BTFP 3SS4A 4E3NA 1YKDA 5DJUA 3IT9A 1TS6A 1BTLA 3U4LP 3NHQA 1LL5A 4MN6A 4UA9A 1L0FA 4UAAA 5EVEA 4S2NC 1G6AA 2EX6A 4EUZA 4L9FA 4DXCA 4ZJ1A 5HWWA 2CMNA 3IH8A 3DTIA 2JHEA 3I7JA 3LICA 1ES2A 3HUNA 4HIAA 1FCOA 2WKQA 1H5XA 3G30A 2HDSA 3MJQA 3BY8A 4CPKA 4X56A 2KOIA 4UA7A 5FEFA 1TDLA 2O0YA 4Y15A 1JWZA 4DE2A 2XFSA 5CRFA 1WYBA 4MDZA 3PBOA 5TJJA 4QU3A 3QP6A 1YLTA 1YQSA 3SS5A 5F68A 4BD1A 3T1XA 3V3RA 1LSXA 1LSWA 3IS2A 3LEZA 2BASA 1QMFA 1P9WA 3BJNA 2HDRA 2PD7A 4WEKA 1RCJA 4GD6A 4R4RA 1NY0A 1ES3A 2YKHA 3H82A 1N9BA 1RP5A 4BMWA 4BBUA 3B42A 4X53A 4FUWA 2WKRA 3KYZA 3IF5A 1I5QA 3N4IA 3VP2A 3QP2A 4EV4A 3K2NA 5HX9A 5E43A 4R3AA 3SH7A 1WE4A 3S7PA 1UGUA 1XP4A 4DJ2A 3BLMA 3V50A 4Y13A 4N1XA 4HHDA 2A3UA 4OOYA 4Y17A 4QY6A 4I3IA 2BG1A 1K6SA 3VE3A 3FV7A 3MFDA 2JKGA 2VGKA 4OPQA 3F1NB 5DTKA 2ZC4B 5DTTA 5A90A 3S1YA 4GKUA 2X02A 4KG2A 4HOIA 4OPZA 4IJGA 4UHUA 1ERMA 2HJEA 1BLPA 3LIBA 1JTDA 1F2KA 5TBMA 4HBUA 1XFNA 5HW3A 1ACFA 1FOFA 5KSCA 3BY9A 4JF4A 4Y0OA 2V8CA 3JVVA 1O07A 2JCHA 2X01A 4DE1A 3MXRA 4PHTA 3DAVA 3C38A 1T1CA 2QPNA 4ARZB 4BQMA 2FFFB 3Q7VA 2VEAA 1K4EA 5EUAA 2FH5A 5HDDA 3W4QA 4F3LA 4KZ5A 2W1TA 5FAQA 2XROA 2PYPA 4LV2A 3KX0X 4EETB 1OTIA 1LI0A 2JBFA 4RQ9A 1M40A 3MZDA 4HJ3A 4FTXA 2G7UA 2ZL1A 3FKVA 2HP6A 3BM6A 3S7QA 1I2WA 2JE5A 2HPBA 3BFDA 4NK3A 5F1FA 2PR6A 5FASA 3T4QA 3KO6A 2J9PA 4MN5A 1YLZA 3E98A 2B02A 1STZA 1NRFA 1MKIA 4WEJA 3T4JA 3HLFA 2IWBA 2Y2LA 2ZQCA 4Z9QA 2XF3A 1XGIA 5JYPA 3M2KA 2G2WA 1QMEA 3LR5A 3MF0A 2VGJA 4WYYA 1K56D 4MBFA 2XGNA 5CECA 2DRWA 3MXSA 1PWDA 2NUPC 5LBRA 5E2FA 3VV4A 4CJNA 3IS2B 4R38A 5DF7A 3IHAA 1XXMA 1UWNX 5HDSA 4I3JA 2I9VA 4KZBA 3WS0A 1MZUA 1AWIA 3H82B 2QYBA 4S2KA 2J9OA 3SH9A 3HJIA 1TVFA 3ISGA 3PR6A 1MWTA 1K25A 3LIAA 3VOYA 4DF6A 3DBAA 1J3WA 1JNUA 3T12B 2JKFA 1GA0A 5DVAA 2B18A 4WZ5C 4UQIS 4PPRA 3NDGA 3IWIA 2O9BA 4H6JA 2J80A 3PBRA 1HZOA 4JXGA 4KUKA 5HAQA 4C3QA 5L8MA 1DP6A 2HV1A 3HLDA 2XA7S 5FQIA 3UE1A 3W8KA 4FH2A 3H7WA 2KDKA 1EI5A 1MBLA 3CITA 2OWJA 1LL8A 3RJUA 2XSSA 3CI6A 3WS1A 2QZ6A 1GSXA 2P04A 4LRYC 4XT2A 2O9CA 4EUVA 1CEGA 3UDFA 2EX2A 5J8XA 1ODVA 5CHMA 4ZDXA 2A49A 2Z6DA 3DTEA 4IVKA 3TW8A 3EEHA 1SCWA 4ETXA 2D01A 3VP1A 3LY3A 4KENB 4L9EA 5FDSA 3MMHA 3PXPA 3BYDA 5DJTA 4DMZA 5L09A 3SS3A 1TS7A 1BLSA 5DKKA 4MBKA 5J4EA 4WMCA 3CJMA 3NDEA 3Q7VB 3FWLA 2OV5A 3TJZC 5CGSA 1GHIA 3MS6A 2W1TB 1XX2A 3VMAA 2VZWA 4BL3A 2ZQDA 1ES5A 3OPHA 3WS5A 3V5MA 1HLUP 3A3IA 2ZL1B 4IVIA 2DMWA 3BQAA 3C5AA 3WRTA 3NC8A 4S2MA 4JXSA 3RXXA 2Y4AA 1CEFA 3DTKA 4Y0UA 5U47A 2MJ6A 2HGVA 4G3VA 1KVMA 4X69A 4L9GA 3B3XA 2O99A 1OJ5A 4R3JA 5CTNA 4KZ6A 3NECA 3IXHA 3IXBA 5EFWA 4LRXC 3SW1A 2WZXA 1N9OA 4QB8A 1WYCA 1MWSA 4NG2A 3LIEA 4XUXA 1WA9A 4HH2A 4YFMA 4OH0A 4R4SA 2PBYA 4BL2A 3EEAA 5L10A 3N8LA 4HESA 3TG9A 3GMWA 4OKPA 5GHZA 1W5DA 3GRJA 1E3UA 1JTGA 2JKTI 5CHUA 5HD5A 3KSIA 2OAQ1 2WADA 5CERA 1VEUA 3BECA 4X1MA 3IBJA 2J7VA 4YOFA 1DJCA 1O7EA 4C75A 1KDSA 3AGFA 5FL3A 1IEMA 2IA2A 3BFGA 3LO7A 3R7WA 4BD0A 3ZNTA 2PRFA 4BJPA 3GV9A 1JVJA 2ZC6B 1ZTUA 5EOEA 4NEED 4BBVA 2PDRA 1KGEA 3HUMA 3H7WB 1L2SA 4RYEA 2R78A 4G3WA 4HY8A 2XK1A 2WYXA 4IUKA 5GLAA 2ZQ7A 3A0RA 3RTYA 2Y2QA 5E2GA 2Y2JA 4DRTA 5EVLA 3JYIA 4MCWA 4XT2B 3TRCA 3PBTA 4OOMA 1KGFA 4OPRA 4E3JA 2Y2GA 3E4OA 1YMSA 3BFCA 5HZHA 4P6ZS 4WZ4A 3ULFA 3IHBA 1CQAA 4B88A 4FOFA 4E3LA 1X0OA 4S2OA 4DDSA 3CZDA 2GZAA 2A24A 5FQJA 4E04A 3ZHHA 1MY8A 3C30A 5EM1A 1L0EA 2V0WA 1G28A 2VV6A 5HL6A 3GQZA 3D9YA 3LGOA 4PKYA 1YAXA 4WUJA 1E4DA 2H0TA 4EERA 3TOIA 4ZTKA 5EPHA 1Z6FA 1K54A 1W63Q 4KG5A 3GECA 2X71A 4HP9A 4GS9B 3F1PB 4GW9A 1FIKA 1CJFA 4KQQA 4UEYA 1TS8A 3UMDA 3ZYTA 4NXGA 2EWWA 3CUEA 5HPIA 1KDWA 4NXEA 3A3FA 2Y2MA 1PWGA 4HP4A 5G4YA 4GD8A 1OT9A 2VKSA 3AGEA 2Y91A 5G4ZA 3VP0A 3G2YA 5FI2A 4KQDA 2XRNA 3LFVA 3F1OA 2V9AA 4LPZA 2QMIA 4JPMA 3PHYA 2W1RA 3IWOA 4OVDA 1SDEA 1T1AA 2WZZA 2J3WA 5L2FA 5HARA 2VK3A 2HJ9C 4XUZA 1YMXA 3QNBA 3ZVTA 3LEQA 3VFHA 4X55A 3JPUA 4LRZE 1AXBA 3PTEA 4PAUA 4IBRA 4AFIA 4EESA 5HSQA 3Q81A 4R0QA 3MQ0A 2PYRA 3P98A 4Q0JA 1V9ZA 2PU2A 1GA9A 2V1BA 5F83A 3GDIA 3L9KA 1EW0A 4OQ0A 3R7WB 4WM9A 4U0TA 2K31A 3HLEA 3N8RA 4IBXA 3RXWA 1PWCA 2FZ0A 3WRZA 2HZ5A 4EU0A 1S6RA 2ZM2A 2ZMAA 2M1CA 2J3TC 4M4XA 3UE3A 2ZQ8A 2Y2IA 1ZG4A 4PMAA 1K57A 5HAPA 3HREA 3R4KA 3G2ZA 2J3TD 1KE0A 2JKRM 1KGGA 1HVBA 3MZEA 2KX6A 4N9KA 3TE8A 3CG5A 1F9IA 2LB5A 2V1ZA 5AQBA 4JGRA 5FQQA 4PM8A 1UWPX 5TFQA 1PW1A 3LR4A 2LB9A 3OLOA 2PR5A 5CEBA 1BLHA 4Y2FA 4HJ4A 2HF6A 2XLNA 4I5SA 1D06A 3UMEA 4KZAA 1PZOA 2Y2PA 5DTSA 2C5WB 