4M3KA

Structure of a single domain camelid antibody fragment cab-h7s in complex with the blap beta-lactamase from bacillus licheniformis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
260
Chain Sequence
MKDDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALVTSLRAFALEDPGKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Probing the mechanism of aggregation of polyQ model proteins with camelid heavy-chain antibody fragments
rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase/immune system
total genus 93
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4m3kA00
1ERMA 3N7WA 2EFUA 5DTTA 4ZTKA 4DXCA 4KZAA 1K6RA 3VP4A 1PZPA 3TG9A 1W7FA 1JTGA 1IYPA 1XX2A 3ZDJA 3UO9A 3TOIA 4C75A 4FSFA 1LL9A 3A3IA 1MPLA 3GRJA 1W8YA 2ZM8A 3IWQA 3BFDA 3OPPA 5GL9A 5IHVA 3SS5A 3ZHHA 1HD8A 3Q82A 3SH7A 1K4EA 1RCJA 1FCMA 2ZMAA 4GZBA 4X56A 3IT9A 1ZKJA 2XEPA 4JF4A 2HP5A 1BLSA 1KE3A 2EFXA 5CTNA 5F83A 4EBPA 2B5RA 3A3EA 3SS3A 2BG1A 2PBYA 2JCHA 1HVBA 3LCEA 2J7VA 4IBXA 4JLFA 4WEKA 1CI9A 1ZG6A 1EROA 3HREA 4K0WA 1H8YA 3OCNA 2H5SA 2VGKA 2Y2HA 3GVBA 5FI7A 5TR7A 1KE4A 1MBLA 3IH8A 1PZOA 3W8KA 1NY0A 4KZ8A 2Y91A 5EVIC 1GHPA 2PU2A 2HP9A 3HUNA 3Q07A 4R23A 3B3XA 1M40A 1BSGA 4MEZA 3LY4A 1CEGA 4WEJA 4WMCD 1K55A 1JWPA 2ZC5B 2H0TA 3IXDA 4KQOA 4RX3A 4JXGA 5GHZA 4ZDXA 1VM1A 2XF3A 5KZHA 1Q2QA 5DTSA 4D2OA 1LHYA 4LV3A 1GCEA 1MWUA 4HESA 1TVFA 1PI4A 2Q9NA 1WYBA 1L0GA 3AGFA 1LL5A 3UDFA 4OOYA 1NYYA 1ONGA 1BLCA 3VFHA 2ZC6B 1K38A 1DY6A 1PIOA 1CI8A 2EXBA 4PM5A 1W79A 2XLNA 3PBOA 3ZCZA 1I2WA 4EQIA 2XFTA 3VP2A 3CG5A 3N6IA 2ZQCA 4JXWA 4NK3A 4GOGA 5HARA 2ZJ9A 3NDEA 5J8XA 4OQIA 4F94A 4E3OA 5EVLA 1K6SA 3OCLA 4FH2A 2HPBA 3PBTA 3GV9A 3ZG5A 4OPYA 1EI5A 4WZ4A 4JXVA 1PWGA 3NI9A 4IEDA 2Z2LB 5FAPA 3IWIA 3C7UA 3W4QA 1CEFA 3D4FA 4OQHA 1YLYA 5HAQA 3PBSA 3UPOA 2I72A 2FFFB 3O88A 5CHMA 4MBHA 4QD4A 5FI2A 3G2ZA 2ZM0A 4GNUA 1QMFA 5KSCA 4MNRA 1Z6FA 5FSRA 5CGXA 3G32A 4KG6A 4DKIA 4NETA 2XGNA 2XD5A 1AXBA 2ZM2A 2ZLYA 4RA7A 4E3KA 2DNSA 3P09A 4UA7A 1GHMA 3GMWA 5CECA 4E6WA 3OPRA 4JF5A 3HUOA 4ZJ1A 3NY4A 2P74A 3BFCA 1N9BA 3I7JA 5EPHA 2EX2A 5GLAA 3WRTA 1IEMA 1W5DA 3BFFA 5AQAA 4Q8IA 3NBLA 3QNCA 1FSWA 4R1GA 4EBLA 1WYCA 3S4XA 5GLDA 4FD8A 5EE8A 1IKIA 4P85A 3ITBA 3IQAA 4KG2A 2V1ZA 3CJMA 5FAQA 2Z2MB 4C3QA 2WAFA 1K25A 2BLSA 4GD6A 3UE3A 5FATA 3IXBA 5FASA 2WGWA 1MWRA 1MXOA 2WUQA 4BENA 3EQVA 2X01A 1LLBA 3BFEA 3IWOA 5DF7A 4BLMA 1EWZA 5E2GA 4DE2A 5FQMA 1GA0A 2ZC7A 1MWTA 3PBQA 3LY3A 4OP8A 2C5WB 3VP3A 1BTLA 4U3TA 1ZC2A 1MY8A 3JYIA 5FA7A 3VFFA 4CJNA 5E2EA 4PM7A 3BRMA 2C6WB 3MXRA 3NC8A 5HW3A 1BLHA 4JKTA 3HLEA 3IHAA 5M18A 2QPNA 2HDSA 5FQ9A 4ZJ2A 3M6HA 5F82A 1JWVA 5CTMA 1XA7A 5GHYA 1G6AA 2Y2OA 3BLMA 1S0WA 2OV5A 4R3BA 3G35A 4XUXA 1JTDA 3BEBA 2WK0A 4JBFA 1KVMA 3O87A 4DRTA 1YLTA 3NIAA 4PM6A 1IKGA 2E8IA 4S2LA 2X02A 2H10A 3G34A 2HDQA 2ZC3B 2XK1A 1NZUA 3C7VA 4QB8A 2Y4AA 3G4PA 3G2YA 4BJPA 1KDSA 4DDYA 1FCOA 5JYOA 1DJCA 3HLGA 4E3NA 5KSHA 3QHYA 3V39A 4S2IA 3Q1FA 1NYMA 1SDEA 4LCMA 2Y2JA 5D3OA 4OONA 3W4PA 2WADA 3DTMA 4P6BA 3MBZA 2Y2LA 2CC1A 4PPRA 2Y59A 2GDNA 5DF9A 4BL2A 4WMCA 2XD1A 3E2KA 1PWDA 2G2UA 3DW0A 1KGFA 3PTEA 5CERA 4ID4A 5E43A 1BLPA 2PU4A 3EQUA 3HLFA 5DF8A 1L0DA 2Y2KA 4E3LA 3SOIA 2EX9A 1C3BA 2R9WA 4WZ5C 5EUAA 3OZHA 4MBKA 1SHVA 4Y0UA 3ZNTA 4A5RA 1FR6A 2WZZA 3ZGAB 4BD0A 4WELA 2XQZA 4MBFA 4N9KA 2H0YA 4E3IA 1ESIA 4HBUA 3MZFA 4M3KA 1FOFA 1L0FA 4DE1A 4DXBA 1ES3A 1M6KA 5TFQA 3IH9A 2IWBA 5A92A 1KGEA 2EXAA 4IVIA 1YT4A 5E2HA 5EVIB 4P0MA 3ZVWA 3MKFA 3VP0A 1K56A 5CHJA 1KGGA 3N8RA 1BT5A 3UN7A 1IELA 2Y2GA 1K56D 4GDNA 3ITAA 3PBNA 4X68A 1BULA 1KE0A 5CGWA 4K0XA 5AQBA 3RXWA 3VP1A 5A93A 4E3JA 2OLVA 5DVAA 2XH9A 4N9LA 4ZBEA 4FH4A 4QY5A 3WWXA 1G68A 2J9OA 3UPNA 2DCFA 3RXXA 1E3UA 3N8LA 1L0EA 3HBRA 5FQIA 4OLGA 3G31A 1E3UD 2VGJA 3S22A 3VMAA 2ZQ7A 1KDWA 1W8QA 1K54C 5EVIA 4X69A 4X55A 5HX9A 1NJ4A 2Y55A 5TGFA 3ZG9B 5EVID 5CGSA 1ES5A 1ES2A 4QJGA 1BUEA 1CK3A 2WKHA 2X71A 1ERQA 3V5MA 3ZG8B 4P87A 2V20A 2XDMA 4OPZA 1XGIA 5FQKA 3IXGA 4MLLA 4KQQA 2ZC4B 5F1GA 1FCNA 5FAOA 3ISGA 4R4RA 5CEBA 4OOLA 3FYZA 1ONHA 3ZG0A 1LI9A 2EX8A 1S6RA 1TDGA 4S2JA 4GN2A 1Y54A 3LEZA 5CHUA 3SS4A 1YLJA 1NXYA 3W4OA 4KG5A 5F1FA 1TDLA 3M2KA 1YM1A 4KQRA 1YMXA 1IYQA 3V3RA 1YMSA 1IYSA 4PM8A 1O7EA 1XA1A 4KZ5A 4KZ7A 4YFMA 2Y2NA 4RVAA 2EX6A 3GQZA 1SDNA 4GKUA 4LV2A 2XFSA 1QMEA 5FDHA 4LCLA 4UA6A 4EWFA 2WKEA 3MZEA 3CZDA 2WAEA 3BFGA 4KZ4A 4R4SA 4RYEA 3MZDA 3PBRA 2HP6A 5M1AA 4CPKA 3IF6C 3ZG7B 2R9XA 2A3UA 1PW8A 3UNWA 3BM6A 3FKVA 3Q7VB 3BLSA 3NDGA 2OSUA 4KENB 2Y2IA 4C6YA 3NCKA 3C5AA 5KMWA 3ZFZA 3UDIA 1IYOA 1I2SA 3MFDA 3LO7A 5GHXA 3QNBA 1K57C 4O7DA 4OOMA 4OVDA 3AGDA 3C4PA 5GLCA 3UPPA 3V50A 2UWXA 4JXSA 1I5QA 5AQ7A 1YQSA 5FQJA 5HAPA 2Q9MA 4B4XA 4E6XA 3SH8A 3G30A 4KZ9A 1XXMA 4OH0A 1GA9A 1NZOA 1YLWA 2ZD8A 3OPHA 3PAEA 3Q7ZA 2QZ6A 3VSLA 4B88A 5JYPA 3AGEA 2JE5A 3Q7VA 4R3JA 1H8ZA 1PYYA 4JPMA 3GTCA 4LV1A 5HFOA 4S2OA 2FFYA 3O86A 3HVFA 3P98A 4U0XA 2WKIA 3WRZA 4N1HA 3IF6B 4PM9A 1FSYA 4KZ6A 2P9VB 3GR2A 4QU3A 4E3MA 4DDSA 2RCXA 3A3JA 5A91A 1BZAA 4OKPA 3WS5A 2IWCA 4GDBA 3UY6A 3UE0A 4OQ0A 4JF6A 2WGVA 5I94A 1O07A 4WM9A 1E25A 5L2FA 4Y7PA 5CEDA 1TEMA 1ZG4A 3FV7A 1DJAA 4OPRA 5E2FA 5HL1A 4U0TA 5FI6A 3IF6A 4H8RA 2QMIA 2P9VA 1RP5A 3HL9A 3PAGA 4WYYA 1SCWA 3HLWA 3CMZA 2J8YA 5CRFA 5DTKA 2HDRA 1YLZA 1N4OA 1XPBA 4IVKA 1ALQA 1K57A 1Q2PA 1XGJA 4LENA 2XR0A 3FKWA 3IF5A 2A49A 1KVLA 2JC7A 2OLUA 4YINA 4X6TA 1ESUA 1E4DA 3BECA 2ZQDA 4BQMA 4N92A 4S2NC 4UAAA 3HLBA 3HUMA 3DWKA 1H5XA 1DJBA 4KZ3A 1MKIA 1J9MA 4KZBA 3GSGA 4Z9QA 4FCFA 2IWDA 3C4OA 1ES4A 3OC2A 5FQQA 3WS2A 4Y0TA 3MKEA 4HEFA 2G2WA 2ZQ8A 3E2LA 1HTZA 3S1YA 4K91A 3VOYA 4ZAMA 4UA9A 3RJUA 1XKZA 5EOOA 4QHCA 4EV4A 1K4FA 3M2JA 2DRWA 4PMAA 3IXHA 4WZ5A 4XUZA 4EUZA 3BYDA 4BD1A 4UHUA 2WZXA 1PW1A 4Y0OA 2Y2QA 5U47A 3VSKA 3ZVTA 4B4ZA 4L0LA 3A3FA 3TSGA 4N1XA 5BOHA 4ZJ3A 2J9PA 4OQGA 2WYXA 4S2MA 3ZNYA 3M6BA 4OP5A 3OPLA 1LI0A 3N4IA 3Q81A 4EBNA 1OMEA 1PWCA 2WGWB 3V3SA 5EECA 4S2PA 3N8SA 3WS4A 5AQ9A 2Y2MA 3UE1A 1GHIA 1SKFA 3HLCA 5G18A 1WE4A 1JWZA 2JBFA 1JVJA 2V2FF 3WS1A 4S2KA 3IHBA 3HLDA 4WBGA 1YLPA 4GD8A 4DF6A 1PI5A 2ZQAA 2RL3A 3FWLA 5GLBA 1FR1A 4LV0A 4BL3A 1L2SA 4R0QA 4DE0A 5HAIA 2WGIA 1MWSA 1RGZA 3UDXA 3WS0A 4DE3A 3FZCA 1K55C 1XP4A 4X53A 4RX2A 1HZOA 1VQQA 4S2NA 3SH9A 3MXSA 5A90A 5EOEA 4OLDA 3A3DA 3VOZA 5CXWA 2ZQ9A 1K54A 3DWZA 2HDUA 2Y2PA 1NRFA 1FQGA 1RGYA 4GB7A 4IBRA 4XXRA 5M19A 4OPQA 4QY6A 3O3VA 4HBTA 1U60A
chains in the Genus database with same CATH superfamily
