4M3KA

Structure of a single domain camelid antibody fragment cab-h7s in complex with the blap beta-lactamase from bacillus licheniformis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
260
Chain Sequence
b'MKDDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALVTSLRAFALEDPGKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Probing the mechanism of aggregation of polyQ model proteins with camelid heavy-chain antibody fragments
rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase/immune system
total genus 93
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4m3kA00
4X53A 3NC8A 3C5AA 4FCFA 2JC7A 2WGVA 3BYDA 4X69A 4WELA 4YINA 3G34A 3Q82A 1E4DA 5CHMA 5E2GA 1BLPA 3IWIA 4QY5A 2WKHA 1SDEA 1IYSA 4X68A 3VOZA 3V50A 5FI2A 5KMWA 5AQ7A 1MWTA 1CI9A 4GDNA 4ZJ2A 4CPKA 3CJMA 2Y2GA 3HVFA 5EVIC 3UPPA 3G30A 2EX9A 2XD1A 1FR6A 3A3FA 3G2YA 1KE4A 3VMAA 5JYPA 1BSGA 3IXGA 3P09A 4LV3A 4HEFA 2HP9A 2Y2KA 3QNCA 4XUXA 2HDQA 3AGFA 2HPBA 3BLSA 4N9LA 4E6WA 3IT9A 3ZG0A 1KDWA 3PAGA 2A3UA 3ZG5A 2ZQAA 3UPNA 5EUAA 5HARA 1XA1A 5I94A 2XR0A 4YFMA 4Y0TA 4OOMA 1XKZA 3PBNA 4R4RA 5A91A 3WS1A 3HLFA 2ZMAA 2ZC3B 3S1YA 3SOIA 4OLDA 4RYEA 3WS4A 3HLCA 1TEMA 4E3JA 1C3BA 1YLPA 1WE4A 3N7WA 5HX9A 3Q7ZA 1IKIA 2H5SA 1MWUA 1HTZA 2GDNA 4GD6A 5FQMA 4OKPA 3C4PA 2XFSA 4GNUA 2ZLYA 3BFFA 4QHCA 1K56A 2EX8A 3V3SA 4BLMA 3BLMA 3TSGA 3O88A 4OPQA 1NYYA 3M6HA 5DF7A 1J9MA 1PW1A 1YMSA 3HBRA 3ITBA 2VGKA 4KQOA 4L0LA 4PPRA 2ZC5B 3MZEA 2HP6A 3Q7VB 2OSUA 3PBQA 1FQGA 4OP5A 2Y2PA 4KZAA 5FI6A 1O07A 3RXXA 5GL9A 4R1GA 3HLGA 3MKEA 4IVIA 5CHJA 1XA7A 4R4SA 5EE8A 5KZHA 1YLYA 4PM8A 4DRTA 1PZPA 4DE3A 2A49A 3NY4A 1K57A 5F83A 2G2UA 3O86A 3PBTA 4DXCA 1K54A 5DF8A 5M1AA 3GRJA 5FQQA 1ONHA 4ZJ1A 4RVAA 3BM6A 5EOOA 3SH9A 5HAQA 4Q8IA 4DKIA 4KQRA 4OQIA 3IXDA 1L2SA 1PWDA 3MFDA 4K0WA 4RA7A 1DY6A 5GHZA 1JWZA 4UA6A 3SH8A 4OQHA 1IELA 4LCLA 3V3RA 4WZ5A 1IKGA 2IWDA 1E3UA 1GA9A 3VSKA 2WGWA 2WYXA 2Y2JA 4GZBA 2RL3A 2ZQ9A 1QMEA 1K55C 2Y2QA 1MY8A 3EQUA 4S2NC 1I2SA 1PI5A 2Y2OA 4FH2A 2ZM8A 5DTTA 2V2FF 4JBFA 4QJGA 3OPLA 1I2WA 2E8IA 2IWCA 2R9WA 4XUZA 4KZ8A 1W8YA 2H10A 2PBYA 3Q1FA 3UE1A 5HAIA 2Q9MA 3UPOA 5EECA 1VQQA 3IH9A 4JF5A 3UE3A 5EVIB 4KQQA 1IYOA 2ZQ7A 1LI0A 3V39A 5HL1A 1M40A 1I5QA 2FFFB 5GLBA 4D2OA 2OV5A 4EUZA 2ZD8A 3FV7A 3M2JA 4PM7A 1PWCA 5FASA 3ZFZA 5L2FA 5AQBA 5DTKA 5EVLA 3ZVTA 2XF3A 1SCWA 2OLUA 5GLCA 2UWXA 1U60A 4S2JA 1CEGA 4KZ4A 2C6WB 4OPZA 4PM9A 3IWOA 3OPPA 1EI5A 2DNSA 5GHXA 3UNWA 3WS0A 1ERMA 1K56D 2WZXA 2Y2MA 1TVFA 3IHAA 1BZAA 3MZDA 1HVBA 4PM6A 3DWZA 4WZ4A 3O3VA 5GLAA 4QY6A 1M6KA 3AGEA 4WEJA 3DW0A 4PMAA 5CGWA 1BTLA 4RX3A 4UHUA 1L0GA 4A5RA 3M6BA 1RGZA 3N8RA 1H8ZA 4JXWA 4MNRA 1N4OA 2J9OA 3ZVWA 3TG9A 3LCEA 4WYYA 4X6TA 4GD8A 3WRTA 3IWQA 2BG1A 5M18A 3RJUA 1ONGA 5GHYA 5EVIA 5CECA 1XX2A 2PU4A 1CK3A 1H8YA 1O7EA 1FR1A 2WKIA 3OCLA 3HLDA 4S2LA 4WMCD 1ALQA 1W79A 3NBLA 3VP4A 4LCMA 1L0FA 3MXRA 5FI7A 2Y91A 1G6AA 2OLVA 1GHPA 4PM5A 1ES2A 4DDYA 1FSWA 2Y55A 3AGDA 2J7VA 4FD8A 5DVAA 5HW3A 3ZNYA 5DTSA 3VSLA 2XLNA 3GVBA 4IBRA 3UO9A 3VFHA 4S2KA 1PI4A 4WEKA 2WADA 1QMFA 1E3UD 1YLZA 4C6YA 4JF4A 3LY4A 4GN2A 4N9KA 1Q2QA 3S4XA 4S2IA 1KVLA 1NXYA 1MWRA 1JTDA 2PU2A 2Y2NA 3IXBA 4P6BA 3HREA 2EXBA 3MKFA 1Q2PA 4Z9QA 3GQZA 2XEPA 1IYPA 2WGWB 4KG5A 4RX2A 4C75A 4E3NA 5CTNA 3SH7A 2JE5A 4Y0UA 4EV4A 1BLSA 2ZM0A 5TR7A 3CMZA 4K91A 2ZC6B 5M19A 3JYIA 4LV1A 3WRZA 4P0MA 3C7UA 4JXGA 4EBPA 3OC2A 3ZGAB 3BFGA 4KZ7A 1RCJA 2EX6A 3UDFA 4E6XA 5CEDA 2EFXA 4N92A 5CGXA 2J8YA 4EQIA 3NDGA 5CRFA 3WWXA 2HDRA 4KENB 1KVMA 3FKVA 3WS2A 4JPMA 2XGNA 4WMCA 3VP3A 4B88A 1VM1A 1ES5A 1ZG6A 4B4XA 3IH8A 4HBUA 2VGJA 4GKUA 3HUOA 1GA0A 1NZUA 3I7JA 3B3XA 4R3JA 4LV0A 5U47A 1PW8A 4OLGA 3HUNA 1YT4A 4OPRA 4B4ZA 5KSCA 4FSFA 5F82A 1G68A 5GLDA 2Y2HA 4BENA 3UE0A 2H0TA 1HD8A 3FKWA 5FQKA 3V5MA 2G2WA 2ZQDA 4UAAA 2ZM2A 5EVID 3RXWA 1K6SA 1GHIA 1WYCA 1FOFA 3IF6C 4OOLA 3GSGA 1YLJA 4Y7PA 1ESUA 5E43A 1JTGA 4ZBEA 3N6IA 1JWVA 3ZDJA 1K55A 4JXSA 4S2NA 3FWLA 5CEBA 2HDSA 3W8KA 5BOHA 1K4FA 3MBZA 4U0XA 4BD0A 2XQZA 3PAEA 1FSYA 4MEZA 3ZG7B 3DWKA 1PWGA 3FYZA 1JVJA 3A3IA 4C3QA 1SDNA 4UA7A 4BJPA 2QMIA 5FA7A 1N9BA 4IVKA 4X56A 4Y0OA 5CHUA 5AQAA 5TGFA 5HFOA 4QB8A 3OPRA 1BULA 4KG2A 2Z2LB 1MBLA 1W7FA 3QHYA 1MKIA 1OMEA 4KZ9A 4K0XA 1DJAA 3PBOA 3M2KA 3P98A 3VOYA 3G2ZA 4O7DA 5HAPA 3SS4A 1YLTA 1S6RA 3WS5A 5FQJA 3ZNTA 2P74A 1RGYA 2WAFA 5DF9A 1RP5A 4JLFA 4R3BA 4E3OA 2XH9A 2QPNA 4OONA 4P85A 3ZG8B 1L0DA 3OCNA 3D4FA 5G18A 1L0EA 2ZQ8A 3UDIA 4DE2A 4N1HA 1FCMA 3CZDA 3DTMA 4QD4A 4S2MA 4JF6A 1K38A 1E25A 2HP5A 1XPBA 3A3JA 3VFFA 4E3IA 1EROA 1NY0A 1CI8A 4ID4A 5E2HA 1Y54A 4EWFA 3N8SA 1K25A 2V20A 3Q81A 5D3OA 3HLBA 4X55A 4KZBA 1KGGA 3C4OA 3W4PA 4R23A 1PIOA 1K4EA 4CJNA 2P9VB 3BRMA 2WK0A 3C7VA 2XDMA 1W5DA 2X01A 2B5RA 1SKFA 5EOEA 2R9XA 2FFYA 2H0YA 3GR2A 3IXHA 2X71A 4MBKA 1LHYA 3A3EA 1W8QA 4GDBA 4KZ5A 4OH0A 5FQIA 3VP1A 3A3DA 1NJ4A 1MWSA 4OQGA 3HLEA 3NI9A 3BFCA 4MBHA 4JKTA 3OPHA 1FCOA 3ZCZA 3HL9A 2J9PA 3ITAA 3O87A 4E3LA 4QU3A 1PZOA 1SHVA 5E2EA 3OZHA 3G35A 2WUQA 3NCKA 5A90A 2I72A 1NRFA 1BUEA 5E2FA 3N4IA 3SS3A 1LL9A 1XGJA 1YQSA 4BL3A 2WZZA 5F1FA 4N1XA 2Y59A 1ESIA 2JCHA 3LEZA 4ZAMA 4MLLA 2CC1A 1KDSA 2IWBA 3HUMA 3ISGA 3LO7A 1LI9A 4OQ0A 1ES3A 4BQMA 1ZC2A 1LL5A 3BECA 2P9VA 3IF6B 3UDXA 1KGFA 4HESA 4DXBA 4WBGA 4M3KA 5FAOA 5FDHA 3E2KA 3VP2A 2Y2IA 2ZC7A 1BT5A 5JYOA 1CEFA 5CXWA 3W4OA 4EBLA 4MBFA 1IEMA 4NETA 5FQ9A 4BD1A 4DE1A 4GOGA 2EFUA 3EQVA 5KSHA 4EBNA 4H8RA 5IHVA 1DJBA 1KE3A 2XD5A 3BFEA 1BLCA 2Q9NA 1AXBA 1NYMA 1Z6FA 1XXMA 4S2OA 1GHMA 4S2PA 1YMXA 3UY6A 5A93A 2XK1A 5A92A 1FCNA 4DF6A 4P87A 5J8XA 1GCEA 1KE0A 3MZFA 1K57C 2QZ6A 5F1GA 1K54C 2BLSA 2WKEA 2ZC4B 1IYQA 1LLBA 2DRWA 3E2LA 5FAPA 2RCXA 3G4PA 4OPYA 1BLHA 3IQAA 3TOIA 1XGIA 4FH4A 3LY3A 3IF6A 3PBSA 3UN7A 3IHBA 1DJCA 3S22A 2Z2MB 4WZ5C 2Y2LA 4KZ6A 1ES4A 4LV2A 3GV9A 3NDEA 5EPHA 3ZG9B 2JBFA 2X02A 1H5XA 1TDGA 1ZKJA 4R0QA 1K6RA 3W4QA 3CG5A 4LENA 4U0TA 4OVDA 4UA9A 3BFDA 1HZOA 4WM9A 2WAEA 4ZTKA 3Q07A 2ZQCA 4GB7A 2ZJ9A 4KZ3A 2EXAA 2DCFA 5FAQA 3BEBA 5CERA 1ZG4A 1XP4A 1YM1A 3FZCA 2XFTA 4NK3A 4E3MA 3Q7VA 1JWPA 2EX2A 1PYYA 3PBRA 3VP0A 5CGSA 5CTMA 5TFQA 3HLWA 4BL2A 1KGEA 1YLWA 2C5WB 4ZJ3A 4F94A 1NZOA 4DE0A 2V1ZA 5FSRA 1MXOA 1TDLA 5AQ9A 4DDSA 2HDUA 3N8LA 3QNBA 4IBXA 3GMWA 3IF5A 4HBTA 3GTCA 1EWZA 4JXVA 4OP8A 3SS5A 3MXSA 4OOYA 1ERQA 5FATA 1S0WA 3ZHHA 2Y4AA 4ZDXA 3G31A 4E3KA 4IEDA 4XXRA 3G32A 1WYBA 4KG6A 2WGIA 4U3TA 3NIAA 3PTEA 1MPLA
chains in the Genus database with same CATH superfamily