4LENA 2A24B 5HL1A 1D7EA 3UNWA 3ZG5A 4JF5A 1W8YA 3V67A 1XKZA 2Y55A 4ETZA 4KZ8A 2RCXA 3BWLA 4CLCA 4JGOA 1A0KA 3D4FA 4WELA 4CQHA 1ZG6A 5CX7A 5J7EA 1VB6A 4K0XA 1ZKJA 4WN5A 1PRQA 1K0KA 3PBQA 1FSWA 3CWFA 3PYPA 2AVXA 4YNRA 1TEMA 5KZHA 1XGJA 4KZ7A 2ZBBA 5F1GA 5KSHA 2ZJ9A 1K55A 2EA9A 1W79A 3W4PA 1S67L 3KSGA 4WBGA 3O88A 3T4OA 3EGDC 4HEFA 2ZMFA 1XJ3A 1VHMA 4EBNA 4GCZA 1FR6A 3MSHA 5I94A 1NYYA 4O8GA 2H10A 2XR0A 1CI8A 1G68A 1VETA 3T1SA 3N6IA 1K6RA 4X1LA 1FILA 3F1OB 5M18A 2ZMVA 4D2OA 4EQ1A 4DE0A 1Z09A 1G5UA 3FC7A 3UO9A 3SZTA 5FAPA 1W63M 1PNEA 2NUTC 2XD1A 3E2LA 1HD8A 4U0XA 1IFQA 2W27A 1E3UD 4MN7A 5GLCA 2P08A 3G32A 4KZ3A 3PAEA 2XDMA 2Y79A 3S4XA 4RA7A 4E6XA 1S0WA 4P6BA 5HD3A 4C6YA 1BSGA 3E2KA 4ESPA 3Q1FA 3C4OA 2M7UA 1P0ZA 3WS2A 4MLLA 2B5RA 3B33A 3D3OA 3S7NA 3UB8A 5EVIA 1L0GA 5FA7A 1XPBA 5HPFA 2WUQA 4UQIM 3OCLA 3OBFA 2HP9A 1NLZA 3HLCA 3BW6A 1KVLA 1S1ZA 4I39A 4N1HA 2ZD8A 5CGXA 1P9RA 4LV3A 2A2LA 2OLVA 1VM1A 4IUHA 3NULA 1ESUA 2VA0A 2XD5A 3HUOA 3ZNYA 1BULA 1J9MA 2XA7M 2Q9NA 4DXBA 1DJBA 2W3EA 3SOIA 4BENA 2KLIA 3MQQA 4X25A 3W4OA 4LGWA 2PAVP 2V0UA 4A5RA 3G35A 5IT5A 1RGZA 4O0PA 5TBMB 5C5KA 1XJ6A 5FATA 3IF6A 2ZOIA 2CC1A 4B4XA 1YPRA 2H5SA 4EBLA 1K54C 2P74A 3UB6A 1SDNA 4G3KA 4F3LB 2Y2OA 4P0MA 3FPVA 3HLBA 4PM9A 3E0YA 4JXWA 1P97A 4QPRA 2WGWA 3RFBA 1NJ4A 3CUEC 1DRMA 4CLCB 2OLUA 1DP8A 4MMNA 2XH9A 3T50A 1DJAA 5A91A 4IEDA 5M1AA 4P85A 1GHPA 1OT6A 3IXDA 4LV1A 3EQUA 1E25A 2O9AA 2GDNA 4S2LA 4FD8A 1YLJA 2C6WB 4LCLA 2JC7A 3MQOA 1PW8A 1BYWA 1IELA 2ZQAA 4CLCE 4HJ6A 3LR3A 5GLBA 4GDBA 1FR1A 1KOUA 4K0WA 5GLDA 2ACGA 1VETB 2XFTA 4JGQA 4X68A 2K2NA 1C3BA 1LI9A 4JXVA 1N4OA 1ZC2A 4B93A 1IYPA 4DKIA 2HDQA 2PU4A 3HCYA 2VGLS 3ZG0A 1DY6A 2EFXA 5FAOA 3Q82A 3VP4A 3K3CA 4Y3IA 1SKOA 3IQAA 4Y5FA 3T4SA 5HAIA 4S2IA 2QJ7A 3QP1A 4GNUA 4R23A 1FCNA 1I2SA 3C4PA 3IX4A 3LI8A 5CXWA 3MZFA 3VSKA 3GTCA 4EXOA 1FCMA 2EFUA 4N9LA 3IX3A 3MKEA 4H6JB 3IH9A 4S2JA 1GSWA 1K57C 2Q0OA 1BUEA 4GHIA 5FQ9A 3AGDA 5EVIB 1XJ4A 5F5YA 3FYZA 5AQ9A 1T19A 2L4RA 3BLSA 1VQQA 1JWVA 2INWA 1TD5A 2HP5A 4H8RA 2EXBA 3PBSA 4GOGA 4KQOA 3WS4A 4R3BA 3OPRA 4R1GA 4PM5A 1BLCA 4B4ZA 5EV0A 3N7WA 3F1NA 3ZG9B 3UN7A 2QWSA 3OPPA 4QWOA 3T1QB 1KE3A 3G4PA 4HBTA 3IXGA 3ZGAB 1DP9A 2JKRI 3UPNA 1OPXA 4Q0HA 3HLWA 1NZOA 5G18A 4O01A 3UB9A 3IF6B 3ZG8B 3UPOA 1LT0A 3A0SA 4CLCC 2VV7A 1S1YA 4GJ4A 2WKIA 4WF0A 1S4SA 4ID4A 2P9VA 4P6ZM 4CLCD 3QP8A 3C7UA 2OWHA 4ARZA 4HQAA 4B9OA 1MWRA 2YKFA 1YT4A 1IYQA 1ONHA 5A93A 4I3AA 4JF6A 3MBZA 3VFFA 2WGWB 1YSQA 3S22A 1EROA 3A3EA 4OONA 2OSUA 4ZRRA 3HBRA 1K55C 2Z2LB 3O87A 3W2ZA 3CPTA 4GLQA 4S2PA 4LFUA 3Q07A 1NRJA 2E8JA 2VLGA 1Y4OA 4JLFA 2Q9MA 3T4KA 4RX3A 3LI9A 3QP5A 3T4LA 1XA7A 4WLAA 3PBNA 2H28A 3LIDA 5L07A 5MC7A 3N8SA 1MKMA 2VJWA 5FSRA 2WGVA 1GHMA 4OQHA 4NXBA 5DFYA 1SKFA 1S4RA 3LCEA 1K4FA 1GSVA 4II7A 4FH4A 3S7OA 4HNBA 2BLSA 4LCMA 4QD4A 2OOLA 1YLYA 3IX8A 3BFFA 1CF0A 1BZAA 3NOPC 2IWCA 1OTEA 1N9LA 4E3IA 5DF8A 2W3GA 1SKOB 2E8IA 2JKTM 5AVEA 5AVFA 3V39A 2R9XA 3G34A 1ALQA 5E2HA 1VEUB 1ZHHB 3MFXA 4Q8IA 5EVIC 2WK0A 4OP8A 2R9WA 1H8ZA 2ZQ9A 1HTZA 5J3WA 2EWVA 1SZVA 4RX2A 5EVID 2ZC7A 5F69A 3G31A 1XA1A 4JKTA 1BT5A 4K91A 5EOOA 2V20A 4OQGA 4GHIB 3H9WA 3QNCA 1G6OA 3VOLA 4XXRA 2Y2KA 4OOLA 1H8MA 3OPLA 1RGYA 2WGIA 3M2JA 5K5BA 2OAP1 4OLGA 3NOTC 3ZG7B 3BEBA 1XFQA 2Y59A 5AQ7A 3IF6C 3U2AA 2DCFA 3G6OA 4NXFA 5FEGA 2W3DA 3C7VA 5EM0A 4YINA 2EX9A 3GSGA 5DKLA 3MKFA 2J8YA 4Y7PA 1H0MA 2WAFA 1IKIA 3ICYA 4NKPA 4U3TA 4WMCD 1K38A 3C2WA 4HH3A 5JYOA 1ONGA 4Y0TA 3UDXA 3B47A 5HDCA 4EEPA 2W3FA 3DW0A 1CI9A 5A92A 2P9VB 4DDYA 1PI4A 3T1RA 1Q2PA 3DWZA 2PHYA 3LR0A 4L0LA 2ZC5B 2FFYA 2WKPA 1LLBA 1T1BA 3LUQA 3DTMA 3CPTB 2GNXA 1U60A 4OQIA 5D3OA 4EW7A 4PM6A 3IBRA 4MEZA 1YLPA 3HJKA 3IWQA 3KYEA 4OLDA 3GR2A 3ZDJA 4S2NA 4Q0IA 5IHVA 4KQRA 3VE4A 5TGFA 2QJ5A 4OPYA 3A3JA 5CEDA 1PYYA 3LYXA 1W7FA 5A8BA 1SHVA 3UDIA 2QKPA 3D72A 3K3DA 5HWTA 1YM1A 1F98A 2EX8A 1XJ2A 4PKYG 4O7DA 4PM7A 5HFOA 3NIAA 3CHWP 5IU1A 2H0YA 2WKEA 4KG6A 3NBLA 2UV0E 4QJGA 3EQVA 2IWDA 3FPWA 4D60A 3OCNA 1PZPA 5CHJA 3MXQA 4GZBA 5I5LA 5HWVA 3ITBA 4QHCA 1MXOA 1MPLA 4BBTA 5F82A 3QHYA 4QY5A 3O5YA 3LIFA 2GX5A 1T18A 1IOUA 4ZJ3A 1LHYA 2PBDP 3ZFZA 2ZC3B 4R70A 3OZHA 5CTMA 3CAXA 1FSYA 1LSVA 1OTDA 1NYMA 3NOUC 2L0WA 3M6BA 4BWIA 4OP5A 1D1JA 3MR0A 5FDHA 2Y8HA 3O86A 4BLMA 5CGWA 1KE4A 1H8YA 5FQKA 5DFXA 2VV8A 5KIZA 3ITAA 2L1MA 1TS0A 4ME4A 2XQZA 4E3OA 4NETA 2Z2MB 3UB7A 4KZ4A 1Q2QA 2Z6CA 4KUOA 4FCFA 3T4TA 5FI6A 4M3KA 5IS1A 4JBFA 4DE3A 2K7SA 3OC2A 5BOHA 4DJ3A 1M6KA 3M6HA 4FSFA 4RVAA 1PIOA 3ZQ5A 4N92A 3UE0A 2V2FF 3KSFA 3O3VA 4Z1WA 2D02A 4EQIA 3PAGA 4ZAMA 4IHQA 4K08A 1ES4A 3L7HA 3EGXC 3ZVWA 2B95A 4ZBEA 3V3SA 1F5MA 4EEUA 2WAEA 1NZUA 3VOZA 2HDUA 4MNRA 4ZJ2A 2Y2NA 5E2EA 3UE6A 4GDNA 3HVFA 3P09A 2QHKA 5EE8A 1W8QA 2Y2HA 2I72A 3TSGA 3BQ8A 2JN7A 4GS9A 3F1PA 2WKHA 1N9NA 1OMEA 3HLGA 3FKWA 1LL9A 4E3MA 3CLOA 3A0VA 2DNSA 4F94A 1YSPA 3NJAA 2M7VA 4LV0A 3ZCZA 2UWXA 5M19A 2EXAA 1L0DA 4DN0A 2VX8A 2RL3A 1H3QA