3N7WA 2EFUA 5DTTA 1K6RA 3D72A 1G5UA 1W7FA 1JTGA 1IYPA 1XX2A 3UO9A 4FSFA 3A3IA 5HWWA 3BFDA 3S7OA 2NUTC 3Q82A 4CQHA 4ETZA 4GZBA 1FCMA 4X56A 4EEUA 1BLSA 1KE3A 2BG1A 2PBYA 2QKPA 2V9AA 1HVBA 3BJNA 3LCEA 3DAVA 2IA2A 3HREA 4K0WA 1H8YA 4L9GA 2H5SA 3GVBA 2Y2HA 2PRFA 1NY0A 2P04A 2Y91A 4GJ4A 2PU2A 2HP9A 2OWHA 4MEZA 4P6ZS 2H0TA 4X25A 4HHDA 4JXGA 3QP1A 2XF3A 4LV3A 1GCEA 2A2LA 1PI4A 2VGLM 4GS9A 1BLCA 2O0YA 3P01A 3L7HA 1PIOA 1TF1A 1W79A 1I2WA 4EQIA 4L9FA 2XFTA 3VP2A 2ZQCA 4XT2A 1K6SA 3OCLA 1EI5A 2W3DA 3L9KA 3NI9A 4IEDA 1DP8A 1OT6A 3NHQA 4OQHA 4IJGA 1Y4OA 5HD5A 4MNRA 2WKPA 4KG6A 4NETA 2ZM2A 1W63M 4WN5A 3GMWA 5CECA 4E6WA 4JF5A 5EPHA 1CF0A 3BFFA 3NBLA 1FSWA 1UGUA 3CJMA 5FAQA 2P7JA 3UE3A 5FASA 2WGWA 4BENA 2W1TB 5DJTA 2X01A 1LLBA 2Z6DA 1EWZA 4DE2A 1MWTA 5DFYA 4U3TA 5FA7A 3VFFA 4LRXC 3BRMA 3NC8A 1BLHA 4GW9A 2G7UA 4JKTA 5FEFA 1YPRA 2HF6A 1K0KA 1LSWA 3LUQA 5GHYA 4O0PA 1G6AA 3BLMA 4XUXA 3LI8A 2HV1A 3UB6A 3NIAA 3LFVA 2O9AA 3UMEA 4NEED 2ZC3B 3R7WB 2XK1A 3C7VA 3G2YA 5EM1A 3E4QA 1D1JA 5JYOA 2VEAA 3HLGA 3V39A 1SDEA 4LCMA 2CMNA 1WA9A 3H82B 5HWVA 3DTMA 4P6BA 3MBZA 1OJ5A 2XD1A 1PWDA 5I5LA 4IUKA 5DF8A 1L0DA 3SOIA 2EX9A 3C8CA 5DKLA 5J3WA 4A5RA 1FR6A 3TE8A 1LSXA 3ZGAB 2XQZA 5HZHA 2H0YA 2KX6A 1D7EA 4DE1A 3IH9A 4NXGA 2IWBA 5A92A 3T1QB 2JKTI 4IVIA 5E2HA 1YSPA 3MKFA 5CHJA 3N8RA 2XA7S 2Y2GA 3A0SA 3PBNA 1BULA 1KE0A 5A93A 5DVAA 2DCFA 1E3UA 4RQ9A 4HJ6A 4KUKA 3K3CA 5EVIA 3S7PA 3LIFA 4X55A 5HX9A 3ZG9B 1VETB 5TGFA 1VB6A 1PFLA 2X71A 4HJ3A 2Z6CA 4DJ2A 5FQKA 4MLLA 3ISGA 4R4RA 3FYZA 3MR0A 1S6RA 4S2JA 3IX4A 4H6JA 3D3OA 4PM8A 5G4YA 1XA1A 4YFMA 3GQZA 1SDNA 1QMEA 1MKMA 3F1PB 3D9YA 3K3DA 3CZDA 2WAEA 4KZ4A 3MZDA 4CPKA 4X1LA 2XSSA 2A3UA 5L07A 3NDGA 4C6YA 3C5AA 3F1NA 1IYOA 5GHXA 1K57C 4OOMA 3C4PA 4B9OA 2UWXA 1X0OA 5AQ7A 4BBVA 2PAVP 3KYEA 1XXMA 5EM0A 4CLCA 2ZD8A 1YLWA 3PAEA 3VSLA 4B88A 5JYPA 3AGEA 2JE5A 4R3JA 1PYYA 1T1CA 4KUOA 5HFOA 2FFYA 2W3GA 2P9VB 3GR2A 3T1RA 4E3MA 2O9CA 4I39A 3A3JA 5A91A 1BZAA 5AVEA 1O07A 4WM9A 1E25A 5L2FA 4Y7PA 1UWPX 5CEDA 3CHWP 5HL1A 4U0TA 4ARZA 3IF6A 3H7WA 4WYYA 2H28A 4HP9A 4HI4A 4MN5A 4LENA 2XR0A 3IF5A 2J80A 3LICA 4YINA 4O8GA 1ESUA 2ZQDA 4BQMA 1H5XA 4KZ3A 1MKIA 2W0NA 3EGDC 4JGOA 2IWDA 1ES4A 2W3EA 4Y0TA 1S1YA 2M1CA 1XKZA 4EV4A 3M2JA 4PMAA 3BYDA 4UHUA 4Y0OA 1J3WA 4N1XA 3LEQA 2WYXA 3OPLA 1PWCA 4S2PA 1OTDA 3E4OA 4LRYC 1WE4A 1JWZA 3IHBA 3MMHA 1EW0A 2RL3A 4EQ1A 2Y8HA 1L2SA 2GNXA 3WS0A 2GX5A 4DE3A 4S2NA 3IX3A 3SH9A 4EETB 3MXSA 3VOZA 2HDUA 5M19A 3NOUC 4QY6A 2ZL1A 4HBTA 1U60A 1ERMA 3VP4A 1P9RA 5FEGA 3TG9A 3ZDJA 3TOIA 4C75A 1MPLA 3OPPA 2ZMAA 4NXFA 3IT9A 1ZKJA 5CTNA 5F83A 4EBPA 3A3EA 3U2AA 2JCHA 1IOUA 3QP5A 4IBXA 4JLFA 1ZG6A 2VGKA 5FI7A 5F6AA 3IH8A 3W8KA 2A24B 3FPVA 3LR0A 1M40A 1BSGA 3RTYA 1K55A 3C38A 3KYZA 2ZC5B 3IXDA 4KQOA 4RX3A 4P6ZM 3MSHA 1Z09A 5DTSA 2VV6A 3HJKA 5F68A 3VFHA 1F2KA 3T4SA 2ZC6B 1K38A 1CI8A 3KSGA 3RFBA 3N6IA 4NK3A 5J8XA 3PHYA 3PBTA 3GV9A 1TS7A 4WZ4A 3T4TA 5FAPA 3W4QA 4BWIA 1YLYA 5HDDA 3G2ZA 4GNUA 3MQQA 5FSRA 4DKIA 2XGNA 4MN6A 2XD5A 2ZLYA 4E3KA 1BYWA 5HSQA 4R3AA 3NY4A 3BFCA 1TS0A 3I7JA 3WRTA 2QHKA 1IEMA 3KX0X 3T1XA 2ZMVA 4Y17A 4P85A 2BLSA 3DTKA 4IUHA 3IWOA 4BLMA 2ZC7A 3U4LP 2K2NA 1GSWA 2C5WB 3QP8A 1ZC2A 1MY8A 3CAXA 2C6WB 1SKOB 5DJUA 3HLEA 3CPTB 3IHAA 2Y79A 2HDSA 5FQ9A 4ZJ2A 2XROA 2EWWA 2W1TA 5CTMA 2ZBBA 1T1BA 2Y2OA 2KDKA 4R3BA 3G35A 1JTDA 3BEBA 2VK3A 4DRTA 3IS2A 4QWOA 3S7NA 2HDQA 1NZUA 4HP4A 3G4PA 3BY8A 2KOIA 4KQDA 1GSVA 1DJCA 5KSHA 1H8MA 2YKHA 4OONA 3TRCA 5KMWA 2Y59A 5DF9A 2OWJA 5CERA 4HJ4A 3SZTA 4UQIS 3ZYTA 2PU4A 3EQUA 4QPRA 2Y2KA 5EV0A 4WZ5C 3LIDA 2W1RA 4MCWA 4F3LB 3F1OB 3H82A 3B42A 3OOVA 4M3KA 3OBFA 3TW8A 1KGEA 4NKPA 4P0MA 3ZVWA 1K56A 3T1SA 1KGGA 1BT5A 1S66L 3ITAA 2GZAA 5AQBA 3FC7A 2XA7M 3VP1A 4R6LA 4N9LA 4NXEA 2J9OA 3UPNA 5FDSA 2UV0E 3HBRA 1HLUP 2VGJA 3S22A 3VMAA 1W8QA 1N9LA 2YKFA 2Y55A 4HH2A 3T50A 2JKRM 5TJJA 2WKHA 2EWVA 3V5MA 3ZG8B 2V20A 4OPZA 1NRJA 1OTAA 3VV4A 1FCNA 3UMDA 4Q0JA 3EEHA 3IBJA 3OLOA 3SS4A 1ODVA 1YLJA 1NXYA 3JVVA 1KOUA 1TDLA 1YMSA 3IBRA 4KZ5A 4KZ7A 5AVFA 1VEUA 2EX6A 4Y13A 2WKEA 1N9NA 4R4SA 4RYEA 5M1AA 4CLCE 4FUWA 2R9XA 3BLSA 4KENB 4Z1WA 3ZFZA 2PR6A 3QNBA 1ZTUA 4O7DA 4OVDA 5GLCA 3F1PA 3UPPA 4I3AA 3QP4A 1XFQA 4B4XA 1V9ZA 4KZ9A 3QP6A 1NZOA 4JPMA 2J3WA 4S2OA 3O86A 3HVFA 4PM9A 1NLZA 4WF0A 4KZ6A 4DDSA 2D02A 3EWKA 4OKPA 1CQAA 2IWCA 4GDBA 3UE0A 4JF6A 2WGVA 4HIAA 1ZG4A 3FV7A 1F9IA 5HL6A 4XT2B 4DMZA 2P9VA 3PAGA 1SCWA 5DTKA 2HDRA 3T4KA 1F5MA 3BQ8A 2VKSA 1K57A 1XGJA 3FKWA 2OLUA 2MJ6A 3LR3A 1E4DA 4UAAA 1DJBA 1PRQA 1J9MA 3GSGA 3WS2A 1XJ2A 2QJ7A 1HTZA 3S1YA 1T1AA 4UA9A 4EUZA 4BD1A 3VSKA 1PW1A 3LIAA 4G3KA 3LR4A 4ZJ3A 2J9PA 3MQ0A 5F69A 1LI0A 3N4IA 3V3SA 2WGWB 3WS4A 4JGRA 2Y2MA 5AQ9A 5G18A 2V2FF 1JVJA 3UB9A 1YLPA 4DF6A 3A0RA 2W3HA 3FWLA 1LT0A 4BL3A 3VE4A 4R0QA 4MMNA 1MWSA 1RGZA 3FZCA 1HZOA 1VQQA 3RH8B 5A90A 3S7QA 1K54A 3DWZA 1DP6A 1FQGA 4IBRA 4LGWA 4XXRA 5A8BA 3KSIA 4KZAA 1PZPA 4Y3IA 2V8FA 3GRJA 3ZHHA 1W8YA 2ZM8A 5GL9A 3SS5A 5IHVA 1HD8A 1DP9A 1XJ4A 3MS6A 4ESPA 4JF4A 2XEPA 2HP5A 2ACGA 2B02A 2B5RA 3SS3A 4GHIA 2GJ3A 1GSXA 1CI9A 3OCNA 5TR7A 1KE4A 3MQOA 2JN7A 5EVIC 1GHPA 3HUNA 3B3XA 3QP2A 3LY4A 1CEGA 2D01A 3PR6A 1JWPA 2Q0OA 5GHZA 2WKQA 4IHQA 1VM1A 2XRNA 5KZHA 4D2OA 1OT9A 1JNUA 1MWUA 1FIKA 3AGFA 3K2NA 3UDFA 1ONGA 1OTIA 3UB8A 1DY6A 2A24A 3ZCZA 3LI9A 3CG5A 2M7UA 2ZJ9A 2L4RA 4OQIA 4F94A 4E3OA 5EVLA 4FH2A 2HPBA 3FG8A 3ZG5A 4OPYA 3NJAA 4JXVA 2NUPC 3C7UA 3PBSA 3O88A 5CHMA 4MBHA 3CUEA 2ZM0A 4Q0IA 4YOFA 4WLAA 3JPUA 4JGQA 5KSCA 3ULFA 1Z6FA 3FPWA 4R70A 3C30A 2DNSA 4M4XA 4H6JB 3OPRA 4ZJ1A 3HUOA 4PKYG 1N9BA 5GLAA 1SZVA 2EX2A 5HWTA 1W5DA 1UWNX 4Q8IA 2JKTM 3KYQA 3QNCA 5MC7A 1WYCA 1IKIA 3ITBA 3IQAA 2V1ZA 3DTIA 2WAFA 3NOPC 1K25A 4WL9A 5FATA 3IXBA 2WUQA 1MWRA 1MXOA 3EQVA 3BFEA 5DF7A 3KO6A 5E2GA 5FQMA 3F1NB 4O01A 3LY3A 4OP8A 1BTLA 3JYIA 4CJNA 5E2EA 4GLQA 3SW1A 3MXRA 5EVEA 5HW3A 5CX7A 3E98A 3M6HA 3O5YA 5F82A 1JWVA 4EXOA 1XA7A 2ZOHA 2BASA 2WK0A 3O87A 4PM6A 1IKGA 2E8IA 2LB9A 3T4QA 2X02A 2H10A 1YKDA 3G34A 1SKOA 4QB8A 2L0WA 2LB5A 2PR5A 4BJPA 2OAP1 3QHYA 4S2IA 2L1MA 2Y2JA 4I5SA 2QWSA 3MFXA 3P7NA 3W4PA 2GDNA 4BL2A 4WMCA 5HDSA 3E2KA 3DW0A 1KGFA 4ID4A 4ARZB 3ZQ5A 1BLPA 3HLFA 4UQIM 1C3BA 2R9WA 5EUAA 3R4KA 1XFNA 3ZNTA 4MDZA 4BD0A 3MF0A 1ESIA 2JKRI 1FOFA 3B47A 1ES3A 5TFQA 3E4PA 3H9WA 3VP0A 3UN7A 5CGWA 4GDNA 5FL3A 4BBUA 2PDRA 4LLOB 3C2WA 2OLVA 2XH9A 3WWXA 3F1OA 5L09A 1G68A 1NWZA 3A0VA 3N8LA 1L0EA 4PAUA 5FQIA 3G31A 1E3UD 1VHMA 3KSFA 1NJ4A 5EVID 1ES5A 1ES2A 4QJGA 3G6OA 4E04A 5K5BA 1CK3A 1T19A 1ERQA 2INWA 2JKFA 1XGIA 5F1GA 5FAOA 1FILA 4Y2FA 5CEBA 4OOLA 1ONHA 2VA0A 3ZG0A 2EX8A 4R38A 3LEZA 5CHUA 5EFWA 5HDCA 4KG5A 1YMXA 1IYQA 1O7EA 1P9WA 2Y2NA 4RVAA 2XFSA 2ZL1B 4HQAA 4II7A 5FDHA 4LCLA 4EWFA 2JHEA 3MZEA 2PD7A 3BFGA 1AWIA 5L8MA 4EW7A 3ZG7B 1S1ZA 3UNWA 3BM6A 3Q7VB 2OSUA 2Y2IA 1H3QA 3BY9A 3UDIA 2DMWA 2VX8A 1MZUA 2K31A 3DBAA 4PKYA 1YQSA 5FQJA 5HAPA 2Q9MA 1T18A 4OH0A 5HPFA 1GA9A 3OPHA 2VV8A 2HZ5A 4CLCD 4DN0A 3GTCA 4L9EA 4LV1A 4PHTA 3WRZA 2W3FA 4K08A 1TS8A 5DFXA 1TS6A 3R7WA 2RCXA 3MJQA 3WS5A 3UY6A 4OQ0A 5KIZA 3LIBA 1DJAA 2B18A 4H8RA 2QMIA 2V1BA 1RP5A 5F5YA 3CMZA 1G6OA 2J8YA 2PHYA 1YLZA 1XPBA 4IVKA 1ALQA 2A49A 2AVXA 3HUMA 3DWKA 2R78A 4KZBA 3MXQA 4Z9QA 4FCFA 3C4OA 3OC2A 3UB7A 1W63Q 4BBTA 2ZQ8A 3E2LA 4K91A 4ZAMA 3RJUA 4BMWA 4QHCA 1F98A 