4M3KA

Structure of a single domain camelid antibody fragment cab-h7s in complex with the blap beta-lactamase from bacillus licheniformis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
260
Chain Sequence
MKDDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALVTSLRAFALEDPGKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Beta-lactamase
publication title Probing the mechanism of aggregation of polyQ model proteins with camelid heavy-chain antibody fragments
rcsb
source organism Bacillus licheniformis
total genus 93
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4m3kA00
1LLBA 3PTEA 4OH0A 4EV4A 2WKIA 2ZQ8A 3N8RA 5CHJA 1IKGA 3NBLA 4RVAA 4JXVA 3FV7A 3WS5A 4BD0A 4DXCA 1W7FA 1PW1A 1VQQA 1ERQA 2ZQ9A 1LHYA 4KZ8A 3MKEA 4OQIA 4DE2A 1M6KA 3IF6A 4DE0A 1PIOA 1E25A 1FCNA 3LY4A 1PYYA 4OONA 1G6AA 5F1GA 1I2WA 2FFFB 2RL3A 3IHAA 5FI6A 5TFQA 4PM5A 3QNCA 5HARA 1XA1A 1KE4A 4LCMA 4NK3A 1CK3A 2Q9NA 3AGDA 2V2FF 3DWKA 1IEMA 3Q7VA 4XUXA 5HAQA 3BFEA 4S2MA 3E2LA 3ITAA 4UA7A 5A90A 1NZUA 1K6SA 3PBRA 3ZCZA 4QJGA 4B4ZA 3OZHA 4WMCA 4PM9A 1ES2A 3UY6A 3NC8A 3ZGAB 3UO9A 1FR6A 4KG6A 1XKZA 4HESA 2Y55A 5DTSA 2JC7A 2IWCA 4WZ5A 3A3FA 1L2SA 5A92A 4N9KA 4JXWA 1MY8A 4YINA 3BLSA 1HTZA 2XEPA 3M2JA 5DTTA 2DNSA 4KQOA 1G68A 4EWFA 1C3BA 2VGJA 4JF5A 3OPLA 4X53A 3SH9A 3IF5A 3IXHA 3M6HA 1W79A 3FZCA 3UDIA 3WRTA 4IBXA 3Q7ZA 5AQ9A 4S2NA 5CHUA 4E3JA 3ZDJA 1TDLA 4Q8IA 3VFFA 5CERA 4R1GA 2Y2KA 4ZJ3A 2PU2A 4X69A 4U0TA 3IT9A 4OOLA 1KVLA 4KG5A 3RJUA 2WADA 2WUQA 3BFFA 1K54C 2WKHA 2UWXA 1KE3A 1FSYA 3W4QA 4ZDXA 3ZG5A 4LV3A 4B4XA 3VP2A 1PWGA 1ZC2A 2QMIA 4BLMA 3G31A 4UHUA 1MWSA 1NZOA 3HREA 1IYOA 1Q2PA 1ES5A 4JBFA 4QD4A 4HEFA 1HVBA 1IELA 2X01A 3BRMA 3IQAA 5HAPA 1MXOA 4Y0TA 2ZQAA 4MLLA 3OCNA 2OLVA 2CC1A 3M2KA 4PM8A 5EVLA 3G30A 2R9XA 4IBRA 1CEGA 2J8YA 1H5XA 1M40A 1E3UD 3A3DA 1ALQA 3OC2A 1K25A 1BLPA 3BFGA 3DW0A 3TOIA 2EXAA 3IWOA 3PAEA 3HLBA 2FFYA 3ZVTA 1KGEA 2Q9MA 3G2ZA 3N4IA 4PM7A 5TR7A 4P87A 1ZG6A 1IYPA 4GD6A 3VP0A 5A91A 5KSHA 4N1HA 5HW3A 3CG5A 5CTNA 1PWCA 1TEMA 2XGNA 3O86A 4KZAA 3W4OA 4RYEA 1LL5A 4NETA 1WYBA 2RCXA 5FI2A 5F82A 1BT5A 2OLUA 1VM1A 3D4FA 4S2JA 1YLWA 4WEJA 4WEKA 5F83A 1L0FA 2HP6A 1ZKJA 2EX9A 2ZMAA 4QY5A 5E2HA 4S2IA 2ZC5B 2XLNA 1YLJA 3OCLA 4X6TA 2OV5A 3PBSA 3OPHA 3UPNA 4DF6A 5E2GA 4DE1A 5FI7A 1FQGA 2XFTA 1FOFA 2Y2PA 3NCKA 1HZOA 3TSGA 5IHVA 1JWVA 4OP5A 5E2FA 1PZPA 1GCEA 4ZJ2A 3ZNYA 2HPBA 2I72A 1XXMA 1WE4A 5FQKA 1U60A 3GSGA 5CHMA 2JCHA 5JYPA 1QMFA 4LV1A 5EE8A 3HLGA 3UDXA 2A3UA 3AGFA 2X02A 5FQMA 2H0TA 4E3MA 3EQVA 5DF8A 2G2UA 5CTMA 3LEZA 1BZAA 4JXSA 4K91A 4IVIA 1PW8A 5AQBA 5CECA 3G4PA 3VP1A 3GRJA 3NDGA 1KGGA 3V5MA 3P09A 4DE3A 4C3QA 3PBTA 3W8KA 3RXXA 1FCMA 2JE5A 3UE0A 4QHCA 4PMAA 1RCJA 4FD8A 3PBOA 4DDSA 5I94A 1H8YA 1CI9A 3MZFA 2DCFA 3Q07A 3C5AA 3LY3A 5FDHA 1O7EA 2XDMA 2A49A 4S2KA 4GB7A 2EXBA 3SS3A 3MBZA 4GD8A 4XUZA 2Y2JA 4WZ4A 1K54A 3MXRA 2WZXA 2ZD8A 3GVBA 5J8XA 3BM6A 1JTDA 2WK0A 1SDNA 3G34A 2ZQCA 4KZ4A 1GHPA 4OPZA 4Y7PA 3DTMA 3N7WA 4YFMA 3UE1A 1S6RA 4X55A 3GR2A 3MZEA 5GLCA 3Q81A 2P74A 5GLBA 2ZC3B 4WYYA 1YLPA 5A93A 4P6BA 4GDBA 4R0QA 2J7VA 3N6IA 2IWBA 3WS0A 3ZG0A 5EOOA 2QZ6A 4OLDA 5FATA 1TDGA 3I7JA 3MKFA 1S0WA 1NJ4A 1AXBA 1XGJA 1HD8A 5DF9A 1W8QA 3M6BA 4LCLA 5EVIB 1IYSA 3C7UA 3E2KA 5DTKA 1WYCA 4HBUA 2EFXA 1SDEA 3FKVA 3IWIA 3G35A 3NIAA 4E3KA 4E6WA 1LI9A 4U0XA 4EBLA 2XH9A 1ONHA 1PI5A 2ZM0A 1JWPA 2BLSA 3C7VA 4OQ0A 1ERMA 3MXSA 4E3NA 1NXYA 1YLTA 3GQZA 4GDNA 1E3UA 3C4PA 4UA6A 2VGKA 5FAOA 2WYXA 1MWRA 2HDRA 3UPOA 3QHYA 2V20A 2C6WB 4FSFA 3DWZA 5GHZA 1Q2QA 3IH9A 1NY0A 1BLSA 1K38A 4GNUA 4L0LA 4C6YA 2H10A 1EROA 4KZ6A 3ZVWA 3VSKA 3QNBA 4WELA 1L0EA 4N1XA 1PWDA 1XPBA 4KZBA 3CMZA 2HDUA 4DDYA 1DJAA 5EPHA 3O88A 4OPQA 4OPRA 5KZHA 3WRZA 1J9MA 1ZG4A 3VMAA 1QMEA 2EX8A 3IWQA 5DVAA 4GOGA 2HDSA 2ZM8A 4IVKA 2XFSA 1LL9A 1LI0A 2Y2HA 4RX3A 4LV2A 2Y2GA 3NY4A 5GHYA 1W8YA 3LCEA 3LO7A 4B88A 2R9WA 3ZNTA 4QY6A 3IXBA 3P98A 1BTLA 5CRFA 2WGWB 3IXGA 1RP5A 4ID4A 1SCWA 2WZZA 3V3SA 5KMWA 3UNWA 3GV9A 1O07A 3HUMA 4R3JA 1DY6A 2Y2MA 4MBFA 4N9LA 5GLAA 4S2LA 4E3LA 1GA0A 5FQQA 1K55C 1IYQA 5FQ9A 4DKIA 5L2FA 3WWXA 1MBLA 1FSWA 1BULA 3VOYA 4RA7A 3G2YA 1BLCA 2B5RA 3Q1FA 3SS5A 4U3TA 4KENB 1K57C 4UA9A 4ZAMA 4WM9A 4M3KA 4Y0UA 3N8LA 4WBGA 2X71A 3CJMA 4P85A 4BENA 1MWUA 1NYMA 2G2WA 3OPRA 1CEFA 1EWZA 5TGFA 2XQZA 4LENA 4GN2A 5EOEA 4KQQA 2Y91A 4FH4A 4OOYA 1K4FA 1TVFA 4EUZA 4PPRA 1KVMA 5HL1A 2ZC4B 4OP8A 4C75A 1YMXA 3N8SA 2OSUA 4JXGA 5CXWA 4R23A 2E8IA 5FAPA 1DJBA 4DXBA 3WS4A 1XX2A 3A3JA 1PZOA 5HFOA 1MWTA 4BL2A 3SOIA 1K6RA 3TG9A 3VP3A 4EQIA 1YLZA 4K0XA 3ISGA 3GTCA 5FAQA 3EQUA 5FSRA 3V3RA 3UN7A 1E4DA 2J9PA 2WAFA 4QB8A 3VOZA 4OKPA 2GDNA 1XA7A 1GHMA 3C4OA 1Z6FA 3S1YA 4GZBA 1BUEA 2WGVA 3FKWA 5EVIA 1JWZA 1YLYA 1MKIA 2P9VB 3SH7A 1L0GA 4MBKA 1JVJA 1CI8A 3S4XA 4JKTA 1ES3A 3SH8A 4OLGA 3ZG9B 4HBTA 4R3BA 1ESUA 4ZBEA 3BEBA 4OQGA 5CEBA 5FQIA 2XR0A 3WS1A 2WGIA 2EFUA 4FH2A 4F94A 3ZG7B 5CGXA 5EVID 2ZC6B 2IWDA 1I5QA 2QPNA 3AGEA 2ZLYA 3A3EA 3UDFA 4RX2A 3G32A 3VSLA 2Y2NA 4MBHA 3BLMA 3VFHA 4E3IA 5M1AA 2XD1A 1XP4A 2J9OA 5EECA 2Y59A 3CZDA 1IKIA 4R4SA 4S2PA 3BYDA 5EVIC 3HUNA 3O87A 5HX9A 4R4RA 1ESIA 3GMWA 4KQRA 1FR1A 1FCOA 2ZJ9A 3ZFZA 4JF6A 3IH8A 5M19A 5CGSA 3UPPA 4KZ5A 2PU4A 2ZQDA 4D2OA 2EX6A 4S2OA 3FWLA 4Y0OA 5AQAA 1ES4A 2BG1A 4FCFA 5FQJA 3IF6B 5FA7A 1KGFA 4WMCD 5DF7A 5CEDA 5KSCA 4LV0A 4EBNA 2XK1A 4ZTKA 3IF6C 3V50A 2WGWA 2XF3A 3Q82A 4OPYA 3Q7VB 2EX2A 2H0YA 2Y2LA 1K55A 5CGWA 3HLWA 4E3OA 4JF4A 1DJCA 1KDSA 1OMEA 3MZDA 1SHVA 3JYIA 5E2EA 3RXWA 4CJNA 5FASA 3IXDA 3SS4A 4BQMA 4IEDA 5GHXA 1K57A 3PAGA 2ZC7A 1L0DA 4XXRA 5E43A 3HUOA 4A5RA 4OQHA 4P0MA 4WZ5C 2V1ZA 5AQ7A 1YT4A 2XD5A 3ITBA 5M18A 1YM1A 3S22A 1XGIA 3PBQA 4PM6A 3W4PA 4KZ9A 1YQSA 4QU3A 4BD1A 2Y4AA 5F1FA 4Z9QA 2HP5A 3BFDA 3OPPA 4ZJ1A 4DRTA 2Y2OA 4K0WA 4S2NC 1EI5A 3UE3A 1K4EA 2ZQ7A 5U47A 3A3IA 1GHIA 3NI9A 3MFDA 4H8RA 4JPMA 4EBPA 4OOMA 3WS2A 1ONGA 4E6XA 1SKFA 1KE0A 1RGYA 4O7DA 2ZM2A 2Y2IA 1PI4A 2Z2MB 2P9VA 2WAEA 1GA9A 3HL9A 2C5WB 1H8ZA 1KDWA 4MEZA 1MPLA 4OVDA 4MNRA 5D3OA 3BECA 1K56A 1YMSA 4X68A 2Y2QA 3HLEA 1W5DA 4KZ3A 3HVFA 4BL3A 2PBYA 1N9BA 4UAAA 3O3VA 1BLHA 1N4OA 4GKUA 4JLFA 5GL9A 2DRWA 3B3XA 3HLFA 1Y54A 4KZ7A 3IHBA 2HP9A 1BSGA 1RGZA 2H5SA 3FYZA 5G18A 2HDQA 4CPKA 3VP4A 4N92A 1NRFA 3ZHHA 1NYYA 3PBNA 1I2SA 4X56A 3ZG8B 3HBRA 4BJPA 2Z2LB 5BOHA 1JTGA 1K56D 3V39A 2WKEA 4KG2A 3NDEA 5HAIA 5GLDA 3HLDA 5EUAA 3BFCA 3HLCA 5JYOA 2JBFA
chains in the Genus database with same CATH superfamily