3PR6A 2JC7A 3BYDA 4WELA 3T4QA 1VHMA 5HPFA 4L9EA 2WKHA 4X68A 5HD3A 1OTDA 1UWPX 1ACFA 3V50A 5C5KA 5KMWA 4ZJ2A 3HVFA 4HNBA 3A3FA 4ETXA 3VMAA 4LV3A 4HEFA 1NLYA 2HDQA 3ZYTA 3BLSA 1YPRA 3IT9A 3ZG0A 3PAGA 5HARA 1XKZA 3PBNA 4R4RA 4G3VA 5A91A 3WS1A 3SOIA 4CLCE 4RQ9A 4RYEA 1OPXA 5HX9A 1IKIA 4PKYG 2GDNA 5FQMA 3T50A 4QHCA 2EX8A 4MMNA 3V3SA 4GHIA 4OPQA 1VEUB 2HP6A 4OP5A 1O07A 4R1GA 5DJUA 5CHJA 3RFBA 1SKOB 5EE8A 1ZTUA 4DRTA 3C38A 2XA7S 2VGLM 4QWOA 3PBTA 4L9GA 4DXCA 5FQQA 5AVEA 3BM6A 3KYQA 4X25A 4RA7A 4OQIA 3IXDA 1L2SA 4K0WA 4WN5A 5GHZA 1JWZA 3QP8A 4WZ5A 2WYXA 2Y2JA 2ZQ9A 1QMEA 3MR0A 4S2NC 2Y2OA 3EWKA 5DTTA 1VEUA 3OPLA 1I2WA 2IWCA 4XUZA 2K2NA 3T1SA 3MMHA 1SKOA 3IH9A 1CJFA 4JF5A 1LT0A 3FG8A 2ZQ7A 1F9IA 2M1CA 4EUZA 4NXGA 5L07A 4MN7A 2ZD8A 3ZFZA 1VETB 1D06A 2OLUA 1CEGA 4OPZA 4PM9A 2YKHA 5J3WA 5GHXA 3WS0A 1K56D 3E4QA 1BZAA 4H6JB 3OLOA 4WZ4A 1TS0A 5GLAA 1M6KA 4WEJA 3DW0A 3GDIA 4A5RA 3N8RA 5F69A 4EEPA 3GECA 1N4OA 3F1OB 4WYYA 1LSWA 2BG1A 5M18A 5HZHA 3T4TA 5GHYA 3TRCA 3LI8A 3VP4A 2ZOIA 3UB9A 5HWWA 5FI7A 4Y17A 2Y91A 1G6AA 1ES2A 4DDYA 1VETA 1N9OA 3BW6A 4FD8A 5DTSA 1DRMA 2XLNA 1EW0A 3GVBA 3MF0A 4S2KA 3VFHA 3BQAA 1OJ5A 4WEKA 1E3UD 1S67L 4S2IA 1KVLA 3R4KA 2Y2NA 2KLIA 4R38A 4Z9QA 3F1OA 2XEPA 3K3CA 4E3NA 1XJ4A 4Y0UA 4CQHA 1OTBA 3CMZA 4LV1A 3D9YA 1F2KA 3E4PA 3C7UA 5HL6A 4HJ4A 4KZ7A 3UDFA 4EQIA 3NDGA 5CRFA 4JPMA 2XGNA 4II7A 2KDKA 4CLCC 5J7EA 3QP1A 4HBUA 3I7JA 4Y3IA 2FZ0A 3S7QA 1PW8A 4OPRA 1G68A 5HDCA 2Y2HA 1ODVA 5HDDA 4BENA 3V5MA 2G2WA 4P6ZM 5EVID 1WYCA 1GHIA 1FOFA 1YLJA 3N6IA 5CEBA 1SZVA 4B93A 5IS1A 4U0XA 4Q0JA 2XQZA 1FSYA 2W3FA 3DWKA 1JVJA 2I9VA 5FA7A 1T1AA 5TGFA 3OOVA 2HZ5A 1MBLA 3QHYA 3LIBA 1MKIA 2MJ6A 4K0XA 3PBOA 5HAPA 5FEGA 3T1XA 1YLTA 2XSSA 3ZNTA 2P74A 3MQQA 1RP5A 2QPNA 3KX0X 1L0DA 3OCNA 3D4FA 1L0EA 3UDIA 1FCMA 3DTMA 3A3JA 3VFFA 1XPBA 3N8SA 2VZWA 3HLBA 1PIOA 2B5RA 4KUOA 4R6LA 3PHYA 2X71A 4KZ5A 1NLZA 1NJ4A 2W0NA 4OQGA 1LSVA 2W3DA 2J9PA 3O87A 3NJAA 1PZOA 1SHVA 3OZHA 2I72A 3N4IA 1DP9A 1LL9A 1XGJA 5EM1A 2OAP1 2Y59A 1ESIA 2O9AA 2JCHA 4MLLA 4X1MA 5DKKA 3LIFA 2ZC7A 3EEAA 4Z1WA 5FQ9A 4DE1A 4GOGA 4EBNA 3A0VA 4H8RA 5IHVA 3SZTA 3IX8A 4G3WA 3BFEA 1BLCA 2L1MA 3VE3A 1NYMA 1Z6FA 1GHMA 4MN5A 5A93A 2XK1A 4DF6A 1T18A 3E2LA 3OBFA 5FAPA 2RCXA 3IQAA 3TOIA 1FILA 3JVVA 3VE4A 5L09A 3S22A 2DMWA 4WZ5C 4KZ6A 1S66L 4HHDA 3QP6A 1H5XA 1TDGA 3W4QA 3CG5A 2A24A 4KQDA 4U0TA 2WAEA 4ZTKA 2ZJ9A 4KZ3A 2EXAA 4I38A 5CERA 1YSQA 1TF1A 1MC0A 4Y2FA 4BWIA 2C5WB 4ZJ3A 1NZOA 4K08A 5FSRA 3T12B 3QNBA 4HBTA 4JXVA 3GTCA 1EWZA 3MXSA 3EOIA 2O9CA 4ZDXA 3G32A 3PTEA 4X53A 3C5AA 2WGVA 4YINA 3IWIA 2G7UA 3VV4A 1MWTA 4GDNA 4CPKA 3TW8A 3CJMA 2Y2GA 3K2NA 2V1AA 3IBRA 3UPPA 2EX9A 4LGWA 5CX7A 4KUKA 3G2YA 2VV8A 2QJ5A 2KOIA 2Y2KA 4JGOA 4XUXA 3TE8A 3CHWP 4N9LA 1KDWA 2A3UA 2ZQAA 5EUAA 5I94A 2PYPA 3NHQA 2ACGA 4IUHA 5LBRA 2ZMAA 3S1YA 3WS4A 4E3JA 4HH2A 3S7OA 4Y15A 1WE4A 3Q7ZA 2VJWA 1MWUA 1HTZA 4GD6A 2ZLYA 3BFFA 3LGOA 1TS7A 5DF7A 3FPVA 1J9MA 3ITBA 4L0LA 1VB6A 2ZC5B 5FI6A 2PAVP 2R78A 5EVEA 1XA7A 4R4SA 4R3AA 1YSPA 2G2UA 5DF8A 3E4OA 5HAQA 1PWDA 1OT6A 5F5YA 1IELA 4LCLA 4NXEA 2L0WA 4DJ2A 2EWVA 2Y2QA 4HH3A 1I2SA 2ZM8A 3T1RA 1X0OA 2K7SA 4QJGA 2E8IA 2ZMFA 2R9WA 2VLGA 4HOIA 4KZ8A 3Q1FA 2Q9MA 3UE3A 4IJGA 1M40A 1I5QA 2FFFB 2VGLS 3FV7A 4PM7A 5DTKA 1SCWA 4HIAA 4GJ4A 3BWLA 1U60A 4S2JA 3IWOA 3OPPA 3KSFA 1ERMA 3MZDA 3LR4A 1H0MA 3M6BA 2O99A 1H8ZA 4WUJA 4DN0A 3HCYA 3TG9A 3LCEA 4GD8A 4GHIB 2GJ3A 5CECA 1XX2A 2PU4A 1H8YA 3CI6A 3HLDA 1W79A 4UQIM 4LCMA 1L0FA 3W2ZA 4BBUA 3ZNYA 1PI4A 2WADA 4N9KA 3MQ0A 2PU2A 3IXBA 4IUKA 3U4LP 2EXBA 1Q2PA 5DKLA 3SW1A 1IYPA 4KG5A 3F1NB 1OTEA 1N9NA 3SH7A 2OAQ1 1BLSA 3QP5A 2ZMVA 5J4EA 2EWWA 3UB5P 2HJ9C 3ZGAB 4E6XA 1RCJA 3LIEA 4DJ3A 3WWXA 2HDRA 3FKVA 2BASA 4WMCA 3VP3A 3MS6A 3IH8A 4PKYA 2VGJA 1GA0A 1NZUA 3B3XA 3CWFA 3HUNA 1YT4A 2W27A 3B42A 4B4ZA 5KIZA 5GLDA 2H0TA 3FKWA 5FQKA 3F1NA 2ZM2A 3RXWA 1L3LA 4Y7PA 1ESUA 4JXSA 3NOPC 3MBZA 3PAEA 4MEZA 3ZG7B 2QMIA 3T4SA 4IVKA 5CHUA 3CAXA 1BULA 4FUWA 4GCZA 1OMEA 4KZ9A 1MZUA 3SS4A 3NOTC 3P01A 4LLOB 4NXFA 3DTIA 2O9BA 3H7WB 1XJ6A 4R3BA 2J3WA 4P6ZS 4OONA 1WA9A 2FH5A 1K38A 1E25A 4E3IA 2PDRA 4EETB 4ID4A 2V20A 2H28A 1CQAA 4KZBA 3W4PA 4R23A 3BRMA 1CF0A 2WK0A 2XDMA 1W5DA 1SKFA 5EOEA 2FFYA 2H0YA 4ME4A 3DTKA 4GDBA 5DFXA 3VP1A 3A3DA 4ARZA 3HLEA 2KX6A 3TJZC 4Q0IA 3BFCA 3H7WA 4MBHA 3OPHA 1FCOA 4B9OA 3ZCZA 2PR5A 2WUQA 5E2FA 3SS3A 2WZZA 4WL9A 2VA0A 3LEZA 2CC1A 1KDSA 2V8FA 1NRJA 4OQ0A 1ES3A 4BQMA 3UDXA 1KGFA 1S1YA 3JPUA 5FAOA 5FDHA 2Y2IA 3W4OA 4EBLA 4G3KA 4MBFA 4BD1A 2EFUA 2V1BA 3EQVA 1KE3A 1W63Q 4UEYA 3CUEA 1AXBA 4I3AA 4LPZA 1G5UA 5HPIA 1XXMA 4S2OA 3UY6A 2L4RA 4Y5FA 4LRXC 3MZFA 2PD7A 2QZ6A 5F1GA 1IYQA 2B02A 3G4PA 2VK3A 1BLHA 1OTIA 4LV2A 2Y2LA 1ES4A 3IS2A 3GV9A 5IU1A 2Z6CA 2J3TC 2X02A 1IOUA 1K6RA 4OVDA 3BFDA 4WM9A 5FAQA 4EQ1A 2V0UA 1J3WA 2PRFA 4NK3A 2XFTA 3Q7VA 4LRYC 2EX2A 4E3MA 1PYYA 5CTMA 1S4SA 3HLWA 4HJ3A 5HDSA 3LIDA 3T4KA 4DE0A 2WKQA 1TDLA 5AQ9A 4DDSA 2D01A 4IBXA 3UE6A 1S0WA 3L7HA 4I3IA 4IEDA 3ULFA 3MJQA 2WGIA 3NIAA 4FCFA 3Q82A 1E4DA 5E2GA 1S1ZA 4CLCD 1SDEA 1IYSA 3T4JA 3DAVA 5FI2A 5AQ7A 1FR6A 2J80A 1BSGA 3P09A 4I5SA 2HP9A 3QNCA 2HPBA 3ZG5A 3CITA 4Y0TA 4OOMA 1P97A 3IX3A 3UMDA 2E8JA 4LFUA 2QWSA 3E98A 5DFYA 4OKPA 4GNUA 3RH8B 2A24B 1K56A 4BLMA 2VV7A 3TSGA 2W3EA 3O88A 1NYYA 1YMSA 4I39A 3MZEA 2OSUA 1FQGA 2Y2PA 4KZAA 3RXXA 3T1QB 5GL9A 3F1PA 3MKEA 1NWZA 1A0KA 1YLYA 3P7NA 2HGVA 5IT5A 3NY4A 5HWTA 1K57A 5F83A 1ONHA 4ZJ1A 4RVAA 5EOOA 2XRNA 4DKIA 4KQRA 2JKTI 3MFDA 4D60A 2JHEA 1DY6A 2VEAA 4OQHA 4WLAA 3V3RA 2UV0E 2IWDA 1E3UA 4EERA 2WGWA 4NEED 4GZBA 5AVFA 1UWNX 2P7JA 5TBMA 4FH2A 4JBFA 2B18A 4YNRA 3UPOA 1VQQA 4ESPA 2Y8HA 5EVIB 4KQQA 1IYOA 1LI0A 3V39A 4HY8A 5GLBA 1LSXA 4ETZA 3M2JA 5DJTA 5FASA 5AQBA 5EVLA 3ZVTA 2XF3A 2UWXA 2C6WB 2LB9A 2HJEA 3UNWA 2WZXA 2Y2MA 1HVBA 3DWZA 3HJKA 4QPRA 2NUPC 3O3VA 4QY6A 4FOFA 4RX3A 4UHUA 1L0GA 4M4XA 3K3DA 1H3QA 4MNRA 3EEHA 2J9OA 3ZVWA 4NG2A 2JKTM 3IWQA 2V8CA 1T1CA 3BY9A 3RJUA 5EVIA 1IFQA 1CK3A 4WMCD 1FR1A 2JKGA 3OCLA 1PRQA 3NBLA 3MXRA 2A2LA 2OLVA 1FSWA 2Y55A 3DTEA 3AGDA 2J7VA 4NXBA 3VSLA 5HD5A 3UO9A 4YWZA 3VOLA 1QMFA 1YLZA 4JF4A 2JN7A 4GN2A 1K0KA 2Z6DA 3S4XA 3IX4A 1V9YA 1NXYA 5L10A 1JTDA 4RX2A 4C75A 5CTNA 2JE5A 2D02A 4EV4A 1KOUA 5TR7A 2OOLA 4Y13A 1DP8A 1ZHHB 3QP2A 5AJGA 1T1BA 3JYIA 5M19A 3WRZA 4P0MA 4EBPA 4JXGA 2EX6A 5CEDA 1PFLA 4N92A 5CGXA 1KVMA 4L9FA 3CUEC 4B88A 1ES5A 1P9RA 4GKUA 3HUOA 1BYWA 5U47A 4HP4A 2VV6A 5F82A 2VKSA 3IBJA 2PD8A 4UAAA 4NKPA 3LIAA 1K6SA 4OOLA 3GSGA 1JTGA 3H82A 3ZDJA 1GSVA 1K55A 5BOHA 1K4FA 4BD0A 1PWGA 3FYZA 1SDNA 4UA7A 4BJPA 4Y0OA 4LRZE 3UMEA 3O5YA 4QB8A 3OPRA 4KG2A 2Z2LB 3VOYA 3M2KA 3T4OA 3G2ZA 2V9AA 3C30A 5FQJA 3WS5A 1RGYA 5EV0A 2PHYA 4JLFA 2XH9A 3KSHA 4JGRA 5G18A 4DE2A 4N1HA 4Q0HA 3CZDA 3D72A 1T19A 4S2MA 4JF6A 2HP5A 3DBAA 1NY0A 5A8BA 1CI8A 4EWFA 4EEUA 2WKRA 5D3OA 4X55A 1Y4OA 1KGGA 1K4EA 2P9VB 5G4YA 1OT9A 2X01A 3GR2A 3IXHA 1LHYA 4BBVA 3G6OA 1D1JA 1MWSA 4JKTA 3HL9A 4E3LA 2NUTC 4QU3A 5E2EA 3G35A 3NCKA 5A90A 1NRFA 1BUEA 1AWIA 5HSQA 5F1FA 4N1XA 2W1RA 3R7WB 4ZAMA 4WF0A 2IWBA 3ISGA 1XFQA 1LI9A 1YAXA 1LL5A 1ZC2A 2P9VA 3IF6B 4HESA 4M3KA 3V67A 5JYOA 1BT5A 4NETA 3MSHA 2Q9NA 1YMXA 4O01A 5A92A 1FCNA 3S7PA 1GCEA 1KE0A 1K57C 4JGPA 2WKEA 2ZC4B 1LLBA 3R7WA 4HJ6A 2GZAA 4FH4A 3LY3A 3LEQA 3E0YA 3IF6A 3PBSA 4EUVA 