2DRWA 3IXHA 4HOIA 2WZXA 2Y2QA 3ZVTA 1V9YA 4B4ZA 3M6BA 3EOIA 4OP5A 4NXBA 3Q81A 4EBNA 1OMEA 5AJGA 3N8SA 3T4JA 3UE1A 1VETA 2ZMFA 2JBFA 3WS1A 4S2KA 3HLDA 4WBGA 1Y28A 5TBMB 5GLBA 3LR5A 2E8JA 4GCZA 4DE0A 4WUJA 5IU1A 2J3TC 4RX2A 4YWZA 3UB5P 5EOEA 4OLDA 3A3DA 2Y2PA 1NRFA 1RGYA 3IS2B 3NULA 3LGOA 4Y5FA 4ZTKA 4DXCA 3LIEA 5IT5A 1TD5A 3PYPA 3B33A 1LL9A 3IWQA 1P97A 4EUVA 4FTXA 3SH7A 1K4EA 1RCJA 2K7SA 2PBDP 2P08A 2EFXA 1DRMA 2J7VA 4WEKA 2O99A 1EROA 4GS9B 1MBLA 1PZOA 4KZ8A 1P0ZA 2OAQ1 4R23A 3Q07A 4WEJA 4WMCD 4ZDXA 1S4RA 1Q2QA 2VGLS 1LHYA 4HESA 4Y15A 1TVFA 2Q9NA 1WYBA 1L0GA 2KLIA 1LL5A 4OOYA 1NYYA 3T4OA 2W27A 3PXPA 1D06A 2EXBA 4PM5A 4D60A 2XLNA 1L3LA 3PBOA 1NLYA 4JXWA 5HARA 4GOGA 3NDEA 4I3IA 4EESA 4HH3A 3T4LA 1PWGA 2Z2LB 3IWIA 1CEFA 3D4FA 5HAQA 3UPOA 2I72A 2FFFB 3VOLA 5FI2A 4QD4A 1QMFA 2HJ9C 1STZA 5CGXA 3G32A 3GECA 1OTBA 3DTEA 1AXBA 4RA7A 1YAXA 3P09A 4UA7A 1GHMA 2P74A 2FZ0A 1VEUB 4R1GA 4EBLA 3S4XA 5GLDA 4FD8A 5EE8A 4B93A 2M7VA 4G3VA 4KG2A 2Z2MB 4C3QA 1LSVA 4GD6A 1CJFA 5IS1A 4EERA 1GA0A 2WKRA 3PBQA 3VP3A 3CLOA 4HY8A 4PM7A 2V8CA 3GDIA 3E0YA 3HCYA 5M18A 2QPNA 3JVUA 2BTFP 4LFUA 1ZHHB 1IFQA 1S0WA 2V1AA 3NECA 2OV5A 3VE3A 4JBFA 1G28A 1KVMA 1YLTA 4G3WA 4S2LA 2VV7A 2Y4AA 4DDYA 1KDSA 1FCOA 4E3NA 3Q1FA 1NYMA 5D3OA 2WADA 3TJZC 4PPRA 2Y2LA 2CC1A 2G2UA 1XJ3A 3PTEA 2V0WA 5E43A 4Q0HA 4E3LA 2J3TD 3OZHA 4MBKA 1SHVA 4Y0UA 2ZOIA 4ETXA 2WZZA 5L10A 4WELA 4MBFA 4N9KA 4E3IA 4ME4A 4HBUA 3MZFA 4DXBA 1L0FA 2EA9A 1M6KA 5J4EA 1A0KA 2EXAA 1YT4A 5EVIB 1LL8A 1XJ6A 4HNBA 1IELA 1K56D 4X68A 4K0XA 3RXWA 1S4SA 4E3JA 4ZBEA 2I9VA 4FH4A 4QY5A 4I38A 3RXXA 2PYRA 4ZRRA 4OLGA 5HD3A 2ZQ7A 1KDWA 1K54C 2FH5A 4AFIA 4EEPA 4X69A 5CGSA 1BUEA 1OJGA 4P87A 2XDMA 3IXGA 1H0MA 4CLCC 4KQQA 2ZC4B 3KSHA 5HPIA 4I3JA 1LI9A 1TDGA 2PD8A 1Y54A 2HJEA 4GN2A 3BQAA 3W4OA 5F1FA 3M2KA 1YM1A 4KQRA 3V3RA 1IYSA 5LBRA 4GKUA 4LV2A 4DJ3A 4UA6A 3IX8A 3PBRA 2HP6A 4CLCB 3IF6C 1PW8A 3FKVA 3NCKA 3EEAA 1I2SA 3MFDA 3LO7A 3V67A 2QJ5A 3AGDA 3ICYA 3V50A 4UEYA 4JXSA 4GHIB 1I5QA 4E6XA 3SH8A 4LPZA 3CPTA 3G30A 3Q7ZA 3BW6A 2QZ6A 3LYXA 4YNRA 3Q7VA 1H8ZA 1S67L 4X1MA 1OPXA 3P98A 4U0XA 2WKIA 2V0UA 4N1HA 3IF6B 3NOTC 3H7WB 1FSYA 4QU3A 3W2ZA 3CUEC 5I94A 2VJWA 1TEMA 4OPRA 5E2FA 2QYBA 4JGPA 1ACFA 5FI6A 3HL9A 3T12B 3HLWA 5CRFA 1N4OA 4MN7A 1Q2PA 2O9BA 3HJIA 1KVLA 1N9OA 2JC7A 4F3LA 4X6TA 2PT7A 3BECA 3CITA 4N92A 4S2NC 3HLBA 3UE6A 2VLGA 1MC0A 2B95A 5FQQA 1OTEA 3MKEA 4HEFA 2G2WA 3VOYA 2PYPA 2VZWA 5EOOA 1YSQA 1K4FA 4WZ5A 4FOFA 4XUZA 2OOLA 5U47A 3EGXC 4L0LA 3A3FA 3TSGA 4LRZE 5BOHA 4OQGA 4S2MA 2HGVA 3ZNYA 5EECA 5C5KA 1GHIA 5J7EA 1SKFA 3HLCA 4GD8A 4EU0A 1PI5A 2ZQAA 1FR1A 4LV0A 2JKGA 5HAIA 3CWFA 2WGIA 3UDXA 1K55C 1XP4A 4X53A 5DKKA 4NG2A 5CXWA 2ZQ9A 1PNEA 3BWLA 4GB7A 5G4ZA 5TBMA 3CI6A 4OPQA 3O3VA 5AQAA
chains in the Genus database with same CATH topology
1ERMA 3N7WA 2EFUA 5DTTA 4ZTKA 4DXCA 4KZAA 1K6RA 3VP4A 1PZPA 3TG9A 1W7FA 1JTGA 1IYPA 1XX2A 3ZDJA 3UO9A 3TOIA 4C75A 4FSFA 1LL9A 3A3IA 1MPLA 3GRJA 1W8YA 2ZM8A 3IWQA 3BFDA 3OPPA 5GL9A 5IHVA 3SS5A 3ZHHA 1HD8A 3Q82A 3SH7A 1K4EA 1RCJA 1FCMA 2ZMAA 4GZBA 4X56A 3IT9A 1ZKJA 2XEPA 4JF4A 2HP5A 1BLSA 1KE3A 2EFXA 5CTNA 5F83A 4EBPA 2B5RA 3A3EA 3SS3A 2BG1A 2PBYA 2JCHA 1HVBA 3LCEA 2J7VA 4IBXA 4JLFA 4WEKA 1CI9A 1ZG6A 1EROA 3HREA 4K0WA 1H8YA 3OCNA 2H5SA 2VGKA 2Y2HA 3GVBA 5FI7A 5TR7A 1KE4A 1MBLA 3IH8A 1PZOA 3W8KA 1NY0A 4KZ8A 2Y91A 5EVIC 1GHPA 2PU2A 2HP9A 3HUNA 3Q07A 4R23A 3B3XA 1M40A 1BSGA 4MEZA 3LY4A 1CEGA 4WEJA 4WMCD 1K55A 1JWPA 2ZC5B 2H0TA 3IXDA 4KQOA 4RX3A 4JXGA 5GHZA 4ZDXA 1VM1A 2XF3A 5KZHA 1Q2QA 5DTSA 4D2OA 1LHYA 4LV3A 1GCEA 1MWUA 4HESA 1TVFA 1PI4A 2Q9NA 1WYBA 1L0GA 3AGFA 1LL5A 3UDFA 4OOYA 1NYYA 1ONGA 1BLCA 3VFHA 2ZC6B 1K38A 1DY6A 1PIOA 1CI8A 2EXBA 4PM5A 1W79A 2XLNA 3PBOA 3ZCZA 1I2WA 4EQIA 2XFTA 3VP2A 3CG5A 3N6IA 2ZQCA 4JXWA 4NK3A 4GOGA 5HARA 2ZJ9A 3NDEA 5J8XA 4OQIA 4F94A 4E3OA 5EVLA 1K6SA 3OCLA 4FH2A 2HPBA 3PBTA 3GV9A 3ZG5A 4OPYA 1EI5A 4WZ4A 4JXVA 1PWGA 3NI9A 4IEDA 2Z2LB 5FAPA 3IWIA 3C7UA 3W4QA 1CEFA 3D4FA 4OQHA 1YLYA 5HAQA 3PBSA 3UPOA 2I72A 2FFFB 3O88A 5CHMA 4MBHA 4QD4A 5FI2A 3G2ZA 2ZM0A 4GNUA 1QMFA 5KSCA 4MNRA 1Z6FA 5FSRA 5CGXA 3G32A 4KG6A 4DKIA 4NETA 2XGNA 2XD5A 1AXBA 2ZM2A 2ZLYA 4RA7A 4E3KA 2DNSA 3P09A 4UA7A 1GHMA 3GMWA 5CECA 4E6WA 3OPRA 4JF5A 3HUOA 4ZJ1A 3NY4A 2P74A 3BFCA 1N9BA 3I7JA 5EPHA 2EX2A 5GLAA 3WRTA 1IEMA 1W5DA 3BFFA 5AQAA 4Q8IA 3NBLA 3QNCA 1FSWA 4R1GA 4EBLA 1WYCA 3S4XA 5GLDA 4FD8A 5EE8A 1IKIA 4P85A 3ITBA 3IQAA 4KG2A 2V1ZA 3CJMA 5FAQA 2Z2MB 4C3QA 2WAFA 1K25A 2BLSA 4GD6A 3UE3A 5FATA 3IXBA 5FASA 2WGWA 1MWRA 1MXOA 2WUQA 4BENA 3EQVA 2X01A 1LLBA 3BFEA 3IWOA 5DF7A 4BLMA 1EWZA 5E2GA 4DE2A 5FQMA 1GA0A 2ZC7A 1MWTA 3PBQA 3LY3A 4OP8A 2C5WB 3VP3A 1BTLA 4U3TA 1ZC2A 1MY8A 3JYIA 5FA7A 3VFFA 4CJNA 5E2EA 4PM7A 3BRMA 2C6WB 3MXRA 3NC8A 5HW3A 1BLHA 4JKTA 3HLEA 3IHAA 5M18A 2QPNA 2HDSA 5FQ9A 4ZJ2A 3M6HA 5F82A 1JWVA 5CTMA 1XA7A 5GHYA 1G6AA 2Y2OA 3BLMA 1S0WA 2OV5A 4R3BA 3G35A 4XUXA 1JTDA 3BEBA 2WK0A 4JBFA 1KVMA 3O87A 4DRTA 1YLTA 3NIAA 4PM6A 1IKGA 2E8IA 4S2LA 2X02A 2H10A 3G34A 2HDQA 2ZC3B 2XK1A 1NZUA 3C7VA 4QB8A 2Y4AA 3G4PA 3G2YA 4BJPA 1KDSA 4DDYA 1FCOA 5JYOA 1DJCA 3HLGA 4E3NA 5KSHA 3QHYA 3V39A 4S2IA 3Q1FA 1NYMA 1SDEA 4LCMA 2Y2JA 5D3OA 4OONA 3W4PA 2WADA 3DTMA 4P6BA 3MBZA 2Y2LA 2CC1A 4PPRA 2Y59A 2GDNA 5DF9A 4BL2A 4WMCA 2XD1A 3E2KA 1PWDA 2G2UA 3DW0A 1KGFA 3PTEA 5CERA 4ID4A 5E43A 1BLPA 2PU4A 3EQUA 3HLFA 5DF8A 1L0DA 2Y2KA 4E3LA 3SOIA 2EX9A 1C3BA 2R9WA 4WZ5C 5EUAA 3OZHA 4MBKA 1SHVA 4Y0UA 3ZNTA 4A5RA 1FR6A 2WZZA 3ZGAB 4BD0A 4WELA 2XQZA 4MBFA 4N9KA 2H0YA 4E3IA 1ESIA 4HBUA 3MZFA 4M3KA 1FOFA 1L0FA 4DE1A 4DXBA 1ES3A 1M6KA 5TFQA 3IH9A 2IWBA 5A92A 1KGEA 2EXAA 4IVIA 1YT4A 5E2HA 5EVIB 4P0MA 3ZVWA 3MKFA 3VP0A 1K56A 5CHJA 1KGGA 3N8RA 1BT5A 3UN7A 1IELA 2Y2GA 1K56D 4GDNA 3ITAA 3PBNA 4X68A 1BULA 1KE0A 5CGWA 4K0XA 5AQBA 3RXWA 3VP1A 5A93A 4E3JA 2OLVA 5DVAA 2XH9A 4N9LA 4ZBEA 4FH4A 4QY5A 3WWXA 1G68A 2J9OA 3UPNA 2DCFA 3RXXA 1E3UA 3N8LA 1L0EA 3HBRA 5FQIA 4OLGA 3G31A 1E3UD 2VGJA 3S22A 3VMAA 2ZQ7A 1KDWA 1W8QA 1K54C 5EVIA 4X69A 4X55A 5HX9A 1NJ4A 2Y55A 5TGFA 3ZG9B 5EVID 5CGSA 1ES5A 1ES2A 4QJGA 1BUEA 1CK3A 2WKHA 2X71A 1ERQA 3V5MA 3ZG8B 4P87A 2V20A 2XDMA 4OPZA 1XGIA 5FQKA 3IXGA 4MLLA 4KQQA 2ZC4B 5F1GA 1FCNA 5FAOA 3ISGA 4R4RA 5CEBA 4OOLA 3FYZA 1ONHA 3ZG0A 1LI9A 2EX8A 1S6RA 1TDGA 4S2JA 4GN2A 1Y54A 3LEZA 5CHUA 3SS4A 1YLJA 1NXYA 3W4OA 4KG5A 5F1FA 1TDLA 3M2KA 1YM1A 4KQRA 1YMXA 1IYQA 3V3RA 1YMSA 1IYSA 4PM8A 1O7EA 1XA1A 4KZ5A 4KZ7A 4YFMA 2Y2NA 4RVAA 2EX6A 3GQZA 1SDNA 4GKUA 4LV2A 2XFSA 1QMEA 5FDHA 4LCLA 4UA6A 4EWFA 2WKEA 3MZEA 3CZDA 2WAEA 3BFGA 4KZ4A 4R4SA 4RYEA 3MZDA 3PBRA 2HP6A 5M1AA 4CPKA 3IF6C 3ZG7B 2R9XA 2A3UA 1PW8A 3UNWA 3BM6A 3FKVA 3Q7VB 3BLSA 3NDGA 2OSUA 4KENB 2Y2IA 4C6YA 3NCKA 3C5AA 5KMWA 3ZFZA 3UDIA 1IYOA 1I2SA 3MFDA 3LO7A 5GHXA 3QNBA 1K57C 4O7DA 4OOMA 4OVDA 3AGDA 3C4PA 5GLCA 3UPPA 3V50A 2UWXA 4JXSA 1I5QA 