1LLBA 3PTEA 1OTAA 3E4OA 2WKIA 4HQAA 4XT2A 3N8RA 2R78A 1IKGA 4DN0A 4PAUA 1W7FA 1VQQA 1ERQA 2ZQ9A 1LHYA 3MKEA 2A24A 1M6KA 1PIOA 1E25A 1G6AA 1KE4A 2HV1A 1IEMA 3E2LA 3ITAA 3PBRA 3ZCZA 3K3CA 3OZHA 4NXGA 3UY6A 5DTSA 2JC7A 2IA2A 4NG2A 3A3FA 1GSXA 1MY8A 3PXPA 1C3BA 2VGJA 4X53A 1FIKA 3M6HA 1W79A 3MQ0A 1S1ZA 4Y17A 3WRTA 3Q7ZA 2Z6DA 1TDLA 2OAP1 3VFFA 4R1GA 2P04A 2XA7S 1ZTUA 2NUTC 4WF0A 3VP2A 1ZC2A 1MWSA 3F1NB 3HREA 1IYOA 2M1CA 1ES5A 5HWVA 1KOUA 2X01A 4WL9A 4G3KA 2ZMFA 4Y0TA 5EVLA 2R9XA 1ALQA 2PD8A 1BLPA 3DW0A 4X1LA 3ZVTA 2PHYA 3N4IA 5TR7A 1IYPA 4GD6A 3VP0A 5A91A 5KSHA 5CTNA 1PWCA 3W4OA 2W27A 1WYBA 4HY8A 3D9YA 1UWPX 1BT5A 2OLUA 4EU0A 3D4FA 2JKRI 5HDCA 1YLWA 4WEJA 5F83A 1L0FA 2ZMAA 3QP2A 5E2HA 4O8GA 4Q0HA 2P08A 3PBSA 2OV5A 3E4PA 5FI7A 1FQGA 3NCKA 3UE6A 1JWVA 4OP5A 1NLYA 1PZPA 4RQ9A 5FEFA 1U60A 3CPTA 3GSGA 4HJ4A 4E3MA 5CTMA 3VV4A 2L0WA 4JXSA 3IX3A 5CECA 3VP1A 1KGGA 2V0WA 3P09A 3PBTA 3UE0A 2O99A 3PBOA 4GHIB 4DDSA 2DMWA 3C5AA 5FDHA 2XDMA 2HF6A 4GB7A 2EXBA 3BM6A 1SDNA 1GHPA 3N7WA 2JN7A 3MZEA 4BBUA 2W3HA 4P6BA 4GDBA 3WS0A 4FTXA 2QZ6A 4ESPA 1TDGA 3MKFA 1NJ4A 1XGJA 4LCLA 1WYCA 3FKVA 3R7WA 4JGRA 2ZM0A 2BLSA 2KLIA 2KDKA 1NXYA 4WUJA 3GQZA 1E3UA 5FAOA 4FSFA 1Q2QA 1NY0A 4R6LA 4DJ2A 1AWIA 4GNUA 5EV0A 3ZVWA 4WELA 1L0EA 1PWDA 1XPBA 2W3GA 2HDUA 1DJAA 3CITA 2ZM8A 4RX3A 2XFSA 2Y2HA 2INWA 4HOIA 3IS2A 4GS9B 3JVUA 3K2NA 3ZNTA 4HJ3A 2WGWB 4ID4A 1SCWA 3V3SA 5KMWA 3UB6A 3UNWA 3GV9A 3U2AA 1O07A 1DY6A 4MBFA 4N9LA 5FQ9A 1BULA 5L8MA 4RA7A 3T4KA 1BLCA 1K57C 1OT6A 4M3KA 1VEUB 1NYMA 1ODVA 1WA9A 1TVFA 3B33A 5F68A 3N8SA 4CLCE 3T4LA 3OBFA 1DJBA 1XX2A 3A3JA 1MWTA 3A0VA 3SOIA 3TG9A 3VP3A 4Y13A 3GTCA 1E4DA 3VOZA 2GDNA 1Y28A 4IUKA 3C4OA 3FC7A 3S1YA 1BUEA 2O9BA 1S1YA 3PYPA 3SH7A 3MQOA 2VX8A 1CI8A 5J3WA 3SH8A 3ZG9B 4HBTA 1N9LA 3BEBA 3WS1A 4Y3IA 2IWDA 3AGEA 4DJ3A 3OLOA 3F1PB 3UDFA 5EECA 4CLCB 3BYDA 3HJIA 1FCOA 3KX0X 3CUEC 1XFNA 4KZ5A 2PU4A 3BWLA 3P7NA 1ES4A 1MZUA 1TD5A 2A24B 4I3JA 4WMCD 5DF7A 5CEDA 2XK1A 1XJ3A 4OPYA 5HZHA 3NOUC 4LFUA 4JF4A 3JYIA 5E2EA 4IEDA 1K57A 4EEPA 2V0UA 3IBRA 4XXRA 5E43A 1F98A 5AQ7A 2XD5A 4HP4A 3ITBA 5M18A 5DJTA 3S22A 3PBQA 3C2WA 4BD1A 5F1FA 3LIFA 1F5MA 4S2NC 2EA9A 2JKGA 1H0MA 5K5BA 3MFDA 4JPMA 3WS2A 4E6XA 5G4YA 1JNUA 1Z09A 1GA9A 2P9VA 4Y5FA 3C8CA 1KDWA 5D3OA 5DKKA 1YMSA 2Y2QA 2ZMVA 1W5DA 2PYPA 4BL3A 2PBYA 4GKUA 1N4OA 5GL9A 2BASA 3QP8A 4KZ7A 5G18A 2HP9A 1PNEA 2VV7A 3PBNA 3HBRA 5BOHA 2HGVA 2WKEA 4KG2A 3NJAA 5GLDA 3LICA 3BFCA 4D60A 3CUEA 1DP8A 4EV4A 2OAQ1 5CHJA 4RVAA 4R70A 4JXVA 2JKRM 1PW1A 1ZHHB 4WLAA 4DE2A 2JHEA 3KSHA 4OONA 3LY4A 1I2WA 2FFFB 1XA1A 3NOPC 4NK3A 1CK3A 2Q9NA 3DWKA 5HAQA 3T4QA 3CPTB 4UA7A 1K6SA 4QJGA 4B4ZA 2PR6A 2O9CA 1LSWA 5LBRA 3ZGAB 4KG6A 4HESA 2Y55A 3CAXA 2IWCA 1L2SA 3M2JA 2DNSA 1G68A 2JKFA 4JF5A 3SH9A 2M7VA 4IBXA 1CJFA 4S2NA 5CHUA 2QJ7A 2QWSA 5CERA 4ZJ3A 3HJKA 4U0TA 3IT9A 4OOLA 3RJUA 3BFFA 2WKHA 1KE3A 4NXFA 1FSYA 4ZDXA 2OOLA 2QMIA 3LI8A 3G31A 3T12B 4H6JA 3IQAA 1SKOA 3R7WB 1CEGA 2J8YA 3VE3A 3BFGA 5EM1A 3IWOA 3HLBA 3KYQA 1KGEA 3G2ZA 4PM7A 1XJ2A 4II7A 5HW3A 1TEMA 3O86A 3H82A 5FI2A 4BBVA 2EX9A 1YLJA 2QYBA 4DF6A 4DE1A 2KOIA 3MFXA 2XFTA 5F5YA 1HZOA 5IHVA 1GCEA 4ZJ2A 3IS2B 1V9YA 5FQKA 2A3UA 3EQVA 4M4XA 1BZAA 3JPUA 4K91A 4Y2FA 4YWZA 2VGLS 3ZYTA 3NDGA 3V5MA 3RFBA 1FCMA 2VLGA 5I94A 3Q07A 3SW1A 5IT5A 1HLUP 3LY3A 1O7EA 3VE4A 3MBZA 2Y2JA 3TJZC 2ZD8A 5J8XA 4YFMA 3GECA 2W1TA 2B18A 5GLBA 4WYYA 1YLPA 4R0QA 3GDIA 2J7VA 5FATA 4PHTA 2I9VA 1S0WA 1HD8A 2ZL1A 5DF9A 3D3OA 2VZWA 4NXBA 1SDEA 4YOFA 3NIAA 1LI9A 4U0XA 3LIEA 3LFVA 2YKHA 1YLTA 3UPOA 1MWRA 2HDRA 3QHYA 2C6WB 3MR0A 3UMEA 3EWKA 2VV8A 4L0LA 4C6YA 1EROA 4KZ6A 5FEGA 4HIAA 3CMZA 2E8JA 1OT9A 3WRZA 1J9MA 1ZG4A 4HHDA 3VMAA 3MMHA 2EX8A 3IWQA 2HDSA 4IVKA 3BW6A 4LV2A 3NY4A 5GHYA 1W8YA 3B47A 3LCEA 3LO7A 2R9WA 4JGPA 1NLZA 3HUMA 4R3JA 3G6OA 4S2LA 4E3LA 1GA0A 5FQQA 1IYQA 5L2FA 4X25A 1MBLA 4HJ6A 4U3TA 4KENB 4ZAMA 4PKYG 4LRZE 3CJMA 2G2WA 3OPRA 5TGFA 2B95A 2KX6A 3EEHA 5EOEA 2WKRA 3QP4A 2Y91A 3K3DA 4EUZA 3A0RA 2ZC4B 5HWWA 4YNRA 1XJ4A 5FAPA 5HD5A 4DXBA 4BL2A 1K6RA 1YLZA 3O5YA 2J3TD 3V3RA 5FAQA 2J9PA 4I3AA 2WAFA 3QP1A 4QB8A 4KUOA 1JWZA 1T1BA 2P9VB 1CF0A 4HH3A 1L0GA 3RTYA 3MXQA 4JKTA 4EW7A 1ES3A 1XJ6A 4OQGA 1IOUA 4GLQA 5FQIA 4UQIM 3CWFA 3LR3A 2QPNA 2ZLYA 1DRMA 3A3EA 4RX2A 2Y2NA 3VFHA 2XD1A 1XP4A 2J9OA 4EEUA 2W3EA 1IKIA 3KSGA 4R4SA 4NKPA 3HUNA 4R4RA 2W0NA 4P6ZM 4KQRA 3ZFZA 1YPRA 3EGDC 1W63M 4Z1WA 1YSPA 4HNBA 4FCFA 2BG1A 5FQJA 3L9KA 3QP5A 2J80A 4LV0A 3Q82A 2EX2A 5G4ZA 2WKQA 2Y2LA 2V9AA 3HLWA 4EQ1A 3IXDA 2ZC7A 3SZTA 4A5RA 3MJQA 4OQHA 4P0MA 2V1ZA 3DAVA 4QU3A 2HP5A 1LL8A 5I5LA 4K0WA 4FOFA 3UE3A 1K4EA 2V1AA 4KQDA 3A3IA 2PAVP 4H8RA 4Y15A 4OOMA 1SKFA 2HJ9C 4H6JB 4QPRA 4Q0IA 2C5WB 1H8ZA 4F3LA 1S4RA 4OVDA 2K7SA 1SKOB 1K56A 4X68A 3O3VA 1BLHA 3ICYA 3B3XA 3CHWP 1BSGA 4CPKA 3VP4A 3ZHHA 1I2SA 2XROA 5AVFA 1K56D 3H82B 3NDEA 5C5KA 3HLDA 4B88A 5EM0A 2JBFA 5JYOA 3DTKA 4OH0A 3T1RA 2EWWA 1TS8A 1MKMA 3WS5A 1T19A 4L9EA 4DXCA 4OQIA 3TW8A 4DE0A 3C30A 1N9OA 4LGWA 1FCNA 1PYYA 4UQIS 3IHAA 5FI6A 5TFQA 4XUXA 5IS1A 4S2MA 1NZUA 1A0KA 4WMCA 4PM9A 2YKFA 4L9GA 1XKZA 2O9AA 4XT2B 5A92A 4N9KA 4JXWA 2PDRA 5EFWA 5DTTA 4EWFA 3IF5A 3IXHA 2PYRA 3FZCA 2PR5A 3UDIA 4MN7A 5AQ9A 5AVEA 1W63Q 1GSWA 2OWHA 3E0YA 3LEQA 2ACGA 2EWVA 4KG5A 3TRCA 4Q0JA 2WUQA 2W1TB 2UWXA 4B4XA 1G28A 1NZOA 4JBFA 1HVBA 3BRMA 2ZL1B 5HAPA 1MXOA 3FPWA 4ETZA 1LT0A 2OLVA 2CC1A 3M2KA 4MN6A 4PM8A 3G30A 4IBRA 3A3DA 1K25A 1VB6A 2EXAA 4O0PA 2FFYA 4E04A 2Q9MA 1F2KA 2GNXA 1PRQA 4WN5A 4P87A 4ME4A 5DKLA 1ZG6A 3CG5A 2XGNA 4RYEA 5F82A 1VM1A 1Y4OA 3NHQA 4S2JA 3PHYA 4WEKA 1H8MA 3BY8A 4QY5A 2XLNA 3OPHA 3T4TA 2J3WA 2Y2PA 3TSGA 3LIDA 2HPBA 2I72A 1XXMA 1WE4A 1XFQA 5CHMA 2JCHA 1QMFA 4LV1A 3HLGA 3UDXA 3AGFA 2X02A 5FQMA 3UB8A 5DF8A 4HH2A 3L7HA 3R4KA 1N9NA 1PW8A 3GRJA 5AJGA 3W8KA 2LB5A 4K08A 3LGOA 4QHCA 3S7PA 1RCJA 1V9ZA 1H8YA 1CI9A 3LR5A 4S2KA 3SS3A 5CX7A 3MXRA 2WZXA 3GVBA 1JTDA 2WK0A 3UE1A 3GR2A 4MMNA 2P74A 2XSSA 2IWBA 3N6IA 2FH5A 5HL6A 3I7JA 1AXBA 1P9WA 1W8QA 5DTKA 2EFXA 3IWIA 3G35A 3T4SA 3H7WA 4GW9A 1TF1A 4EBLA 2XH9A 3KYZA 1ONHA 4LRYC 3CLOA 4OQ0A 1TS6A 3C7VA 1D06A 3MXSA 3B42A 4UA6A 2VGKA 2WYXA 2V20A 1BLSA 1STZA 2XA7M 1K38A 2H10A 3VSKA 3PR6A 4N1XA 4BWIA 1T1CA 5L07A 4KZBA 3P01A 5EPHA 3O88A 4OPRA 1VETA 5KZHA 2ZOIA 5DVAA 4GOGA 1LL9A 2Y2GA 3IXBA 3P98A 5CRFA 5TJJA 4JGQA 2Y79A 3U4LP 2Y2MA 3WWXA 4X1MA 3BQ8A 4EETB 4PKYA 1FILA 3Q1FA 1J3WA 3SS5A 4UA9A 4HP9A 2A2LA 4WBGA 4P85A 4BENA 1MWUA 1CEFA 1EWZA 3LIBA 2XQZA 4LENA 4GN2A 3ULFA 4KQQA 3IX8A 4FH4A 1S66L 1K4FA 1KVMA 4QWOA 5FDSA 1YMXA 5CXWA 2OSUA 4R23A 2E8IA 1PZOA 5HFOA 4K0XA 1D1JA 3UN7A 5IU1A 3UMDA 3UB9A 4OKPA 5F69A 1XA7A 1GHMA 2V8CA 2BTFP 4GZBA 2WGVA 5EVIA 4BBTA 4CLCA 1YLYA 3JVVA 1VHMA 4MBKA 4F3LB 3NULA 2J3TC 4OLGA 2JKTI 4CQHA 5CEBA 2WGIA 3IX4A 4FH2A 5EVID 2ZC6B 4CLCD 1OTIA 1TS7A 5M1AA 2L1MA 4S2PA 3HCYA 1NWZA 3O87A 5HX9A 1ESIA 2H28A 2UV0E 4JF6A 5CGSA 1YSQA 4ARZA 2EX6A 2P7JA 3FWLA 5AQAA 3T4OA 4ETXA 1KGFA 3BJNA 1CQAA 3EGXC 4ZTKA 3IF6C 3V50A 2H0YA 1DJCA 1KDSA 1OMEA 5FASA 4CJNA 4BQMA 5MC7A 3T4JA 3KO6A 1L0DA 1OTDA 3F1OA 4WZ5C 3T1QB 2PT7A 1DP6A 5DJUA 1YM1A 1XGIA 1YQSA 2Y4AA 3BY9A 2VV6A 4MCWA 4NXEA 4DRTA 2Y2OA 1T1AA 1GHIA 1ONGA 3V67A 1KE0A 1RGYA 4O7DA 2ZM2A 4FUWA 2Y2IA 1PI4A 2Z2MB 3EEAA 1G6OA 4ZRRA 3OOVA 2K2NA 2VEAA 4IJGA 1MPLA 