4D2OA

Crystal structure of the class a extended-spectrum beta-lactamase per- 2
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
280
structure length
277
Chain Sequence
AQSPLLKEQIETIVTGKKATVGVAVWGPDDLEPLLLNPFEKFPMQSVFKLHLAMLVLHQVDQGKLDLNQSVTVNRAAVTWSPMMKDHQGDEFTVAVQQLLQYSVSHSDNVACDLLFELVGGPQALHAYIQSLGVKEAAVVANEAQMHADDQVQYQNWTSMKAAAQVLQKFEQKKQLSETSQALLWKWMVETTTGPQRLKGLLPAGTIVAHKTGTSGVRAGKTAATNDAGVIMLPDGRPLLVAVFVKDSAESERTNEAIIAQVAQAAYQFELKKLSAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PER-2 BETA-LACTAMASE
publication title Crystal Structure of the Extended-Spectrum Beta-Lactamase Per- 2 and Insights Into the Role of Specific Residues in the Interaction with Beta-Lactams and Beta-Lactamase Inhibitors.
pubmed doi rcsb
source organism Citrobacter freundii
total genus 90
structure length 277
sequence length 280
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4d2oA00
3IXBA 1ZG4A 1GA9A 2OLVA 3PBQA 4IVIA 4OQGA 3VOZA 3O86A 1XGIA 4LV3A 5FQMA 4N1XA 5M18A 1PIOA 4MBKA 5FQQA 4Y0TA 3A3IA 3N8SA 1G68A 4U0XA 4GD6A 4P87A 3HLCA 4X68A 3I7JA 3IQAA 4FD8A 1S0WA 1QMFA 4S2MA 2ZC4B 4WMCD 4S2NC 4KZ9A 2XDMA 3DTMA 1PWDA 3NC8A 3HLEA 1O7EA 4QJGA 4BL3A 3CG5A 1L0DA 2Z2MB 2XR0A 3UDIA 2J9PA 2ZC5B 3QHYA 5FATA 3NDEA 3E2KA 2ZQ8A 3NCKA 4ZJ1A 4E3OA 5EVLA 4MLLA 3ZG9B 1I2WA 3PAEA 3UO9A 4WMCA 4UHUA 2ZD8A 3LY4A 1SDEA 5FAQA 3HUOA 5F82A 1PW1A 4ID4A 4Z9QA 5HX9A 5A92A 1GA0A 2Y55A 3ZG0A 2A3UA 5E2HA 3M2KA 3IF6A 4E3KA 1YLWA 3BFGA 3MZFA 3ZG8B 3UDFA 4EBLA 4JLFA 3VOYA 4E6XA 3IWOA 4RX2A 3HVFA 4C75A 1OMEA 3FKWA 3G32A 3WS1A 5GHYA 3Q07A 4JBFA 5HARA 3W8KA 3GVBA 1S6RA 4LV2A 3PBNA 3A3JA 3G35A 4KQQA 4UAAA 5DTTA 3MXSA 2Y2IA 4GDNA 4JXVA 2EFUA 4HBTA 2WZXA 5CHMA 3GSGA 1K57A 3NI9A 1IKGA 3WRTA 2QMIA 2WAEA 4BD0A 5EVIB 4E3IA 3SH9A 1SDNA 4OH0A 5TFQA 2G2UA 3CMZA 1I5QA 1XX2A 3MKFA 2Y2QA 4S2PA 2WADA 3FZCA 1U60A 2WYXA 1LL9A 2WKEA 4E3MA 3AGDA 3SS4A 3VP1A 3Q7ZA 3MBZA 2ZQAA 4E6WA 3C7UA 1FOFA 1ZG6A 1C3BA 1N9BA 4OP8A 3OCLA 1PWCA 2Y2KA 2XQZA 4KG2A 3IF5A 1ESIA 5EPHA 3C7VA 4EBNA 1O07A 1IYQA 1JVJA 3VSKA 5BOHA 3HLFA 4GOGA 2PBYA 4KZ8A 4Y7PA 1KVLA 4GZBA 1E25A 5KSCA 2HPBA 2WGWA 2X01A 5J8XA 4E3LA 3HLWA 4JXWA 2XFSA 3GRJA 1GHIA 1PI4A 4QU3A 3LY3A 3UNWA 4EBPA 4EUZA 4OPYA 5F1GA 1I2SA 4DDYA 2ZC7A 3IH8A 1LL5A 2UWXA 5FQKA 1BUEA 1ONHA 1TDLA 3B3XA 3C5AA 2IWCA 4HBUA 4Y0OA 1K38A 3O87A 5FQJA 1ALQA 1ERQA 5CXWA 5HW3A 3EQUA 3SH8A 4C3QA 1N4OA 4IBRA 2XD1A 3ZVTA 1BT5A 1E3UD 4PM9A 2EX9A 1YLTA 1ERMA 1WE4A 4X6TA 3Q82A 2C6WB 5FI6A 5GLCA 3G4PA 1GCEA 4F94A 4OKPA 5GLAA 5KZHA 5CEDA 1HD8A 4LV1A 4H8RA 1IYPA 3BFEA 1AXBA 4WZ5C 2Y91A 2WKHA 4MBHA 4IEDA 5FAOA 3BLMA 3ZNYA 1E3UA 4DF6A 2Y2HA 4R4RA 4UA9A 1XA1A 5CHUA 1E4DA 1NYYA 4JF6A 2E8IA 5TGFA 3IWIA 3S1YA 3SH7A 5L2FA 2ZC6B 3BEBA 3BM6A 3V50A 3MFDA 4WELA 2WAFA 5CHJA 1L0FA 1FSYA 3ITAA 3OPHA 3Q7VB 4JF5A 4OOYA 2GDNA 4EQIA 2JCHA 1YMSA 1WYCA 2XLNA 1KGGA 1EROA 2QPNA 2ZJ9A 1NZUA 1Z6FA 2J9OA 3P09A 1Q2QA 3BYDA 4LCMA 5JYOA 4JXSA 1Y54A 4KZ4A 1CEFA 1K25A 2Y2JA 3FWLA 1HTZA 1NYMA 3QNCA 5DTSA 3VMAA 2ZQCA 3UPOA 1LI9A 5E2GA 5HAQA 2PU2A 5DF7A 5GHXA 4MEZA 3IHBA 5DTKA 4C6YA 3ZDJA 4K0WA 4DXCA 1BTLA 3NBLA 4IVKA 4YINA 1IEMA 2X71A 3SS5A 4U0TA 2Q9MA 1YLPA 3G2ZA 1TDGA 2CC1A 2V2FF 1YMXA 1YT4A 2P9VA 4OPRA 4Q8IA 1ES2A 4LENA 2WKIA 2WGVA 4LCLA 5G18A 1IYSA 2ZQ9A 2RL3A 1YQSA 1K6SA 1G6AA 4BL2A 4RA7A 4N9KA 3HLGA 4PPRA 2ZLYA 2IWDA 3S22A 2EX8A 4BLMA 3OCNA 3JYIA 3M6BA 4DDSA 1NJ4A 3ITBA 4P85A 1FR6A 5CEBA 3OPLA 5M1AA 3BFCA 3WRZA 4XXRA 2I72A 3IF6C 3LEZA 4N9LA 4QB8A 3N7WA 1K6RA 3BFFA 4N1HA 2WK0A 4O7DA 1MPLA 4OOMA 3AGEA 5CERA 3OC2A 4KZ7A 3PBOA 1KGFA 5EE8A 2XD5A 4RYEA 4PM5A 4HESA 1KDSA 3P98A 3UE0A 4FSFA 3D4FA 5TR7A 5E43A 4CJNA 5E2EA 4X55A 4DE3A 4OQIA 1MKIA 3IXHA 4KENB 3UPPA 1K57C 2H0TA 4B4ZA 4D2OA 1SHVA 1PZOA 1W79A 1L0EA 4WBGA 2HP6A 2OSUA 5FSRA 3V3RA 4ZTKA 1IYOA 1XP4A 1FCNA 3EQVA 3HL9A 4ZDXA 5FASA 3A3FA 3NY4A 4S2LA 2X02A 4X69A 2Q9NA 1K55A 3M2JA 3UE3A 5HL1A 4DXBA 1DJCA 1ZC2A 2J8YA 2OLUA 3SOIA 4BD1A 5D3OA 4RVAA 3PBRA 3GTCA 1W8QA 1DJAA 3BFDA 2ZM0A 2WUQA 4GB7A 3RXWA 2EFXA 4R3JA 3A3DA 1H8YA 4FH4A 3TOIA 3OPPA 1HVBA 4KZBA 3G2YA 3UE1A 3A3EA 2FFFB 2RCXA 4XUZA 4JF4A 1BZAA 4B88A 4BQMA 2BLSA 4KZAA 3LCEA 4OPZA 4QHCA 4UA6A 1KVMA 4JPMA 1MWSA 1BLSA 5FA7A 3VP3A 5FI2A 3FYZA 4OPQA 2ZM2A 1W7FA 5DVAA 5EVID 5A90A 4WEKA 4PM7A 3VP4A 3QNBA 4IBXA 5M19A 3N8RA 4GN2A 4X56A 5CRFA 1K54A 1H5XA 1FCOA 2ZQDA 1CEGA 1JTGA 1EI5A 2XFTA 1BSGA 1DY6A 1RGYA 3GV9A 2DRWA 4JKTA 2H0YA 2R9XA 2QZ6A 3MXRA 3VFHA 4A5RA 3ISGA 4KG5A 4PM8A 2HDSA 3HBRA 2WZZA 3VSLA 2EX2A 4R4SA 3SS3A 5EVIA 3GQZA 1XGJA 1KE0A 4PMAA 4QY5A 1PI5A 4WYYA 3VP2A 5F83A 4R1GA 2B5RA 4LV0A 1VM1A 3PBSA 2VGKA 2Y2OA 3IF6B 4CPKA 1WYBA 1L2SA 3HREA 4S2IA 2Y4AA 4OQHA 5EOOA 5HAIA 1VQQA 4OQ0A 4QD4A 1ES3A 1SKFA 1W8YA 5HAPA 1KE4A 1M40A 4OLGA 4X53A 4B4XA 3Q81A 2Y59A 4DE1A 1DJBA 4EV4A 1YM1A 2JBFA 5JYPA 4M3KA 3WS0A 3G34A 3UY6A 1MXOA 4DRTA 3ZFZA 1PYYA 1JWPA 1HZOA 4WM9A 3V5MA 2J7VA 2EXBA 2H5SA 1KGEA 1NRFA 2XEPA 1BLCA 3BLSA 1Q2PA 2DCFA 3FKVA 5FQ9A 3V3SA 1XKZA 2ZMAA 4GNUA 1XA7A 1TEMA 1LLBA 4P0MA 1QMEA 2C5WB 4S2NA 3E2LA 2Y2PA 5HFOA 3LO7A 1NZOA 1PZPA 3MZDA 2P74A 5IHVA 1MY8A 1MBLA 1BLPA 4BJPA 3GMWA 5CECA 3VFFA 4R3BA 3PBTA 5AQBA 1CI9A 1CI8A 3UN7A 1J9MA 3C4PA 5CTNA 2XH9A 4KQRA 4MBFA 2JE5A 4KG6A 2EXAA 3BRMA 3WS5A 3Q1FA 3ZGAB 2FFYA 3HLBA 5CGXA 2OV5A 2XGNA 3HUNA 4KZ3A 1CK3A 3HUMA 1ONGA 1FR1A 2WGWB 3WS2A 3GR2A 3ZCZA 3IXDA 1JTDA 3WS4A 3O3VA 3RXXA 5AQAA 1KE3A 4OONA 4XUXA 2HDQA 2BG1A 1EWZA 2R9WA 4GDBA 2Y2LA 5EUAA 3ZHHA 1ZKJA 1RCJA 4ZJ3A 3W4PA 4KZ6A 3Q7VA 4S2KA 5GLBA 3ZNTA 2WGIA 2JC7A 2G2WA 3CZDA 3DWZA 3N6IA 4MNRA 5GL9A 1RGZA 5U47A 2EX6A 1ES4A 1XPBA 3TSGA 5AQ9A 1K4EA 1FSWA 3HLDA 5DF8A 4KQOA 1K4FA 1BLHA 4FH2A 4P6BA 5CTMA 1YLJA 4N92A 4YFMA 1H8ZA 1SCWA 3DWKA 4QY6A 3N8LA 2Y2NA 3N4IA 3WWXA 3ZG7B 4ZBEA 3IXGA 3IWQA 2V1ZA 1FQGA 4U3TA 3AGFA 2VGJA 1KDWA 2ZC3B 1IELA 5A93A 2XK1A 4K0XA 1ESUA 1YLZA 1MWUA 2Z2LB 3M6HA 3PTEA 5DF9A 1L0GA 4E3JA 1FCMA 3OPRA 5AQ7A 4WZ4A 4WEJA 2DNSA 1K55C 1RP5A 3UPNA 3G30A 4PM6A 3IHAA 4ZJ2A 3PAGA 3NDGA 4GKUA 2XF3A 2Y2MA 5E2FA 5CGWA 4NK3A 5GHZA 4JXGA 3VP0A 5FAPA 1MWTA 5KMWA 3W4QA 4EWFA 2H10A 4FCFA 3S4XA 3V39A 4OLDA 2PU4A 4L0LA 1K56D 1LI0A 2HDUA 1NY0A 3RJUA 2A49A 1M6KA 3CJMA 1JWVA 4OVDA 4DKIA 3BECA 2P9VB 4OP5A 3TG9A 3W4OA 3UDXA 1XXMA 1YLYA 1IKIA 4WZ5A 4HEFA 2Y2GA 5A91A 4DE0A 4ZAMA 1K54C 2HP9A 4Y0UA 5F1FA 1TVFA 4UA7A 3MZEA 1K56A 4RX3A 5I94A 5FI7A 3IH9A 4NETA 5FQIA 4E3NA 1W5DA 1PW8A 3G31A 3ZG5A 3ZVWA 1NXYA 2HP5A 1ES5A 1BULA 3O88A 5EVIC 4DE2A 1MWRA 4KZ5A 5KSHA 1JWZA 1LHYA 1GHPA 5EOEA 5FDHA 4R23A 2HDRA 4K91A 3C4OA 3IT9A 3FV7A 2IWBA 3DW0A 2V20A 4OOLA 4BENA 5EECA 1GHMA 2ZM8A 4GD8A 4S2OA 5CGSA 1PWGA 3MKEA 5GLDA 3OZHA 4R0QA 2ZQ7A 4S2JA 3NIAA
chains in the Genus database with same CATH superfamily