5AQ7A 1YQSA 5FQJA 5HAPA 2Q9MA 4B4XA 4E6XA 3SH8A 3G30A 4KZ9A 1XXMA 4OH0A 1GA9A 1NZOA 1YLWA 2ZD8A 3OPHA 3PAEA 3Q7ZA 2QZ6A 3VSLA 4B88A 5JYPA 3AGEA 2JE5A 3Q7VA 4R3JA 1H8ZA 1PYYA 4JPMA 3GTCA 4LV1A 5HFOA 4S2OA 2FFYA 3O86A 3HVFA 3P98A 4U0XA 2WKIA 3WRZA 4N1HA 3IF6B 4PM9A 1FSYA 4KZ6A 2P9VB 3GR2A 4QU3A 4E3MA 4DDSA 2RCXA 3A3JA 5A91A 1BZAA 4OKPA 3WS5A 2IWCA 4GDBA 3UY6A 3UE0A 4OQ0A 4JF6A 2WGVA 5I94A 1O07A 4WM9A 1E25A 5L2FA 4Y7PA 5CEDA 1TEMA 1ZG4A 3FV7A 1DJAA 4OPRA 5E2FA 5HL1A 4U0TA 5FI6A 3IF6A 4H8RA 2QMIA 2P9VA 1RP5A 3HL9A 3PAGA 4WYYA 1SCWA 3HLWA 3CMZA 2J8YA 5CRFA 5DTKA 2HDRA 1YLZA 1N4OA 1XPBA 4IVKA 1ALQA 1K57A 1Q2PA 1XGJA 4LENA 2XR0A 3FKWA 3IF5A 2A49A 1KVLA 2JC7A 2OLUA 4YINA 4X6TA 1ESUA 1E4DA 3BECA 2ZQDA 4BQMA 4N92A 4S2NC 4UAAA 3HLBA 3HUMA 3DWKA 1H5XA 1DJBA 4KZ3A 1MKIA 1J9MA 4KZBA 3GSGA 4Z9QA 4FCFA 2IWDA 3C4OA 1ES4A 3OC2A 5FQQA 3WS2A 4Y0TA 3MKEA 4HEFA 2G2WA 2ZQ8A 3E2LA 1HTZA 3S1YA 4K91A 3VOYA 4ZAMA 4UA9A 3RJUA 1XKZA 5EOOA 4QHCA 4EV4A 1K4FA 3M2JA 2DRWA 4PMAA 3IXHA 4WZ5A 4XUZA 4EUZA 3BYDA 4BD1A 4UHUA 2WZXA 1PW1A 4Y0OA 2Y2QA 5U47A 3VSKA 3ZVTA 4B4ZA 4L0LA 3A3FA 3TSGA 4N1XA 5BOHA 4ZJ3A 2J9PA 4OQGA 2WYXA 4S2MA 3ZNYA 3M6BA 4OP5A 3OPLA 1LI0A 3N4IA 3Q81A 4EBNA 1OMEA 1PWCA 2WGWB 3V3SA 5EECA 4S2PA 3N8SA 3WS4A 5AQ9A 2Y2MA 3UE1A 1GHIA 1SKFA 3HLCA 5G18A 1WE4A 1JWZA 2JBFA 1JVJA 2V2FF 3WS1A 4S2KA 3IHBA 3HLDA 4WBGA 1YLPA 4GD8A 4DF6A 1PI5A 2ZQAA 2RL3A 3FWLA 5GLBA 1FR1A 4LV0A 4BL3A 1L2SA 4R0QA 4DE0A 5HAIA 2WGIA 1MWSA 1RGZA 3UDXA 3WS0A 4DE3A 3FZCA 1K55C 1XP4A 4X53A 4RX2A 1HZOA 1VQQA 4S2NA 3SH9A 3MXSA 5A90A 5EOEA 4OLDA 3A3DA 3VOZA 5CXWA 2ZQ9A 1K54A 3DWZA 2HDUA 2Y2PA 1NRFA 1FQGA 1RGYA 4GB7A 4IBRA 4XXRA 5M19A 4OPQA 4QY6A 3O3VA 4HBTA 1U60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ERM A;  3N7W A;  2EFU A;  5DTT A;  4ZTK A;  4DXC A;  4KZA A;  1K6R A;  3VP4 A;  1PZP A;  3TG9 A;  1W7F A;  1JTG A;  1IYP A;  1XX2 A;  3ZDJ A;  3UO9 A;  3TOI A;  4C75 A;  4FSF A;  1LL9 A;  3A3I A;  1MPL A;  3GRJ A;  1W8Y A;  2ZM8 A;  3IWQ A;  3BFD A;  3OPP A;  5GL9 A;  5IHV A;  3SS5 A;  3ZHH A;  1HD8 A;  3Q82 A;  3SH7 A;  1K4E A;  1RCJ A;  1FCM A;  2ZMA A;  4GZB A;  4X56 A;  3IT9 A;  1ZKJ A;  2XEP A;  4JF4 A;  2HP5 A;  1BLS A;  1KE3 A;  2EFX A;  5CTN A;  5F83 A;  4EBP A;  2B5R A;  3A3E A;  3SS3 A;  2BG1 A;  2PBY A;  2JCH A;  1HVB A;  3LCE A;  2J7V A;  4IBX A;  4JLF A;  4WEK A;  1CI9 A;  1ZG6 A;  1ERO A;  3HRE A;  4K0W A;  1H8Y A;  3OCN A;  2H5S A;  2VGK A;  2Y2H A;  3GVB A;  5FI7 A;  5TR7 A;  1KE4 A;  1MBL A;  3IH8 A;  1PZO A;  3W8K A;  1NY0 A;  4KZ8 A;  2Y91 A;  5EVI C;  1GHP A;  2PU2 A;  2HP9 A;  3HUN A;  3Q07 A;  4R23 A;  3B3X A;  1M40 A;  1BSG A;  4MEZ A;  3LY4 A;  1CEG A;  4WEJ A;  4WMC D;  1K55 A;  1JWP A;  2ZC5 B;  2H0T A;  3IXD A;  4KQO A;  4RX3 A;  4JXG A;  5GHZ A;  4ZDX A;  1VM1 A;  2XF3 A;  5KZH A;  1Q2Q A;  5DTS A;  4D2O A;  1LHY A;  4LV3 A;  1GCE A;  1MWU A;  4HES A;  1TVF A;  1PI4 A;  2Q9N A;  1WYB A;  1L0G A;  3AGF A;  1LL5 A;  3UDF A;  4OOY A;  1NYY A;  1ONG A;  1BLC A;  3VFH A;  2ZC6 B;  1K38 A;  1DY6 A;  1PIO A;  1CI8 A;  2EXB A;  4PM5 A;  1W79 A;  2XLN A;  3PBO A;  3ZCZ A;  1I2W A;  4EQI A;  2XFT A;  3VP2 A;  3CG5 A;  3N6I A;  2ZQC A;  4JXW A;  4NK3 A;  4GOG A;  5HAR A;  2ZJ9 A;  3NDE A;  5J8X A;  4OQI A;  4F94 A;  4E3O A;  5EVL A;  1K6S A;  3OCL A;  4FH2 A;  2HPB A;  3PBT A;  3GV9 A;  3ZG5 A;  4OPY A;  1EI5 A;  4WZ4 A;  4JXV A;  1PWG A;  3NI9 A;  4IED A;  2Z2L B;  5FAP A;  3IWI A;  3C7U A;  3W4Q A;  1CEF A;  3D4F A;  4OQH A;  1YLY A;  5HAQ A;  3PBS A;  3UPO A;  2I72 A;  2FFF B;  3O88 A;  5CHM A;  4MBH A;  4QD4 A;  5FI2 A;  3G2Z A;  2ZM0 A;  4GNU A;  1QMF A;  5KSC A;  4MNR A;  1Z6F A;  5FSR A;  5CGX A;  3G32 A;  4KG6 A;  4DKI A;  4NET A;  2XGN A;  2XD5 A;  1AXB A;  2ZM2 A;  2ZLY A;  4RA7 A;  4E3K A;  2DNS A;  3P09 A;  4UA7 A;  1GHM A;  3GMW A;  5CEC A;  4E6W A;  3OPR A;  4JF5 A;  3HUO A;  4ZJ1 A;  3NY4 A;  2P74 A;  3BFC A;  1N9B A;  3I7J A;  5EPH A;  2EX2 A;  5GLA A;  3WRT A;  1IEM A;  1W5D A;  3BFF A;  5AQA A;  4Q8I A;  3NBL A;  3QNC A;  1FSW A;  4R1G A;  4EBL A;  1WYC A;  3S4X A;  5GLD A;  4FD8 A;  5EE8 A;  1IKI A;  4P85 A;  3ITB A;  3IQA A;  4KG2 A;  2V1Z A;  3CJM A;  5FAQ A;  2Z2M B;  4C3Q A;  2WAF A;  1K25 A;  2BLS A;  4GD6 A;  3UE3 A;  5FAT A;  3IXB A;  5FAS A;  2WGW A;  1MWR A;  1MXO A;  2WUQ A;  4BEN A;  3EQV A;  2X01 A;  1LLB A;  3BFE A;  3IWO A;  5DF7 A;  4BLM A;  1EWZ A;  5E2G A;  4DE2 A;  5FQM A;  1GA0 A;  2ZC7 A;  1MWT A;  3PBQ A;  3LY3 A;  4OP8 A;  2C5W B;  3VP3 A;  1BTL A;  4U3T A;  1ZC2 A;  1MY8 A;  3JYI A;  5FA7 A;  3VFF A;  4CJN A;  5E2E A;  4PM7 A;  3BRM A;  2C6W B;  3MXR A;  3NC8 A;  5HW3 A;  1BLH A;  4JKT A;  3HLE A;  3IHA A;  5M18 A;  2QPN A;  2HDS A;  5FQ9 A;  4ZJ2 A;  3M6H A;  5F82 A;  1JWV A;  5CTM A;  1XA7 A;  5GHY A;  1G6A A;  2Y2O A;  3BLM A;  1S0W A;  2OV5 A;  4R3B A;  3G35 A;  4XUX A;  1JTD A;  3BEB A;  2WK0 A;  4JBF A;  1KVM A;  3O87 A;  4DRT A;  1YLT A;  3NIA A;  4PM6 A;  1IKG A;  2E8I A;  4S2L A;  2X02 A;  2H10 A;  3G34 A;  2HDQ A;  2ZC3 B;  2XK1 A;  1NZU A;  3C7V A;  4QB8 A;  2Y4A A;  3G4P A;  3G2Y A;  4BJP A;  1KDS A;  4DDY A;  1FCO A;  5JYO A;  1DJC A;  3HLG A;  4E3N A;  5KSH A;  3QHY A;  3V39 A;  4S2I A;  3Q1F A;  1NYM A;  1SDE A;  4LCM A;  2Y2J A;  5D3O A;  4OON A;  3W4P A;  2WAD A;  3DTM A;  4P6B A;  3MBZ A;  2Y2L A;  2CC1 A;  4PPR A;  2Y59 A;  2GDN A;  5DF9 A;  4BL2 A;  4WMC A;  2XD1 A;  3E2K A;  1PWD A;  2G2U A;  3DW0 A;  1KGF A;  3PTE A;  5CER A;  4ID4 A;  5E43 A;  1BLP A;  2PU4 A;  3EQU A;  3HLF A;  5DF8 A;  1L0D A;  2Y2K A;  4E3L A;  3SOI A;  2EX9 A;  1C3B A;  2R9W A;  4WZ5 C;  5EUA A;  3OZH A;  4MBK A;  1SHV A;  4Y0U A;  3ZNT A;  4A5R A;  1FR6 A;  2WZZ A;  3ZGA B;  4BD0 A;  4WEL A;  2XQZ A;  4MBF A;  4N9K A;  2H0Y A;  4E3I A;  1ESI A;  4HBU A;  3MZF A;  4M3K A;  1FOF A;  1L0F A;  4DE1 A;  4DXB A;  1ES3 A;  1M6K A;  5TFQ A;  3IH9 A;  2IWB A;  5A92 A;  1KGE A;  2EXA A;  4IVI A;  1YT4 A;  5E2H A;  5EVI B;  4P0M A;  3ZVW A;  3MKF A;  3VP0 A;  1K56 A;  5CHJ A;  1KGG A;  3N8R A;  1BT5 A;  3UN7 A;  1IEL A;  2Y2G A;  1K56 D;  4GDN A;  3ITA A;  3PBN A;  4X68 A;  1BUL A;  1KE0 A;  5CGW A;  4K0X A;  5AQB A;  3RXW A;  3VP1 A;  5A93 A;  4E3J A;  2OLV A;  5DVA A;  2XH9 A;  4N9L A;  4ZBE A;  4FH4 A;  4QY5 A;  3WWX A;  1G68 A;  2J9O A;  3UPN A;  2DCF A;  3RXX A;  1E3U A;  3N8L A;  1L0E A;  3HBR A;  5FQI A;  4OLG A;  3G31 A;  1E3U D;  2VGJ A;  3S22 A;  3VMA A;  2ZQ7 A;  1KDW A;  1W8Q A;  1K54 C;  5EVI A;  4X69 A;  4X55 A;  5HX9 A;  1NJ4 A;  2Y55 A;  5TGF A;  3ZG9 B;  5EVI D;  5CGS A;  1ES5 A;  1ES2 A;  4QJG A;  1BUE A;  1CK3 A;  2WKH A;  2X71 A;  1ERQ A;  3V5M A;  3ZG8 B;  4P87 A;  2V20 A;  2XDM A;  4OPZ A;  1XGI A;  5FQK A;  3IXG A;  4MLL A;  4KQQ A;  2ZC4 B;  5F1G A;  1FCN