1G5UA 4MNRA 2Z6CA 3HLEA 5A8BA 1P0ZA 3NOTC 5F6AA 2DRWA 2PBDP 1GSVA 2HDQA 4N92A 4X56A 3ZG8B 4BJPA 1JTGA 3LIAA 3V39A 1S67L 5TBMA 1NRJA 5HAIA 5EUAA 3DBAA 2ZQ8A 3NBLA 3FV7A 4BD0A 2FZ0A 3LI9A 1OTBA 5HSQA 4KZ8A 4G3WA 2QKPA 3IF6A 3UB5P 5F1GA 3DTEA 2RL3A 4PM5A 3QNCA 5HARA 4LCMA 3AGDA 2V2FF 3Q7VA 3BFEA 2OWJA 5A90A 2D02A 3ZQ5A 1ES2A 3NC8A 3NECA 3KSFA 3UO9A 1FR6A 4JGOA 3KSIA 4WZ5A 4YINA 4HI4A 3BLSA 3EOIA 1HTZA 2XEPA 4KQOA 3OPLA 3UB7A 1D7EA 2MJ6A 3VOLA 3A0SA 2B02A 4E3JA 3LR4A 3ZDJA 3T1XA 4Q8IA 2Y2KA 1ACFA 3S7NA 2PU2A 4X69A 1KVLA 2WADA 1K54C 2VA0A 3W4QA 3C38A 3ZG5A 4LV3A 1PWGA 4BLMA 4UHUA 1Q2PA 4QD4A 4HEFA 1IELA 2GJ3A 1L3LA 2QJ5A 2ZQAA 4MLLA 3OCNA 2GX5A 3H7WB 1H5XA 1M40A 1E3UD 4I3IA 5L09A 3OC2A 4MDZA 5DFYA 3TOIA 1YKDA 4IUHA 3PAEA 5HD3A 3LUQA 3MS6A 3DTIA 2VJWA 4N1HA 4GJ4A 3W2ZA 4KZAA 1LL5A 4NETA 1F9IA 2RCXA 4MN5A 2HP6A 1ZKJA 4S2IA 2XRNA 2ZC5B 1TS0A 3OCLA 4X6TA 1VETB 3UPNA 5E2GA 4EXOA 1FOFA 2O0YA 5E2FA 3D72A 4DMZA 3ZNYA 1X0OA 2QHKA 5JYPA 4IHQA 2W3FA 3E4QA 5EE8A 4R3AA 2H0TA 3MSHA 2G2UA 3LEZA 1OTEA 4IVIA 5AQBA 3G4PA 2G7UA 4DE3A 4C3QA 3RXXA 1UWNX 2JE5A 4PMAA 1P9RA 5HDSA 4FD8A 5KIZA 4O01A 3MZFA 2DCFA 3E98A 2PRFA 2A49A 1OJGA 2CMNA 2W1RA 4GD8A 4XUZA 4WZ4A 1H3QA 1K54A 4I38A 4LPZA 4OPZA 3G34A 4KZ4A 4Y7PA 2ZQCA 3DTMA 2V8FA 1S6RA 4X55A 3RH8B 1SZVA 5GLCA 3Q81A 2ZC3B 5A93A 4B93A 1DP9A 3F1NA 3FG8A 3ZG0A 5EOOA 4P6ZS 4OLDA 2NUPC 1IFQA 5EVEA 5EVIB 3M6BA 1IYSA 3C7UA 3E2KA 4HBUA 5J4EA 1EW0A 4E3KA 4E6WA 1PI5A 3QP6A 1JWPA 1ERMA 4E3NA 4GDNA 3H9WA 3C4PA 1BYWA 5GHZA 3DWZA 3IH9A 3T50A 5J7EA 2JKTM 5DFXA 1PFLA 3QNBA 3KYEA 4KUKA 4DDYA 4OPQA 4LRXC 5HWTA 1QMEA 4ARZB 1LI0A 2VKSA 2ZOHA 4QY6A 1BTLA 3IXGA 2M7UA 1RP5A 2WZZA 2WKPA 3CI6A 1T18A 5GLAA 1K55C 4DKIA 4I39A 1FSWA 1OJ5A 5HDDA 3VOYA 3G2YA 2B5RA 1K0KA 3T1SA 3F1OB 4WM9A 4Y0UA 2X71A 4GHIA 1LSVA 4GCZA 3LR0A 4OOYA 4PPRA 3TE8A 5HL1A 4OP8A 4C75A 4JXGA 5L10A 5HPFA 3WS4A 4EQIA 2HJEA 3ISGA 5FSRA 3EQUA 1Z6FA 3FKWA 1MKIA 1JVJA 2VGLM 4G3VA 3S4XA 4UEYA 4EESA 2V1BA 4R3BA 1ESUA 4ZBEA 2XR0A 2EFUA 4F94A 3ZG7B 3LYXA 5CGXA 1I5QA 1MC0A 5HPIA 3G32A 3VSLA 4MBHA 3BLMA 4E3IA 3MF0A 2Y59A 3CZDA 2GZAA 5TBMB 4EERA 4BMWA 5EVIC 4CLCC 3GMWA 1FR1A 2ZJ9A 3IH8A 5M19A 3UPPA 2ZQDA 4D2OA 1S4SA 4S2OA 4Y0OA 4L9FA 3IF6B 5FA7A 4GS9A 5KSCA 4EBNA 3MQQA 2WGWA 2LB9A 2XF3A 2Y8HA 3Q7VB 1K55A 2K31A 2ZBBA 5CGWA 4E3OA 3MZDA 1SHVA 3RXWA 3SS4A 5GHXA 3PAGA 3HUOA 2L4RA 1VEUA 4LLOB 1P97A 3BQAA 2HZ5A 1YAXA 1YT4A 2W3DA 4PM6A 4R38A 3W4PA 4KZ9A 4Z9QA 3BFDA 3OPPA 4ZJ1A 1EI5A 2AVXA 2ZQ7A 5U47A 4EUVA 3NI9A 2PD7A 4EBPA 3S7QA 4NEED 1LSXA 3IBJA 3S7OA 2WAEA 1UGUA 3HL9A 4MEZA 3BECA 4KZ3A 3HVFA 1N9BA 1OPXA 4UAAA 4JLFA 2Q0OA 3HLFA 1Y54A 3IHBA 1RGZA 2H5SA 3FYZA 3F1PA 4B9OA 1NRFA 3FPVA 1NYYA 2Z2LB 2VK3A 4AFIA 4I5SA 5FL3A 2D01A 3N8LA 3HLCA
chains in the Genus database with same CATH topology
1LLBA 3PTEA 4OH0A 4EV4A 2WKIA 2ZQ8A 3N8RA 5CHJA 1IKGA 3NBLA 4RVAA 4JXVA 3FV7A 3WS5A 4BD0A 4DXCA 1W7FA 1PW1A 1VQQA 1ERQA 2ZQ9A 1LHYA 4KZ8A 3MKEA 4OQIA 4DE2A 1M6KA 3IF6A 4DE0A 1PIOA 1E25A 1FCNA 3LY4A 1PYYA 4OONA 1G6AA 5F1GA 1I2WA 2FFFB 2RL3A 3IHAA 5FI6A 5TFQA 4PM5A 3QNCA 5HARA 1XA1A 1KE4A 4LCMA 4NK3A 1CK3A 2Q9NA 3AGDA 2V2FF 3DWKA 1IEMA 3Q7VA 4XUXA 5HAQA 3BFEA 4S2MA 3E2LA 3ITAA 4UA7A 5A90A 1NZUA 1K6SA 3PBRA 3ZCZA 4QJGA 4B4ZA 3OZHA 4WMCA 4PM9A 1ES2A 3UY6A 3NC8A 3ZGAB 3UO9A 1FR6A 4KG6A 1XKZA 4HESA 2Y55A 5DTSA 2JC7A 2IWCA 4WZ5A 3A3FA 1L2SA 5A92A 4N9KA 4JXWA 1MY8A 4YINA 3BLSA 1HTZA 2XEPA 3M2JA 5DTTA 2DNSA 4KQOA 1G68A 4EWFA 1C3BA 2VGJA 4JF5A 3OPLA 4X53A 3SH9A 3IF5A 3IXHA 3M6HA 1W79A 3FZCA 3UDIA 3WRTA 4IBXA 3Q7ZA 5AQ9A 4S2NA 5CHUA 4E3JA 3ZDJA 1TDLA 4Q8IA 3VFFA 5CERA 4R1GA 2Y2KA 4ZJ3A 2PU2A 4X69A 4U0TA 3IT9A 4OOLA 1KVLA 4KG5A 3RJUA 2WADA 2WUQA 3BFFA 1K54C 2WKHA 2UWXA 1KE3A 1FSYA 3W4QA 4ZDXA 3ZG5A 4LV3A 4B4XA 3VP2A 1PWGA 1ZC2A 2QMIA 4BLMA 3G31A 4UHUA 1MWSA 1NZOA 3HREA 1IYOA 1Q2PA 1ES5A 4JBFA 4QD4A 4HEFA 1HVBA 1IELA 2X01A 3BRMA 3IQAA 5HAPA 1MXOA 4Y0TA 2ZQAA 4MLLA 3OCNA 2OLVA 2CC1A 3M2KA 4PM8A 5EVLA 3G30A 2R9XA 4IBRA 1CEGA 2J8YA 1H5XA 1M40A 1E3UD 3A3DA 1ALQA 3OC2A 1K25A 1BLPA 3BFGA 3DW0A 3TOIA 2EXAA 3IWOA 3PAEA 3HLBA 2FFYA 3ZVTA 1KGEA 2Q9MA 3G2ZA 3N4IA 4PM7A 5TR7A 4P87A 1ZG6A 1IYPA 4GD6A 3VP0A 5A91A 5KSHA 4N1HA 5HW3A 3CG5A 5CTNA 1PWCA 1TEMA 2XGNA 3O86A 4KZAA 3W4OA 4RYEA 1LL5A 4NETA 1WYBA 2RCXA 5FI2A 5F82A 1BT5A 2OLUA 1VM1A 3D4FA 4S2JA 1YLWA 4WEJA 4WEKA 5F83A 1L0FA 2HP6A 1ZKJA 2EX9A 2ZMAA 4QY5A 5E2HA 4S2IA 2ZC5B 2XLNA 1YLJA 3OCLA 4X6TA 2OV5A 3PBSA 3OPHA 3UPNA 4DF6A 5E2GA 4DE1A 5FI7A 1FQGA 2XFTA 1FOFA 2Y2PA 3NCKA 1HZOA 3TSGA 5IHVA 1JWVA 4OP5A 5E2FA 1PZPA 1GCEA 4ZJ2A 3ZNYA 2HPBA 2I72A 1XXMA 1WE4A 5FQKA 1U60A 3GSGA 5CHMA 2JCHA 5JYPA 1QMFA 4LV1A 5EE8A 3HLGA 3UDXA 2A3UA 3AGFA 2X02A 5FQMA 2H0TA 4E3MA 3EQVA 5DF8A 2G2UA 5CTMA 3LEZA 1BZAA 4JXSA 4K91A 4IVIA 1PW8A 5AQBA 5CECA 3G4PA 3VP1A 3GRJA 3NDGA 1KGGA 3V5MA 3P09A 4DE3A 4C3QA 3PBTA 3W8KA 3RXXA 1FCMA 2JE5A 3UE0A 4QHCA 4PMAA 1RCJA 4FD8A 3PBOA 4DDSA 5I94A 1H8YA 1CI9A 3MZFA 2DCFA 3Q07A 3C5AA 3LY3A 5FDHA 1O7EA 2XDMA 2A49A 4S2KA 4GB7A 2EXBA 3SS3A 3MBZA 4GD8A 4XUZA 2Y2JA 4WZ4A 1K54A 3MXRA 2WZXA 2ZD8A 3GVBA 5J8XA 3BM6A 1JTDA 2WK0A 1SDNA 3G34A 2ZQCA 4KZ4A 1GHPA 4OPZA 4Y7PA 3DTMA 3N7WA 4YFMA 3UE1A 1S6RA 4X55A 3GR2A 3MZEA 5GLCA 3Q81A 2P74A 5GLBA 2ZC3B 4WYYA 1YLPA 5A93A 4P6BA 4GDBA 4R0QA 2J7VA 3N6IA 2IWBA 3WS0A 3ZG0A 5EOOA 2QZ6A 4OLDA 5FATA 1TDGA 3I7JA 3MKFA 1S0WA 1NJ4A 1AXBA 1XGJA 1HD8A 5DF9A 1W8QA 3M6BA 4LCLA 5EVIB 1IYSA 3C7UA 3E2KA 5DTKA 1WYCA 4HBUA 2EFXA 1SDEA 3FKVA 3IWIA 3G35A 3NIAA 4E3KA 4E6WA 1LI9A 4U0XA 4EBLA 2XH9A 1ONHA 1PI5A 2ZM0A 1JWPA 2BLSA 3C7VA 4OQ0A 1ERMA 3MXSA 4E3NA 1NXYA 1YLTA 3GQZA 4GDNA 1E3UA 3C4PA 4UA6A 2VGKA 5FAOA 2WYXA 1MWRA 2HDRA 3UPOA 3QHYA 2V20A 2C6WB 4FSFA 3DWZA 5GHZA 1Q2QA 3IH9A 1NY0A 1BLSA 1K38A 4GNUA 4L0LA 4C6YA 2H10A 1EROA 4KZ6A 3ZVWA 3VSKA 3QNBA 4WELA 1L0EA 4N1XA 1PWDA 1XPBA 4KZBA 3CMZA 2HDUA 4DDYA 1DJAA 5EPHA 3O88A 4OPQA 4OPRA 5KZHA 3WRZA 1J9MA 1ZG4A 3VMAA 1QMEA 2EX8A 3IWQA 5DVAA 4GOGA 2HDSA 2ZM8A 4IVKA 2XFSA 1LL9A 1LI0A 2Y2HA 4RX3A 4LV2A 2Y2GA 3NY4A 5GHYA 1W8YA 3LCEA 3LO7A 4B88A 2R9WA 3ZNTA 4QY6A 3IXBA 3P98A 1BTLA 5CRFA 2WGWB 3IXGA 1RP5A 4ID4A 1SCWA 2WZZA 3V3SA 5KMWA 3UNWA 3GV9A 1O07A 3HUMA 4R3JA 1DY6A 2Y2MA 4MBFA 4N9LA 5GLAA 4S2LA 4E3LA 1GA0A 5FQQA 1K55C 1IYQA 5FQ9A 4DKIA 5L2FA 3WWXA 1MBLA 1FSWA 1BULA 3VOYA 4RA7A 3G2YA 1BLCA 2B5RA 3Q1FA 3SS5A 4U3TA 4KENB 1K57C 4UA9A 4ZAMA 4WM9A 4M3KA 4Y0UA 3N8LA 4WBGA 2X71A 3CJMA 4P85A 4BENA 1MWUA 1NYMA 2G2WA 3OPRA 1CEFA 1EWZA 5TGFA 2XQZA 4LENA 4GN2A 5EOEA 4KQQA 2Y91A 4FH4A 4OOYA 1K4FA 1TVFA 4EUZA 4PPRA 1KVMA 5HL1A 2ZC4B 4OP8A 4C75A 1YMXA 3N8SA 2OSUA 4JXGA 5CXWA 4R23A 2E8IA 5FAPA 1DJBA 4DXBA 3WS4A 1XX2A 3A3JA 1PZOA 5HFOA 1MWTA 4BL2A 3SOIA 1K6RA 3TG9A 3VP3A 4EQIA 1YLZA 4K0XA 3ISGA 3GTCA 5FAQA 3EQUA 5FSRA 3V3RA 3UN7A 1E4DA 2J9PA 2WAFA 4QB8A 3VOZA 4OKPA 2GDNA 1XA7A 