2BTFP 3IXBA 2OLVA 2HZ5A 3PBQA 4HJ3A 4OQGA 3O86A 4HP9A 5FQQA 4IUKA 1F5MA 2KOIA 3HLCA 4FD8A 5J3WA 2ZC4B 2XDMA 3CG5A 3IX8A 1L0DA 2Z2MB 2XR0A 3UDIA 2ZC5B 1XJ6A 3NDEA 5AJGA 3E2KA 4E3OA 2OAP1 3ZG9B 1I2WA 3LY4A 1TS8A 5FAQA 1PW1A 1GA0A 1TS7A 4EBLA 5LBRA 4II7A 3HVFA 1VETA 3Q07A 5HARA 1WA9A 1TS0A 3A3JA 5DTTA 4GDNA 4JXVA 5CHMA 1IKGA 2WAEA 4BD0A 3S7PA 1S67L 2L0WA 5AVFA 3CMZA 1I5QA 1TS6A 3MKFA 3SS4A 3Q7ZA 3CUEC 4BWIA 2O0YA 1FOFA 1ZG6A 1N9BA 2Y2KA 4PKYG 4KG2A 3JVUA 1ESIA 1LL8A 1IYQA 2V1AA 3KX0X 2PBYA 5KSCA 2B02A 3GRJA 1PI4A 4QU3A 3S7QA 3O5YA 1I2SA 5K5BA 2UWXA 5FQKA 4HBUA 1H3QA 3O87A 5CXWA 3U4LP 3SH8A 4IBRA 3ZVTA 1WE4A 2B95A 5GLCA 2V1BA 1HD8A 4I3IA 3LGOA 1IYPA 4MBHA 2WKHA 3UB9A 1E3UA 3IS2A 4R4RA 3RH8B 5L2FA 3SH7A 3HCYA 3MF0A 3BEBA 3EGXC 3V50A 4WELA 2QJ7A 2WAFA 4EESA 3OPHA 3D9YA 4M4XA 1G6OA 3NULA 1WYCA 2XLNA 4YOFA 1KGGA 4FOFA 1DP6A 1GSWA 1Q2QA 3BYDA 3C2WA 5HWVA 5JYOA 4KZ4A 2Y2JA 1NYMA 3VMAA 1XJ2A 2ZQCA 3C8CA 5E2GA 3JPUA 3A0RA 3NBLA 4IVKA 3SS5A 4EEUA 4OPRA 4Q8IA 1ES2A 3PR6A 2OOLA 5G18A 1IYSA 4KUKA 1K6SA 3HLGA 2FH5A 2EX8A 2L4RA 2EWVA 2AVXA 3M6BA 5CEBA 3BFCA 2I72A 4QB8A 3LEZA 3N7WA 1SKOA 2PAVP 3OC2A 4KZ7A 5EE8A 4GS9A 3QP1A 4HESA 1KDSA 5E2EA 3LR3A 3UPPA 2HJEA 2L1MA 1SHVA 5IT5A 4WF0A 1L0EA 5F6AA 3TW8A 2OWJA 3V3RA 4ZTKA 2O9AA 1XP4A 1FCNA 1TD5A 3EQVA 3HL9A 4X69A 3M2JA 2OLUA 2JHEA 5TJJA 3BFDA 2ZM0A 2HF6A 2JKFA 2WUQA 2QHKA 4KZBA 4LLOB 3G2YA 2FFFB 3MQOA 4KZAA 1MWSA 3CHWP 3QP6A 2ZM2A 3BQAA 5A8BA 4PM7A 3H9WA 3KYEA 5M19A 3BLMA 1FCOA 3FC7A 3GV9A 1BSGA 2DRWA 2H0YA 2QZ6A 1NLZA 3VFHA 2JKGA 3GQZA 3KSFA 4HHDA 5FEFA 4WYYA 4R1GA 4LV0A 1VM1A 3VV4A 2VGKA 1WYBA 4KQDA 5HAIA 4OQ0A 4HH2A 4H6JA 4B4XA 4EV4A 3LYXA 3Q81A 2JBFA 4DRTA 1JWPA 2J7VA 3UB7A 3BY8A 1XKZA 2ZMAA 1TEMA 5KIZA 1K0KA 4ESPA 5HFOA 3MZDA 4BJPA 3VFFA 1LSWA 4R3BA 1DRMA 2JKRM 2XH9A 1HLUP 2JE5A 3E98A 4B9OA 2VK3A 3HUMA 1FR1A 2W1RA 2WGWB 3WS2A 1P0ZA 1LSVA 3GR2A 2NUPC 3RFBA 3IXDA 3ZYTA 4L9GA 1JTDA 4MN7A 5AQAA 4XUXA 1ZKJA 3K3DA 4KZ6A 2FZ0A 5IU1A 3Q7VA 1PFLA 4BBTA 2WGIA 3DWZA 5U47A 1XPBA 5AQ9A 3HLDA 1DP8A 1K4FA 3LR4A 1YLJA 2HV1A 1SCWA 5C5KA 1XFQA 1STZA 2Y2NA 2PT7A 3IXGA 1KDWA 2PHYA 5A93A 2XK1A 4K0XA 1UGUA 2ZMVA 5FDSA 5DF9A 1L0GA 5AQ7A 4WZ4A 4WEJA 1RP5A 4IHQA 4CLCD 4NEED 3NDGA 2ACGA 2XF3A 2Y2MA 4I3AA 1PNEA 5GHZA 3MS6A 5KMWA 2QYBA 2PR6A 3LIFA 4L0LA 4EEPA 1LI0A 2A49A 3UE6A 4AFIA 1JWVA 5L09A 3F1NB 2MJ6A 5A91A 1G5UA 2A24A 2W1TB 5I94A 4YNRA 2W3EA 1T18A 2VV7A 4NETA 5FI7A 3G31A 2HP5A 4NXFA 3DTEA 5KSHA 1UWNX 3NOUC 1JWZA 3PXPA 4HI4A 4K91A 3IT9A 3UB5P 3DW0A 4S2OA 1NRJA 1PWGA 3MKEA 5GLDA 3CPTB 1N9LA 3VOZA 5FQMA 1PIOA 3A3IA 3N8SA 1G68A 2PYPA 4GD6A 4X68A 4XT2B 1S0WA 1QMFA 4S2MA 4S2NC 4KZ9A 1O7EA 4QJGA 4BL3A 2PBDP 3QHYA 3IX3A 4D60A 5FATA 2ZQ8A 4ZJ1A 2PRFA 1SZVA 2ZD8A 3HUOA 4ARZB 2A3UA 5E2HA 3M2KA 2VGLM 3IF6A 4WLAA 1F9IA 1YLWA 3BFGA 5FL3A 3ZG8B 3UDFA 4JLFA 3VOYA 4E6XA 4RX2A 3FKWA 4LV2A 3PBNA 4UAAA 1VEUA 3MXSA 2Y2IA 3DTKA 2WZXA 2J3WA 3GSGA 3NI9A 4GHIA 1SDNA 4S2PA 1LL9A 2R78A 4IJGA 4DMZA 3T50A 2ZQAA 4E6WA 3G6OA 4WUJA 1O07A 3HLFA 5HPFA 1KVLA 4E3LA 4PKYA 3LY3A 3UNWA 5F1GA 2ZC7A 4PHTA 1LL5A 3C5AA 1K38A 1ALQA 5HW3A 4C3QA 1N4OA 4IUHA 1E3UD 4PM9A 4CLCC 1P9WA 5FI6A 3KYQA 5HSQA 2PYRA 4OKPA 5GLAA 5CEDA 1D06A 4LV1A 4H8RA 3C38A 5FAOA 5HD5A 4UA9A 1E4DA 1IFQA 2E8IA 5HDCA 3BM6A 4F3LB 2W3FA 1L0FA 4JF5A 1S4RA 4OOYA 1MZUA 4EQIA 4JXSA 1HTZA 3QNCA 2VGLS 4JGQA 4HY8A 5GHXA 5DTKA 3ZDJA 4K0WA 4DXCA 5DFYA 2X71A 4U0TA 4CQHA 3S7OA 3BW6A 3LIBA 1YMXA 4MCWA 2WKQA 5HD3A 2RL3A 4NXEA 3CI6A 1G6AA 4RA7A 1X0OA 2PDRA 4PPRA 2VX8A 3JYIA 4DDSA 2H28A 4O0PA 4P85A 4CLCB 5M1AA 3WRZA 2HGVA 4N9LA 1K6RA 4LRZE 4N1HA 4O7DA 1MPLA 3AGEA 5AVEA 2XD5A 3VOLA 3KYZA 4FSFA 4LPZA 3BJNA 4X55A 1LT0A 4OQIA 2V8FA 4KENB 4B4ZA 4O01A 4D2OA 1W79A 1F2KA 3LIDA 5FEGA 1T1AA 1OTBA 4ZDXA 3F1PB 4Q0JA 1K55A 3LIAA 5TBMB 5HL1A 4QPRA 2J8YA 3CLOA 4R3JA 3RXWA 3T1QB 1H8YA 3TOIA 1N9NA 1HVBA 2K2NA 2K7SA 3A3EA 2RCXA 4B88A 1BZAA 4BQMA 4QHCA 4OPZA 4JPMA 1BLSA 3FYZA 1D7EA 3MR0A 4OPQA 5G4ZA 2YKHA 4ZRRA 4WEKA 3VP4A 3QNBA 1H5XA 4KUOA 1JTGA 2XFTA 2J80A 3MXRA 2ZL1A 4R4SA 5EVIA 3L7HA 1KE0A 3CWFA 2B5RA 2ZOIA 4QWOA 1JNUA 2P7JA 2JKTM 4FUWA 3HJKA 4OQHA 1VQQA 5DFXA 1VETB 1FILA 1MC0A 4OLGA 4X53A 2CMNA 4M3KA 3UY6A 4WM9A 1HZOA 5DJTA 3V5MA 1BYWA 2EXBA 2H5SA 3BLSA 3V3SA 4P0MA 3F1OA 3LO7A 1PZPA 2P74A 5IHVA 5CECA 4R38A 1CI9A 1CI8A 3UN7A 1J9MA 3C4PA 2GJ3A 1OT6A 4KG6A 2EXAA 3BRMA 3Q1FA 3ZGAB 4NG2A 3HLBA 2XGNA 3GECA 4EQ1A 4KZ3A 3PHYA 1ONGA 1OTIA 1XJ3A 3VP2A 4OONA 2BG1A 1EWZA 2R9WA 1RCJA 2KX6A 3W4PA 4YWZA 3D72A 4S2KA 3CZDA 5HWTA 3KSIA 5GL9A 1RGZA 3TSGA 1A0KA 4FH2A 2V0UA 3MQ0A 3DWKA 2YKFA 3IS2B 3WWXA 1Y28A 4ZBEA 5DKLA 2ZC3B 4DJ3A 1IELA 2JKRI 1D1JA 1ESUA 1YLZA 5J7EA 1FCMA 3UPNA 3G30A 3IHAA 3H82A 5E2FA 2UV0E 3VP0A 1EW0A 3W4QA 2H10A 3S4XA 3MMHA 1OTAA 1IOUA 3RJUA 1M6KA 3BECA 4OP5A 3EWKA 3W4OA 3UDXA 1IKIA 3CITA 4WZ5A 2VV8A 1OPXA 1TVFA 3MZEA 3NECA 1K56A 3E4OA 4RX3A 5FQIA 3LI9A 1PW8A 3L9KA 4G3KA 4EXOA 1MWRA 3S7NA 3OBFA 1LHYA 1T19A 5EOEA 4R23A 3C4OA 3SW1A 3FV7A 3DTIA 2V20A 4OOLA 4BENA 1CJFA 1SKOB 1GHMA 5EECA 2ZM8A 3T4QA 2V8CA 5CGSA 4GS9B 4R0QA 4S2JA 1ZG4A 2M7UA 2GZAA 4N1XA 3T4OA 3EGDC 4U0XA 3P7NA 3E0YA 1ACFA 3TRCA 1V9ZA 2ZMFA 1PWDA 3NC8A 1LSXA 2LB9A 2J9PA 3NJAA 1P97A 1P9RA 4MLLA 5EVLA 3UO9A 4L9FA 2VKSA 4WMCA 1SDEA 5F82A 4Z9QA 4NXBA 3EEAA 3T1RA 1OMEA 3G32A 4EUVA 1S6RA 2XSSA 1PRQA 3G35A 4EU0A 1YPRA 4HBTA 2O9CA 1K57A 3WRTA 3NOPC 4OH0A 3IX4A 2G2UA 5EFWA 3FZCA 1FIKA 1U60A 2WYXA 4E3MA 2WKEA 3VP1A 3MBZA 3QP5A 1C3BA 4H6JB 3EOIA 3IF5A 4EBNA 3C7VA 5HPIA 4GOGA 3VE4A 4KZ8A 5J8XA 3T4JA 3HLWA 4EBPA 4OPYA 2O9BA 4DDYA 3IH8A 4HIAA 1BUEA 2IWCA 3QP8A 1ERQA 2W3DA 1BT5A 2EX9A 1ERMA 4X6TA 3H7WA 4I5SA 3G4PA 1GCEA 2VZWA 5KZHA 1GSXA 2QWSA 3RTYA 3R7WA 2VA0A 4G3WA 1AXBA 3LICA 3ZNYA 4IEDA 1L3LA 4Y5FA 3LEQA 1XA1A 4JF6A 5TGFA 3B42A 1FSYA 3ITAA 3Q7VB 2JCHA 1YMSA 4GCZA 2GNXA 1EROA 4DJ2A 1NZUA 4I39A 1Y54A 1K25A 1N9OA 1W63M 2M1CA 5DTSA 3KSHA 3UPOA 5HAQA 2PU2A 3IHBA 4C6YA 5EVEA 2V0WA 1BTLA 4YINA 1IEMA 3G2ZA 1TDGA 2V2FF 1YT4A 2P9VA 4LENA 2OWHA 2WKIA 5HL6A 1V9YA 2ZQ9A 4EW7A 3W2ZA 4BL2A 4N9KA 2IWDA 3R4KA 3S22A 4BLMA 4MN5A 1NLYA 3OCNA 1H8MA 1NJ4A 3ITBA 3OPLA 4XXRA 3IF6C 2J3TD 3BFFA 4OOMA 1KGFA 4PM5A 3UE0A 2A24B 5TR7A 4CJNA 1YKDA 4CLCE 1PZOA 4WBGA 5FSRA 3NY4A 4S2LA 2X02A 1AWIA 3UE3A 3IBJA 5HDDA 4DXBA 1DJCA 4BD1A 3SOIA 2WKPA 5D3OA 3PBRA 1W8QA 1DJAA 3A3DA 2PD7A 2P08A 4XUZA 1YAXA 5FA7A 3LCEA 1KVMA 4Y2FA 3VP3A 5FI2A 3QP4A 5DVAA 5EVID 5A90A 4IBXA 3N8RA 4GN2A 4Y17A 5CRFA 1K54A 3WS5A 4FTXA 1CEGA 4C75A 1DY6A 4JKTA 4PM8A 3HBRA 3VSLA 2EX2A 3T4SA 5HDSA 4QY5A 1PI5A 1S66L 4O8GA 3MFXA 2Y2OA 3IF6B 3T4KA 2W27A 4S2IA 5EOOA 4QD4A 3NHQA 1W8YA 1KE4A 2Y59A 1YM1A 5JYPA 1VEUB 1MXOA 1PYYA 4MDZA 4GHIB 1NRFA 1BLCA 1Q2PA 3FKVA 5FQ9A 3SZTA 1LLBA 2Y2PA 3GDIA 1BLPA 4NKPA 3GMWA 1OTEA 3PBTA 5I5LA 2G7UA 4KQRA 4UEYA 4WL9A 2OV5A 2BASA 3HUNA 1CK3A 3ZCZA 2JKTI 3PYPA 3WS4A 1W63Q 3O3VA 2NUTC 3RXXA 2W3HA 4HH3A 1XJ4A 4GDBA 3ZHHA 5EUAA 1MKMA 4ZJ3A 1G28A 4HQAA 2JC7A 2G2WA 3N6IA 1ES4A 1TF1A 1K4EA 1FSWA 5J4EA 1BLHA 4LFUA 2Y79A 3K2NA 4YFMA 