chains in the Genus database with same CATH topology
3PR6A 4I38A 4YWZA 2KX6A 4I3AA 3LIAA 1YSQA 2P7JA 3DBAA 1F9IA 3TE8A 3JVUA 1JNUA 2LB5A 4JGRA 2ZOHA 1UWPX 4ZRRA 2B18A 3RH8B 4UQIS 3LR4A 2LB9A 2GJ3A 3OLOA 3W2ZA 3E4PA 2O9BA 2PR5A 4GLQA 3OOVA 4H6JA 2J80A 3PBRA 2W3HA 4Y2FA 4HJ4A 1NRJA 2VLGA 4KUKA 3P7NA 2HF6A 4I5SA 5L8MA 3T4KA 1DP6A 2HV1A 2XA7S 1D06A 3LI9A 3UMEA 3E4QA 3T4LA 1S66L 4WLAA 3PBNA 2A24B 1OTBA 2H28A 3LIDA 3H7WA 1D7EA 2KDKA 3V67A 2VGLM 1NWZA 5F6AA 5MC7A 2PD8A 3CITA 2OWJA 3FG8A 1MKMA 4ETZA 1LL8A 2VJWA 3EWKA 4NXBA 2XSSA 3BWLA 3CI6A 5DFYA 1S4RA 1GSXA 2P04A 4JGOA 4LRYC 4WL9A 4XT2A 4CLCA 4WELA 2O9CA 4CQHA 4EUVA 1GSVA 4JGPA 5CX7A 4II7A 5J7EA 1VB6A 3S7OA 4HNBA 1ODVA 5DF9A 1Y28A 4WN5A 2Z6DA 2OOLA 3TW8A 3EEHA 4ETXA 3NOPC 3PBQA 3CWFA 2D01A 1OTEA 3PYPA 1N9LA 1V9YA 1MC0A 4YNRA 4L9EA 3MMHA 3PXPA 1NLYA 2ZBBA 5DJTA 4DMZA 2W3GA 5KSHA 2JKTM 2EA9A 1TS7A 1S67L 3KSGA 5AVEA 1OTAA 5DKKA 5J4EA 5AVFA 3T4OA 3EGDC 2ZMFA 1XJ3A 1VHMA 4LLOB 4GCZA 1ZHHB 3MFXA 3KSHA 4O8GA 3C8CA 2W0NA 3TJZC 3F1OB 2ZMVA 2W1TB 3P01A 4EQ1A 2V1AA 4R6LA 5J3WA 2VZWA 2EWVA 2PT7A 1TF1A 3FC7A 5F69A 1W63M 2NUTC 3EOIA 1IFQA 2DMWA 3BQAA 2W27A 4GHIB 3H9WA 1G6OA 3KYQA 4HI4A 3VOLA 4MN7A 1OJGA 2P08A 5AJGA 4OOLA 1H8MA 5K5BA 2Y79A 2OAP1 3NOTC 2MJ6A 2HGVA 4G3VA 1XFQA 1YKDA 4L9GA 5DJUA 3U2AA 2O99A 1TS6A 5HD3A 1OJ5A 3G6OA 4NXFA 2W3DA 3NHQA 5EFWA 5DKLA 4LRXC 3SW1A 4MN6A 1N9OA 3ICYA 4NKPA 2M7UA 1P0ZA 3C2WA 4HH3A 3B33A 3D3OA 3S7NA 3LIEA 3UB8A 1WA9A 4HH2A 4L9FA 5HPFA 3EEAA 4UQIM 3OCLA 3OBFA 5HWWA 2CMNA 1NLZA 2JHEA 3LICA 3B47A 3BW6A 5HDCA 4EEPA 2W3FA 1S1ZA 4I39A 1P9RA 2A2LA 4HIAA 2WKQA 4IUHA 2VA0A 2JKTI 5HD5A 3MJQA 3BY8A 3KSIA 2KOIA 2XA7M 2OAQ1 3LR0A 2PHYA 3IBJA 2W3EA 2KLIA 2O0YA 4YOFA 3MQQA 4L0LA 2WKPA 5FL3A 2V0UA 4MDZA 1T1BA 2IA2A 3PBOA 5TJJA 5IT5A 3LUQA 4O0PA 5TBMB 5C5KA 1XJ6A 5F68A 3R7WA 1LSXA 1LSWA 2ZOIA 3IS2A 4BJPA 2BASA 2GNXA 1P9WA 3BJNA 4EW7A 2PD7A 4WEKA 1ZTUA 3IBRA 4NEED 3UB6A 4BBVA 3HJKA 2PDRA 2YKHA 4G3KA 3H82A 4BMWA 4F3LB 4BBUA 3H7WB 3B42A 3FPVA 2R78A 4G3WA 4Q0IA 3E0YA 2WKRA 4HY8A 3VE4A 4IUKA 1P97A 3KYZA 4QPRA 3RFBA 3A0RA 2QJ5A 3RTYA 3LYXA 3CUEC 1DRMA 4MCWA 4XT2B 4CLCB 1DP8A 5A8BA 4MMNA 3TRCA 3K2NA 3PBTA 4OOMA 2QKPA 3D72A 4R3AA 3T50A 3K3DA 3S7PA 5HWTA 1F98A 3E4OA 1UGUA 1XJ2A 4PKYG 4DJ2A 1OT6A 5HZHA 4P6ZS 3EQUA 3ULFA 2O9AA 4HHDA 5IU1A 4FOFA 1X0OA 4I3IA 3MQOA 2GZAA 1BYWA 2A24A 3EQVA 3VE3A 4E04A 3FPWA 3OCNA 4CLCE 3C30A 2V0WA 3MXQA 1G28A 3LR3A 4HJ6A 2VV6A 5I5LA 3F1NB 5HWVA 1KOUA 5HL6A 4PKYA 4BBTA 1YAXA 4WUJA 3O5YA 4EERA 3LIFA 4JGQA 2GX5A 2K2NA 4HOIA 1T18A 1IOUA 1W63Q 4IJGA 2HJEA 4R70A 3GECA 4HP9A 4GS9B 4B93A 3LIBA 3F1PB 4GW9A 3CAXA 1LSVA 1OTDA 5TBMA 4UEYA 1XFNA 1TS8A 3HCYA 3NOUC 2VGLS 3BY9A 3UMDA 2L0WA 4BWIA 3JVVA 3ZYTA 3MR0A 2Y8HA 3K3CA 4NXGA 2EWWA 3CUEA 4Y3IA 5HPIA 4NXEA 4HP4A 5G4YA 4PHTA 1OT9A 4Y5FA 2VKSA 5DFXA 3T4SA 3C38A 2VV8A 5G4ZA 1T1CA 4ARZB 5KIZA 2L1MA 2QJ7A 2VEAA 1TS0A 4KQDA 4ME4A 2FH5A 5HDDA 4F3LA 2XRNA 3LFVA 3F1OA 2W1TA 2XROA 2PYPA 3KX0X 4EETB 1OTIA 3LI8A 2V9AA 4LPZA 4RQ9A 3UB7A 3PHYA 2W1RA 2Z6CA 4EXOA 4KUOA 4HJ3A 1T1AA 2G7UA 4H6JB 3T4TA 2J3WA 5IS1A 1GSWA 2K7SA 3OC2A 4DJ3A 4GHIA 3S7QA 4FSFA 3ZQ5A 2PR6A 1XJ4A 5F5YA 2HJ9C 3T4QA 3KO6A 4MN5A 3KSFA 1T19A 2L4RA 4Z1WA 2D02A 3E98A 2B02A 1STZA 2INWA 1TD5A 4IHQA 4LRZE 4WEJA 3T4JA 4K08A 3PBSA 4KQOA 4PAUA 3EGXC 4AFIA 4EESA 1F5MA 5HSQA 4EEUA 3F1NA 2QWSA 3MQ0A 3UE6A 3LR5A 3MF0A 1DP9A 2PYRA 4Q0JA 1V9ZA 2V1BA 2JKRI 3GDIA 2QHKA 1OPXA 4Q0HA 1EW0A 3BQ8A 2JN7A 4GS9A 3R7WB 2NUPC 4O01A 3F1PA 5LBRA 2K31A 3VV4A 1N9NA 3UB9A 3IS2B 4R38A 2FZ0A 1LT0A 3CLOA 3A0SA 4CLCC 1UWNX 5HDSA 4I3JA 2VV7A 2I9VA 1S1YA 4EU0A 3A0VA 4GJ4A 2M1CA 4WF0A 1YSPA 2J3TC 4M4XA 3UE3A 1S4SA 3NJAA 2M7VA 4P6ZM 4CLCD 1MZUA 3H82B 2QYBA 2OWHA 3R4KA 4ARZA 4HQAA 4DN0A 2J3TD 4B9OA 2YKFA 3HJIA 2JKRM 2VX8A 1H3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VEA A;  3BJN A;  1YSQ A;  3DBA A;  4ME4 A;  2LB5 A;  1ZTU A;  3IBR A;  4ZRR A;  