1DJCA 2Z2MB 4GW9A 3ZG9B 2JBFA 1ZKJA 5MC7A 3ZQ5A 4UA9A 1HZOA 3Q07A 3S7NA 1F5MA 2DCFA 3BEBA 1ZG4A 1XP4A 1JWPA 1OJGA 3PBRA 3VP0A 5CGSA 3LR3A 5TFQA 3KO6A 4BL2A 2QYBA 4HQAA 4ARZB 1KGEA 1YLWA 3L9KA 5G4ZA 1MXOA 2HDUA 3N8LA 3GMWA 4OOYA 1ERQA 3ZHHA 3G31A 4MCWA 4XXRA 1WYBA 4KG6A 1MPLA 3NC8A 2W3HA 4X69A 3G34A 3CLOA 5CHMA 1BLPA 1JNUA 4QY5A 1V9ZA 3VOZA 2ZL1B 1CI9A 5EVIC 1TS8A 4IHQA 1XJ2A 3G30A 2W3GA 2XD1A 1LL8A 1KE4A 5JYPA 3IXGA 3AGFA 4E6WA 1N9LA 3UPNA 1XA1A 2XR0A 4YFMA 2XA7M 4MN6A 3HLFA 4H6JA 2ZC3B 4OLDA 3HLCA 1TEMA 5L8MA 1C3BA 1YLPA 3NULA 2P04A 4XT2B 3N7WA 3IS2B 2H5SA 5FL3A 2ZL1A 3C4PA 3EGDC 2XFSA 1TS6A 3UB8A 3BLMA 3M6HA 1PW1A 3HBRA 2VGKA 4KQOA 4PPRA 3Q7VB 4EESA 3PBQA 3HLGA 4IVIA 4GLQA 5KZHA 4PM8A 1PZPA 1DP6A 4DE3A 2A49A 3O86A 1K54A 5M1AA 3GRJA 3SH9A 4Q8IA 3LICA 4XT2A 2P08A 4UA6A 3SH8A 1G6OA 3MQOA 1IKGA 1GA9A 3VSKA 3LFVA 2RL3A 3A0SA 1K55C 1MY8A 3EQUA 1HLUP 1PI5A 3D3OA 2V2FF 4F3LB 1GSWA 1Y28A 3HJIA 2IA2A 1W8YA 2H10A 2PBYA 2YKFA 3UE1A 4EW7A 5HAIA 5EECA 3CPTB 3KSGA 1XJ3A 5HL1A 5TJJA 4D2OA 2OV5A 2EA9A 3LUQA 1PWCA 5L2FA 5GLCA 4KZ4A 1W63M 3U2AA 1EI5A 2DNSA 3IHAA 1TVFA 3EGXC 4PM6A 5EFWA 2M7UA 3AGEA 4PMAA 5CGWA 1BTLA 2V0WA 1RGZA 4JXWA 4F3LA 5F6AA 4X6TA 3LR0A 3WRTA 1UGUA 2JKRI 3CPTA 2HV1A 1ONGA 1O7EA 3B33A 2WKIA 4S2LA 1ALQA 3F1PB 4PHTA 4O0PA 1GHPA 4PM5A 1P0ZA 2O0YA 5DVAA 2PR6A 5HW3A 3FC7A 4GS9B 4IBRA 5EM0A 3PXPA 4C6YA 2ZOHA 2J3TD 3LY4A 1Q2QA 4AFIA 1MWRA 2PYRA 4P6BA 2PBDP 3HREA 3MKFA 3BY8A 3GQZA 3C8CA 2WGWB 2VX8A 3KSIA 1PNEA 1D7EA 2ZM0A 5TBMB 4K91A 2ZC6B 3LR5A 1MKMA 2LB5A 3OC2A 3MXQA 3BFGA 2EFXA 2J8YA 4KENB 2OWHA 3WS2A 4GS9A 1VM1A 1ZG6A 3C2WA 4HI4A 4B4XA 3B47A 2JKRM 4R3JA 4LV0A 4E04A 3LI9A 4OLGA 2Y79A 1YKDA 5KSCA 4FSFA 1Z09A 3UE0A 1HD8A 3UB6A 1XFNA 2ZQDA 5E43A 3IF6C 4JGQA 5I5LA 4ZBEA 1JWVA 4S2NA 3FWLA 3BJNA 2HDSA 3KYEA 3W8KA 2PT7A 3BQ8A 2W1TB 3RTYA 3MFXA 3A3IA 4C3QA 1N9BA 4X56A 4DMZA 5AQAA 5HFOA 3ICYA 1W7FA 2CMNA 1DJAA 3P98A 4O7DA 4I3JA 5FDSA 1S6RA 3PYPA 3QP4A 2WAFA 5DF9A 4E3OA 4P85A 3ZG8B 2ZQ8A 4QD4A 2QKPA 1F98A 3A0RA 1EROA 2W1TA 1Y54A 5E2HA 4O8GA 1K25A 2BTFP 3Q81A 3C4OA 4CJNA 3C7VA 2R9XA 4MBKA 3A3EA 1W8QA 4OH0A 5FQIA 3H9WA 5K5BA 4FTXA 4ZRRA 2AVXA 3NI9A 4CLCB 3ITAA 1OTAA 3NECA 2B95A 3T4LA 4EU0A 4PAUA 1YQSA 4BL3A 3KYZA 3NOUC 2GX5A 1S4RA 2QJ7A 3H82B 1STZA 3HUMA 3LO7A 2QHKA 3BECA 4UQIS 4DXBA 4WBGA 3VP2A 3E2KA 2JKFA 4X1LA 2GNXA 1CEFA 5CXWA 2M7VA 1IEMA 5KSHA 4MDZA 4BMWA 1DJBA 1FIKA 2XD5A 4CLCA 1TD5A 4YOFA 4EXOA 2K31A 4S2PA 3LYXA 4R70A 4P87A 2Q0OA 5J8XA 4HP9A 2INWA 2XROA 1K54C 2BLSA 5HWVA 2DRWA 4OPYA 1XGIA 3JVUA 3UN7A 3IHBA 2ZBBA 2OWJA 5EPHA 3NDEA 1P9WA 4R0QA 4BBTA 4LENA 1GSXA 2ZQCA 2WKPA 4GB7A 5F68A 1G28A 1YM1A 3FZCA 4F94A 2V1ZA 3UB7A 1H8MA 4OP8A 3IF5A 3SS5A 2HF6A 5FATA 2Y4AA 5FEFA 3FPWA 4E3KA 4U3TA
chains in the Genus database with same CATH topology
4X53A 3NC8A 3C5AA 4FCFA 2JC7A 2WGVA 3BYDA 4X69A 4WELA 4YINA 3G34A 3Q82A 1E4DA 5CHMA 5E2GA 1BLPA 3IWIA 4QY5A 2WKHA 1SDEA 1IYSA 4X68A 3VOZA 3V50A 5FI2A 5KMWA 5AQ7A 1MWTA 1CI9A 4GDNA 4ZJ2A 4CPKA 3CJMA 2Y2GA 3HVFA 5EVIC 3UPPA 3G30A 2EX9A 2XD1A 1FR6A 3A3FA 3G2YA 1KE4A 3VMAA 5JYPA 1BSGA 3IXGA 3P09A 4LV3A 4HEFA 2HP9A 2Y2KA 3QNCA 4XUXA 2HDQA 3AGFA 2HPBA 3BLSA 4N9LA 4E6WA 3IT9A 3ZG0A 1KDWA 3PAGA 2A3UA 3ZG5A 2ZQAA 3UPNA 5EUAA 5HARA 1XA1A 5I94A 2XR0A 4YFMA 4Y0TA 4OOMA 1XKZA 3PBNA 4R4RA 5A91A 3WS1A 3HLFA 2ZMAA 2ZC3B 3S1YA 3SOIA 4OLDA 4RYEA 3WS4A 3HLCA 1TEMA 4E3JA 1C3BA 1YLPA 1WE4A 3N7WA 5HX9A 3Q7ZA 1IKIA 2H5SA 1MWUA 1HTZA 2GDNA 4GD6A 5FQMA 4OKPA 3C4PA 2XFSA 4GNUA 2ZLYA 3BFFA 4QHCA 1K56A 2EX8A 3V3SA 4BLMA 3BLMA 3TSGA 3O88A 4OPQA 1NYYA 3M6HA 5DF7A 1J9MA 1PW1A 1YMSA 3HBRA 3ITBA 2VGKA 4KQOA 4L0LA 4PPRA 2ZC5B 3MZEA 2HP6A 3Q7VB 2OSUA 3PBQA 1FQGA 4OP5A 2Y2PA 4KZAA 5FI6A 1O07A 3RXXA 5GL9A 4R1GA 3HLGA 3MKEA 4IVIA 5CHJA 1XA7A 4R4SA 5EE8A 5KZHA 1YLYA 4PM8A 4DRTA 1PZPA 4DE3A 2A49A 3NY4A 1K57A 5F83A 2G2UA 3O86A 3PBTA 4DXCA 1K54A 5DF8A 5M1AA 3GRJA 5FQQA 1ONHA 4ZJ1A 4RVAA 3BM6A 5EOOA 3SH9A 5HAQA 4Q8IA 4DKIA 4KQRA 4OQIA 3IXDA 1L2SA 1PWDA 3MFDA 4K0WA 4RA7A 1DY6A 5GHZA 1JWZA 4UA6A 3SH8A 4OQHA 1IELA 4LCLA 3V3RA 4WZ5A 1IKGA 2IWDA 1E3UA 1GA9A 3VSKA 2WGWA 2WYXA 2Y2JA 4GZBA 2RL3A 2ZQ9A 1QMEA 1K55C 2Y2QA 1MY8A 3EQUA 4S2NC 1I2SA 1PI5A 2Y2OA 4FH2A 2ZM8A 5DTTA 2V2FF 4JBFA 4QJGA 3OPLA 1I2WA 2E8IA 2IWCA 2R9WA 4XUZA 4KZ8A 1W8YA 2H10A 2PBYA 3Q1FA 3UE1A 5HAIA 2Q9MA 3UPOA 5EECA 1VQQA 3IH9A 4JF5A 3UE3A 5EVIB 4KQQA 1IYOA 2ZQ7A 1LI0A 3V39A 5HL1A 1M40A 1I5QA 2FFFB 5GLBA 4D2OA 2OV5A 4EUZA 2ZD8A 3FV7A 3M2JA 4PM7A 1PWCA 5FASA 3ZFZA 5L2FA 5AQBA 5DTKA 5EVLA 3ZVTA 2XF3A 1SCWA 2OLUA 5GLCA 2UWXA 1U60A 4S2JA 1CEGA 4KZ4A 2C6WB 4OPZA 4PM9A 3IWOA 3OPPA 1EI5A 2DNSA 5GHXA 3UNWA 3WS0A 1ERMA 1K56D 2WZXA 2Y2MA 1TVFA 3IHAA 1BZAA 3MZDA 1HVBA 4PM6A 3DWZA 4WZ4A 3O3VA 5GLAA 4QY6A 1M6KA 3AGEA 4WEJA 3DW0A 4PMAA 5CGWA 1BTLA 4RX3A 4UHUA 1L0GA 4A5RA 3M6BA 1RGZA 3N8RA 1H8ZA 4JXWA 4MNRA 1N4OA 2J9OA 3ZVWA 3TG9A 3LCEA 4WYYA 4X6TA 4GD8A 3WRTA 3IWQA 2BG1A 5M18A 3RJUA 1ONGA 5GHYA 5EVIA 5CECA 1XX2A 2PU4A 1CK3A 1H8YA 1O7EA 1FR1A 2WKIA 3OCLA 3HLDA 4S2LA 4WMCD 1ALQA 1W79A 3NBLA 3VP4A 4LCMA 1L0FA 3MXRA 5FI7A 2Y91A 1G6AA 2OLVA 1GHPA 4PM5A 1ES2A 4DDYA 1FSWA 2Y55A 3AGDA 2J7VA 4FD8A 5DVAA 5HW3A 3ZNYA 5DTSA 3VSLA 2XLNA 3GVBA 4IBRA 3UO9A 3VFHA 4S2KA 1PI4A 4WEKA 2WADA 1QMFA 1E3UD 1YLZA 4C6YA 4JF4A 3LY4A 4GN2A 4N9KA 1Q2QA 3S4XA 4S2IA 1KVLA 1NXYA 1MWRA 1JTDA 2PU2A 2Y2NA 3IXBA 4P6BA 3HREA 2EXBA 3MKFA 1Q2PA 4Z9QA 3GQZA 2XEPA 1IYPA 2WGWB 4KG5A 4RX2A 4C75A 4E3NA 5CTNA 3SH7A 2JE5A 4Y0UA 4EV4A 1BLSA 2ZM0A 5TR7A 3CMZA 4K91A 2ZC6B 5M19A 3JYIA 4LV1A 3WRZA 4P0MA 3C7UA 4JXGA 4EBPA 3OC2A 3ZGAB 3BFGA 4KZ7A 1RCJA 2EX6A 3UDFA 4E6XA 5CEDA 2EFXA 4N92A 5CGXA 2J8YA 4EQIA 3NDGA 5CRFA 3WWXA 2HDRA 4KENB 1KVMA 3FKVA 3WS2A 4JPMA 2XGNA 4WMCA 3VP3A 4B88A 1VM1A 1ES5A 1ZG6A 4B4XA 3IH8A 4HBUA 2VGJA 4GKUA 3HUOA 1GA0A 1NZUA 3I7JA 3B3XA 4R3JA 4LV0A 5U47A 1PW8A 4OLGA 3HUNA 1YT4A 4OPRA 4B4ZA 5KSCA 4FSFA 5F82A 1G68A 5GLDA 2Y2HA 4BENA 3UE0A 2H0TA 1HD8A 3FKWA 5FQKA 3V5MA 2G2WA 2ZQDA 4UAAA 2ZM2A 5EVID 3RXWA 1K6SA 1GHIA 1WYCA 1FOFA 3IF6C 4OOLA 3GSGA 1YLJA 4Y7PA 1ESUA 5E43A 1JTGA 4ZBEA 3N6IA 1JWVA 3ZDJA 1K55A 4JXSA 4S2NA 3FWLA 5CEBA 2HDSA 3W8KA 5BOHA 1K4FA 3MBZA 4U0XA 4BD0A 2XQZA 3PAEA 1FSYA 4MEZA 3ZG7B 3DWKA 1PWGA 3FYZA 1JVJA 3A3IA 4C3QA 1SDNA 4UA7A 4BJPA 2QMIA 5FA7A 1N9BA 4IVKA 4X56A 4Y0OA 5CHUA 5AQAA 5TGFA 5HFOA 4QB8A 3OPRA 1BULA 4KG2A 2Z2LB 1MBLA 1W7FA 3QHYA 1MKIA 1OMEA 4KZ9A 4K0XA 1DJAA 3PBOA 3M2KA 3P98A 3VOYA 3G2ZA 4O7DA 5HAPA 3SS4A 1YLTA 1S6RA 3WS5A 5FQJA 3ZNTA 2P74A 1RGYA 2WAFA 5DF9A 1RP5A 4JLFA 4R3BA 4E3OA 2XH9A 2QPNA 4OONA 4P85A 3ZG8B 1L0DA 3OCNA 3D4FA 5G18A 1L0EA 2ZQ8A 3UDIA 4DE2A 4N1HA 1FCMA 3CZDA 3DTMA 4QD4A 4S2MA 4JF6A 1K38A 1E25A 2HP5A 1XPBA 3A3JA 3VFFA 4E3IA 1EROA 1NY0A 1CI8A 4ID4A 5E2HA 1Y54A 4EWFA 3N8SA 1K25A 2V20A 3Q81A 5D3OA 3HLBA 4X55A 4KZBA 1KGGA 3C4OA 3W4PA 