4HOIA 1H8ZA 2WKRA 3CUEA 4QY6A 3T1XA 3N8LA 3N4IA 3ZG7B 4E04A 1CF0A 3AGFA 2J3TC 1MWUA 3M6HA 3PTEA 2DNSA 1K55C 4PM6A 4ZJ2A 4EETB 4NK3A 4EERA 5IS1A 4JXGA 4R6LA 4GJ4A 2VLGA 4FCFA 1K56D 3FPVA 2HDUA 3UMEA 5EM0A 2Z6CA 2JN7A 2Q0OA 3CJMA 4OVDA 5DJUA 3TG9A 2OAQ1 4Z1WA 3LFVA 1XXMA 4DE0A 2EA9A 4E3NA 3T4LA 3ZG5A 1NXYA 5EVIC 1ES5A 1BULA 1F98A 4DE2A 1YSQA 4KZ5A 1GHPA 5FDHA 3OOVA 4ETZA 4GW9A 2ZQ7A 3NIAA 4IVIA 1GA9A 4WN5A 1XGIA 4LV3A 5M18A 4MBKA 4Y0TA 2B18A 3T1SA 4P87A 3I7JA 3IQAA 4WMCD 3DTMA 3DAVA 3HLEA 3A0VA 4HNBA 3B47A 1KOUA 1T1BA 3ICYA 3NCKA 3QP2A 1XFNA 1S4SA 3PAEA 2XRNA 4UHUA 4ID4A 2W3GA 5HX9A 5A92A 4R70A 2Y55A 3ZG0A 3HJIA 1CQAA 4E3KA 3MZFA 3UB6A 3IWOA 4JGRA 3WS1A 5GHYA 2A2LA 4JBFA 3W8KA 3GVBA 4KQQA 3UMDA 3E4QA 2O99A 2EFUA 3FPWA 2ZL1B 2HJ9C 2QMIA 5EVIB 4E3IA 3SH9A 5TFQA 1XX2A 2XA7M 4HJ6A 2Y2QA 2WADA 3AGDA 3T4TA 3C7UA 2INWA 4OP8A 2XROA 3OCLA 1PWCA 4NXGA 2XQZA 5EPHA 4DN0A 1JVJA 3VSKA 4ME4A 5BOHA 4Y7PA 4GZBA 1E25A 2QKPA 2HPBA 2WGWA 2X01A 3K3CA 4JXWA 2XFSA 4I38A 1GHIA 4EUZA 2D01A 4X25A 1DP9A 3F1OB 1TDLA 1ONHA 3B3XA 4Y0OA 5MC7A 5FQJA 1S1YA 3NOTC 1OJGA 3EQUA 2XD1A 1YLTA 3T12B 4LRXC 3Q82A 2C6WB 1T1CA 2E8JA 4F94A 4MMNA 4ETXA 4BMWA 2VJWA 4X1LA 3BFEA 4Y15A 4WZ5C 2Y91A 4DF6A 5HWWA 2Y2HA 5CHUA 2VV6A 1NYYA 3S1YA 3IWIA 2ZC6B 3MFDA 5CHJA 2V9AA 2GDNA 1ZHHB 3CAXA 2QPNA 2ZJ9A 1Z6FA 2J9OA 3P09A 3KO6A 4LCMA 1CEFA 3FWLA 4GLQA 1LI9A 2DMWA 5DF7A 4I3JA 4MEZA 1GSVA 4BBUA 4X1MA 2Q9MA 1OJ5A 3A0SA 3ULFA 1YLPA 2CC1A 3F1NA 2WGVA 4LCLA 5L8MA 3B33A 3DBAA 3H82B 2XA7S 2GX5A 1YQSA 2KLIA 2W1TA 4Q0IA 4LGWA 2ZLYA 4HJ4A 4UQIM 1FR6A 5EV0A 5EM1A 2D02A 2P04A 2WK0A 1Z09A 5CERA 3PBOA 1ODVA 4RYEA 3CPTA 3P98A 2ZBBA 3D4FA 5E43A 5F69A 4DE3A 1MKIA 3IXHA 1K57C 2H0TA 5HZHA 3D3OA 2VEAA 2HP6A 2OSUA 3P01A 1IYOA 5FASA 4XT2A 3A3FA 2KDKA 3JVVA 2Q9NA 1ZC2A 4RVAA 2QJ5A 3FG8A 3GTCA 4GB7A 2EFXA 3LUQA 4FH4A 4G3VA 3OPPA 5L07A 3UE1A 4ARZA 4JF4A 2BLSA 4UA6A 5G4YA 1W7FA 4X56A 2ZQDA 1EI5A 4P6ZM 1RGYA 2R9XA 4A5RA 3ISGA 4KG5A 5F5YA 2HDSA 2W0NA 2WZZA 3SS3A 1XGJA 3V67A 4PMAA 1VB6A 4K08A 5F83A 4Y3IA 1VHMA 1OTDA 4CPKA 1L2SA 3HREA 2Y4AA 3TJZC 1ES3A 1SKFA 2I9VA 3BY9A 5HAPA 1M40A 3KSGA 4DE1A 1DJBA 3WS0A 1S1ZA 3G34A 2Z6DA 4R3AA 4L9EA 3ZFZA 1KGEA 2XEPA 1UWPX 1Y4OA 2DCFA 4GNUA 3MQQA 1XA7A 1QMEA 2C5WB 4S2NA 3VE3A 4UQIS 3E2LA 3LI8A 4JGPA 3MJQA 1NZOA 1MY8A 1MBLA 5CX7A 5AQBA 5CTNA 4MBFA 2ZOHA 3ZQ5A 1NWZA 2FFYA 5CGXA 4B93A 3LIEA 1KE3A 4F3LA 2HDQA 2Y2LA 2M7VA 5GLBA 3ZNTA 3MXQA 4MNRA 3H7WB 2EX6A 5DF8A 4KQOA 4P6BA 5CTMA 4N92A 3R7WB 2LB5A 3LR0A 1J3WA 3BWLA 5F68A 3IWQA 2V1ZA 1FQGA 4U3TA 3MSHA 2VGJA 4P6ZS 1OT9A 4JGOA 2Z2LB 4MN6A 4BBVA 4E3JA 3OPRA 2Y8HA 3PAGA 4GKUA 5CGWA 4HP4A 4PAUA 1ZTUA 5FAPA 1MWTA 4EWFA 4Q0HA 3C30A 3V39A 4OLDA 2PU4A 4CLCA 3BQ8A 1NY0A 4DKIA 2P9VB 3EEHA 3U2AA 3IBRA 1YLYA 4HEFA 2Y2GA 2K31A 4ZAMA 1K54C 2HP9A 4Y0UA 5F1FA 4UA7A 3IH9A 2IA2A 2PR5A 1W5DA 3ZVWA 3E4PA 3OLOA 3O88A 3UB8A 4LRYC 3F1PA 5DKKA 5TBMA 2HDRA 3TE8A 4RQ9A 2IWBA 3LR5A 4Y13A 1H0MA 5L10A 4GD8A 2EWWA 1YSPA 3OZHA 3PBSA 2PD8A
chains in the Genus database with same CATH topology
3IXBA 1ZG4A 1GA9A 2OLVA 3PBQA 4IVIA 4OQGA 3VOZA 3O86A 1XGIA 4LV3A 5FQMA 4N1XA 5M18A 1PIOA 4MBKA 5FQQA 4Y0TA 3A3IA 3N8SA 1G68A 4U0XA 4GD6A 4P87A 3HLCA 4X68A 3I7JA 3IQAA 4FD8A 1S0WA 1QMFA 4S2MA 2ZC4B 4WMCD 4S2NC 4KZ9A 2XDMA 3DTMA 1PWDA 3NC8A 3HLEA 1O7EA 4QJGA 4BL3A 3CG5A 1L0DA 2Z2MB 2XR0A 3UDIA 2J9PA 2ZC5B 3QHYA 5FATA 3NDEA 3E2KA 2ZQ8A 3NCKA 4ZJ1A 4E3OA 5EVLA 4MLLA 3ZG9B 1I2WA 3PAEA 3UO9A 4WMCA 4UHUA 2ZD8A 3LY4A 1SDEA 5FAQA 3HUOA 5F82A 1PW1A 4ID4A 4Z9QA 5HX9A 5A92A 1GA0A 2Y55A 3ZG0A 2A3UA 5E2HA 3M2KA 3IF6A 4E3KA 1YLWA 3BFGA 3MZFA 3ZG8B 3UDFA 4EBLA 4JLFA 3VOYA 4E6XA 3IWOA 4RX2A 3HVFA 4C75A 1OMEA 3FKWA 3G32A 3WS1A 5GHYA 3Q07A 4JBFA 5HARA 3W8KA 3GVBA 1S6RA 4LV2A 3PBNA 3A3JA 3G35A 4KQQA 4UAAA 5DTTA 3MXSA 2Y2IA 4GDNA 4JXVA 2EFUA 4HBTA 2WZXA 5CHMA 3GSGA 1K57A 3NI9A 1IKGA 3WRTA 2QMIA 2WAEA 4BD0A 5EVIB 4E3IA 3SH9A 1SDNA 4OH0A 5TFQA 2G2UA 3CMZA 1I5QA 1XX2A 3MKFA 2Y2QA 4S2PA 2WADA 3FZCA 1U60A 2WYXA 1LL9A 2WKEA 4E3MA 3AGDA 3SS4A 3VP1A 3Q7ZA 3MBZA 2ZQAA 4E6WA 3C7UA 1FOFA 1ZG6A 1C3BA 1N9BA 4OP8A 3OCLA 1PWCA 2Y2KA 2XQZA 4KG2A 3IF5A 1ESIA 5EPHA 3C7VA 4EBNA 1O07A 1IYQA 1JVJA 3VSKA 5BOHA 3HLFA 4GOGA 2PBYA 4KZ8A 4Y7PA 1KVLA 4GZBA 1E25A 5KSCA 2HPBA 2WGWA 2X01A 5J8XA 4E3LA 3HLWA 4JXWA 2XFSA 3GRJA 1GHIA 1PI4A 4QU3A 3LY3A 3UNWA 4EBPA 4EUZA 4OPYA 5F1GA 1I2SA 4DDYA 2ZC7A 3IH8A 1LL5A 2UWXA 5FQKA 1BUEA 1ONHA 1TDLA 3B3XA 3C5AA 2IWCA 4HBUA 4Y0OA 1K38A 3O87A 5FQJA 1ALQA 1ERQA 5CXWA 5HW3A 3EQUA 3SH8A 4C3QA 1N4OA 4IBRA 2XD1A 3ZVTA 1BT5A 1E3UD 4PM9A 2EX9A 1YLTA 1ERMA 1WE4A 4X6TA 3Q82A 2C6WB 5FI6A 5GLCA 3G4PA 1GCEA 4F94A 4OKPA 5GLAA 5KZHA 5CEDA 1HD8A 4LV1A 4H8RA 1IYPA 3BFEA 1AXBA 4WZ5C 2Y91A 2WKHA 4MBHA 4IEDA 5FAOA 3BLMA 3ZNYA 1E3UA 4DF6A 2Y2HA 4R4RA 4UA9A 1XA1A 5CHUA 1E4DA 1NYYA 4JF6A 2E8IA 5TGFA 3IWIA 3S1YA 3SH7A 5L2FA 2ZC6B 3BEBA 3BM6A 3V50A 3MFDA 4WELA 2WAFA 5CHJA 1L0FA 1FSYA 3ITAA 3OPHA 3Q7VB 4JF5A 4OOYA 2GDNA 4EQIA 2JCHA 1YMSA 1WYCA 2XLNA 1KGGA 1EROA 2QPNA 2ZJ9A 1NZUA 1Z6FA 2J9OA 3P09A 1Q2QA 3BYDA 4LCMA 5JYOA 4JXSA 1Y54A 4KZ4A 1CEFA 1K25A 2Y2JA 3FWLA 1HTZA 1NYMA 3QNCA 5DTSA 3VMAA 2ZQCA 3UPOA 1LI9A 5E2GA 5HAQA 2PU2A 5DF7A 5GHXA 4MEZA 3IHBA 5DTKA 4C6YA 3ZDJA 4K0WA 4DXCA 1BTLA 3NBLA 4IVKA 4YINA 1IEMA 2X71A 3SS5A 4U0TA 2Q9MA 1YLPA 3G2ZA 1TDGA 2CC1A 2V2FF 1YMXA 1YT4A 2P9VA 4OPRA 4Q8IA 1ES2A 4LENA 2WKIA 2WGVA 4LCLA 5G18A 1IYSA 2ZQ9A 2RL3A 1YQSA 1K6SA 1G6AA 4BL2A 4RA7A 4N9KA 3HLGA 4PPRA 2ZLYA 2IWDA 3S22A 2EX8A 4BLMA 3OCNA 3JYIA 3M6BA 4DDSA 1NJ4A 3ITBA 4P85A 1FR6A 5CEBA 3OPLA 5M1AA 3BFCA 3WRZA 4XXRA 2I72A 3IF6C 3LEZA 4N9LA 4QB8A 3N7WA 1K6RA 3BFFA 4N1HA 2WK0A 4O7DA 1MPLA 4OOMA 3AGEA 5CERA 3OC2A 4KZ7A 3PBOA 1KGFA 5EE8A 2XD5A 4RYEA 4PM5A 4HESA 1KDSA 3P98A 3UE0A 4FSFA 3D4FA 5TR7A 5E43A 4CJNA 5E2EA 4X55A 4DE3A 4OQIA 1MKIA 3IXHA 4KENB 3UPPA 1K57C 2H0TA 4B4ZA 4D2OA 1SHVA 1PZOA 1W79A 1L0EA 4WBGA 2HP6A 2OSUA 5FSRA 3V3RA 4ZTKA 1IYOA 1XP4A 1FCNA 3EQVA 3HL9A 4ZDXA 5FASA 3A3FA 3NY4A 4S2LA 2X02A 4X69A 2Q9NA 1K55A 3M2JA 3UE3A 5HL1A 4DXBA 1DJCA 1ZC2A 2J8YA 2OLUA 3SOIA 4BD1A 5D3OA 4RVAA 3PBRA 3GTCA 1W8QA 1DJAA 3BFDA 2ZM0A 2WUQA 4GB7A 3RXWA 2EFXA 4R3JA 3A3DA 1H8YA 4FH4A 3TOIA 3OPPA 1HVBA 4KZBA 3G2YA 3UE1A 3A3EA 2FFFB 2RCXA 4XUZA 4JF4A 1BZAA 4B88A 4BQMA 2BLSA 4KZAA 3LCEA 4OPZA 4QHCA 4UA6A 1KVMA 4JPMA 1MWSA 1BLSA 5FA7A 3VP3A 5FI2A 3FYZA 4OPQA 2ZM2A 1W7FA 5DVAA 5EVID 5A90A 4WEKA 4PM7A 3VP4A 3QNBA 4IBXA 5M19A 3N8RA 4GN2A 4X56A 5CRFA 1K54A 1H5XA 1FCOA 2ZQDA 1CEGA 1JTGA 1EI5A 2XFTA 1BSGA 1DY6A 1RGYA 3GV9A 2DRWA 4JKTA 2H0YA 2R9XA 2QZ6A 3MXRA 3VFHA 4A5RA 3ISGA 4KG5A 4PM8A 2HDSA 3HBRA 2WZZA 3VSLA 2EX2A 4R4SA 3SS3A 5EVIA 3GQZA 1XGJA 1KE0A 4PMAA 4QY5A 1PI5A 4WYYA 3VP2A 5F83A 4R1GA 2B5RA 4LV0A 1VM1A 3PBSA 2VGKA 2Y2OA 3IF6B 4CPKA 1WYBA 1L2SA 3HREA 4S2IA 2Y4AA 4OQHA 5EOOA 5HAIA 1VQQA 4OQ0A 4QD4A 1ES3A 1SKFA 1W8YA 5HAPA 1KE4A 1M40A 