A;  5FAO A;  3ISG A;  4R4R A;  5CEB A;  4OOL A;  3FYZ A;  1ONH A;  3ZG0 A;  1LI9 A;  2EX8 A;  1S6R A;  1TDG A;  4S2J A;  4GN2 A;  1Y54 A;  3LEZ A;  5CHU A;  3SS4 A;  1YLJ A;  1NXY A;  3W4O A;  4KG5 A;  5F1F A;  1TDL A;  3M2K A;  1YM1 A;  4KQR A;  1YMX A;  1IYQ A;  3V3R A;  1YMS A;  1IYS A;  4PM8 A;  1O7E A;  1XA1 A;  4KZ5 A;  4KZ7 A;  4YFM A;  2Y2N A;  4RVA A;  2EX6 A;  3GQZ A;  1SDN A;  4GKU A;  4LV2 A;  2XFS A;  1QME A;  5FDH A;  4LCL A;  4UA6 A;  4EWF A;  2WKE A;  3MZE A;  3CZD A;  2WAE A;  3BFG A;  4KZ4 A;  4R4S A;  4RYE A;  3MZD A;  3PBR A;  2HP6 A;  5M1A A;  4CPK A;  3IF6 C;  3ZG7 B;  2R9X A;  2A3U A;  1PW8 A;  3UNW A;  3BM6 A;  3FKV A;  3Q7V B;  3BLS A;  3NDG A;  2OSU A;  4KEN B;  2Y2I A;  4C6Y A;  3NCK A;  3C5A A;  5KMW A;  3ZFZ A;  3UDI A;  1IYO A;  1I2S A;  3MFD A;  3LO7 A;  5GHX A;  3QNB A;  1K57 C;  4O7D A;  4OOM A;  4OVD A;  3AGD A;  3C4P A;  5GLC A;  3UPP A;  3V50 A;  2UWX A;  4JXS A;  1I5Q A;  5AQ7 A;  1YQS A;  5FQJ A;  5HAP A;  2Q9M A;  4B4X A;  4E6X A;  3SH8 A;  3G30 A;  4KZ9 A;  1XXM A;  4OH0 A;  1GA9 A;  1NZO A;  1YLW A;  2ZD8 A;  3OPH A;  3PAE A;  3Q7Z A;  2QZ6 A;  3VSL A;  4B88 A;  5JYP A;  3AGE A;  2JE5 A;  3Q7V A;  4R3J A;  1H8Z A;  1PYY A;  4JPM A;  3GTC A;  4LV1 A;  5HFO A;  4S2O A;  2FFY A;  3O86 A;  3HVF A;  3P98 A;  4U0X A;  2WKI A;  3WRZ A;  4N1H A;  3IF6 B;  4PM9 A;  1FSY A;  4KZ6 A;  2P9V B;  3GR2 A;  4QU3 A;  4E3M A;  4DDS A;  2RCX A;  3A3J A;  5A91 A;  1BZA A;  4OKP A;  3WS5 A;  2IWC A;  4GDB A;  3UY6 A;  3UE0 A;  4OQ0 A;  4JF6 A;  2WGV A;  5I94 A;  1O07 A;  4WM9 A;  1E25 A;  5L2F A;  4Y7P A;  5CED A;  1TEM A;  1ZG4 A;  3FV7 A;  1DJA A;  4OPR A;  5E2F A;  5HL1 A;  4U0T A;  5FI6 A;  3IF6 A;  4H8R A;  2QMI A;  2P9V A;  1RP5 A;  3HL9 A;  3PAG A;  4WYY A;  1SCW A;  3HLW A;  3CMZ A;  2J8Y A;  5CRF A;  5DTK A;  2HDR A;  1YLZ A;  1N4O A;  1XPB A;  4IVK A;  1ALQ A;  1K57 A;  1Q2P A;  1XGJ A;  4LEN A;  2XR0 A;  3FKW A;  3IF5 A;  2A49 A;  1KVL A;  2JC7 A;  2OLU A;  4YIN A;  4X6T A;  1ESU A;  1E4D A;  3BEC A;  2ZQD A;  4BQM A;  4N92 A;  4S2N C;  4UAA A;  3HLB A;  3HUM A;  3DWK A;  1H5X A;  1DJB A;  4KZ3 A;  1MKI A;  1J9M A;  4KZB A;  3GSG A;  4Z9Q A;  4FCF A;  2IWD A;  3C4O A;  1ES4 A;  3OC2 A;  5FQQ A;  3WS2 A;  4Y0T A;  3MKE A;  4HEF A;  2G2W A;  2ZQ8 A;  3E2L A;  1HTZ A;  3S1Y A;  4K91 A;  3VOY A;  4ZAM A;  4UA9 A;  3RJU A;  1XKZ A;  5EOO A;  4QHC A;  4EV4 A;  1K4F A;  3M2J A;  2DRW A;  4PMA A;  3IXH A;  4WZ5 A;  4XUZ A;  4EUZ A;  3BYD A;  4BD1 A;  4UHU A;  2WZX A;  1PW1 A;  4Y0O A;  2Y2Q A;  5U47 A;  3VSK A;  3ZVT A;  4B4Z A;  4L0L A;  3A3F A;  3TSG A;  4N1X A;  5BOH A;  4ZJ3 A;  2J9P A;  4OQG A;  2WYX A;  4S2M A;  3ZNY A;  3M6B A;  4OP5 A;  3OPL A;  1LI0 A;  3N4I A;  3Q81 A;  4EBN A;  1OME A;  1PWC A;  2WGW B;  3V3S A;  5EEC A;  4S2P A;  3N8S A;  3WS4 A;  5AQ9 A;  2Y2M A;  3UE1 A;  1GHI A;  1SKF A;  3HLC A;  5G18 A;  1WE4 A;  1JWZ A;  2JBF A;  1JVJ A;  2V2F F;  3WS1 A;  4S2K A;  3IHB A;  3HLD A;  4WBG A;  1YLP A;  4GD8 A;  4DF6 A;  1PI5 A;  2ZQA A;  2RL3 A;  3FWL A;  5GLB A;  1FR1 A;  4LV0 A;  4BL3 A;  1L2S A;  4R0Q A;  4DE0 A;  5HAI A;  2WGI A;  1MWS A;  1RGZ A;  3UDX A;  3WS0 A;  4DE3 A;  3FZC A;  1K55 C;  1XP4 A;  4X53 A;  4RX2 A;  1HZO A;  1VQQ A;  4S2N A;  3SH9 A;  3MXS A;  5A90 A;  5EOE A;  4OLD A;  3A3D A;  3VOZ A;  5CXW A;  2ZQ9 A;  1K54 A;  3DWZ A;  2HDU A;  2Y2P A;  1NRF A;  1FQG A;  1RGY A;  4GB7 A;  4IBR A;  4XXR A;  5M19 A;  4OPQ A;  4QY6 A;  3O3V A;  4HBT A;  1U60 A; 
#chains in the Genus database with same CATH topology
 3N7W A;  2EFU A;  5DTT A;  1K6R A;  3D72 A;  1G5U A;  1W7F A;  1JTG A;  1IYP A;  1XX2 A;  3UO9 A;  4FSF A;  3A3I A;  5HWW A;  3BFD A;  3S7O A;  2NUT C;  3Q82 A;  4CQH A;  4ETZ A;  4GZB A;  1FCM A;  4X56 A;  4EEU A;  1BLS A;  1KE3 A;  2BG1 A;  2PBY A;  2QKP A;  2V9A A;  1HVB A;  3BJN A;  3LCE A;  3DAV A;  2IA2 A;  3HRE A;  4K0W A;  1H8Y A;  4L9G A;  2H5S A;  3GVB A;  2Y2H A;  2PRF A;  1NY0 A;  2P04 A;  2Y91 A;  4GJ4 A;  2PU2 A;  2HP9 A;  2OWH A;  4MEZ A;  4P6Z S;  2H0T A;  4X25 A;  4HHD A;  4JXG A;  3QP1 A;  2XF3 A;  4LV3 A;  1GCE A;  2A2L A;  1PI4 A;  2VGL M;  4GS9 A;  1BLC A;  2O0Y A;  3P01 A;  3L7H A;  1PIO A;  1TF1 A;  1W79 A;  1I2W A;  4EQI A;  4L9F A;  2XFT A;  3VP2 A;  2ZQC A;  4XT2 A;  1K6S A;  3OCL A;  1EI5 A;  2W3D A;  3L9K A;  3NI9 A;  4IED A;  1DP8 A;  1OT6 A;  3NHQ A;  4OQH A;  4IJG A;  1Y4O A;  5HD5 A;  4MNR A;  2WKP A;  4KG6 A;  4NET A;  2ZM2 A;  1W63 M;  4WN5 A;  3GMW A;  5CEC A;  4E6W A;  4JF5 A;  5EPH A;  1CF0 A;  3BFF A;  3NBL A;  1FSW A;  1UGU A;  3CJM A;  5FAQ A;  2P7J A;  3UE3 A;  5FAS A;  2WGW A;  4BEN A;  2W1T B;  5DJT A;  2X01 A;  1LLB A;  2Z6D A;  1EWZ A;  4DE2 A;  1MWT A;  5DFY A;  4U3T A;  5FA7 A;  3VFF A;  4LRX C;  3BRM A;  3NC8 A;  1BLH A;  4GW9 A;  2G7U A;  4JKT A;  5FEF A;  1YPR A;  2HF6 A;  1K0K A;  1LSW A;  3LUQ A;  5GHY A;  4O0P A;  1G6A A;  3BLM A;  4XUX A;  3LI8 A;  2HV1 A;  3UB6 A;  3NIA A;  3LFV A;  2O9A A;  3UME A;  4NEE D;  2ZC3 B;  3R7W B;  2XK1 A;  3C7V A;  3G2Y A;  5EM1 A;  3E4Q A;  1D1J A;  5JYO A;  2VEA A;  3HLG A;  3V39 A;  1SDE A;  4LCM A;  2CMN A;  1WA9 A;  3H82 B;  5HWV A;  3DTM A;  4P6B A;  3MBZ A;  1OJ5 A;  2XD1 A;  1PWD A;  5I5L A;  4IUK A;  5DF8 A;  1L0D A;  3SOI A;  2EX9 A;  3C8C A;  5DKL A;  5J3W A;  4A5R A;  1FR6 A;  3TE8 A;  1LSX A;  3ZGA B;  2XQZ A;  5HZH A;  2H0Y A;  2KX6 A;  1D7E A;  4DE1 A;  3IH9 A;  4NXG A;  2IWB A;  5A92 A;  3T1Q B;  2JKT I;  4IVI A;  5E2H A;  1YSP A;  3MKF A;  5CHJ A;  3N8R A;  2XA7 S;  2Y2G A;  3A0S A;  3PBN A;  1BUL A;  1KE0 A;  5A93 A;  5DVA A;  2DCF A;  1E3U A;  4RQ9 A;  4HJ6 A;  4KUK A;  3K3C A;  5EVI A;  3S7P A;  3LIF A;  4X55 A;  5HX9 A;  3ZG9 B;  1VET B;  5TGF A;  1VB6 A;  1PFL A;  2X71 A;  4HJ3 A;  2Z6C A;  4DJ2 A;  5FQK A;  4MLL A;  3ISG A;  4R4R A;  3FYZ A;  3MR0 A;  1S6R A;  4S2J A;  3IX4 A;  4H6J A;  3D3O A;  4PM8 A;  5G4Y A;  1XA1 A;  4YFM A;  3GQZ A;  1SDN A;  1QME A;  1MKM A;  3F1P B;  3D9Y A;  3K3D A;  3CZD A;  2WAE A;  4KZ4 A;  3MZD A;  4CPK A;  4X1L A;  2XSS A;  2A3U A;  5L07 A;  3NDG A;  4C6Y A;  3C5A A;  3F1N A;  1IYO A;  5GHX A;  1K57 C;  4OOM A;  3C4P A;  4B9O A;  2UWX A;  1X0O A;  5AQ7 A;  4BBV A;  2PAV P;  3KYE A;  1XXM A;  5EM0 A;  4CLC A;  2ZD8 A;  1YLW A;  3PAE A;  3VSL A;  4B88 A;  5JYP A;  3AGE A;  2JE5 A;  4R3J A;  1PYY A;  1T1C A;  4KUO A;  5HFO A;  2FFY A;  2W3G A;  2P9V B;  3GR2 A;  3T1R A;  4E3M A;  2O9C A;  4I39 A;  3A3J A;  5A91 A;  1BZA A;  5AVE A;  1O07 A;  4WM9 A;  1E25 A;  5L2F A;  4Y7P A;  1UWP X;  5CED A;  3CHW P;  5HL1 A;  4U0T A;  4ARZ A;  3IF6 A;  3H7W A;  4WYY A;  2H28 A;  4HP9 A;  4HI4 A;  4MN5 A;  4LEN A;  2XR0 A;  3IF5 A;  2J80 A;  3LIC A;  4YIN A;  4O8G A;  1ESU A;  2ZQD A;  4BQM A;  