4R23A 1PIOA 1K4EA 4CJNA 2P9VB 3BRMA 2WK0A 3C7VA 2XDMA 1W5DA 2X01A 2B5RA 1SKFA 5EOEA 2R9XA 2FFYA 2H0YA 3GR2A 3IXHA 2X71A 4MBKA 1LHYA 3A3EA 1W8QA 4GDBA 4KZ5A 4OH0A 5FQIA 3VP1A 3A3DA 1NJ4A 1MWSA 4OQGA 3HLEA 3NI9A 3BFCA 4MBHA 4JKTA 3OPHA 1FCOA 3ZCZA 3HL9A 2J9PA 3ITAA 3O87A 4E3LA 4QU3A 1PZOA 1SHVA 5E2EA 3OZHA 3G35A 2WUQA 3NCKA 5A90A 2I72A 1NRFA 1BUEA 5E2FA 3N4IA 3SS3A 1LL9A 1XGJA 1YQSA 4BL3A 2WZZA 5F1FA 4N1XA 2Y59A 1ESIA 2JCHA 3LEZA 4ZAMA 4MLLA 2CC1A 1KDSA 2IWBA 3HUMA 3ISGA 3LO7A 1LI9A 4OQ0A 1ES3A 4BQMA 1ZC2A 1LL5A 3BECA 2P9VA 3IF6B 3UDXA 1KGFA 4HESA 4DXBA 4WBGA 4M3KA 5FAOA 5FDHA 3E2KA 3VP2A 2Y2IA 2ZC7A 1BT5A 5JYOA 1CEFA 5CXWA 3W4OA 4EBLA 4MBFA 1IEMA 4NETA 5FQ9A 4BD1A 4DE1A 4GOGA 2EFUA 3EQVA 5KSHA 4EBNA 4H8RA 5IHVA 1DJBA 1KE3A 2XD5A 3BFEA 1BLCA 2Q9NA 1AXBA 1NYMA 1Z6FA 1XXMA 4S2OA 1GHMA 4S2PA 1YMXA 3UY6A 5A93A 2XK1A 5A92A 1FCNA 4DF6A 4P87A 5J8XA 1GCEA 1KE0A 3MZFA 1K57C 2QZ6A 5F1GA 1K54C 2BLSA 2WKEA 2ZC4B 1IYQA 1LLBA 2DRWA 3E2LA 5FAPA 2RCXA 3G4PA 4OPYA 1BLHA 3IQAA 3TOIA 1XGIA 4FH4A 3LY3A 3IF6A 3PBSA 3UN7A 3IHBA 1DJCA 3S22A 2Z2MB 4WZ5C 2Y2LA 4KZ6A 1ES4A 4LV2A 3GV9A 3NDEA 5EPHA 3ZG9B 2JBFA 2X02A 1H5XA 1TDGA 1ZKJA 4R0QA 1K6RA 3W4QA 3CG5A 4LENA 4U0TA 4OVDA 4UA9A 3BFDA 1HZOA 4WM9A 2WAEA 4ZTKA 3Q07A 2ZQCA 4GB7A 2ZJ9A 4KZ3A 2EXAA 2DCFA 5FAQA 3BEBA 5CERA 1ZG4A 1XP4A 1YM1A 3FZCA 2XFTA 4NK3A 4E3MA 3Q7VA 1JWPA 2EX2A 1PYYA 3PBRA 3VP0A 5CGSA 5CTMA 5TFQA 3HLWA 4BL2A 1KGEA 1YLWA 2C5WB 4ZJ3A 4F94A 1NZOA 4DE0A 2V1ZA 5FSRA 1MXOA 1TDLA 5AQ9A 4DDSA 2HDUA 3N8LA 3QNBA 4IBXA 3GMWA 3IF5A 4HBTA 3GTCA 1EWZA 4JXVA 4OP8A 3SS5A 3MXSA 4OOYA 1ERQA 5FATA 1S0WA 3ZHHA 2Y4AA 4ZDXA 3G31A 4E3KA 4IEDA 4XXRA 3G32A 1WYBA 4KG6A 2WGIA 4U3TA 3NIAA 3PTEA 1MPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X53 A;  3NC8 A;  3C5A A;  4FCF A;  2JC7 A;  2WGV A;  3BYD A;  4X69 A;  4WEL A;  4YIN A;  3G34 A;  3Q82 A;  1E4D A;  5CHM A;  5E2G A;  1BLP A;  3IWI A;  4QY5 A;  2WKH A;  1SDE A;  1IYS A;  4X68 A;  3VOZ A;  3V50 A;  5FI2 A;  5KMW A;  5AQ7 A;  1MWT A;  1CI9 A;  4GDN A;  4ZJ2 A;  4CPK A;  3CJM A;  2Y2G A;  3HVF A;  5EVI C;  3UPP A;  3G30 A;  2EX9 A;  2XD1 A;  1FR6 A;  3A3F A;  3G2Y A;  1KE4 A;  3VMA A;  5JYP A;  1BSG A;  3IXG A;  3P09 A;  4LV3 A;  4HEF A;  2HP9 A;  2Y2K A;  3QNC A;  4XUX A;  2HDQ A;  3AGF A;  2HPB A;  3BLS A;  4N9L A;  4E6W A;  3IT9 A;  3ZG0 A;  1KDW A;  3PAG A;  2A3U A;  3ZG5 A;  2ZQA A;  3UPN A;  5EUA A;  5HAR A;  1XA1 A;  5I94 A;  2XR0 A;  4YFM A;  4Y0T A;  4OOM A;  1XKZ A;  3PBN A;  4R4R A;  5A91 A;  3WS1 A;  3HLF A;  2ZMA A;  2ZC3 B;  3S1Y A;  3SOI A;  4OLD A;  4RYE A;  3WS4 A;  3HLC A;  1TEM A;  4E3J A;  1C3B A;  1YLP A;  1WE4 A;  3N7W A;  5HX9 A;  3Q7Z A;  1IKI A;  2H5S A;  1MWU A;  1HTZ A;  2GDN A;  4GD6 A;  5FQM A;  4OKP A;  3C4P A;  2XFS A;  4GNU A;  2ZLY A;  3BFF A;  4QHC A;  1K56 A;  2EX8 A;  3V3S A;  4BLM A;  3BLM A;  3TSG A;  3O88 A;  4OPQ A;  1NYY A;  3M6H A;  5DF7 A;  1J9M A;  1PW1 A;  1YMS A;  3HBR A;  3ITB A;  2VGK A;  4KQO A;  4L0L A;  4PPR A;  2ZC5 B;  3MZE A;  2HP6 A;  3Q7V B;  2OSU A;  3PBQ A;  1FQG A;  4OP5 A;  2Y2P A;  4KZA A;  5FI6 A;  1O07 A;  3RXX A;  5GL9 A;  4R1G A;  3HLG A;  3MKE A;  4IVI A;  5CHJ A;  1XA7 A;  4R4S A;  5EE8 A;  5KZH A;  1YLY A;  4PM8 A;  4DRT A;  1PZP A;  4DE3 A;  2A49 A;  3NY4 A;  1K57 A;  5F83 A;  2G2U A;  3O86 A;  3PBT A;  4DXC A;  1K54 A;  5DF8 A;  5M1A A;  3GRJ A;  5FQQ A;  1ONH A;  4ZJ1 A;  4RVA A;  3BM6 A;  5EOO A;  3SH9 A;  5HAQ A;  4Q8I A;  4DKI A;  4KQR A;  4OQI A;  3IXD A;  1L2S A;  1PWD A;  3MFD A;  4K0W A;  4RA7 A;  1DY6 A;  5GHZ A;  1JWZ A;  4UA6 A;  3SH8 A;  4OQH A;  1IEL A;  4LCL A;  3V3R A;  4WZ5 A;  1IKG A;  2IWD A;  1E3U A;  1GA9 A;  3VSK A;  2WGW A;  2WYX A;  2Y2J A;  4GZB A;  2RL3 A;  2ZQ9 A;  1QME A;  1K55 C;  2Y2Q A;  1MY8 A;  3EQU A;  4S2N C;  1I2S A;  1PI5 A;  2Y2O A;  4FH2 A;  2ZM8 A;  5DTT A;  2V2F F;  4JBF A;  4QJG A;  3OPL A;  1I2W A;  2E8I A;  2IWC A;  2R9W A;  4XUZ A;  4KZ8 A;  1W8Y A;  2H10 A;  2PBY A;  3Q1F A;  3UE1 A;  5HAI A;  2Q9M A;  3UPO A;  5EEC A;  1VQQ A;  3IH9 A;  4JF5 A;  3UE3 A;  5EVI B;  4KQQ A;  1IYO A;  2ZQ7 A;  1LI0 A;  3V39 A;  5HL1 A;  1M40 A;  1I5Q A;  2FFF B;  5GLB A;  4D2O A;  2OV5 A;  4EUZ A;  2ZD8 A;  3FV7 A;  3M2J A;  4PM7 A;  1PWC A;  5FAS A;  3ZFZ A;  5L2F A;  5AQB A;  5DTK A;  5EVL A;  3ZVT A;  2XF3 A;  1SCW A;  2OLU A;  5GLC A;  2UWX A;  1U60 A;  4S2J A;  1CEG A;  4KZ4 A;  2C6W B;  4OPZ A;  4PM9 A;  3IWO A;  3OPP A;  1EI5 A;  2DNS A;  5GHX A;  3UNW A;  3WS0 A;  1ERM A;  1K56 D;  2WZX A;  2Y2M A;  1TVF A;  3IHA A;  1BZA A;  3MZD A;  1HVB A;  4PM6 A;  3DWZ A;  4WZ4 A;  3O3V A;  5GLA A;  4QY6 A;  1M6K A;  3AGE A;  4WEJ A;  3DW0 A;  4PMA A;  5CGW A;  1BTL A;  4RX3 A;  4UHU A;  1L0G A;  4A5R A;  3M6B A;  1RGZ A;  3N8R A;  1H8Z A;  4JXW A;  4MNR A;  1N4O A;  2J9O A;  3ZVW A;  3TG9 A;  3LCE A;  4WYY A;  4X6T A;  4GD8 A;  3WRT A;  3IWQ A;  2BG1 A;  5M18 A;  3RJU A;  1ONG A;  5GHY A;  5EVI A;  5CEC A;  1XX2 A;  2PU4 A;  1CK3 A;  1H8Y A;  1O7E A;  1FR1 A;  2WKI A;  3OCL A;  3HLD A;  4S2L A;  4WMC D;  1ALQ A;  1W79 A;  3NBL A;  3VP4 A;  4LCM A;  1L0F A;  3MXR A;  5FI7 A;  2Y91 A;  1G6A A;  2OLV A;  1GHP A;  4PM5 A;  1ES2 A;  4DDY A;  1FSW A;  2Y55 A;  3AGD A;  2J7V A;  4FD8 A;  5DVA A;  5HW3 A;  3ZNY A;  5DTS A;  3VSL A;  2XLN A;  3GVB A;  4IBR A;  3UO9 A;  3VFH A;  4S2K A;  1PI4 A;  4WEK A;  2WAD A;  1QMF A;  1E3U D;  1YLZ A;  4C6Y A;  4JF4 A;  3LY4 A;  4GN2 A;  4N9K A;  1Q2Q A;  3S4X A;  4S2I A;  1KVL A;  1NXY A;  1MWR A;  1JTD A;  2PU2 A;  2Y2N A;  3IXB A;  4P6B A;  3HRE A;  2EXB A;  3MKF A;  1Q2P A;  4Z9Q A;  3GQZ A;  2XEP A;  1IYP A;  2WGW B;  4KG5 A;  4RX2 A;  4C75 A;  4E3N A;  5CTN A;  3SH7 A;  2JE5 A;  4Y0U A;  4EV4 A;  1BLS A;  2ZM0 A;  5TR7 A;  3CMZ A;  4K91 A;  2ZC6 B;  5M19 A;  3JYI A;  4LV1 A;  3WRZ A;  4P0M A;  3C7U A;  4JXG A;  4EBP A;  3OC2 A;  3ZGA B;  3BFG A;  4KZ7 A;  1RCJ A;  2EX6 A;  3UDF A;  4E6X A;  5CED A;  2EFX A;  4N92 A;  5CGX A;  2J8Y A;  4EQI A;  3NDG A;  5CRF A;  3WWX A;  2HDR A;  4KEN B;  1KVM A;  3FKV A;  3WS2 A;  4JPM A;  2XGN A;  4WMC A;  3VP3 A;  4B88 A;  1VM1 A;  1ES5 A;  1ZG6 A;  4B4X A;  3IH8 A;  4HBU A;  2VGJ A;  4GKU A;  3HUO A;  1GA0 A;  1NZU A;  3I7J A;  3B3X A;  4R3J A;  4LV0 A;  5U47 A;  1PW8 A;  4OLG A;  3HUN A;  1YT4 A;  4OPR A;  4B4Z A;  5KSC A;  4FSF A;  5F82 A;  1G68 A;  5GLD A;  2Y2H A;  4BEN A;  3UE0 A;  2H0T A;  1HD8 A;  3FKW A;  5FQK A;  3V5M A;  2G2W A;  2ZQD A;  4UAA A;  2ZM2 A;  5EVI D;  3RXW A;  1K6S A;  1GHI A;  1WYC A;  1FOF A;  3IF6 C;  4OOL A;  3GSG A;  1YLJ A;  4Y7P A;  1ESU A;  5E43 A;  1JTG A;  4ZBE A;  3N6I A;  1JWV A;  3ZDJ A;  1K55 A;  4JXS A;  4S2N A;  3FWL A;  5CEB A;  2HDS A;  3W8K A;  5BOH A;  1K4F A;  3MBZ A;  4U0X A;  4BD0 A;  2XQZ A;  3PAE