1GHMA 3C4OA 1Z6FA 3S1YA 4GZBA 1BUEA 2WGVA 3FKWA 5EVIA 1JWZA 1YLYA 1MKIA 2P9VB 3SH7A 1L0GA 4MBKA 1JVJA 1CI8A 3S4XA 4JKTA 1ES3A 3SH8A 4OLGA 3ZG9B 4HBTA 4R3BA 1ESUA 4ZBEA 3BEBA 4OQGA 5CEBA 5FQIA 2XR0A 3WS1A 2WGIA 2EFUA 4FH2A 4F94A 3ZG7B 5CGXA 5EVID 2ZC6B 2IWDA 1I5QA 2QPNA 3AGEA 2ZLYA 3A3EA 3UDFA 4RX2A 3G32A 3VSLA 2Y2NA 4MBHA 3BLMA 3VFHA 4E3IA 5M1AA 2XD1A 1XP4A 2J9OA 5EECA 2Y59A 3CZDA 1IKIA 4R4SA 4S2PA 3BYDA 5EVIC 3HUNA 3O87A 5HX9A 4R4RA 1ESIA 3GMWA 4KQRA 1FR1A 1FCOA 2ZJ9A 3ZFZA 4JF6A 3IH8A 5M19A 5CGSA 3UPPA 4KZ5A 2PU4A 2ZQDA 4D2OA 2EX6A 4S2OA 3FWLA 4Y0OA 5AQAA 1ES4A 2BG1A 4FCFA 5FQJA 3IF6B 5FA7A 1KGFA 4WMCD 5DF7A 5CEDA 5KSCA 4LV0A 4EBNA 2XK1A 4ZTKA 3IF6C 3V50A 2WGWA 2XF3A 3Q82A 4OPYA 3Q7VB 2EX2A 2H0YA 2Y2LA 1K55A 5CGWA 3HLWA 4E3OA 4JF4A 1DJCA 1KDSA 1OMEA 3MZDA 1SHVA 3JYIA 5E2EA 3RXWA 4CJNA 5FASA 3IXDA 3SS4A 4BQMA 4IEDA 5GHXA 1K57A 3PAGA 2ZC7A 1L0DA 4XXRA 5E43A 3HUOA 4A5RA 4OQHA 4P0MA 4WZ5C 2V1ZA 5AQ7A 1YT4A 2XD5A 3ITBA 5M18A 1YM1A 3S22A 1XGIA 3PBQA 4PM6A 3W4PA 4KZ9A 1YQSA 4QU3A 4BD1A 2Y4AA 5F1FA 4Z9QA 2HP5A 3BFDA 3OPPA 4ZJ1A 4DRTA 2Y2OA 4K0WA 4S2NC 1EI5A 3UE3A 1K4EA 2ZQ7A 5U47A 3A3IA 1GHIA 3NI9A 3MFDA 4H8RA 4JPMA 4EBPA 4OOMA 3WS2A 1ONGA 4E6XA 1SKFA 1KE0A 1RGYA 4O7DA 2ZM2A 2Y2IA 1PI4A 2Z2MB 2P9VA 2WAEA 1GA9A 3HL9A 2C5WB 1H8ZA 1KDWA 4MEZA 1MPLA 4OVDA 4MNRA 5D3OA 3BECA 1K56A 1YMSA 4X68A 2Y2QA 3HLEA 1W5DA 4KZ3A 3HVFA 4BL3A 2PBYA 1N9BA 4UAAA 3O3VA 1BLHA 1N4OA 4GKUA 4JLFA 5GL9A 2DRWA 3B3XA 3HLFA 1Y54A 4KZ7A 3IHBA 2HP9A 1BSGA 1RGZA 2H5SA 3FYZA 5G18A 2HDQA 4CPKA 3VP4A 4N92A 1NRFA 3ZHHA 1NYYA 3PBNA 1I2SA 4X56A 3ZG8B 3HBRA 4BJPA 2Z2LB 5BOHA 1JTGA 1K56D 3V39A 2WKEA 4KG2A 3NDEA 5HAIA 5GLDA 3HLDA 5EUAA 3BFCA 3HLCA 5JYOA 2JBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LLB A;  3PTE A;  4OH0 A;  4EV4 A;  2WKI A;  2ZQ8 A;  3N8R A;  5CHJ A;  1IKG A;  3NBL A;  4RVA A;  4JXV A;  3FV7 A;  3WS5 A;  4BD0 A;  4DXC A;  1W7F A;  1PW1 A;  1VQQ A;  1ERQ A;  2ZQ9 A;  1LHY A;  4KZ8 A;  3MKE A;  4OQI A;  4DE2 A;  1M6K A;  3IF6 A;  4DE0 A;  1PIO A;  1E25 A;  1FCN A;  3LY4 A;  1PYY A;  4OON A;  1G6A A;  5F1G A;  1I2W A;  2FFF B;  2RL3 A;  3IHA A;  5FI6 A;  5TFQ A;  4PM5 A;  3QNC A;  5HAR A;  1XA1 A;  1KE4 A;  4LCM A;  4NK3 A;  1CK3 A;  2Q9N A;  3AGD A;  2V2F F;  3DWK A;  1IEM A;  3Q7V A;  4XUX A;  5HAQ A;  3BFE A;  4S2M A;  3E2L A;  3ITA A;  4UA7 A;  5A90 A;  1NZU A;  1K6S A;  3PBR A;  3ZCZ A;  4QJG A;  4B4Z A;  3OZH A;  4WMC A;  4PM9 A;  1ES2 A;  3UY6 A;  3NC8 A;  3ZGA B;  3UO9 A;  1FR6 A;  4KG6 A;  1XKZ A;  4HES A;  2Y55 A;  5DTS A;  2JC7 A;  2IWC A;  4WZ5 A;  3A3F A;  1L2S A;  5A92 A;  4N9K A;  4JXW A;  1MY8 A;  4YIN A;  3BLS A;  1HTZ A;  2XEP A;  3M2J A;  5DTT A;  2DNS A;  4KQO A;  1G68 A;  4EWF A;  1C3B A;  2VGJ A;  4JF5 A;  3OPL A;  4X53 A;  3SH9 A;  3IF5 A;  3IXH A;  3M6H A;  1W79 A;  3FZC A;  3UDI A;  3WRT A;  4IBX A;  3Q7Z A;  5AQ9 A;  4S2N A;  5CHU A;  4E3J A;  3ZDJ A;  1TDL A;  4Q8I A;  3VFF A;  5CER A;  4R1G A;  2Y2K A;  4ZJ3 A;  2PU2 A;  4X69 A;  4U0T A;  3IT9 A;  4OOL A;  1KVL A;  4KG5 A;  3RJU A;  2WAD A;  2WUQ A;  3BFF A;  1K54 C;  2WKH A;  2UWX A;  1KE3 A;  1FSY A;  3W4Q A;  4ZDX A;  3ZG5 A;  4LV3 A;  4B4X A;  3VP2 A;  1PWG A;  1ZC2 A;  2QMI A;  4BLM A;  3G31 A;  4UHU A;  1MWS A;  1NZO A;  3HRE A;  1IYO A;  1Q2P A;  1ES5 A;  4JBF A;  4QD4 A;  4HEF A;  1HVB A;  1IEL A;  2X01 A;  3BRM A;  3IQA A;  5HAP A;  1MXO A;  4Y0T A;  2ZQA A;  4MLL A;  3OCN A;  2OLV A;  2CC1 A;  3M2K A;  4PM8 A;  5EVL A;  3G30 A;  2R9X A;  4IBR A;  1CEG A;  2J8Y A;  1H5X A;  1M40 A;  1E3U D;  3A3D A;  1ALQ A;  3OC2 A;  1K25 A;  1BLP A;  3BFG A;  3DW0 A;  3TOI A;  2EXA A;  3IWO A;  3PAE A;  3HLB A;  2FFY A;  3ZVT A;  1KGE A;  2Q9M A;  3G2Z A;  3N4I A;  4PM7 A;  5TR7 A;  4P87 A;  1ZG6 A;  1IYP A;  4GD6 A;  3VP0 A;  5A91 A;  5KSH A;  4N1H A;  5HW3 A;  3CG5 A;  5CTN A;  1PWC A;  1TEM A;  2XGN A;  3O86 A;  4KZA A;  3W4O A;  4RYE A;  1LL5 A;  4NET A;  1WYB A;  2RCX A;  5FI2 A;  5F82 A;  1BT5 A;  2OLU A;  1VM1 A;  3D4F A;  4S2J A;  1YLW A;  4WEJ A;  4WEK A;  5F83 A;  1L0F A;  2HP6 A;  1ZKJ A;  2EX9 A;  2ZMA A;  4QY5 A;  5E2H A;  4S2I A;  2ZC5 B;  2XLN A;  1YLJ A;  3OCL A;  4X6T A;  2OV5 A;  3PBS A;  3OPH A;  3UPN A;  4DF6 A;  5E2G A;  4DE1 A;  5FI7 A;  1FQG A;  2XFT A;  1FOF A;  2Y2P A;  3NCK A;  1HZO A;  3TSG A;  5IHV A;  1JWV A;  4OP5 A;  5E2F A;  1PZP A;  1GCE A;  4ZJ2 A;  3ZNY A;  2HPB A;  2I72 A;  1XXM A;  1WE4 A;  5FQK A;  1U60 A;  3GSG A;  5CHM A;  2JCH A;  5JYP A;  1QMF A;  4LV1 A;  5EE8 A;  3HLG A;  3UDX A;  2A3U A;  3AGF A;  2X02 A;  5FQM A;  2H0T A;  4E3M A;  3EQV A;  5DF8 A;  2G2U A;  5CTM A;  3LEZ A;  1BZA A;  4JXS A;  4K91 A;  4IVI A;  1PW8 A;  5AQB A;  5CEC A;  3G4P A;  3VP1 A;  3GRJ A;  3NDG A;  1KGG A;  3V5M A;  3P09 A;  4DE3 A;  4C3Q A;  3PBT A;  3W8K A;  3RXX A;  1FCM A;  2JE5 A;  3UE0 A;  4QHC A;  4PMA A;  1RCJ A;  4FD8 A;  3PBO A;  4DDS A;  5I94 A;  1H8Y A;  1CI9 A;  3MZF A;  2DCF A;  3Q07 A;  3C5A A;  3LY3 A;  5FDH A;  1O7E A;  2XDM A;  2A49 A;  4S2K A;  4GB7 A;  2EXB A;  3SS3 A;  3MBZ A;  4GD8 A;  4XUZ A;  2Y2J A;  4WZ4 A;  1K54 A;  3MXR A;  2WZX A;  2ZD8 A;  3GVB A;  5J8X A;  3BM6 A;  1JTD A;  2WK0 A;  1SDN A;  3G34 A;  2ZQC A;  4KZ4 A;  1GHP A;  4OPZ A;  4Y7P A;  3DTM A;  3N7W A;  4YFM A;  3UE1 A;  1S6R A;  4X55 A;  3GR2 A;  3MZE A;  5GLC A;  3Q81 A;  2P74 A;  5GLB A;  2ZC3 B;  4WYY A;  1YLP A;  5A93 A;  4P6B A;  4GDB A;  4R0Q A;  2J7V A;  3N6I A;  2IWB A;  3WS0 A;  3ZG0 A;  5EOO A;  2QZ6 A;  4OLD A;  5FAT A;  1TDG A;  3I7J A;  3MKF A;  1S0W A;  1NJ4 A;  1AXB A;  1XGJ A;  1HD8 A;  5DF9 A;  1W8Q A;  3M6B A;  4LCL A;  5EVI B;  1IYS A;  3C7U A;  3E2K A;  5DTK A;  1WYC A;  4HBU A;  2EFX A;  1SDE A;  3FKV A;  3IWI A;  3G35 A;  3NIA A;  4E3K A;  4E6W A;  1LI9 A;  4U0X A;  4EBL A;  2XH9 A;  1ONH A;  1PI5 A;  2ZM0 A;  1JWP A;  2BLS A;  3C7V A;  4OQ0 A;  1ERM A;  3MXS A;  4E3N A;  1NXY A;  1YLT A;  3GQZ A;  4GDN A;  1E3U A;  3C4P A;  4UA6 A;  2VGK A;  5FAO A;  2WYX A;  1MWR A;  2HDR A;  3UPO A;  3QHY A;  2V20 A;  2C6W B;  4FSF A;  3DWZ A;  5GHZ A;  1Q2Q A;  3IH9 A;  1NY0 A;  1BLS A;  1K38 A;  4GNU A;  4L0L A;  4C6Y A;  2H10 A;  1ERO A;  4KZ6 A;  3ZVW A;  3VSK A;  3QNB A;  4WEL A;  1L0E A;  4N1X A;  1PWD A;  1XPB A;  4KZB A;  3CMZ A;  2HDU A;  4DDY A;  1DJA A;  5EPH A;  3O88 A;  4OPQ A;  4OPR A;  5KZH A;  3WRZ A;  1J9M A;  1ZG4 A;  3VMA A;  1QME A;  2EX8 A;  3IWQ A;  5DVA A;  4GOG A;  2HDS A;  2ZM8 A;  4IVK A;  2XFS A;  1LL9 A;  1LI0 A;  2Y2H A;  4RX3 A;  4LV2 A;  2Y2G A;  3NY4 A;  5GHY A;  1W8Y A;  3LCE A;  3LO7 A;  4B88 A;  2R9W A;  3ZNT A;  4QY6 A;  3IXB A;  3P98 A;  1BTL A;  5CRF A;  2WGW B;  3IXG A;  1RP5 A;  4ID4 A;  1SCW A;  2WZZ A;  3V3S A;  5KMW A;  3UNW A;  3GV9 A;  1O07 A;  3HUM A;  4R3J A;  