1H5X A;  4KZ3 A;  1MKI A;  2W0N A;  3EGD C;  4JGO A;  2IWD A;  1ES4 A;  2W3E A;  4Y0T A;  1S1Y A;  2M1C A;  1XKZ A;  4EV4 A;  3M2J A;  4PMA A;  3BYD A;  4UHU A;  4Y0O A;  1J3W A;  4N1X A;  3LEQ A;  2WYX A;  3OPL A;  1PWC A;  4S2P A;  1OTD A;  3E4O A;  4LRY C;  1WE4 A;  1JWZ A;  3IHB A;  3MMH A;  1EW0 A;  2RL3 A;  4EQ1 A;  2Y8H A;  1L2S A;  2GNX A;  3WS0 A;  2GX5 A;  4DE3 A;  4S2N A;  3IX3 A;  3SH9 A;  4EET B;  3MXS A;  3VOZ A;  2HDU A;  5M19 A;  3NOU C;  4QY6 A;  2ZL1 A;  4HBT A;  1U60 A;  1ERM A;  3VP4 A;  1P9R A;  5FEG A;  3TG9 A;  3ZDJ A;  3TOI A;  4C75 A;  1MPL A;  3OPP A;  2ZMA A;  4NXF A;  3IT9 A;  1ZKJ A;  5CTN A;  5F83 A;  4EBP A;  3A3E A;  3U2A A;  2JCH A;  1IOU A;  3QP5 A;  4IBX A;  4JLF A;  1ZG6 A;  2VGK A;  5FI7 A;  5F6A A;  3IH8 A;  3W8K A;  2A24 B;  3FPV A;  3LR0 A;  1M40 A;  1BSG A;  3RTY A;  1K55 A;  3C38 A;  3KYZ A;  2ZC5 B;  3IXD A;  4KQO A;  4RX3 A;  4P6Z M;  3MSH A;  1Z09 A;  5DTS A;  2VV6 A;  3HJK A;  5F68 A;  3VFH A;  1F2K A;  3T4S A;  2ZC6 B;  1K38 A;  1CI8 A;  3KSG A;  3RFB A;  3N6I A;  4NK3 A;  5J8X A;  3PHY A;  3PBT A;  3GV9 A;  1TS7 A;  4WZ4 A;  3T4T A;  5FAP A;  3W4Q A;  4BWI A;  1YLY A;  5HDD A;  3G2Z A;  4GNU A;  3MQQ A;  5FSR A;  4DKI A;  2XGN A;  4MN6 A;  2XD5 A;  2ZLY A;  4E3K A;  1BYW A;  5HSQ A;  4R3A A;  3NY4 A;  3BFC A;  1TS0 A;  3I7J A;  3WRT A;  2QHK A;  1IEM A;  3KX0 X;  3T1X A;  2ZMV A;  4Y17 A;  4P85 A;  2BLS A;  3DTK A;  4IUH A;  3IWO A;  4BLM A;  2ZC7 A;  3U4L P;  2K2N A;  1GSW A;  2C5W B;  3QP8 A;  1ZC2 A;  1MY8 A;  3CAX A;  2C6W B;  1SKO B;  5DJU A;  3HLE A;  3CPT B;  3IHA A;  2Y79 A;  2HDS A;  5FQ9 A;  4ZJ2 A;  2XRO A;  2EWW A;  2W1T A;  5CTM A;  2ZBB A;  1T1B A;  2Y2O A;  2KDK A;  4R3B A;  3G35 A;  1JTD A;  3BEB A;  2VK3 A;  4DRT A;  3IS2 A;  4QWO A;  3S7N A;  2HDQ A;  1NZU A;  4HP4 A;  3G4P A;  3BY8 A;  2KOI A;  4KQD A;  1GSV A;  1DJC A;  5KSH A;  1H8M A;  2YKH A;  4OON A;  3TRC A;  5KMW A;  2Y59 A;  5DF9 A;  2OWJ A;  5CER A;  4HJ4 A;  3SZT A;  4UQI S;  3ZYT A;  2PU4 A;  3EQU A;  4QPR A;  2Y2K A;  5EV0 A;  4WZ5 C;  3LID A;  2W1R A;  4MCW A;  4F3L B;  3F1O B;  3H82 A;  3B42 A;  3OOV A;  4M3K A;  3OBF A;  3TW8 A;  1KGE A;  4NKP A;  4P0M A;  3ZVW A;  1K56 A;  3T1S A;  1KGG A;  1BT5 A;  1S66 L;  3ITA A;  2GZA A;  5AQB A;  3FC7 A;  2XA7 M;  3VP1 A;  4R6L A;  4N9L A;  4NXE A;  2J9O A;  3UPN A;  5FDS A;  2UV0 E;  3HBR A;  1HLU P;  2VGJ A;  3S22 A;  3VMA A;  1W8Q A;  1N9L A;  2YKF A;  2Y55 A;  4HH2 A;  3T50 A;  2JKR M;  5TJJ A;  2WKH A;  2EWV A;  3V5M A;  3ZG8 B;  2V20 A;  4OPZ A;  1NRJ A;  1OTA A;  3VV4 A;  1FCN A;  3UMD A;  4Q0J A;  3EEH A;  3IBJ A;  3OLO A;  3SS4 A;  1ODV A;  1YLJ A;  1NXY A;  3JVV A;  1KOU A;  1TDL A;  1YMS A;  3IBR A;  4KZ5 A;  4KZ7 A;  5AVF A;  1VEU A;  2EX6 A;  4Y13 A;  2WKE A;  1N9N A;  4R4S A;  4RYE A;  5M1A A;  4CLC E;  4FUW A;  2R9X A;  3BLS A;  4KEN B;  4Z1W A;  3ZFZ A;  2PR6 A;  3QNB A;  1ZTU A;  4O7D A;  4OVD A;  5GLC A;  3F1P A;  3UPP A;  4I3A A;  3QP4 A;  1XFQ A;  4B4X A;  1V9Z A;  4KZ9 A;  3QP6 A;  1NZO A;  4JPM A;  2J3W A;  4S2O A;  3O86 A;  3HVF A;  4PM9 A;  1NLZ A;  4WF0 A;  4KZ6 A;  4DDS A;  2D02 A;  3EWK A;  4OKP A;  1CQA A;  2IWC A;  4GDB A;  3UE0 A;  4JF6 A;  2WGV A;  4HIA A;  1ZG4 A;  3FV7 A;  1F9I A;  5HL6 A;  4XT2 B;  4DMZ A;  2P9V A;  3PAG A;  1SCW A;  5DTK A;  2HDR A;  3T4K A;  1F5M A;  3BQ8 A;  2VKS A;  1K57 A;  1XGJ A;  3FKW A;  2OLU A;  2MJ6 A;  3LR3 A;  1E4D A;  4UAA A;  1DJB A;  1PRQ A;  1J9M A;  3GSG A;  3WS2 A;  1XJ2 A;  2QJ7 A;  1HTZ A;  3S1Y A;  1T1A A;  4UA9 A;  4EUZ A;  4BD1 A;  3VSK A;  1PW1 A;  3LIA A;  4G3K A;  3LR4 A;  4ZJ3 A;  2J9P A;  3MQ0 A;  5F69 A;  1LI0 A;  3N4I A;  3V3S A;  2WGW B;  3WS4 A;  4JGR A;  2Y2M A;  5AQ9 A;  5G18 A;  2V2F F;  1JVJ A;  3UB9 A;  1YLP A;  4DF6 A;  3A0R A;  2W3H A;  3FWL A;  1LT0 A;  4BL3 A;  3VE4 A;  4R0Q A;  4MMN A;  1MWS A;  1RGZ A;  3FZC A;  1HZO A;  1VQQ A;  3RH8 B;  5A90 A;  3S7Q A;  1K54 A;  3DWZ A;  1DP6 A;  1FQG A;  4IBR A;  4LGW A;  4XXR A;  5A8B A;  3KSI A;  4KZA A;  1PZP A;  4Y3I A;  2V8F A;  3GRJ A;  3ZHH A;  1W8Y A;  2ZM8 A;  5GL9 A;  3SS5 A;  5IHV A;  1HD8 A;  1DP9 A;  1XJ4 A;  3MS6 A;  4ESP A;  4JF4 A;  2XEP A;  2HP5 A;  2ACG A;  2B02 A;  2B5R A;  3SS3 A;  4GHI A;  2GJ3 A;  1GSX A;  1CI9 A;  3OCN A;  5TR7 A;  1KE4 A;  3MQO A;  2JN7 A;  5EVI C;  1GHP A;  3HUN A;  3B3X A;  3QP2 A;  3LY4 A;  1CEG A;  2D01 A;  3PR6 A;  1JWP A;  2Q0O A;  5GHZ A;  2WKQ A;  4IHQ A;  1VM1 A;  2XRN A;  5KZH A;  4D2O A;  1OT9 A;  1JNU A;  1MWU A;  1FIK A;  3AGF A;  3K2N A;  3UDF A;  1ONG A;  1OTI A;  3UB8 A;  1DY6 A;  2A24 A;  3ZCZ A;  3LI9 A;  3CG5 A;  2M7U A;  2ZJ9 A;  2L4R A;  4OQI A;  4F94 A;  4E3O A;  5EVL A;  4FH2 A;  2HPB A;  3FG8 A;  3ZG5 A;  4OPY A;  3NJA A;  4JXV A;  2NUP C;  3C7U A;  3PBS A;  3O88 A;  5CHM A;  4MBH A;  3CUE A;  2ZM0 A;  4Q0I A;  4YOF A;  4WLA A;  3JPU A;  4JGQ A;  5KSC A;  3ULF A;  1Z6F A;  3FPW A;  4R70 A;  3C30 A;  2DNS A;  4M4X A;  4H6J B;  3OPR A;  4ZJ1 A;  3HUO A;  4PKY G;  1N9B A;  5GLA A;  1SZV A;  2EX2 A;  5HWT A;  1W5D A;  1UWN X;  4Q8I A;  2JKT M;  3KYQ A;  3QNC A;  5MC7 A;  1WYC A;  1IKI A;  3ITB A;  3IQA A;  2V1Z A;  3DTI A;  2WAF A;  3NOP C;  1K25 A;  4WL9 A;  5FAT A;  3IXB A;  2WUQ A;  1MWR A;  1MXO A;  3EQV A;  3BFE A;  5DF7 A;  3KO6 A;  5E2G A;  5FQM A;  3F1N B;  4O01 A;  3LY3 A;  4OP8 A;  1BTL A;  3JYI A;  4CJN A;  5E2E A;  4GLQ A;  3SW1 A;  3MXR A;  5EVE A;  5HW3 A;  5CX7 A;  3E98 A;  3M6H A;  3O5Y A;  5F82 A;  1JWV A;  4EXO A;  1XA7 A;  2ZOH A;  2BAS A;  2WK0 A;  3O87 A;  4PM6 A;  1IKG A;  2E8I A;  2LB9 A;  3T4Q A;  2X02 A;  2H10 A;  1YKD A;  3G34 A;  1SKO A;  4QB8 A;  2L0W A;  2LB5 A;  2PR5 A;  4BJP A;  2OAP 1;  3QHY A;  4S2I A;  2L1M A;  2Y2J A;  4I5S A;  2QWS A;  3MFX A;  3P7N A;  3W4P A;  2GDN A;  4BL2 A;  4WMC A;  5HDS A;  3E2K A;  3DW0 A;  1KGF A;  4ID4 A;  4ARZ B;  3ZQ5 A;  1BLP A;  3HLF A;  4UQI M;  1C3B A;  2R9W A;  5EUA A;  3R4K A;  1XFN A;  3ZNT A;  4MDZ A;  4BD0 A;  3MF0 A;  1ESI A;  2JKR I;  1FOF A;  3B47 A;  1ES3 A;  5TFQ A;  3E4P A;  3H9W A;  3VP0 A;  3UN7 A;  5CGW A;  4GDN A;  5FL3 A;  4BBU A;  2PDR A;  4LLO B;  3C2W A;  2OLV A;  2XH9 A;  3WWX A;  3F1O A;  5L09 A;  1G68 A;  1NWZ A;  3A0V A;  3N8L A;  1L0E A;  4PAU A;  5FQI A;  3G31 A;  1E3U D;  1VHM A;  3KSF A;  1NJ4 A;  5EVI D;  1ES5 A;  1ES2 A;  4QJG A;  3G6O A;  4E04 A;  5K5B A;  1CK3 A;  1T19 A;  1ERQ A;  2INW A;  2JKF A;  1XGI A;  5F1G A;  5FAO A;  1FIL A;  4Y2F A;  5CEB A;  4OOL A;  1ONH A;  2VA0 A;  3ZG0 A;  2EX8 A;  4R38 A;  3LEZ A;  5CHU A;  5EFW A;  5HDC A;  4KG5 A;  1YMX A;  1IYQ A;  1O7E A;  1P9W A;  2Y2N A;  4RVA A;  2XFS A;  2ZL1 B;  4HQA A;  4II7 A;  5FDH A;  4LCL A;  4EWF A;  2JHE A;  3MZE A;  2PD7 A;  3BFG A;  1AWI A;  5L8M