A;  1FSY A;  4MEZ A;  3ZG7 B;  3DWK A;  1PWG A;  3FYZ A;  1JVJ A;  3A3I A;  4C3Q A;  1SDN A;  4UA7 A;  4BJP A;  2QMI A;  5FA7 A;  1N9B A;  4IVK A;  4X56 A;  4Y0O A;  5CHU A;  5AQA A;  5TGF A;  5HFO A;  4QB8 A;  3OPR A;  1BUL A;  4KG2 A;  2Z2L B;  1MBL A;  1W7F A;  3QHY A;  1MKI A;  1OME A;  4KZ9 A;  4K0X A;  1DJA A;  3PBO A;  3M2K A;  3P98 A;  3VOY A;  3G2Z A;  4O7D A;  5HAP A;  3SS4 A;  1YLT A;  1S6R A;  3WS5 A;  5FQJ A;  3ZNT A;  2P74 A;  1RGY A;  2WAF A;  5DF9 A;  1RP5 A;  4JLF A;  4R3B A;  4E3O A;  2XH9 A;  2QPN A;  4OON A;  4P85 A;  3ZG8 B;  1L0D A;  3OCN A;  3D4F A;  5G18 A;  1L0E A;  2ZQ8 A;  3UDI A;  4DE2 A;  4N1H A;  1FCM A;  3CZD A;  3DTM A;  4QD4 A;  4S2M A;  4JF6 A;  1K38 A;  1E25 A;  2HP5 A;  1XPB A;  3A3J A;  3VFF A;  4E3I A;  1ERO A;  1NY0 A;  1CI8 A;  4ID4 A;  5E2H A;  1Y54 A;  4EWF A;  3N8S A;  1K25 A;  2V20 A;  3Q81 A;  5D3O A;  3HLB A;  4X55 A;  4KZB A;  1KGG A;  3C4O A;  3W4P A;  4R23 A;  1PIO A;  1K4E A;  4CJN A;  2P9V B;  3BRM A;  2WK0 A;  3C7V A;  2XDM A;  1W5D A;  2X01 A;  2B5R A;  1SKF A;  5EOE A;  2R9X A;  2FFY A;  2H0Y A;  3GR2 A;  3IXH A;  2X71 A;  4MBK A;  1LHY A;  3A3E A;  1W8Q A;  4GDB A;  4KZ5 A;  4OH0 A;  5FQI A;  3VP1 A;  3A3D A;  1NJ4 A;  1MWS A;  4OQG A;  3HLE A;  3NI9 A;  3BFC A;  4MBH A;  4JKT A;  3OPH A;  1FCO A;  3ZCZ A;  3HL9 A;  2J9P A;  3ITA A;  3O87 A;  4E3L A;  4QU3 A;  1PZO A;  1SHV A;  5E2E A;  3OZH A;  3G35 A;  2WUQ A;  3NCK A;  5A90 A;  2I72 A;  1NRF A;  1BUE A;  5E2F A;  3N4I A;  3SS3 A;  1LL9 A;  1XGJ A;  1YQS A;  4BL3 A;  2WZZ A;  5F1F A;  4N1X A;  2Y59 A;  1ESI A;  2JCH A;  3LEZ A;  4ZAM A;  4MLL A;  2CC1 A;  1KDS A;  2IWB A;  3HUM A;  3ISG A;  3LO7 A;  1LI9 A;  4OQ0 A;  1ES3 A;  4BQM A;  1ZC2 A;  1LL5 A;  3BEC A;  2P9V A;  3IF6 B;  3UDX A;  1KGF A;  4HES A;  4DXB A;  4WBG A;  4M3K A;  5FAO A;  5FDH A;  3E2K A;  3VP2 A;  2Y2I A;  2ZC7 A;  1BT5 A;  5JYO A;  1CEF A;  5CXW A;  3W4O A;  4EBL A;  4MBF A;  1IEM A;  4NET A;  5FQ9 A;  4BD1 A;  4DE1 A;  4GOG A;  2EFU A;  3EQV A;  5KSH A;  4EBN A;  4H8R A;  5IHV A;  1DJB A;  1KE3 A;  2XD5 A;  3BFE A;  1BLC A;  2Q9N A;  1AXB A;  1NYM A;  1Z6F A;  1XXM A;  4S2O A;  1GHM A;  4S2P A;  1YMX A;  3UY6 A;  5A93 A;  2XK1 A;  5A92 A;  1FCN A;  4DF6 A;  4P87 A;  5J8X A;  1GCE A;  1KE0 A;  3MZF A;  1K57 C;  2QZ6 A;  5F1G A;  1K54 C;  2BLS A;  2WKE A;  2ZC4 B;  1IYQ A;  1LLB A;  2DRW A;  3E2L A;  5FAP A;  2RCX A;  3G4P A;  4OPY A;  1BLH A;  3IQA A;  3TOI A;  1XGI A;  4FH4 A;  3LY3 A;  3IF6 A;  3PBS A;  3UN7 A;  3IHB A;  1DJC A;  3S22 A;  2Z2M B;  4WZ5 C;  2Y2L A;  4KZ6 A;  1ES4 A;  4LV2 A;  3GV9 A;  3NDE A;  5EPH A;  3ZG9 B;  2JBF A;  2X02 A;  1H5X A;  1TDG A;  1ZKJ A;  4R0Q A;  1K6R A;  3W4Q A;  3CG5 A;  4LEN A;  4U0T A;  4OVD A;  4UA9 A;  3BFD A;  1HZO A;  4WM9 A;  2WAE A;  4ZTK A;  3Q07 A;  2ZQC A;  4GB7 A;  2ZJ9 A;  4KZ3 A;  2EXA A;  2DCF A;  5FAQ A;  3BEB A;  5CER A;  1ZG4 A;  1XP4 A;  1YM1 A;  3FZC A;  2XFT A;  4NK3 A;  4E3M A;  3Q7V A;  1JWP A;  2EX2 A;  1PYY A;  3PBR A;  3VP0 A;  5CGS A;  5CTM A;  5TFQ A;  3HLW A;  4BL2 A;  1KGE A;  1YLW A;  2C5W B;  4ZJ3 A;  4F94 A;  1NZO A;  4DE0 A;  2V1Z A;  5FSR A;  1MXO A;  1TDL A;  5AQ9 A;  4DDS A;  2HDU A;  3N8L A;  3QNB A;  4IBX A;  3GMW A;  3IF5 A;  4HBT A;  3GTC A;  1EWZ A;  4JXV A;  4OP8 A;  3SS5 A;  3MXS A;  4OOY A;  1ERQ A;  5FAT A;  1S0W A;  3ZHH A;  2Y4A A;  4ZDX A;  3G31 A;  4E3K A;  4IED A;  4XXR A;  3G32 A;  1WYB A;  4KG6 A;  2WGI A;  4U3T A;  3NIA A;  3PTE A;  1MPL A; 
#chains in the Genus database with same CATH topology
 3PR6 A;  2JC7 A;  3BYD A;  4WEL A;  3T4Q A;  1VHM A;  5HPF A;  4L9E A;  2WKH A;  4X68 A;  5HD3 A;  1OTD A;  1UWP X;  1ACF A;  3V50 A;  5C5K A;  5KMW A;  4ZJ2 A;  3HVF A;  4HNB A;  3A3F A;  4ETX A;  3VMA A;  4LV3 A;  4HEF A;  1NLY A;  2HDQ A;  3ZYT A;  3BLS A;  1YPR A;  3IT9 A;  3ZG0 A;  3PAG A;  5HAR A;  1XKZ A;  3PBN A;  4R4R A;  4G3V A;  5A91 A;  3WS1 A;  3SOI A;  4CLC E;  4RQ9 A;  4RYE A;  1OPX A;  5HX9 A;  1IKI A;  4PKY G;  2GDN A;  5FQM A;  3T50 A;  4QHC A;  2EX8 A;  4MMN A;  3V3S A;  4GHI A;  4OPQ A;  1VEU B;  2HP6 A;  4OP5 A;  1O07 A;  4R1G A;  5DJU A;  5CHJ A;  3RFB A;  1SKO B;  5EE8 A;  1ZTU A;  4DRT A;  3C38 A;  2XA7 S;  2VGL M;  4QWO A;  3PBT A;  4L9G A;  4DXC A;  5FQQ A;  5AVE A;  3BM6 A;  3KYQ A;  4X25 A;  4RA7 A;  4OQI A;  3IXD A;  1L2S A;  4K0W A;  4WN5 A;  5GHZ A;  1JWZ A;  3QP8 A;  4WZ5 A;  2WYX A;  2Y2J A;  2ZQ9 A;  1QME A;  3MR0 A;  4S2N C;  2Y2O A;  3EWK A;  5DTT A;  1VEU A;  3OPL A;  1I2W A;  2IWC A;  4XUZ A;  2K2N A;  3T1S A;  3MMH A;  1SKO A;  3IH9 A;  1CJF A;  4JF5 A;  1LT0 A;  3FG8 A;  2ZQ7 A;  1F9I A;  2M1C A;  4EUZ A;  4NXG A;  5L07 A;  4MN7 A;  2ZD8 A;  3ZFZ A;  1VET B;  1D06 A;  2OLU A;  1CEG A;  4OPZ A;  4PM9 A;  2YKH A;  5J3W A;  5GHX A;  3WS0 A;  1K56 D;  3E4Q A;  1BZA A;  4H6J B;  3OLO A;  4WZ4 A;  1TS0 A;  5GLA A;  1M6K A;  4WEJ A;  3DW0 A;  3GDI A;  4A5R A;  3N8R A;  5F69 A;  4EEP A;  3GEC A;  1N4O A;  3F1O B;  4WYY A;  1LSW A;  2BG1 A;  5M18 A;  5HZH A;  3T4T A;  5GHY A;  3TRC A;  3LI8 A;  3VP4 A;  2ZOI A;  3UB9 A;  5HWW A;  5FI7 A;  4Y17 A;  2Y91 A;  1G6A A;  1ES2 A;  4DDY A;  1VET A;  1N9O A;  3BW6 A;  4FD8 A;  5DTS A;  1DRM A;  2XLN A;  1EW0 A;  3GVB A;  3MF0 A;  4S2K A;  3VFH A;  3BQA A;  1OJ5 A;  4WEK A;  1E3U D;  1S67 L;  4S2I A;  1KVL A;  3R4K A;  2Y2N A;  2KLI A;  4R38 A;  4Z9Q A;  3F1O A;  2XEP A;  3K3C A;  4E3N A;  1XJ4 A;  4Y0U A;  4CQH A;  1OTB A;  3CMZ A;  4LV1 A;  3D9Y A;  1F2K A;  3E4P A;  3C7U A;  5HL6 A;  4HJ4 A;  4KZ7 A;  3UDF A;  4EQI A;  3NDG A;  5CRF A;  4JPM A;  2XGN A;  4II7 A;  2KDK A;  4CLC C;  5J7E A;  3QP1 A;  4HBU A;  3I7J A;  4Y3I A;  2FZ0 A;  3S7Q A;  1PW8 A;  4OPR A;  1G68 A;  5HDC A;  2Y2H A;  1ODV A;  5HDD A;  4BEN A;  3V5M A;  2G2W A;  4P6Z M;  5EVI D;  1WYC A;  1GHI A;  1FOF A;  1YLJ A;  3N6I A;  5CEB A;  1SZV A;  4B93 A;  5IS1 A;  4U0X A;  4Q0J A;  2XQZ A;  1FSY A;  2W3F A;  3DWK A;  1JVJ A;  2I9V A;  5FA7 A;  1T1A A;  5TGF A;  3OOV A;  2HZ5 A;  1MBL A;  3QHY A;  3LIB A;  1MKI A;  2MJ6 A;  4K0X A;  3PBO A;  5HAP A;  5FEG A;  3T1X A;  1YLT A;  2XSS A;  3ZNT A;  2P74 A;  3MQQ A;  1RP5 A;  2QPN A;  3KX0 X;  1L0D A;  3OCN A;  3D4F A;  1L0E A;  3UDI A;  1FCM A;  3DTM A;  3A3J A;  3VFF A;  1XPB A;  3N8S A;  2VZW A;  3HLB A;  1PIO A;  2B5R A;  4KUO A;  4R6L A;  3PHY A;  2X71 A;  4KZ5 A;  1NLZ A;  1NJ4 A;  2W0N A;  4OQG A;  1LSV A;  2W3D A;  2J9P A;  3O87 A;  3NJA A;  1PZO A;  1SHV A;  3OZH A;  2I72 A;  3N4I A;  1DP9 A;  1LL9 A;  1XGJ A;  5EM1 A;  2OAP 1;  2Y59 A;  1ESI A;  2O9A A;  2JCH A;  4MLL A;  4X1M A;  5DKK A;  3LIF A;  2ZC7 A;  3EEA A;  4Z1W A;  5FQ9 A;  4DE1 A;  4GOG A;  4EBN A;  3A0V A;  4H8R A;  5IHV A;  3SZT A;  3IX8 A;  4G3W A;  3BFE A;  