1DY6 A;  2Y2M A;  4MBF A;  4N9L A;  5GLA A;  4S2L A;  4E3L A;  1GA0 A;  5FQQ A;  1K55 C;  1IYQ A;  5FQ9 A;  4DKI A;  5L2F A;  3WWX A;  1MBL A;  1FSW A;  1BUL A;  3VOY A;  4RA7 A;  3G2Y A;  1BLC A;  2B5R A;  3Q1F A;  3SS5 A;  4U3T A;  4KEN B;  1K57 C;  4UA9 A;  4ZAM A;  4WM9 A;  4M3K A;  4Y0U A;  3N8L A;  4WBG A;  2X71 A;  3CJM A;  4P85 A;  4BEN A;  1MWU A;  1NYM A;  2G2W A;  3OPR A;  1CEF A;  1EWZ A;  5TGF A;  2XQZ A;  4LEN A;  4GN2 A;  5EOE A;  4KQQ A;  2Y91 A;  4FH4 A;  4OOY A;  1K4F A;  1TVF A;  4EUZ A;  4PPR A;  1KVM A;  5HL1 A;  2ZC4 B;  4OP8 A;  4C75 A;  1YMX A;  3N8S A;  2OSU A;  4JXG A;  5CXW A;  4R23 A;  2E8I A;  5FAP A;  1DJB A;  4DXB A;  3WS4 A;  1XX2 A;  3A3J A;  1PZO A;  5HFO A;  1MWT A;  4BL2 A;  3SOI A;  1K6R A;  3TG9 A;  3VP3 A;  4EQI A;  1YLZ A;  4K0X A;  3ISG A;  3GTC A;  5FAQ A;  3EQU A;  5FSR A;  3V3R A;  3UN7 A;  1E4D A;  2J9P A;  2WAF A;  4QB8 A;  3VOZ A;  4OKP A;  2GDN A;  1XA7 A;  1GHM A;  3C4O A;  1Z6F A;  3S1Y A;  4GZB A;  1BUE A;  2WGV A;  3FKW A;  5EVI A;  1JWZ A;  1YLY A;  1MKI A;  2P9V B;  3SH7 A;  1L0G A;  4MBK A;  1JVJ A;  1CI8 A;  3S4X A;  4JKT A;  1ES3 A;  3SH8 A;  4OLG A;  3ZG9 B;  4HBT A;  4R3B A;  1ESU A;  4ZBE A;  3BEB A;  4OQG A;  5CEB A;  5FQI A;  2XR0 A;  3WS1 A;  2WGI A;  2EFU A;  4FH2 A;  4F94 A;  3ZG7 B;  5CGX A;  5EVI D;  2ZC6 B;  2IWD A;  1I5Q A;  2QPN A;  3AGE A;  2ZLY A;  3A3E A;  3UDF A;  4RX2 A;  3G32 A;  3VSL A;  2Y2N A;  4MBH A;  3BLM A;  3VFH A;  4E3I A;  5M1A A;  2XD1 A;  1XP4 A;  2J9O A;  5EEC A;  2Y59 A;  3CZD A;  1IKI A;  4R4S A;  4S2P A;  3BYD A;  5EVI C;  3HUN A;  3O87 A;  5HX9 A;  4R4R A;  1ESI A;  3GMW A;  4KQR A;  1FR1 A;  1FCO A;  2ZJ9 A;  3ZFZ A;  4JF6 A;  3IH8 A;  5M19 A;  5CGS A;  3UPP A;  4KZ5 A;  2PU4 A;  2ZQD A;  4D2O A;  2EX6 A;  4S2O A;  3FWL A;  4Y0O A;  5AQA A;  1ES4 A;  2BG1 A;  4FCF A;  5FQJ A;  3IF6 B;  5FA7 A;  1KGF A;  4WMC D;  5DF7 A;  5CED A;  5KSC A;  4LV0 A;  4EBN A;  2XK1 A;  4ZTK A;  3IF6 C;  3V50 A;  2WGW A;  2XF3 A;  3Q82 A;  4OPY A;  3Q7V B;  2EX2 A;  2H0Y A;  2Y2L A;  1K55 A;  5CGW A;  3HLW A;  4E3O A;  4JF4 A;  1DJC A;  1KDS A;  1OME A;  3MZD A;  1SHV A;  3JYI A;  5E2E A;  3RXW A;  4CJN A;  5FAS A;  3IXD A;  3SS4 A;  4BQM A;  4IED A;  5GHX A;  1K57 A;  3PAG A;  2ZC7 A;  1L0D A;  4XXR A;  5E43 A;  3HUO A;  4A5R A;  4OQH A;  4P0M A;  4WZ5 C;  2V1Z A;  5AQ7 A;  1YT4 A;  2XD5 A;  3ITB A;  5M18 A;  1YM1 A;  3S22 A;  1XGI A;  3PBQ A;  4PM6 A;  3W4P A;  4KZ9 A;  1YQS A;  4QU3 A;  4BD1 A;  2Y4A A;  5F1F A;  4Z9Q A;  2HP5 A;  3BFD A;  3OPP A;  4ZJ1 A;  4DRT A;  2Y2O A;  4K0W A;  4S2N C;  1EI5 A;  3UE3 A;  1K4E A;  2ZQ7 A;  5U47 A;  3A3I A;  1GHI A;  3NI9 A;  3MFD A;  4H8R A;  4JPM A;  4EBP A;  4OOM A;  3WS2 A;  1ONG A;  4E6X A;  1SKF A;  1KE0 A;  1RGY A;  4O7D A;  2ZM2 A;  2Y2I A;  1PI4 A;  2Z2M B;  2P9V A;  2WAE A;  1GA9 A;  3HL9 A;  2C5W B;  1H8Z A;  1KDW A;  4MEZ A;  1MPL A;  4OVD A;  4MNR A;  5D3O A;  3BEC A;  1K56 A;  1YMS A;  4X68 A;  2Y2Q A;  3HLE A;  1W5D A;  4KZ3 A;  3HVF A;  4BL3 A;  2PBY A;  1N9B A;  4UAA A;  3O3V A;  1BLH A;  1N4O A;  4GKU A;  4JLF A;  5GL9 A;  2DRW A;  3B3X A;  3HLF A;  1Y54 A;  4KZ7 A;  3IHB A;  2HP9 A;  1BSG A;  1RGZ A;  2H5S A;  3FYZ A;  5G18 A;  2HDQ A;  4CPK A;  3VP4 A;  4N92 A;  1NRF A;  3ZHH A;  1NYY A;  3PBN A;  1I2S A;  4X56 A;  3ZG8 B;  3HBR A;  4BJP A;  2Z2L B;  5BOH A;  1JTG A;  1K56 D;  3V39 A;  2WKE A;  4KG2 A;  3NDE A;  5HAI A;  5GLD A;  3HLD A;  5EUA A;  3BFC A;  3HLC A;  5JYO A;  2JBF A; 
#chains in the Genus database with same CATH topology
 1LLB A;  3PTE A;  1OTA A;  3E4O A;  2WKI A;  4HQA A;  4XT2 A;  3N8R A;  2R78 A;  1IKG A;  4DN0 A;  4PAU A;  1W7F A;  1VQQ A;  1ERQ A;  2ZQ9 A;  1LHY A;  3MKE A;  2A24 A;  1M6K A;  1PIO A;  1E25 A;  1G6A A;  1KE4 A;  2HV1 A;  1IEM A;  3E2L A;  3ITA A;  3PBR A;  3ZCZ A;  3K3C A;  3OZH A;  4NXG A;  3UY6 A;  5DTS A;  2JC7 A;  2IA2 A;  4NG2 A;  3A3F A;  1GSX A;  1MY8 A;  3PXP A;  1C3B A;  2VGJ A;  4X53 A;  1FIK A;  3M6H A;  1W79 A;  3MQ0 A;  1S1Z A;  4Y17 A;  3WRT A;  3Q7Z A;  2Z6D A;  1TDL A;  2OAP 1;  3VFF A;  4R1G A;  2P04 A;  2XA7 S;  1ZTU A;  2NUT C;  4WF0 A;  3VP2 A;  1ZC2 A;  1MWS A;  3F1N B;  3HRE A;  1IYO A;  2M1C A;  1ES5 A;  5HWV A;  1KOU A;  2X01 A;  4WL9 A;  4G3K A;  2ZMF A;  4Y0T A;  5EVL A;  2R9X A;  1ALQ A;  2PD8 A;  1BLP A;  3DW0 A;  4X1L A;  3ZVT A;  2PHY A;  3N4I A;  5TR7 A;  1IYP A;  4GD6 A;  3VP0 A;  5A91 A;  5KSH A;  5CTN A;  1PWC A;  3W4O A;  2W27 A;  1WYB A;  4HY8 A;  3D9Y A;  1UWP X;  1BT5 A;  2OLU A;  4EU0 A;  3D4F A;  2JKR I;  5HDC A;  1YLW A;  4WEJ A;  5F83 A;  1L0F A;  2ZMA A;  3QP2 A;  5E2H A;  4O8G A;  4Q0H A;  2P08 A;  3PBS A;  2OV5 A;  3E4P A;  5FI7 A;  1FQG A;  3NCK A;  3UE6 A;  1JWV A;  4OP5 A;  1NLY A;  1PZP A;  4RQ9 A;  5FEF A;  1U60 A;  3CPT A;  3GSG A;  4HJ4 A;  4E3M A;  5CTM A;  3VV4 A;  2L0W A;  4JXS A;  3IX3 A;  5CEC A;  3VP1 A;  1KGG A;  2V0W A;  3P09 A;  3PBT A;  3UE0 A;  2O99 A;  3PBO A;  4GHI B;  4DDS A;  2DMW A;  3C5A A;  5FDH A;  2XDM A;  2HF6 A;  4GB7 A;  2EXB A;  3BM6 A;  1SDN A;  1GHP A;  3N7W A;  2JN7 A;  3MZE A;  4BBU A;  2W3H A;  4P6B A;  4GDB A;  3WS0 A;  4FTX A;  2QZ6 A;  4ESP A;  1TDG A;  3MKF A;  1NJ4 A;  1XGJ A;  4LCL A;  1WYC A;  3FKV A;  3R7W A;  4JGR A;  2ZM0 A;  2BLS A;  2KLI A;  2KDK A;  1NXY A;  4WUJ A;  3GQZ A;  1E3U A;  5FAO A;  4FSF A;  1Q2Q A;  1NY0 A;  4R6L A;  4DJ2 A;  1AWI A;  4GNU A;  5EV0 A;  3ZVW A;  4WEL A;  1L0E A;  1PWD A;  1XPB A;  2W3G A;  2HDU A;  1DJA A;  3CIT A;  2ZM8 A;  4RX3 A;  2XFS A;  2Y2H A;  2INW A;  4HOI A;  3IS2 A;  4GS9 B;  3JVU A;  3K2N A;  3ZNT A;  4HJ3 A;  2WGW B;  4ID4 A;  1SCW A;  3V3S A;  5KMW A;  3UB6 A;  3UNW A;  3GV9 A;  3U2A A;  1O07 A;  1DY6 A;  4MBF A;  4N9L A;  5FQ9 A;  1BUL A;  5L8M A;  4RA7 A;  3T4K A;  1BLC A;  1K57 C;  1OT6 A;  4M3K A;  1VEU B;  1NYM A;  1ODV A;  1WA9 A;  1TVF A;  3B33 A;  5F68 A;  3N8S A;  4CLC E;  3T4L A;  3OBF A;  1DJB A;  1XX2 A;  3A3J A;  1MWT A;  3A0V A;  3SOI A;  3TG9 A;  3VP3 A;  4Y13 A;  3GTC A;  1E4D A;  3VOZ A;  2GDN A;  1Y28 A;  4IUK A;  3C4O A;  3FC7 A;  3S1Y A;  1BUE A;  2O9B A;  1S1Y A;  3PYP A;  3SH7 A;  3MQO A;  2VX8 A;  1CI8 A;  5J3W A;  3SH8 A;  3ZG9 B;  4HBT A;  1N9L A;  3BEB A;  3WS1 A;  4Y3I A;  2IWD A;  3AGE A;  4DJ3 A;  3OLO A;  3F1P B;  3UDF A;  5EEC A;  4CLC B;  3BYD A;  3HJI A;  1FCO A;  3KX0 X;  3CUE C;  1XFN A;  4KZ5 A;  2PU4 A;  3BWL A;  3P7N A;  1ES4 A;  1MZU A;  1TD5 A;  2A24 B;  4I3J A;  4WMC D;  5DF7 A;  5CED A;  2XK1 A;  1XJ3 A;  4OPY A;  5HZH A;  3NOU C;  4LFU A;  4JF4 A;  3JYI A;  5E2E A;  4IED A;  1K57 A;  4EEP A;  2V0U A;  3IBR A;  4XXR A;  5E43 A;  1F98 A;  5AQ7 A;  2XD5 A;  4HP4 A;  3ITB A;  5M18 A;  5DJT A;  3S22 A;  3PBQ A;  3C2W A;  4BD1 A;  5F1F A;  