4OLGA 4X53A 4B4XA 3Q81A 2Y59A 4DE1A 1DJBA 4EV4A 1YM1A 2JBFA 5JYPA 4M3KA 3WS0A 3G34A 3UY6A 1MXOA 4DRTA 3ZFZA 1PYYA 1JWPA 1HZOA 4WM9A 3V5MA 2J7VA 2EXBA 2H5SA 1KGEA 1NRFA 2XEPA 1BLCA 3BLSA 1Q2PA 2DCFA 3FKVA 5FQ9A 3V3SA 1XKZA 2ZMAA 4GNUA 1XA7A 1TEMA 1LLBA 4P0MA 1QMEA 2C5WB 4S2NA 3E2LA 2Y2PA 5HFOA 3LO7A 1NZOA 1PZPA 3MZDA 2P74A 5IHVA 1MY8A 1MBLA 1BLPA 4BJPA 3GMWA 5CECA 3VFFA 4R3BA 3PBTA 5AQBA 1CI9A 1CI8A 3UN7A 1J9MA 3C4PA 5CTNA 2XH9A 4KQRA 4MBFA 2JE5A 4KG6A 2EXAA 3BRMA 3WS5A 3Q1FA 3ZGAB 2FFYA 3HLBA 5CGXA 2OV5A 2XGNA 3HUNA 4KZ3A 1CK3A 3HUMA 1ONGA 1FR1A 2WGWB 3WS2A 3GR2A 3ZCZA 3IXDA 1JTDA 3WS4A 3O3VA 3RXXA 5AQAA 1KE3A 4OONA 4XUXA 2HDQA 2BG1A 1EWZA 2R9WA 4GDBA 2Y2LA 5EUAA 3ZHHA 1ZKJA 1RCJA 4ZJ3A 3W4PA 4KZ6A 3Q7VA 4S2KA 5GLBA 3ZNTA 2WGIA 2JC7A 2G2WA 3CZDA 3DWZA 3N6IA 4MNRA 5GL9A 1RGZA 5U47A 2EX6A 1ES4A 1XPBA 3TSGA 5AQ9A 1K4EA 1FSWA 3HLDA 5DF8A 4KQOA 1K4FA 1BLHA 4FH2A 4P6BA 5CTMA 1YLJA 4N92A 4YFMA 1H8ZA 1SCWA 3DWKA 4QY6A 3N8LA 2Y2NA 3N4IA 3WWXA 3ZG7B 4ZBEA 3IXGA 3IWQA 2V1ZA 1FQGA 4U3TA 3AGFA 2VGJA 1KDWA 2ZC3B 1IELA 5A93A 2XK1A 4K0XA 1ESUA 1YLZA 1MWUA 2Z2LB 3M6HA 3PTEA 5DF9A 1L0GA 4E3JA 1FCMA 3OPRA 5AQ7A 4WZ4A 4WEJA 2DNSA 1K55C 1RP5A 3UPNA 3G30A 4PM6A 3IHAA 4ZJ2A 3PAGA 3NDGA 4GKUA 2XF3A 2Y2MA 5E2FA 5CGWA 4NK3A 5GHZA 4JXGA 3VP0A 5FAPA 1MWTA 5KMWA 3W4QA 4EWFA 2H10A 4FCFA 3S4XA 3V39A 4OLDA 2PU4A 4L0LA 1K56D 1LI0A 2HDUA 1NY0A 3RJUA 2A49A 1M6KA 3CJMA 1JWVA 4OVDA 4DKIA 3BECA 2P9VB 4OP5A 3TG9A 3W4OA 3UDXA 1XXMA 1YLYA 1IKIA 4WZ5A 4HEFA 2Y2GA 5A91A 4DE0A 4ZAMA 1K54C 2HP9A 4Y0UA 5F1FA 1TVFA 4UA7A 3MZEA 1K56A 4RX3A 5I94A 5FI7A 3IH9A 4NETA 5FQIA 4E3NA 1W5DA 1PW8A 3G31A 3ZG5A 3ZVWA 1NXYA 2HP5A 1ES5A 1BULA 3O88A 5EVIC 4DE2A 1MWRA 4KZ5A 5KSHA 1JWZA 1LHYA 1GHPA 5EOEA 5FDHA 4R23A 2HDRA 4K91A 3C4OA 3IT9A 3FV7A 2IWBA 3DW0A 2V20A 4OOLA 4BENA 5EECA 1GHMA 2ZM8A 4GD8A 4S2OA 5CGSA 1PWGA 3MKEA 5GLDA 3OZHA 4R0QA 2ZQ7A 4S2JA 3NIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IXB A;  1ZG4 A;  1GA9 A;  2OLV A;  3PBQ A;  4IVI A;  4OQG A;  3VOZ A;  3O86 A;  1XGI A;  4LV3 A;  5FQM A;  4N1X A;  5M18 A;  1PIO A;  4MBK A;  5FQQ A;  4Y0T A;  3A3I A;  3N8S A;  1G68 A;  4U0X A;  4GD6 A;  4P87 A;  3HLC A;  4X68 A;  3I7J A;  3IQA A;  4FD8 A;  1S0W A;  1QMF A;  4S2M A;  2ZC4 B;  4WMC D;  4S2N C;  4KZ9 A;  2XDM A;  3DTM A;  1PWD A;  3NC8 A;  3HLE A;  1O7E A;  4QJG A;  4BL3 A;  3CG5 A;  1L0D A;  2Z2M B;  2XR0 A;  3UDI A;  2J9P A;  2ZC5 B;  3QHY A;  5FAT A;  3NDE A;  3E2K A;  2ZQ8 A;  3NCK A;  4ZJ1 A;  4E3O A;  5EVL A;  4MLL A;  3ZG9 B;  1I2W A;  3PAE A;  3UO9 A;  4WMC A;  4UHU A;  2ZD8 A;  3LY4 A;  1SDE A;  5FAQ A;  3HUO A;  5F82 A;  1PW1 A;  4ID4 A;  4Z9Q A;  5HX9 A;  5A92 A;  1GA0 A;  2Y55 A;  3ZG0 A;  2A3U A;  5E2H A;  3M2K A;  3IF6 A;  4E3K A;  1YLW A;  3BFG A;  3MZF A;  3ZG8 B;  3UDF A;  4EBL A;  4JLF A;  3VOY A;  4E6X A;  3IWO A;  4RX2 A;  3HVF A;  4C75 A;  1OME A;  3FKW A;  3G32 A;  3WS1 A;  5GHY A;  3Q07 A;  4JBF A;  5HAR A;  3W8K A;  3GVB A;  1S6R A;  4LV2 A;  3PBN A;  3A3J A;  3G35 A;  4KQQ A;  4UAA A;  5DTT A;  3MXS A;  2Y2I A;  4GDN A;  4JXV A;  2EFU A;  4HBT A;  2WZX A;  5CHM A;  3GSG A;  1K57 A;  3NI9 A;  1IKG A;  3WRT A;  2QMI A;  2WAE A;  4BD0 A;  5EVI B;  4E3I A;  3SH9 A;  1SDN A;  4OH0 A;  5TFQ A;  2G2U A;  3CMZ A;  1I5Q A;  1XX2 A;  3MKF A;  2Y2Q A;  4S2P A;  2WAD A;  3FZC A;  1U60 A;  2WYX A;  1LL9 A;  2WKE A;  4E3M A;  3AGD A;  3SS4 A;  3VP1 A;  3Q7Z A;  3MBZ A;  2ZQA A;  4E6W A;  3C7U A;  1FOF A;  1ZG6 A;  1C3B A;  1N9B A;  4OP8 A;  3OCL A;  1PWC A;  2Y2K A;  2XQZ A;  4KG2 A;  3IF5 A;  1ESI A;  5EPH A;  3C7V A;  4EBN A;  1O07 A;  1IYQ A;  1JVJ A;  3VSK A;  5BOH A;  3HLF A;  4GOG A;  2PBY A;  4KZ8 A;  4Y7P A;  1KVL A;  4GZB A;  1E25 A;  5KSC A;  2HPB A;  2WGW A;  2X01 A;  5J8X A;  4E3L A;  3HLW A;  4JXW A;  2XFS A;  3GRJ A;  1GHI A;  1PI4 A;  4QU3 A;  3LY3 A;  3UNW A;  4EBP A;  4EUZ A;  4OPY A;  5F1G A;  1I2S A;  4DDY A;  2ZC7 A;  3IH8 A;  1LL5 A;  2UWX A;  5FQK A;  1BUE A;  1ONH A;  1TDL A;  3B3X A;  3C5A A;  2IWC A;  4HBU A;  4Y0O A;  1K38 A;  3O87 A;  5FQJ A;  1ALQ A;  1ERQ A;  5CXW A;  5HW3 A;  3EQU A;  3SH8 A;  4C3Q A;  1N4O A;  4IBR A;  2XD1 A;  3ZVT A;  1BT5 A;  1E3U D;  4PM9 A;  2EX9 A;  1YLT A;  1ERM A;  1WE4 A;  4X6T A;  3Q82 A;  2C6W B;  5FI6 A;  5GLC A;  3G4P A;  1GCE A;  4F94 A;  4OKP A;  5GLA A;  5KZH A;  5CED A;  1HD8 A;  4LV1 A;  4H8R A;  1IYP A;  3BFE A;  1AXB A;  4WZ5 C;  2Y91 A;  2WKH A;  4MBH A;  4IED A;  5FAO A;  3BLM A;  3ZNY A;  1E3U A;  4DF6 A;  2Y2H A;  4R4R A;  4UA9 A;  1XA1 A;  5CHU A;  1E4D A;  1NYY A;  4JF6 A;  2E8I A;  5TGF A;  3IWI A;  3S1Y A;  3SH7 A;  5L2F A;  2ZC6 B;  3BEB A;  3BM6 A;  3V50 A;  3MFD A;  4WEL A;  2WAF A;  5CHJ A;  1L0F A;  1FSY A;  3ITA A;  3OPH A;  3Q7V B;  4JF5 A;  4OOY A;  2GDN A;  4EQI A;  2JCH A;  1YMS A;  1WYC A;  2XLN A;  1KGG A;  1ERO A;  2QPN A;  2ZJ9 A;  1NZU A;  1Z6F A;  2J9O A;  3P09 A;  1Q2Q A;  3BYD A;  4LCM A;  5JYO A;  4JXS A;  1Y54 A;  4KZ4 A;  1CEF A;  1K25 A;  2Y2J A;  3FWL A;  1HTZ A;  1NYM A;  3QNC A;  5DTS A;  3VMA A;  2ZQC A;  3UPO A;  1LI9 A;  5E2G A;  5HAQ A;  2PU2 A;  5DF7 A;  5GHX A;  4MEZ A;  3IHB A;  5DTK A;  4C6Y A;  3ZDJ A;  4K0W A;  4DXC A;  1BTL A;  3NBL A;  4IVK A;  4YIN A;  1IEM A;  2X71 A;  3SS5 A;  4U0T A;  2Q9M A;  1YLP A;  3G2Z A;  1TDG A;  2CC1 A;  2V2F F;  1YMX A;  1YT4 A;  2P9V A;  4OPR A;  4Q8I A;  1ES2 A;  4LEN A;  2WKI A;  2WGV A;  4LCL A;  5G18 A;  1IYS A;  2ZQ9 A;  2RL3 A;  1YQS A;  1K6S A;  1G6A A;  4BL2 A;  4RA7 A;  4N9K A;  3HLG A;  4PPR A;  2ZLY A;  2IWD A;  3S22 A;  2EX8 A;  4BLM A;  3OCN A;  3JYI A;  3M6B A;  4DDS A;  1NJ4 A;  3ITB A;  4P85 A;  1FR6 A;  5CEB A;  3OPL A;  5M1A A;  3BFC A;  3WRZ A;  4XXR A;  2I72 A;  3IF6 C;  3LEZ A;  4N9L A;  4QB8 A;  3N7W A;  1K6R A;  3BFF A;  4N1H A;  2WK0 A;  4O7D A;  1MPL A;  4OOM A;  3AGE A;  5CER A;  3OC2 A;  4KZ7 A;  3PBO A;  1KGF A;  5EE8 A;  2XD5 A;  4RYE A;  4PM5 A;  4HES A;  1KDS A;  3P98 A;  3UE0 A;  4FSF A;  3D4F A;  5TR7 A;  5E43 A;  4CJN A;  5E2E A;  4X55 A;  4DE3 A;  4OQI A;  1MKI A;  3IXH A;  4KEN B;  3UPP A;  1K57 C;  2H0T A;  4B4Z A;  4D2O A;  1SHV A;  1PZO A;  1W79 A;  1L0E A;  4WBG A;  2HP6 A;  2OSU A;  5FSR A;  3V3R A;  4ZTK A;  1IYO A;  1XP4 A;  1FCN A;  3EQV A;  3HL9 A;  4ZDX A;  5FAS A;  3A3F A;  3NY4 A;  4S2L A;  2X02 A;  4X69 A;  2Q9N A;  1K55 A;  3M2J A;  3UE3 A;  5HL1 A;  4DXB A;  1DJC A;  1ZC2 A;  2J8Y A;  2OLU A;  3SOI A;  4BD1 A;  5D3O A;  4RVA A;  3PBR A;  3GTC A;  1W8Q A;  1DJA A;  3BFD A;  2ZM0 A;  2WUQ A;  4GB7 A;  3RXW A;  2EFX A;  4R3J A;  3A3D A;  1H8Y A;  4FH4 A;  3TOI A;  3OPP A;  1HVB A;  4KZB A;  3G2Y A;  3UE1 A;  3A3E A;  2FFF B;  2RCX A;  4XUZ A;  4JF4 A;  1BZA A;  4B88 A;  4BQM A;  2BLS A;  4KZA A;  3LCE A;  4OPZ A;  4QHC A;  4UA6 A;  1KVM A;  4JPM A;  1MWS