1BLC A;  2L1M A;  3VE3 A;  1NYM A;  1Z6F A;  1GHM A;  4MN5 A;  5A93 A;  2XK1 A;  4DF6 A;  1T18 A;  3E2L A;  3OBF A;  5FAP A;  2RCX A;  3IQA A;  3TOI A;  1FIL A;  3JVV A;  3VE4 A;  5L09 A;  3S22 A;  2DMW A;  4WZ5 C;  4KZ6 A;  1S66 L;  4HHD A;  3QP6 A;  1H5X A;  1TDG A;  3W4Q A;  3CG5 A;  2A24 A;  4KQD A;  4U0T A;  2WAE A;  4ZTK A;  2ZJ9 A;  4KZ3 A;  2EXA A;  4I38 A;  5CER A;  1YSQ A;  1TF1 A;  1MC0 A;  4Y2F A;  4BWI A;  2C5W B;  4ZJ3 A;  1NZO A;  4K08 A;  5FSR A;  3T12 B;  3QNB A;  4HBT A;  4JXV A;  3GTC A;  1EWZ A;  3MXS A;  3EOI A;  2O9C A;  4ZDX A;  3G32 A;  3PTE A;  4X53 A;  3C5A A;  2WGV A;  4YIN A;  3IWI A;  2G7U A;  3VV4 A;  1MWT A;  4GDN A;  4CPK A;  3TW8 A;  3CJM A;  2Y2G A;  3K2N A;  2V1A A;  3IBR A;  3UPP A;  2EX9 A;  4LGW A;  5CX7 A;  4KUK A;  3G2Y A;  2VV8 A;  2QJ5 A;  2KOI A;  2Y2K A;  4JGO A;  4XUX A;  3TE8 A;  3CHW P;  4N9L A;  1KDW A;  2A3U A;  2ZQA A;  5EUA A;  5I94 A;  2PYP A;  3NHQ A;  2ACG A;  4IUH A;  5LBR A;  2ZMA A;  3S1Y A;  3WS4 A;  4E3J A;  4HH2 A;  3S7O A;  4Y15 A;  1WE4 A;  3Q7Z A;  2VJW A;  1MWU A;  1HTZ A;  4GD6 A;  2ZLY A;  3BFF A;  3LGO A;  1TS7 A;  5DF7 A;  3FPV A;  1J9M A;  3ITB A;  4L0L A;  1VB6 A;  2ZC5 B;  5FI6 A;  2PAV P;  2R78 A;  5EVE A;  1XA7 A;  4R4S A;  4R3A A;  1YSP A;  2G2U A;  5DF8 A;  3E4O A;  5HAQ A;  1PWD A;  1OT6 A;  5F5Y A;  1IEL A;  4LCL A;  4NXE A;  2L0W A;  4DJ2 A;  2EWV A;  2Y2Q A;  4HH3 A;  1I2S A;  2ZM8 A;  3T1R A;  1X0O A;  2K7S A;  4QJG A;  2E8I A;  2ZMF A;  2R9W A;  2VLG A;  4HOI A;  4KZ8 A;  3Q1F A;  2Q9M A;  3UE3 A;  4IJG A;  1M40 A;  1I5Q A;  2FFF B;  2VGL S;  3FV7 A;  4PM7 A;  5DTK A;  1SCW A;  4HIA A;  4GJ4 A;  3BWL A;  1U60 A;  4S2J A;  3IWO A;  3OPP A;  3KSF A;  1ERM A;  3MZD A;  3LR4 A;  1H0M A;  3M6B A;  2O99 A;  1H8Z A;  4WUJ A;  4DN0 A;  3HCY A;  3TG9 A;  3LCE A;  4GD8 A;  4GHI B;  2GJ3 A;  5CEC A;  1XX2 A;  2PU4 A;  1H8Y A;  3CI6 A;  3HLD A;  1W79 A;  4UQI M;  4LCM A;  1L0F A;  3W2Z A;  4BBU A;  3ZNY A;  1PI4 A;  2WAD A;  4N9K A;  3MQ0 A;  2PU2 A;  3IXB A;  4IUK A;  3U4L P;  2EXB A;  1Q2P A;  5DKL A;  3SW1 A;  1IYP A;  4KG5 A;  3F1N B;  1OTE A;  1N9N A;  3SH7 A;  2OAQ 1;  1BLS A;  3QP5 A;  2ZMV A;  5J4E A;  2EWW A;  3UB5 P;  2HJ9 C;  3ZGA B;  4E6X A;  1RCJ A;  3LIE A;  4DJ3 A;  3WWX A;  2HDR A;  3FKV A;  2BAS A;  4WMC A;  3VP3 A;  3MS6 A;  3IH8 A;  4PKY A;  2VGJ A;  1GA0 A;  1NZU A;  3B3X A;  3CWF A;  3HUN A;  1YT4 A;  2W27 A;  3B42 A;  4B4Z A;  5KIZ A;  5GLD A;  2H0T A;  3FKW A;  5FQK A;  3F1N A;  2ZM2 A;  3RXW A;  1L3L A;  4Y7P A;  1ESU A;  4JXS A;  3NOP C;  3MBZ A;  3PAE A;  4MEZ A;  3ZG7 B;  2QMI A;  3T4S A;  4IVK A;  5CHU A;  3CAX A;  1BUL A;  4FUW A;  4GCZ A;  1OME A;  4KZ9 A;  1MZU A;  3SS4 A;  3NOT C;  3P01 A;  4LLO B;  4NXF A;  3DTI A;  2O9B A;  3H7W B;  1XJ6 A;  4R3B A;  2J3W A;  4P6Z S;  4OON A;  1WA9 A;  2FH5 A;  1K38 A;  1E25 A;  4E3I A;  2PDR A;  4EET B;  4ID4 A;  2V20 A;  2H28 A;  1CQA A;  4KZB A;  3W4P A;  4R23 A;  3BRM A;  1CF0 A;  2WK0 A;  2XDM A;  1W5D A;  1SKF A;  5EOE A;  2FFY A;  2H0Y A;  4ME4 A;  3DTK A;  4GDB A;  5DFX A;  3VP1 A;  3A3D A;  4ARZ A;  3HLE A;  2KX6 A;  3TJZ C;  4Q0I A;  3BFC A;  3H7W A;  4MBH A;  3OPH A;  1FCO A;  4B9O A;  3ZCZ A;  2PR5 A;  2WUQ A;  5E2F A;  3SS3 A;  2WZZ A;  4WL9 A;  2VA0 A;  3LEZ A;  2CC1 A;  1KDS A;  2V8F A;  1NRJ A;  4OQ0 A;  1ES3 A;  4BQM A;  3UDX A;  1KGF A;  1S1Y A;  3JPU A;  5FAO A;  5FDH A;  2Y2I A;  3W4O A;  4EBL A;  4G3K A;  4MBF A;  4BD1 A;  2EFU A;  2V1B A;  3EQV A;  1KE3 A;  1W63 Q;  4UEY A;  3CUE A;  1AXB A;  4I3A A;  4LPZ A;  1G5U A;  5HPI A;  1XXM A;  4S2O A;  3UY6 A;  2L4R A;  4Y5F A;  4LRX C;  3MZF A;  2PD7 A;  2QZ6 A;  5F1G A;  1IYQ A;  2B02 A;  3G4P A;  2VK3 A;  1BLH A;  1OTI A;  4LV2 A;  2Y2L A;  1ES4 A;  3IS2 A;  3GV9 A;  5IU1 A;  2Z6C A;  2J3T C;  2X02 A;  1IOU A;  1K6R A;  4OVD A;  3BFD A;  4WM9 A;  5FAQ A;  4EQ1 A;  2V0U A;  1J3W A;  2PRF A;  4NK3 A;  2XFT A;  3Q7V A;  4LRY C;  2EX2 A;  4E3M A;  1PYY A;  5CTM A;  1S4S A;  3HLW A;  4HJ3 A;  5HDS A;  3LID A;  3T4K A;  4DE0 A;  2WKQ A;  1TDL A;  5AQ9 A;  4DDS A;  2D01 A;  4IBX A;  3UE6 A;  1S0W A;  3L7H A;  4I3I A;  4IED A;  3ULF A;  3MJQ A;  2WGI A;  3NIA A;  4FCF A;  3Q82 A;  1E4D A;  5E2G A;  1S1Z A;  4CLC D;  1SDE A;  1IYS A;  3T4J A;  3DAV A;  5FI2 A;  5AQ7 A;  1FR6 A;  2J80 A;  1BSG A;  3P09 A;  4I5S A;  2HP9 A;  3QNC A;  2HPB A;  3ZG5 A;  3CIT A;  4Y0T A;  4OOM A;  1P97 A;  3IX3 A;  3UMD A;  2E8J A;  4LFU A;  2QWS A;  3E98 A;  5DFY A;  4OKP A;  4GNU A;  3RH8 B;  2A24 B;  1K56 A;  4BLM A;  2VV7 A;  3TSG A;  2W3E A;  3O88 A;  1NYY A;  1YMS A;  4I39 A;  3MZE A;  2OSU A;  1FQG A;  2Y2P A;  4KZA A;  3RXX A;  3T1Q B;  5GL9 A;  3F1P A;  3MKE A;  1NWZ A;  1A0K A;  1YLY A;  3P7N A;  2HGV A;  5IT5 A;  3NY4 A;  5HWT A;  1K57 A;  5F83 A;  1ONH A;  4ZJ1 A;  4RVA A;  5EOO A;  2XRN A;  4DKI A;  4KQR A;  2JKT I;  3MFD A;  4D60 A;  2JHE A;  1DY6 A;  2VEA A;  4OQH A;  4WLA A;  3V3R A;  2UV0 E;  2IWD A;  1E3U A;  4EER A;  2WGW A;  4NEE D;  4GZB A;  5AVF A;  1UWN X;  2P7J A;  5TBM A;  4FH2 A;  4JBF A;  2B18 A;  4YNR A;  3UPO A;  1VQQ A;  4ESP A;  2Y8H A;  5EVI B;  4KQQ A;  1IYO A;  1LI0 A;  3V39 A;  4HY8 A;  5GLB A;  1LSX A;  4ETZ A;  3M2J A;  5DJT A;  5FAS A;  5AQB A;  5EVL A;  3ZVT A;  2XF3 A;  2UWX A;  2C6W B;  2LB9 A;  2HJE A;  3UNW A;  2WZX A;  2Y2M A;  1HVB A;  3DWZ A;  3HJK A;  4QPR A;  2NUP C;  3O3V A;  4QY6 A;  4FOF A;  4RX3 A;  4UHU A;  1L0G A;  4M4X A;  3K3D A;  1H3Q A;  4MNR A;  3EEH A;  2J9O A;  3ZVW A;  4NG2 A;  2JKT M;  3IWQ A;  2V8C A;  1T1C A;  3BY9 A;  3RJU A;  5EVI A;  1IFQ A;  1CK3 A;  4WMC D;  1FR1 A;  2JKG A;  3OCL A;  1PRQ A;  3NBL A;  3MXR A;  2A2L A;  2OLV A;  1FSW A;  2Y55 A;  3DTE A;  3AGD A;  2J7V A;  4NXB A;  3VSL A;  5HD5 A;  3UO9 A;  4YWZ A;  3VOL A;  1QMF A;  1YLZ A;  4JF4 A;  2JN7 A;  4GN2 A;  1K0K A;  2Z6D A;  3S4X A;  3IX4 A;  1V9Y A;  1NXY A;  5L10 A;  1JTD A;  4RX2 A;  4C75 A;  5CTN A;  2JE5 A;  2D02 A;  4EV4 A;  1KOU A;  5TR7 A;  2OOL A;  4Y13 A;  1DP8 A;  1ZHH B;  3QP2 A;  5AJG A;  1T1B A;  3JYI A;  5M19 A;  3WRZ A;  4P0M A;  4EBP A;  4JXG A;  2EX6 A;  5CED A;  1PFL A;  4N92 A;  5CGX A;  1KVM A;  4L9F A;  3CUE C;  4B88 A;  1ES5 A;  1P9R A;  4GKU A;  3HUO A;  1BYW A;  5U47 A;  4HP4 A;  2VV6 A;  5F82 A;  2VKS A;  3IBJ A;  2PD8 A;  4UAA A;  4NKP A;  3LIA A;  1K6S A;  4OOL A;  3GSG A;  1JTG A;  3H82 A;  3ZDJ A;  1GSV A;  1K55 A;  5BOH A;  1K4F A;  4BD0 A;  1PWG A;  3FYZ A;  1SDN A;  4UA7 A;  4BJP A;  4Y0O A;  4LRZ E;  3UME A;  3O5Y A;  4QB8 A;  3OPR A;  4KG2 A;  2Z2L B;  3VOY A;  3M2K A;  3T4O A;  3G2Z A;  2V9A A;  3C30 A;  5FQJ A;  3WS5 A;  1RGY A;  5EV0 A;  2PHY A;  4JLF A;  2XH9 A;  3KSH A;  4JGR A;  5G18 A;  4DE2 A;  4N1H A;  4Q0H A;  3CZD A;  3D72 