3LIF A;  1F5M A;  4S2N C;  2EA9 A;  2JKG A;  1H0M A;  5K5B A;  3MFD A;  4JPM A;  3WS2 A;  4E6X A;  5G4Y A;  1JNU A;  1Z09 A;  1GA9 A;  2P9V A;  4Y5F A;  3C8C A;  1KDW A;  5D3O A;  5DKK A;  1YMS A;  2Y2Q A;  2ZMV A;  1W5D A;  2PYP A;  4BL3 A;  2PBY A;  4GKU A;  1N4O A;  5GL9 A;  2BAS A;  3QP8 A;  4KZ7 A;  5G18 A;  2HP9 A;  1PNE A;  2VV7 A;  3PBN A;  3HBR A;  5BOH A;  2HGV A;  2WKE A;  4KG2 A;  3NJA A;  5GLD A;  3LIC A;  3BFC A;  4D60 A;  3CUE A;  1DP8 A;  4EV4 A;  2OAQ 1;  5CHJ A;  4RVA A;  4R70 A;  4JXV A;  2JKR M;  1PW1 A;  1ZHH B;  4WLA A;  4DE2 A;  2JHE A;  3KSH A;  4OON A;  3LY4 A;  1I2W A;  2FFF B;  1XA1 A;  3NOP C;  4NK3 A;  1CK3 A;  2Q9N A;  3DWK A;  5HAQ A;  3T4Q A;  3CPT B;  4UA7 A;  1K6S A;  4QJG A;  4B4Z A;  2PR6 A;  2O9C A;  1LSW A;  5LBR A;  3ZGA B;  4KG6 A;  4HES A;  2Y55 A;  3CAX A;  2IWC A;  1L2S A;  3M2J A;  2DNS A;  1G68 A;  2JKF A;  4JF5 A;  3SH9 A;  2M7V A;  4IBX A;  1CJF A;  4S2N A;  5CHU A;  2QJ7 A;  2QWS A;  5CER A;  4ZJ3 A;  3HJK A;  4U0T A;  3IT9 A;  4OOL A;  3RJU A;  3BFF A;  2WKH A;  1KE3 A;  4NXF A;  1FSY A;  4ZDX A;  2OOL A;  2QMI A;  3LI8 A;  3G31 A;  3T12 B;  4H6J A;  3IQA A;  1SKO A;  3R7W B;  1CEG A;  2J8Y A;  3VE3 A;  3BFG A;  5EM1 A;  3IWO A;  3HLB A;  3KYQ A;  1KGE A;  3G2Z A;  4PM7 A;  1XJ2 A;  4II7 A;  5HW3 A;  1TEM A;  3O86 A;  3H82 A;  5FI2 A;  4BBV A;  2EX9 A;  1YLJ A;  2QYB A;  4DF6 A;  4DE1 A;  2KOI A;  3MFX A;  2XFT A;  5F5Y A;  1HZO A;  5IHV A;  1GCE A;  4ZJ2 A;  3IS2 B;  1V9Y A;  5FQK A;  2A3U A;  3EQV A;  4M4X A;  1BZA A;  3JPU A;  4K91 A;  4Y2F A;  4YWZ A;  2VGL S;  3ZYT A;  3NDG A;  3V5M A;  3RFB A;  1FCM A;  2VLG A;  5I94 A;  3Q07 A;  3SW1 A;  5IT5 A;  1HLU P;  3LY3 A;  1O7E A;  3VE4 A;  3MBZ A;  2Y2J A;  3TJZ C;  2ZD8 A;  5J8X A;  4YFM A;  3GEC A;  2W1T A;  2B18 A;  5GLB A;  4WYY A;  1YLP A;  4R0Q A;  3GDI A;  2J7V A;  5FAT A;  4PHT A;  2I9V A;  1S0W A;  1HD8 A;  2ZL1 A;  5DF9 A;  3D3O A;  2VZW A;  4NXB A;  1SDE A;  4YOF A;  3NIA A;  1LI9 A;  4U0X A;  3LIE A;  3LFV A;  2YKH A;  1YLT A;  3UPO A;  1MWR A;  2HDR A;  3QHY A;  2C6W B;  3MR0 A;  3UME A;  3EWK A;  2VV8 A;  4L0L A;  4C6Y A;  1ERO A;  4KZ6 A;  5FEG A;  4HIA A;  3CMZ A;  2E8J A;  1OT9 A;  3WRZ A;  1J9M A;  1ZG4 A;  4HHD A;  3VMA A;  3MMH A;  2EX8 A;  3IWQ A;  2HDS A;  4IVK A;  3BW6 A;  4LV2 A;  3NY4 A;  5GHY A;  1W8Y A;  3B47 A;  3LCE A;  3LO7 A;  2R9W A;  4JGP A;  1NLZ A;  3HUM A;  4R3J A;  3G6O A;  4S2L A;  4E3L A;  1GA0 A;  5FQQ A;  1IYQ A;  5L2F A;  4X25 A;  1MBL A;  4HJ6 A;  4U3T A;  4KEN B;  4ZAM A;  4PKY G;  4LRZ E;  3CJM A;  2G2W A;  3OPR A;  5TGF A;  2B95 A;  2KX6 A;  3EEH A;  5EOE A;  2WKR A;  3QP4 A;  2Y91 A;  3K3D A;  4EUZ A;  3A0R A;  2ZC4 B;  5HWW A;  4YNR A;  1XJ4 A;  5FAP A;  5HD5 A;  4DXB A;  4BL2 A;  1K6R A;  1YLZ A;  3O5Y A;  2J3T D;  3V3R A;  5FAQ A;  2J9P A;  4I3A A;  2WAF A;  3QP1 A;  4QB8 A;  4KUO A;  1JWZ A;  1T1B A;  2P9V B;  1CF0 A;  4HH3 A;  1L0G A;  3RTY A;  3MXQ A;  4JKT A;  4EW7 A;  1ES3 A;  1XJ6 A;  4OQG A;  1IOU A;  4GLQ A;  5FQI A;  4UQI M;  3CWF A;  3LR3 A;  2QPN A;  2ZLY A;  1DRM A;  3A3E A;  4RX2 A;  2Y2N A;  3VFH A;  2XD1 A;  1XP4 A;  2J9O A;  4EEU A;  2W3E A;  1IKI A;  3KSG A;  4R4S A;  4NKP A;  3HUN A;  4R4R A;  2W0N A;  4P6Z M;  4KQR A;  3ZFZ A;  1YPR A;  3EGD C;  1W63 M;  4Z1W A;  1YSP A;  4HNB A;  4FCF A;  2BG1 A;  5FQJ A;  3L9K A;  3QP5 A;  2J80 A;  4LV0 A;  3Q82 A;  2EX2 A;  5G4Z A;  2WKQ A;  2Y2L A;  2V9A A;  3HLW A;  4EQ1 A;  3IXD A;  2ZC7 A;  3SZT A;  4A5R A;  3MJQ A;  4OQH A;  4P0M A;  2V1Z A;  3DAV A;  4QU3 A;  2HP5 A;  1LL8 A;  5I5L A;  4K0W A;  4FOF A;  3UE3 A;  1K4E A;  2V1A A;  4KQD A;  3A3I A;  2PAV P;  4H8R A;  4Y15 A;  4OOM A;  1SKF A;  2HJ9 C;  4H6J B;  4QPR A;  4Q0I A;  2C5W B;  1H8Z A;  4F3L A;  1S4R A;  4OVD A;  2K7S A;  1SKO B;  1K56 A;  4X68 A;  3O3V A;  1BLH A;  3ICY A;  3B3X A;  3CHW P;  1BSG A;  4CPK A;  3VP4 A;  3ZHH A;  1I2S A;  2XRO A;  5AVF A;  1K56 D;  3H82 B;  3NDE A;  5C5K A;  3HLD A;  4B88 A;  5EM0 A;  2JBF A;  5JYO A;  3DTK A;  4OH0 A;  3T1R A;  2EWW A;  1TS8 A;  1MKM A;  3WS5 A;  1T19 A;  4L9E A;  4DXC A;  4OQI A;  3TW8 A;  4DE0 A;  3C30 A;  1N9O A;  4LGW A;  1FCN A;  1PYY A;  4UQI S;  3IHA A;  5FI6 A;  5TFQ A;  4XUX A;  5IS1 A;  4S2M A;  1NZU A;  1A0K A;  4WMC A;  4PM9 A;  2YKF A;  4L9G A;  1XKZ A;  2O9A A;  4XT2 B;  5A92 A;  4N9K A;  4JXW A;  2PDR A;  5EFW A;  5DTT A;  4EWF A;  3IF5 A;  3IXH A;  2PYR A;  3FZC A;  2PR5 A;  3UDI A;  4MN7 A;  5AQ9 A;  5AVE A;  1W63 Q;  1GSW A;  2OWH A;  3E0Y A;  3LEQ A;  2ACG A;  2EWV A;  4KG5 A;  3TRC A;  4Q0J A;  2WUQ A;  2W1T B;  2UWX A;  4B4X A;  1G28 A;  1NZO A;  4JBF A;  1HVB A;  3BRM A;  2ZL1 B;  5HAP A;  1MXO A;  3FPW A;  4ETZ A;  1LT0 A;  2OLV A;  2CC1 A;  3M2K A;  4MN6 A;  4PM8 A;  3G30 A;  4IBR A;  3A3D A;  1K25 A;  1VB6 A;  2EXA A;  4O0P A;  2FFY A;  4E04 A;  2Q9M A;  1F2K A;  2GNX A;  1PRQ A;  4WN5 A;  4P87 A;  4ME4 A;  5DKL A;  1ZG6 A;  3CG5 A;  2XGN A;  4RYE A;  5F82 A;  1VM1 A;  1Y4O A;  3NHQ A;  4S2J A;  3PHY A;  4WEK A;  1H8M A;  3BY8 A;  4QY5 A;  2XLN A;  3OPH A;  3T4T A;  2J3W A;  2Y2P A;  3TSG A;  3LID A;  2HPB A;  2I72 A;  1XXM A;  1WE4 A;  1XFQ A;  5CHM A;  2JCH A;  1QMF A;  4LV1 A;  3HLG A;  3UDX A;  3AGF A;  2X02 A;  5FQM A;  3UB8 A;  5DF8 A;  4HH2 A;  3L7H A;  3R4K A;  1N9N A;  1PW8 A;  3GRJ A;  5AJG A;  3W8K A;  2LB5 A;  4K08 A;  3LGO A;  4QHC A;  3S7P A;  1RCJ A;  1V9Z A;  1H8Y A;  1CI9 A;  3LR5 A;  4S2K A;  3SS3 A;  5CX7 A;  3MXR A;  2WZX A;  3GVB A;  1JTD A;  2WK0 A;  3UE1 A;  3GR2 A;  4MMN A;  2P74 A;  2XSS A;  2IWB A;  3N6I A;  2FH5 A;  5HL6 A;  3I7J A;  1AXB A;  1P9W A;  1W8Q A;  5DTK A;  2EFX A;  3IWI A;  3G35 A;  3T4S A;  3H7W A;  4GW9 A;  1TF1 A;  4EBL A;  2XH9 A;  3KYZ A;  1ONH A;  4LRY C;  3CLO A;  4OQ0 A;  1TS6 A;  3C7V A;  1D06 A;  3MXS A;  3B42 A;  4UA6 A;  2VGK A;  2WYX A;  2V20 A;  1BLS A;  1STZ A;  2XA7 M;  1K38 A;  2H10 A;  3VSK A;  3PR6 A;  4N1X A;  4BWI A;  1T1C A;  5L07 A;  4KZB A;  3P01 A;  5EPH A;  3O88 A;  4OPR A;  1VET A;  5KZH A;  2ZOI A;  5DVA A;  4GOG A;  1LL9 A;  2Y2G A;  3IXB A;  3P98 A;  5CRF A;  5TJJ A;  4JGQ A;  2Y79 A;  3U4L P;  2Y2M A;  3WWX A;  4X1M A;  3BQ8 A;  4EET B;  4PKY A;  1FIL A;  3Q1F A;  1J3W A;  3SS5 A;  4UA9 A;  4HP9 A;  2A2L A;  4WBG A;  4P85 A;  4BEN A;  1MWU A;  1CEF A;  1EWZ A;  3LIB A;  2XQZ A;  4LEN A;  4GN2 A;  3ULF A;  4KQQ A;  3IX8 A;  4FH4 A;  1S66 L;  1K4F A;  1KVM A;  4QWO A;  5FDS A;  1YMX A;  5CXW A;  2OSU A;  4R23 A;  2E8I A;  1PZO A;  5HFO A;  4K0X A;  1D1J A;  3UN7 A;  5IU1 A;  3UMD A;  3UB9 A;  4OKP A;  5F69 A;  1XA7 A;  1GHM A;  2V8C A;  2BTF P;  4GZB A;  2WGV A;  5EVI A;  4BBT A;  4CLC A;  1YLY A;  3JVV A;  1VHM A;  4MBK A;  4F3L B;  3NUL A;  2J3T C;  4OLG A;  2JKT