2XRN A;  2B18 A;  3LFV A;  4G3K A;  2W1T A;  2XRO A;  4MN7 A;  2LB9 A;  3W2Z A;  2O9B A;  5AJG A;  4GLQ A;  3OOV A;  4RQ9 A;  4G3W A;  4Q0I A;  2W3H A;  3E0Y A;  4Y2F A;  2W1R A;  4IUK A;  4QPR A;  5L8M A;  2G7U A;  3RFB A;  5K5B A;  2Y79 A;  4MCW A;  3NOT C;  2HGV A;  4MMN A;  4G3V A;  3K2N A;  3S7Q A;  3TRC A;  1YKD A;  2O99 A;  3ZQ5 A;  3G6O A;  2W3D A;  3S7P A;  3KO6 A;  3CIT A;  3KSF A;  1MKM A;  3NHQ A;  4LRX C;  4ETZ A;  2VJW A;  4Z1W A;  2O9A A;  3E98 A;  1STZ A;  1TD5 A;  2XSS A;  3CI6 A;  4FOF A;  4LRZ E;  5DFY A;  4LRY C;  2M7U A;  4PAU A;  2O9C A;  3C2W A;  4CQH A;  4EUV A;  3D3O A;  3S7N A;  1F5M A;  3S7O A;  5HSQ A;  4E04 A;  5HPF A;  3EEA A;  3OBF A;  3MQ0 A;  2OOL A;  4ETX A;  3MF0 A;  5I5L A;  2W3F A;  4Q0J A;  5HL6 A;  3NOP C;  4IUH A;  3O5Y A;  4Q0H A;  1MC0 A;  2GX5 A;  2K2N A;  4YNR A;  3KSI A;  2KOI A;  3MMH A;  4IJG A;  4O01 A;  5LBR A;  4DMZ A;  2W3G A;  2K31 A;  4R70 A;  3VV4 A;  3KSG A;  3IBJ A;  2W3E A;  2KLI A;  2O0Y A;  4YOF A;  4GW9 A;  2ZMF A;  1VHM A;  4EU0 A;  3KSH A;  4O8G A;  1YSP A;  3HCY A;  3NOU C;  2M7V A;  4MDZ A;  4BWI A;  2IA2 A;  5TJJ A;  2W1T B;  4O0P A;  2Y8H A;  2QYB A;  5C5K A;  3R4K A;  4R6L A;  4DN0 A;  2VZW A;  4Y3I A;  5HPI A;  1TF1 A;  4Y5F A;  2VKS A;  5DFX A; 
#chains in the Genus database with same CATH topology
 4I38 A;  2V8F A;  4YWZ A;  1IKG A;  2P7J A;  3JVU A;  3FZC A;  5EEC A;  3NY4 A;  1TDG A;  3QP4 A;  2ZOH A;  1FQG A;  4MBH A;  1NXY A;  3RH8 B;  3NI9 A;  3WWX A;  3CMZ A;  1EWZ A;  1CK3 A;  1YLW A;  2GJ3 A;  3E4P A;  3OOV A;  1PI5 A;  2W3H A;  2ZM0 A;  5GHY A;  1K56 A;  1MWU A;  2G2U A;  3P7N A;  3E4Q A;  1S66 L;  4GB7 A;  2ZM8 A;  1OTB A;  1IYS A;  3VP3 A;  2VGL M;  1PFL A;  1NWZ A;  5F6A A;  2PD8 A;  3FG8 A;  5GHX A;  2ZLY A;  3HL9 A;  3UY6 A;  3VSL A;  3BRM A;  3EWK A;  3UB5 P;  3GVB A;  5KMW A;  3UPP A;  4WL9 A;  1L3L A;  4JGP A;  1ESI A;  3NCK A;  5DF9 A;  1Y28 A;  1JWP A;  3BFE A;  5FQM A;  4E6W A;  1GCE A;  5GL9 A;  3A3D A;  1V9Y A;  1MC0 A;  5FI7 A;  4GN2 A;  1NLY A;  4WZ5 A;  4X6T A;  4P87 A;  1Y54 A;  1OTA A;  5TR7 A;  4LLO B;  3DWK A;  1ERQ A;  3Q7Z A;  3KSH A;  3LY4 A;  3C8C A;  2W0N A;  4EBP A;  5AQA A;  1IYO A;  3P01 A;  2V1A A;  4R6L A;  4KZ9 A;  2PT7 A;  1TF1 A;  4UA6 A;  3EOI A;  3SH8 A;  4EWF A;  3KYQ A;  4HI4 A;  4E3K A;  1OJG A;  5AJG A;  2XEP A;  2BTF P;  3SS4 A;  4E3N A;  1YKD A;  5DJU A;  3IT9 A;  1TS6 A;  1BTL A;  3U4L P;  3NHQ A;  1LL5 A;  4MN6 A;  4UA9 A;  1L0F A;  4UAA A;  5EVE A;  4S2N C;  1G6A A;  2EX6 A;  4EUZ A;  4L9F A;  4DXC A;  4ZJ1 A;  5HWW A;  2CMN A;  3IH8 A;  3DTI A;  2JHE A;  3I7J A;  3LIC A;  1ES2 A;  3HUN A;  4HIA A;  1FCO A;  2WKQ A;  1H5X A;  3G30 A;  2HDS A;  3MJQ A;  3BY8 A;  4CPK A;  4X56 A;  2KOI A;  4UA7 A;  5FEF A;  1TDL A;  2O0Y A;  4Y15 A;  1JWZ A;  4DE2 A;  2XFS A;  5CRF A;  1WYB A;  4MDZ A;  3PBO A;  5TJJ A;  4QU3 A;  3QP6 A;  1YLT A;  1YQS A;  3SS5 A;  5F68 A;  4BD1 A;  3T1X A;  3V3R A;  1LSX A;  1LSW A;  3IS2 A;  3LEZ A;  2BAS A;  1QMF A;  1P9W A;  3BJN A;  2HDR A;  2PD7 A;  4WEK A;  1RCJ A;  4GD6 A;  4R4R A;  1NY0 A;  1ES3 A;  2YKH A;  3H82 A;  1N9B A;  1RP5 A;  4BMW A;  4BBU A;  3B42 A;  4X53 A;  4FUW A;  2WKR A;  3KYZ A;  3IF5 A;  1I5Q A;  3N4I A;  3VP2 A;  3QP2 A;  4EV4 A;  3K2N A;  5HX9 A;  5E43 A;  4R3A A;  3SH7 A;  1WE4 A;  3S7P A;  1UGU A;  1XP4 A;  4DJ2 A;  3BLM A;  3V50 A;  4Y13 A;  4N1X A;  4HHD A;  2A3U A;  4OOY A;  4Y17 A;  4QY6 A;  4I3I A;  2BG1 A;  1K6S A;  3VE3 A;  3FV7 A;  3MFD A;  2JKG A;  2VGK A;  4OPQ A;  3F1N B;  5DTK A;  2ZC4 B;  5DTT A;  5A90 A;  3S1Y A;  4GKU A;  2X02 A;  4KG2 A;  4HOI A;  4OPZ A;  4IJG A;  4UHU A;  1ERM A;  2HJE A;  1BLP A;  3LIB A;  1JTD A;  1F2K A;  5TBM A;  4HBU A;  1XFN A;  5HW3 A;  1ACF A;  1FOF A;  5KSC A;  3BY9 A;  4JF4 A;  4Y0O A;  2V8C A;  3JVV A;  1O07 A;  2JCH A;  2X01 A;  4DE1 A;  3MXR A;  4PHT A;  3DAV A;  3C38 A;  1T1C A;  2QPN A;  4ARZ B;  4BQM A;  2FFF B;  3Q7V A;  2VEA A;  1K4E A;  5EUA A;  2FH5 A;  5HDD A;  3W4Q A;  4F3L A;  4KZ5 A;  2W1T A;  5FAQ A;  2XRO A;  2PYP A;  4LV2 A;  3KX0 X;  4EET B;  1OTI A;  1LI0 A;  2JBF A;  4RQ9 A;  1M40 A;  3MZD A;  4HJ3 A;  4FTX A;  2G7U A;  2ZL1 A;  3FKV A;  2HP6 A;  3BM6 A;  3S7Q A;  1I2W A;  2JE5 A;  2HPB A;  3BFD A;  4NK3 A;  5F1F A;  2PR6 A;  5FAS A;  3T4Q A;  3KO6 A;  2J9P A;  4MN5 A;  1YLZ A;  3E98 A;  2B02 