A;  1BLS A;  5FA7 A;  3VP3 A;  5FI2 A;  3FYZ A;  4OPQ A;  2ZM2 A;  1W7F A;  5DVA A;  5EVI D;  5A90 A;  4WEK A;  4PM7 A;  3VP4 A;  3QNB A;  4IBX A;  5M19 A;  3N8R A;  4GN2 A;  4X56 A;  5CRF A;  1K54 A;  1H5X A;  1FCO A;  2ZQD A;  1CEG A;  1JTG A;  1EI5 A;  2XFT A;  1BSG A;  1DY6 A;  1RGY A;  3GV9 A;  2DRW A;  4JKT A;  2H0Y A;  2R9X A;  2QZ6 A;  3MXR A;  3VFH A;  4A5R A;  3ISG A;  4KG5 A;  4PM8 A;  2HDS A;  3HBR A;  2WZZ A;  3VSL A;  2EX2 A;  4R4S A;  3SS3 A;  5EVI A;  3GQZ A;  1XGJ A;  1KE0 A;  4PMA A;  4QY5 A;  1PI5 A;  4WYY A;  3VP2 A;  5F83 A;  4R1G A;  2B5R A;  4LV0 A;  1VM1 A;  3PBS A;  2VGK A;  2Y2O A;  3IF6 B;  4CPK A;  1WYB A;  1L2S A;  3HRE A;  4S2I A;  2Y4A A;  4OQH A;  5EOO A;  5HAI A;  1VQQ A;  4OQ0 A;  4QD4 A;  1ES3 A;  1SKF A;  1W8Y A;  5HAP A;  1KE4 A;  1M40 A;  4OLG A;  4X53 A;  4B4X A;  3Q81 A;  2Y59 A;  4DE1 A;  1DJB A;  4EV4 A;  1YM1 A;  2JBF A;  5JYP A;  4M3K A;  3WS0 A;  3G34 A;  3UY6 A;  1MXO A;  4DRT A;  3ZFZ A;  1PYY A;  1JWP A;  1HZO A;  4WM9 A;  3V5M A;  2J7V A;  2EXB A;  2H5S A;  1KGE A;  1NRF A;  2XEP A;  1BLC A;  3BLS A;  1Q2P A;  2DCF A;  3FKV A;  5FQ9 A;  3V3S A;  1XKZ A;  2ZMA A;  4GNU A;  1XA7 A;  1TEM A;  1LLB A;  4P0M A;  1QME A;  2C5W B;  4S2N A;  3E2L A;  2Y2P A;  5HFO A;  3LO7 A;  1NZO A;  1PZP A;  3MZD A;  2P74 A;  5IHV A;  1MY8 A;  1MBL A;  1BLP A;  4BJP A;  3GMW A;  5CEC A;  3VFF A;  4R3B A;  3PBT A;  5AQB A;  1CI9 A;  1CI8 A;  3UN7 A;  1J9M A;  3C4P A;  5CTN A;  2XH9 A;  4KQR A;  4MBF A;  2JE5 A;  4KG6 A;  2EXA A;  3BRM A;  3WS5 A;  3Q1F A;  3ZGA B;  2FFY A;  3HLB A;  5CGX A;  2OV5 A;  2XGN A;  3HUN A;  4KZ3 A;  1CK3 A;  3HUM A;  1ONG A;  1FR1 A;  2WGW B;  3WS2 A;  3GR2 A;  3ZCZ A;  3IXD A;  1JTD A;  3WS4 A;  3O3V A;  3RXX A;  5AQA A;  1KE3 A;  4OON A;  4XUX A;  2HDQ A;  2BG1 A;  1EWZ A;  2R9W A;  4GDB A;  2Y2L A;  5EUA A;  3ZHH A;  1ZKJ A;  1RCJ A;  4ZJ3 A;  3W4P A;  4KZ6 A;  3Q7V A;  4S2K A;  5GLB A;  3ZNT A;  2WGI A;  2JC7 A;  2G2W A;  3CZD A;  3DWZ A;  3N6I A;  4MNR A;  5GL9 A;  1RGZ A;  5U47 A;  2EX6 A;  1ES4 A;  1XPB A;  3TSG A;  5AQ9 A;  1K4E A;  1FSW A;  3HLD A;  5DF8 A;  4KQO A;  1K4F A;  1BLH A;  4FH2 A;  4P6B A;  5CTM A;  1YLJ A;  4N92 A;  4YFM A;  1H8Z A;  1SCW A;  3DWK A;  4QY6 A;  3N8L A;  2Y2N A;  3N4I A;  3WWX A;  3ZG7 B;  4ZBE A;  3IXG A;  3IWQ A;  2V1Z A;  1FQG A;  4U3T A;  3AGF A;  2VGJ A;  1KDW A;  2ZC3 B;  1IEL A;  5A93 A;  2XK1 A;  4K0X A;  1ESU A;  1YLZ A;  1MWU A;  2Z2L B;  3M6H A;  3PTE A;  5DF9 A;  1L0G A;  4E3J A;  1FCM A;  3OPR A;  5AQ7 A;  4WZ4 A;  4WEJ A;  2DNS A;  1K55 C;  1RP5 A;  3UPN A;  3G30 A;  4PM6 A;  3IHA A;  4ZJ2 A;  3PAG A;  3NDG A;  4GKU A;  2XF3 A;  2Y2M A;  5E2F A;  5CGW A;  4NK3 A;  5GHZ A;  4JXG A;  3VP0 A;  5FAP A;  1MWT A;  5KMW A;  3W4Q A;  4EWF A;  2H10 A;  4FCF A;  3S4X A;  3V39 A;  4OLD A;  2PU4 A;  4L0L A;  1K56 D;  1LI0 A;  2HDU A;  1NY0 A;  3RJU A;  2A49 A;  1M6K A;  3CJM A;  1JWV A;  4OVD A;  4DKI A;  3BEC A;  2P9V B;  4OP5 A;  3TG9 A;  3W4O A;  3UDX A;  1XXM A;  1YLY A;  1IKI A;  4WZ5 A;  4HEF A;  2Y2G A;  5A91 A;  4DE0 A;  4ZAM A;  1K54 C;  2HP9 A;  4Y0U A;  5F1F A;  1TVF A;  4UA7 A;  3MZE A;  1K56 A;  4RX3 A;  5I94 A;  5FI7 A;  3IH9 A;  4NET A;  5FQI A;  4E3N A;  1W5D A;  1PW8 A;  3G31 A;  3ZG5 A;  3ZVW A;  1NXY A;  2HP5 A;  1ES5 A;  1BUL A;  3O88 A;  5EVI C;  4DE2 A;  1MWR A;  4KZ5 A;  5KSH A;  1JWZ A;  1LHY A;  1GHP A;  5EOE A;  5FDH A;  4R23 A;  2HDR A;  4K91 A;  3C4O A;  3IT9 A;  3FV7 A;  2IWB A;  3DW0 A;  2V20 A;  4OOL A;  4BEN A;  5EEC A;  1GHM A;  2ZM8 A;  4GD8 A;  4S2O A;  5CGS A;  1PWG A;  3MKE A;  5GLD A;  3OZH A;  4R0Q A;  2ZQ7 A;  4S2J A;  3NIA A; 
#chains in the Genus database with same CATH topology
 2BTF P;  3IXB A;  2OLV A;  2HZ5 A;  3PBQ A;  4HJ3 A;  4OQG A;  3O86 A;  4HP9 A;  5FQQ A;  4IUK A;  1F5M A;  2KOI A;  3HLC A;  4FD8 A;  5J3W A;  2ZC4 B;  2XDM A;  3CG5 A;  3IX8 A;  1L0D A;  2Z2M B;  2XR0 A;  3UDI A;  2ZC5 B;  1XJ6 A;  3NDE A;  5AJG A;  3E2K A;  4E3O A;  2OAP 1;  3ZG9 B;  1I2W A;  3LY4 A;  1TS8 A;  5FAQ A;  1PW1 A;  1GA0 A;  1TS7 A;  4EBL A;  5LBR A;  4II7 A;  3HVF A;  1VET A;  3Q07 A;  5HAR A;  1WA9 A;  1TS0 A;  3A3J A;  5DTT A;  4GDN A;  4JXV A;  5CHM A;  1IKG A;  2WAE A;  4BD0 A;  3S7P A;  1S67 L;  2L0W A;  5AVF A;  3CMZ A;  1I5Q A;  1TS6 A;  3MKF A;  3SS4 A;  3Q7Z A;  3CUE C;  4BWI A;  2O0Y A;  1FOF A;  1ZG6 A;  1N9B A;  2Y2K A;  4PKY G;  4KG2 A;  3JVU A;  1ESI A;  1LL8 A;  1IYQ A;  2V1A A;  3KX0 X;  2PBY A;  5KSC A;  2B02 A;  3GRJ A;  1PI4 A;  4QU3 A;  3S7Q A;  3O5Y A;  1I2S A;  5K5B A;  2UWX A;  5FQK A;  4HBU A;  1H3Q A;  3O87 A;  5CXW A;  3U4L P;  3SH8 A;  4IBR A;  3ZVT A;  1WE4 A;  2B95 A;  5GLC A;  2V1B A;  1HD8 A;  4I3I A;  3LGO A;  1IYP A;  4MBH A;  2WKH A;  3UB9 A;  1E3U A;  3IS2 A;  4R4R A;  3RH8 B;  5L2F A;  3SH7 A;  3HCY A;  3MF0 A;  3BEB A;  3EGX C;  3V50 A;  4WEL A;  2QJ7 A;  2WAF A;  4EES A;  3OPH A;  3D9Y A;  4M4X A;  1G6O A;  3NUL A;  1WYC A;  2XLN A;  4YOF A;  1KGG A;  4FOF A;  1DP6 A;  1GSW A;  1Q2Q A;  3BYD A;  3C2W A;  5HWV A;  5JYO A;  4KZ4 A;  2Y2J A;  1NYM A;  3VMA A;  1XJ2 A;  2ZQC A;  3C8C A;  5E2G A;  3JPU A;  3A0R A;  3NBL A;  4IVK A;  3SS5 A;  4EEU A;  4OPR A;  4Q8I A;  1ES2 A;  3PR6 A;  2OOL A;  5G18 A;  1IYS A;  4KUK A;  1K6S A;  3HLG A;  2FH5 A;  2EX8 A;  2L4R A;  2EWV A;  2AVX A;  3M6B A;  5CEB A;  3BFC A;  2I72 A;  4QB8 A;  3LEZ A;  3N7W A;  1SKO A;  2PAV P;  3OC2 A;  4KZ7 A;  5EE8 A;  4GS9 A;  3QP1 A;  4HES A;  1KDS A;  5E2E A;  3LR3 A;  3UPP A;  2HJE A;  2L1M A;  1SHV A;  5IT5 A;  4WF0 A;  1L0E A;  5F6A A;  3TW8 A;  2OWJ A;  3V3R A;  4ZTK A;  2O9A A;  1XP4 A;  1FCN A;  1TD5 A;  3EQV A;  3HL9 A;  4X69 A;  3M2J A;  2OLU A;  2JHE A;  5TJJ A;  3BFD A;  2ZM0 A;  2HF6 A;  2JKF A;  2WUQ A;  2QHK A;  4KZB A;  4LLO B;  3G2Y A;  2FFF B;  3MQO A;  4KZA A;  1MWS A;  3CHW P;  3QP6 A;  2ZM2 A;  3BQA A;  5A8B A;  4PM7 A;  3H9W A;  3KYE A;  5M19 A;  3BLM A;  1FCO A;  3FC7 A;  3GV9 A;  1BSG A;  2DRW A;  2H0Y A;  2QZ6 A;  1NLZ A;  3VFH A;  2JKG A;  3GQZ A;  3KSF A;  4HHD A;  5FEF A;  4WYY A;  4R1G A;  4LV0 A;  1VM1 A;  3VV4 A;  2VGK A;  1WYB A;  4KQD A;  5HAI A;  4OQ0 A;  4HH2 A;  4H6J A;  4B4X A;  4EV4 A;  3LYX A;  3Q81 A;  2JBF A;  4DRT A;  1JWP A;  2J7V A;  3UB7 A;  3BY8 A;  1XKZ A;  2ZMA A;  1TEM A;  5KIZ A;  1K0K A;  4ESP A;  5HFO A;  3MZD A;  4BJP A;  3VFF A;  1LSW A;  4R3B A;  1DRM A;  2JKR M;  2XH9 A;  1HLU P;  2JE5 A;  3E98 A;  4B9O A;  2VK3 A;  3HUM A;  1FR1 A;  2W1R A;  2WGW B;  3WS2 A;  1P0Z A;  1LSV A;  3GR2 A;  2NUP C;  3RFB A;  3IXD A;  3ZYT A;  4L9G A;  1JTD A;  4MN7 A;  5AQA A;  4XUX A;  1ZKJ A;  3K3D A;  4KZ6 A;  2FZ0 A;  5IU1 A;  3Q7V A;  1PFL A;  4BBT A;  2WGI A;  3DWZ A;  5U47 A;  1XPB A;  5AQ9 A;  3HLD A;  1DP8 A;  1K4F A;  3LR4 A;  1YLJ A;  2HV1 