I;  4CQH A;  5CEB A;  2WGI A;  3IX4 A;  4FH2 A;  5EVI D;  2ZC6 B;  4CLC D;  1OTI A;  1TS7 A;  5M1A A;  2L1M A;  4S2P A;  3HCY A;  1NWZ A;  3O87 A;  5HX9 A;  1ESI A;  2H28 A;  2UV0 E;  4JF6 A;  5CGS A;  1YSQ A;  4ARZ A;  2EX6 A;  2P7J A;  3FWL A;  5AQA A;  3T4O A;  4ETX A;  1KGF A;  3BJN A;  1CQA A;  3EGX C;  4ZTK A;  3IF6 C;  3V50 A;  2H0Y A;  1DJC A;  1KDS A;  1OME A;  5FAS A;  4CJN A;  4BQM A;  5MC7 A;  3T4J A;  3KO6 A;  1L0D A;  1OTD A;  3F1O A;  4WZ5 C;  3T1Q B;  2PT7 A;  1DP6 A;  5DJU A;  1YM1 A;  1XGI A;  1YQS A;  2Y4A A;  3BY9 A;  2VV6 A;  4MCW A;  4NXE A;  4DRT A;  2Y2O A;  1T1A A;  1GHI A;  1ONG A;  3V67 A;  1KE0 A;  1RGY A;  4O7D A;  2ZM2 A;  4FUW A;  2Y2I A;  1PI4 A;  2Z2M B;  3EEA A;  1G6O A;  4ZRR A;  3OOV A;  2K2N A;  2VEA A;  4IJG A;  1MPL A;  1G5U A;  4MNR A;  2Z6C A;  3HLE A;  5A8B A;  1P0Z A;  3NOT C;  5F6A A;  2DRW A;  2PBD P;  1GSV A;  2HDQ A;  4N92 A;  4X56 A;  3ZG8 B;  4BJP A;  1JTG A;  3LIA A;  3V39 A;  1S67 L;  5TBM A;  1NRJ A;  5HAI A;  5EUA A;  3DBA A;  2ZQ8 A;  3NBL A;  3FV7 A;  4BD0 A;  2FZ0 A;  3LI9 A;  1OTB A;  5HSQ A;  4KZ8 A;  4G3W A;  2QKP A;  3IF6 A;  3UB5 P;  5F1G A;  3DTE A;  2RL3 A;  4PM5 A;  3QNC A;  5HAR A;  4LCM A;  3AGD A;  2V2F F;  3Q7V A;  3BFE A;  2OWJ A;  5A90 A;  2D02 A;  3ZQ5 A;  1ES2 A;  3NC8 A;  3NEC A;  3KSF A;  3UO9 A;  1FR6 A;  4JGO A;  3KSI A;  4WZ5 A;  4YIN A;  4HI4 A;  3BLS A;  3EOI A;  1HTZ A;  2XEP A;  4KQO A;  3OPL A;  3UB7 A;  1D7E A;  2MJ6 A;  3VOL A;  3A0S A;  2B02 A;  4E3J A;  3LR4 A;  3ZDJ A;  3T1X A;  4Q8I A;  2Y2K A;  1ACF A;  3S7N A;  2PU2 A;  4X69 A;  1KVL A;  2WAD A;  1K54 C;  2VA0 A;  3W4Q A;  3C38 A;  3ZG5 A;  4LV3 A;  1PWG A;  4BLM A;  4UHU A;  1Q2P A;  4QD4 A;  4HEF A;  1IEL A;  2GJ3 A;  1L3L A;  2QJ5 A;  2ZQA A;  4MLL A;  3OCN A;  2GX5 A;  3H7W B;  1H5X A;  1M40 A;  1E3U D;  4I3I A;  5L09 A;  3OC2 A;  4MDZ A;  5DFY A;  3TOI A;  1YKD A;  4IUH A;  3PAE A;  5HD3 A;  3LUQ A;  3MS6 A;  3DTI A;  2VJW A;  4N1H A;  4GJ4 A;  3W2Z A;  4KZA A;  1LL5 A;  4NET A;  1F9I A;  2RCX A;  4MN5 A;  2HP6 A;  1ZKJ A;  4S2I A;  2XRN A;  2ZC5 B;  1TS0 A;  3OCL A;  4X6T A;  1VET B;  3UPN A;  5E2G A;  4EXO A;  1FOF A;  2O0Y A;  5E2F A;  3D72 A;  4DMZ A;  3ZNY A;  1X0O A;  2QHK A;  5JYP A;  4IHQ A;  2W3F A;  3E4Q A;  5EE8 A;  4R3A A;  2H0T A;  3MSH A;  2G2U A;  3LEZ A;  1OTE A;  4IVI A;  5AQB A;  3G4P A;  2G7U A;  4DE3 A;  4C3Q A;  3RXX A;  1UWN X;  2JE5 A;  4PMA A;  1P9R A;  5HDS A;  4FD8 A;  5KIZ A;  4O01 A;  3MZF A;  2DCF A;  3E98 A;  2PRF A;  2A49 A;  1OJG A;  2CMN A;  2W1R A;  4GD8 A;  4XUZ A;  4WZ4 A;  1H3Q A;  1K54 A;  4I38 A;  4LPZ A;  4OPZ A;  3G34 A;  4KZ4 A;  4Y7P A;  2ZQC A;  3DTM A;  2V8F A;  1S6R A;  4X55 A;  3RH8 B;  1SZV A;  5GLC A;  3Q81 A;  2ZC3 B;  5A93 A;  4B93 A;  1DP9 A;  3F1N A;  3FG8 A;  3ZG0 A;  5EOO A;  4P6Z S;  4OLD A;  2NUP C;  1IFQ A;  5EVE A;  5EVI B;  3M6B A;  1IYS A;  3C7U A;  3E2K A;  4HBU A;  5J4E A;  1EW0 A;  4E3K A;  4E6W A;  1PI5 A;  3QP6 A;  1JWP A;  1ERM A;  4E3N A;  4GDN A;  3H9W A;  3C4P A;  1BYW A;  5GHZ A;  3DWZ A;  3IH9 A;  3T50 A;  5J7E A;  2JKT M;  5DFX A;  1PFL A;  3QNB A;  3KYE A;  4KUK A;  4DDY A;  4OPQ A;  4LRX C;  5HWT A;  1QME A;  4ARZ B;  1LI0 A;  2VKS A;  2ZOH A;  4QY6 A;  1BTL A;  3IXG A;  2M7U A;  1RP5 A;  2WZZ A;  2WKP A;  3CI6 A;  1T18 A;  5GLA A;  1K55 C;  4DKI A;  4I39 A;  1FSW A;  1OJ5 A;  5HDD A;  3VOY A;  3G2Y A;  2B5R A;  1K0K A;  3T1S A;  3F1O B;  4WM9 A;  4Y0U A;  2X71 A;  4GHI A;  1LSV A;  4GCZ A;  3LR0 A;  4OOY A;  4PPR A;  3TE8 A;  5HL1 A;  4OP8 A;  4C75 A;  4JXG A;  5L10 A;  5HPF A;  3WS4 A;  4EQI A;  2HJE A;  3ISG A;  5FSR A;  3EQU A;  1Z6F A;  3FKW A;  1MKI A;  1JVJ A;  2VGL M;  4G3V A;  3S4X A;  4UEY A;  4EES A;  2V1B A;  4R3B A;  1ESU A;  4ZBE A;  2XR0 A;  2EFU A;  4F94 A;  3ZG7 B;  3LYX A;  5CGX A;  1I5Q A;  1MC0 A;  5HPI A;  3G32 A;  3VSL A;  4MBH A;  3BLM A;  4E3I A;  3MF0 A;  2Y59 A;  3CZD A;  2GZA A;  5TBM B;  4EER A;  4BMW A;  5EVI C;  4CLC C;  3GMW A;  1FR1 A;  2ZJ9 A;  3IH8 A;  5M19 A;  3UPP A;  2ZQD A;  4D2O A;  1S4S A;  4S2O A;  4Y0O A;  4L9F A;  3IF6 B;  5FA7 A;  4GS9 A;  5KSC A;  4EBN A;  3MQQ A;  2WGW A;  2LB9 A;  2XF3 A;  2Y8H A;  3Q7V B;  1K55 A;  2K31 A;  2ZBB A;  5CGW A;  4E3O A;  3MZD A;  1SHV A;  3RXW A;  3SS4 A;  5GHX A;  3PAG A;  3HUO A;  2L4R A;  1VEU A;  4LLO B;  1P97 A;  3BQA A;  2HZ5 A;  1YAX A;  1YT4 A;  2W3D A;  4PM6 A;  4R38 A;  3W4P A;  4KZ9 A;  4Z9Q A;  3BFD A;  3OPP A;  4ZJ1 A;  1EI5 A;  2AVX A;  2ZQ7 A;  5U47 A;  4EUV A;  3NI9 A;  2PD7 A;  4EBP A;  3S7Q A;  4NEE D;  1LSX A;  3IBJ A;  3S7O A;  2WAE A;  1UGU A;  3HL9 A;  4MEZ A;  3BEC A;  4KZ3 A;  3HVF A;  1N9B A;  1OPX A;  4UAA A;  4JLF A;  2Q0O A;  3HLF A;  1Y54 A;  3IHB A;  1RGZ A;  2H5S A;  3FYZ A;  3F1P A;  4B9O A;  1NRF A;  3FPV A;  1NYY A;  2Z2L B;  2VK3 A;  4AFI A;  4I5S A;  5FL3 A;  2D01 A;  3N8L A;  3HLC A; 
#chains in the Genus database with same CATH homology
 1LLB A;  3PTE A;  4OH0 A;  4EV4 A;  2WKI A;  2ZQ8 A;  3N8R A;  5CHJ A;  1IKG A;  3NBL A;  4RVA A;  4JXV A;  3FV7 A;  3WS5 A;  4BD0 A;  4DXC A;  1W7F A;  1PW1 A;  1VQQ A;  1ERQ A;  2ZQ9 A;  1LHY A;  4KZ8 A;  3MKE A;  4OQI A;  4DE2 A;  1M6K A;  3IF6 A;  4DE0 A;  1PIO A;  1E25 A;  1FCN A;  3LY4 A;  1PYY A;  4OON A;  1G6A A;  5F1G A;  1I2W A;  2FFF B;  2RL3 A;  3IHA A;  5FI6 A;  5TFQ A;  4PM5 A;  3QNC A;  5HAR A;  1XA1 A;  1KE4 A;  4LCM A;  4NK3 A;  1CK3 A;  2Q9N A;  3AGD A;  2V2F F;  3DWK A;  1IEM A;  3Q7V A;  4XUX A;  5HAQ A;  3BFE A;  4S2M A;  3E2L A;  3ITA A;  4UA7 A;  5A90 A;  1NZU A;  1K6S A;  3PBR A;  3ZCZ A;  4QJG A;  4B4Z A;  3OZH A;  4WMC A;  4PM9 A;  1ES2 A;  3UY6 A;  3NC8 A;  3ZGA B;  3UO9 A;  1FR6 A;  4KG6 A;  1XKZ A;  4HES A;  2Y55 A;  5DTS A;  2JC7 A;  2IWC A;  4WZ5 A;  3A3F A;  1L2S A;  5A92 A;  4N9K A;  4JXW A;  1MY8 A;  4YIN A;  3BLS A;  1HTZ A;  2XEP A;  3M2J A;  5DTT A;  2DNS A;  4KQO A;  1G68 A;  4EWF A;  1C3B A;  2VGJ A;  4JF5 A;  3OPL A;  4X53 A;  3SH9 A;  3IF5 A;  3IXH A;  3M6H A;  1W79 A;  3FZC A;  3UDI A;  3WRT A;  4IBX A;  3Q7Z A;  5AQ9 A;  4S2N A;  5CHU A;  4E3J A;  3ZDJ A;  1TDL A;  4Q8I A;  3VFF A;  5CER A;  4R1G A;  2Y2K A;  4ZJ3 A;  2PU2 A;  4X69 A;  4U0T A;  3IT9 A;  4OOL A;  1KVL A;  4KG5 A;  3RJU A;  2WAD A;  2WUQ A;  3BFF A;  1K54 C;  2WKH A;  2UWX A;  1KE3 A;  1FSY A;  3W4Q A;  4ZDX A;  3ZG5 A;  4LV3 A;  4B4X A;  3VP2 A;  1PWG A;  1ZC2 A;  2QMI A;  4BLM A;  3G31 A;  4UHU A;  1MWS A;  1NZO A;  3HRE A;  1IYO A;  1Q2P A;  1ES5 A;  4JBF A;  4QD4 A;  4HEF A;  1HVB A;  1IEL A;  2X01 A;  3BRM A;  3IQA A;  5HAP A;  1MXO A;  4Y0T A;  2ZQA A;  4MLL A;  3OCN A;  2OLV A;  2CC1 A;  3M2K A;  4PM8 A;  5EVL A;  3G30 A;  2R9X A;  4IBR A;  1CEG A;  2J8Y A;  1H5X A;  1M40 A;  1E3U D;  3A3D A;  