A;  1STZ A;  1NRF A;  1MKI A;  4WEJ A;  3T4J A;  3HLF A;  2IWB A;  2Y2L A;  2ZQC A;  4Z9Q A;  2XF3 A;  1XGI A;  5JYP A;  3M2K A;  2G2W A;  1QME A;  3LR5 A;  3MF0 A;  2VGJ A;  4WYY A;  1K56 D;  4MBF A;  2XGN A;  5CEC A;  2DRW A;  3MXS A;  1PWD A;  2NUP C;  5LBR A;  5E2F A;  3VV4 A;  4CJN A;  3IS2 B;  4R38 A;  5DF7 A;  3IHA A;  1XXM A;  1UWN X;  5HDS A;  4I3J A;  2I9V A;  4KZB A;  3WS0 A;  1MZU A;  1AWI A;  3H82 B;  2QYB A;  4S2K A;  2J9O A;  3SH9 A;  3HJI A;  1TVF A;  3ISG A;  3PR6 A;  1MWT A;  1K25 A;  3LIA A;  3VOY A;  4DF6 A;  3DBA A;  1J3W A;  1JNU A;  3T12 B;  2JKF A;  1GA0 A;  5DVA A;  2B18 A;  4WZ5 C;  4UQI S;  4PPR A;  3NDG A;  3IWI A;  2O9B A;  4H6J A;  2J80 A;  3PBR A;  1HZO A;  4JXG A;  4KUK A;  5HAQ A;  4C3Q A;  5L8M A;  1DP6 A;  2HV1 A;  3HLD A;  2XA7 S;  5FQI A;  3UE1 A;  3W8K A;  4FH2 A;  3H7W A;  2KDK A;  1EI5 A;  1MBL A;  3CIT A;  2OWJ A;  1LL8 A;  3RJU A;  2XSS A;  3CI6 A;  3WS1 A;  2QZ6 A;  1GSX A;  2P04 A;  4LRY C;  4XT2 A;  2O9C A;  4EUV A;  1CEG A;  3UDF A;  2EX2 A;  5J8X A;  1ODV A;  5CHM A;  4ZDX A;  2A49 A;  2Z6D A;  3DTE A;  4IVK A;  3TW8 A;  3EEH A;  1SCW A;  4ETX A;  2D01 A;  3VP1 A;  3LY3 A;  4KEN B;  4L9E A;  5FDS A;  3MMH A;  3PXP A;  3BYD A;  5DJT A;  4DMZ A;  5L09 A;  3SS3 A;  1TS7 A;  1BLS A;  5DKK A;  4MBK A;  5J4E A;  4WMC A;  3CJM A;  3NDE A;  3Q7V B;  3FWL A;  2OV5 A;  3TJZ C;  5CGS A;  1GHI A;  3MS6 A;  2W1T B;  1XX2 A;  3VMA A;  2VZW A;  4BL3 A;  2ZQD A;  1ES5 A;  3OPH A;  3WS5 A;  3V5M A;  1HLU P;  3A3I A;  2ZL1 B;  4IVI A;  2DMW A;  3BQA A;  3C5A A;  3WRT A;  3NC8 A;  4S2M A;  4JXS A;  3RXX A;  2Y4A A;  1CEF A;  3DTK A;  4Y0U A;  5U47 A;  2MJ6 A;  2HGV A;  4G3V A;  1KVM A;  4X69 A;  4L9G A;  3B3X A;  2O99 A;  1OJ5 A;  4R3J A;  5CTN A;  4KZ6 A;  3NEC A;  3IXH A;  3IXB A;  5EFW A;  4LRX C;  3SW1 A;  2WZX A;  1N9O A;  4QB8 A;  1WYC A;  1MWS A;  4NG2 A;  3LIE A;  4XUX A;  1WA9 A;  4HH2 A;  4YFM A;  4OH0 A;  4R4S A;  2PBY A;  4BL2 A;  3EEA A;  5L10 A;  3N8L A;  4HES A;  3TG9 A;  3GMW A;  4OKP A;  5GHZ A;  1W5D A;  3GRJ A;  1E3U A;  1JTG A;  2JKT I;  5CHU A;  5HD5 A;  3KSI A;  2OAQ 1;  2WAD A;  5CER A;  1VEU A;  3BEC A;  4X1M A;  3IBJ A;  2J7V A;  4YOF A;  1DJC A;  1O7E A;  4C75 A;  1KDS A;  3AGF A;  5FL3 A;  1IEM A;  2IA2 A;  3BFG A;  3LO7 A;  3R7W A;  4BD0 A;  3ZNT A;  2PRF A;  4BJP A;  3GV9 A;  1JVJ A;  2ZC6 B;  1ZTU A;  5EOE A;  4NEE D;  4BBV A;  2PDR A;  1KGE A;  3HUM A;  3H7W B;  1L2S A;  4RYE A;  2R78 A;  4G3W A;  4HY8 A;  2XK1 A;  2WYX A;  4IUK A;  5GLA A;  2ZQ7 A;  3A0R A;  3RTY A;  2Y2Q A;  5E2G A;  2Y2J A;  4DRT A;  5EVL A;  3JYI A;  4MCW A;  4XT2 B;  3TRC A;  3PBT A;  4OOM A;  1KGF A;  4OPR A;  4E3J A;  2Y2G A;  3E4O A;  1YMS A;  3BFC A;  5HZH A;  4P6Z S;  4WZ4 A;  3ULF A;  3IHB A;  1CQA A;  4B88 A;  4FOF A;  4E3L A;  1X0O A;  4S2O A;  4DDS A;  3CZD A;  2GZA A;  2A24 A;  5FQJ A;  4E04 A;  3ZHH A;  1MY8 A;  3C30 A;  5EM1 A;  1L0E A;  2V0W A;  1G28 A;  2VV6 A;  5HL6 A;  3GQZ A;  3D9Y A;  3LGO A;  4PKY A;  1YAX A;  4WUJ A;  1E4D A;  2H0T A;  4EER A;  3TOI A;  4ZTK A;  5EPH A;  1Z6F A;  1K54 A;  1W63 Q;  4KG5 A;  3GEC A;  2X71 A;  4HP9 A;  4GS9 B;  3F1P B;  4GW9 A;  1FIK A;  1CJF A;  4KQQ A;  4UEY A;  1TS8 A;  3UMD A;  3ZYT A;  4NXG A;  2EWW A;  3CUE A;  5HPI A;  1KDW A;  4NXE A;  3A3F A;  2Y2M A;  1PWG A;  4HP4 A;  5G4Y A;  4GD8 A;  1OT9 A;  2VKS A;  3AGE A;  2Y91 A;  5G4Z A;  3VP0 A;  3G2Y A;  5FI2 A;  4KQD A;  2XRN A;  3LFV A;  3F1O A;  2V9A A;  4LPZ A;  2QMI A;  4JPM A;  3PHY A;  2W1R A;  3IWO A;  4OVD A;  1SDE A;  1T1A A;  2WZZ A;  2J3W A;  5L2F A;  5HAR A;  2VK3 A;  2HJ9 C;  4XUZ A;  1YMX A;  3QNB A;  3ZVT A;  3LEQ A;  3VFH A;  4X55 A;  3JPU A;  4LRZ E;  1AXB A;  3PTE A;  4PAU A;  4IBR A;  4AFI A;  4EES A;  5HSQ A;  3Q81 A;  4R0Q A;  3MQ0 A;  2PYR A;  3P98 A;  4Q0J A;  1V9Z A;  2PU2 A;  1GA9 A;  2V1B A;  5F83 A;  3GDI A;  3L9K A;  1EW0 A;  4OQ0 A;  3R7W B;  4WM9 A;  4U0T A;  2K31 A;  3HLE A;  3N8R A;  4IBX A;  3RXW A;  1PWC A;  2FZ0 A;  3WRZ A;  2HZ5 A;  4EU0 A;  1S6R A;  2ZM2 A;  2ZMA A;  2M1C A;  2J3T C;  4M4X A;  3UE3 A;  2ZQ8 A;  2Y2I A;  1ZG4 A;  4PMA A;  1K57 A;  5HAP A;  3HRE A;  3R4K A;  3G2Z A;  2J3T D;  1KE0 A;  2JKR M;  1KGG A;  1HVB A;  3MZE A;  2KX6 A;  4N9K A;  3TE8 A;  3CG5 A;  1F9I A;  2LB5 A;  2V1Z A;  5AQB A;  4JGR A;  5FQQ A;  4PM8 A;  1UWP X;  5TFQ A;  