A;  4EW7 A;  3ZG7 B;  1S1Z A;  3UNW A;  3BM6 A;  3Q7V B;  2OSU A;  2Y2I A;  1H3Q A;  3BY9 A;  3UDI A;  2DMW A;  2VX8 A;  1MZU A;  2K31 A;  3DBA A;  4PKY A;  1YQS A;  5FQJ A;  5HAP A;  2Q9M A;  1T18 A;  4OH0 A;  5HPF A;  1GA9 A;  3OPH A;  2VV8 A;  2HZ5 A;  4CLC D;  4DN0 A;  3GTC A;  4L9E A;  4LV1 A;  4PHT A;  3WRZ A;  2W3F A;  4K08 A;  1TS8 A;  5DFX A;  1TS6 A;  3R7W A;  2RCX A;  3MJQ A;  3WS5 A;  3UY6 A;  4OQ0 A;  5KIZ A;  3LIB A;  1DJA A;  2B18 A;  4H8R A;  2QMI A;  2V1B A;  1RP5 A;  5F5Y A;  3CMZ A;  1G6O A;  2J8Y A;  2PHY A;  1YLZ A;  1XPB A;  4IVK A;  1ALQ A;  2A49 A;  2AVX A;  3HUM A;  3DWK A;  2R78 A;  4KZB A;  3MXQ A;  4Z9Q A;  4FCF A;  3C4O A;  3OC2 A;  3UB7 A;  1W63 Q;  4BBT A;  2ZQ8 A;  3E2L A;  4K91 A;  4ZAM A;  3RJU A;  4BMW A;  4QHC A;  1F98 A;  2DRW A;  3IXH A;  4HOI A;  2WZX A;  2Y2Q A;  3ZVT A;  1V9Y A;  4B4Z A;  3M6B A;  3EOI A;  4OP5 A;  4NXB A;  3Q81 A;  4EBN A;  1OME A;  5AJG A;  3N8S A;  3T4J A;  3UE1 A;  1VET A;  2ZMF A;  2JBF A;  3WS1 A;  4S2K A;  3HLD A;  4WBG A;  1Y28 A;  5TBM B;  5GLB A;  3LR5 A;  2E8J A;  4GCZ A;  4DE0 A;  4WUJ A;  5IU1 A;  2J3T C;  4RX2 A;  4YWZ A;  3UB5 P;  5EOE A;  4OLD A;  3A3D A;  2Y2P A;  1NRF A;  1RGY A;  3IS2 B;  3NUL A;  3LGO A;  4Y5F A;  4ZTK A;  4DXC A;  3LIE A;  5IT5 A;  1TD5 A;  3PYP A;  3B33 A;  1LL9 A;  3IWQ A;  1P97 A;  4EUV A;  4FTX A;  3SH7 A;  1K4E A;  1RCJ A;  2K7S A;  2PBD P;  2P08 A;  2EFX A;  1DRM A;  2J7V A;  4WEK A;  2O99 A;  1ERO A;  4GS9 B;  1MBL A;  1PZO A;  4KZ8 A;  1P0Z A;  2OAQ 1;  4R23 A;  3Q07 A;  4WEJ A;  4WMC D;  4ZDX A;  1S4R A;  1Q2Q A;  2VGL S;  1LHY A;  4HES A;  4Y15 A;  1TVF A;  2Q9N A;  1WYB A;  1L0G A;  2KLI A;  1LL5 A;  4OOY A;  1NYY A;  3T4O A;  2W27 A;  3PXP A;  1D06 A;  2EXB A;  4PM5 A;  4D60 A;  2XLN A;  1L3L A;  3PBO A;  1NLY A;  4JXW A;  5HAR A;  4GOG A;  3NDE A;  4I3I A;  4EES A;  4HH3 A;  3T4L A;  1PWG A;  2Z2L B;  3IWI A;  1CEF A;  3D4F A;  5HAQ A;  3UPO A;  2I72 A;  2FFF B;  3VOL A;  5FI2 A;  4QD4 A;  1QMF A;  2HJ9 C;  1STZ A;  5CGX A;  3G32 A;  3GEC A;  1OTB A;  3DTE A;  1AXB A;  4RA7 A;  1YAX A;  3P09 A;  4UA7 A;  1GHM A;  2P74 A;  2FZ0 A;  1VEU B;  4R1G A;  4EBL A;  3S4X A;  5GLD A;  4FD8 A;  5EE8 A;  4B93 A;  2M7V A;  4G3V A;  4KG2 A;  2Z2M B;  4C3Q A;  1LSV A;  4GD6 A;  1CJF A;  5IS1 A;  4EER A;  1GA0 A;  2WKR A;  3PBQ A;  3VP3 A;  3CLO A;  4HY8 A;  4PM7 A;  2V8C A;  3GDI A;  3E0Y A;  3HCY A;  5M18 A;  2QPN A;  3JVU A;  2BTF P;  4LFU A;  1ZHH B;  1IFQ A;  1S0W A;  2V1A A;  3NEC A;  2OV5 A;  3VE3 A;  4JBF A;  1G28 A;  1KVM A;  1YLT A;  4G3W A;  4S2L A;  2VV7 A;  2Y4A A;  4DDY A;  1KDS A;  1FCO A;  4E3N A;  3Q1F A;  1NYM A;  5D3O A;  2WAD A;  3TJZ C;  4PPR A;  2Y2L A;  2CC1 A;  2G2U A;  1XJ3 A;  3PTE A;  2V0W A;  5E43 A;  4Q0H A;  4E3L A;  2J3T D;  3OZH A;  4MBK A;  1SHV A;  4Y0U A;  2ZOI A;  4ETX A;  2WZZ A;  5L10 A;  4WEL A;  4MBF A;  4N9K A;  4E3I A;  4ME4 A;  4HBU A;  3MZF A;  4DXB A;  1L0F A;  2EA9 A;  1M6K A;  5J4E A;  1A0K A;  2EXA A;  1YT4 A;  5EVI B;  1LL8 A;  1XJ6 A;  4HNB A;  1IEL A;  1K56 D;  4X68 A;  4K0X A;  3RXW A;  1S4S A;  4E3J A;  4ZBE A;  2I9V A;  4FH4 A;  4QY5 A;  4I38 A;  3RXX A;  2PYR A;  4ZRR A;  4OLG A;  5HD3 A;  2ZQ7 A;  1KDW A;  1K54 C;  2FH5 A;  4AFI A;  4EEP A;  4X69 A;  5CGS A;  1BUE A;  1OJG A;  4P87 A;  2XDM A;  3IXG A;  1H0M A;  4CLC C;  4KQQ A;  2ZC4 B;  3KSH A;  5HPI A;  4I3J A;  1LI9 A;  1TDG A;  2PD8 A;  1Y54 A;  2HJE A;  4GN2 A;  3BQA A;  3W4O A;  5F1F A;  3M2K A;  1YM1 A;  4KQR A;  3V3R A;  1IYS A;  5LBR A;  4GKU A;  4LV2 A;  4DJ3 A;  4UA6 A;  3IX8 A;  3PBR A;  2HP6 A;  4CLC B;  3IF6 C;  1PW8 A;  3FKV A;  3NCK A;  3EEA A;  1I2S A;  3MFD A;  3LO7 A;  3V67 A;  2QJ5 A;  3AGD A;  3ICY A;  3V50 A;  4UEY A;  4JXS A;  4GHI B;  1I5Q A;  4E6X A;  3SH8 A;  4LPZ A;  3CPT A;  3G30 A;  3Q7Z A;  3BW6 A;  2QZ6 A;  3LYX A;  4YNR A;  3Q7V A;  1H8Z A;  1S67 L;  4X1M A;  1OPX A;  3P98 A;  4U0X A;  2WKI A;  2V0U A;  4N1H A;  3IF6 B;  3NOT C;  3H7W B;  1FSY A;  4QU3 A;  3W2Z A;  3CUE C;  5I94 A;  2VJW A;  1TEM A;  4OPR A;  5E2F A;  2QYB A;  4JGP A;  1ACF A;  5FI6 A;  3HL9 A;  3T12 B;  3HLW A;  5CRF A;  1N4O A;  4MN7 A;  1Q2P A;  2O9B A;  3HJI A;  1KVL A;  1N9O A;  2JC7 A;  4F3L A;  4X6T A;  2PT7 A;  3BEC A;  3CIT A;  4N92 A;  4S2N C;  3HLB A;  3UE6 A;  2VLG A;  1MC0 A;  2B95 A;  5FQQ A;  1OTE A;  3MKE A;  4HEF A;  2G2W A;  3VOY A;  2PYP A;  2VZW A;  5EOO A;  1YSQ A;  1K4F A;  4WZ5 A;  4FOF A;  4XUZ A;  2OOL A;  5U47 A;  3EGX C;  4L0L A;  3A3F A;  3TSG A;  4LRZ E;  5BOH A;  4OQG A;  4S2M A;  2HGV A;  3ZNY A;  5EEC A;  5C5K A;  1GHI A;  5J7E A;  1SKF A;  3HLC A;  4GD8 A;  4EU0 A;  1PI5 A;  2ZQA A;  1FR1 A;  4LV0 A;  2JKG A;  5HAI A;  3CWF A;  2WGI A;  3UDX A;  1K55 C;  1XP4 A;  4X53 A;  5DKK A;  4NG2 A;  5CXW A;  2ZQ9 A;  1PNE A;  3BWL A;  4GB7 A;  5G4Z A;  5TBM A;  3CI6 A;  4OPQ A;  3O3V A;  5AQA A; 
#chains in the Genus database with same CATH homology
 1ERM A;  3N7W A;  2EFU A;  5DTT A;  4ZTK A;  4DXC A;  4KZA A;  1K6R A;  3VP4 A;  1PZP A;  3TG9 A;  1W7F A;  1JTG A;  1IYP A;  1XX2 A;  3ZDJ A;  3UO9 A;  3TOI A;  4C75 A;  4FSF A;  1LL9 A;  3A3I A;  1MPL A;  3GRJ A;  1W8Y A;  2ZM8 A;  3IWQ A;  3BFD A;  3OPP A;  5GL9 A;  5IHV A;  3SS5 A;  3ZHH A;  1HD8 A;  3Q82 A;  3SH7 A;  1K4E A;  1RCJ A;  1FCM A;  2ZMA A;  4GZB A;  4X56 A;  3IT9 A;  1ZKJ A;  2XEP A;  4JF4 A;  2HP5 A;  1BLS A;  1KE3 A;  2EFX A;  5CTN A;  5F83 A;  4EBP A;  2B5R A;  3A3E A;  3SS3 A;  2BG1 A;  2PBY A;  2JCH A;  1HVB A;  3LCE A;  2J7V A;  4IBX A;  4JLF A;  4WEK A;  1CI9 A;  1ZG6 A;  1ERO A;  3HRE A;  4K0W A;  1H8Y A;  3OCN A;  2H5S A;  2VGK A;  2Y2H A;  3GVB A;  5FI7 A;  5TR7 A;  1KE4 A;  1MBL A;  3IH8 A;  1PZO A;  3W8K A;  1NY0 A;  4KZ8 A;  2Y91 A;  5EVI C;  1GHP A;  2PU2 A;  2HP9 A;  3HUN A;  3Q07 A;  4R23 A;  3B3X A;  1M40 A;  1BSG A;  4MEZ A;  3LY4 A;  1CEG A;  4WEJ A;  4WMC D;  1K55 A;  1JWP A;  2ZC5 B;  2H0T A;  3IXD A;  4KQO A;  4RX3 A;  4JXG A;  5GHZ A;  4ZDX A;  1VM1 A;  2XF3 A;  5KZH A;  1Q2Q A;  5DTS A;  4D2O A;  1LHY A;  4LV3 A;  1GCE A;  1MWU A;  4HES A;  1TVF A;  1PI4 A;  2Q9N A;  1WYB A;  1L0G A;  3AGF A;  1LL5 A;  3UDF A;  4OOY A;  1NYY A;  1ONG A;  1BLC A;  3VFH A;  2ZC6 B;  1K38 A;  1DY6 A;  1PIO A;  1CI8 A;  2EXB A;  4PM5 A;  1W79 A;  2XLN A;  3PBO A;  3ZCZ A;  1I2W A;  4EQI A;  2XFT A;  3VP2 A;  3CG5 A;  3N6I A;  2ZQC A;  4JXW A;  4NK3 A;  4GOG A;  5HAR A;  2ZJ9 A;  3NDE A;  5J8X A;  4OQI A;  4F94 A;  4E3O A;  5EVL A;  1K6S A;  3OCL A;  4FH2 A;  2HPB A;  3PBT A;  3GV9 A;  3ZG5 A;  4OPY A;  1EI5 A;  4WZ4 A;  4JXV A;  1PWG A;  3NI9 A;  4IED A;  2Z2L B;  5FAP A;  3IWI A;  3C7U A;  3W4Q A;  1CEF A;  3D4F A;  4OQH A;  1YLY A;  5HAQ A;  3PBS A;  3UPO A;  2I72 A;  2FFF B;  3O88 A;  