1ALQ A;  3OC2 A;  1K25 A;  1BLP A;  3BFG A;  3DW0 A;  3TOI A;  2EXA A;  3IWO A;  3PAE A;  3HLB A;  2FFY A;  3ZVT A;  1KGE A;  2Q9M A;  3G2Z A;  3N4I A;  4PM7 A;  5TR7 A;  4P87 A;  1ZG6 A;  1IYP A;  4GD6 A;  3VP0 A;  5A91 A;  5KSH A;  4N1H A;  5HW3 A;  3CG5 A;  5CTN A;  1PWC A;  1TEM A;  2XGN A;  3O86 A;  4KZA A;  3W4O A;  4RYE A;  1LL5 A;  4NET A;  1WYB A;  2RCX A;  5FI2 A;  5F82 A;  1BT5 A;  2OLU A;  1VM1 A;  3D4F A;  4S2J A;  1YLW A;  4WEJ A;  4WEK A;  5F83 A;  1L0F A;  2HP6 A;  1ZKJ A;  2EX9 A;  2ZMA A;  4QY5 A;  5E2H A;  4S2I A;  2ZC5 B;  2XLN A;  1YLJ A;  3OCL A;  4X6T A;  2OV5 A;  3PBS A;  3OPH A;  3UPN A;  4DF6 A;  5E2G A;  4DE1 A;  5FI7 A;  1FQG A;  2XFT A;  1FOF A;  2Y2P A;  3NCK A;  1HZO A;  3TSG A;  5IHV A;  1JWV A;  4OP5 A;  5E2F A;  1PZP A;  1GCE A;  4ZJ2 A;  3ZNY A;  2HPB A;  2I72 A;  1XXM A;  1WE4 A;  5FQK A;  1U60 A;  3GSG A;  5CHM A;  2JCH A;  5JYP A;  1QMF A;  4LV1 A;  5EE8 A;  3HLG A;  3UDX A;  2A3U A;  3AGF A;  2X02 A;  5FQM A;  2H0T A;  4E3M A;  3EQV A;  5DF8 A;  2G2U A;  5CTM A;  3LEZ A;  1BZA A;  4JXS A;  4K91 A;  4IVI A;  1PW8 A;  5AQB A;  5CEC A;  3G4P A;  3VP1 A;  3GRJ A;  3NDG A;  1KGG A;  3V5M A;  3P09 A;  4DE3 A;  4C3Q A;  3PBT A;  3W8K A;  3RXX A;  1FCM A;  2JE5 A;  3UE0 A;  4QHC A;  4PMA A;  1RCJ A;  4FD8 A;  3PBO A;  4DDS A;  5I94 A;  1H8Y A;  1CI9 A;  3MZF A;  2DCF A;  3Q07 A;  3C5A A;  3LY3 A;  5FDH A;  1O7E A;  2XDM A;  2A49 A;  4S2K A;  4GB7 A;  2EXB A;  3SS3 A;  3MBZ A;  4GD8 A;  4XUZ A;  2Y2J A;  4WZ4 A;  1K54 A;  3MXR A;  2WZX A;  2ZD8 A;  3GVB A;  5J8X A;  3BM6 A;  1JTD A;  2WK0 A;  1SDN A;  3G34 A;  2ZQC A;  4KZ4 A;  1GHP A;  4OPZ A;  4Y7P A;  3DTM A;  3N7W A;  4YFM A;  3UE1 A;  1S6R A;  4X55 A;  3GR2 A;  3MZE A;  5GLC A;  3Q81 A;  2P74 A;  5GLB A;  2ZC3 B;  4WYY A;  1YLP A;  5A93 A;  4P6B A;  4GDB A;  4R0Q A;  2J7V A;  3N6I A;  2IWB A;  3WS0 A;  3ZG0 A;  5EOO A;  2QZ6 A;  4OLD A;  5FAT A;  1TDG A;  3I7J A;  3MKF A;  1S0W A;  1NJ4 A;  1AXB A;  1XGJ A;  1HD8 A;  5DF9 A;  1W8Q A;  3M6B A;  4LCL A;  5EVI B;  1IYS A;  3C7U A;  3E2K A;  5DTK A;  1WYC A;  4HBU A;  2EFX A;  1SDE A;  3FKV A;  3IWI A;  3G35 A;  3NIA A;  4E3K A;  4E6W A;  1LI9 A;  4U0X A;  4EBL A;  2XH9 A;  1ONH A;  1PI5 A;  2ZM0 A;  1JWP A;  2BLS A;  3C7V A;  4OQ0 A;  1ERM A;  3MXS A;  4E3N A;  1NXY A;  1YLT A;  3GQZ A;  4GDN A;  1E3U A;  3C4P A;  4UA6 A;  2VGK A;  5FAO A;  2WYX A;  1MWR A;  2HDR A;  3UPO A;  3QHY A;  2V20 A;  2C6W B;  4FSF A;  3DWZ A;  5GHZ A;  1Q2Q A;  3IH9 A;  1NY0 A;  1BLS A;  1K38 A;  4GNU A;  4L0L A;  4C6Y A;  2H10 A;  1ERO A;  4KZ6 A;  3ZVW A;  3VSK A;  3QNB A;  4WEL A;  1L0E A;  4N1X A;  1PWD A;  1XPB A;  4KZB A;  3CMZ A;  2HDU A;  4DDY A;  1DJA A;  5EPH A;  3O88 A;  4OPQ A;  4OPR A;  5KZH A;  3WRZ A;  1J9M A;  1ZG4 A;  3VMA A;  1QME A;  2EX8 A;  3IWQ A;  5DVA A;  4GOG A;  2HDS A;  2ZM8 A;  4IVK A;  2XFS A;  1LL9 A;  1LI0 A;  2Y2H A;  4RX3 A;  4LV2 A;  2Y2G A;  3NY4 A;  5GHY A;  1W8Y A;  3LCE A;  3LO7 A;  4B88 A;  2R9W A;  3ZNT A;  4QY6 A;  3IXB A;  3P98 A;  1BTL A;  5CRF A;  2WGW B;  3IXG A;  1RP5 A;  4ID4 A;  1SCW A;  2WZZ A;  3V3S A;  5KMW A;  3UNW A;  3GV9 A;  1O07 A;  3HUM A;  4R3J A;  1DY6 A;  2Y2M A;  4MBF A;  4N9L A;  5GLA A;  4S2L A;  4E3L A;  1GA0 A;  5FQQ A;  1K55 C;  1IYQ A;  5FQ9 A;  4DKI A;  5L2F A;  3WWX A;  1MBL A;  1FSW A;  1BUL A;  3VOY A;  4RA7 A;  3G2Y A;  1BLC A;  2B5R A;  3Q1F A;  3SS5 A;  4U3T A;  4KEN B;  1K57 C;  4UA9 A;  4ZAM A;  4WM9 A;  4M3K A;  4Y0U A;  3N8L A;  4WBG A;  2X71 A;  3CJM A;  4P85 A;  4BEN A;  1MWU A;  1NYM A;  2G2W A;  3OPR A;  1CEF A;  1EWZ A;  5TGF A;  2XQZ A;  4LEN A;  4GN2 A;  5EOE A;  4KQQ A;  2Y91 A;  4FH4 A;  4OOY A;  1K4F A;  1TVF A;  4EUZ A;  4PPR A;  1KVM A;  5HL1 A;  2ZC4 B;  4OP8 A;  4C75 A;  1YMX A;  3N8S A;  2OSU A;  4JXG A;  5CXW A;  4R23 A;  2E8I A;  5FAP A;  1DJB A;  4DXB A;  3WS4 A;  1XX2 A;  3A3J A;  1PZO A;  5HFO A;  1MWT A;  4BL2 A;  3SOI A;  1K6R A;  3TG9 A;  3VP3 A;  4EQI A;  1YLZ A;  4K0X A;  3ISG A;  3GTC A;  5FAQ A;  3EQU A;  5FSR A;  3V3R A;  3UN7 A;  1E4D A;  2J9P A;  2WAF A;  4QB8 A;  3VOZ A;  4OKP A;  2GDN A;  1XA7 A;  1GHM A;  3C4O A;  1Z6F A;  3S1Y A;  4GZB A;  1BUE A;  2WGV A;  3FKW A;  5EVI A;  1JWZ A;  1YLY A;  1MKI A;  2P9V B;  3SH7 A;  1L0G A;  4MBK A;  1JVJ A;  1CI8 A;  3S4X A;  4JKT A;  1ES3 A;  3SH8 A;  4OLG A;  3ZG9 B;  4HBT A;  4R3B A;  1ESU A;  4ZBE A;  3BEB A;  4OQG A;  5CEB A;  5FQI A;  2XR0 A;  3WS1 A;  2WGI A;  2EFU A;  4FH2 A;  4F94 A;  3ZG7 B;  5CGX A;  5EVI D;  2ZC6 B;  2IWD A;  1I5Q A;  2QPN A;  3AGE A;  2ZLY A;  3A3E A;  3UDF A;  4RX2 A;  3G32 A;  3VSL A;  2Y2N A;  4MBH A;  3BLM A;  3VFH A;  4E3I A;  5M1A A;  2XD1 A;  1XP4 A;  2J9O A;  5EEC A;  2Y59 A;  3CZD A;  1IKI A;  4R4S A;  4S2P A;  3BYD A;  5EVI C;  3HUN A;  3O87 A;  5HX9 A;  4R4R A;  1ESI A;  3GMW A;  4KQR A;  1FR1 A;  1FCO A;  2ZJ9 A;  3ZFZ A;  4JF6 A;  3IH8 A;  5M19 A;  5CGS A;  3UPP A;  4KZ5 A;  2PU4 A;  2ZQD A;  4D2O A;  2EX6 A;  4S2O A;  3FWL A;  4Y0O A;  5AQA A;  1ES4 A;  2BG1 A;  4FCF A;  5FQJ A;  3IF6 B;  5FA7 A;  1KGF A;  4WMC D;  5DF7 A;  5CED A;  5KSC A;  4LV0 A;  4EBN A;  2XK1 A;  4ZTK A;  3IF6 C;  3V50 A;  2WGW A;  2XF3 A;  3Q82 A;  4OPY A;  3Q7V B;  2EX2 A;  2H0Y A;  2Y2L A;  1K55 A;  5CGW A;  3HLW A;  4E3O A;  4JF4 A;  1DJC A;  1KDS A;  1OME A;  3MZD A;  1SHV A;  3JYI A;  5E2E A;  3RXW A;  4CJN A;  5FAS A;  3IXD A;  3SS4 A;  4BQM A;  4IED A;  5GHX A;  1K57 A;  3PAG A;  2ZC7 A;  1L0D A;  4XXR A;  5E43 A;  3HUO A;  4A5R A;  4OQH A;  4P0M A;  4WZ5 C;  2V1Z A;  5AQ7 A;  1YT4 A;  2XD5 A;  3ITB A;  5M18 A;  1YM1 A;  3S22 A;  1XGI A;  3PBQ A;  4PM6 A;  3W4P A;  4KZ9 A;  1YQS A;  4QU3 A;  4BD1 A;  2Y4A A;  5F1F A;  4Z9Q A;  2HP5 A;  3BFD A;  3OPP A;  4ZJ1 A;  4DRT A;  2Y2O A;  4K0W A;  4S2N C;  1EI5 A;  3UE3 A;  1K4E A;  2ZQ7 A;  5U47 A;  3A3I A;  1GHI A;  3NI9 A;  3MFD A;  4H8R A;  4JPM A;  4EBP A;  4OOM A;  3WS2 A;  1ONG A;  4E6X A;  1SKF A;  1KE0 A;  1RGY A;  4O7D A;  2ZM2 A;  2Y2I A;  1PI4 A;  2Z2M B;  2P9V A;  2WAE A;  1GA9 A;  3HL9 A;  2C5W B;  1H8Z A;  1KDW A;  4MEZ A;  1MPL A;  4OVD A;  4MNR A;  5D3O A;  3BEC A;  1K56 A;  1YMS A;  4X68 A;  2Y2Q A;  3HLE A;  1W5D A;  4KZ3 A;  3HVF A;  4BL3 A;  2PBY A;  1N9B A;  4UAA A;  3O3V A;  1BLH A;  1N4O A;  4GKU A;  4JLF A;  5GL9 A;  2DRW A;  3B3X A;  3HLF A;  1Y54 A;  4KZ7 A;  3IHB A;  2HP9 A;  1BSG A;  1RGZ A;  2H5S A;  3FYZ A;  5G18 A;  2HDQ A;  4CPK A;  3VP4 A;  4N92 A;  1NRF A;  3ZHH A;  1NYY A;  3PBN A;  1I2S A;  4X56 A;  3ZG8 B;  3HBR A;  4BJP A;  2Z2L B;  5BOH A;  1JTG A;  1K56 D;  3V39 A;  2WKE A;  4KG2 A;  3NDE A;  5HAI A;  5GLD A;  3HLD A;  5EUA A;  3BFC A;  3HLC A;  5JYO A;  2JBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...