1PW1 A;  3LR4 A;  2LB9 A;  3OLO A;  2PR5 A;  5CEB A;  1BLH A;  4Y2F A;  4HJ4 A;  2HF6 A;  2XLN A;  4I5S A;  1D06 A;  3UME A;  4KZA A;  1PZO A;  2Y2P A;  5DTS A;  2C5W B;  4LEN A;  2A24 B;  5HL1 A;  1D7E A;  3UNW A;  3ZG5 A;  4JF5 A;  1W8Y A;  3V67 A;  1XKZ A;  2Y55 A;  4ETZ A;  4KZ8 A;  2RCX A;  3BWL A;  4CLC A;  4JGO A;  1A0K A;  3D4F A;  4WEL A;  4CQH A;  1ZG6 A;  5CX7 A;  5J7E A;  1VB6 A;  4K0X A;  1ZKJ A;  4WN5 A;  1PRQ A;  1K0K A;  3PBQ A;  1FSW A;  3CWF A;  3PYP A;  2AVX A;  4YNR A;  1TEM A;  5KZH A;  1XGJ A;  4KZ7 A;  2ZBB A;  5F1G A;  5KSH A;  2ZJ9 A;  1K55 A;  2EA9 A;  1W79 A;  3W4P A;  1S67 L;  3KSG A;  4WBG A;  3O88 A;  3T4O A;  3EGD C;  4HEF A;  2ZMF A;  1XJ3 A;  1VHM A;  4EBN A;  4GCZ A;  1FR6 A;  3MSH A;  5I94 A;  1NYY A;  4O8G A;  2H10 A;  2XR0 A;  1CI8 A;  1G68 A;  1VET A;  3T1S A;  3N6I A;  1K6R A;  4X1L A;  1FIL A;  3F1O B;  5M18 A;  2ZMV A;  4D2O A;  4EQ1 A;  4DE0 A;  1Z09 A;  1G5U A;  3FC7 A;  3UO9 A;  3SZT A;  5FAP A;  1W63 M;  1PNE A;  2NUT C;  2XD1 A;  3E2L A;  1HD8 A;  4U0X A;  1IFQ A;  2W27 A;  1E3U D;  4MN7 A;  5GLC A;  2P08 A;  3G32 A;  4KZ3 A;  3PAE A;  2XDM A;  2Y79 A;  3S4X A;  4RA7 A;  4E6X A;  1S0W A;  4P6B A;  5HD3 A;  4C6Y A;  1BSG A;  3E2K A;  4ESP A;  3Q1F A;  3C4O A;  2M7U A;  1P0Z A;  3WS2 A;  4MLL A;  2B5R A;  3B33 A;  3D3O A;  3S7N A;  3UB8 A;  5EVI A;  1L0G A;  5FA7 A;  1XPB A;  5HPF A;  2WUQ A;  4UQI M;  3OCL A;  3OBF A;  2HP9 A;  1NLZ A;  3HLC A;  3BW6 A;  1KVL A;  1S1Z A;  4I39 A;  4N1H A;  2ZD8 A;  5CGX A;  1P9R A;  4LV3 A;  2A2L A;  2OLV A;  1VM1 A;  4IUH A;  3NUL A;  1ESU A;  2VA0 A;  2XD5 A;  3HUO A;  3ZNY A;  1BUL A;  1J9M A;  2XA7 M;  2Q9N A;  4DXB A;  1DJB A;  2W3E A;  3SOI A;  4BEN A;  2KLI A;  3MQQ A;  4X25 A;  3W4O A;  4LGW A;  2PAV P;  2V0U A;  4A5R A;  3G35 A;  5IT5 A;  1RGZ A;  4O0P A;  5TBM B;  5C5K A;  1XJ6 A;  5FAT A;  3IF6 A;  2ZOI A;  2CC1 A;  4B4X A;  1YPR A;  2H5S A;  4EBL A;  1K54 C;  2P74 A;  3UB6 A;  1SDN A;  4G3K A;  4F3L B;  2Y2O A;  4P0M A;  3FPV A;  3HLB A;  4PM9 A;  3E0Y A;  4JXW A;  1P97 A;  4QPR A;  2WGW A;  3RFB A;  1NJ4 A;  3CUE C;  1DRM A;  4CLC B;  2OLU A;  1DP8 A;  4MMN A;  2XH9 A;  3T50 A;  1DJA A;  5A91 A;  4IED A;  5M1A A;  4P85 A;  1GHP A;  1OT6 A;  3IXD A;  4LV1 A;  3EQU A;  1E25 A;  2O9A A;  2GDN A;  4S2L A;  4FD8 A;  1YLJ A;  2C6W B;  4LCL A;  2JC7 A;  3MQO A;  1PW8 A;  1BYW A;  1IEL A;  2ZQA A;  4CLC E;  4HJ6 A;  3LR3 A;  5GLB A;  4GDB A;  1FR1 A;  1KOU A;  4K0W A;  5GLD A;  2ACG A;  1VET B;  2XFT A;  4JGQ A;  4X68 A;  2K2N A;  1C3B A;  1LI9 A;  4JXV A;  1N4O A;  1ZC2 A;  4B93 A;  1IYP A;  4DKI A;  2HDQ A;  2PU4 A;  3HCY A;  2VGL S;  3ZG0 A;  1DY6 A;  2EFX A;  5FAO A;  3Q82 A;  3VP4 A;  3K3C A;  4Y3I A;  1SKO A;  3IQA A;  4Y5F A;  3T4S A;  5HAI A;  4S2I A;  2QJ7 A;  3QP1 A;  4GNU A;  4R23 A;  1FCN A;  1I2S A;  3C4P A;  3IX4 A;  3LI8 A;  5CXW A;  3MZF A;  3VSK A;  3GTC A;  4EXO A;  1FCM A;  2EFU A;  4N9L A;  3IX3 A;  3MKE A;  4H6J B;  3IH9 A;  4S2J A;  1GSW A;  1K57 C;  2Q0O A;  1BUE A;  4GHI A;  5FQ9 A;  3AGD A;  5EVI B;  1XJ4 A;  5F5Y A;  3FYZ A;  5AQ9 A;  1T19 A;  2L4R A;  3BLS A;  1VQQ A;  1JWV A;  2INW A;  1TD5 A;  2HP5 A;  4H8R A;  2EXB A;  3PBS A;  4GOG A;  4KQO A;  3WS4 A;  4R3B A;  3OPR A;  4R1G A;  4PM5 A;  1BLC A;  4B4Z A;  5EV0 A;  3N7W A;  3F1N A;  3ZG9 B;  3UN7 A;  2QWS A;  3OPP A;  4QWO A;  3T1Q B;  1KE3 A;  3G4P A;  4HBT A;  3IXG A;  3ZGA B;  1DP9 A;  2JKR I;  3UPN A;  1OPX A;  4Q0H A;  3HLW A;  1NZO A;  5G18 A;  4O01 A;  3UB9 A;  3IF6 B;  3ZG8 B;  3UPO A;  1LT0 A;  3A0S A;  4CLC C;  2VV7 A;  1S1Y A;  4GJ4 A;  2WKI A;  4WF0 A;  1S4S A;  4ID4 A;  2P9V A;  4P6Z M;  4CLC D;  3QP8 A;  3C7U A;  2OWH A;  4ARZ A;  4HQA A;  4B9O A;  1MWR A;  2YKF A;  1YT4 A;  1IYQ A;  1ONH A;  5A93 A;  4I3A A;  4JF6 A;  3MBZ A;  3VFF A;  2WGW B;  1YSQ A;  3S22 A;  1ERO A;  3A3E A;  4OON A;  2OSU A;  4ZRR A;  3HBR A;  1K55 C;  2Z2L B;  3O87 A;  3W2Z A;  3CPT A;  4GLQ A;  4S2P A;  4LFU A;  3Q07 A;  1NRJ A;  2E8J A;  2VLG A;  1Y4O A;  4JLF A;  2Q9M A;  3T4K A;  4RX3 A;  3LI9 A;  3QP5 A;  3T4L A;  1XA7 A;  4WLA A;  3PBN A;  2H28 A;  3LID A;  5L07 A;  5MC7 A;  3N8S A;  1MKM A;  2VJW A;  5FSR A;  2WGV A;  1GHM A;  4OQH A;  4NXB A;  5DFY A;  1SKF A;  1S4R A;  3LCE A;  1K4F A;  1GSV A;  4II7 A;  4FH4 A;  3S7O A;  4HNB A;  2BLS A;  4LCM A;  4QD4 A;  2OOL