A;  1SCW A;  5C5K A;  1XFQ A;  1STZ A;  2Y2N A;  2PT7 A;  3IXG A;  1KDW A;  2PHY A;  5A93 A;  2XK1 A;  4K0X A;  1UGU A;  2ZMV A;  5FDS A;  5DF9 A;  1L0G A;  5AQ7 A;  4WZ4 A;  4WEJ A;  1RP5 A;  4IHQ A;  4CLC D;  4NEE D;  3NDG A;  2ACG A;  2XF3 A;  2Y2M A;  4I3A A;  1PNE A;  5GHZ A;  3MS6 A;  5KMW A;  2QYB A;  2PR6 A;  3LIF A;  4L0L A;  4EEP A;  1LI0 A;  2A49 A;  3UE6 A;  4AFI A;  1JWV A;  5L09 A;  3F1N B;  2MJ6 A;  5A91 A;  1G5U A;  2A24 A;  2W1T B;  5I94 A;  4YNR A;  2W3E A;  1T18 A;  2VV7 A;  4NET A;  5FI7 A;  3G31 A;  2HP5 A;  4NXF A;  3DTE A;  5KSH A;  1UWN X;  3NOU C;  1JWZ A;  3PXP A;  4HI4 A;  4K91 A;  3IT9 A;  3UB5 P;  3DW0 A;  4S2O A;  1NRJ A;  1PWG A;  3MKE A;  5GLD A;  3CPT B;  1N9L A;  3VOZ A;  5FQM A;  1PIO A;  3A3I A;  3N8S A;  1G68 A;  2PYP A;  4GD6 A;  4X68 A;  4XT2 B;  1S0W A;  1QMF A;  4S2M A;  4S2N C;  4KZ9 A;  1O7E A;  4QJG A;  4BL3 A;  2PBD P;  3QHY A;  3IX3 A;  4D60 A;  5FAT A;  2ZQ8 A;  4ZJ1 A;  2PRF A;  1SZV A;  2ZD8 A;  3HUO A;  4ARZ B;  2A3U A;  5E2H A;  3M2K A;  2VGL M;  3IF6 A;  4WLA A;  1F9I A;  1YLW A;  3BFG A;  5FL3 A;  3ZG8 B;  3UDF A;  4JLF A;  3VOY A;  4E6X A;  4RX2 A;  3FKW A;  4LV2 A;  3PBN A;  4UAA A;  1VEU A;  3MXS A;  2Y2I A;  3DTK A;  2WZX A;  2J3W A;  3GSG A;  3NI9 A;  4GHI A;  1SDN A;  4S2P A;  1LL9 A;  2R78 A;  4IJG A;  4DMZ A;  3T50 A;  2ZQA A;  4E6W A;  3G6O A;  4WUJ A;  1O07 A;  3HLF A;  5HPF A;  1KVL A;  4E3L A;  4PKY A;  3LY3 A;  3UNW A;  5F1G A;  2ZC7 A;  4PHT A;  1LL5 A;  3C5A A;  1K38 A;  1ALQ A;  5HW3 A;  4C3Q A;  1N4O A;  4IUH A;  1E3U D;  4PM9 A;  4CLC C;  1P9W A;  5FI6 A;  3KYQ A;  5HSQ A;  2PYR A;  4OKP A;  5GLA A;  5CED A;  1D06 A;  4LV1 A;  4H8R A;  3C38 A;  5FAO A;  5HD5 A;  4UA9 A;  1E4D A;  1IFQ A;  2E8I A;  5HDC A;  3BM6 A;  4F3L B;  2W3F A;  1L0F A;  4JF5 A;  1S4R A;  4OOY A;  1MZU A;  4EQI A;  4JXS A;  1HTZ A;  3QNC A;  2VGL S;  4JGQ A;  4HY8 A;  5GHX A;  5DTK A;  3ZDJ A;  4K0W A;  4DXC A;  5DFY A;  2X71 A;  4U0T A;  4CQH A;  3S7O A;  3BW6 A;  3LIB A;  1YMX A;  4MCW A;  2WKQ A;  5HD3 A;  2RL3 A;  4NXE A;  3CI6 A;  1G6A A;  4RA7 A;  1X0O A;  2PDR A;  4PPR A;  2VX8 A;  3JYI A;  4DDS A;  2H28 A;  4O0P A;  4P85 A;  4CLC B;  5M1A A;  3WRZ A;  2HGV A;  4N9L A;  1K6R A;  4LRZ E;  4N1H A;  4O7D A;  1MPL A;  3AGE A;  5AVE A;  2XD5 A;  3VOL A;  3KYZ A;  4FSF A;  4LPZ A;  3BJN A;  4X55 A;  1LT0 A;  4OQI A;  2V8F A;  4KEN B;  4B4Z A;  4O01 A;  4D2O A;  1W79 A;  1F2K A;  3LID A;  5FEG A;  1T1A A;  1OTB A;  4ZDX A;  3F1P B;  4Q0J A;  1K55 A;  3LIA A;  5TBM B;  5HL1 A;  4QPR A;  2J8Y A;  3CLO A;  4R3J A;  3RXW A;  3T1Q B;  1H8Y A;  3TOI A;  1N9N A;  1HVB A;  2K2N A;  2K7S A;  3A3E A;  2RCX A;  4B88 A;  1BZA A;  4BQM A;  4QHC A;  4OPZ A;  4JPM A;  1BLS A;  3FYZ A;  1D7E A;  3MR0 A;  4OPQ A;  5G4Z A;  2YKH A;  4ZRR A;  4WEK A;  3VP4 A;  3QNB A;  1H5X A;  4KUO A;  1JTG A;  2XFT A;  2J80 A;  3MXR A;  2ZL1 A;  4R4S A;  5EVI A;  3L7H A;  1KE0 A;  3CWF A;  2B5R A;  2ZOI A;  4QWO A;  1JNU A;  2P7J A;  2JKT M;  4FUW A;  3HJK A;  4OQH A;  1VQQ A;  5DFX A;  1VET B;  1FIL A;  1MC0 A;  4OLG A;  4X53 A;  2CMN A;  4M3K A;  3UY6 A;  4WM9 A;  1HZO A;  5DJT A;  3V5M A;  1BYW A;  2EXB A;  2H5S A;  3BLS A;  3V3S A;  4P0M A;  3F1O A;  3LO7 A;  1PZP A;  2P74 A;  5IHV A;  5CEC A;  4R38 A;  1CI9 A;  1CI8 A;  3UN7 A;  1J9M A;  3C4P A;  2GJ3 A;  1OT6 A;  4KG6 A;  2EXA A;  3BRM A;  3Q1F A;  3ZGA B;  4NG2 A;  3HLB A;  2XGN A;  3GEC A;  4EQ1 A;  4KZ3 A;  3PHY A;  1ONG A;  1OTI A;  1XJ3 A;  3VP2 A;  4OON A;  2BG1 A;  1EWZ A;  2R9W A;  1RCJ A;  2KX6 A;  3W4P A;  4YWZ A;  3D72 A;  4S2K A;  3CZD A;  5HWT A;  3KSI A;  5GL9 A;  1RGZ A;  3TSG A;  1A0K A;  4FH2 A;  2V0U A;  3MQ0 A;  3DWK A;  2YKF A;  3IS2 B;  3WWX A;  1Y28 A;  4ZBE A;  5DKL A;  2ZC3 B;  4DJ3 A;  1IEL A;  2JKR I;  1D1J A;  1ESU A;  1YLZ A;  5J7E A;  1FCM A;  3UPN A;  3G30 A;  3IHA A;  3H82 A;  5E2F A;  2UV0 E;  3VP0 A;  1EW0 A;  3W4Q A;  2H10 A;  3S4X A;  3MMH A;  1OTA A;  1IOU A;  3RJU A;  1M6K A;  3BEC A;  4OP5 A;  3EWK A;  3W4O A;  3UDX A;  1IKI A;  3CIT A;  4WZ5 A;  2VV8 A;  1OPX A;  1TVF A;  3MZE A;  3NEC A;  1K56 A;  3E4O A;  4RX3 A;  5FQI A;  3LI9 A;  1PW8 A;  3L9K A;  4G3K A;  4EXO A;  1MWR A;  3S7N A;  3OBF A;  1LHY A;  1T19 A;  5EOE A;  4R23 A;  3C4O A;  3SW1 A;  3FV7 A;  3DTI A;  2V20 A;  4OOL A;  4BEN A;  1CJF A;  1SKO B;  1GHM A;  5EEC A;  2ZM8 A;  3T4Q A;  2V8C A;  5CGS A;  4GS9 B;  4R0Q A;  4S2J A;  1ZG4 A;  2M7U A;  2GZA A;  4N1X A;  3T4O A;  3EGD C;  4U0X A;  3P7N A;  3E0Y A;  1ACF A;  3TRC A;  1V9Z A;  2ZMF A;  1PWD A;  3NC8 A;  1LSX A;  2LB9 A;  2J9P A;  3NJA A;  1P97 A;  1P9R A;  4MLL A;  5EVL A;  3UO9 A;  4L9F A;  2VKS A;  4WMC A;  1SDE A;  5F82 A;  4Z9Q A;  4NXB A;  3EEA A;  3T1R A;  1OME A;  3G32 A;  4EUV A;  1S6R A;  2XSS A;  1PRQ A;  3G35 A;  4EU0 A;  1YPR A;  4HBT A;  2O9C A;  1K57 A;  3WRT A;  3NOP C;  4OH0 A;  3IX4 A;  2G2U A;  5EFW A;  3FZC A;  1FIK A;  1U60 A;  2WYX A;  4E3M A;  2WKE A;  3VP1 A;  3MBZ A;  3QP5 A;  1C3B A;  4H6J B;  3EOI A;  3IF5 A;  4EBN A;  3C7V A;  5HPI A;  4GOG A;  3VE4 A;  4KZ8 A;  5J8X A;  3T4J A;  3HLW A;  4EBP A;  4OPY A;  2O9B A;  4DDY A;  3IH8 A;  4HIA A;  1BUE A;  2IWC A;  3QP8 A;  1ERQ A;  2W3D A;  1BT5 A;  2EX9 A;  1ERM A;  4X6T A;  3H7W A;  4I5S A;  3G4P A;  1GCE A;  2VZW A;  5KZH A;  1GSX A;  2QWS A;  3RTY A;  3R7W A;  2VA0 A;  4G3W A;  1AXB A;  3LIC A;  3ZNY A;  4IED A;  1L3L A;  4Y5F A;  3LEQ A;  1XA1 A;  4JF6 A;  5TGF A;  3B42 A;  1FSY A;  3ITA A;  3Q7V B;  2JCH A;  1YMS A;  4GCZ A;  2GNX A;  1ERO A;  4DJ2 A;  1NZU A;  4I39 A;  1Y54 A;  1K25 A;  1N9O A;  1W63 M;  2M1C A;  5DTS A;  3KSH A;  3UPO A;  5HAQ A;  2PU2 A;  3IHB A;  4C6Y A;  5EVE A;  2V0W A;  1BTL A;  4YIN A;  1IEM A;  3G2Z A;  1TDG A;  2V2F F;  1YT4 A;  2P9V A;  4LEN A;  2OWH A;  2WKI A;  5HL6 A;  1V9Y A;  2ZQ9 A;  4EW7 A;  3W2Z A;  4BL2 A;  4N9K A;  2IWD A;  3R4K A;  3S22 A;  4BLM A;  4MN5 A;  1NLY A;  3OCN A;  1H8M A;  1NJ4 A;  3ITB A;  3OPL A;  4XXR A;  3IF6 C;  2J3T D;  3BFF A;  4OOM A;  1KGF A;  4PM5 A;  3UE0 A;  2A24 B;  5TR7 A;  4CJN A;  1YKD A;  4CLC E;  1PZO A;  4WBG A;  5FSR A;  3NY4 A;  4S2L A;  2X02 A;  1AWI A;  3UE3 A;  3IBJ A;  5HDD A;  4DXB A;  1DJC A;  4BD1 A;  3SOI A;  2WKP A;  5D3O A;  3PBR A;  1W8Q A;  1DJA A;  3A3D A;  2PD7 A;  2P08 A;  4XUZ A;  1YAX A;  5FA7 A;  3LCE A;  1KVM A;  4Y2F A;  3VP3 A;  5FI2 A;  3QP4 A;  5DVA A;  5EVI D;  5A90 A;  4IBX A;  3N8R A;  4GN2 A;  4Y17 A;  5CRF A;  1K54 A;  3WS5 A;  4FTX A;  1CEG A;  4C75 A;  1DY6 A;  4JKT A;  4PM8 A;  3HBR A;  3VSL A;  2EX2 A;  3T4S A;  5HDS A;  4QY5 A;  1PI5 A;  1S66 L;  4O8G A;  3MFX A;  2Y2O A;  3IF6 B;  3T4K A;  2W27 A;  4S2I A;  5EOO A;  4QD4 A;  3NHQ A;  1W8Y A;  1KE4 A;  2Y59 A;  1YM1 A;  5JYP A;  1VEU B;  1MXO A;  1PYY A;  