A;  1T19 A;  4S2M A;  4JF6 A;  2HP5 A;  3DBA A;  1NY0 A;  5A8B A;  1CI8 A;  4EWF A;  4EEU A;  2WKR A;  5D3O A;  4X55 A;  1Y4O A;  1KGG A;  1K4E A;  2P9V B;  5G4Y A;  1OT9 A;  2X01 A;  3GR2 A;  3IXH A;  1LHY A;  4BBV A;  3G6O A;  1D1J A;  1MWS A;  4JKT A;  3HL9 A;  4E3L A;  2NUT C;  4QU3 A;  5E2E A;  3G35 A;  3NCK A;  5A90 A;  1NRF A;  1BUE A;  1AWI A;  5HSQ A;  5F1F A;  4N1X A;  2W1R A;  3R7W B;  4ZAM A;  4WF0 A;  2IWB A;  3ISG A;  1XFQ A;  1LI9 A;  1YAX A;  1LL5 A;  1ZC2 A;  2P9V A;  3IF6 B;  4HES A;  4M3K A;  3V67 A;  5JYO A;  1BT5 A;  4NET A;  3MSH A;  2Q9N A;  1YMX A;  4O01 A;  5A92 A;  1FCN A;  3S7P A;  1GCE A;  1KE0 A;  1K57 C;  4JGP A;  2WKE A;  2ZC4 B;  1LLB A;  3R7W A;  4HJ6 A;  2GZA A;  4FH4 A;  3LY3 A;  3LEQ A;  3E0Y A;  3IF6 A;  3PBS A;  4EUV A;  1DJC A;  2Z2M B;  4GW9 A;  3ZG9 B;  2JBF A;  1ZKJ A;  5MC7 A;  3ZQ5 A;  4UA9 A;  1HZO A;  3Q07 A;  3S7N A;  1F5M A;  2DCF A;  3BEB A;  1ZG4 A;  1XP4 A;  1JWP A;  1OJG A;  3PBR A;  3VP0 A;  5CGS A;  3LR3 A;  5TFQ A;  3KO6 A;  4BL2 A;  2QYB A;  4HQA A;  4ARZ B;  1KGE A;  1YLW A;  3L9K A;  5G4Z A;  1MXO A;  2HDU A;  3N8L A;  3GMW A;  4OOY A;  1ERQ A;  3ZHH A;  3G31 A;  4MCW A;  4XXR A;  1WYB A;  4KG6 A;  1MPL A;  3NC8 A;  2W3H A;  4X69 A;  3G34 A;  3CLO A;  5CHM A;  1BLP A;  1JNU A;  4QY5 A;  1V9Z A;  3VOZ A;  2ZL1 B;  1CI9 A;  5EVI C;  1TS8 A;  4IHQ A;  1XJ2 A;  3G30 A;  2W3G A;  2XD1 A;  1LL8 A;  1KE4 A;  5JYP A;  3IXG A;  3AGF A;  4E6W A;  1N9L A;  3UPN A;  1XA1 A;  2XR0 A;  4YFM A;  2XA7 M;  4MN6 A;  3HLF A;  4H6J A;  2ZC3 B;  4OLD A;  3HLC A;  1TEM A;  5L8M A;  1C3B A;  1YLP A;  3NUL A;  2P04 A;  4XT2 B;  3N7W A;  3IS2 B;  2H5S A;  5FL3 A;  2ZL1 A;  3C4P A;  3EGD C;  2XFS A;  1TS6 A;  3UB8 A;  3BLM A;  3M6H A;  1PW1 A;  3HBR A;  2VGK A;  4KQO A;  4PPR A;  3Q7V B;  4EES A;  3PBQ A;  3HLG A;  4IVI A;  4GLQ A;  5KZH A;  4PM8 A;  1PZP A;  1DP6 A;  4DE3 A;  2A49 A;  3O86 A;  1K54 A;  5M1A A;  3GRJ A;  3SH9 A;  4Q8I A;  3LIC A;  4XT2 A;  2P08 A;  4UA6 A;  3SH8 A;  1G6O A;  3MQO A;  1IKG A;  1GA9 A;  3VSK A;  3LFV A;  2RL3 A;  3A0S A;  1K55 C;  1MY8 A;  3EQU A;  1HLU P;  1PI5 A;  3D3O A;  2V2F F;  4F3L B;  1GSW A;  1Y28 A;  3HJI A;  2IA2 A;  1W8Y A;  2H10 A;  2PBY A;  2YKF A;  3UE1 A;  4EW7 A;  5HAI A;  5EEC A;  3CPT B;  3KSG A;  1XJ3 A;  5HL1 A;  5TJJ A;  4D2O A;  2OV5 A;  2EA9 A;  3LUQ A;  1PWC A;  5L2F A;  5GLC A;  4KZ4 A;  1W63 M;  3U2A A;  1EI5 A;  2DNS A;  3IHA A;  1TVF A;  3EGX C;  4PM6 A;  5EFW A;  2M7U A;  3AGE A;  4PMA A;  5CGW A;  1BTL A;  2V0W A;  1RGZ A;  4JXW A;  4F3L A;  5F6A A;  4X6T A;  3LR0 A;  3WRT A;  1UGU A;  2JKR I;  3CPT A;  2HV1 A;  1ONG A;  1O7E A;  3B33 A;  2WKI A;  4S2L A;  1ALQ A;  3F1P B;  4PHT A;  4O0P A;  1GHP A;  4PM5 A;  1P0Z A;  2O0Y A;  5DVA A;  2PR6 A;  5HW3 A;  3FC7 A;  4GS9 B;  4IBR A;  5EM0 A;  3PXP A;  4C6Y A;  2ZOH A;  2J3T D;  3LY4 A;  1Q2Q A;  4AFI A;  1MWR A;  2PYR A;  4P6B A;  2PBD P;  3HRE A;  3MKF A;  3BY8 A;  3GQZ A;  3C8C A;  2WGW B;  2VX8 A;  3KSI A;  1PNE A;  1D7E A;  2ZM0 A;  5TBM B;  4K91 A;  2ZC6 B;  3LR5 A;  1MKM A;  2LB5 A;  3OC2 A;  3MXQ A;  3BFG A;  2EFX A;  2J8Y A;  4KEN B;  2OWH A;  3WS2 A;  4GS9 A;  1VM1 A;  1ZG6 A;  3C2W A;  4HI4 A;  4B4X A;  3B47 A;  2JKR M;  4R3J A;  4LV0 A;  4E04 A;  3LI9 A;  4OLG A;  2Y79 A;  1YKD A;  5KSC A;  4FSF A;  1Z09 A;  3UE0 A;  1HD8 A;  3UB6 A;  1XFN A;  2ZQD A;  5E43 A;  3IF6 C;  4JGQ A;  5I5L A;  4ZBE A;  1JWV A;  4S2N A;  3FWL A;  3BJN A;  2HDS A;  3KYE A;  3W8K A;  2PT7 A;  3BQ8 A;  2W1T B;  3RTY A;  3MFX A;  3A3I A;  4C3Q A;  1N9B A;  4X56 A;  4DMZ A;  5AQA A;  5HFO A;  3ICY A;  1W7F A;  2CMN A;  1DJA A;  3P98 A;  4O7D A;  4I3J A;  5FDS A;  1S6R A;  3PYP A;  3QP4 A;  2WAF A;  5DF9 A;  4E3O A;  4P85 A;  3ZG8 B;  2ZQ8 A;  4QD4 A;  2QKP A;  1F98 A;  3A0R A;  1ERO A;  2W1T A;  1Y54 A;  5E2H A;  4O8G A;  1K25 A;  2BTF P;  3Q81 A;  3C4O A;  4CJN A;  3C7V A;  2R9X A;  4MBK A;  3A3E A;  1W8Q A;  4OH0 A;  5FQI A;  3H9W A;  5K5B A;  4FTX A;  4ZRR A;  2AVX A;  3NI9 A;  4CLC B;  3ITA A;  1OTA A;  3NEC A;  2B95 A;  3T4L A;  4EU0 A;  4PAU A;  1YQS A;  4BL3 A;  3KYZ A;  3NOU C;  2GX5 A;  1S4R A;  2QJ7 A;  3H82 B;  1STZ A;  3HUM A;  3LO7 A;  2QHK A;  3BEC A;  4UQI S;  4DXB A;  4WBG A;  3VP2 A;  3E2K A;  2JKF A;  4X1L A;  2GNX A;  1CEF A;  5CXW A;  2M7V A;  1IEM A;  5KSH A;  4MDZ A;  4BMW A;  1DJB A;  1FIK A;  2XD5 A;  4CLC A;  1TD5 A;  4YOF A;  4EXO A;  2K31 A;  4S2P A;  3LYX A;  4R70 A;  4P87 A;  2Q0O A;  5J8X A;  4HP9 A;  2INW A;  2XRO A;  1K54 C;  2BLS A;  5HWV A;  2DRW A;  4OPY A;  1XGI A;  3JVU A;  3UN7 A;  3IHB A;  2ZBB A;  2OWJ A;  5EPH A;  3NDE A;  1P9W A;  4R0Q A;  4BBT A;  4LEN A;  1GSX A;  2ZQC A;  2WKP A;  4GB7 A;  5F68 A;  1G28 A;  1YM1 A;  3FZC A;  4F94 A;  2V1Z A;  3UB7 A;  1H8M A;  4OP8 A;  3IF5 A;  3SS5 A;  2HF6 A;  5FAT A;  2Y4A A;  5FEF A;  3FPW A;  4E3K A;  4U3T A; 
#chains in the Genus database with same CATH homology
 4X53 A;  3NC8 A;  3C5A A;  4FCF A;  2JC7 A;  2WGV A;  3BYD A;  4X69 A;  4WEL A;  4YIN A;  3G34 A;  3Q82 A;  1E4D A;  5CHM A;  5E2G A;  1BLP A;  3IWI A;  4QY5 A;  2WKH A;  1SDE A;  1IYS A;  4X68 A;  3VOZ A;  3V50 A;  5FI2 A;  5KMW A;  5AQ7 A;  1MWT A;  1CI9 A;  4GDN A;  4ZJ2 A;  4CPK A;  3CJM A;  2Y2G A;  3HVF A;  5EVI C;  3UPP A;  3G30 A;  2EX9 A;  2XD1 A;  1FR6 A;  3A3F A;  3G2Y A;  1KE4 A;  3VMA A;  5JYP A;  1BSG A;  3IXG A;  3P09 A;  4LV3 A;  4HEF A;  2HP9 A;  2Y2K A;  3QNC A;  4XUX A;  2HDQ A;  3AGF A;  2HPB A;  3BLS A;  4N9L A;  4E6W A;  3IT9 A;  3ZG0 A;  1KDW A;  3PAG A;  2A3U A;  3ZG5 A;  2ZQA A;  3UPN A;  5EUA A;  5HAR A;  1XA1 A;  5I94 A;  2XR0 A;  4YFM A;  4Y0T A;  4OOM A;  1XKZ A;  3PBN A;  4R4R A;  5A91 A;  3WS1 A;  3HLF A;  2ZMA A;  2ZC3 B;  3S1Y A;  3SOI A;  4OLD A;  4RYE A;  3WS4 A;  3HLC A;  1TEM A;  4E3J A;  1C3B A;  1YLP A;  1WE4 A;  3N7W A;  5HX9 A;  3Q7Z A;  1IKI A;  2H5S A;  1MWU A;  1HTZ A;  2GDN A;  4GD6 A;  5FQM A;  4OKP A;  3C4P A;  2XFS A;  4GNU A;  2ZLY A;  3BFF A;  4QHC A;  1K56 A;  2EX8 A;  3V3S A;  4BLM A;  3BLM A;  3TSG A;  3O88 A;  4OPQ A;  1NYY A;  3M6H A;  5DF7 A;  1J9M A;  1PW1 A;  1YMS A;  3HBR A;  3ITB A;  2VGK A;  4KQO A;  4L0L A;  4PPR A;  2ZC5 B;  3MZE A;  2HP6 A;  3Q7V B;  2OSU A;  3PBQ A;  1FQG A;  4OP5 A;  2Y2P A;  4KZA A;  5FI6 A;  1O07 A;  3RXX A;  5GL9 A;  4R1G A;  3HLG A;  3MKE A;  4IVI A;  5CHJ A;  1XA7 A;  4R4S A;  5EE8 A;  5KZH A;  1YLY A;  4PM8 A;  4DRT A;  1PZP A;  4DE3 A;  2A49 A;  3NY4 A;  1K57 A;  5F83 A;  2G2U A;  3O86 A;  3PBT A;  4DXC A;  1K54 A;  5DF8 A;  5M1A A;  3GRJ A;  5FQQ A;  1ONH A;  4ZJ1 A;  4RVA A;  3BM6 A;  5EOO A;  3SH9 A;  5HAQ A;  4Q8I A;  4DKI A;  4KQR A;  4OQI A;  3IXD A;  1L2S A;  1PWD A;  3MFD A;  4K0W A;  4RA7 A;  1DY6 A;  5GHZ A;  