A;  1YLY A;  3IX8 A;  3BFF A;  1CF0 A;  1BZA A;  3NOP C;  2IWC A;  1OTE A;  1N9L A;  4E3I A;  5DF8 A;  2W3G A;  1SKO B;  2E8I A;  2JKT M;  5AVE A;  5AVF A;  3V39 A;  2R9X A;  3G34 A;  1ALQ A;  5E2H A;  1VEU B;  1ZHH B;  3MFX A;  4Q8I A;  5EVI C;  2WK0 A;  4OP8 A;  2R9W A;  1H8Z A;  2ZQ9 A;  1HTZ A;  5J3W A;  2EWV A;  1SZV A;  4RX2 A;  5EVI D;  2ZC7 A;  5F69 A;  3G31 A;  1XA1 A;  4JKT A;  1BT5 A;  4K91 A;  5EOO A;  2V20 A;  4OQG A;  4GHI B;  3H9W A;  3QNC A;  1G6O A;  3VOL A;  4XXR A;  2Y2K A;  4OOL A;  1H8M A;  3OPL A;  1RGY A;  2WGI A;  3M2J A;  5K5B A;  2OAP 1;  4OLG A;  3NOT C;  3ZG7 B;  3BEB A;  1XFQ A;  2Y59 A;  5AQ7 A;  3IF6 C;  3U2A A;  2DCF A;  3G6O A;  4NXF A;  5FEG A;  2W3D A;  3C7V A;  5EM0 A;  4YIN A;  2EX9 A;  3GSG A;  5DKL A;  3MKF A;  2J8Y A;  4Y7P A;  1H0M A;  2WAF A;  1IKI A;  3ICY A;  4NKP A;  4U3T A;  4WMC D;  1K38 A;  3C2W A;  4HH3 A;  5JYO A;  1ONG A;  4Y0T A;  3UDX A;  3B47 A;  5HDC A;  4EEP A;  2W3F A;  3DW0 A;  1CI9 A;  5A92 A;  2P9V B;  4DDY A;  1PI4 A;  3T1R A;  1Q2P A;  3DWZ A;  2PHY A;  3LR0 A;  4L0L A;  2ZC5 B;  2FFY A;  2WKP A;  1LLB A;  1T1B A;  3LUQ A;  3DTM A;  3CPT B;  2GNX A;  1U60 A;  4OQI A;  5D3O A;  4EW7 A;  4PM6 A;  3IBR A;  4MEZ A;  1YLP A;  3HJK A;  3IWQ A;  3KYE A;  4OLD A;  3GR2 A;  3ZDJ A;  4S2N A;  4Q0I A;  5IHV A;  4KQR A;  3VE4 A;  5TGF A;  2QJ5 A;  4OPY A;  3A3J A;  5CED A;  1PYY A;  3LYX A;  1W7F A;  5A8B A;  1SHV A;  3UDI A;  2QKP A;  3D72 A;  3K3D A;  5HWT A;  1YM1 A;  1F98 A;  2EX8 A;  1XJ2 A;  4PKY G;  4O7D A;  4PM7 A;  5HFO A;  3NIA A;  3CHW P;  5IU1 A;  2H0Y A;  2WKE A;  4KG6 A;  3NBL A;  2UV0 E;  4QJG A;  3EQV A;  2IWD A;  3FPW A;  4D60 A;  3OCN A;  1PZP A;  5CHJ A;  3MXQ A;  4GZB A;  5I5L A;  5HWV A;  3ITB A;  4QHC A;  1MXO A;  1MPL A;  4BBT A;  5F82 A;  3QHY A;  4QY5 A;  3O5Y A;  3LIF A;  2GX5 A;  1T18 A;  1IOU A;  4ZJ3 A;  1LHY A;  2PBD P;  3ZFZ A;  2ZC3 B;  4R70 A;  3OZH A;  5CTM A;  3CAX A;  1FSY A;  1LSV A;  1OTD A;  1NYM A;  3NOU C;  2L0W A;  3M6B A;  4BWI A;  4OP5 A;  1D1J A;  3MR0 A;  5FDH A;  2Y8H A;  3O86 A;  4BLM A;  5CGW A;  1KE4 A;  1H8Y A;  5FQK A;  5DFX A;  2VV8 A;  5KIZ A;  3ITA A;  2L1M A;  1TS0 A;  4ME4 A;  2XQZ A;  4E3O A;  4NET A;  2Z2M B;  3UB7 A;  4KZ4 A;  1Q2Q A;  2Z6C A;  4KUO A;  4FCF A;  3T4T A;  5FI6 A;  4M3K A;  5IS1 A;  4JBF A;  4DE3 A;  2K7S A;  3OC2 A;  5BOH A;  4DJ3 A;  1M6K A;  3M6H A;  4FSF A;  4RVA A;  1PIO A;  3ZQ5 A;  4N92 A;  3UE0 A;  2V2F F;  3KSF A;  3O3V A;  4Z1W A;  2D02 A;  4EQI A;  3PAG A;  4ZAM A;  4IHQ A;  4K08 A;  1ES4 A;  3L7H A;  3EGX C;  3ZVW A;  2B95 A;  4ZBE A;  3V3S A;  1F5M A;  4EEU A;  2WAE A;  1NZU A;  3VOZ A;  2HDU A;  4MNR A;  4ZJ2 A;  2Y2N A;  5E2E A;  3UE6 A;  4GDN A;  3HVF A;  3P09 A;  2QHK A;  5EE8 A;  1W8Q A;  2Y2H A;  2I72 A;  3TSG A;  3BQ8 A;  2JN7 A;  4GS9 A;  3F1P A;  2WKH A;  1N9N A;  1OME A;  3HLG A;  3FKW A;  1LL9 A;  4E3M A;  3CLO A;  3A0V A;  2DNS A;  4F94 A;  1YSP A;  3NJA A;  2M7V A;  4LV0 A;  3ZCZ A;  2UWX A;  5M19 A;  2EXA A;  1L0D A;  4DN0 A;  2VX8 A;  2RL3 A;  1H3Q A; 
#chains in the Genus database with same CATH homology
 3PR6 A;  4I38 A;  4YWZ A;  2KX6 A;  4I3A A;  3LIA A;  1YSQ A;  2P7J A;  3DBA A;  1F9I A;  3TE8 A;  3JVU A;  1JNU A;  2LB5 A;  4JGR A;  2ZOH A;  1UWP X;  4ZRR A;  2B18 A;  3RH8 B;  4UQI S;  3LR4 A;  2LB9 A;  2GJ3 A;  3OLO A;  3W2Z A;  3E4P A;  2O9B A;  2PR5 A;  4GLQ A;  3OOV A;  4H6J A;  2J80 A;  3PBR A;  2W3H A;  4Y2F A;  4HJ4 A;  1NRJ A;  2VLG A;  4KUK A;  3P7N A;  2HF6 A;  4I5S A;  5L8M A;  3T4K A;  1DP6 A;  2HV1 A;  2XA7 S;  1D06 A;  3LI9 A;  3UME A;  3E4Q A;  3T4L A;  1S66 L;  4WLA A;  3PBN A;  2A24 B;  1OTB A;  2H28 A;  3LID A;  3H7W A;  1D7E A;  2KDK A;  3V67 A;  2VGL M;  1NWZ A;  5F6A A;  5MC7 A;  2PD8 A;  3CIT A;  2OWJ A;  3FG8 A;  1MKM A;  4ETZ A;  1LL8 A;  2VJW A;  3EWK A;  4NXB A;  2XSS A;  3BWL A;  3CI6 A;  5DFY A;  1S4R A;  1GSX A;  2P04 A;  4JGO A;  4LRY C;  4WL9 A;  4XT2 A;  4CLC A;  4WEL A;  2O9C A;  4CQH A;  4EUV A;  1GSV A;  4JGP A;  5CX7 A;  4II7 A;  5J7E A;  1VB6 A;  3S7O A;  4HNB A;  1ODV A;  5DF9 A;  1Y28 A;  4WN5 A;  2Z6D A;  2OOL A;  3TW8 A;  3EEH A;  4ETX A;  3NOP C;  3PBQ A;  3CWF A;  2D01 A;  1OTE A;  3PYP A;  1N9L A;  1V9Y A;  1MC0 A;  4YNR A;  4L9E A;  3MMH A;  3PXP A;  1NLY A;  2ZBB A;  5DJT A;  4DMZ A;  2W3G A;  5KSH A;  2JKT M;  2EA9 A;  