4MDZ A;  4GHI B;  1NRF A;  1BLC A;  1Q2P A;  3FKV A;  5FQ9 A;  3SZT A;  1LLB A;  2Y2P A;  3GDI A;  1BLP A;  4NKP A;  3GMW A;  1OTE A;  3PBT A;  5I5L A;  2G7U A;  4KQR A;  4UEY A;  4WL9 A;  2OV5 A;  2BAS A;  3HUN A;  1CK3 A;  3ZCZ A;  2JKT I;  3PYP A;  3WS4 A;  1W63 Q;  3O3V A;  2NUT C;  3RXX A;  2W3H A;  4HH3 A;  1XJ4 A;  4GDB A;  3ZHH A;  5EUA A;  1MKM A;  4ZJ3 A;  1G28 A;  4HQA A;  2JC7 A;  2G2W A;  3N6I A;  1ES4 A;  1TF1 A;  1K4E A;  1FSW A;  5J4E A;  1BLH A;  4LFU A;  2Y79 A;  3K2N A;  4YFM A;  4HOI A;  1H8Z A;  2WKR A;  3CUE A;  4QY6 A;  3T1X A;  3N8L A;  3N4I A;  3ZG7 B;  4E04 A;  1CF0 A;  3AGF A;  2J3T C;  1MWU A;  3M6H A;  3PTE A;  2DNS A;  1K55 C;  4PM6 A;  4ZJ2 A;  4EET B;  4NK3 A;  4EER A;  5IS1 A;  4JXG A;  4R6L A;  4GJ4 A;  2VLG A;  4FCF A;  1K56 D;  3FPV A;  2HDU A;  3UME A;  5EM0 A;  2Z6C A;  2JN7 A;  2Q0O A;  3CJM A;  4OVD A;  5DJU A;  3TG9 A;  2OAQ 1;  4Z1W A;  3LFV A;  1XXM A;  4DE0 A;  2EA9 A;  4E3N A;  3T4L A;  3ZG5 A;  1NXY A;  5EVI C;  1ES5 A;  1BUL A;  1F98 A;  4DE2 A;  1YSQ A;  4KZ5 A;  1GHP A;  5FDH A;  3OOV A;  4ETZ A;  4GW9 A;  2ZQ7 A;  3NIA A;  4IVI A;  1GA9 A;  4WN5 A;  1XGI A;  4LV3 A;  5M18 A;  4MBK A;  4Y0T A;  2B18 A;  3T1S A;  4P87 A;  3I7J A;  3IQA A;  4WMC D;  3DTM A;  3DAV A;  3HLE A;  3A0V A;  4HNB A;  3B47 A;  1KOU A;  1T1B A;  3ICY A;  3NCK A;  3QP2 A;  1XFN A;  1S4S A;  3PAE A;  2XRN A;  4UHU A;  4ID4 A;  2W3G A;  5HX9 A;  5A92 A;  4R70 A;  2Y55 A;  3ZG0 A;  3HJI A;  1CQA A;  4E3K A;  3MZF A;  3UB6 A;  3IWO A;  4JGR A;  3WS1 A;  5GHY A;  2A2L A;  4JBF A;  3W8K A;  3GVB A;  4KQQ A;  3UMD A;  3E4Q A;  2O99 A;  2EFU A;  3FPW A;  2ZL1 B;  2HJ9 C;  2QMI A;  5EVI B;  4E3I A;  3SH9 A;  5TFQ A;  1XX2 A;  2XA7 M;  4HJ6 A;  2Y2Q A;  2WAD A;  3AGD A;  3T4T A;  3C7U A;  2INW A;  4OP8 A;  2XRO A;  3OCL A;  1PWC A;  4NXG A;  2XQZ A;  5EPH A;  4DN0 A;  1JVJ A;  3VSK A;  4ME4 A;  5BOH A;  4Y7P A;  4GZB A;  1E25 A;  2QKP A;  2HPB A;  2WGW A;  2X01 A;  3K3C A;  4JXW A;  2XFS A;  4I38 A;  1GHI A;  4EUZ A;  2D01 A;  4X25 A;  1DP9 A;  3F1O B;  1TDL A;  1ONH A;  3B3X A;  4Y0O A;  5MC7 A;  5FQJ A;  1S1Y A;  3NOT C;  1OJG A;  3EQU A;  2XD1 A;  1YLT A;  3T12 B;  4LRX C;  3Q82 A;  2C6W B;  1T1C A;  2E8J A;  4F94 A;  4MMN A;  4ETX A;  4BMW A;  2VJW A;  4X1L A;  3BFE A;  4Y15 A;  4WZ5 C;  2Y91 A;  4DF6 A;  5HWW A;  2Y2H A;  5CHU A;  2VV6 A;  1NYY A;  3S1Y A;  3IWI A;  2ZC6 B;  3MFD A;  5CHJ A;  2V9A A;  2GDN A;  1ZHH B;  3CAX A;  2QPN A;  2ZJ9 A;  1Z6F A;  2J9O A;  3P09 A;  3KO6 A;  4LCM A;  1CEF A;  3FWL A;  4GLQ A;  1LI9 A;  2DMW A;  5DF7 A;  4I3J A;  4MEZ A;  1GSV A;  4BBU A;  4X1M A;  2Q9M A;  1OJ5 A;  3A0S A;  3ULF A;  1YLP A;  2CC1 A;  3F1N A;  2WGV A;  4LCL A;  5L8M A;  3B33 A;  3DBA A;  3H82 B;  2XA7 S;  2GX5 A;  1YQS A;  2KLI A;  2W1T A;  4Q0I A;  4LGW A;  2ZLY A;  4HJ4 A;  4UQI M;  1FR6 A;  5EV0 A;  5EM1 A;  2D02 A;  2P04 A;  2WK0 A;  1Z09 A;  5CER A;  3PBO A;  1ODV A;  4RYE A;  3CPT A;  3P98 A;  2ZBB A;  3D4F A;  5E43 A;  5F69 A;  4DE3 A;  1MKI A;  3IXH A;  1K57 C;  2H0T A;  5HZH A;  3D3O A;  2VEA A;  2HP6 A;  2OSU A;  3P01 A;  1IYO A;  5FAS A;  4XT2 A;  3A3F A;  2KDK A;  3JVV A;  2Q9N A;  1ZC2 A;  4RVA A;  2QJ5 A;  3FG8 A;  3GTC A;  4GB7 A;  2EFX A;  3LUQ A;  4FH4 A;  4G3V A;  3OPP A;  5L07 A;  3UE1 A;  4ARZ A;  4JF4 A;  2BLS A;  4UA6 A;  5G4Y A;  1W7F A;  4X56 A;  2ZQD A;  1EI5 A;  4P6Z M;  1RGY A;  2R9X A;  4A5R A;  3ISG A;  4KG5 A;  5F5Y A;  2HDS A;  2W0N A;  2WZZ A;  3SS3 A;  1XGJ A;  3V67 A;  4PMA A;  1VB6 A;  4K08 A;  5F83 A;  4Y3I A;  1VHM A;  1OTD A;  4CPK A;  1L2S A;  3HRE A;  2Y4A A;  3TJZ C;  1ES3 A;  1SKF A;  2I9V A;  3BY9 A;  5HAP A;  1M40 A;  3KSG A;  4DE1 A;  1DJB A;  3WS0 A;  1S1Z A;  3G34 A;  2Z6D A;  4R3A A;  4L9E A;  3ZFZ A;  1KGE A;  2XEP A;  1UWP X;  1Y4O A;  2DCF A;  4GNU A;  3MQQ A;  1XA7 A;  1QME A;  2C5W B;  4S2N A;  3VE3 A;  4UQI S;  3E2L A;  3LI8 A;  4JGP A;  3MJQ A;  1NZO A;  1MY8 A;  1MBL A;  5CX7 A;  5AQB A;  5CTN A;  4MBF A;  2ZOH A;  3ZQ5 A;  1NWZ A;  2FFY A;  5CGX A;  4B93 A;  3LIE A;  1KE3 A;  4F3L A;  2HDQ A;  2Y2L A;  2M7V A;  5GLB A;  3ZNT A;  3MXQ A;  4MNR A;  3H7W B;  2EX6 A;  5DF8 A;  4KQO A;  4P6B A;  5CTM A;  4N92 A;  3R7W B;  2LB5 A;  3LR0 A;  1J3W A;  3BWL A;  5F68 A;  3IWQ A;  2V1Z A;  1FQG A;  4U3T A;  3MSH A;  2VGJ A;  4P6Z S;  1OT9 A;  4JGO A;  2Z2L B;  4MN6 A;  4BBV A;  4E3J A;  3OPR A;  2Y8H A;  3PAG A;  4GKU A;  5CGW A;  4HP4 A;  4PAU A;  1ZTU A;  5FAP A;  1MWT A;  4EWF A;  4Q0H A;  3C30 A;  3V39 A;  4OLD A;  2PU4 A;  4CLC A;  3BQ8 A;  1NY0 A;  4DKI A;  2P9V B;  3EEH A;  3U2A A;  3IBR A;  1YLY A;  4HEF A;  2Y2G A;  2K31 A;  4ZAM A;  1K54 C;  2HP9 A;  4Y0U A;  5F1F A;  4UA7 A;  3IH9 A;  2IA2 A;  2PR5 A;  1W5D A;  3ZVW A;  3E4P A;  3OLO A;  3O88 A;  3UB8 A;  4LRY C;  3F1P A;  5DKK A;  5TBM A;  2HDR A;  3TE8 A;  4RQ9 A;  2IWB A;  3LR5 A;  4Y13 A;  1H0M A;  5L10 A;  4GD8 A;  2EWW A;  1YSP A;  3OZH A;  3PBS A;  2PD8 A; 
#chains in the Genus database with same CATH homology
 3IXB A;  1ZG4 A;  1GA9 A;  2OLV A;  3PBQ A;  4IVI A;  4OQG A;  3VOZ A;  3O86 A;  1XGI A;  4LV3 A;  5FQM A;  4N1X A;  5M18 A;  1PIO A;  4MBK A;  5FQQ A;  4Y0T A;  3A3I A;  3N8S A;  1G68 A;  4U0X A;  4GD6 A;  4P87 A;  3HLC A;  4X68 A;  3I7J A;  3IQA A;  4FD8 A;  1S0W A;  1QMF A;  4S2M A;  2ZC4 B;  4WMC D;  4S2N C;  4KZ9 A;  2XDM A;  3DTM A;  1PWD A;  3NC8 A;  3HLE A;  1O7E A;  4QJG A;  4BL3 A;  3CG5 A;  1L0D A;  2Z2M B;  2XR0 A;  3UDI A;  2J9P A;  2ZC5 B;  3QHY A;  5FAT A;  3NDE A;  3E2K A;  2ZQ8 A;  3NCK A;  4ZJ1 A;  4E3O A;  5EVL A;  4MLL A;  3ZG9 B;  1I2W A;  3PAE A;  3UO9 A;  4WMC A;  4UHU A;  2ZD8 A;  3LY4 A;  1SDE A;  5FAQ A;  3HUO A;  5F82 A;  1PW1 A;  4ID4 A;  4Z9Q A;  5HX9 A;  5A92 A;  1GA0 A;  2Y55 A;  3ZG0 A;  2A3U A;  5E2H A;  3M2K A;  3IF6 A;  4E3K A;  1YLW A;  3BFG A;  3MZF A;  3ZG8 B;  3UDF A;  4EBL A;  4JLF A;  3VOY A;  4E6X A;  3IWO A;  4RX2 A;  3HVF A;  4C75 A;  1OME A;  3FKW A;  3G32 A;  3WS1 A;  5GHY A;  3Q07 A;  4JBF A;  5HAR A;  3W8K A;  3GVB A;  1S6R A;  4LV2 A;  3PBN A;  3A3J A;  3G35 A;  4KQQ A;  4UAA A;  5DTT A;  3MXS A;  2Y2I A;  4GDN A;  4JXV A;  2EFU A;  4HBT A;  2WZX A;  5CHM A;  3GSG A;  1K57 A;  3NI9 A;  1IKG A;  3WRT A;  2QMI A;  2WAE A;  4BD0 A;  5EVI B;  4E3I A;  3SH9 A;  1SDN A;  4OH0 A;  5TFQ A;  2G2U A;  3CMZ A;  1I5Q A;  1XX2 A;  3MKF A;  2Y2Q A;  4S2P A;  2WAD A;  3FZC A;  1U60 A;  2WYX A;  1LL9 A;  2WKE A;  4E3M A;  3AGD A;  3SS4 A;  3VP1 A;  3Q7Z A;  3MBZ A;  2ZQA A;  4E6W A;  3C7U A;  1FOF A;  1ZG6 A;  1C3B A;  1N9B A;  4OP8 A;  3OCL A;  1PWC A;  2Y2K A;  2XQZ A;  4KG2 A;  3IF5 A;  1ESI A;  5EPH A;  3C7V A;  4EBN A;  1O07 A;  1IYQ A;  1JVJ A;  3VSK A;  5BOH A;  3HLF A;  4GOG A;  2PBY A;  4KZ8 A;  4Y7P A;  1KVL A;  4GZB A;  1E25 