1JWZ A;  4UA6 A;  3SH8 A;  4OQH A;  1IEL A;  4LCL A;  3V3R A;  4WZ5 A;  1IKG A;  2IWD A;  1E3U A;  1GA9 A;  3VSK A;  2WGW A;  2WYX A;  2Y2J A;  4GZB A;  2RL3 A;  2ZQ9 A;  1QME A;  1K55 C;  2Y2Q A;  1MY8 A;  3EQU A;  4S2N C;  1I2S A;  1PI5 A;  2Y2O A;  4FH2 A;  2ZM8 A;  5DTT A;  2V2F F;  4JBF A;  4QJG A;  3OPL A;  1I2W A;  2E8I A;  2IWC A;  2R9W A;  4XUZ A;  4KZ8 A;  1W8Y A;  2H10 A;  2PBY A;  3Q1F A;  3UE1 A;  5HAI A;  2Q9M A;  3UPO A;  5EEC A;  1VQQ A;  3IH9 A;  4JF5 A;  3UE3 A;  5EVI B;  4KQQ A;  1IYO A;  2ZQ7 A;  1LI0 A;  3V39 A;  5HL1 A;  1M40 A;  1I5Q A;  2FFF B;  5GLB A;  4D2O A;  2OV5 A;  4EUZ A;  2ZD8 A;  3FV7 A;  3M2J A;  4PM7 A;  1PWC A;  5FAS A;  3ZFZ A;  5L2F A;  5AQB A;  5DTK A;  5EVL A;  3ZVT A;  2XF3 A;  1SCW A;  2OLU A;  5GLC A;  2UWX A;  1U60 A;  4S2J A;  1CEG A;  4KZ4 A;  2C6W B;  4OPZ A;  4PM9 A;  3IWO A;  3OPP A;  1EI5 A;  2DNS A;  5GHX A;  3UNW A;  3WS0 A;  1ERM A;  1K56 D;  2WZX A;  2Y2M A;  1TVF A;  3IHA A;  1BZA A;  3MZD A;  1HVB A;  4PM6 A;  3DWZ A;  4WZ4 A;  3O3V A;  5GLA A;  4QY6 A;  1M6K A;  3AGE A;  4WEJ A;  3DW0 A;  4PMA A;  5CGW A;  1BTL A;  4RX3 A;  4UHU A;  1L0G A;  4A5R A;  3M6B A;  1RGZ A;  3N8R A;  1H8Z A;  4JXW A;  4MNR A;  1N4O A;  2J9O A;  3ZVW A;  3TG9 A;  3LCE A;  4WYY A;  4X6T A;  4GD8 A;  3WRT A;  3IWQ A;  2BG1 A;  5M18 A;  3RJU A;  1ONG A;  5GHY A;  5EVI A;  5CEC A;  1XX2 A;  2PU4 A;  1CK3 A;  1H8Y A;  1O7E A;  1FR1 A;  2WKI A;  3OCL A;  3HLD A;  4S2L A;  4WMC D;  1ALQ A;  1W79 A;  3NBL A;  3VP4 A;  4LCM A;  1L0F A;  3MXR A;  5FI7 A;  2Y91 A;  1G6A A;  2OLV A;  1GHP A;  4PM5 A;  1ES2 A;  4DDY A;  1FSW A;  2Y55 A;  3AGD A;  2J7V A;  4FD8 A;  5DVA A;  5HW3 A;  3ZNY A;  5DTS A;  3VSL A;  2XLN A;  3GVB A;  4IBR A;  3UO9 A;  3VFH A;  4S2K A;  1PI4 A;  4WEK A;  2WAD A;  1QMF A;  1E3U D;  1YLZ A;  4C6Y A;  4JF4 A;  3LY4 A;  4GN2 A;  4N9K A;  1Q2Q A;  3S4X A;  4S2I A;  1KVL A;  1NXY A;  1MWR A;  1JTD A;  2PU2 A;  2Y2N A;  3IXB A;  4P6B A;  3HRE A;  2EXB A;  3MKF A;  1Q2P A;  4Z9Q A;  3GQZ A;  2XEP A;  1IYP A;  2WGW B;  4KG5 A;  4RX2 A;  4C75 A;  4E3N A;  5CTN A;  3SH7 A;  2JE5 A;  4Y0U A;  4EV4 A;  1BLS A;  2ZM0 A;  5TR7 A;  3CMZ A;  4K91 A;  2ZC6 B;  5M19 A;  3JYI A;  4LV1 A;  3WRZ A;  4P0M A;  3C7U A;  4JXG A;  4EBP A;  3OC2 A;  3ZGA B;  3BFG A;  4KZ7 A;  1RCJ A;  2EX6 A;  3UDF A;  4E6X A;  5CED A;  2EFX A;  4N92 A;  5CGX A;  2J8Y A;  4EQI A;  3NDG A;  5CRF A;  3WWX A;  2HDR A;  4KEN B;  1KVM A;  3FKV A;  3WS2 A;  4JPM A;  2XGN A;  4WMC A;  3VP3 A;  4B88 A;  1VM1 A;  1ES5 A;  1ZG6 A;  4B4X A;  3IH8 A;  4HBU A;  2VGJ A;  4GKU A;  3HUO A;  1GA0 A;  1NZU A;  3I7J A;  3B3X A;  4R3J A;  4LV0 A;  5U47 A;  1PW8 A;  4OLG A;  3HUN A;  1YT4 A;  4OPR A;  4B4Z A;  5KSC A;  4FSF A;  5F82 A;  1G68 A;  5GLD A;  2Y2H A;  4BEN A;  3UE0 A;  2H0T A;  1HD8 A;  3FKW A;  5FQK A;  3V5M A;  2G2W A;  2ZQD A;  4UAA A;  2ZM2 A;  5EVI D;  3RXW A;  1K6S A;  1GHI A;  1WYC A;  1FOF A;  3IF6 C;  4OOL A;  3GSG A;  1YLJ A;  4Y7P A;  1ESU A;  5E43 A;  1JTG A;  4ZBE A;  3N6I A;  1JWV A;  3ZDJ A;  1K55 A;  4JXS A;  4S2N A;  3FWL A;  5CEB A;  2HDS A;  3W8K A;  5BOH A;  1K4F A;  3MBZ A;  4U0X A;  4BD0 A;  2XQZ A;  3PAE A;  1FSY A;  4MEZ A;  3ZG7 B;  3DWK A;  1PWG A;  3FYZ A;  1JVJ A;  3A3I A;  4C3Q A;  1SDN A;  4UA7 A;  4BJP A;  2QMI A;  5FA7 A;  1N9B A;  4IVK A;  4X56 A;  4Y0O A;  5CHU A;  5AQA A;  5TGF A;  5HFO A;  4QB8 A;  3OPR A;  1BUL A;  4KG2 A;  2Z2L B;  1MBL A;  1W7F A;  3QHY A;  1MKI A;  1OME A;  4KZ9 A;  4K0X A;  1DJA A;  3PBO A;  3M2K A;  3P98 A;  3VOY A;  3G2Z A;  4O7D A;  5HAP A;  3SS4 A;  1YLT A;  1S6R A;  3WS5 A;  5FQJ A;  3ZNT A;  2P74 A;  1RGY A;  2WAF A;  5DF9 A;  1RP5 A;  4JLF A;  4R3B A;  4E3O A;  2XH9 A;  2QPN A;  4OON A;  4P85 A;  3ZG8 B;  1L0D A;  3OCN A;  3D4F A;  5G18 A;  1L0E A;  2ZQ8 A;  3UDI A;  4DE2 A;  4N1H A;  1FCM A;  3CZD A;  3DTM A;  4QD4 A;  4S2M A;  4JF6 A;  1K38 A;  1E25 A;  2HP5 A;  1XPB A;  3A3J A;  3VFF A;  4E3I A;  1ERO A;  1NY0 A;  1CI8 A;  4ID4 A;  5E2H A;  1Y54 A;  4EWF A;  3N8S A;  1K25 A;  2V20 A;  3Q81 A;  5D3O A;  3HLB A;  4X55 A;  4KZB A;  1KGG A;  3C4O A;  3W4P A;  4R23 A;  1PIO A;  1K4E A;  4CJN A;  2P9V B;  3BRM A;  2WK0 A;  3C7V A;  2XDM A;  1W5D A;  2X01 A;  2B5R A;  1SKF A;  5EOE A;  2R9X A;  2FFY A;  2H0Y A;  3GR2 A;  3IXH A;  2X71 A;  4MBK A;  1LHY A;  3A3E A;  1W8Q A;  4GDB A;  4KZ5 A;  4OH0 A;  5FQI A;  3VP1 A;  3A3D A;  1NJ4 A;  1MWS A;  4OQG A;  3HLE A;  3NI9 A;  3BFC A;  4MBH A;  4JKT A;  3OPH A;  1FCO A;  3ZCZ A;  3HL9 A;  2J9P A;  3ITA A;  3O87 A;  4E3L A;  4QU3 A;  1PZO A;  1SHV A;  5E2E A;  3OZH A;  3G35 A;  2WUQ A;  3NCK A;  5A90 A;  2I72 A;  1NRF A;  1BUE A;  5E2F A;  3N4I A;  3SS3 A;  1LL9 A;  1XGJ A;  1YQS A;  4BL3 A;  2WZZ A;  5F1F A;  4N1X A;  2Y59 A;  1ESI A;  2JCH A;  3LEZ A;  4ZAM A;  4MLL A;  2CC1 A;  1KDS A;  2IWB A;  3HUM A;  3ISG A;  3LO7 A;  1LI9 A;  4OQ0 A;  1ES3 A;  4BQM A;  1ZC2 A;  1LL5 A;  3BEC A;  2P9V A;  3IF6 B;  3UDX A;  1KGF A;  4HES A;  4DXB A;  4WBG A;  4M3K A;  5FAO A;  5FDH A;  3E2K A;  3VP2 A;  2Y2I A;  2ZC7 A;  1BT5 A;  5JYO A;  1CEF A;  5CXW A;  3W4O A;  4EBL A;  4MBF A;  1IEM A;  4NET A;  5FQ9 A;  4BD1 A;  4DE1 A;  4GOG A;  2EFU A;  3EQV A;  5KSH A;  4EBN A;  4H8R A;  5IHV A;  1DJB A;  1KE3 A;  2XD5 A;  3BFE A;  1BLC A;  2Q9N A;  1AXB A;  1NYM A;  1Z6F A;  1XXM A;  4S2O A;  1GHM A;  4S2P A;  1YMX A;  3UY6 A;  5A93 A;  2XK1 A;  5A92 A;  1FCN A;  4DF6 A;  4P87 A;  5J8X A;  1GCE A;  1KE0 A;  3MZF A;  1K57 C;  2QZ6 A;  5F1G A;  1K54 C;  2BLS A;  2WKE A;  2ZC4 B;  1IYQ A;  1LLB A;  2DRW A;  3E2L A;  5FAP A;  2RCX A;  3G4P A;  4OPY A;  1BLH A;  3IQA A;  3TOI A;  1XGI A;  4FH4 A;  3LY3 A;  3IF6 A;  3PBS A;  3UN7 A;  3IHB A;  1DJC A;  3S22 A;  2Z2M B;  4WZ5 C;  2Y2L A;  4KZ6 A;  1ES4 A;  4LV2 A;  3GV9 A;  3NDE A;  5EPH A;  3ZG9 B;  2JBF A;  2X02 A;  1H5X A;  1TDG A;  1ZKJ A;  4R0Q A;  1K6R A;  3W4Q A;  3CG5 A;  4LEN A;  4U0T A;  4OVD A;  4UA9 A;  3BFD A;  1HZO A;  4WM9 A;  2WAE A;  4ZTK A;  3Q07 A;  2ZQC A;  4GB7 A;  2ZJ9 A;  4KZ3 A;  2EXA A;  2DCF A;  5FAQ A;  3BEB A;  5CER A;  1ZG4 A;  1XP4 A;  1YM1 A;  3FZC A;  2XFT A;  4NK3 A;  4E3M A;  3Q7V A;  1JWP A;  2EX2 A;  1PYY A;  3PBR A;  3VP0 A;  5CGS A;  5CTM A;  5TFQ A;  3HLW A;  4BL2 A;  1KGE A;  1YLW A;  2C5W B;  4ZJ3 A;  4F94 A;  1NZO A;  4DE0 A;  2V1Z A;  5FSR A;  1MXO A;  1TDL A;  5AQ9 A;  4DDS A;  2HDU A;  3N8L A;  3QNB A;  4IBX A;  3GMW A;  3IF5 A;  4HBT A;  3GTC A;  1EWZ A;  4JXV A;  4OP8 A;  3SS5 A;  3MXS A;  4OOY A;  1ERQ A;  5FAT A;  1S0W A;  3ZHH A;  2Y4A A;  4ZDX A;  3G31 A;  4E3K A;  4IED A;  4XXR A;  3G32 A;  1WYB A;  4KG6 A;  2WGI A;  4U3T A;  3NIA A;  3PTE A;  1MPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...