1TS7 A;  1S67 L;  3KSG A;  5AVE A;  1OTA A;  5DKK A;  5J4E A;  5AVF A;  3T4O A;  3EGD C;  2ZMF A;  1XJ3 A;  1VHM A;  4LLO B;  4GCZ A;  1ZHH B;  3MFX A;  3KSH A;  4O8G A;  3C8C A;  2W0N A;  3TJZ C;  3F1O B;  2ZMV A;  2W1T B;  3P01 A;  4EQ1 A;  2V1A A;  4R6L A;  5J3W A;  2VZW A;  2EWV A;  2PT7 A;  1TF1 A;  3FC7 A;  5F69 A;  1W63 M;  2NUT C;  3EOI A;  1IFQ A;  2DMW A;  3BQA A;  2W27 A;  4GHI B;  3H9W A;  1G6O A;  3KYQ A;  4HI4 A;  3VOL A;  4MN7 A;  1OJG A;  2P08 A;  5AJG A;  4OOL A;  1H8M A;  5K5B A;  2Y79 A;  2OAP 1;  3NOT C;  2MJ6 A;  2HGV A;  4G3V A;  1XFQ A;  1YKD A;  4L9G A;  5DJU A;  3U2A A;  2O99 A;  1TS6 A;  5HD3 A;  1OJ5 A;  3G6O A;  4NXF A;  2W3D A;  3NHQ A;  5EFW A;  5DKL A;  4LRX C;  3SW1 A;  4MN6 A;  1N9O A;  3ICY A;  4NKP A;  2M7U A;  1P0Z A;  3C2W A;  4HH3 A;  3B33 A;  3D3O A;  3S7N A;  3LIE A;  3UB8 A;  1WA9 A;  4HH2 A;  4L9F A;  5HPF A;  3EEA A;  4UQI M;  3OCL A;  3OBF A;  5HWW A;  2CMN A;  1NLZ A;  2JHE A;  3LIC A;  3B47 A;  3BW6 A;  5HDC A;  4EEP A;  2W3F A;  1S1Z A;  4I39 A;  1P9R A;  2A2L A;  4HIA A;  2WKQ A;  4IUH A;  2VA0 A;  2JKT I;  5HD5 A;  3MJQ A;  3BY8 A;  3KSI A;  2KOI A;  2XA7 M;  2OAQ 1;  3LR0 A;  2PHY A;  3IBJ A;  2W3E A;  2KLI A;  2O0Y A;  4YOF A;  3MQQ A;  4L0L A;  2WKP A;  5FL3 A;  2V0U A;  4MDZ A;  1T1B A;  2IA2 A;  3PBO A;  5TJJ A;  5IT5 A;  3LUQ A;  4O0P A;  5TBM B;  5C5K A;  1XJ6 A;  5F68 A;  3R7W A;  1LSX A;  1LSW A;  2ZOI A;  3IS2 A;  4BJP A;  2BAS A;  2GNX A;  1P9W A;  3BJN A;  4EW7 A;  2PD7 A;  4WEK A;  1ZTU A;  3IBR A;  4NEE D;  3UB6 A;  4BBV A;  3HJK A;  2PDR A;  2YKH A;  4G3K A;  3H82 A;  4BMW A;  4F3L B;  4BBU A;  3H7W B;  3B42 A;  3FPV A;  2R78 A;  4G3W A;  4Q0I A;  3E0Y A;  2WKR A;  4HY8 A;  3VE4 A;  4IUK A;  1P97 A;  3KYZ A;  4QPR A;  3RFB A;  3A0R A;  2QJ5 A;  3RTY A;  3LYX A;  3CUE C;  1DRM A;  4MCW A;  4XT2 B;  4CLC B;  1DP8 A;  5A8B A;  4MMN A;  3TRC A;  3K2N A;  3PBT A;  4OOM A;  2QKP A;  3D72 A;  4R3A A;  3T50 A;  3K3D A;  3S7P A;  5HWT A;  1F98 A;  3E4O A;  1UGU A;  1XJ2 A;  4PKY G;  4DJ2 A;  1OT6 A;  5HZH A;  4P6Z S;  3EQU A;  3ULF A;  2O9A A;  4HHD A;  5IU1 A;  4FOF A;  1X0O A;  4I3I A;  3MQO A;  2GZA A;  1BYW A;  2A24 A;  3EQV A;  3VE3 A;  4E04 A;  3FPW A;  3OCN A;  4CLC E;  3C30 A;  2V0W A;  3MXQ A;  1G28 A;  3LR3 A;  4HJ6 A;  2VV6 A;  5I5L A;  3F1N B;  5HWV A;  1KOU A;  5HL6 A;  4PKY A;  4BBT A;  1YAX A;  4WUJ A;  3O5Y A;  4EER A;  3LIF A;  4JGQ A;  2GX5 A;  2K2N A;  4HOI A;  1T18 A;  1IOU A;  1W63 Q;  4IJG A;  2HJE A;  4R70 A;  3GEC A;  4HP9 A;  4GS9 B;  4B93 A;  3LIB A;  3F1P B;  4GW9 A;  3CAX A;  1LSV A;  1OTD A;  5TBM A;  4UEY A;  1XFN A;  1TS8 A;  3HCY A;  3NOU C;  2VGL S;  3BY9 A;  3UMD A;  2L0W A;  4BWI A;  3JVV A;  3ZYT A;  3MR0 A;  2Y8H A;  3K3C A;  4NXG A;  2EWW A;  3CUE A;  4Y3I A;  5HPI A;  4NXE A;  4HP4 A;  5G4Y A;  4PHT A;  1OT9 A;  4Y5F A;  2VKS A;  5DFX A;  3T4S A;  3C38 A;  2VV8 A;  5G4Z A;  1T1C A;  4ARZ B;  5KIZ A;  2L1M A;  2QJ7 A;  2VEA A;  1TS0 A;  4KQD A;  4ME4 A;  2FH5 A;  5HDD A;  4F3L A;  2XRN A;  3LFV A;  3F1O A;  2W1T A;  2XRO A;  2PYP A;  3KX0 X;  4EET B;  1OTI A;  3LI8 A;  2V9A A;  4LPZ A;  4RQ9 A;  3UB7 A;  3PHY A;  2W1R A;  2Z6C A;  4EXO A;  4KUO A;  4HJ3 A;  1T1A A;  2G7U A;  4H6J B;  3T4T A;  2J3W A;  5IS1 A;  1GSW A;  2K7S A;  3OC2 A;  4DJ3 A;  4GHI A;  3S7Q A;  4FSF A;  3ZQ5 A;  2PR6 A;  1XJ4 A;  5F5Y A;  2HJ9 C;  3T4Q A;  3KO6 A;  4MN5 A;  3KSF A;  1T19 A;  2L4R A;  4Z1W A;  2D02 A;  3E98 A;  2B02 A;  1STZ A;  2INW A;  1TD5 A;  4IHQ A;  4LRZ E;  4WEJ A;  3T4J A;  4K08 A;  3PBS A;  4KQO A;  4PAU A;  3EGX C;  4AFI A;  4EES A;  1F5M A;  5HSQ A;  4EEU A;  3F1N A;  2QWS A;  3MQ0 A;  3UE6 A;  3LR5 A;  3MF0 A;  1DP9 A;  2PYR A;  4Q0J A;  1V9Z A;  2V1B A;  2JKR I;  3GDI A;  2QHK A;  1OPX A;  4Q0H A;  1EW0 A;  3BQ8 A;  2JN7 A;  4GS9 A;  3R7W B;  2NUP C;  4O01 A;  3F1P A;  5LBR A;  2K31 A;  3VV4 A;  1N9N A;  3UB9 A;  3IS2 B;  4R38 A;  2FZ0 A;  1LT0 A;  3CLO A;  3A0S A;  4CLC C;  1UWN X;  5HDS A;  4I3J A;  2VV7 A;  2I9V A;  1S1Y A;  4EU0 A;  3A0V A;  4GJ4 A;  2M1C A;  4WF0 A;  1YSP A;  2J3T C;  4M4X A;  3UE3 A;  1S4S A;  3NJA A;  2M7V A;  4P6Z M;  4CLC D;  1MZU A;  3H82 B;  2QYB A;  2OWH A;  3R4K A;  4ARZ A;  4HQA A;  4DN0 A;  2J3T D;  4B9O A;  2YKF A;  3HJI A;  2JKR M;  2VX8 A;  1H3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...