A;  5KSC A;  2HPB A;  2WGW A;  2X01 A;  5J8X A;  4E3L A;  3HLW A;  4JXW A;  2XFS A;  3GRJ A;  1GHI A;  1PI4 A;  4QU3 A;  3LY3 A;  3UNW A;  4EBP A;  4EUZ A;  4OPY A;  5F1G A;  1I2S A;  4DDY A;  2ZC7 A;  3IH8 A;  1LL5 A;  2UWX A;  5FQK A;  1BUE A;  1ONH A;  1TDL A;  3B3X A;  3C5A A;  2IWC A;  4HBU A;  4Y0O A;  1K38 A;  3O87 A;  5FQJ A;  1ALQ A;  1ERQ A;  5CXW A;  5HW3 A;  3EQU A;  3SH8 A;  4C3Q A;  1N4O A;  4IBR A;  2XD1 A;  3ZVT A;  1BT5 A;  1E3U D;  4PM9 A;  2EX9 A;  1YLT A;  1ERM A;  1WE4 A;  4X6T A;  3Q82 A;  2C6W B;  5FI6 A;  5GLC A;  3G4P A;  1GCE A;  4F94 A;  4OKP A;  5GLA A;  5KZH A;  5CED A;  1HD8 A;  4LV1 A;  4H8R A;  1IYP A;  3BFE A;  1AXB A;  4WZ5 C;  2Y91 A;  2WKH A;  4MBH A;  4IED A;  5FAO A;  3BLM A;  3ZNY A;  1E3U A;  4DF6 A;  2Y2H A;  4R4R A;  4UA9 A;  1XA1 A;  5CHU A;  1E4D A;  1NYY A;  4JF6 A;  2E8I A;  5TGF A;  3IWI A;  3S1Y A;  3SH7 A;  5L2F A;  2ZC6 B;  3BEB A;  3BM6 A;  3V50 A;  3MFD A;  4WEL A;  2WAF A;  5CHJ A;  1L0F A;  1FSY A;  3ITA A;  3OPH A;  3Q7V B;  4JF5 A;  4OOY A;  2GDN A;  4EQI A;  2JCH A;  1YMS A;  1WYC A;  2XLN A;  1KGG A;  1ERO A;  2QPN A;  2ZJ9 A;  1NZU A;  1Z6F A;  2J9O A;  3P09 A;  1Q2Q A;  3BYD A;  4LCM A;  5JYO A;  4JXS A;  1Y54 A;  4KZ4 A;  1CEF A;  1K25 A;  2Y2J A;  3FWL A;  1HTZ A;  1NYM A;  3QNC A;  5DTS A;  3VMA A;  2ZQC A;  3UPO A;  1LI9 A;  5E2G A;  5HAQ A;  2PU2 A;  5DF7 A;  5GHX A;  4MEZ A;  3IHB A;  5DTK A;  4C6Y A;  3ZDJ A;  4K0W A;  4DXC A;  1BTL A;  3NBL A;  4IVK A;  4YIN A;  1IEM A;  2X71 A;  3SS5 A;  4U0T A;  2Q9M A;  1YLP A;  3G2Z A;  1TDG A;  2CC1 A;  2V2F F;  1YMX A;  1YT4 A;  2P9V A;  4OPR A;  4Q8I A;  1ES2 A;  4LEN A;  2WKI A;  2WGV A;  4LCL A;  5G18 A;  1IYS A;  2ZQ9 A;  2RL3 A;  1YQS A;  1K6S A;  1G6A A;  4BL2 A;  4RA7 A;  4N9K A;  3HLG A;  4PPR A;  2ZLY A;  2IWD A;  3S22 A;  2EX8 A;  4BLM A;  3OCN A;  3JYI A;  3M6B A;  4DDS A;  1NJ4 A;  3ITB A;  4P85 A;  1FR6 A;  5CEB A;  3OPL A;  5M1A A;  3BFC A;  3WRZ A;  4XXR A;  2I72 A;  3IF6 C;  3LEZ A;  4N9L A;  4QB8 A;  3N7W A;  1K6R A;  3BFF A;  4N1H A;  2WK0 A;  4O7D A;  1MPL A;  4OOM A;  3AGE A;  5CER A;  3OC2 A;  4KZ7 A;  3PBO A;  1KGF A;  5EE8 A;  2XD5 A;  4RYE A;  4PM5 A;  4HES A;  1KDS A;  3P98 A;  3UE0 A;  4FSF A;  3D4F A;  5TR7 A;  5E43 A;  4CJN A;  5E2E A;  4X55 A;  4DE3 A;  4OQI A;  1MKI A;  3IXH A;  4KEN B;  3UPP A;  1K57 C;  2H0T A;  4B4Z A;  4D2O A;  1SHV A;  1PZO A;  1W79 A;  1L0E A;  4WBG A;  2HP6 A;  2OSU A;  5FSR A;  3V3R A;  4ZTK A;  1IYO A;  1XP4 A;  1FCN A;  3EQV A;  3HL9 A;  4ZDX A;  5FAS A;  3A3F A;  3NY4 A;  4S2L A;  2X02 A;  4X69 A;  2Q9N A;  1K55 A;  3M2J A;  3UE3 A;  5HL1 A;  4DXB A;  1DJC A;  1ZC2 A;  2J8Y A;  2OLU A;  3SOI A;  4BD1 A;  5D3O A;  4RVA A;  3PBR A;  3GTC A;  1W8Q A;  1DJA A;  3BFD A;  2ZM0 A;  2WUQ A;  4GB7 A;  3RXW A;  2EFX A;  4R3J A;  3A3D A;  1H8Y A;  4FH4 A;  3TOI A;  3OPP A;  1HVB A;  4KZB A;  3G2Y A;  3UE1 A;  3A3E A;  2FFF B;  2RCX A;  4XUZ A;  4JF4 A;  1BZA A;  4B88 A;  4BQM A;  2BLS A;  4KZA A;  3LCE A;  4OPZ A;  4QHC A;  4UA6 A;  1KVM A;  4JPM A;  1MWS A;  1BLS A;  5FA7 A;  3VP3 A;  5FI2 A;  3FYZ A;  4OPQ A;  2ZM2 A;  1W7F A;  5DVA A;  5EVI D;  5A90 A;  4WEK A;  4PM7 A;  3VP4 A;  3QNB A;  4IBX A;  5M19 A;  3N8R A;  4GN2 A;  4X56 A;  5CRF A;  1K54 A;  1H5X A;  1FCO A;  2ZQD A;  1CEG A;  1JTG A;  1EI5 A;  2XFT A;  1BSG A;  1DY6 A;  1RGY A;  3GV9 A;  2DRW A;  4JKT A;  2H0Y A;  2R9X A;  2QZ6 A;  3MXR A;  3VFH A;  4A5R A;  3ISG A;  4KG5 A;  4PM8 A;  2HDS A;  3HBR A;  2WZZ A;  3VSL A;  2EX2 A;  4R4S A;  3SS3 A;  5EVI A;  3GQZ A;  1XGJ A;  1KE0 A;  4PMA A;  4QY5 A;  1PI5 A;  4WYY A;  3VP2 A;  5F83 A;  4R1G A;  2B5R A;  4LV0 A;  1VM1 A;  3PBS A;  2VGK A;  2Y2O A;  3IF6 B;  4CPK A;  1WYB A;  1L2S A;  3HRE A;  4S2I A;  2Y4A A;  4OQH A;  5EOO A;  5HAI A;  1VQQ A;  4OQ0 A;  4QD4 A;  1ES3 A;  1SKF A;  1W8Y A;  5HAP A;  1KE4 A;  1M40 A;  4OLG A;  4X53 A;  4B4X A;  3Q81 A;  2Y59 A;  4DE1 A;  1DJB A;  4EV4 A;  1YM1 A;  2JBF A;  5JYP A;  4M3K A;  3WS0 A;  3G34 A;  3UY6 A;  1MXO A;  4DRT A;  3ZFZ A;  1PYY A;  1JWP A;  1HZO A;  4WM9 A;  3V5M A;  2J7V A;  2EXB A;  2H5S A;  1KGE A;  1NRF A;  2XEP A;  1BLC A;  3BLS A;  1Q2P A;  2DCF A;  3FKV A;  5FQ9 A;  3V3S A;  1XKZ A;  2ZMA A;  4GNU A;  1XA7 A;  1TEM A;  1LLB A;  4P0M A;  1QME A;  2C5W B;  4S2N A;  3E2L A;  2Y2P A;  5HFO A;  3LO7 A;  1NZO A;  1PZP A;  3MZD A;  2P74 A;  5IHV A;  1MY8 A;  1MBL A;  1BLP A;  4BJP A;  3GMW A;  5CEC A;  3VFF A;  4R3B A;  3PBT A;  5AQB A;  1CI9 A;  1CI8 A;  3UN7 A;  1J9M A;  3C4P A;  5CTN A;  2XH9 A;  4KQR A;  4MBF A;  2JE5 A;  4KG6 A;  2EXA A;  3BRM A;  3WS5 A;  3Q1F A;  3ZGA B;  2FFY A;  3HLB A;  5CGX A;  2OV5 A;  2XGN A;  3HUN A;  4KZ3 A;  1CK3 A;  3HUM A;  1ONG A;  1FR1 A;  2WGW B;  3WS2 A;  3GR2 A;  3ZCZ A;  3IXD A;  1JTD A;  3WS4 A;  3O3V A;  3RXX A;  5AQA A;  1KE3 A;  4OON A;  4XUX A;  2HDQ A;  2BG1 A;  1EWZ A;  2R9W A;  4GDB A;  2Y2L A;  5EUA A;  3ZHH A;  1ZKJ A;  1RCJ A;  4ZJ3 A;  3W4P A;  4KZ6 A;  3Q7V A;  4S2K A;  5GLB A;  3ZNT A;  2WGI A;  2JC7 A;  2G2W A;  3CZD A;  3DWZ A;  3N6I A;  4MNR A;  5GL9 A;  1RGZ A;  5U47 A;  2EX6 A;  1ES4 A;  1XPB A;  3TSG A;  5AQ9 A;  1K4E A;  1FSW A;  3HLD A;  5DF8 A;  4KQO A;  1K4F A;  1BLH A;  4FH2 A;  4P6B A;  5CTM A;  1YLJ A;  4N92 A;  4YFM A;  1H8Z A;  1SCW A;  3DWK A;  4QY6 A;  3N8L A;  2Y2N A;  3N4I A;  3WWX A;  3ZG7 B;  4ZBE A;  3IXG A;  3IWQ A;  2V1Z A;  1FQG A;  4U3T A;  3AGF A;  2VGJ A;  1KDW A;  2ZC3 B;  1IEL A;  5A93 A;  2XK1 A;  4K0X A;  1ESU A;  1YLZ A;  1MWU A;  2Z2L B;  3M6H A;  3PTE A;  5DF9 A;  1L0G A;  4E3J A;  1FCM A;  3OPR A;  5AQ7 A;  4WZ4 A;  4WEJ A;  2DNS A;  1K55 C;  1RP5 A;  3UPN A;  3G30 A;  4PM6 A;  3IHA A;  4ZJ2 A;  3PAG A;  3NDG A;  4GKU A;  2XF3 A;  2Y2M A;  5E2F A;  5CGW A;  4NK3 A;  5GHZ A;  4JXG A;  3VP0 A;  5FAP A;  1MWT A;  5KMW A;  3W4Q A;  4EWF A;  2H10 A;  4FCF A;  3S4X A;  3V39 A;  4OLD A;  2PU4 A;  4L0L A;  1K56 D;  1LI0 A;  2HDU A;  1NY0 A;  3RJU A;  2A49 A;  1M6K A;  3CJM A;  1JWV A;  4OVD A;  4DKI A;  3BEC A;  2P9V B;  4OP5 A;  3TG9 A;  3W4O A;  3UDX A;  1XXM A;  1YLY A;  1IKI A;  4WZ5 A;  4HEF A;  2Y2G A;  5A91 A;  4DE0 A;  4ZAM A;  1K54 C;  2HP9 A;  4Y0U A;  5F1F A;  1TVF A;  4UA7 A;  3MZE A;  1K56 A;  4RX3 A;  5I94 A;  5FI7 A;  3IH9 A;  4NET A;  5FQI A;  4E3N A;  1W5D A;  1PW8 A;  3G31 A;  3ZG5 A;  3ZVW A;  1NXY A;  2HP5 A;  1ES5 A;  1BUL A;  3O88 A;  5EVI C;  4DE2 A;  1MWR A;  4KZ5 A;  5KSH A;  1JWZ A;  1LHY A;  1GHP A;  5EOE A;  5FDH A;  4R23 A;  2HDR A;  4K91 A;  3C4O A;  3IT9 A;  3FV7 A;  2IWB A;  3DW0 A;  2V20 A;  4OOL A;  4BEN A;  5EEC A;  1GHM A;  2ZM8 A;  4GD8 A;  4S2O A;  5CGS A;  1PWG A;  3MKE A;  5GLD A;  3OZH A;  4R0Q A;  2ZQ7 A;  4S2J A;  3NIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...