5CHM A;  4MBH A;  4QD4 A;  5FI2 A;  3G2Z A;  2ZM0 A;  4GNU A;  1QMF A;  5KSC A;  4MNR A;  1Z6F A;  5FSR A;  5CGX A;  3G32 A;  4KG6 A;  4DKI A;  4NET A;  2XGN A;  2XD5 A;  1AXB A;  2ZM2 A;  2ZLY A;  4RA7 A;  4E3K A;  2DNS A;  3P09 A;  4UA7 A;  1GHM A;  3GMW A;  5CEC A;  4E6W A;  3OPR A;  4JF5 A;  3HUO A;  4ZJ1 A;  3NY4 A;  2P74 A;  3BFC A;  1N9B A;  3I7J A;  5EPH A;  2EX2 A;  5GLA A;  3WRT A;  1IEM A;  1W5D A;  3BFF A;  5AQA A;  4Q8I A;  3NBL A;  3QNC A;  1FSW A;  4R1G A;  4EBL A;  1WYC A;  3S4X A;  5GLD A;  4FD8 A;  5EE8 A;  1IKI A;  4P85 A;  3ITB A;  3IQA A;  4KG2 A;  2V1Z A;  3CJM A;  5FAQ A;  2Z2M B;  4C3Q A;  2WAF A;  1K25 A;  2BLS A;  4GD6 A;  3UE3 A;  5FAT A;  3IXB A;  5FAS A;  2WGW A;  1MWR A;  1MXO A;  2WUQ A;  4BEN A;  3EQV A;  2X01 A;  1LLB A;  3BFE A;  3IWO A;  5DF7 A;  4BLM A;  1EWZ A;  5E2G A;  4DE2 A;  5FQM A;  1GA0 A;  2ZC7 A;  1MWT A;  3PBQ A;  3LY3 A;  4OP8 A;  2C5W B;  3VP3 A;  1BTL A;  4U3T A;  1ZC2 A;  1MY8 A;  3JYI A;  5FA7 A;  3VFF A;  4CJN A;  5E2E A;  4PM7 A;  3BRM A;  2C6W B;  3MXR A;  3NC8 A;  5HW3 A;  1BLH A;  4JKT A;  3HLE A;  3IHA A;  5M18 A;  2QPN A;  2HDS A;  5FQ9 A;  4ZJ2 A;  3M6H A;  5F82 A;  1JWV A;  5CTM A;  1XA7 A;  5GHY A;  1G6A A;  2Y2O A;  3BLM A;  1S0W A;  2OV5 A;  4R3B A;  3G35 A;  4XUX A;  1JTD A;  3BEB A;  2WK0 A;  4JBF A;  1KVM A;  3O87 A;  4DRT A;  1YLT A;  3NIA A;  4PM6 A;  1IKG A;  2E8I A;  4S2L A;  2X02 A;  2H10 A;  3G34 A;  2HDQ A;  2ZC3 B;  2XK1 A;  1NZU A;  3C7V A;  4QB8 A;  2Y4A A;  3G4P A;  3G2Y A;  4BJP A;  1KDS A;  4DDY A;  1FCO A;  5JYO A;  1DJC A;  3HLG A;  4E3N A;  5KSH A;  3QHY A;  3V39 A;  4S2I A;  3Q1F A;  1NYM A;  1SDE A;  4LCM A;  2Y2J A;  5D3O A;  4OON A;  3W4P A;  2WAD A;  3DTM A;  4P6B A;  3MBZ A;  2Y2L A;  2CC1 A;  4PPR A;  2Y59 A;  2GDN A;  5DF9 A;  4BL2 A;  4WMC A;  2XD1 A;  3E2K A;  1PWD A;  2G2U A;  3DW0 A;  1KGF A;  3PTE A;  5CER A;  4ID4 A;  5E43 A;  1BLP A;  2PU4 A;  3EQU A;  3HLF A;  5DF8 A;  1L0D A;  2Y2K A;  4E3L A;  3SOI A;  2EX9 A;  1C3B A;  2R9W A;  4WZ5 C;  5EUA A;  3OZH A;  4MBK A;  1SHV A;  4Y0U A;  3ZNT A;  4A5R A;  1FR6 A;  2WZZ A;  3ZGA B;  4BD0 A;  4WEL A;  2XQZ A;  4MBF A;  4N9K A;  2H0Y A;  4E3I A;  1ESI A;  4HBU A;  3MZF A;  4M3K A;  1FOF A;  1L0F A;  4DE1 A;  4DXB A;  1ES3 A;  1M6K A;  5TFQ A;  3IH9 A;  2IWB A;  5A92 A;  1KGE A;  2EXA A;  4IVI A;  1YT4 A;  5E2H A;  5EVI B;  4P0M A;  3ZVW A;  3MKF A;  3VP0 A;  1K56 A;  5CHJ A;  1KGG A;  3N8R A;  1BT5 A;  3UN7 A;  1IEL A;  2Y2G A;  1K56 D;  4GDN A;  3ITA A;  3PBN A;  4X68 A;  1BUL A;  1KE0 A;  5CGW A;  4K0X A;  5AQB A;  3RXW A;  3VP1 A;  5A93 A;  4E3J A;  2OLV A;  5DVA A;  2XH9 A;  4N9L A;  4ZBE A;  4FH4 A;  4QY5 A;  3WWX A;  1G68 A;  2J9O A;  3UPN A;  2DCF A;  3RXX A;  1E3U A;  3N8L A;  1L0E A;  3HBR A;  5FQI A;  4OLG A;  3G31 A;  1E3U D;  2VGJ A;  3S22 A;  3VMA A;  2ZQ7 A;  1KDW A;  1W8Q A;  1K54 C;  5EVI A;  4X69 A;  4X55 A;  5HX9 A;  1NJ4 A;  2Y55 A;  5TGF A;  3ZG9 B;  5EVI D;  5CGS A;  1ES5 A;  1ES2 A;  4QJG A;  1BUE A;  1CK3 A;  2WKH A;  2X71 A;  1ERQ A;  3V5M A;  3ZG8 B;  4P87 A;  2V20 A;  2XDM A;  4OPZ A;  1XGI A;  5FQK A;  3IXG A;  4MLL A;  4KQQ A;  2ZC4 B;  5F1G A;  1FCN A;  5FAO A;  3ISG A;  4R4R A;  5CEB A;  4OOL A;  3FYZ A;  1ONH A;  3ZG0 A;  1LI9 A;  2EX8 A;  1S6R A;  1TDG A;  4S2J A;  4GN2 A;  1Y54 A;  3LEZ A;  5CHU A;  3SS4 A;  1YLJ A;  1NXY A;  3W4O A;  4KG5 A;  5F1F A;  1TDL A;  3M2K A;  1YM1 A;  4KQR A;  1YMX A;  1IYQ A;  3V3R A;  1YMS A;  1IYS A;  4PM8 A;  1O7E A;  1XA1 A;  4KZ5 A;  4KZ7 A;  4YFM A;  2Y2N A;  4RVA A;  2EX6 A;  3GQZ A;  1SDN A;  4GKU A;  4LV2 A;  2XFS A;  1QME A;  5FDH A;  4LCL A;  4UA6 A;  4EWF A;  2WKE A;  3MZE A;  3CZD A;  2WAE A;  3BFG A;  4KZ4 A;  4R4S A;  4RYE A;  3MZD A;  3PBR A;  2HP6 A;  5M1A A;  4CPK A;  3IF6 C;  3ZG7 B;  2R9X A;  2A3U A;  1PW8 A;  3UNW A;  3BM6 A;  3FKV A;  3Q7V B;  3BLS A;  3NDG A;  2OSU A;  4KEN B;  2Y2I A;  4C6Y A;  3NCK A;  3C5A A;  5KMW A;  3ZFZ A;  3UDI A;  1IYO A;  1I2S A;  3MFD A;  3LO7 A;  5GHX A;  3QNB A;  1K57 C;  4O7D A;  4OOM A;  4OVD A;  3AGD A;  3C4P A;  5GLC A;  3UPP A;  3V50 A;  2UWX A;  4JXS A;  1I5Q A;  5AQ7 A;  1YQS A;  5FQJ A;  5HAP A;  2Q9M A;  4B4X A;  4E6X A;  3SH8 A;  3G30 A;  4KZ9 A;  1XXM A;  4OH0 A;  1GA9 A;  1NZO A;  1YLW A;  2ZD8 A;  3OPH A;  3PAE A;  3Q7Z A;  2QZ6 A;  3VSL A;  4B88 A;  5JYP A;  3AGE A;  2JE5 A;  3Q7V A;  4R3J A;  1H8Z A;  1PYY A;  4JPM A;  3GTC A;  4LV1 A;  5HFO A;  4S2O A;  2FFY A;  3O86 A;  3HVF A;  3P98 A;  4U0X A;  2WKI A;  3WRZ A;  4N1H A;  3IF6 B;  4PM9 A;  1FSY A;  4KZ6 A;  2P9V B;  3GR2 A;  4QU3 A;  4E3M A;  4DDS A;  2RCX A;  3A3J A;  5A91 A;  1BZA A;  4OKP A;  3WS5 A;  2IWC A;  4GDB A;  3UY6 A;  3UE0 A;  4OQ0 A;  4JF6 A;  2WGV A;  5I94 A;  1O07 A;  4WM9 A;  1E25 A;  5L2F A;  4Y7P A;  5CED A;  1TEM A;  1ZG4 A;  3FV7 A;  1DJA A;  4OPR A;  5E2F A;  5HL1 A;  4U0T A;  5FI6 A;  3IF6 A;  4H8R A;  2QMI A;  2P9V A;  1RP5 A;  3HL9 A;  3PAG A;  4WYY A;  1SCW A;  3HLW A;  3CMZ A;  2J8Y A;  5CRF A;  5DTK A;  2HDR A;  1YLZ A;  1N4O A;  1XPB A;  4IVK A;  1ALQ A;  1K57 A;  1Q2P A;  1XGJ A;  4LEN A;  2XR0 A;  3FKW A;  3IF5 A;  2A49 A;  1KVL A;  2JC7 A;  2OLU A;  4YIN A;  4X6T A;  1ESU A;  1E4D A;  3BEC A;  2ZQD A;  4BQM A;  4N92 A;  4S2N C;  4UAA A;  3HLB A;  3HUM A;  3DWK A;  1H5X A;  1DJB A;  4KZ3 A;  1MKI A;  1J9M A;  4KZB A;  3GSG A;  4Z9Q A;  4FCF A;  2IWD A;  3C4O A;  1ES4 A;  3OC2 A;  5FQQ A;  3WS2 A;  4Y0T A;  3MKE A;  4HEF A;  2G2W A;  2ZQ8 A;  3E2L A;  1HTZ A;  3S1Y A;  4K91 A;  3VOY A;  4ZAM A;  4UA9 A;  3RJU A;  1XKZ A;  5EOO A;  4QHC A;  4EV4 A;  1K4F A;  3M2J A;  2DRW A;  4PMA A;  3IXH A;  4WZ5 A;  4XUZ A;  4EUZ A;  3BYD A;  4BD1 A;  4UHU A;  2WZX A;  1PW1 A;  4Y0O A;  2Y2Q A;  5U47 A;  3VSK A;  3ZVT A;  4B4Z A;  4L0L A;  3A3F A;  3TSG A;  4N1X A;  5BOH A;  4ZJ3 A;  2J9P A;  4OQG A;  2WYX A;  4S2M A;  3ZNY A;  3M6B A;  4OP5 A;  3OPL A;  1LI0 A;  3N4I A;  3Q81 A;  4EBN A;  1OME A;  1PWC A;  2WGW B;  3V3S A;  5EEC A;  4S2P A;  3N8S A;  3WS4 A;  5AQ9 A;  2Y2M A;  3UE1 A;  1GHI A;  1SKF A;  3HLC A;  5G18 A;  1WE4 A;  1JWZ A;  2JBF A;  1JVJ A;  2V2F F;  3WS1 A;  4S2K A;  3IHB A;  3HLD A;  4WBG A;  1YLP A;  4GD8 A;  4DF6 A;  1PI5 A;  2ZQA A;  2RL3 A;  3FWL A;  5GLB A;  1FR1 A;  4LV0 A;  4BL3 A;  1L2S A;  4R0Q A;  4DE0 A;  5HAI A;  2WGI A;  1MWS A;  1RGZ A;  3UDX A;  3WS0 A;  4DE3 A;  3FZC A;  1K55 C;  1XP4 A;  4X53 A;  4RX2 A;  1HZO A;  1VQQ A;  4S2N A;  3SH9 A;  3MXS A;  5A90 A;  5EOE A;  4OLD A;  3A3D A;  3VOZ A;  5CXW A;  2ZQ9 A;  1K54 A;  3DWZ A;  2HDU A;  2Y2P A;  1NRF A;  1FQG A;  1RGY A;  4GB7 A;  4IBR A;  4XXR A;  5M19 A;  4OPQ A;  4QY6 A;  3O3V A;  4HBT A;  1U60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...